1NMAL

N9 neuraminidase complexes with antibodies nc41 and nc10: empirical free-energy calculations capture specificity trends observed with mutant binding data
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQNPDGTVKLLIYYTSNLHSEVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQDFTLPFTFGGGTKLEIRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (hydrolase/immunoglobulin)
molecule keywords N9 NEURAMINIDASE
publication title N9 neuraminidase complexes with antibodies NC41 and NC10: empirical free energy calculations capture specificity trends observed with mutant binding data.
pubmed doi rcsb
total genus 23
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 1994-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nmaL00
5IEKA 3RA7H 3RBSA 4JFHE 1RJZB 3P40A 1SEQH 1P6AB 3P4MB 4K94L 1S7WB 3O4LB 2VDMH 1S9VB 3FMGH 3KPMA 2NYYD 4YHZL 3ZE0F 3S98A 2R9HD 4PJCB 5DK0B 1OQXA 4J4PC 1YEGL 5IW3A 4MAUH 2CQVA 3LKNA 1CDBA 4FXGA 1B90A 2CLRA 3X11A 1YYML 1AQKH 3OAYK 1KTDA 1YNLH 4M1GL 1GGIL 2EO1A 2VLLB 2F58L 3FQRA 4RFEA 1EJOL 1BIHA 1F4XL 4X6CE 1PQZB 3KPLB 4L8DA 1J1PH 2OI9C 3IU4H 4UU9A 1RZFL 1E6OH 3ULUF 1S7UA 1GZQB 5CEYA 4QHLA 1JGVH 5C07A 4ZS7L 4LFHG 2WLYA 5C0AE 4FQ2H 1Q8MA 1IC5L 4JDZB 5F8RC 4YNYA 1RUMH 4U6XA 4ZO9A 4UV4L 4X4ZA 5E99H 4NDMA 1XF5A 2VLJE 4KKLC 4ALAH 5L6YH 4PG9A 5KN5A 1MCBA 4GUPA 1MFBH 3R8BB 3V6FA 4OD2A 3TCLB 1IEHA 5GXBB 1ACZA 5FV1L 4BFBD 5IMKB 4WY7H 1Q9LB 4NOFA 3MBXH 2XZCH 4HIIA 1WBXB 5FHBL 1B6DA 2VLKB 1HHHA 3MLUH 2NPLX 2CDEB 4QXUL 4G42A 4WUKH 3EDFA 3CDGA 4JKPL 4WU7B 3A6BL 5E2TL 4NFDA 3LMJH 4APQD 1ND0B 4LCYA 4NJ9H 4JM2C 4D3CL 3B6SA 1EEUA 5DJXA 3T0WA 5K59F 5FFLA 4PJ5D 2FSEA 2EEAA 2HT4C 1KEMH 4R26L 4CVZB 2R2HA 3F6LA 3TV3H 5EUOB 2OR8A 3UTQA 4ZFFA 4LCWE 5F1SA 3P11H 4AH2A 1L7TL 1AE6L 3ARRA 2AJYL 1D5MB 5CSZA 1RK0A 5FA4B 1J5OL 5J4MA 2BNQE 3FQNA 3K4AA 4GW5B 1DE4B 3GBNL 2QJDA 2DQEH 2HAZA 3WFDH 1IGJA 3FT3B 1HHJA 3P3YA 5DJ2B 2RGSA 4PV9A 3L9RB 3NIDF 4JRXE 5HXMA 1OARL 4XVTH 3QEQB 2FH8A 1TDQA 5L9DL 1MJJB 4LEXH 4NM8L 1CLZH 4RFOH 4WNQA 5JXAL 3NACH 2XRAH 5A16B 3C60A 1KOAA 3H0TB 4AM0B 4ODTH 4PG2C 2P46B 2XZAL 3BKCH 4R97B 4M8QB 1MCWM 1U8IB 5E2UL 1I7RB 1KXTB 3GJFH 3X12B 3KWWA 3OHXB 5KVGL 3I75B 5HHOA 4ODXA 4KUZH 1CLCA 4BFEA 5GZOC 5SWSD 3VGEA 1X44A 2PYEA 4HMEA 3S96A 1BQHG 4G8EA 2APXA 3HS0B 1KCKA 2VL5B 4XXDB 1HH9B 1UJ3A 3NCMA 3BWAA 2R0WL 4JFHD 2BRRH 1MCWW 1YNKH 2WK2A 3LKRB 5E2VL 4J1UB 2M2DA 1G0XA 4BELD 1LE9B 5E1AB 4Z7UA 1ZANL 5ANMB 4TNVF 5KZCD 3N1FC 3TNNB 2QSCL 3SGEH 2X7LA 5I6XB 1FCGA 4LNVA 1JF6A 4K2UL 4FQXA 2Q76A 4P5TC 4ZFGL 3L7EB 1C16A 2EIZA 4YHKH 5DUBB 4LLQB 4ZAKC 4K7PH 3O11B 5C9JB 4C59B 1MLCA 2VLRA 2V5TA 1I7TB 4FFZL 4YHPA 2X4UA 4JVUA 4QF1B 5JDSB 4I3GA 2XKNA 4RGND 1ACYL 1TVBB 5ID0B 1R3KA 2Z91A 4DGVH 4Y89A 1H3PL 2CUMA 1DP0A 3LN5A 5DHVA 3E6FB 5C0AD 2ZSWA 2NXZB 5IMMA 2W0FB 4LSUL 1U8QA 4XHQA 5T33L 1Z9LA 5E2WH 4KI5C 5JA8B 2VLJD 3ZDZF 4MD4A 4X9IA 3BJ91 2VDKH 2XPGB 4K3EH 4JKMA 4DOHE 2ZNWA 2PO6D 1XZ0B 2YKLH 3QYCA 5D71H 2WSKA 1MWAB 1WAAA 4OCSH 4WWKD 1INDL 4R4FL 3DO7B 1CS6A 3AAZA 4HUXB 5I73C 3VFGH 4BKLA 3L3IA 5C9KA 1I8KA 4E0RA 4WU5A 1YEIL 4NBXB 3SDXB 5FKAB 1EHXA 1PSKL 3PQYE 2HG5B 2IAMC 2FJGB 2PUQT 4KHXH 4M7KH 2YMXH 4CAGA 1G7QA 5DDHB 2A74A 4WFFE 3FB8A 5KG9A 4X99A 3ISWA 3OG6B 5SWZA 2R0ZH 1EBPA 2AXFB 1KFAH 5BO1L 2MJWA 1DSFL 4Z95L 1DBMH 4OUUA 2FO4A 2RJMA 4KFZC 4LCWD 4OZGA 3BKJH 1MJ8H 2NY4C 2BOBB 1FN4A 1S7TB 2J8UF 2NYYC 4YHLH 1QD0A 2R69L 1H3UA 4OZFH 2BOCA 5KAQF 3PF2A 4X5XA 2BNQD 4HUMB 4P23C 3SGEI 3PIQB 3O3BB 1U58A 2VDQL 1MCHA 3PDDA 3V4PL 2WUCL 5EO1A 3QR2A 3T0EB 3QT2A 4BQCA 4GKZB 4JY5L 4Q6IB 2IPKB 2NX5B 5JQHC 4OQTA 3EO1B 4JRXD 4XWGH 4PRAA 7FABL 4N8PA 3FAWA 4HKZB 3BRGC 3U4BL 2HT2C 2A77L 3ZKSD 1BOYA 2CGRL 3H9YA 1YNTB 2BXZA 1FG9C 1T04B 5IW1B 1LD9A 1ZHBA 5IB1B 2HKFL 2CLVB 5EZLB 2FHFA 4Z7WB 4F3FA 3RL1A 3VI4F 1OTUD 2Z8VC 3QZWG 2A9ML 5BQ7B 2VDLL 3V4VH 1N59B 4LLWA 5ETUB 3QCUL 3DMMA 1R5WA 5KSUA 2XWBA 2J8OA 2WINA 1ZT1B 4F58H 4R90L 4LDLB 4U1JA 2CDFA 1TCRB 4X7FC 4CVUA 1TPXC 3BYTA 4WVRA 1YQVL 4Q97A 4YX2L 3WNNA 3E6HA 1M1SA 2FJFB 5D2LA 4XXCA 1OGTB 2YPLB 5DD6A 1WICA 3LKQB 3RWJA 3QFJA 4TOYH 5DS8B 5D7IB 3TNMA 2YZ1A 1NANH 1U9KA 1JTTA 4LCCC 3M07A 4APQC 2R4SH 4UQ3B 5ISZB 5T1LA 5GS0D 3BIAX 4HIEA 4ZOEA 3WFEH 4MZ2A 4Y4KC 5DRXB 3PDGA 4G6AD 2AJUL 2QQLL 1TNMA 3BHBB 1FVEA 3I50L 5SX5K 4N0YH 3ARGB 4POZD 4LGRB 3S3PA 2DS4A 2FHBA 4JLRB 2V6HA 4QNPE 4LVNB 3BW9B 5EU6A 3ULSA 4NWUH 3BPLC 4XBPA 4HH9B 5GIRA 3G9AB 1A6UH 5EU3A 3VJ6B 3W5NA 4CMHC 2YR3A 3W0WE 2G2RA 3O8XD 4GMTL 3UPCA 1TQBB 5C6TH 1PZ5B 3FRPA 3LHPL 5C09E 2DM4A 3IJHB 2NNAB 4MJ2A 1F4WL 3QNYB 1NBVH 2AK4A 4F9LA 1I1FB 1A6WH 3I3EA 5D8JL 4PTTA 1SJHA 4M9PA 4KZEH 4ZUSB 3MV8B 2D3VA 3FO2B 3NABH 3ZE2E 5I71B 2E27H 3F12A 3DVFA 5IEKB 2WBJB 1Q94A 2E7CA 2VDOL 1DBJL 3HE7D 1WGOA 2VXSH 3QUXA 5HYIA 3HC4L 3F7VA 3OJMB 1F97A 2YRZA 4GJTB 5TE7H 1EVUA 5T1DH 3FQXA 1H9VA 4ODSH 1H8NA 5GGUA 2YD3A 3PQYD 3LKNB 3WBDA 4FXGB 1KELH 4ZTPH 5EN2B 1CL7L 3HZKB 4WFFD 1A47A 2XFXA 5DRNA 15C8L 1BFVL 3KLSA 3CSGA 5HYJA 3RX8A 5E24E 2HMIC 1XR9A 4TRPL 4XPHH 4OQTL 1EUUA 4NO0A 2NY6D 5ELIA 5BZWA 4L1DA 4XPTL 1KIPA 2A6DA 