1NMAL

N9 neuraminidase complexes with antibodies nc41 and nc10: empirical free-energy calculations capture specificity trends observed with mutant binding data
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
b'DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQNPDGTVKLLIYYTSNLHSEVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQDFTLPFTFGGGTKLEIRRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N9 NEURAMINIDASE
publication title N9 neuraminidase complexes with antibodies NC41 and NC10: empirical free energy calculations capture specificity trends observed with mutant binding data.
pubmed doi rcsb
molecule tags Complex (hydrolase/immunoglobulin)
total genus 23
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 1994-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nmaL00
4M6NL 4U1LA 1ZANL 4IBLT 4JN2A 5CILH 3U79A 4R4BA 1MJUL 3BWUC 1S9XA 3ULVL 3C60C 3IFLH 3P11L 1K4DB 4OLXL 1HHJB 5IW3A 3KPQB 5C07A 2Q20A 4GQPH 1MCOH 4OLWH 3BRGC 1JTOA 5GIRB 4G8EB 3Q6GL 4QRTB 1G7IA 1RSFA 3C6LA 5LAXA 5IBUB 4JM2D 3W11C 5BOPA 4NM8H 4WV1B 5B3JF 4PJAB 2P5EA 2DLFL 4QRQA 5FF6A 3MRRB 1U8OA 2VDLH 3OL2A 2P8MA 1WBYA 4MLIA 4LF3B 1KF9B 1OTUD 4HKZA 4PJ8A 5FUCE 2BVPB 2IAMD 1NAMH 4PBWD 2QTEA 3MRHB 3T2NL 2J6EA 5KZCB 4MLSA 1Y18A 4PRHA 4XH2A 3WYRA 3ARFC 1T7WA 4RGMC 1BVKB 5DI8A 1UFUA 4Q6IC 5T1LA 1ERNA 4CAGA 2ID5A 4OM0H 3PWJB 5C0GB 5T3ZE 5A16B 4XX1E 4Q9RH 2J4WH 1J1PH 3SKJH 3C60B 1N6VA 3LQZB 4RNRA 3QIBA 1F4XL 4JM4H 4HZLB 5DMYA 1NBZB 1IJ9A 5D2NC 1DDHB 1FCGA 2FBOJ 4W6XB 4HUXA 4KGLA 1OQOA 3MUGA 3KPMA 4X4XA 2DQHL 1TZHA 2OTWA 1YQVH 5AWNH 4AH2A 3V0WH 3T3ME 1K2DB 4LLQB 1ZOXA 1MVFA 5GGUB 2Y5TA 3CDFA 4DUXA 1ZANH 3REWB 4NQUA 4F9LA 2FJHB 4KKBD 5F3HA 5IBTL 3ULVH 2YD9A 5DVLA 1WAAA 2YD1A 3CIQA 2VMFA 3T4AB 3P11H 3QH3A 2MMXA 2FEDD 1XCTB 3JVGC 3WDJA 2F54D 1A02N 4IM8A 5LGHL 5EU3B 1KXVC 3TJHD 3JTTB 2V9QA 3KPRB 4P9ML 4LNVA 4QY8B 2H45A 3ARFB 5T33L 4RGMB 3WFCL 1WFNA 4Q6IB 3SDCA 3O2VL 2EXWC 3MRKA 4LCUB 3UPAA 1GGBL 5DMGC 2QHLA 4NKDB 4POZC 3BZEB 1V7ML 1MLCB 3ET9F 5DUBA 4MZ3A 3LSOA 3RL2B 4F33A 3E1F1 1KNOA 4G8GE 1QSED 3HN3A 4X7EC 1NCNA 5IGXL 4XXCC 5INDB 5TQ0L 3T77A 1AD0B 4NBYB 3T2NH 3WLWD 5IW6B 3CCHA 5D2NB 1XGPB 1CGVA 3GB7B 4OZFH 3B9KC 4PLKC 1S7SA 4OZIB 3MUZ1 2BSED 3L3HA 3H0TA 3OAZK 3KR3H 5DLML 2NW3B 3HC4L 4KZDL 1DBJL 4LSPL 3S3PA 5DURB 2XG5A 5F9OH 3T0EE 3VXMD 1S7UA 5I1AB 5JPNA 2EEDA 1QG3A 3TCLB 4LPYA 3A67H 5ADOL 3MNWB 1OHQA 2DQHH 4I3RL 1RUQL 3WJLA 2X89D 3RGVD 1N7ML 2F19L 3TP4A 4XP9L 5MHSD 3WHXA 1T1WA 3GSRB 1P2CA 4HKXB 2ED7A 4BH7A 1R3KA 4CU6A 4ZUTB 2ZCLL 2C4XA 1KEGL 2D03L 4MNGA 5BZWB 3I6LD 4G80B 1GRWA 3AU1A 1UXSB 3MFFA 4HV8A 5LGHH 3RTQC 1KENH 2D0GA 1LP9E 4P9MH 4UMGA 5T33H 2A9NL 5CEXA 3T4YA 3B9KB 3WFCH 3O2VH 2CLRA 2IBBA 1FGNH 3MV7D 1GGBH 2L0DA 1XEDA 4NO3A 2BVOA 3MBEC 1P7HL 1KG0B 1D9KA 3GJEA 1I8MA 1UB5B 1V7MH 4XBEH 3UPRB 2R1XA 3IXAB 4JGJA 5CZXC 4OKVB 3U9PL 5C0CD 3STBA 2XQYK 4C4KO 4JFDA 5TQ0H 5LGJA 5EULV 5DVKA 4M5ZH 3IS0X 5F96L 2D9QB 1NC4B 3KPOB 5HSFA 3TBWB 1AO7A 5CZVL 1IM3B 4TTGA 5IW1A 5F88A 5EUOB 1NCWH 4KKLC 4OFYD 4K3EH 4GH7B 4IDJL 4S10A 5DLMH 2HT2D 3LEXB 3MLUH 4JCLA 4KZDH 3PL6D 4OI9A 3MXVL 2GAZA 3BO8A 3ZDYE 1DBJH 4LSPH 1P6FA 4P2YA 2UY7A 4JFOB 4J7RA 3WKML 4APQA 4IOSD 4LPUA 3TBVB 4PD4J 2DJUA 3RTQB 4EI5C 3ULUF 1CICA 4LLMB 5ADOH 2B1AL 4I3RH 1RUQH 3QQ9C 4XTRD 3U83A 1GYAA 4EIGB 3WKNA 4PJEA 4PY7A 4TUKL 4XP9H 4HQQL 2VDPL 2PYEA 3FB6B 2VE6A 1A3LL 5LVEA 3MO1B 4MYWB 1MF2L 1MSPA 2P4AB 1JFQL 4Z9KB 2OXGA 2CLVB 2D03H 1BZ9A 3MRQB 2HLFD 4GBXC 5GJTL 1T89C 4MA3B 4Q9CA 2IQ9H 2WZPD 2C3GA 1T6WA 4KROC 5C0FA 3M07A 1F2XK 1OCWL 4OZHB 2A9NH 4QOKA 3TZVC 2E7LA 1JP5A 4XBPB 2JJUA 3RWGA 4AEHL 1FZMB 3B83A 1HCFX 4F8QA 1I3UA 4G7YL 5LWYH 3QUML 1Z5LB 1YJDL 3CPLB 1E6OL 5K9QG 5HY9A 5FYLL 3WHE0 3LKNA 4UINL 4ZG1A 1LVEA 1ZAGA 4F7PB 1QRNE 2C7UB 3IF1A 3RL1B 4KK6C 5D6CB 3FT4B 1AKJA 5DK2B 3ZE1F 1JI2A 5F96H 1EIBA 2AQ1A 1SYSA 2R69L 5CZVH 5I1EL 4Z95H 3DVFA 1LDSA 1A47A 4LPXA 4I2XA 2YZ8A 3T8XB 5C9JA 3I84A 4L1DA 3CFEB 1FL3A 1XH3B 4JFEB 3SGJC 5T1DL 3DUSA 4C4KT 4PJDE 2HG5A 3CSYA 5HI5C 3MXVH 4WEMB 4E41D 3VFTA 1QACA 4NQEB 1BQLL 1MI5D 3WKMH 3HZVB 5HYJE 5AD0B 4GBXB 2ICWB 3I6GA 1SVZA 4Z7UE 1CFNB 4KROB 3H9YA 3RDTA 1E28A 3QUXC 2B1AH 1VPOL 3TZVB 2X70B 1MRFL 4FTVA 4TUKH 5EU6A 5HHXL 1QLEL 4HQQH 1Q94A 3VFPA 2VDPH 5DFTA 1JF1A 5HVGB 3KYMA 2Q3ZA 4D8PB 1A3LH 1QOKA 2ZG3A 2EC9U 1MF2H 4LHQB 5GGSA 3GBNL 1JNLL 4OLYL 1G6VK 1H9VA 2PW1A 3BKYL 1Z9SA 5GJTH 3ARPA 4M9PA 3C9NA 1WK0A 5E8NA 3TBYA 3QISA 1KLUB 1RJYB 4K23H 3VXSB 3EFFB 3QQ3B 1TCRB 3ILPA 4AEHH 5DJAA 2OSLA 4LAQL 4D0CB 3DHJA 4JPIA 5IHZA 3RVUD 2CUHA 3QUMH 5SWZA 1YJDH 1RUAL 3DYMA 4F37F 1G9ML 5FYLH 5D71H 3DROA 1REIA 4NQSB 5C0BA 1TNNA 2DMCA 3KAAA 2OTUA 2YUWA 4OLVL 1ZHNB 4KAQL 5KS9F 3WXWH 1OF2A 2X4SB 3VRIB 3QFJE 1N0LA 2X9YA 3MJ8A 1G7JA 1KYOK 4P5KA 3CLFL 2HRPH 5I1EH 2EECA 1RHHB 1VGKA 3N9GL 5JPMB 2GY5A 4LSTL 4IRZL 3CFIC 4PTUA 4Q2ZB 3QIWA 5DD0H 5T1DH 5IIEB 4W6WB 5C08B 1HHHB 2V9RA 4GXVL 1MAKA 4H8WL 1AE6L 4JPWL 4Q9QL 1BQLH 3KPNB 5ANMA 3F7VA 4URTB 1IFHL 1ZT4A 3KHOA 1WITA 4JFPB 2XT1B 4JKPH 4J3UA 3VXOB 4JHWL 4BELD 1T20B 3BPLC 3DYPA 3MSPA 1MFBL 