2EIZA

Crystal structure of humanized hyhel-10 fv mutant(hw47y)-hen lysozyme complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
EIVMTQSPATLSVSPGERATLSCRASQSIGNNLHWYQQKPGQAPRLLIYYASQSISGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQSNSWPYTFGGGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Critical contribution of VH-VL interaction to reshaping of an antibody: the case of humanization of anti-lysozyme antibody, HyHEL-10
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/hydrolase
molecule keywords ANTI-LYSOZYME ANTIBODY FV REGION
total genus 24
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2007-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2eizA00
2H8PB 4X9FA 4HWNA 5F6HI 1A3RL 1F3RB 4ZSOE 1A4KA 1A7RL 4OKVA 5IOPA 1G1YA 5FDWA 3TWCL 5D71L 1N7MH 1LNUA 3LN9A 3P11H 2FL5B 2W92A 4DGYL 1S7XB 3G9AB 2Z31C 5SWZD 4YZFE 3ULVH 1DEDA 1FH5L 3FRUB 5F9OL 1E6JL 3DYMA 4XNZC 3IFOA 1CFVL 3DVGA 5D1XC 1MCFA 1I1AA 4LBEB 4P59L 1FSKB 3WHE1 3TPUA 1WZLA 1Y6NR 1J0HA 1NMBL 3DOSA 3FKUS 4I3GA 3FQWA 4KDVA 3VWKC 4LHUD 2BVOA 4FMKA 3P0GB 2QKIB 5ELIA 3RVUD 5EOQL 3MRGA 1CGVA 5GS0L 4DTGL 3TESA 1BECA 4Y4HC 5J11C 3OKOB 5ETUB 3EIFA 3Q6GH 3DNKA 2VABA 4RA0C 5T3XL 3V7AE 5FDWB 2XFXA 2X4UB 2UVFA 4GW5B 5E95B 3TNMB 2NX5A 2MCG1 4QNPE 2ZZUT 3VFSA 5F88A 1QP1A 1NBZB 4X9IA 3UZEA 1M05A 5E8DH 1MRDL 5DZLA 4DEPC 5D7JB 4RIRA 5DJXA 1LO3L 5C0BD 3MJ7B 3TV3H 5HGHA 1T6VN 1J05B 1DR9A 3UTSE 2R2BA 3UTOA 1WITA 5KW9L 1NAML 4KVNH 3L5WB 3X3FL 1QYGH 4YHKH 5GS3A 2A9MH 2DLHA 1QSEB 4X4ME 3RP1A 2AVGA 5EPMB 3ILQC 4Q0XH 4X5XB 4RISH 4WI6A 3ZTJG 1J8KA 1WBYB 3E6HA 5CEXB 4X98B 3HPJA 4KKCC 4PLJC 4HUVA 1YEIL 5K59F 4XNYL 4HBQA 1X4YA 4YIQB 1T5WA 4NC1C 5C0AE 3BMWA 2VZ3A 5CUSH 1JWUB 1GVIA 2JJTC 3MACL 1F4XH 4MWFA 5J12B 3MV7D 4WFGE 1PEWA 1F90L 3ARUA 3UXFA 1HILB 1QBLH 3V4UH 3VRLF 2G60L 2DD8L 1IE5A 3WSQH 4S1DD 4DKFL 3CZFA 3IDMB 4X7TA 3L3GA 4GRWB 5TDPB 3RBGA 1Z5LB 3TH4T 4I77H 4Y16B 5BOPA 5CIPB 1OB1B 4G9FE 3BAEH 4M48H 5JHDD 5H8DA 2FATL 