3BOVA 1FVCB 5GS1A 1Y6KR 2OP4H 3FB7B 2X4PA 3DRQB 1AD9A 4XP4L 4JFPB 1NANI 4A2LA 4ZTOH 4LDOB 4JFQB 4NDMB 1XF5B 1T1WB 5I1EH 5ID1A 5LGJA 4X4MA 5KN5B 5MERA 3W9EB 2G75B 3GSWA 5MHSE 3QUMB 2J5LB 1F00I 2F54A 2DQJH 5ESVA 5HYQA 5FDWA 4M43H 1I9EA 1AR2A 5DVNA 4YE4H 3UZVB 4OLWH 3SE3A 1S78D 4PR5B 1ERNA 2IEPA 2WIIB 3ZSTA 5IWLA 5E8NB 3DX8A 1JRHL 3CDGB 5E94A 5HDQH 2EYTA 5GHWH 2XZZA 4LSVL 5JUEL 2PO6C 4NQCB 3RIAF 5D7SH 3WHXB 5DJXB 3UTTE 1OTSC 3HNSH 1IKFL 5JPNB 3IU3A 3RZCA 4NJAH 5ACMA 4OI7A 3N9GL 1EEYB 4O58L 5CGYC 4L8BA 1KN4L 2X10A 1F6AB 4OCWL 3I02B 3ARFA 1N64H 5CJXC 3IF1A 1EMTH 1RZ7H 4IRJB 4I77L 3VMPA 5MEQA 4TVPH 5KJRH 3IDXL 1MF2H 1IGJB 3VFMB 4XH2A 4GRMA 5IJVA 2P43B 3FFCE 3LH2H 5D5MF 1XCTB 5J9PA 3KJ6H 1IGFL 3TO4B 2H32B 4JZNA 2ADGA 4O2FB 4RMSA 4OFDA 2BVPA 4HFUH 2Q7NA 3K46A 4LKCA 3SE8H 1TETL 3MRDA 1FORH 3BE1L 3C60B 2PXYD 1VFUA 4JPIA 3GIZH 3W0WD 4M6MH 2JTDA 5TF1L 1UKTA 1FQ9C 4GRLD 3U79A 3ME0A 4ZPTB 2JB6A 4G9FA 3NCCB 3KWWB 1X7QA 5HYEA 4P2RE 1S9XA 3MC0A 3TIDA 1V5JA 5JW4M 3OGOE 1LK3H 2DN7A 5FGCE 1A7PH 3STZB 1RUAH 3BP5B 3EYFA 4DFIA 1JNLL 3PWPB 5IHBA 3TPUB 4HJ0D 2VDNL 4G9DB 4OGYL 3MRJA 1SYVA 1HQ4B 5D7JD 4TQEL 1Q1JL 4GW4A 2V2WB 4HZAA 1IGTB 5LAXB 4NBYB 5FEBA 2HJFB 3P77A 2EZ0D 1A9EB 2Y72A 3IDNB 4GAFB 1KJ3L 5F7EL 1U36A 2FX7L 4LSSL 5ALBL 2EIZB 1B4JH 5DWUH 1PD6A 1A8JH 5E8EA 1E4XH 2PYFB 1XIWA 1PBYA 1ZHKA 1IGIL 5DSCB 3CCHA 1CICC 1J1XH 2Z31B 2DQCH 1KG0B 1T5XA 3KYKH 3I6GB 5I18H 1T7WA 4Y2DB 1R5IA 3MLSL 3VFWA 4HLZH 5IVZA 3HG1A 5FKPA 3M17A 2EDRA 2QL1A 2ZSWB 3EOAA 4GAGL 1U8QB 4ZNEA 1NLDL 4U1SA 2OJZH 1FJ1A 4NFBA 5HI3D 1OP3K 1CG9A 1T0NA 2JLLA 2LU4A 1YEHH 4FMFA 3L6FB 5HGDB 2H26A 1TZIB 1I7UA 4ERSL 3FRUA 2V9QA 1NUDA 3R06A 2BDNL 5IFHL 4FQ1L 1YEDB 3VD4A 5JPMB 1GGBH 3O8XC 5HVWA 3U1SH 1MAJA 3AAZB 3GSOA 3SQBA 3WDJA 1I8KB 3RVVD 4JFYA 3QCVH 1RUQL 3K2UL 1NBZB 5GISH 5D1XB 3VD9A 3UTTD 1BVZA 3FB8B 4XBEH 3FQWB 3U36A 4KJYA 1A1NA 2ARJQ 4JZJC 4UAOB 2NW3A 1OTTD 4CBPA 3B5GA 4PJAA 2NTFB 3U2SA 3RVWD 1UH2A 2E9JA 1IGCH 4XC3L 2OTUB 2P5EA 2ED8A 2FGWL 3CH1A 3NCYP 1BZ9B 1KT2A 2BOCB 4L3CA 4XNXH 4XNZC 4M7LL 1XGYL 5F7MC 3PXJA 4UINH 1ZLSH 2W07A 4QRPB 3L95A 1K85A 1CGWA 1DUZA 3DURB 4TNWK 5C0DB 4PJGA 5LBSL 4PLNC 3SE9H 5KOVC 3U30B 2WANA 3G9VA 1MPAH 3FFCD 4U6HB 4V2BA 5HGHA 4PRAB 2R1XB 3HNTH 4QXWA 2DLEA 4C56D 4ELME 2J2ZA 1D5IH 4F3FB 1UJTA 1MCRA 4PJHF 4P49A 2A0LC 2YD1A 4N1HB 2Y07L 1IAKB 3OR6A 4P2RD 3V5KA 3DMMB 1OW0C 3O0RH 2FWOA 4MA3B 4XGZA 2VR9A 1OT2A 4TVSa 1KTLA 1TXKA 2ADIA 4ZOBA 1K2DA 4EXKA 3OAYH 5FCSH 5C08E 4WHTA 2NY0D 5DHYA 2UZIH 1S9YA 3B2UC 1Z9OA 4AMKL 1QRNA 1S78C 2VZSA 4ISVB 1YPZE 3TNMB 3RWCA 1MHPH 1L9NA 5DQDL 1T03L 5ADPL 5CBAA 5HD8C 4OZIB 1JCKA 4PRPE 5T1LB 2W9LA 5E7BA 2ZUVA 4RGMC 1KB5B 2F19H 3BDYL 4PGDB 1BVKA 2A9NL 1MCPH 1LE5B 4HHAA 1YN7A 3WO4B 3D0LB 4LLAA 1OLZA 5EU6B 2I60H 4QRQB 2H9GB 1U8HA 5HHME 1MFAL 1G7JA 5EU4A 1G7LB 3PHQA 4JRYB 5EU3B 5C0IB 1I1CA 4PJEB 4XNUH 2FRGP 4OB5L 2NY1B 2EKJA 3O41A 2AK4B 5GRWA 1IQWH 1XCQA 2QLVB 1DZBA 4WEMB 3SKMB 3QQ4B 3HCVB 1SJHB 4BZ1H 2QV2A 1IGMH 1QVOA 5F7DB 5HVFB 5FYKE 4DZBA 3FOMA 3MODL 5D70L 3F12B 1CQYA 1GGYA 3IDYC 4S10A 4YC2C 1FNLA 1TJGL 2PXYC 3ARWA 3O9WD 4Z7QE 3KR3H 3BZ4B 4JHWH 5F9WB 1G1YA 1LO4H 3QUXB 4TTDD 4P3CH 4Y19A 3A6OA 4LDEB 3GBLA 4J4PA 5HHXH 1LILA 2FB4L 3KPRB 4PGJA 3VFNA 2W0KA 4P4KC 3LKSA 4R7NB 5ERWA 2OK0L 4RAHA 3CU7A 3L5IA 4KKBD 1CGVA 4Z0BL 5T3XH 2NCMA 2XFXB 4NNYB 3VG0L 5F1IB 4HJ0C 3SDCD 3VD7A 4MXWL 5IJKC 5LKNA 1E6JL 5F9AC 4NO0B 5BZWB 4I3SL 4HBCH 3P0VH 3DROB 5I1DB 4JG1L 3UAJD 4ORGB 2A6DB 5C8JB 2EZ0C 3UYPA 5IM7B 3F6IA 4S1DD 4M6OH 2AAVA 4OF3A 5IB3B 1MJ7L 1WZ1H 2Y36H 5HDLA 4MJID 3LIZH 4OLXL 2EXYD 5KAQG 5ID1B 2XWTA 1S7XA 5LGJB 5E5MA 3LN4A 5MERB 5IEHA 4Y4HC 1U3YA 2JJSC 4KC3B 4UNTA 2AK1L 4LARL 3GEWB 4JO4L 4OD3L 1T89A 5I8OL 2EYSA 3DVGB 3JV6A 3U9PH 3C6LB 3PWUA 4NKOB 1CFNA 4X8JA 4BYHA 2W60B 1A14H 3G5ZA 1NKRA 5AAMA 1OD7A 4K8RD 1M4KA 3SGKC 5FYJH 4DUWA 4PRDA 5BXFA 1N4XL 4HKJA 4HWBA 1FL5B 3FO1B 1EEQA 3KS0J 2UUDH 5TPWH 4FZ8L 4YK4C 5HI3C 3SJVE 3U0PB 1YPZF 2X4RB 3SDYL 3G6JE 3QCTL 2XKUA 4HUWA 1FVDB 3H9HB 5C08D 4YQXL 3V0WL 4LLUB 2VTFA 3MCKA 3WKML 5IGXL 1VDGA 2BK8A 5T3ZH 3GJEA 4DAGH 4M6AA 3ARFB 2J88L 2UWEA 1PG7W 4P9HL 1ZWIB 2B5IB 3ARPA 1MI5B 1MJUH 1JK8A 1T83C 3L3JA 4PRPD 3GMRA 4LLVA 4YHMH 3T0AA 1MIMH 3RU8L 1ZXQA 4IRZH 5CJ5A 4XH2B 1B6UA 2A6JA 3PHOA 4GRMB 5KSAB 3S35X 3U0TA 1EZVX 3MUHL 4PLKD 3S37L 1IT9H 4HGWB 3UDWC 1F2XK 5ICZB 4WUUB 1UC6A 4JZNB 2FBJH 1J8KA 2BVPB 2N4IA 2OQJA 4L8SC 4PG2A 5HHMD 2V17H 3SDAA 3MOAH 12E8H 1CFVH 1DVFD 2J3SA 3MRDB 1RZGA 3WFHA 1FAKT 1X5XA 3FQUB 2KQMA 1NGYA 1Z5LA 5FYLL 1ZLWK 3B3IA 3VXSB 4YHIA 2P5WA 1EFXA 1DCLA 4MB4A 3IFLL 1CD0A 3GK8L 2R8SL 2P44B 1ZTXL 4DTGH 1RHFA 2B4CH 4PUBH 1FZMA 1WITA 3DUSA 4XZUA 3FO0L 2OMNA 3TYFA 4ZXBC 4JN2A 2YC1B 3CFKA 1AO7D 4LK4A 2XTJE 5FYKD 4HULB 5JHDA 4HFWA 4XP1H 1SYVB 1E4KC 3BZEA 1KYOJ 4OFYD 1UB5A 3OKKA 4UV7L 5GGSB 4NQEB 1MCJA 5DK3A 2ZUYA 1X6LA 3RZWA 4R4BA 5DQJA 4NQSA 3VGBA 1T0PB 1ZA3A 4LIQL 4XCYA 1ZE3C 2VAAB 2W92A 4OM0L 3HAEG 5DD5L 4ZAKA 43CAB 3RWHA 3KPOA 4L4TA 4PY8I 1QSEA 4WW1B 4OF7A 1J11A 1ETZA 4BQ9A 2OX5A 3BT2L 1IC1A 5HBBA 4AEHH 3OJ2C 4Z7VA 4DZ8A 3CCHB 3RPKA 5B8CB 