1JIBA 1LEGB 4GAFB 3P0YL 3FRPA 2DN7A 1VPOH 5F7DB 2CD0A 2NY2C 4HW6A 1MPAL 2DIAA 4P2RA 3DRTB 3QJHA 1QLEH 1NC2A 3N06B 1A6AA 4ALAL 4LARL 2GFBA 4ZOEA 2X9XA 1RAMA 1TPXC 2XNAB 4P4RA 5FV1L 4R7NA 3JTSA 4M00A 5KSVB 3OR6B 1XGUA 1MY7A 3GBNH 4U3HA 1JNLH 1NFIA 3HB3D 3BKYH 3G5VA 5FK9A 1FLTX 2R2EA 2X4RA 2EZ0D 3UROR 4X6EB 2DYPA 2X5PA 3IJHB 3S3JA 5KBNC 4K7FA 4CJ0A 5IP4A 4GUPA 1FZJB 3NGBC 4QT5B 4TVPL 1G9EA 4LAQH 3MUJA 5EUKB 4G6AD 2PXYA 4HG4K 2VISB 5JMRA 1RUAH 1G9MH 5AYUH 1XGTB 3GMQB 4ELMB 3T0DA 1W72A 1TMCB 1MFAL 5E5MB 1QNZL 2N7BA 4KAQH 1FNSL 3ZT5A 4XB7A 2P8LB 2BJML 3AREA 5J6HB 2FR4B 1AD9A 1UC6A 1ZK9A 3UTTD 3BPLB 1R6VA 3CLFH 4FG6C 1HINL 5DDHB 2VLLB 2NY2B 1T22A 3FHQA 3N9GH 2WAHA 3BN9D 4LSTH 3WS6A 2W92A 3OF6D 4M7KL 5DK0B 3OGOE 3WIFB 5C8JA 2EYRB 2V2TB 1R3LB 1P7QD 3H3PL 1TPXB 2J5LC 1OGAB 4H8WH 1AE6H 5E8PB 3ALWA 4F9PC 4OAWB 3FQUA 3PHOA 4G43B 1VKXB 2BVYA 1NH6A 3OB0H 5I0ZA 4JHWH 3T0WA 5DJ6B 5IV2A 1MFBH 3EO0B 3NGBB 1OSPL 1SJHA 1MPAH 1GL4B 2VDKH 2WIIB 1GVIA 5HYIA 1ZT7A 3SE8H 5JLZB 4YXKL 4ALAH 1Z2KA 1H3UA 4ENED 4LARH 4K3HA 3VFVB 4PRAB 4X4MA 1YMHA 2BXZA 3CVHB 4LOUC 5J9PA 2H32A 4OZGB 5ITBL 1J7VR 3LQAL 2HLAB 3VXPA 3CFJA 5I1HL 4NO0B 1GGUA 4EXKA 3CFDA 2AABL 3K2UL 3C5JA 3CVIH 3ARVA 4NNYA 4NYLA 1I3VA 2Q6WB 1ES0B 1BQSA 5F8RC 5JOFB 4UQ2A 4JM2F 4D94A 1K6QL 4Q7DA 4LCCA 3V5KB 4TVPH 2XICA 1PG7W 2X1OA 4LL9A 4YDKL 5L8LB 4ODXB 4H1LG 3C5ZC 2NTFA 1IGML 3CSPA 2AEQL 3BKCL 4YBHA 2J5LB 5A2FA 1OOAA 4G9DA 3VWJD 5CGYD 1FFNA 1U8HA 2X09A 3Q5YA 4D0BA 1QNZH 1E4JA 1FNSH 1MQKL 2CUIA 4K2UL 4CU7A 1G7LB 1NEZB 1ZVYA 5DJCB 1Q9WA 2BJMH 2A6KB 2AQ3A 5E1AB 4G8GA 4KTEH 5EU5A 1H3WM 1ZA6B 4QYOA 3VE0A 2M1KA 4WJ5A 1HINH 3RZCC 3PJSA 3PGDB 3D2UA 4N0RA 4M7KH 5ELIA 3SE4C 3NACH 4MVBC 3GMMB 5KSBB 3FL7A 3H3PH 3D9AL 4BK5A 3NIFF 5FA4A 5T1KA 1WC7A 1JPGB 5C09B 4P3WA 1VERA 3BIBX 3HE6A 1UKQA 3L5HA 1WF5A 4P23D 3T0EA 1I1RA 2G5BA 1TJGL 3P4MA 1OSPH 4YFLF 3OAZH 4E42A 3RP1A 5I9QC 1A6WL 1MNUL 4NC1E 1KN2H 1IQDB 3NA9H 2PW2B 4OV5B 2E7CA 3DMMA 4W4NA 3C5ZB 3ZTJH 1XF3B 2D7NA 4K7PX 2PCPB 2MHAA 5I1HH 4G7VL 4R6UA 4P2QE 2W0PA 2W60B 3SQBA 3K2UH 4EBQL 2ESVD 2BNQE 1FHGA 3KGRA 4LDEB 1KTDB 4EUPA 2E8ZA 1TVBA 3DHMA 3RZCB 3SPVA 4YDKH 2AKRA 4YNYB 1NKOA 2XY2A 1LP9A 5JXED 4FP8L 4KKCD 5EN2B 3T3MF 4AQ1B 5AG9A 4HDIB 4NQVA 3O6FA 4LEXL 4NQCB 1IGMH 2AEQH 3BKCH 2A73B 1N59A 2FIKA 1I7ZB 3ZKQD 4IMLA 4UTBL 2YC1A 1X5JA 3TVMC 3WHE1 3EFDL 4X99A 1MQKH 1X5AA 4CADB 1I1AD 3M1BA 1KT2A 4EQ2A 2NCMA 4X0KB 1T5XA 1G7HB 1HNFA 1FNLA 2H2SD 5F89B 2Q86B 3ELAT 5I9QB 1KULA 5C0JA 1FNEA 3FFCD 3HI5L 3D9AH 4JZNA 5D7JA 5HGBA 4ISVB 4Z77B 5I8CB 2DQJL 4HJJL 3NH7L 4O2EA 1I9EA 4H26A 1T7ZA 1HXMB 3SKOB 5I19L 4RA0C 4JANA 2BC4A 2WP3T 4MD0B 1MLBA 5F72S 1TJGH 4M8QB 1FVDB 5FCUH 4NHUA 2BNRD 1NCBL 4JFYA 2Z31C 1A6WH 1KXTB 4NKQB 2ATPB 4XMLH 5E03A 4IIQC 3JV0A 1HH9A 3GRWA 1CQYA 2GT9B 4G7VH 3S88L 4I9WE 3TVMB 3U7WL 3VD3A 1B0GB 3MJ9A 2BSTA 3HI6L 3WNMA 4X6CF 4M7LT 1HSAB 2P24B 4K7PL 3MLVH 1T1ZA 3VFWA 4G6ML 2O5XL 2DD8H 5A3ID 2WV3A 5FM5M 1CLYL 5DEFA 4FP8H 3QIUC 5IVXB 3BESR 2ZJSL 3H9SB 3BAEL 4I0PC 1E4XI 1FYTD 4LEXH 4HJGB 1JWUA 3LPGA 4LSRL 2UV3A 1MJ8L 3EJYD 4UTBH 2W07A 5F70A 1PDKA 5F9DC 3EFDH 3ILQC 3LKQB 4GLRH 5CD3B 4UNTA 5EO1B 2HN7B 5TE4H 4OFDA 4MHHG 1CXLA 5DHYA 2Z93B 2IPKA 2E7MA 3VA2C 2G75A 4XHJC 1BIIA 4LRNH 5HHPA 4D3CL 4JVWA 1JPSL 4BH8A 3T2QA 2VQ1B 2A74B 3V6OC 2Z31B 4HWNA 3P4NA 4R7DB 3TYGH 3B9AA 4IIQB 3BEVA 3F7YA 1DE4A 1MAMH 4KY1H 4UV7L 5C6TH 4C56E 3ETBF 3HE7A 4PJDA 2AK4E 3SJVB 4HJJH 3NH7H 4U05A 3UTPE 4XXDA 3LKPB 4X98A 1BEYL 1JHKL 1BD2E 4N0CD 5HYJA 3GIVA 4L4VD 3BUYA 2R8SL 4CNIB 5CEZE 4U1KB 1KXQE 5GZOD 4Z7UA 3DSNA 1NCBH 4JN1H 3D1MC 3QIUB 4OI7A 3CLEL 4PRDA 1I3GH 4I0PB 4FFWC 1IC5L 3JSSA 3KNBB 2WQRA 4MA8L 3W81A 1JN6A 3S88H 3U7WH 5DEGA 5E2TL 4ZUSA 3VH8B 1RJCA 4RMUA 4LIQL 1IC1A 4HF5L 3QG6B 3QA3B 3PWUA 2ITCB 3GSNA 4K7PH 5IEHA 3IAPA 2O5XH 2N7AA 3GNML 4PGBA 5DJ8B 1CLYH 1IEHA 5HGHB 1DQJA 3DARA 4N0UB 2HKFL 4WW1B 5HTSA 3MGAA 3EDFA 4HIJA 4LSRH 5BXFA 1MJ8H 2FHBA 3JWDL 5BS0B 5D4QA 2JJSC 1WZ1L 1KPRA 5I66B 1QTYT 4Y4HD 1M1SA 1JWSB 5AYQA 1WGOA 3QNZB 1UZ8B 4WHCA 5F8QC 3SBWC 1TENA 1QFWI 2Z9TA 1S7VA 3QFJA 4J3WA 4Y2OA 5H37G 4D3CH 1J0IA 1JPSH 5CBAA 2QLVB 2VLRE 2NY0C 2EDOA 1W0WB 3MRGA 4UV7H 3W2DL 3KYKL 4P2OA 4U31A 5FO7B 3W0WD 2MFNA 5C0ND 1PGRB 3TF7C 1J1XL 5DRXB 4FQHB 1JHKH 4RFOL 3V7AG 4FQLH 1RJZA 5E95B 2R9HD 3IDNB 1YEHL 1UJ3A 1J8KA 4RMQA 3QO0B 4X7TB 3OKEA 5HGAA 3ZE2F 5DA0B 5K9OA 1HI6B 5ICYA 4DVBB 1S5HA 1OAQL 3CLEH 1OT1A 1C5BL 5F71A 4NIKB 1IC5H 5I8EA 1FC1A 1IC7L 4JQXC 4ZODA 3QULA 5E2TH 2G9HA 4LIQH 3DX9B 3TA3A 5FECA 2FB4L 3VXNB 3S36X 4X8XA 3L3OA 2FGZA 5ESVA 4HMEA 2FWOA 4RBPK 4AMKL 2B8OT 3MRLB 1U8MA 4MQXC 2HKFH 2Y7QA 4BSWB 2NY0B 1ZHLA 3QDJB 5INCA 3MV8B 5E0QA 3JWDH 3OKYA 3VDBA 1WZ1H 1RZJL 1F6AA 2GJZA 3MLXH 3PXHA 4GS7B 1OM3L 3D85D 4PG2A 4ZMAT 1ZA3B 2ZNXA 4MJ2A 5HHME 3V2AR 3RWCA 3GMNA 1T0PB 2ADGA 3QDGB 4U49A 3B5GA 1DFBL 3D3VE 5KANG 2X9WA 1VADB 1MHEA 5MEPB 5GGVY 3TIEA 2ICWJ 5E08L 1G7PA 5HYSB 3W2DH 1XGQA 2WWMC 5BRZE 3KYKH 1F97A 4RFNC 4BZ2L 4YDVA 5EBMA 3U4EB 2VABA 4RFOH 3H9HA 3SE9L 3TPUA 2AI0L 2VZVA 1EEYB 1X5KA 1QBBA 3TNMA 1YEHH 1NLDL 4YX2L 3LPFA 5KOMC 5D7LB 4KRLB 2VUYA 