2YPKA 2VDOH 3PNWA 1OP3K 3TT1H 5EU3B 2ESVA 2P43B 2IH3B 1T5WB 1HYSC 4ELMB 4UUJB 4WCYH 5T1LD 5HI4D 1T7VA 3U7AA 1U0QA 3EYQD 4OGYH 3S7GA 4AT6A 5SWQB 2R0WL 3SE9L 1NGXA 4L9LA 2BNQD 5MEOA 1XF1A 1Z2KA 2FH8A 4OZ4A 3IETA 5F9WC 3KR3L 5CD3A 1E4JA 1JPSH 3JWDC 4WW2C 5KANG 4XH2A 3IGAB 1JJUA 4QTIH 1LO2L 3E8UL 2VLKA 4BA8A 4ENED 4PJIB 5DEFA 3MROA 4D0CA 2HG5A 1PZ5A 5D1QC 4XXDB 5C0CA 1QSFD 2VAAB 4LCCA 4W6XB 3ULUC 3TO4B 1C08B 1U8LB 5F9JB 2YPLE 1BQHG 5GPRA 4MXQC 3EOBB 2EYSB 3Q5TA 4UQ3A 4ODSL 4TUJB 1RMFL 4PJ5E 2B8OT 4N5UA 2QSTA 5LGHL 1SBSH 4X4XA 1NSNL 3ILQD 2WBJB 1WF5A 5FM8A 3QFJE 1UWGH 2XA8L 1T20A 1MCWW 5TDOA 4EKXA 5ENWA 5D7LE 4HUUA 4WU7B 1DSFL 4KK8C 4U7MA 4PV8B 5KSAC 3QXDB 1KB5L 1ZWIB 1IL1B 1F97A 1F4HA 1F2XK 4E5XB 1TJIL 2D7QA 1MAKA 4KRLB 1CDYA 1NFKA 3QXAA 2W0FB 1N64H 3MNWA 5GHWL 3U4BH 3QXUA 4D3CL 3STZB 3KPTA 5LBSL 1VFOA 1U8NB 3U30C 1JVKA 2VRAA 1OSPH 2WP3O 4NKOA 4QXTB 4TUKH 3GMMB 3RFZC 1MWAH 3D25B 1RZKH 3RL1B 4FQ2H 4JO4H 4H20H 3T0ED 4YHNA 5E2UH 4Q9QH 3VXTA 3HAEA 4TSCL 1BIIB 1MH5B 1N5AB 2ED8A 3AMLA 3OB8A 4PRHB 3I2CL 1S7RA 1OHQA 2BERA 5H94A 1FFOB 3GFUA 1T0MB 1YPZE 4LFHG 1A14L 4JPIA 4PV8A 4WO4C 4F8TA 5I0ZA 3GB7A 4PJEA 3QQNA 2X4SB 5INCB 4C59B 4JQVA 1C16A 3TPUB 3ULVE 4M6MH 5GSVA 3F6IA 3T0WA 1R3KB 2EDTA 3TIEB 4AQ1B 2ZUWA 4P46D 4PJCB 5K9JL 3JTTB 5FKPA 5I17B 2PXYC 4JQIH 3ZKMD 1PKOA 1C1EL 1OGAE 5CCKH 4TSBL 3PGCA 1B2WH 4D94A 5BVPL 1EFQA 1Q0XL 3HZKB 5GS1C 4NZTL 1XF2A 2C3HA 1A2YA 4XCYB 3AMKA 4HSQA 3MCKB 4ZXBD 3V0VA 1JV5A 3SDAA 2IQ9H 1NBZA 4N1CA 4NRYA 5DFVC 2BSRB 1MCPH 4M5ZL 1O7SA 1OM3H 3ZDXE 3FMGH 1YEEL 2W38A 4MX7B 1PYWA 4FQLL 5D7KE 1RI8A 5F3HA 3RIFF 4FQQB 5C9JB 1A9EA 2JTDA 4YJZL 1CLZL 5E2TL 3D48R 3WN5A 3MMEA 4G7VH 4XWOD 3QIUA 3RVXD 1WVZA 1EMTL 2A6KA 5IFHH 3Q6FA 2FWOA 4PUBH 4WJ5A 4H1LB 3PDOB 1OD9A 1MCNA 3KWWB 3STLB 2F53D 5C0JA 3ULUL 4UUJA 2J5LC 4Y8AA 4Q97A 3H9SA 1MCCA 4O58L 1ED3A 3QULA 3MLUL 3LRSB 3QJHA 4KKLC 3FZUD 1YY9C 4LCWE 3EHBC 5AAWA 5IBTL 1JHLL 4DVBA 5E2WL 2HKFH 5HI5D 4NNPL 3F58L 3PQYE 1SM3L 1PBYA 4FQIH 