4UMGA 1DLFH 2W1NA 1QFUL 3QIBA 1ZT4A 1AFVL 3TO2A 4DGYH 3MRBA 4NUJA 1V05A 5FKPB 3QUZC 3V9FA 1ZHLB 3EOAB 3VGAC 4MA8H 2YXFA 1NAMH 4HWBL 3S7GA 4WW2B 2DQTL 4MZ3A 5EA0H 5FCUH 1UT9A 3LKOA 4POUB 1J1OH 1I8LC 4RA3A 5D93B 3GSUA 1QBAA 1X5KA 1RZ8B 4JJ5A 1A6AB 3R06B 4X7EC 4HEPG 4Y1AA 4MMXC 1OM3L 2L7JA 1U92A 3NTCH 2A6IB 5DEFA 3CXDL 3RWEA 3GHBH 1NMAH 1JNNL 4YH6A 2Q6WB 2XICA 3O6FD 1L7IL 2YPKB 1MHHB 4JDTH 2AJVL 3SJVD 3R4DA 3FN9A 1P7HL 1A1MA 1P7QD 1DQDL 1J86A 4GQ9H 4HUVB 2IALB 3KXFA 4KXZH 3EYVA 4S1QL 2A73A 3N85L 4JZOB 2B39A 4OLUH 4X7TB 4GAJL 4OGXL 3Q6GL 4CNIA 5B21A 4MWFB 5HVHC 3U2SB 4KTDL 5EZIH 5FXCH 2Q86A 3O9WC 5LGHH 3OR7B 2X09A 4NQVB 4ETQB 4HWEL 3NPSB 4ZO8A 4TTDC 5DFWH 5F7HA 4P23A 2P5EB 3EO9H 1MNUH 2JIXD 1U8LB 1UXSB 4POYA 1JWUA 4KJQD 1GH7A 4JANB 4OCRL 1C08A 1W72B 4R8WL 1MAKA 2V7HB 1U8OA 4PY7A 4W6YB 4X6BB 3ZHDA 1M7IB 1LO2H 3H9SE 4KKBC 4DW2L 5GGVY 2GSIA 2FIKB 2Y1VA 4Y5XB 4YHOH 4QWWD 1NLBL 1YMMB 1MY7A 5TQ2L 4KVCH 5HTSA 1H0DA 4MAYB 3LRGA 3H7BA 1OB1A 4BFIA 1HH6B 3LS4L 4EOWL 3UC0L 3TVMD 3HPLB 4Y4FC 1CLOL 3QIUA 4FA8A 4OAWB 3QUKB 5IVXF 2EH7L 3CFBA 1ONQA 2YXMA 5TDNB 3FONB 4FTVA 5HHPA 4YJZL 1U8MA 3SBWA 2VIRA 1W8OA 1VA9A 4LSDA 3DARA 2M26A 2PR4L 2ZCLH 4GSDL 4KVNL 2GAZB 5D72H 4XGZB 5CUSL 3MV7B 2XTJD 4HK3J 2CIKB 1CF8L 4LLYB 3MJ6A 3U4EB 4E41A 4HX1B 1LP9E 5K9KB 1J0ZA 4QRUB 1XT5A 3S35H 4JDVA 3MRRA 4I0CC 1RZKH 2X1PA 1CFBA 5D6DC 5GRUL 3MRLA 4K8RC 5JHLH 1NFIB 3QAZC 2ATKB 2N7AA 3E3QC 4W4NA 4Y4KA 1MFDL 2GJ6A 3WLBA 1MFCL 4ZPVA 2ZCHL 4XNMB 4FQIH 4CN6A 3QEQE 2ZZUT 2I5YL 4NSKA 2EXWC 2E6JA 4PJFB 1BVKB 1B2WL 2HVJB 4HHAB 5E8OA 4KXZI 3MRHA 4TSAH 4YDVB 1OSZB 4MDJA 1F58L 3V7MA 1U8HB 2VL4A 1FFNA 5CEZE 4MB3A 4NZTL 4JO2H 3ILQD 3QXDB 1OF2A 4I48B 3GBML 2R2BA 3GSXA 1R3HA 4PJCF 4OCMC 3KDMA 2L0DA 2G9HA 1Q38A 4HZLA 1CK0L 4ODWB 5D1QA 3QXAB 3L3GA 1LEIA 1WSST 1OT1A 1Q9WB 3D85A 1ODAA 1MIEL 5C70A 4MNHB 4GOSA 3HLAA 2WQ8A 1MCCA 2O61A 4LOUD 3O2WL 4R2GB 2JCCA 5E6IB 2APTA 2D7NA 4QRSB 1IC7H 1NPUA 1D5ZB 4X9GA 2YS4A 4ONGL 1SBSL 4X7SL 2XWJB 4YHNA 3E8UL 4L5FL 4O02L 1JGEB 5F88A 4PJXE 5BV7L 5L7XL 2RCSH 3F7RA 4FQLH 5GRZA 4N8CL 4MGXA 4LSTL 5DFVD 5JR1L 1UADC 1S5IH 5ERWB 1F3JB 3NGBB 2Z92B 3FN0H 1CXEA 4P5MB 3BKYH 5FM5M 3IJSB 1NGQL 5B4MC 1R5VA 2XT1B 3QPXL 3OBAA 2C3VA 3IDIA 2DMBA 3IAQA 4MA7L 3B2VH 1FPTL 2NXYB 2YD4A 4R9HA 4QRRA 3U46A 1CXLA 5ESAB 1UENA 4XPGL 5EUKA 2Q8BH 1L4IA 1BFSA 1C12B 5IBTL 3VXMA 4MXVE 2YPVH 4QOKA 3H9SD 1GAFH 5IMOA 5IT2L 5E5MB 3LN4B 3ULUL 5IEHB 4O5LH 5ABDE 3LRSA 4IS6A 1FL6A 5EUOF 1V7NL 1EGJH 2J6EH 3SO3B 5EBLB 1ITBB 4FXKA 4JO3L 4UUJA 3K74B 4UNUA 3VXUB 4Y16B 3F5WA 2A1WL 5ALCL 1X5JA 4PRDB 1OAQH 1UB6A 5TE6L 1SJEA 3Q3GB 3VFRB 1MWAH 2YN5A 4DJMA 4LPYA 1NAKH 4H88L 5LG1A 4GKSA 4JY4B 1ROWA 2FZ3A 4KROD 3VWKA 4OV5A 4MNQB 1NEZA 1SM3L 2X70B 3HE6D 5ICXA 1YEFH 1R0AL 1I3GL 2JF1A 2BSSB 2YD8A 5INCB 4F7CA 3SY0A 2YA2A 1EH9A 4M93B 4NNXA 3RVXC 3TP4A 5EOQH 5I75C 5BVJB 1RULL 3TA3C 3OG4B 1NGWA 2A38A 3TIEA 2QTEA 3O6FC 2UWEB 4H20H 1JN6B 1ZLVK 3KNBB 3L3JB 3CGTA 3QEQD 3VG9B 3EOBB 1U8NB 2BY3A 4OQ1A 1MREL 4UI2A 1OP3H 4EDWH 1PW3A 3RA7L 3QXVA 1KLFA 1SEQL 5DI8A 5HJ3B 3TN0B 3VFUA 4W6XB 1P7KA 4HW6A 5H94A 5CEZD 1GGCH 3MREB 2VDML 1A7RH 3FMGL 5I1LB 2BY0A 3GJFA 1OGAA 3PP4H 5D1ZA 1YJDH 4LHUD 4MAUL 5EIIA 3KPSB 5IKCB 4XCFH 2B4CC 2I25N 2AJXL 5ICYA 2J8UA 1ZVYA 5CIPB 3WHE1 4QWWC 4IBLT 1YNLL 5JOFB 1K8IA 4LKXB 1IC5H 1LDSA 3UJJL 3T2NH 2D7OA 1A22B 1YEKH 4GG6A 5JHDB 4IMLB 2X5PA 5A43C 5EOTA 5TDOA 4EN3B 4PJIA 4CU8A 3HB3D 1J1PL 1GHFH 3IU4L 1NJ9A 5FGBC 3BZEB 1E6OL 1F3DJ 3TVMC 4RIRA 3VXTA 4J2XA 3H3KA 3CVHB 1JMXA 1JGVL 3MX0A 5BJTB 2IADA 3WFZA 2BVEA 3HFMH 4FQ2L 1L6XA 2HN7B 4NQSB 4TUJA 5DQJB 5AYUH 4XCYB 3BFOA 1RUML 5E99L 4ALAL 4CGTA 5L6YL 3RWHB 1TJHH 2AKRA 2VE6B 2ESVE 3EGSB 1MFBL 1X4XA 3F7PC 2XN9B 2XTJC 4QRTB 4GS7C 1ETZB 2F53E 1OVZA 4F7TB 2DF3A 4MXVF 1CICA 2YUWA 4N8VB 4PIRF 3S97C 3ABZA 4WY7L 2GFBB 3MBXL 3IRZA 2XZCL 5I1GH 1BBJB 1KCSH 4OI8A 3HUJA 2XXCB 5F6IB 3MLUL 2EDBA 4P2CG 2ZOKA 3QWRD 4HH8A 4PJ7E 4WUKL 3QIBB 4NQXA 3SDXF 5I66A 5ECJE 4NUJB 3UTSB 3QG6A 1BIIB 3QNXB 3WE6A 2ZOLB 1NFKA 1L7TH 3TBSB 1AE6H 1V7MH 2EH8H 4NJ9L 3KYOA 5IMLB 3BZFB 2AJYH 2VDPH 4EI6A 5DJDB 3OKOB 3BVNA 3IDMA 3K2MC 3LKOB 3QQ3A 1KEML 2UVEA 2RFXA 2ITCB 5KSBA 5KSVB 1QSFA 2O26U 4P59H 3GSUB 3TV3L 4EI5B 2GITA 1L6ZA 3MNVB 3P11L 5GRJH 2HVKA 3P9LA 1FFOB 3VFSB 1J05A 5F7KC 1FZKA 1JPFB 4KK8D 3RWEB 5AG8A 4XWOC 3C2AL 3T2QA 1QO3B 4NUGH 1WBYA 1MELA 5E4EB 4X4YA 4YXKH 1G9MH 1FNAA 4JHAL 1VFAB 1J9CT 1QKZL 3WFDL 4BUHA 3QA3A 3LDBB 1HSAB 3S5LB 4JCLA 3KXFB 4DWHA 1HHIA 3EYVB 2PCPA 4LOUC 3FCTB 1UXWB 4XVTL 5C07E 3CAFA 4X6EA 1RD6A 4CNIB 3QDMA 1EXUB 4TPRH 1CLZL 4RFOL 3NACL 2Q86B 1MQ8A 5BRZA 3UPRB 2XRAL 4OZFA 5BV7B 3MLXH 3OKMA 4HT1H 4ODTL 1NMBH 1T66C 3BKCL 2HFEB 5KW9H 3B9KD 3A6CH 5CZXD 5DFVC 4E42A 2MFNA 3RGVA 4LBEB 4KUZL 2UZYB 3T3PE 5EIQA 2QSCH 4XI5D 4XAKE 2WWMD 2OMBA 1MHCA 4WRLA 1UVQB 1Q9OB 1UZ8A 2BRRL 1YNKL 3HZMB 3REWA 5CEXA 1TZHB 4MNGA 2YZ8A 2XNAA 3H7BB 1H3WM 4TNWF 1M7DB 2DBLH 5GPRA 2P45B 5D7IF 1VEMA 3WUWG 3QUMH 4P2QA 4L1HA 4YXHL 4FFZH 4CL7A 1RIVH 1KCVH 2ERJB 3P9WB 1MHEA 3CFBB 2PTTB 2H8PA 2R1WA 4URTB 4Q7DA 4GAYA 4F80A 5DLML 4YHKL 1H3PH 