3ZYOA 5F1KC 1XGRA 3GGWA 1OAQH 4LEOA 4CMMB 3KPSB 2FX9L 1C5BH 4YH6A 4JAMB 1IKNC 2GTZA 4OUOA 2R56L 4NOBA 1F2QA 5FOBA 4IHOB 1KCUL 2H2PC 5KAQF 1G0YR 5E9DD 5I1KL 5CBEA 2EKSA 3GHEH 1C08B 4ONHA 3CU7A 3BHBB 3RBGA 4J8RB 4AMKH 1A6UL 4F7MA 3DECA 3IDGA 4PR5A 3K8KA 1SEQL 3V4UL 3EYQC 4JJ5B 2R15A 3C08L 4U1LB 3S36L 4JN2B 2C1PA 4R4BB 1YEJL 5DQJA 1C5DB 1RZKC 2MCG1 1RZJH 5F7MC 4K8RD 1R0AL 3PF2A 1WZMA 5I1JL 5CIPH 3HFMH 1HHIA 4OCWL 3WJJA 3ZSSA 3MJ7A 5EZIL 2R2CA 4HCRA 1BQHA 3QCTH 1VENA 4WU5A 2VLJE 5ITFA 1DFBH 3TN0C 3MLPA 1VFAA 4HBCL 5GSRA 3S5LA 4MD4A 1A4KB 4Y5YC 4F9LC 5E08H 4QRQB 3LRSA 3R06A 4RA3A 1HH6B 1HQ4A 2P8MB 2BSSB 3K0WA 1WBYB 2XPGA 3BZFB 3WN5A 1PKQE 2EYTA 4S1DD 4UOW0 4BZ2H 3C2AL 4X6FA 4AIXA 3P9MA 5CWSA 2E9WA 4R3SA 4WFFD 3OX8A 3SE9H 4X4YB 2B39A 1BVLA 1CZ8L 1T4KB 1NLDH 4X5WA 4YX2H 2WINA 3PWPD 2H9GA 3LV3A 4DKEL 4WWKA 3SDCC 5T1LB 5FO8A 3HAEA 1Q9KA 3FOMA 2FX9H 2BY2A 1HIML 4Y5VC 5DRNB 1E4KC 2R56H 4GRLD 3U1SL 4FFZL 1KCUH 1XR8A 4N1HB 5GRZA 2UWEE 1N3NB 3NBNA 2DOCA 4HKBB 4K71C 5JNYA 3DUUA 5I1KH 4P2QA 3BGFC 1IT9L 4HUXB 2VLKB 2BNQA 3ULUC 1MCSA 1A6UH 1S9VB 4ZFOA 2XFXA 3K74B 5J11C 1J0YA 4MB4A 5C2UB 1MIEL 3TN0B 5IMLA 1A6PA 1SEQH 1IM9B 3V4UH 3V6ZA 3OXRA 1EBAA 2SEBB 3C08H 8FABA 2Y5TB 3O9WD 4Y2DD 3S36H 1A64A 1Z0NA 4Y5YB 3QXDA 3C09C 5FYJL 3MACL 1YEJH 2D4DA 3S7GA 5GRJL 3BQUC 1F5WA 3O11A 4JRXE 4DZBA 4YBLC 4LCWD 5J3HD 5I1JH 5KAQG 5I74C 4HIHA 4OCWH 5EZIH 3P9LB 4F2MA 4XNYH 2R1YA 3U0PA 4UV4L 2BSRB 2J8HA 5TF1L 1AXTL 4DGVL 3MRKB 2AAVA 3L3IA 4HBCH 2NNAB 2DQGH 4Y5VB 1T2QL 4OUUB 4KK9C 5JQHC 5KN5B 4RWYL 1CGSL 5DUBB 1M71B 1UM4L 1XAUA 4NT6A 1NDGA 3C2AH 5BZDA 1FC2D 1K8IA 2EIZA 4K71B 3T77B 1CD0A 1X5XA 3BGFB 4HK0B 3CCHB 1CZ8H 5FYKL 3HPJB 4M1DH 3AY4C 4DKEH 1BZQK 2VDQL 5J11B 4C58B 4LLYB 1IVLA 4EN3A 1TXKA 1D9KC 3EGSA 4KJPC 4O2CB 3C09B 4FFZH 3TIDA 3QUZD 4QHLB 3VGFA 1CFQA 5JO5A 2XTJC 4XB8A 4QXTB 3BQUB 2ORBL 3OHXB 1E27A 3STZB 4U1HB 2FDBP 4YBLB 2RB8A 4YDLC 5I74B 1VACB 2ICCA 2WW8A 4LDOB 1IT9H 3FQRB 3TWCH 1B9ZA 1IAIL 2VXSL 3HZMA 2QR0B 2R1WB 3ZLQC 1TQBC 4N9GB 1MIEH 1A1OA 4YK4C 5EBLA 3FN0L 4MAYA 4JFQA 5F7WC 5FKPA 4KUCD 2EDBA 3MACH 4R4ND 1ZVSB 4IOIA 5GRJH 1YMME 3TCXA 3BT2L 1CBVL 4BKLA 5IVOA 2ZOKB 1FVCB 3MFFB 1I1FA 4UIMA 3ARYA 4M7JL 1KJVA 4U2YA 1HOCB 4CVZA 5TF1H 3T4YB 1DBML 3BEWB 5ECJE 1AXTH 4DGVH 3BGMB 3QWRD 4MCYB 3RUGE 3ULVE 2QADD 2O5YL 4MJID 3ES6A 3I9GL 4UOJA 2BMKA 1T2QH 3CSBA 4NKOA 3IFOA 2MQ0A 1D9KB 3HRZB 1J9CT 1JZ5A 4RWYH 1CGSH 3ZT6A 4NUJA 1UM4H 2XTJB 2MJWA 1P6AB 1G9NL 5LQBH 4C56A 2AK4A 5EFIA 5DRWB 4PRIE 4YDLB 4UT7L 2KH2B 1AO7B 1BD2A 4TULL 1FG2A 4KJWC 3MNZA 4DOHB 3BYYA 1J0HA 1TQBB 2DLGA 2GITA 3EO9L 2F53D 4YK4B 2VDOL 4NN5C 4HWBL 3BSZL 4LLWB 4N0FA 1A3QA 2FYYA 3MGOA 4G9FD 1DLHA 1S7TA 4XMPL 3JV6A 4LQ1A 1F42A 4NRZA 3KLHD 3KLAA 1NGQL 2ORBH 3QZWA 5DFVC 2QSQA 3WUZA 4HXBL 2I9TA 4ZNEE 5F1IB 3QPQD 4ORGA 5GGTA 1IAIH 1FRGL 2VXSH 1BQHG 2VDRL 1T6VN 4OD3L 4ELKB 1EEZB 2NX5B 4OF5A 3VCLB 4I0CC 4GRWE 4Y19D 3S5LG 5DGQA 1N5YH 1N8ZB 1UH2A 3HS0B 2G2RA 4XCCL 4M4RA 4RAUA 2C1OA 3HR6A 1MFDL 3BT2H 4YR6A 4DKDC 1CBVH 2HRLA 5GGVL 2YZ1A 3WV0A 1JL8A 5KS9B 1INEL 3O8XA 4M7ZC 4BSVB 4M7JH 5C0FB 3RDTC 3TJEL 4HC1A 5DGRA 1DBMH 4MSWB 1YUHB 2EO1A 1PQZA 2VXVL 4KVNL 4NN5B 1U3JA 3I9GH 4I77L 1MWAA 2Z8RA 1CTOA 1A6ZB 5HY9B 4ZUVA 2VLRA 5IG7A 3S3SA 3O2DA 1HEZB 1OGTA 4N8VA 4P4KC 1KPVB 4B0MM 2IPUG 4PP2A 2BY1A 2XOTA 3IF1B 5ISZD 1CFTA 1CD1B 4OIIL 1AKJB 1DUYA 1C5CL 4UT7H 1BPVA 1NMBL 3QDME 1SYSB 3CX2A 2LTQC 4HJ0D 2EDJA 3BPNB 5HHVL 1A3RH 4H1LB 4YHIB 2VDOH 5C86A 5HGGS 4HWBH 3BSZH 5I1LB 2EH8H 3O4LE 3SY0A 3T0XA 2HG5B 1JGEA 3X3FH 3HC0A 4XMPH 5MEOB 5E2VH 3VFTB 1X5HA 3OAYH 5AUMB 5E7BA 1EEUA 4JKMA 2HJLB 1XF2B 4XCEA 2Q7NA 3TGXA 3I6GB 5GRWA 2FNBA 5K93A 3GMPA 4M7ZB 3C60D 2M8XA 3EDDA 2VDRH 1UQSA 4OD3H 3UYOD 1KC5L 3MX0A 5C7XL 1XCQA 3VFPB 1JF1B 4BUHA 2BOCB 5F7UA 1CGUA 4YDIL 3IT8D 3RJDA 4DGIL 1I1YA 3HTLX 1QP1A 1MH5B 5GGSB 4XCCH 4HS3A 3MRDA 4P4KB 1IZKA 3UYPA 5GJSH 1MUJA 3W9DB 4RBPH 3F5WB 4CW1A 3VI3E 3TJEH 2LTQB 4JM2C 1U8NA 2VITB 2W59A 2QQNL 3RVWD 3TYFA 3G5YA 4LVOB 2OSLB 5C0AE 3RWEA 4HH8A 2AJYL 1FZKB 4MAUL 2VXVH 3PQYB 4YWGL 3LD8C 4C83A 5SWZB 4I77H 3HZYB 3KPRD 2ARJB 4X9HA 3NMEA 4WO4C 3ARFD 3D3VA 4MJ5A 1KCVL 1OW0A 5FM5O 5I8OL 4XHQA 2OZ4A 3FQWA 4HBQA 2IAMC 1JMXA 3RU8L 5BRZA 5DJYB 4OIIH 2DL2A 4OGAD 4WUUE 4JG1L 4UOW1 1FH5L 1C5CH 1NMBH 5IUSA 4OGYL 5CMAB 4LP4A 4EDXA 3HC3H 2DJSA 5SWSD 3AM8A 1VGKB 5HHVH 2GJ6B 3BMWA 5FIEA 3PGFL 2PYFB 4PTUB 3DVNB 1DBKH 5B39A 5TDPB 4HWUA 4JRYE 2VRAA 1NCAL 3NA4A 4BQ9A 5HDQL 5M94B 3F7VB 4UTAL 3N1QC 1EHLL 3AREC 4LSQL 3IRZA 2X7LB 1WEJL 4PB9L 1J0ZA 5DURD 1BFOA 2VO5A 4XRCA 3P4LA 4WHYG 4JM2B 1HZHH 1KC5H 4PJ7E 4NCC2 3KHQA 4WFED 5C7XH 4F7TA 1A6AB 2ZCHH 3LD8B 2MWCA 4Z7VE 3AS3A 43CAA 4WO4B 1PZ5A 5AZ2L 3PABB 4GKNB 3RGHA 4R7NB 1QSFE 3JTSB 5BOZG 2IMNA 5C9KA 2IAMB 4PJ5E 1DANU 3PGCB 4B53A 5K59E 4DGYL 1OWWA 4H5SB 3QWOA 1FV1A 4AM0B 3DX6A 4PGEB 2J12B 5HJ3A 1I4FA 2QQNH 1MIMH 2R2HA 2YA1A 4G5ZL 2GJJA 3QJFA 2AJYH 3C5SB 4YWGH 5I75C 4NQDE 1HHKA 4H25B 1KCVH 5I8OH 3B9KD 1UH3A 3U36B 3VFUA 1N2RA 4PFEA 4WHDA 2AJVL 5D7KD 3QZWG 3CGTA 3UDWA 5BW7A 5EZOL 4JG1H 2A6IA 3V5DB 1PKQA 1FH5H 3AREB 2VDNH 3BRFA 4OGYH 