4KKBC 2A73B 5EZOL 5FYKE 4GG6F 3G5ZA 3VI4F 1FDLH 5F7NC 3CLFH 1O0VA 5DJ0A 4MAYA 5AZEL 1I9EA 4J7RA 4JHZA 1HIMH 3GSQA 3MRHB 1KEML 5DC0A 1U42A 3O0RL 4DKDC 4XNXH 3FOLB 3O8XD 1E4KC 3QUYB 4FFVD 4ELKB 5I18H 2QR0A 3CLEH 1J1OH 3SDDD 3H0TB 1OPGH 5E8NA 4FFVC 1MELA 4OAWB 3FT3A 3QDHA 4NO0B 3WJLC 2P1YA 3ECBB 4G6FD 4R8WH 3OAYH 2J6EH 5F93C 3WXVH 5DJ8A 3T77B 4TSBH 1JL8A 1MFBH 3NFPB 4J3SA 1QSFA 4G43A 1XMWA 1R0AL 4DGYH 2ADIB 3SO3C 3DARA 1PFCA 5C0NC 1YNLH 3OMZA 4OTXL 4AEIH 1ORSA 2I27N 5ACMA 1CVSC 5TDOB 1LEGB 2BVTA 5CIPH 4RFEB 4YBLC 5LG1A 2CPCA 4NM8L 3B5TA 5AEAA 4X5WB 3KYOB 4G3YL 5FUZL 5HYSG 1CFSB 5C2BH 1QO3B 2X4RB 4DW2H 4U2ZA 4LSVL 4GBXA 1SJHA 2UV3A 2BY2A 3WD5H 5F1NA 4K8RD 3T65B 1T21A 3I6LE 2MCPL 4UINH 3TGXA 2ARJQ 1UZ8A 1XR9B 4Y1AA 3FFDB 5ALCH 1X5IA 2VDQH 3LV3B 3D2UB 3VRIB 3PWLA 5FGSA 1JE6A 2X09A 1B88A 4IOIB 2V5TA 4K9EL 1QPXA 4NN6C 2X1WL 1B3JA 2AEPH 2JJUA 3H9YA 1ZTXL 3O45A 3PUCA 3KAAA 1Q9WB 3MXVL 1IEBB 4LEXH 3W5NA 1ZA6B 1KJ2B 3NIFE 1JPTL 2YSSB 3MNVB 1T1ZA 1GGYA 1IC5L 1U8KA 1QO3A 4MAUH 3QDGE 4HMEA 4OCLC 5CZVL 3WS3B 5I75B 4Z6AT 1XGPA 3P30L 3EYSH 3T0BA 3RZCD 4LDLB 4QRSB 4OM1L 4P23D 2NY4B 4JN2A 5I8KH 2B39A 4Y4FC 4N1HB 2FSEA 4X6DE 3B9KD 3B2UD 1GHFH 4FQ1L 4PP1C 5L8KB 3JTSA 5C08E 4YHMH 3ARSA 2P42B 1NCWH 3VH8A 4GH7B 4XVJL 3AVEA 4BFIB 2PXYB 3MUZ1 5IQ7H 5DMKA 1ONQA 4UV4L 3I3EA 3L5HA 1JYWA 4TVPE 2HT3D 4Z5RB 3VXME 3RUGE 1FZKA 2QSCL 4JRXA 2ITDA 1H3XA 2VISB 4OLUL 1DQDL 3BIAX 2G9HA 3ILPA 1X5KA 3VXQA 4CVZB 3H8NA 3NCJH 4FTVD 1AJ7H 1ZHKB 3HPJB 4S0TD 4M62H 1QBML 4HC1L 2QQNH 3UROR 1DEEB 5HVWA 5D6DC 1RZKC 3TZVD 4GFTB 4U6TA 3D0LB 1JFQH 5E2VH 4OGYL 5FV2A 2VMFA 2BC4B 4AIXA 1K9TA 5TF0A 2R0WH 4U3XA 4U3HA 5JDSB 1EPFA 3G08A 4YDKH 3VXRE 2FWOB 3TVMA 3DGCR 2WNGA 1J05A 2EDYA 1LWRA 1LHZA 3MXVH 1K85A 4LEXL 1JWMA 1CIUA 2P45B 1NGZB 4NKMB 3U36B 2R69H 4I3SL 1I85A 2QHRL 4YLQT 5F7FA 5IUSA 3B5GA 4XPGH 5D7IE 3TNMA 2VXSL 3TBTA 4BSWB 5A3ID 1IBGH 1AQDA 4CMHB 2KZWA 4XWGH 3CX5K 1XR9A 1G9EA 3S35X 3A6CH 3L5XH 1A2YB 2ZUYA 5CJBA 5GRZA 4MXWL 2X40A 