4K7PL 1QYGH 2H6PB 4MSWA 5F21B 4YHYB 5E8DH 4BA8A 5ITBH 4LU5H 3IFOB 5L2KA 2MOVA 1RZKC 5D96C 4DN3H 4DGVL 3THMH 2HJLA 3IKCB 1E0OB 3CXHK 4R0LA 5AD0B 2XQBH 5E2WL 2EDJA 3DYPA 1HKLH 4GBXD 3DGGB 5BS0B 4BSWB 4KROC 3ZTJH 4K3EL 2ESVD 2C1PB 2D9QB 2F53D 2YKLL 2BCKA 4FN0A 5D71L 3G5VB 3FTGA 3MUGA 4YBHA 3ROLB 4ODUB 3MACH 1J8HB 2AJSH 1JHKH 4M5ZH 4NCC1 5HHOE 2QQKH 1FFNB 1OF2B 1QPXA 3BEWB 1JYVA 4NKDA 3VFGL 1R3HB 5HVGB 2PYEE 4AZ8A 1NC2D 3BDXA 4B0MM 4N9OB 1S7QA 2H32H 5CWSB 2G9HB 4M62H 1JNJA 2ENSA 4RMVA 4NT6A 4KHXL 1LEIB 5TH2B 4M7KL 2YMXL 4U3HA 3EKCA 3JUYA 5DQ9B 3UYRH 3V4UL 2R0ZL 4Z7UE 1KFAL 2O61B 4R97C 4O51A 3MLWH 2X1XR 2JCCB 1MH5B 5C3TA 4S2SB 1W0WA 3VDBA 4JY5H 4J3OC 3BKJL 1MJ8L 4NKIH 2F8XC 2Z4QB 5D5MA 4YHLL 1EUTA 1ZT7B 4G6KH 1XEDA 2CGRH 4HIXL 2VLRE 1EHNA 3BO8B 3H9ZA 3EJJX 5GRYA 1WZMA 4H8WC 4P2OA 4J8RA 5D4QA 4J12A 3QEUA 1KULA 3ES6A 4KRPB 4XWGL 2VDLH 5C07D 3T3PF 3QO1B 3HB3C 4ZODA 3AXLB 3IDIB 3AUVA 4HGMA 3HR5A 5F1OB 4OD1H 4R90H 2VO5A 3IS0X 4LMQE 1G6VK 2BVOA 5E9DA 5D2NA 3I6LE 4PBWD 5C0BA 1UKQA 1WFTA 4HIHA 4QT5A 3V4VL 1EO8H 1A6VH 2ZNXA 2MMXA 4Y4HA 4K7FA 3UMTA 1WAAE 1PYWB 3PWJA 4F58L 1A7BA 4XAKD 1AGBB 3HZVB 4KRLB 5FOBA 5HDBE 2P8PB 3X3GH 2NXZC 4OGZA 2JK5A 2VQ1B 2KZ1B 5ACZA 1FSKB 4RMWA 3JUZA 2CDGA 4RGOH 3MV9A 4TOYL 4UUJB 1VKXA 1UKSA 1JUFB 3F5WB 1HCVA 3G6AA 5SWZE 2R4SL 1SJEB 1CN4A 4X80H 3AREA 4C54A 3WFEL 2CK0H 4M1CD 2Z8RA 3C87A 1G6RA 4OZGE 3JWDH 2FZ3B 3T4AB 3VWKB 4OV5B 2V5MA 1NEZB 1IQDA 4PFEA 4G8FA 5ICXB 4L9LA 1DEEA 3WNLA 4YDKH 4R96A 5F96H 2X4NA 2W91A 5IFAH 4NWUL 3DX7A 2AXGB 3SY0B 1CZ8H 1U8PB 2XI9A 4WO4A 3F58H 3JVGC 4KK8C 4NNXB 4DKDC 1OP5H 1A6UL 2RB8A 2AI0H 2VUOA 5C6TL 1YDPB 3ORJA 3EYOB 9CGTA 3MLTB 2MCPL 1JP5A 1NBVL 4G8GB 3S34H 1A6WL 4EKXA 3M8OH 1G7PB 5GS3A 4KZEL 2EC9T 4MCYA 5B38B 4O2EB 5DGQA 4K3JH 1JYWA 3VRJA 4BJLA 3NABL 2E27L 1EJ6A 3KJ4C 1DUYB 1ADQH 1LEGA 4CVWA 5DJ8A 1DQTA 5HHOD 1XGPA 3T0EC 2VXSL 3E1F1 2O93L 3LCYA 4NKMA 3SGDH 1VADA 2OJEB 5TE7L 1QLRA 3B9KC 4KY1L 2PYED 5CZXC 5T1DL 4ODSL 1CFTA 3GMMA 2IANB 3OF6A 4ZXBA 1CDIA 4XT1C 2DQGH 3DTXB 4RZCB 5FK9B 4ZTPL 1MRDH 1QLFB 2XG5A 1X5GA 2KZWA 1NCNA 4U1GB 4XI5C 2EDQA 5D2LE 1T3FA 5DEZA 3VCLA 1ZHNA 2WWMC 1BD2D 5IIEB 2W0LA 2N56A 3B5HA 3QFJE 4XPHL 3UROR 5C2UB 1AY1H 5TDOB 4PP2A 1A21A 2YSSA 4PJIB 3RKDC 3T8XA 3ZT7A 1W8NA 2CIIA 4FQXD 1KLUA 1H15A 2OP4L 3CC5A 5HI4D 4JFFA 4X4XA 3KPNA 1JPSH 1EAPA 2VLRD 5DJZA 1S9WB 4ZTOL 5MENA 4UZGA 2VRAA 4AIZB 2V2TB 2P4AB 5EU6E 5GSVA 3WXWH 4YAQA 3GMQA 4PJHA 1DN0B 1NBYB 3AS1A 4XCEA 1RZIA 3RHWK 2DQJL 3EIFA 3AU1A 3Q48A 2GSGA 1WAAF 4M43L 1KBGH 3T77B 2PW2A 3GGWB 1NGXA 1JHTB 1D5BB 3MRKA 4PRNB 2AK4E 3IDGB 3HUJB 3VH8G 1KB5H 3AFLA 1WLHA 4OLWL 3QUZA 4KK6C 5IB2A 3TFKD 5IG7A 4YPGB 4UOJA 3I6LD 3ARGC 1GGUA 4O58H 2AEPH 4NRYB 4NQXB 3VXQB 2FYYB 3DBXB 3OQ3B 5GHWL 5HDQL 2QHRH 4RAUB 4P4RA 4NRZB 5H35B 5IF0A 4F37K 1UH3A 3UZEA 5D7SL 3HNSL 3QQ3B 1T0MA 1G6RL 2VN4A 4NJAL 5KSBB 5CBEA 1H5BB 1AKJA 4OZGF 2GITB 3PHSA 3PWLB 3C5JA 4QO1A 3BH8A 3G5YB 1FZKB 5HI5D 2IBGA 4WJ5A 3WNKA 5SWZD 1RZ7L 3BPOB 5CP7A 3SGDI 2B1HH 1IEAA 1WBYB 5H37H 1LHZA 3P4LA 4OZ4B 4PJDA 5HYJE 1CXIA 2WBJC 4TVPL 5KJRL 2K7PA 1VFBA 4Z77B 3OXRB 4QHNA 2ZUXA 3LH2L 4GG8B 5EO0B 1IL1A 3KJ6L 4JREC 3QIWB 2F5BH 2R0KH 3QDJA 4JGJA 2DQFA 4X6EB 1HYRC 3QDMB 3MUY1 3D69A 4HFUL 5BRZB 1FORL 4OZFB 4L3AA 4WI7A 2B1AH 5GSRB 1CD1B 1XGUB 3ZKMD 4JKLA 4M6ML 4OLVH 4G7VH 4X4ME 1NCCH 4TQEH 1Q1JH 3OAZK 2F54E 5I2IA 1U2HA 3BPNB 1P84J 3RGVB 4PJBB 1MQKH 1LK3L 1BGXH 1A7PL 3UP1A 2K1MA 1RUAL 4JFOA 1ED3A 5DEGA 1JZ6A 1JF1A 3TBTB 3GUTB 3AY4A 2P7TA 1KJ3H 1RJCA 4Y4FA 4H1LB 5CLWA 2DJ4A 1RIUH 2FX7H 4LSSH 1INEH 5FA3B 2EYRA 4LHUG 1UQSB 3DMMD 5M7QA 1OAUH 1WUNT 4R4ND 2J5LC 4P2QB 1T21B 5GS2H 3HR6A 1EO5A 4M3JA 4OZIF 4I0PA 3EYUH 1EHAA 3TESA 2QADD 2Q87A 2ICEA 1CT8B 1B4JL 5DWUL 4M61B 1AGEB 3OKLB 5KVMC 3C5ZB 4HF5H 2EDLA 3C6SA 3MRPA 4ZSOB 3QFJD 5EORH 1CDHA 4X7DC 1UGNA 2GY7B 5HHNA 3K1KC 3MNWA 4BFGA 1J1XL 2I9TA 1XH3A 2DQCL 3TBWA 3KYKL 1I1AB 5I18L 4PJEF 3N50A 2IQAA 3SDDD 5C0RL 1DDHB 4NRXA 3QUYA 4RFNB 5I74B 3W39B 3U9UB 4LSQH 5AWNH 4R0LB 4X7CC 4M1CC 2OJZL 4PJ8A 1P69B 4TTGA 1AC0A 1Y0LA 3DI3B 1YEHL 5EU6D 2WLZA 1S7SA 3PL6A 4XP6H 2OTWA 1FHGA 3MV01 3H2WA 1JZ7A 5IOPA 4E5XB 4NC0B 3MFGB 4IRJC 1AD0B 2NY1D 4G9FE 4M9OA 2AK4D 4WFEE 1NGPH 1GGBL 4QTIH 3U1SL 4V1DA 3RPIB 4HAGA 4NO3A 5DYOB 3DX9B 3WLWD 1S7QB 1N26A 1AR1C 1I9JH 3QCVL 4L4VB 3NIGE 1JI1A 5GISL 3VA6A 3CX5K 1ZV5A 1RMFH 3C60C 4G7YH 2ENYA 4LVHB 3WYRA 3T65B 4I2XA 4XBEL 1S7RA 4NN5B 5SV3A 3NFSH 3QUXD 3KPQA 4DFHA 4I4WB 3O3UN 1T7YA 3SO5A 2HP4A 1CQKA 3MRGB 5MEOA 1FZJB 1U3JA 3QHTC 1IGCL 5J06A 4OFKA 1QPPA 1FYTA 1E27A 3TBVA 4XNXL 5JMOC 3WUWA 1K5NB 5JLZA 4UINL 2AV1B 3QFDA 1UJ3C 1ZLSL 3X3FL 2LAAA 1QUNA 3CPLB 5HYJD 3PJSB 3SE9L 1IM9A 4NO0D 3CNKA 3EOYG 4UTBH 1MPAL 1GPOH 1ZLVH 4P2OB 3C9NA 5HHQA 5IK3A 3S37X 4KTYA 3HNTL 1JZ3A 5IHZB 3HG1E 5DGRA 5DR5H 4W70A 4FQXC 4ZNEE 1Y6NR 5CJQH 5EO9B 3PGDA 3P4OA 4IRSA 4QY8A 1KC5H 2AJZB 2B0SL 3PUCA 4OCYH 3B8SA 5HI4C 1D5IL 3RY6A 1U8KB 4WDIA 2Z8SA 1JTPA 2AEQH 1FL3A 3MRCB 2A83A 5DZLA 2F54D 3BQUA 1D9KB 4QT5B 2Q1EA 2ZUQC 3AB0B 3H42H 3LB6D 2C7UB 4K7FB 1P4BH 3PWVA 4F57H 5BZDB 3O0RL 3QXUA 2BVQB 2Z31C 