4PGDA 4C54A 2FLBT 4PJGA 4HUNB 3Q3GA 5FYLE 1T83C 2AJSL 4YZFF 3KG5A 1MELA 3KLSA 4FQJL 1UWXK 2Q1EA 1U58B 4MXVF 4O51A 4Y4KA 1P9MA 4YHKL 3RX7A 2IH1B 1UZ6E 2JB6B 5HPMB 5HDQH 1R3IL 1D5IL 2P44B 4PPTA 1Q9OB 5EPMB 1JGUH 1XF5B 2IH3B 1FIGL 1WEJH 2GEEA 3CZFB 5DMKA 5EZLA 4QF1A 5ACZB 4GW4B 5HYEA 2EDRA 5JHDD 3LS4L 3UBXA 1AGDB 5I75B 4Z5RB 1VESA 2GK0A 4HFUH 5AZ2H 4YBQC 5IB3A 2J1KA 3SKNA 3H6JA 4UQ3A 2P48B 2AJXL 3EZ8A 3FCTA 2OS7A 3CFDB 3HUJF 3PG2A 5I8KL 3CU1A 3HE6C 1RV6X 3MBED 2DWDA 5D1ZD 4DGYH 4GRMA 4JRXA 1NGPH 4UQ2B 4U6HB 1S7XA 2D7QA 3L7FA 4TSAH 3QPXL 3VD5A 1NGYA 2ZSVA 1J1OL 4G5ZH 1RURL 3ZSTA 1J8HD 4EVNA 2LU7A 3MBXH 4CKVX 5IQ9A 2VAJA 5TJWK 1ZLWK 2O5ZL 1H15B 2VL4A 4KKLD 3R4DA 4CU8A 4G9DB 3I75A 3VXMB 3G5XA 1U8HB 3TO4C 2AJVH 4CMHC 2F8VA 1KBGL 5TQ2H 3VXUE 4P59L 1CDGA 4XNZB 2H3NA 5EZOH 4GG6F 4XCFL 5I6XC 3IXTB 1BBJA 4AIOA 5I18L 5EU5B 4JDVA 2CSPA 4YHLL 3F7PC 4BSJA 4QCIA 1I7TB 2AJSH 1ORQB 4YGVB 3K4ZA 1QKZL 4FQJH 4FZEL 1MCIA 4KDTA 3VI4F 4EI5D 2YR3A 3QEHB 5EC2B 4YHKH 4GG8A 4Z7QE 1L6XA 3MV9E 4DN4L 1QSEA 3H7BA 1JK8A 5JOPE 2FO4A 5FA4B 3MOQA 1NAMA 1CE6B 1R3IH 3G6JF 3T1WA 2VXQH 4F15C 3HE6B 3AS1A 4J2XA 4X6CB 5D7IE 1KIPA 5HBBA 1OSZB 4XTRC 1FIGH 2XKNA 4NQED 2G5BB 4H20L 3P4MB 1WT5A 4OM1L 4ODUB 1Q72L 2YD8A 2XXCB 4WI2A 3MV7B 1WV7T 1KJ2B 1H5BA 5IB2A 2YD2A 3LS4H 3ZE0F 4DVRL 1EZVX 4KROD 3JWOL 3BD5A 4IMKC 3TZVD 3IVKA 5C0CB 2HLFC 1TQCC 2AJXH 4L3EB 1ZHBA 4GO6B 5I16B 4K94C 4M7LL 3TO4B 4Z7NE 5C0IA 4CMHB 5GS1A 2UWEF 3DXAD 1CDCA 5I8KH 4J1UA 1YMMA 5C0DB 5I6XB 4G42B 1HDMA 5BO1L 2WBJC 4KXZI 4KJYB 4ONFL 4KK6D 1J1OH 5ID1B 1LP9B 2VL5A 3O6KL 5F44A 1IGJA 1F45A 5GSVA 4RWHA 2O5ZH 3RUGA 5DA4A 4M4PA 5B39G 3CH8A 3VDAA 4JDTL 2ZCKH 2B0SH 1KBGH 3C8KA 4P59H 4TVPE 3GSQB 4M61A 3FTGA 1NUFA 4FXGA 1CFSB 4F15B 4NFBA 5MERA 4YHLH 5E1HB 3SGDH 4PRIA 4KV5F 3HZKB 1NKRA 1YYML 2EDQA 2JIXD 5ESQA 1EFXD 4FZEH 4BFIA 1HXYA 4X4ZA 1RFDL 3QUXD 3DO7A 1YY9C 2NW2B 3OR7A 3LN9A 5HGBB 2CDGA 4ODVH 4XVUD 1TQCB 2AGJL 2FJGB 3GMRB 4NUGL 4H26B 2VSDA 3D0LA 5F6HI 3QFDB 2CPCA 4HK3N 2DIBA 5IB4A 3VFGL 3FFCE 1ND0B 3QHTC 4OZFA 2BC4B 1ADQL 2WBJB 2HKHL 4OLEA 4ZNEA 1MLBB 4H20H 1RZGA 4OM1H 5CCKH 4KUCF 4MDIB 5IB5B 1Q72H 1AY1H 4O2FB 3GMLB 4FQXA 2I9LA 5IMKA 1LNUA 1GGTA 4YXHL 1LEKA 2AXJA 3JWOH 2DTSA 4U33A 1HH9B 3KPPA 3NAAL 2V5RA 1EDQA 1OTSC 1I9RL 2Z4QA 3CVHH 2BSTB 3VFOB 3SDYH 4ZAKA 2DKMA 3OKNB 2XN9E 5HHNA 4YHNA 3BKJL 1ZMYA 5BO1H 4Y1AB 3FRUB 2BDNH 1A7BA 2UYLA 3BDBA 1YN6A 1F11B 4OCXL 1QQDA 2EDFA 4ONFH 2CIKA 4D0DB 2P5WD 3ZDZE 4NFDA 2CXGA 5DEFB 3LKSB 3O6KH 5D5ME 2V2XB 3RAJL 4OSUL 1AHWA 4OFIA 3A6OA 4E41B 3OMZA 4ZUWB 5L88L 3O3EB 4JDTH 4XP1L 5I15L 4LHJB 3SEPA 5E8EA 2VZ1A 1ZHKB 3LKOB 4FQ1L 1QRNB 5CEYA 2EXYC 3RVVD 1UWGL 2C3WA 5DHYB 1KOAA 2Z91A 2IPKB 2XA3A 3QDMA 1E6JL 2DL9A 3NZ8B 4XT1C 5FDWA 2OBGA 1RFDH 1MHHA 2V7NA 3D18B 3BEVB 2HJKB 1M6OA 4NP4L 1TIUA 4NDMB 4XPFL 4KKAC 3FB5A 3O4LA 1UGNA 5GS0L 2AGJH 2XI9A 4E0RB 2PR4L 2DF3A 1BFTA 4X98B 5F7KC 3DTXA 4RAVB 3SGEH 1OGAD 3K2MC 3FO0L 3VFGH 2Y4SA 4F7CA 5HYJB 4P46A 1ADQH 2HKHH 2FSEB 5T5NF 2Q76B 2GTWA 1RIVL 5JTWA 3EYVA 5L2KD 4UDUB 4YXHH 4FHBD 4MD5B 4F3FB 1DSFH 4L3CA 2VDMH 1DUZA 4RRPA 5FGSA 3HB3C 2OTPA 1E4WL 5I76A 2DWEA 4P2OC 3NAAH 1F13A 1RZFL 3VXRE 2OI9C 3FMGL 5DEGB 4EI6B 5IFAL 1U8JB 5TFSL 3RWFB 3BKJH 4WDIA 1BJ8A 1BIHA 4PRBA 4NO0D 1UJ3C 5D2LF 1FZOA 2ARWA 1FFOA 3VGAC 3SCMC 3IDIA 2RJMA 3LN4A 4PGBB 1JRHI 2ADJB 3MGTB 4HIIB 5HHOB 1MVUB 3LIZH 3RAJH 4OSUH 1XIWA 5GGRA 5C0AA 2HP4A 5L88H 4GRWF 2FX7L 2NY5C 2BCKA 2F15A 4XP1H 5I15H 1H0DA 1J87A 2ZUYA 4AT6A 1UXWA 3IRPX 1AGBA 2K1MA 4FQ1H 3VFRB 5JDSA 1IARB 4WUUA 3QCVL 5H35A 1S7VB 1FO0L 1ACZA 1WFUA 2KKQA 2VTFA 4PGCB 3VD4A 3HCVB 4QTIL 2JELL 3MJGX 5F9JA 5DJ0A 2XWBB 4NP4H 4ZQKA 1HKLL 3M45A 3NVQA 4P2OB 3UP1A 2DLIA 5LBSL 2A83B 4PJIE 2OI9B 4JRYA 4LOUD 4LMQE 4MJ4A 3FO0H 1OTTC 1RJZB 5F1NA 2JK5A 3DX8B 3UJJH 1RZ8B 1IGFL 1RIVH 3SCMB 1CG9B 3OKEB 5C09D 3X14B 3B3IA 4ZPTB 5ICYB 4WTXA 1CE1L 3W0WE 1JGDA 5CAYB 4PJ7A 3CAFA 5E00A 3EHBD 2J3SA 4R8WH 2R23B 3QXVA 4M3JA 5GQBA 1B6DA 2G60L 3MR9A 5DMIL 2LVCA 1LK2B 3KXFD 2VH5L 2APVA 1RZFH 3G9AB 4E5XB 3FMGH 1EUTA 1MREL 5IFAH 3C5ZD 4B5EA 2G9HB 4L9LA 4PJ5A 3UTTB 4MHHI 2KPNA 3HLAB 1T1XB 5T5NG 1YN7A 5E94B 4BQ6A 3T1FB 2JCCE 4K9EL 2FBJL 4Y16C 3AXLA 3LHPL 4YHZL 3CC5B 5CGYC 2FX7H 3S97C 4WHTB 1HILB 3C6SA 3CDYA 3BJ91 3D25A 1A2YB 5DQ9B 1A9EA 1CXKA 4NQCD 4R9HA 4TTDC 1YEDB 4J4PC 4R96B 4P3CL 3BJLA 4OZFG 3GM0A 4DAGL 1NLBL 5H2BA 3VI3F 1FO0H 2CQVA 2XRAL 3ARDA 3BP6B 3QUMA 1J88A 3V5HB 3V4VL 1ZT1B 2OQJB 5DJXA 2CKBB 2R4RH 3M8OL 5D1XD 3JXAA 4MXQD 2GSIA 3PNWA 5FM8A 1HKLH 1OB1B 1EAPA 2W38A 1BAFL 3DIFA 2X40A 4YXLL 4P23C 2AERT 3TPUB 2P1YA 3C2SA 5BVPL 3OKKA 4HGWA 1IGFH 4PRPD 3IB4A 4M1GL 1P7QA 1FLRL 5DC9B 3U82B 1U91A 4LEOB 1BJ1H 1X9QA 4Y16B 1VFBA 3ZDXE 2DM4A 4P48A 4I4WB 3VWJB 2GTZB 1B0WA 3RVTC 1Y0LB 2GSGB 2VH5H 1GC1L 3HPLA 4U1GB 1SBSL 4NO2B 2EDLA 5JUEL 5HI3C 4I5BB 2BRQA 4F37K 3TVMD 3PHSA 2E9IA 1ZLSL 2LU3A 4WWKC 4F7MB 3PV6B 1ZS8A 1AJ7H 3QT2A 5EWIH 1K8DA 3LHPH 3X3GH 4RQQA 1XF4A 4NC1C 3SQOL 1U9KA 4Z7VF 4O58L 4LIQE 2C1PB 3PWLA 3O41B 4NN7C 1KB9J 4ZUUB 5K9KA 2E7BA 1DVFC 1ED3A 3AGVA 4RZCB 2J8UE 1R5VA 3LEYH 3F6IA 4P23B 5CD5D 1HHIB 