3WV0A 4LRNH 4ZFZB 4KJWD 2APVA 3IFPB 4Z76B 5D9SB 2FHCA 4ZD3L 4Y2DC 4TUKH 1A6ZB 1EERB 5E5RB 5FO9A 1I8IA 1B0WA 4NQDB 1WQVT 3IGAB 3VWJB 5FO8A 5K33A 1DQQB 2JK5B 3WD5H 4FQCH 5T1KA 1SQ2N 3BDYH 3Q0HA 3EJZD 2XKSA 1JWMB 4LLMB 3MJ9H 5J56B 1ZGLA 1FV1B 3MV9B 3VW3H 3IVKA 2CLZB 3V2AR 4AEFA 1AXSA 3RZCD 4NZRH 2NZIA 3AREB 1DFBH 3LZFH 4PJAE 2DIAA 2H2PD 1G6RB 2F19L 3AROA 3ECBA 2VXTH 1LO0H 5ITFB 1MCPL 2WIMA 5D6CA 3OKYA 1BLNB 1RHHA 2P5EE 4YR6A 3JV4B 5DJCB 4PLJC 1DEEB 3DV6A 5C92A 3ARDD 2X4NB 3BGAA 2I60L 3TA3A 1BQHB 5GGRY 2XG4A 5JA9A 1BBDH 1JJUA 2GTZB 4PJGE 1REIA 1T4KB 32C2A 3MJ8B 3TLRA 4XNUL 2C26A 4MHHI 4X0KB 3L5WB 5FO7A 4NN6B 5I17A 1IQWL 2MPAH 1JNHA 2D0HA 2GJZA 3TZVB 2UV3A 4BZ1L 1IGML 3GZKA 1KGCE 2AXJA 4J7RA 4R7DA 5C0CB 3RNQA 3VRJB 5JNYA 3U48A 5FV2A 1GCFA 3MRIB 4BK5A 4JFDD 1W72H 4LFHD 1QSVA 2UYLA 5BCAA 2ATPA 4G9FD 5DJ8B 3MGOB 3KR3L 4WFED 3NCFB 4JHWL 1LO4L 3ZKMC 1ORQB 4P3CL 1OAKH 5HHXL 2HFFA 4JPWH 2VABA 2VR4A 1KACB 4S0SD 1B0RA 4QXTA 3QPQD 1Q9KA 5J13C 1BF8A 4JR9L 3UJTH 3RDTA 3MNZB 3QDGB 4PGBA 5T3XL 1YY8B 2LV4A 1QEWB 4KH2A 1ZHNB 3ZE1F 3QO0A 4XPBL 1QRNE 5CHNB 4OKDA 1PGRB 2VQUA 5DJ0B 4HBCL 3FT4B 2MHAB 3D1MC 5GRXG 3GMOA 2HLFD 3DMMC 2DQIH 1JL8A 5A2JH 3MJGX 2VITA 3B8YA 1H15B 4IIQA 4M6OL 3L3OB 3HZYB 2PKDA 4QEGA 4X4XB 1IRAY 4HS6A 1EAPB 5DJZB 1XIWD 4Q2ZA 2QADC 4WW2F 3LIZL 3BH9B 3ZTNH 3K0WA 5IBUB 4XXCC 5I8KH 4AJ0A 4XHJC 5IVXA 1NH6A 1VERA 4O9HH 4M7ZB 3BIKB 4OF8A 3U9PL 3PV6A 3HG1D 2PW2B 5DJAB 4PP1C 3BSZH 1NGXB 3MRKB 1A14L 5B3JF 1CE1H 5FYJL 3V95A 1NAMA 2COQA 5CKAA 5DUMH 3WO4C 1NDMA 5TPWL 3O45B 2VAJA 4D94A 1NCAH 3DETD 3WL9B 1T2QH 5AUMA 5FYLE 2GTWA 1NUGA 4Y19E 2D31A 4LNRB 3CMOL 3L3KB 2NY1C 4YO0A 3RU8H 1X5YA 4F9LC 3ILPA 5T5NF 3C5JB 3CDYA 1RU9H 1R3LB 2YRLA 5T3ZL 4DAGL 4MQXD 1RJZA 5KS9B 3WLWC 2ZG2A 4JVPA 3BZDA 3P4MA 4XPAH 2RR3A 1MJUL 1O0VA 1RJLA 1IEAB 1GRWA 3O4LA 3K4ZA 3RRQA 4PJGF 4YHML 4PJDB 3G04B 1MIML 1S9VA 4YBQD 3OXSB 1VFBB 4IRZL 4NWTH 2E6QA 3QZWB 5F9WC 3QUXC 2FO1A 4PJCA 1IT9L 5DK0A 4Y5YA 4LIQE 3S3SA 1F02I 5FYJU 3QDJB 2FBJL 3DO3A 4NCDA 3D69B 3FO0H 3MOAL 1CFVL 1EPFA 4CU6A 1A3RH 4N1EA 4ONFH 2PNDA 1G7MB 1B0GB 2R0LH 4ZDHB 5LJYH 1PQZA 3KPLA 2G5RA 4FQPA 2FECI 1KN2H 5BMFH 4LPVA 4UV7H 4DTGL 1P4LB 2B4CL 4PUBL 3TC9A 1NC4B 5DZOA 3SOBH 1E28B 5H2BB 3JSSA 1JGDB 1KGCD 1CDCA 2V9TA 4JDZA 1K8DB 4JFOB 1XF4A 4LEOA 4OM0H 1ED3B 4XMPH 1ZGLP 4XP1L 5EZOL 2E8ZA 2AQ1A 3P9MB 3O3DA 5DTFB 3BT2H 4KGLA 3V79C 2E6PA 5IMKA 1Q9LA 4HG4J 1EEZB 4I3RH 3TT1H 3LB6C 1WBXA 3FQTA 2VLKA 1YC8A 1MCNA 3C6LC 5IB5B 4PJFF 4KJWC 4JM2B 3ZT6A 4WU7A 2D7MA 2HT3D 3DVNB 3SE3C 1QRND 3DYMA 4XNQB 5IWLC 2EO9A 4AEHL 4ZG1A 2UWEE 1P9MC 3SPVB 2OZ4H 5HHNB 5HYSB 3O81A 2O5XH 3DSFH 1DLFL 4WTXA 4EUPB 4X98B 4CVZA 3TWCH 5EUOA 4DGYL 3BGFC 2DYPB 3QSKB 4MA8L 3WO3B 5J1SC 1NAML 3WN5B 5DK2B 5D7LA 1D5MA 3GB7A 5EA0L 5FCUL 5E0QA 2YUZA 3PL6B 4FFWD 3ARBB 3PGCA 1J1OL 5T5FH 2OTWB 3ELAT 1ULVA 1DE4A 4GW5A 4A6YB 3ARFC 4IJ3C 2XZQH 1N5YL 2B5IC 2P5WE 3FT3A 2OR9H 5DJ2A 1HHKB 2E7LA 4LQ1A 5CSBA 2X2YA 4HGKC 4JPVH 4OGXH 2WWKO 4LCUB 3GHBL 1NMAL 4L3EB 1I1YB 3RAJH 1VCAA 4LLDB 1ZS8B 4JDTL 5A16A 4R2GD 5JHDE 4HWEH 4DQOH 3H0TA 1VACA 4H5SB 4GQ9L 1DQJB 4M8QA 1H8SA 4PRHB 4OLUL 1DBAH 1U8IA 5FYLD 1NFDB 3X12A 3OHXA 3I75A 1QA9B 4Y19D 4J4PD 2F8OA 5EZIL 2IFFH 3ROOB 5LGHL 3JXAA 2OL3H 2D7QA 5D7KE 1RK1A 1SYSB 3HS0A 2VL5A 5CIPH 1N6QH 4HJGB 4XXDA 4HQQH 4L4TE 1MNUL 1QSEE 3VFOB 3LKRA 3BUTA 4J1UA 1LE9A 3QPQC 5ANMA 2I9LA 3KLHC 3RWGB 4EOWH 1QP1A 4WGWB 1LO2L 1IM9B 2EDXA 4P5TB 2V5SA 4LPXA 3CVHH 4Z7VE 4NPYB 4YHOL 2FX8H 4HWZB 2B20A 4KVCL 1ZMYA 2J4WH 1U6AH 3L7EA 4GRWE 5DUBA 3TF7C 2HLFC 1KSRA 4MD0A 5DURD 3OPZH 5C9JA 5CUSH 4IRSB 1BF2A 1I7TA 1CF8H 4YDIH 3PXHA 5DFTA 2D7PA 1FL3B 5E5UB 2D0FA 3I3BA 4QF1A 5JDSA 1XIWC 3D2UA 4MQ7A 1TVBA 5ID0A 2CPCA 2AS5M 2ZCLL 3D18B 3E6FA 5D72L 4Y1AE 1WCBA 2W0FA 1R6VA 1EGJA 3VGDA 2J6EA 1MFCH 1RJYB 4WFHE 5EPMB 1U8JB 3LQZA 4R3SB 1V3MA 2CXKA 4WW2C 1K6QH 1RZKL 3GSVA 1HXYB 5CILH 2HT4D 5JHLL 3TBYB 4I8DA 2HTKC 3CSBA 1MWAA 5CGMA 2UWEF 3KXFE 5CP3H 3MBEB 4HKXB 4UT7L 2R29H 4J23A 5I73B 4MS8C 4BSVB 4YBLB 4FQIL 3VRIB 5L0QB 1NQBA 3DO7A 1CTNA 2IAMB 3DETC 3RP1A 2QHLA 3GBMH 5I8EB 2WQRA 2KPNA 1IAIM 3SDXA 2Q20A 4TSAL 1CK0H 2HG5A 3C08L 2BNRA 4G5ZH 1WT5A 4M4RA 3DV6B 3WHE0 5DDHA 2IBZX 3MXWH 5F9DC 2YOCA 5DC4B 2AXFA 4JO2L 4KQ3H 3ZKXC 1IGYB 3ZE0E 2DLFH 1IFHH 1OWWA 5C2BH 1SMOA 3HI6H 1S7TA 3OKNB 4LCIH 3QP3A 4JY6B 1D5XA 4O02H 2HRLA 1QHPA 2P8MB 4CADA 5BV7H 4KQ4H 3NPSC 3JTSB 5J11B 3SDAD 3PIQA 3O3BA 3ARXA 1CGXA 4R7DB 4F33B 3RNQB 4M7JH 1SEBB 3RVTD 3T0EA 4GKZA 2P5WD 1EFXD 1IC7L 4N5UA 4FTVE 5CAYB 4Q6IA 2UYLB 5H8DA 2NX5A 5I16B 4KKAD 3EO1A 3ULUE 4HKZA 2W9EH 4HCRH 5IW6B 2RCSL 3A67H 1N6UA 2HFFB 4QCIB 2ICWB 2E9WA 5SX4H 4DUXA 4FQLL 2PTVA 1YNTA 5J7CC 2IMMA 1T04A 3BISA 5JHDD 3L5XH 5FUOH 3O2DH 4MAYC 5IB1A 1Q9KB 2YWYA 1S5IL 2NY2D 5EZLA 4E41E 4Z7WA 1JGUH 1BMGA 5EOCJ 1FNSH 3BKYL 3OB8A 5BQ7A 4P99A 1CU4H 1N59A 5ETUA 1RSFA 4U1LB 5HGBB 1TPXB 4U31A 5EBMB 2GJ6E 1ZT1A 3B2VL 2ID5A 3PP3K 1IJ9A 5D7KD 4YDLC 4ZAKD 4L4TD 1QG3A 2Q8AH 1QSED 2F74B 4GRWF 1J0JA 2FJFA 4MX7B 2Q8BL 1OGTA 3M45A 2YPLA 4LCCB 4HS6B 5F93C 2YPVL 1OAXH 3LKQA 4APQB 1GAFL 1QQDA 5D7IA 3NCEB 5DS8A 5HGAB 4EIGB 2HT3C 4O5LL 4HS8H 4PJ5B 5K59E 4UQ3A 1W0VB 1LWRA 5ISZA 2HFTA 3QIBD 5DRXA 1EGJL 4X5WA 2J6EL 2ZSVB 3PV6B 5I30L 3BHBA 2QQNH 3ARGA 2D0GA 1F90H 3RBGA 3I2CH 4ZS6D 3LVEA 2OBGA 2IPTL 1OAQL 3BW9A 3RHWF 4KU1A 5IBLD 3UXFA 3ZHLA 1MWAL 4U1IA 1NAKL 2JCCE 3VJ6A 2EC9U 1DQLH 2XXMB 4FFWC 3CX5J 3BX7C 3FL7A 1PZ5A 3HMWH 4NO5B 4Y1AD 1DBBH 5TFSH 3RJQB 3IJHA 5AUMB 4P9HC 5EOCH 4K7PX 1YEFL 3BGMB 3QNYA 4KMQA 2GT9A 2P48B 3IDUA 1KIQA 3CK0H 1CGYA 5GGTH 2APFA 3F65A 4ZUSA 3MV8A 3BXNB 5EOQL 1TVHB 3FO2A 4F37F 2FGZA 4QHKJ 2YBRB 4YZFE 2WBJA 4NYLB 4H20L 1KB9J 4R2GC 5EZJB 5E6IC 4NGHH 1RJLB 5SX4I 4M4PA 2NY4D 2KL6A 4NOBA 1EVTC 4QRRE 3GI9H 4U6YB 1SBBA 4EDWL 4P23D 4Y5YB 2PW1B 4H26B 3CZFB 4JE4B 4U6VH 1U95B 5EN2A 3HZKA 2AJXH 3BP6A 4YUEH 2IGFH 1MCLA 3VXME 1GGCL 2X4QB 1EO7A 1A7RL 2BSED 3C2SA 5KZCB 3UJJH 4IOIB 3NGBC 3ARTA 3PP4L 4QOKE 4BM7A 3KHOA 4MJ6B 4Q0XH 5A2KH 1YJDL 2HT2D 4D0CB 1QRKA 1EZVY 4XCFL 1FVCA 3FB7A 5JORB 3ARSA 1XF1A 3DRQA 4Q9CA 3MRMA 4NBZB 4JFPA 3T2NL 1ZAGA 3QIUD 5DA4A 1YEKL 1XF4B 4LEOB 2DRUA 4JFQA 5FAAA 1T1WA 5CJ8A 4MHHG 4X6CB 1GHFL 4FTVD 1PG7H 3W9EA 2G75A 4OSUH 3QUMA 1LEKB 4CDGC 2C1OA 3ULUD 4RGNB 4N5ED 1UEMA 3O3DB 2R39A 3HFML 2K7QA 4WV1B 1M05A 1T80A 4UDTB 2MNUA 5C0AB 1A6TB 4KUCF 5AYUL 5C6WH 3CSYB 1Q72H 1T89C 3IETB 3FQTB 4E41D 2VLJB 1TJHL 3D3VA 3ZDZE 4Z7NE 4PR5A 2WIIA 3UJIH 4ZOAA 5E8NA 1RIHL 4L29B 2E3VA 1DR9A 3BP7B 5JW3H 2I27N 3LQMA 1B4RA 4XBGB 4RISL 2ED9A 4NQCA 2AJ3B 4Y4KD 2GJ6D 5I1GL 3NOIA 3WHXA 1KCSL 3MOQA 4WWKB 5JPNA 1YECH 3TH4T 4QLRA 1EEYA 1MSPA 4HK3N 1F6AA 4DCQB 1SJXA 3NAAH 1V7ML 2EH8L 3I02A 3ZO0A 5D7LB 2VDPL 3GB7B 2R2CA 3QG7H 3Q1SH 3C2AH 3PGCB 1SJVA 4IRJA 2D03H 2VOTA 3GI8H 4P59L 2JCCF 1OGAE 4JHAH 1F5WA 1QKZH 2BXYA 5GRJL 5CFHA 3VFMA 4LCWB 5HY9B 3B4NA 3BRDA 4BQ8A 1XCTA 3T4YB 2GK0B 5DMKB 3VG9C 1BWWA 5D1QD 1OHQA 3T1WA 3TO4A 1CE6A 1MVUB 5C0EB 2H32A 2J8UE 3D85D 4O2FA 4AIOA 4NUGL 1JWSB 1X4YA 2BNQB 4O2CB 4YXKL 1G9ML 4GG6E 4GQPH 3TN0C 4EDXA 2BHYA 1VACB 2NZ9D 4PJIE 4JVWA 4JQXA 4YZFF 3SDAC 1PX3A 4JN1H 2CUHA 4ZPTA 4JRXB 3RVTC 4F7EA 4TPRL 3EOTL 1PAMA 4KKAC 4C56A 2OSLB 1C1EH 3MLXL 3STZA 4HT1L 1RK1B 3BP5A 1NMBL 2XACC 3PWPA 4P5KB 4PBVC 2JELL 5F7WC 3TPUA 5J6GA 4G9DA 3VI4E 5KW9L 3A6CL 2HMID 1HQ4A 4N1CA 1EHLH 2V2WA 2P24A 1IGTA 5T5NG 3LAFA 1WZLA 4EN3C 2I9LB 1YUHB 2NY2C 5LAXA 1X5AA 3MO1B 2HJFA 4QHKI 1A9EA 2UUDK 5CMAB 4YXHH 3QRGH 4QRRD 3IDNA 3HUJE 3Q2CA 4CW1B 4DEPC 1XGTB 3ZLQC 1QSZA 5DLMH 1D6EB 3WKNA 3VXMD 5SWQB 2DBLL 2X4SB 4MD0B 2PYFA 4QOKD 3QUML 1RIVL 1KCVL 1PJ9A 2AEIT 3V5DA 3MSPA 4FFYH 5DSCA 4AL8H 5JO5B 5KSBE 1QSFE 3D2UB 3SKJH 2Z31A 1KG0A 4MQ7B 2BVYA 1PVHA 4JQVA 3I6GA 1OY3B 2MKWA 3FOLB 4Y2DA 2DWDB 1C8PA 1QYGL 5F6IC 1WCBB 2WM0A 4OIBA 2VWEC 3QIBC 3IYLW 5E8DL 3CJJA 5ITBL 2PETA 3BJLA 4Z7NF 5I1JH 3HN3A 4LU5L 1TCMA 3LQZB 1Y18A 3L6FA 4I18A 5HGDA 4P3DA 1TZIA 4DN3L 3GSVB 3MLZH 1OTSD 4CVXA 4HWNA 3THML 4ZS6C 1XAUA 3TYGH 1MOEA 1CI5A 1TIUA 5IBLC 2IFGA 2YD2A 5CGYD 3K4DA 4ENED 2XQBL 5IV2B 1YEDA 2SEBB 4OT1H 4EI5C 1HKLL 3NH7H 5JPMA 4XC1H 3VE0B 3QDME 1JHLH 3QJHA 4DOHB 5BRZE 5KVDH 1WFUA 2GW5A 1TLKA 4EIZC 3BKMH 3RNKA 2FR4A 2BNRB 1NBZA 3MACL 2GUOB 2AJSL 2W65A 4MD5B 5D1XA 5E4EC 1JHKL 4M5ZL 5CCKH 3V4UH 2D4FA 3BEVB 3FQWA 3HE7B 2QQKL 3SQOH 4FRWA 4ORZC 1IVLA 4F9PA 5EBWA 2NTFA 3IXTB 5FM8A 4M62L 4RDQF 3D87B 2OTUA 2VISA 3PQYB 1D5XB 1BZ9A 4MNGE 5BV7C 1R3JB 3UYRL 4CADB 2BZDA 3D0VB 2YRPA 2YK1H 1ADQA 4QRPA 5SV4A 3RVUD 4GG6F 3DURA 4HIXH 3HAEB 3MLWL 1OGAD 3BUYA 4H0HB 5C0DA 4P2QE 5K9OB 4PJIF 4XAWH 5D1ZD 1JTOA 2NY6B 1JFQH 4NKIL 3INUH 5B22A 4U6HA 3P73A 5IR1B 3NZ8B 2CK2A 2R1XA 1BFOB 3F7YB 1GC1H 1OPGH 4G6KL 4WHDA 5CD3B 4Q9QH 5FF6A 2CD0A 3RQ3A 1NGZB 4H1LH 4MJIA 5DD0L 3NA4A 4Z0XB 3UX9B 5L2KE 3QIUC 1IAKA 3HI1B 1F4HA 1RQ5A 1NMCB 3E2HC 3SBWC 4MA3A 1QFPA 4OD1L 3ULUC 3HUJF 1OCWH 4N5EC 3IB4A 2XQYK 4HAFA 4WGVB 4MLIA 3UYOD 4F7MA 3QEGH 1PKQA 1KYOK 4Y8AA 5JZ7C 4GMSL 1LO5B 1EO8L 1A6VL 3V6OA 2NW2B 4HUKB 2ZG1A 1CICD 4ISVA 1QQDB 5I8CA 4ODBD 5KSBF 4OZIA 4HUUB 3X3GL 1MUJA 1WFNA 3V6BR 1P4IL 1KB5A 4X5WB 4PGDA 4HBQA 1N5AB 4RGOL 1LE5A 1X6NA 1VB9A 2R1YB 4JFXB 4K23H 3D0LA 4ZUTB 1QR1B 4JG0H 4QRQA 2H9GA 1QSFD 1WIOA 2HFGH 2Q3ZA 3GFUA 4X80L 5KVEH 1UM4L 4U1IB 2CK0L 4OIIH 3VI3F 1G7LA 4JRYA 3EBAA 3JWDL 5C0IA 3CH8A 4PJEA 1XFPA 4UQ2B 5D5ME 5C0FB 4YFLI 3ESUF 1OWRM 2MCPH 2GT9B 4PRIA 3CZJA 4YDKL 1KIQB 5F96L 3SKMA 5IFAL 3QQ4A 3HCVA 4YFLF 1CZ8L 3F58L 2W0PA 5D1QC 5F7DA 2MCG1 1UWEH 5F3HB 2PXYB 4LF3B 2CR3A 2AI0L 3LY6A 3W0WB 5JTWA 2D9CA 1UCBH 4GRLB 4LHJB 3MYJB 1N6VA 3S34L 3BZ4A 1CXFA 2NZ9C 3M8OL 3QDMD 4D9QE 2DQDH 5BRZD 3KPRA 4NHUB 1P1ZB 4KY1H 2V5YA 4K3JL 1AO7A 5C71A 2ZWLT 43C9B 4R7NA 1Q0YH 5E9DE 5D2NE 1ADQL 5C0BE 4OFYA 4X83A 5D7JB 3BP6B 1KPRB 4DKEH 4NNYA 5C0ND 1T6VN 5F1IA 3RGVD 3LEXB 1ZKAA 4LASH 4XRCB 1WBZA 4KRPC 1SMAA 3DROA 5I1DA 5AZEL 4ORGA 1I3VA 1LVEA 2DQGL 3EFFB 5C8JA 4HEME 1MRDL 4U1MB 1X4ZA 4JFZH 3LS5H 5IM7A 5GQBA 3FB6B 3MRMB 3P30H 3HHRB 1CXHA 5IB3A 1FDLH 2A0LD 3MV9E 5TQ0H 5E03A 1AY1L 4P2QD 3RWIA 1UYWH 4RMTA 2HLAB 2DJSA 3ZYOA 2C1OB 5C6PB 1Z3GH 1M05B 3DVGA 3C6LA 1JPSL 1T1XB 4NKOA 3DHMA 1BEYH 2ITDB 2W60A 3P0YL 1T1ZB 4RX4D 4JHBA 3TPKA 1RPQA 3B2UD 1G7HB 