5IWLA 3V0VA 3VXUA 1FBIL 4P3CH 2X4OA 3QNXA 2H2SC 1BQHB 4KKNA 1NLBH 3V79C 1WTLA 4PJBA 3V4VH 5IM7A 4N8CL 1ZLWH 1B0RA 2XV6B 4G8FB 3S5LB 5DZNA 3GI8L 1ZEAL 4P5TA 5DK3A 3KJ6L 4RRPG 4DZ8B 3OGCB 3DV4A 2Z31D 1BAFH 4XC1L 3MV9A 4N9OB 1N5AA 5DO2D 4PG9A 5JORB 1CDBA 4GJTB 4FFVC 4YXLH 3KYNA 2D0HA 1OP3K 3VXTA 3ZZ1A 1JZ8A 4HZAA 4FQQA 1J86A 1UENA 1BVLB 2IC2A 1HWHB 4D9RD 5IF0A 2ATKA 3LV3B 5D7IA 1YPZE 3DSFL 3H3BC 4M1GH 4WWKB 5GXBB 2KQNA 1FLRH 1Q9KB 1U95A 5GS2D 3FHAA 1LE5B 2HYMA 4WFFE 1B2WH 4NN7B 3QIUD 4MZ2A 3PWPE 1DVFB 3WFHA 3BP7B 1SBSH 1P4LB 5JUEH 2ZOLA 3L95B 1NJ9A 2DICA 3MCG1 3IDYC 1LEIA 3ILQD 4NQXA 1HYSC 1EXUA 5B22A 4AJ0A 5L9DL 2IPTH 1NFDE 2XFXB 2KZ1B 2H6PA 4NGHL 1NGWB 4UU9B 2LV4A 3V6ZB 5KANI 1RPQA 8FABB 1DR9A 1DTUA 5JZ7C 4HWEL 5IR1B 3FB8B 3I2CL 1S9WA 3VXQA 5KJRL 2DIJA 5L8JB 1UG9A 5CJXA 3AS2A 1PD6A 1P84J 5FV2A 4XC3L 3GI9L 3CMOH 1QEWA 5E8OB 2VWEE 1KPUA 2CDFB 3QI9C 4HS6A 1NGZA 5DSCB 2BNRB 4TNWK 2IAND 4MJ6A 2DQUL 3ALPA 3U7YL 4RFEB 1MCCA 3N1GC 4N8CH 4QHNA 5MENE 3L3IB 3OXSB 1EHNA 1KB9K 3SDXE 3W39A 3GI8H 1ZEAH 4LCWE 4BZYA 3KJ6H 4LKCB 4BQBA 4ZFOL 1I1AA 4LSVL 1PY9A 4V1DE 4XC1H 1QPPA 1P7KB 2YEZA 3FO2A 4PLNC 5BZDB 1B4RA 3CFKB 2OL3B 3G04A 2ENSA 3RWHA 4RMTA 1OY3B 4PJHE 2H26A 3IDYB 3ROOB 3U9UA 1INDH 3FFCA 3DSFH 3JBG7 3KLDA 1FYTB 2YPLD 2NXZC 4OQTL 4PV8A 1LWRA 3UO1L 1FIEA 1OARL 2FATL 2FECI 1TZIA 1CYGA 5FDYA 1Y6NR 5GRVL 1GCFA 5JO5B 4XI5C 5F7HA 2RAMA 1FNFA 3QWQB 2X4NA 5IOPA 3QCUL 4LBEB 3S9DB 3QI9B 5IHLB 2XN9A 1OD7A 5GZNC 4DKFL 4MNQE 4KI5E 5L9DH 4NGHH 3RY6C 1A1OB 4XWGL 5CKAA 5IHBA 4IRJA 1IAIM 4PJFE 5D5MA 2VQUA 1OLLA 4WW2A 4PJCE 2GCYA 2I26N 3QP3A 3DV6B 2F9BT 3GSUA 3GI9H 1U3YA 2NY0D 4BKLB 4Z7NF 3AAZA 4QRRE 1I1FB 3QRGL 4ETYA 2C4FT 5C2BL 2AV1A 3UEZA 2DQUH 3EOAB 3U7YH 1A7OL 3CDGB 5D93C 4XMKL 4BUGA 2CK2A 3BXNB 1D5BB 2NXZB 4JDZA 4PV9A 2NY3D 3ES6B 3QDGD 5J12C 4YPJA 1CVSC 4JHBA 2UUDK 3IFOB 2DDQL 1BLNB 4UIKL 4LSVH 3LZFL 1DL7L 3QG7L 3BPCB 2Q8BH 3GMOB 1PY4A 4XGZA 4FXKB 1SMOA 4L8DA 4JG0L 4L4TE 1KIQB 4K07A 3ZYIA 5ALCH 3NPZB 4OQTH 1QR1B 2AS5M 3VMPA 3WFZA 3ULUL 4QHKI 1FFPA 1OARH 4QRPD 2FATH 5D7LD 1DLHB 4ZYKB 1UJTA 1D6EB 4QTHB 1RUKL 1ROWA 2B2XL 5FA3A 4MQXD 3QZWB 1MJJA 5C70A 1KEMH 1H3VA 2YUVA 5C07E 2I9TB 3QCUH 4JFFE 5JMOC 4G9FE 4ORGB 2X6MA 4L8BB 2CLZA 4TRPL 1OVZA 5D93B 1VGEL 3W9EB 3D87B 4KTDL 4JLRA 3KPLB 4XWGH 1NCDH 3L3GA 5J12B 1EHXA 4NBXB 3WUWA 2RFXB 1AP2A 4M03A 2C1OB 4ELMF 4LHUA 2W65B 3QXAA 4WFGE 1R5WB 1NBYA 2H1PL 4X8JA 1U3HC 4YR6B 3U4BL 4KU1A 1DQTA 4CBPA 5CFHA 1GHFL 2DI7A 2IBGA 1WWWX 4MX7A 2WWMD 4AIZA 1NGXA 5F21B 2JJTA 5DXWA 3NABL 3TT3L 4H0IA 5IEKA 4XMKH 5FHBH 3BP4B 2IGFH 5GGTL 2MSPA 5T3XL 3C6LD 4Y4HA 2DDQH 3U0TA 3LY6A 4UIKH 5IG7B 5F7NC 4OF6A 1OGTB 3WO4C 1DL7H 3MNVA 1QHPA 4O4YL 1UADC 3ARTA 1T3FA 2P5ED 2EDYA 1DUYB 2Y25A 4PJIA 4PYGA 2H2PD 1AXSB 4OD2A 1Z9LA 2OX5A 1P69B 1JHLL 2BERA 3LN5A 4JG0H 1MAJA 3TM6A 5I30L 1SYVB 5CSZB 3ULUH 3WXVL 3M17A 4PJAE 2KBGA 4PRHD 4LGPB 3ARGA 4MNHA 2F8OA 3SY0B 2XWJB 3JV4A 3L7EB 3W0WA 1OW0C 2A6DA 3BW9A 4J23A 5T1LD 3OG4B 2GYSA 5HD8D 4U6XA 1DEDA 1RUKH 1JTPA 2Z35B 3EYQD 1MWAL 1HHGB 1U3HB 4XCEB 4ZS6C 5J1AB 2HJFB 2DQIL 4QGYA 2R0KH 2YPKA 1S7WA 5E2UL 2YA0A 2IG2L 4YLQT 1CT8B 1QBLL 4HKJB 4TRPH 3QIBD 2E27L 5MI0C 1VGEH 2PO6A 4KTDH 2P7TB 4LNRA 1EJ6A 1NUGA 2JCCA 1CLCA 3MROA 2ZPKL 4K8RC 3TN0D 3MRDB 3S96B 4QXWA 1BBDL 3WO4B 1N64L 2H1PH 4OB5L 3U4BH 1GHFH 3HNTL 1PKOA 3ALXA 4CW1B 2WBKA 4P2CG 2ZKHL 1CR9H 1U8NB 3TT3H 1G6RB 3TYFB 3G5YB 3RWEB 4NO5B 5T3XH 1HE7A 2APXA 4MCZB 4S1DC 5F3BB 3SDCD 1Q0XL 3D85A 1I7RA 3FONA 3NPSC 2OR7A 3IETB 4O4YH 3DVGA 3RWIB 5BRZB 1I9IL 3IDUA 1ZKAA 4M93C 5D6DC 4YDJB 4JB9L 1D5ZB 4EDXB 4HXAL 1JHLH 2IFFL 2RBLA 3BE1L 4CVUA 5MI0B 5I30H 2Y36L 1WBXA 1VEMA 3SKMB 1SHMA 3WXVH 4N90D 4GRLC 3MRBA 3G6AB 4R2GC 4G8IA 5B39B 2Z92A 5L7XL 1MCBA 2DLHA 1U36A 5TGBB 5IJVA 2Y5EA 1RI8A 3UDWC 3HUJB 2DQIH 3B6SB 4LLUA 2B4CL 2IG2H 3BQUD 3TH3T 1QBLH 1QYGL 4S1RH 2GIYA 3R8BB 1FQ9C 5BJTB 1ZSDA 3VFSA 4OZIE 2E27H 3P9WB 2NLJB 2AW2A 3OJVC 4WNQB 4Y4KC 1P9MC 2IADB 2D0FA 5ICZA 5F9AC 3E0GA 3OZ9L 4JVUA 1T0NA 3WFBL 4NPYB 1BBDH 1GZQB 1N64H 3NPSB 2ICEA 1SVCP 1UCBL 4KUZL 1RY7B 1T5WA 1JYVA 3MC0A 4OLZL 2BP3A 2J8UA 3HNTH 3PWVA 4KK9D 4GG6B 5DS8B 5J89A 2ZKHH 2W9EL 3DGGA 2VXTL 4XWOC 1IAKB 1AIFB 2VLJB 5C0EA 5JA9A 4GRLB 1A0QL 4R2GB 2HMIC 2W9DL 1YEFL 1AQDB 4HHAB 1KLGA 2PTUA 4Y4FA 1I9IH 4IRSA 5I1IL 4KJPD 1D9KD 4LVEA 3BP5B 1HQRA 4KVCH 4JKKA 1X5FA 4QRSA 3GSOA 4JFDD 1P4BL 5C92A 3BE1H 5DHVH 3ARWA 2XWTB 1YNTA 3O9WB 1GIGL 1MCJA 3ARZA 5T5FL 2JB5L 1YPZA 5D7KE 4Z78B 1AO7D 1EPFA 4O51B 4Y4KB 4NQTA 4U1JA 4H1LH 3VJ6A 4YC2C 3WUWG 4X9FA 4LHUG 2Q87A 3D39B 4UNUA 1NANH 1FN4A 3PWPA 4IOFD 3PHQB 2UWEB 3F12A 5MEQA 3MCKA 1B90A 1QYGH 2ADFL 5EUOE 1Q9LA 5TDOB 5EZLB 3MRFA 4HH9B 4APQD 5AZEL 3QDHA 4WGWB 2HVJB 2YXFA 2JF1A 1CICD 1NFDA 5GGRY 5IVXF 3DURA 2QHRL 4JY6A 3FOLB 1JPST 3SGKC 4KMTL 3OZ9H 3PE9A 4OFVA 3FCTB 1OP5H 2PYED 3KS0J 3S8WA 3QUYA 3NIGE 1QA9B 4KUZH 4OLZH 2DWDB 4GKSA 3HI1A 3CFBB 3FQNA 1A6TB 4X6BA 2W9EH 2ZSVB 5GHWL 2VXTH 4IEFB 3DBXB 1AGFB 3V8OA 4W70A 4OBRA 4Z76B 1A0QH 4WI6A 1V05A 5MENA 2W9DH 1YEFH 3SDXA 3DLQR 4U1MB 4YC2B 4LCWA 5CIPA 2AXFA 2DQCL 4V1DA 4ZSOA 1V3LA 