4XMKH 3ARZA 1FSKC 3D3VB 3SKOB 3WXWL 2CSPA 5L2KD 5IQ9B 1BX2A 1FL5A 1KCUH 3UEZA 3FO1A 4Q9BA 1P9MA 1WJ3A 2NY5H 3RWDA 1KBGL 2F15A 2X4RA 5HD8D 3U0PA 2F9BT 3U4AA 4TVPE 3CFJA 3VGFA 1KB5L 4N8VG 1G6RH 3MRNB 3ZMRA 1HWGB 1A4JB 3VWKC 1FVDA 3H9HA 3HMXH 2AEPL 4ENEC 5DVLA 4LLUA 2QHRL 3D9AH 2R15A 1KPUA 4PRBA 3U83A 1TZGH 4LQFH 1LMKA 1CWVA 4IDJH 1ZWIA 2Y5TB 1MI5A 1T5WB 5KOMC 3BN9C 5C86A 3ULVH 2GQHA 1FNFA 3GSNB 5JMRA 5FDYA 4DKAA 5KSAA 4KHTH 1RURH 3DIFB 4HGWA 3EYQC 4DVBA 4PGCB 1CE6B 5ICZA 1KXQE 4WUUA 2B1HL 1ZVSB 3FQUA 4EDXB 1FLTX 3ZZ1A 3VXSA 2FX9H 2FJHB 3FFCB 5GGRB 3RVUC 5EIVA 5C09D 4C83A 2F5BL 3C8KB 2R0KL 2EICA 4P4KD 4JFFE 5D1ZC 4F7EB 1WWAX 3BPCB 2YC1A 4N0FB 4C56B 2JKXA 2FLBT 5MENE 3EZ8A 4U1GC 2B1AL 2DJUA 2HA1A 2IPUK 4OLVL 4G7VL 5J6GB 3MRFB 4P2OD 1NCCL 4PJHE 3OKEB 1NCBH 1QLEL 4Q9RH 4HWUA 2P24B 2O5YH 5GGSA 4PREB 4NQEA 1MQKL 4P2RB 2YWZA 1BGXL 1GIGL 5FGCB 4BQ6A 2EKSB 4Z18A 1AGCB 2VAAA 3TJEH 1YYLH 3B9AA 5GGVH 3QI9A 43CAA 2BMKB 5E9DD 5C0BD 2IG2H 2PTUA 4WW1A 1HNGA 1RIUL 1INEL 2NY0B 1F4YL 1VEPA 4Y4HD 1OAUL 5F6HJ 2BERA 4RWHA 4PLOB 3REVA 4UIMB 3V5DB 1I8MB 2B2XL 1IZKA 2EE9A 2V7NB 1HIMH 3EYUL 2R2EA 5B8CA 3VGAB 3DVIA 1BAFH 3L7FB 3OWEA 4XX1E 1OAZH 4AENB 5C0RH 4OLZH 4HF5L 1ZHLA 3MV9D 2GI7A 5EORL 2BC4B 5CJBA 2CKBB 5FB8B 1LNUA 4LSPH 4WW2A 1QNZH 3GMLA 2DI8A 3MJ9A 2HKHH 3EDKA 4OF5A 1Y18B 4I18B 5MHSD 1N3NA 3ARED 4P3DB 4PJDE 1UWXH 4GFTB 3I3DA 1KJMA 2HH0H 4CVXB 3O3AB 5JW5B 3PP3H 1RZ8A 3ULVF 1A6AA 1G7IA 4LSQL 1FBIL 5AWNL 1AHWB 4HK0B 5EBGA 3QDJE 4HDIB 3HI5H 2A6IA 4AQOA 4XP6L 3QJHB 2Q6WA 2DOCA 4CN1A 4WO4D 2YPKA 4JGUA 4HXBH 3UTZA 1MHHA 4GXUM 3LD8B 1IILE 1MAMH 5DRWA 5BVPH 3RNKB 1MFNA 1UEYA 3BPOC 2FR4B 4J6RH 4IDLA 4HUVA 3C5SB 4TVPD 2W65B 2IALA 4JZOA 5I19L 4X7TA 5IESH 3O9WB 1NGPL 4QTIL 1M6OB 3NIFF 4W68A 1A7QL 2FDBP 1HZHH 3MLRH 5EBWB 4MWFA 2H3NA 2BY2A 1I9JL 2LVEA 3OR7A 4NQVA 4ETQA 5LWYL 3QQNA 3BESR 5I1IH 2VISB 2N7BA 3L3DA 4IOFC 3Q5TA 1U8LA 3MCLH 1RMFL 1UXSA 4G7YL 4WEBH 2M8XA 3KAAA 1DEDA 2BP3A 4JANA 4H0GA 4PYGA 2G60H 3M1BB 3NFSL 1VGKB 1W72A 3X3FH 3SDCB 2V7HA 3BUYB 4X6BA 1M7IA 2BSRB 3VXPB 2FIKA 3BPNC 4Y5XA 3OF6D 4ZXBD 1EAJA 3RGVC 1YMMA 5C0NC 3P73B 3DXAA 3FFDA 4MAYA 1JPGB 1K4DA 3QHZH 1HH6A 3K8MA 1T22B 4UTAH 3HPLA 1QR4A 5FF6B 5DF0A 4MJIB 2B0SH 3D25B 1KNOB 4OAWA 1FRGH 4UTBL 1GPOL 3QUKA 5TDNA 3DECA 3FONA 2VZUA 3E3QE 4PPTA 4KMTH 4RRPG 1HQRB 4JFFD 1INQB 3VFVB 1GVIA 3MROB 4XCNA 2QEJA 5DR5L 2OXHA 4RA0C 2GAZA 3WXVL 1QFHA 2YUVA 1TITA 5CJQL 5MEND 4ELMB 3MV7A 1KC5L 4OCYL 4S1SH 1UA6H 5INDB 2CIKA 4ZD3H 4LLYA 3MA9L 3U4EA 4F7MB 2AEQL 3U82B 4HX1A 1PKQB 5K9KA 1BOGB 3BD5A 3QAZB 4QRUA 4OKVB 1OP9A 3H42L 3OL2A 3RUGA 1C5BH 1O7VA 1CR9H 1P4BL 4F57L 1NFIA 5TJWK 3GMPA 3HRPA 2ATKA 4UBDD 5I8CB 4LRNL 4YIQB 4EUPH 1I1AC 4EVNA 3MCG1 4TUKL 3QUZD 2CRYA 4XNMA 4RFNC 4V1DE 1MUJB 4C4KO 4R0LC 5C08B 3WD5L 4FQCL 1VENA 4PJFA 1CLYH 3MJ9L 2HVJA 4LVOB 1Z0NA 3CLFH 4L4JA 1ZOXA 4YDVA 3SKNB 5KS9F 3VW3L 2WBWB 3SCMA 4YLQT 1OSZA 4I2XE 1KIUA 4A6YH 4NZRL 4PJDF 1DFBL 3LZFL 1AKJD 3QXDA 5J6HA 1XMWA 4I48A 5TE4L 2HWZH 3DV4B 4D2NA 3KG5A 1LO0L 2VXTL 2X4OB 2JE8A 1UG9A 1NDGB 4WI2A 2DWEB 4YDJA 4ODWA 1FYTE 3QXAA 2IF7A 1A64A 2R4RH 4PRIB 5GJTL 5JIKA 1MRFH 1Q9WA 1NEZG 1K9TA 4MNHA 5HHMB 4UOW1 1BBDL 1CFQA 1DVFB 5T3XE 3EW3B 2EDOA 3S3JA 4LVHC 5E6IA 4OZHA 3N1GC 1HINH 4QRSA 1D5ZA 2XWJA 2ZCKH 2ARJA 3QDJD 1FFPB 2MPAL 1JGEA 5LXGH 3GMNB 5CS7A 4UNVA 1AO7B 4O4YL 4AK1A 1TFHA 3LSOB 5B38G 4JR9H 3WJLA 1W72L 1F3JA 2MTPA 1FFRA 3FAXA 2Z92A 4JPKL 4P5MA 3IJSA 5A40E 1OAKL 4XPBH 3WEXB 4P2OC 4JPWL 1WBZB 4ONHA 4U0RB 2YEZB 3N1PC 4Z8FH 3UJTL 2IH3A 3CFDB 4Y4FD 1I85A 5ESAA 1FG2B 1DTUA 3HRZB 2A6KB 5FYJE 4RDQG 1C12A 4HIJB 5D2NC 3CLEH 4PGEA 3RWIB 3RTQA 3AB0C 4I0PD 1KLGB 5F1NA 2DQIL 2FECL 5C0JB 1E4JA 1WZKA 4PYHA 1GZPB 25C8H 5I9QB 1UCTA 4ETYA 1KENH 1NCWH 1IC4H 2BHZA 4K3DH 2FL5B 5EBLA 1KPVB 3VXUA 3ZTNL 4Y16A 4Q74A 5I8KL 4P0DA 3V52H 1BZ7A 5T3ZE 1QFOA 4Y2OA 1BX2B 2ICWJ 3Q3GA 4O9HL 4BZ2H 1WC7A 1LK2B 3EFDH 2OZ4A 3VFRA 3H3PH 3HC0B 1A4KA 3QUYD 3RWDB 4JY4A 4YEFA 2VXVH 3LV3B 3BSZL 4Y5VA 1Z2KA 3AREC 4TUOB 4MNQA 2X70A 3CFJB 2EXWD 1KUMA 4PJ8D 1GOHA 1CE1L 1AP2B 3GKWL 3CMOH 4JKWA 2BSSA 4RMQA 5INCA 5DUML 2AVGA 4L9LC 1OQOA 3QULB 2W59A 5EWIH 1KPUB 2VB5A 3SJVB 4PRBB 4CUCA 5BVJA 4XB7A 1NCAL 3KLAB 5F9OH 3VXRA 2VDRH 1T2QL 4WO4C 3PNWB 3JWOH 1NFDF 3L3HB 3G6JB 1JN6A 3WIFA 3KNBA 4UDUA 4V1DD 4I5BB 3ULVC 1AXTH 5GGQH 4LPCA 3EOBA 1U8NA 2NY3B 5F7FA 4KV5E 4NN6C 2BX5A 1RU9L 4KDVA 1WIUA 4DVBB 2ZUSA 2JIXB 3ZSSA 4G8IB 4XPAL 5DZNA 5HJ3A 3TN0A 5J89A 1T6WA 4EZMA 1YEEH 1HXMB 5L8LB 3MREA 4FQJH 5I1LA 4KKCD 4M00A 3P4NB 1PLGH 2L4OA 2HRPH 4NWTL 1R24B 2EEBA 4Y0GA 1F2QA 1FNHA 2NY7H 3K8LA 4U0QB 4UB0H 4L8CB 4C83B 2OL3A 3KPSA 1FYTD 5IKCA 5DMGD 3KS0H 5CIPA 5E7FA 5IROA 2NLJB 3QB7C 5JOFA 4ZFOB 4LKXA 3U0WH 4EQ3A 3O6ML 1A3RL 5T3XD 3TVMB 1J0IA 4ONFL 5ENWB 1IM9D 2R0LL 3Q6FB 4IMLA 5B4MD 4EN3A 2BJMH 1HILB 1KN2L 4OZFG 5IVXE 5EZOH 3AS2A 5BMFL 2ZUTA 3CVHA 2GCYB 5I1AB 3SOBL 4B7IA 1KTRL 3D5OF 5BJTA 3QISA 2HN7A 1FGVH 4IRSD 4XMPL 3VRLF 2XTJB 4LRIC 3TJHD 3DUUB 3MJ7B 1Z0MA 3QI9B 1ZA6A 3IAGC 2VE6A 4UT6H 3EGSA 2BNUB 2QSVA 4OCXH 2XN9A 3BQUD 4JB9H 4QRTA 4F7TA 4XNYH 1KEGH 4N8VA 