5I1IH 2LE9A 3UZVB 1FFRA 5T1MB 1JNHA 3ESUF 4OZHE 2YN3A 4GKZB 3L3KA 1ACYL 4HUWA 1P4BH 4PJHA 1AKJD 1DEEB 5SWQB 1M7DA 1GIGH 4JE4B 5T5FH 3QQ4B 2YXMA 4A6YB 2GUOA 4GG8B 4KQ3L 4Y5XA 4X7FC 2Q7YA 1M4KA 1SY6L 4YPGA 1L0YA 1YDPA 2DMBA 1AGEA 4Z7OE 3ZHKA 4JFHD 2ZUTA 3EOBB 4DFIA 2ADFH 5SX4H 2CIIB 4M62L 3O6ML 2I5YL 5FB8A 2QADB 3NN8B 5AZEH 2X1WL 1SJXA 2OR8A 2HT4C 5IB2B 1FE8L 3PP3K 4MNQA 4JFEE 1T2JA 3RDTD 3VFMA 2QHRH 3AC0A 5ACMA 4KMTH 1J05B 1JF6A 1L9MA 4PJFA 2HA1A 5C0IB 5A2LH 4FFYH 3F62A 1F90L 4ZXBA 1LMKA 4RMRA 3SDAA 4PJCA 3RHWK 3GUTB 1KSRA 1HDMB 4HLZH 4CDGC 5D9SA 4QRRA 3MOAL 5GHWH 5HGDB 3V7MA 4FQXC 4L29A 5ICXB 4NHCL 3GM8A 1JPTL 1YNKL 4LU5L 5HDBE 3MTRA 3TNNA 5EZJB 3NFPB 4OIBA 1BJMA 1I7UA 4TUOB 1KIRA 4U0QB 3FFDA 2V5TA 5SWZD 3DYOA 1BFSA 4LSUH 4Q9RL 2X4UA 4ZAKC 2DQCH 4FXGB 3J7HA 4HJ0C 3T0VA 3VXSE 5C0BD 4JM4L 5F6IC 1ACYH 3HHRB 4MJIA 3EIFA 4W4OA 5I17B 3D0VA 3RWDB 1KIUA 1AHWC 1CD9B 2ZUWA 1YQVL 4L4TA 5JW3L 5IJKC 2APBA 3V0WL 1YECL 2DQFA 1RJLB 1U92A 4X6DF 3D69A 4NSKA 2GJ6D 1SY6H 2V5YA 3MLWL 1WFOA 3EYOB 1YEKL 3QIWD 5IFJA 2KDGA 4QNPE 2N56A 4JZOB 1D3CA 2P42B 1WCQA 4OZFB 5EIIA 5I1DA 5DJ2A 4JFFA 4M62H 1T1YA 3O6MH 2E6PA 2I5YH 5D2LB 5IB1B 1CGTA 2VZUA 4G9FA 3WLBB 1FE8H 4FQXB 1LEKB 3LKRB 1WJ3A 5TE6L 2VAAA 5C08E 3L3DA 4KHXL 4CRPA 4QXUL 4WI4A 1KJ2L 4GRWB 2EE9A 5CHNA 1NC2D 5ISZB 3AB0C 1RK0A 2Z4QB 4UT6H 3KWWA 1F90H 3BVNA 4WO4D 4ZAKB 3L5JA 1RK1B 5IMMA 1ONQA 2W9LA 3RVWC 5KSAA 1UVQB 3MA9L 4LLDB 5F6IB 3MOAH 1QQDB 1CVRA 3WL9B 4PRNB 3RNQA 2DYPD 4KI5F 4U1SA 2ED9A 4NHCH 1AHWB 1JPTH 1YNKH 1O0VA 4LU5H 1D5XB 4J3VA 1KB5B 2B1HL 1YEIL 1KCRH 1QFUL 3KYOA 2PN5A 1F58H 3QR2A 3KR3L 4OGAC 5TH2B 2L7JA 1K4CA 1K4DA 1HHJA 3ABZA 2XZAH 4GT7A 3KPQA 5F9OL 1F3JA 1FYHB 3CZJA 5GIRA 4QRTA 1JZ6A 3QDMB 3A67L 3SDDC 3LQMA 5J0BA 3ARED 5FDWB 3UAJC 5JW3H 4JZJA 1YECH 4X4ME 4ONOA 1M6OB 3O3BB 4PJAA 1JGLL 2FJFB 3MLWH 3MRRA 1YEKH 3AB0B 3DVIA 4U4BA 4LF3A 4X80H 2JJWA 1P4IL 2BVPA 5T3ZD 3MRHA 3CDCA 2GTWB 4JGUA 3VW3L 1T0MA 2IPUK 3EYVB 1KENL 1WIUA 1BVKA 1R3JB 3I3EA 4N68A 1P53A 4PJXF 2X4PB 3VGHA 5TE6H 2E5EA 4KHXH 1IGYA 1OGAE 4QXUH 3D6GA 1KJ2H 3PWJA 1FGNL 2CR3A 5I76B 3O0RL 1TJHL 5A16A 1JUFB 4XBEL 3C60A 3LQZA 1ORSB 3L9RB 3PWNB 4PRBB 2D2OA 2DLTA 4HZLA 5SWSB 3MA9H 1NBZA 1FZOB 1DDHA 2NTSP 4KK8C 4M5ZL 2NYYD 3IDIB 1SM3L 5GRYA 1ITCA 3SDDB 2V7HB 2X4QB 3OKLA 4ZPVB 1K2DA 4LLQA 1NCWL 4PTTB 3DWTA 2B1HH 5GGUA 4K3EL 1YEIH 1QFUH 3REWA 3MRJB 2FJHA 2A0LC 3MLUL 3NFNB 3BH8B 4YO0B 3K1KC 1AH1A 1MHCB 4UB0L 3T4AA 4TUJB 1XCTA 4L8SC 5DFWH 3VWKA 4WUUB 5EU3A 3JTTA 4UZGA 3IDMB 25C8L 1PX3A 4G8GD 3QXWA 4Q6IA 1YZZA 3Q6FA 1CWVA 4KK5C 1L9NA 5B4MD 4NKMA 5DJ0B 2MNUA 3OJMB 4NKDA 1JGLH 3BZEA 1MLCA 4JRYB 3RL2A 4XNUH 1JZ4A 2JLLA 4YBQD 5INDA 1P4IH 2O61B 5D8JL 1AD0A 4K94H 3WBDA 5F1NB 4DFHA 3E3QE 5T1KD 5IW6A 3VW3H 2IQ9L 1XGPA 4LCYB 1X7QB 3ARDC 3ZYZA 3GB7A 3HE6D 1A8JH 4HWBA 5SX5K 1JPFB 4KHTL 2A77L 3QXTA 1JGDB 3T0ED 2OCFD 4M8VA 4Z7WE 5KSBE 4PJ7B 4OZIA 3EDEA 5DR5L 4ACPA 2HVKB 5LWYL 3FZUC 2NW3A 2RHEA 1BZ7B 4Z7VB 3O0RH 1TJHH 4WY7H 3RNKA 4ESKA 3LMJH 3FO9B 5D1ZC 1QSFB 1LD9B 3DMMD 1WAAF 3V8CA 4DW2L 4PJ5B 5CJOL 5DHXB 3JVGA 4L8SB 4L3ED 4D9QE 3TO4D 5DD5L 1F00I 5J1SC 1GZPB 1SM3H 2Z0BA 1CGWA 4Z95L 2YK1L 3AXLB 3UBXI 35C8H 2H8PB 3GSRA 3MPCA 1F3DH 32C2A 3OWEA 2WUCL 4NQDB 1IGCL 3KDMB 5HYQA 3C6SB 4ZUTA 4NRYA 3D25B 1RD6A 3O6FD 4UB0H 1RQ5A 5A2KH 3I02B 1KCSL 1T7VA 3F58H 4XXCA 3MRNB 5IK3B 5BZWA 2ZG2A 4G80A 3DGCR 3ARBA 1S9YB 4TVSa 3ARDB 25C8H 2CUMA 3QUMB 5JHDB 2OK0L 2D4FA 4NZUH 1J12A 1NPUA 5EIVA 1LQSR 1X4YA 1C16A 1CDYA 3OJ2C 4YHPB 4TNVK 3FQTB 2GSIB 5AAWA 4XP6L 1DN0B 1EAPB 1KG0A 3MLTB 4JPVL 1CK0L 2V5SA 1UB5A 3UPRA 3QXUA 4GW5A 3MBEB 4RX4A 3IXAA 5D1ZB 4RGOH 4OKVA 1NCTA 5D7JD 1WICA 5D8JH 4HWZB 3ZMRA 4KMLB 5DTFB 2J8OA 1NC4A 3KPOA 1J8HB 1WVZA 1IM3A 4K23L 4KHTH 2A77H 5EUOA 2EDHA 4HGKC 2WBJD 1K9TA 1KYOJ 5GS3A 5DR5H 2NY7L 3WS3A 3LEXA 3FO1A 1B88A 2GQHA 5D71L 1K3IA 5EO0A 4JFOA 4DW2H 5CJOH 2NXYC 1JNNL 4QHMB 3WXWL 3TBVA 3OAUH 1WTGT 3RTQA 5DD5H 4LSSH 3Q0HA 3U4AA 1OAXL 2YRPA 4EI5B 1ZS8B 3UJIL 2BNUB 2HRPL 5ADPL 4Y1AD 5IBUG 2YK1H 1WQVT 3U2SB 3VRLE 4H8WC 4RQQB 2BVTA 3FB6A 3PIQB 3PWLB 2WUCH 1IGCH 2YBRB 2ZSWB 3MO1A 5F7YC 5DD0L 2XACC 5LXGH 4Y8AA 1YY9D 3MRQA 1JHTB 1KCSH 4YHMH 1W8NA 4HGMA 3VXUB 1JWMB 4MA3A 2X4OB 1H8NA 4JKPL 2OK0H 4LPCA 4OZHA 1QRND 3H9SE 4XBPA 4LFHG 1FZMA 1BVZA 2IFGA 3IU3B 1CXEA 1Z5LA 4XVUC 3CPLA 4HX1A 3MZTA 4XP6H 2ADIB 4JPVH 1CK0H 3DXAB 1MEXL 4RGNE 5HHQA 2VYRE 1MCRA 3WDIA 4HG4J 3VXTB 2F5AL 3KYNB 2C7UA 1MCDA 2NXYB 5D6CA 3REVB 3FT4A 1A5FL 4R4FL 3HE7D 5DK2A 4NRXB 1OTSD 3O3DA 1C7SA 2ATKB 2X10A 5D7IB 4XAKE 4Z0XB 1JZ7A 4DQOH 5HYJD 1YEGH 2O26U 3GSWB 4PJEF 3QBTB 3T8XA 1U2CA 1U41A 3CFEA 4EQ3A 4JFEA 2NY7H 3SJVE 3PUCA 1MOEA 5KVMC 1M7IB 1I8KA 5AYUL 3WFHB 2PETA 2VUOA 4NQEA 4P49A 1BGXL 3HG1E 4K7PY 1WIOA 1OAUL 3HZVA 4OIAA 1WWBX 4GBXA 1JNNH 2ICWA 2NQCA 1NJ9B 4G6KL 3LDBC 1UT9A 2JIXB 4NQXB 1EXUB 3PP3H 1EFXB 3AS0A 1OAXH 3UJIH 2R2BA 1QBML 2X70A 2EXYD 3QUXB 5ADPH 3RIAK 4CGTA 5GPRA 2WBWB 1PX4A 2COQA 4D8PA 2WMPA 5HHOD 3IAGC 3IFPB 2NY4C 2R39A 1U8PA 3RVVC 4JKWA 4K55A 1WCBB 2VC2L 4KKAD 5IROC 1QSVA 1NGZB 4Q58C 1V8HA 5BVJA 1KLUA 1RJYA 3VXSA 3EFFA 3V6OE 3QQ3A 1KTLA 4QHNB 1EO5A 4D0CA 3KS0H 5IKCB 4HUKB 5H94B 2VDKL 3W39B 3LQAC 4IRJC 4PREB 3SE8L 1P5VA 5BS0E 3SGJA 2CKBH 3JV5A 3CFCL 4HMCA 1MEXH 3RPIA 1F8TL 4OD1L 2F5AH 4NWUL 4NQSA 3FO2B 1ZHNA 1II4E 1FJ1A 3MRPB 2X4SA 1A5FH 4R4FH 3G04B 3RWHB 4P2OD 2BY0A 2Z8SA 2P5WB 1I3RB 3CVIL 4QLRA 3U9UB 3LDBB 5B8CA 2AEPL 3GO1L 3I6KB 4X5XB 3ZL4L 1RUMH 3MLZL 5JPMA 3BH9B 1NBVH 3WIHL 1Q1JL 3SCMD 4Q2ZA 5IIEA 5I71C 5C08A 1HHHA 4O9HH 2BVQA 1BGXH 2GW5A 1AR2A 5IOPB 1OAUH 4JFPA 5FGBC 3ARSA 4G6KH 3VXOA 1HCVA 2XN9B 1T20A 4KTEL 1LEGA 5DJZA 5F7DA 1QBMH 2DQEL 2XY1A 3HA0A 3DRTA 4XNMB 4L3AA 3CMGA 4MS8D 3BIKB 5LKNA 4RAHA 3NACL 2XNAA 2LAGB 5KSVA 5E6IC 2GCYB 1S8DB 3OR6A 4OV6F 4LKXB 4TNWF 4AY0A 3JWNC 3X11A 3EYFA 4QWWC 4FA8A 4XPBH 1FPTH 2VC2H 4X6EA 1JBJA 3F7QA 2AV7B 5L2KB 1FNGA 1UEMA 3IJHA 1FZJA 1IEBB 2Y9RT 3V6FB 1OTTD 3IDJB 1K5NB 4P57B 3QDJE 5B3JE 3MV8E 1PYWB 3T0AA 1KN2L 5HDBF 3NA9L 2RGSA 3CFCH 1XGTA 3GMQA 4NJAL 5AG8A 4AZ8A 1F8TH 3PDOB 3N50A 3QEQE 4X9BA 3S35X 4OD1H 3FB7B 4NWUH 2ZNWA 4HFWA 5EORL 2CO6B 1JV5A 2P8LA 3FQXB 4GW1B 4WI3A 5J6HA 2WWKT 1SJEA 3DX7B 4ETQB 2OL3L 1CFVL 4ZTOL 4EOWH 5DDHA 2AEPH 2VLLA 3MFGB 3EHBC 3B5HA 3GO1H 5CP7B 3N1MC 5EOTB 3ZL4H 3MLZH 5CJQL 3WIHH 5DK0A 2PTTB 1Q1JH 3WIFA 1RIUL 2YRZA 1ULVA 5I2IB 2V2TA 1R3LA 4XBGA 1OGAA 4ZD3H 4Y16D 5E6IB 2BOBA 1IRAY 5E8PA 3LOWA 4NZRL 4OAWA 3GJFB 2MQCA 4G43A 1VKXA 4WU7B 3I50L 3VXRB 5DJ6A 3TT1L 5D7LE 3SE3A 2CLZB 3U48A 4TTDD 3EO0A 4NJ9L 2EDTA 3E6FB 3KPSE 4J4PD 5CGTA 2DQEH 1CIDA 1SQ2N 5JLZA 3MOBL 4U1IB 3ARGC 4AL8L 3L3GB 3VFVA 2WP3O 4HAGA 2IJ0C 3MA7B 4PRAA 3CVHA 4P9HL 4OZGA 3G5ZB 2HLAA 1CI5A 2ED8A 1N4XH 3IGAB 3B2UC 1U93B 1IGIH 1URLA 3K1DA 2Q6WA 2HFTA 1F4HA 1AGCB 1ES0A 3IJYB 4UUJB 4ODBD 5JOFA 1FL5A 4LSDA 1VCAA 3V5KA 1C12A 5D1XC 1CL7H 4MXQC 2ILLA 2L4OA 2PO6C 4ODXA 5FCUL 1AR1C 5D72H 2HFEB 1D5MB 1J0KA 4MQ7B 3KXFB 4XMLL 1ZLUK 3X13B 4NJAH 4WWID 3MNVB 4HLJA 3CJJA 4F9PA 5EORH 3RVTD 1G7LA 1XZ0B 1NEZA 5TDNB 4PJIB 5DJCA 2A6KA 3L1OH 2FZ3A 3O3AB 3NCCB 4M43L 1G7MB 1ZA6A 2OL3H 3MRCB 1CFVH 4ZTOH 5HI3D 2ZUVA 3CUPB 3RY5A 3OKOA 3MLVL 3KYAA 3PGDA 4PS4L 5CJQH 2W0FB 1QVOA 2DD8L 1R24B 1WBZA 2MOVA 3CSGA 1RIUH 4WWKD 3FAXA 3GMMA 4Z7WA 5KSBA 3H8NA 3TBSB 5E6ZA 2HWZL 3P0VL 4V2BA 4MWFB 2EKJA 4NBZB 3DO3A 4NZRH 1ADQA 3ECBB 3I50H 1Q8MA 1JPGA 4M48L 5DC4B 2BZDA 3EUUA 1ITBB 1ETZA 1DVFD 1MCPL 4O02H 5TE4L 3TT1H 4K3DL 4PY8I 4F7EB 4NJ9H 4MGXA 4P2QD 5D1XB 3FRPG 1L0QA 4LRNL 3MOBH 3ARUA 4FQCL 4LNRB 4AL8H 3EDJA 1JGVH 1MCWW 2PW2A 4P99A 4OV5A 2Y07L 3C5ZA 4P9HH 3TYGL 4YJZL 1XF3A 5BCAA 2PCPA 5CD5C 1MAML 4KY1L 2VR4A 5C6TL 5J6GB 5ETUB 2W60A 3IKCB 4PRPB 5F7LB 1ZGLB 2IALB 2VLKE 1NUNB 4PJ9A 4FFVD 1KTDA 3B43A 1EHAA 3RZCA 1IQWL 4YNYA 2AJ3B 2CRYA 4WHYH 5EU7C 4A2MA 4JN1L 5EN2A 3W82A 3G08B 4HDIA 5DO2C 1I3GL 4U7SA 2A73A 1I7ZA 3H2WA 1H8SA 1D6VH 2IF7A 3DVGB 2D31B 4CVXB 1QO3B 5IMOB 4HUMB 2E6QA 1GOGA 4AENB 1NEUA 4WVRA 4X0KA 43C9B 4M43H 4QHUB 5JW4R 5C1MB 3S35H 4PUBL 4FN0A 5KOVC 1A4JB 1MQ8A 2YD4A 1DQQA 1QD0A 3RZWA 4PS4H 2Q86A 1UB6B 2EC9T 5F89A 3WEXA 3TC9A 1RMFL 3JWDC 4G8IB 1HYSD 5DRZA 2HWZH 3P0VH 4ISVA 4Z77A 2Y06H 3UCRA 5I8CA 1BM3H 4IRSC 3ARXA 4EN3D 5JZ7D 3EO1B 4WEUD 1HXMA 4M48H 3SKOA 4MDJA 5C71A 1EK3A 4XX1G 3ULUE 1MCPH 2C3XA 4K3DH 4MD0A 4I9WD 1FVDA 4M6MH 5JW5B 3CH1B 3QI9D 4X9IA 1LP9F 2ITDB 5FGCB 2AK1L 4FQCH 4LDLB 4WEBH 2ATPA 2D7OA 1OWRM 2Y07H 5CP3H 3AVEA 4MAYD 2GT9A 1B0GA 4ZFFB 2V6HA 4R0LC 1CFBA 3GSXB 3RJQB 2EIBA 4C55A 1HSAA 2FGWH 4FQLL 1FCCA 2VZTA 4ODWB 3B9DA 2XZZA 1IQWH 4C59B 5C0EB 1PJ9A 1G6RL 2RR3A 3EOTL 3H9SA 4HIEB 2MQ3A 3IFNL 1LK3L 2NXZD 4JY4A 4OBSA 4AEEA 2BHYA 3VRJB 3LKQA 5CD3A 3ZDYF 3ZE1E 5EO1A 2HN7A 2N4IA 1NFKA 1P1ZB 5F7FA 1FO0A 3LS5H 4YIQB 4XI5D 3UTSE 2HTKC 2Z93A 4C56D 1X5LA 5T3XE 4PUBH 3NCJL 4CJ1A 5FO9B 3UTPD 5J7CC 1TLKA 1YNTB 2I27N 2VB5A 3VD9A 2VQ1A 1YPZB 2A74A 2Z31A 1BD2D 1RMFH 1PG7X 3OJDB 5GZND 4R7DA 4LRIC 5CEZD 5I1GL 1RZJC 4IIQA 4N5UA 2XTJE 2I07B 4O00A 3SJVA 1FN4B 2DKUA 5I73C 2IANB 4R0LB 1U8QB 1U8KB 3HG1A 2CH8A 3MLXL 5JA8B 4WTWA 2YWZA 4DOHE 4CNIA 4U1KA 4L9DA 4HUUB 1IAOA 2FL5B 3HMXL 1N6QL 2AK1H 2VXUL 1C7TA 5IVZB 1BOGB 4JY6B 4PLJC 4I0PA 4QRUB 3KNBA 4JR9L 4WENB 3MRMB 1JJUA 4Z6AT 3UTZA 3QEGL 3VH8A 3FQNB 3QG6A 3QA3A 2EEAA 2OJEB 2YPLB 1BMGA 2NX5E 1I85A 5FYJU 2NY3C 5ERWB 1ZWIA 3BZ4B 3VFNB 3O8XD 5DJ8A 4B7IA 4S2SB 4EUPG 4KI5C 3WE6B 2YSSB 3V6OA 1G6RH 3EOTH 5HGHA 4WW1A 3IJSB 5EU4B 3IFNH 3ZKXC 1LK3H 4X6DB 3LB6D 4ZS7H 1JYNA 5BS0A 1I8IA 4PJDF 1YNLH 4ZXBC 4MA1C 5KS9E 3DRQB 2VZSA 5I66A 2VLRD 1TVHB 3MV11 5JHLL 1UZ8A 4Q9BA 3UTQA 4KMQA 3QEUB 3BOVA 3BWAB 5ILTL 1MCNA 3L3KB 4HUWB 2HFFA 4NC2B 4NZTL 3GHEL 3NCJH 4PJHB 4Z7UF 5L2JB 1Z3GL 5B3NA 4BA8A 5IFHL 5DUML 1FAIL 5EBWA 5I1GH 4GSDL 1W0WA 1S78C 3P77B 5FYKU 5FO7A 4G6JH 1PG7L 1AGEB 3EBAA 3LRHA 4K8RH 1INQB 1KJMB 5DRXA 4HPOL 4FQHA 5DJDB 3RA7L 5ESAB 2YD3A 4P0DA 3K7UA 4RISL 5FKAB 1U3HD 3HFML 3HMWL 3IDNA 2NY3B 1HSBB 4X7TA 5TF0A 1JNJA 3HMXH 3QCTL 3OPZH 3OKMA 1HI6A 1N6QH 1T04B 4DVBA 2VXUH 3P40A 4TPRH 3PXJA 4JFHE 2AJZB 4JR9H 2E6JA 5GGQL 3ZKXB 4PJFB 1QRKA 1GAFL 2JJSA 4MA1B 4ZXBB 5DD3L 3NCEB 1KGCE 5HVWA 3QEGH 3U6RB 4F58L 4M1CC 3DX9A 1FL6B 3VXNA 5D9SB 3SBWA 2XG4A 4KH2A 3SOBH 1WFTA 4Z0BH 4S11A 3MRLA 