3G6DH 2GFBA 1OP5K 3REVB 2EDFA 4I3RL 3TT1L 4M7ZC 1BBJA 1D3CA 5JQ6H 2Y6SC 2R2EB 2DKMA 4GBXA 1QTYT 4UBDC 3C09C 3Q5YA 4FQHA 4X6FB 1C7SA 5T1KD 5ESQB 4PTUB 3OGCB 5FYJD 1IM3A 3UTSA 1BIIA 1II4E 3QNXA 1YMHB 2ZOLA 5J3HC 3TBSA 4F2MB 1LNUB 3NCYS 5IMLA 3BZFA 3EDJA 3GMLB 2OZ4L 3NN8B 2VXQH 3OKOA 5DJDA 4NZJA 2O5XL 1ES0B 1TQCC 3DSFL 3O4LE 2ITCA 5CP3A 5KSVA 1N3NB 3TWCL 1KJMB 1GSMA 4XVUD 4EI5A 3MNVA 2DM7A 3O4OB 1N5YH 1FZOB 1G7IB 1FFOA 4PJCE 3VFSA 2DKSA 1JPFA 1QFWH 5K9JL 3RVXD 4G6FD 1O7SA 5T3ZD 2MQ3A 2FH6A 3TA3D 5LQBH 5T5FL 1QO3A 4U1HB 3UTZB 5I1CH 4FZEH 1VFAA 1J7VR 2F8VA 2VJXA 5K9QI 2XZQL 5DRWB 2JB5L 1FGNH 3CFCH 1HSAA 2OR9L 3S5LA 4OJFH 3H3BC 2ICWI 8CGTA 2BRQA 2YD5A 1SHMA 4NCC2 1YZZA 3L1OH 3FCTA 4JPVL 1UXWA 3HKFA 4B41A 1EXUA 3RAJL 5E00B 1A9BB 3OJDB 4KV5F 3V8CA 2H3NB 3UPRA 4BSJA 3W11C 2VKXA 3T08A 4DQOL 4KPHH 3W81A 4F15B 1EX0A 2HFEA 3L3DB 1JV5B 3O6KH 5HPOA 3MA7A 1DBAL 5LCVH 5EU5B 4RGNE 3S4SB 4LBEA 1VFOA 4W4OA 2IFFL 1YN6A 4OCLC 2OL3L 5GJSH 2ZPKH 4HCRA 1N6QL 2VLKE 4HQQL 2WNGA 4I1NB 1UVQA 3HC3H 3RDTD 1Q9OA 3DXAB 3HZMA 3U6RA 1HOCB 3FFDB 5I76B 1F11B 3O2DA 1TZHA 1Z6JT 5J57B 3ARUA 1GJIA 3QEHB 3AY4C 1K4DB 1XGQB 1M7DA 3VH8B 3KHQA 1MCOH 3OKDB 2L7UA 1CGTA 3W9DB 2DMKA 3H9SB 3CVHL 4AT6A 2FX8L 4JO1H 3QDHA 4HS3B 2PTTA 2J4WL 5FIEA 1U6AL 5C3LD 5EUOE 3LPFA 4I0PC 4KGJA 4XCNB 4XP5H 5L2JB 2G5BB 2CR6A 3JTTB 3OPZL 2H6PA 4HKBB 1FH5H 1P6FA 3UO1H 5D7LE 2LTQC 2OM5A 3KYMB 4YDIL 1P2CA 5D96B 5TGBB 3IFOA 2ADFH 4QHUA 4GKOA 1AGDB 1HEZA 3FJTA 3MUZ1 4RMUA 3RUGB 3IKCA 2P8LB 3GMPB 3QJFB 4KROB 1QFWI 3QBTB 4UT7H 5AD0A 3HE6B 4EVNB 3OAUH 4D8PA 3FN3A 4MMZC 3QUYC 5DMJB 1HN1A 3DGGA 5BS0A 4BSWA 1LP9B 1S3KH 5JOEA 4WI5A 2VQTA 2C1PA 3WN5C 1K6QL 4PJ8C 5FHAH 3PE9A 2AV7B 5CILL 5EC2A 3G5VA 1FE8H 3ROLA 2E7MA 3PL6C 4MA1C 3C08H 4ODUA 3ARBC 5J1AB 1J8HA 3SCMB 5J1TC 2R29L 1S7VB 4NO2B 2QQQA 2ZP0T 4FOMA 4KTEH 1HSBB 1UH4A 5J6HB 3BEWA 2VH5L 1MLBB 3ALXA 4XWOD 3KPPB 3NPZB 5GGTA 5CWSA 7CGTA 4G5ZL 4YDJB 3WS6A 4PD4K 3GSRB 1WIPA 5TH2A 2UY7A 3PABA 5DQ9A 3MXWL 5ANME 3O4LD 2IMNA 1CFQB 4KQ3L 5F7YC 4ZUVB 1UACH 1JGLH 3R1GH 1MH5A 4OZHB 4MQTB 2DLFL 4S2SA 1IFHL 3TT3H 1CBVH 5C2BL 4D9RE 1IEBB 3HI6L 1BWMA 2Z4QA 4OLYH 4LHUB 4LCIL 2ARJB 4KKCC 5IVOA 2D4DA 4KQ4L 1ZT7A 1T66D 4Y7MA 1BD2A 2I26N 4M7JL 3BO8A 5DMGC 4RRPA 2LU3A 4X6CF 5F89B 2UVFA 4WI3A 3RY4A 3BRFA 2YD6A 1ZLUK 4K9EH 2ARWA 2W9EL 4NP4H 4PJXB 3QO1A 4HCRL 3A67L 3D39A 3AXLA 1PX4A 3HNVH 4ONHB 4UIKH 3L5XL 5FUOL 3O2DL 4U6TA 3CFEB 1JGUL 2IH3B 1FNSL 3DLQR 1FO0B 1RVFH 4IRSC 4G6MH 3CFIC 4U7MA 1CU4L 3TJHC 1RZJH 3RY6C 3UTPE 2BSTB 4UT9H 4JAMB 1D7FA 1P84K 1H3XA 1P5UA 5EFIB 1PYWA 4PGEB 3RTQB 3BQUC 5GS0H 4WHYH 3O3EA 1AGBA 3HZVA 4K71C 2VLKD 5F1NB 4M1DH 5AYQA 2Q8AL 5LGKA 5E2JA 3FB5B 2P8PA 2WAHA 3HPJB 5DJ6B 3AC0A 2VQ1A 3F8UB 4TSCH 1U93B 2LAGB 3SDXE 3MGTA 5I30H 3IDJB 1OAXL 2IH1B 4X9HA 2BNRE 4H0IA 1JUFA 1BZ7B 4HS8L 2IPTH 4BZYA 1WC7B 3VGHA 5IBUG 3MBEC 2VYRE 4B5EA 2EEDA 1A4KB 1CXKA 3NCJH 3WDIA 4YBLC 4Y5VB 3T4AA 2QQNL 5L0QC 2X9XA 4RWYH 1F90L 3I9GH 5IVNA 2V9RA 5D7LD 4XVUC 3I2CL 1M71B 2DLTA 5F8QC 2AXGA 3PGFH 2EDWA 1JIBA 1U8PA 4HLZG 1KTKE 3T0EE 5AAWA 1JF5A 1DQLL 2N1KA 1YDPA 3HMWL 3VXRB 1DBBL 3JWOC 2NX5E 5TFSL 4TN9A 3EYOA 5EOCL 3MLTA 4DK6A 4G8GA 3WIFB 2WP3O 2Z35B 4UDUB 3CK0L 2V2XB 4RQQA 2P47B 1G7PA 1ZSDB 1EFQA 4P46A 5GGTL 2R9HC 2FCBA 3X14B 5B38A 4WEUD 4O2EA 3KJ4B 3WFCH 5DD3L 2RQ8A 1F6LL 1FC2D 4Z7WE 2QKIB 4XX1G 5J11C 4LAQH 1DUYA 5DD1H 3B9KB 3HAEH 5KTEH 4NGHL 2DD8H 2Q7YA 5DC0A 1WWBX 4ONOA 2Y9RT 4U1NA 2I07B 2OJEA 3LRHA 2P1YA 5TDPB 3I6KA 1HYSD 3GI9L 1F45A 2IANA 4WWID 1J18A 3MRQA 1I4FB 1IE5A 3UBXB 3DTXA 3OX8A 4RZCA 2OL3B 4U6VL 5FK9A 1QBMH 1QLFA 3GNMH 3O2VH 3DRTB 4RNRB 1A1OB 4YUEL 1N2RB 3MMEB 2IGFL 2RHEA 1NL0H 2YPLE 5FECA 4GXUN 1T7ZA 5IIEA 3RDTC 4Y88A 5D7IE 3KGRA 4G80B 4Q0XL 4N0UA 3V7AE 2FATH 4D9RD 5ISZE 1CCZA 1N7MH 2CMRH 2DMCA 4KDWA 2CO6B 1SVZA 1U0QA 6FABH 1S9WA 4IIQC 1P53A 4AIZA 1ZA6B 2V2TA 1PG7L 3MV11 4OSUL 1BREA 4YGVB 3D2UD 2QR0B 3IFNH 1DN0A 1NBYA 1RIHH 3IJYB 1JZ5A 2CRZA 3VFTB 2VXUH 3SDDA 3T77A 3V0VB 2Z9TA 3GGWA 4WHCA 2NXZD 2X6MA 4RISH 5T1MB 1JHTA 1D5BA 1Q72L 1WCQA 4PRNA 3IDGA 1BECA 2ZUWA 2DIBA 2YN3A 4GBXB 4YPGA 3UJIL 4FQHB 2ESVB 4WFGE 5B39A 1S9KC 3VXQA 4NRYA 2FYYA 3DBXA 3MV8E 4G43A 1IM3B 2F53B 3ZYZA 3UTPD 3AM8A 4RAUA 5FUZH 3SKUD 5JW3L 3GSQB 4GKNA 1MFEH 5FGSA 4NRZA 5H35A 4WI8A 5E8PA 4G6JL 1DANU 1YECL 1HHGA 3FT2B 1P5VA 1H5BA 4V2CB 4PJ7B 5DUPH 5HYSG 1NC2B 3PWLA 3BP4B 4EUPG 1NUFA 3NAAL 4QTHA 3F62A 3G5YA 2BNRD 1I9IH 1BM3H 1F3DH 3CU1A 3QG7L 3Q1SL 3GRWH 2D03L 3GI8L 4OZ4A 4JREB 5IP4A 3KPMB 1TMCB 4XVJH 4Z77A 1UM6H 4DKFL 3OXRA 2M1KA 2WUBH 4GG8A 5EO0A 3CSPA 3QIWA 1C5CH 2CLRB 3ZDXE 5A3ID 3X11B 35C8L 3EOTH 1KTDB 4NN7B 4Y5YC 1A2YA 2Q3AA 2X89A 3QDAA 3QH3A 3FQRB 4RFEB 5GSRA 4Z7WF 3E0GA 1CD1A 3T0ED 5FOJA 1XGUA 1KJ2H 5C7XH 2JELH 4L8DB 4JN1L 3EYSH 3MA7B 2NX5D 4UU9B 3VU2A 3DPBA 2XY2A 3OZ9L 1S7UB 3FHAA 3KYAA 4QHLB 5CEYB 4LP5A 5C07B 5MP6H 4PJBA 1YN6B 2OS7A 4U2ZA 1C1EL 4KAQH 1CGSH 4YNYB 1CD9B 4U6XB 3SHSA 4FFVD 3TBTA 3GUTA 3D3VE 4PG9B 3U6RB 1IBGH 4GUPB 1EHLL 4H1LA 1FNEA 3V6FB 4OD2B 5FA3A 2Y7QA 3B9EA 4JQIH 4KK5D 3RKDD 4NZDA 1UQSA 1G84A 4NQCE 1T21A 4RGNC </