4QRPB 1PW3A 2RIKA 3C6LC 4IDLA 1AFVL 2HAZA 4GAYB 5HHMD 5JW4M 3QDJA 2BHZA 3MV8A 3QO1A 3FFDB 2W1NA 2I25N 3TFKC 3NCYS 1A6VL 3D3VD 2ICES 2JE8A 3F6LA 1UCTA 3QEQA 2Q8AH 5JHLH 2LQRA 4PJ8C 4BJLA 4DKAA 1ZA3A 5ILTH 5DYOB 4ZS6D 5BRZD 4NZTH 4ZDHB 1Z3GH 3QDGA 3PQYE 5KTEL 5IFHH 1QBAA 2EDDA 1S7QB 1EGJL 5DUMH 4PJXB 3QAZC 3MYJB 5E4EC 1FAIH 1IEAB 1VADA 5HD8C 1MCWM 1MCLA 2WQ8A 3UPCA 5MEPA 3JUYA 5DWUL 4GSDH 1U92B 4BZ1L 3C8DA 4GLRI 5HYSA 4A6YL 1S9XB 4JQXA 1PG7H 3R1GL 3UJTL 4RFNB 3BDYL 4HPOH 3U4EA 3RA7H 5D1QA 1CN4A 5I1DB 5C07B 3QIBC 4RISH 1EEYA 3HMWH 4JFFB 1LDPL 4LMQI 1EJOH 2YUZA 1FGVL 4XNYL 5D7LA 1G7IB 1X3DA 3C6LB 5LAXB 4JZJC 4CMMA 3KPSA 3RHWF 4JAMA 3THML 4UNVA 2DQGL 5CHNB 5GGQH 2P5EB 5FF6B 4HAFA 1GAFH 1RK0B 1U8OB 3O81A 5DD3H 4F58H 4HKZB 1ONQB 2KL6A 4PJ8B 1KACB 5JXAL 3WNKA 4PJGE 1C08A 3ISWA 3UXFA 3BHBA 4J8RA 1Y18B 4PRHB 4M1DL 3B8YA 4WUKL 4XH2B 1BHGA 5DI8B 1AFVH 4OI8A 4RMWA 4FABH 3QAZB 5E4EB 4JJ5A 4JGMA 3KYOB 4KRPC 2VLJD 1C5DA 1A6VH 1K4CB 1BX2A 2YOCA 4R2GD 3QB7C 1F3JB 4RNRB 4JHAL 2X4TA 3IDXL 3QIBB 1F6LL 5GRXG 3BDXA 5KTEH 3MUGB 3KPMB 3TWCL 4X4XB 1EGJH 1TZHB 2OTWB 3RWJA 5CLTA 1ZLUH 4AH2B 3GBLA 4JZJB 3ZKSD 2LU4A 5DWUH 1A4KA 3NIFE 1IKNA 4BZ1H 4Q74A 4A6YH 1TITA 1HH6A 2BSSA 4Y4KD 3BZFA 1CU4L 4JFZL 5F3HB 4KFZC 4U6YA 3R1GH 3UJTH 3BDYH 2K7PA 4AEIH 1TTUA 3VH8G 3QH3B 2LABA 3VWKC 1JI1A 4X4YA 4OJFL 3D39D 1T0MB 3BIAX 1KJ3L 1LDPH 1T4KA 1X5IA 1Z0MA 3OB0K 4OQTA 2DJ4A 1FGVH 4I18A 1V3MA 3NTCL 3WJLC 3SDCB 1IGYB 2FIRT 2UZXB 4UBDD 1G9NC 5DRNA 3THMH 4XWOD 1DN2A 2AEIT 3FN9A 4KRPB 2FHFA 2F54E 4XVSL 4XNXL 1N3NA 3LSOB 2HMID 3NOIA 4HKBA 4F33B 1KNOB 3RI5K 1YQ2A 5LQBL 5JXAH 5MP6L 2B5IC 2VLKA 3GSVA 1S9VA 3B2VL 1FG9C 4JRXD 4WUKH 3K81A 3OKLB 1S7SB 3TN0A 1IM9A 2SEBA 3I85A 4M6NH 1QSEE 3L3HB 3H0TB 4Y5YA 2X42A 1MJUH 4WI8A 3SKUD 2IWGA 2WLYA 1KB5L 3TO2A 4OLXH 4DEPC 5ACLA 3FKUS 5IESL 2V2WA 1S7UB 3B8SA 4JHAH 3VWKB 1WIPA 3IDXH 3P9LA 5JPNB 2X2YA 2YUXA 3Q6GH 3EW3B 1GGYA 2BSRA 1A9BA 3Q6FB 1AQKL 1OP9A 1QLRA 2QJDA 1R5IA 2NNAA 4NOFA 4NKMB 4QGTA 1DQLL 4JFXA 4Y5VA 3WHXB 5KW9L 3VXME 1T1WB 1E4KA 2DLFH 4OUUA 1P2CB 5KN5A 4P5MA 4BH7B 4POYA 1R3KB 1N5YL 4IOFC 3I3BA 1CU4H 1M71A 4JFZH 3F8UB 3ZKND 4DTGL 4U7KA 4MNGB 1GPOL 5IBLC 4APQC 3ARBC 4OJFH 2D7MA 4HK0A 5MHSE 3AU1B 2B5IB 1KJ3H 3HPJA 4HV8B 5FGRA 1CICC 3ESVF 3RKDC 3NTCH 4D9LL 5CEXB 1I8LA 2APFA 1FDLL 4LLYA 2CLRB 2GKIA 1CS6A 3RNKB 3I6LE 4O2CA 4NO3B 2BVOB 3GJEB 4QHLA 4XNXH 4XVSH 1I8MB 4QXTA 4WFHD 2A1WL 3BQUA 2R1XB 3OHXA 4GRWH 4X6CE 3STZA 4U1HA 4DEPB 1W0VA 1F4XH 4JFDB 1VACA 5MP6H 5LGJB 3FQRA 1L6ZA 3MV7E 1YMMD 4X7SL 2QR0A 2R1WA 3B2VH 2E7LC 5IW1B 5F88B 4N9GA 2CDEA 1A3RL 2MKLC 5C0CE 32C2B 4L3EE 3EJJX 1U3ZA 2I60L 5HYQB 2EH8L 4NRYB 2QSVA 4YHOL 2XKUA 1ZVSA 5IBTH 3X3FL 5HYSG 4MMZC 1KB5H 3V7AE 2GAZB 3BO8B 5E2VL 3ULVD 4YQXL 12E8L 5HXMA 2ZOKA 5IESH 1FVCA 4APQB 3ARBB 4MMXC 1GGIL 1NAKL 1VFUA 1HOCA 1CICB 3AY4A 1BWMA 3BEWA 2DI9A 3UTSA 4LP5A 4DCQA 3BGMA 4MCYA 1AQKH 4PRID 3ZKMD 1C16B 4PJEB 1OT2A 4PY7B 1DQLH 5KW9H 4KQ4L 2PYEB 2VE6B 3HRZA 2HT4D 2JTDA 3WMSA 3MODL 4GW5B 3O4OC 4ZO8A 2NY6C 2CJUL 5IGXH 4DTGH 2K3TA 5F9WC 1BZ9B 2QKIA 1GPOH 3N85L 5DRWA 2VERN 5GJSL 2BVEA 1F6FB 3GJFK 1A7PL 4D9LH 1UACL 4QOKB 3RWGB 3RY4A 1FDLH 4LLWA 3HAEG 3HC4H 3WS3B 4NZDA 4XPGL 4FQXD 3FO1B 3B9EA 5M7QA 4DUVA 3LKNB 3EKCA 2A1WH 5E8DL 5EO0B 2EICA 5F1IA 2Y23A 1NMCC 4JQIL 4ZAKD 2EYSA 4X7SH 1N7MH 4ELKA 4XP5L 1EEZA 2F19H 2W91A 2NX5A 3HC3L 5FUOL 2ZP0T 4I2XB 3VCLA 2NR6C 1UM6L 5C9JB 1KN4L 1FL3B 2I60H 1N8ZA 1DBKL 3DUSB 3HS0A 2ZCLH 1PVHA 3N1FC 4YHOH 3CSYB 1KEGH 3O4OB 2NY6B 4R26L 5F9WB 2NPLX 4Y1AE 4YQXH 12E8H 5KS9A 1H3PL 2VIRA 1GGIH 1IC4L 1NAKH 4BSVA 4TNVF 3VGGA 2OYPA 3ARQA 5HYFA 4MSWA 3RDTB 1E28B 1YUHA 4E41E 1HZHL 1F4AA 4FTVB 5EU6B 4HX1B 1EMTL 4TN9A 1Q94B 1MI5E 3QDMD 1A6ZA 2ZCHL 4KQ4H 3KYMB 3V95A 5CJ5A 1FNHA 3QIWC 3ZHLA 5HHQB 3MODH 2DM3A 1HEZA 3JUZA 3U9PH 1KPVA 3ROLA 2CJUH 4F8TA 1CD1A 3ME0A 3O4LD 2PW1B 3N85H 1H3TA 3GEWB 3P3YA 3N1PC 5DHVA 3C9NB 1IILE 3O3DB 2R29L 5E8NB 3TBYB 1NMCB 3ZE2E 3BGAA 4N5EC 1A7PH 2ZUUA 4OCLC 3H7LA 4P46D 1UACH 2Y6SD 4HEPG 2HFGL 4H1LA 3ILPB 4YHIA 1MIML 5DJAB 4IDJH 4JPIB 5IHZB 2AVGA 5I1LA 3K8MA 2P8PA 4XPGH 1EZVY 5AEAA 5MEOA 1I8KB 3DROB 2F8XC 4ODHL 5E8DH 5AUMA 2HJLA 1XF2A 5C0BB 4K3GA 2OTUB 3GBML 1OF2B 1XGYL 1EEQA 5B8CC 3MJ8B 2VDNL 4JQIH 2LVEA 1G7JB 2R2BB 4P5KB 4XP5H 5FUOH 1RU9L 3HKFA 1UM6H 2BOCA 1KN4H 2PXYC 4NNXA 3SDDD 3QIWB 1MH5A 1XIWD 1JFQH 3BN3B 5C0AD 3UAJD 4P4KA 3WD5L 1U8PB 3WNOA 4R26H 4PD4K 4KPHL 2X44D 2EEBA 5ANMB 1U8LA 1H3PH 3W9DA 3WNNA 4DUWA 1ZT4B 3F5WA 5BVJB 1IC4H 5EO9A 1JGUL 5FUCC 5HHOE 1OCWH 2VITA 4WIQA 1EA9C 1KTLB 4L8CA 1U42A 2E7HA 4WUUD 1FZKA 5HPOA 4FXLA 4G7YH 3PQYA 2BX5A 4P2RB 3WS6C 3QJHB 3HZYA 1EMTH 1NC2B 2ARJA 1E6OH 2NZIA 2GFBB 3RPIB 2ZUSA 4HFUL 4P4RB 4UINH 1E4XL 1XGUB 2EDEA 1FJ1B 1NFIB 5DJYA 5DC0A 2OMBA 3G5VB 5FK9B 1MFEL 2R2EB 2X4RB 2R29H 2DYPB 4JRYD 2R69H 5CMAA 1NGPL 5B8CB 2C5DC 4K7FB 4GUPB 3MLSL 1FAKT 4TSAL 1F3RB 2HFGH 2GJ6A 4KK8D 2PYFA 3DVNA 3DETD 2PXYB 3MBXL 1KV3A 5TDPA 1CLOL 5DVMA 1W72B 4BYHA 3OG6B 2BVQB 4ODHH 2O93L 1FSKC 3TBTA 4F57L 2NYYC 3GBMH 5TQ2L 3RIAF 2A0LD 1XGYH 1QSFD 2CGRL 2X7LA 1S7RA 1G0XA 1AD9B 4S1QL 4PJ