2K9UA 2N56A 2AJZB 1SBBA 1FIGH 2DM4A 2NPLX 1MREL 5DJAA 4F7PA 3G08B 2BNRA 5GS2H 1DE4A 4WWKB 2WWMC 1ZSDB 5IW6A 3BQUB 5GZOD 1YN7A 1Q9LA 4GRMA 4GG6A 2H9GB 5GZOC 2VOTA 1U8MA 4V1DD 1HHHA 1RJYA 1T0MA 5KW9H 5LGJA 1LEIA 2XA3A 1YEIH 3BP4B 4YNYB 1IAOB 2YA0A 3C5ZA 2Z93B 1AQDB 3RKDD 5C6PB 4V2BA 3Q48A 1PKQE 35C8H 3PWLB 3REWA 2OL3B 1XEDA 2ZOKA 3QBTB 1QBMH 1N6QL 3TO4C 4OZIE 1OSPL 4LVOB 3V6ZB 4J3UA 4OZGB 5C0IB 3SDDC 1KCVH 5INDB 4ALAH 4PGZA 4UDTA 1G7PA 3GKZA 4CKVX 3MRCA 1U3HA 1FZJB 5JOFA 4QTHA 2LE9A 1A6VH 3BSZL 4KQ4L 3HMXH 4D0DA 1N59B 3I9GH 4J8RB 2O5ZL 3VFMA 1VACB 4Y4KD 2D7OA 1WTGT 5IK3A 5JOEA 1BPVA 1EJOL 1QOKA 2E7LA 1T3FA 1PSKH 1TJGH 3O6FD 5EORL 3KLHC 3IFLL 2L7JA 4YUEL 1XGPB 2KH2B 1FZMB 4NSKB 2BOBB 4ZFOA 3OGOE 2Q3ZA 4UILL 3RDTB 3WDIA 3ARWA 1LO2H 3ECBA 3LQZB 4EDXA 5JOFB 1C12B 5E8NB 3RWHB 3QRGH 1K5NB 4CU7A 2E7HA 4TUJA 3ROOB 4OCSH 4BSJA 4WGWB 3MA7B 4TTDC 1RSFA 1JPFA 5HHNA 5DXWA 2DQIL 4I2XB 1ZANL 2HN7A 1ITBB 3C08L 4JRYD 3O41A 5KSUB 1P1ZA 3TNNA 5DSCA 4ZSOB 4E41D 3LQAC 5DD5L 2CR3A 2FECL 4CNIA 4QOKE 5HYSA 3QG7L 2PW2B 3CDGB 4NQXB 5FA3A 1V3MA 5T3XE 5I74C 5C0EB 1YEGL 2VE6A 3RHWK 1GC1C 2P8PB 4DOHB 2BZDA 5ACLA 1IGMH 1BQHB 2DM3A 1CWVA 1Q1JH 4LPTA 1WAAA 4PJDB 1RIHL 3LMJL 3RNKB 4H8WC 2VLME 5CD5D 4GSDL 5TE7L 4PG9B 5HI3D 1OGTA 1VHPA 3NIDE 3PG2A 2FLBT 5GXBB 5L2KE 3MLZH 2EIDA 4WU5B 1KJ2A 2XG4A 3O3UN 1J1XL 2G75B 2IH1B 2FL5A 3NH7H 1IGCL 1HHIA 5IESH 2DIAA 1BBJB 3TNNB 4NO2A 4OF7A 4N1EA 1K6QH 1H3VA 1A7OL 1I3GH 3BZ4A 3RIAF 1C5DA 5J6HB 2APXA 2D9QB 2Z91B 1RK1A 2BHZA 2XWTA 4LHUA 1EBPA 1XH3B 2K1MA 1HIML 3S3SA 4DQOH 1KEMH 3P4NB 3GJFB 1DLFL 1UM5H 3C60B 3GRWA 3TZVA 4LGRB 5FUOH 3QUZB 2YK1L 5TQ2H 2E8YA 1S78C 4JRYE 4PJXE 1QRNE 4Z0XA 3VI3F 2IJ0C 5IR1B 3RDTA 1QLFB 3EYQC 5KS9A 3N1MC 4OM0L 3SGDI 3BPOC 2R1YB 3LN5A 3O6FB 1UEYA 3PDGA 1OVZA 3LKSB 4OLVH 3GZKA 4G8IB 3QDJE 1I9RH 2OL3L 5JPMA 1ED3B 3QULB 1YNLL 43C9B 5J0BA 3CVHH 4NQEE 4HUWB 5IEKB 5CSZA 3C08H 5DF0A 5GGTH 2CK2A 2DJSA 2Y4SA 1DLHA 4KJPD 4HX1A 2XPGB 1N6VA 3HN3A 3BQUC 3HTLX 4PRPA 2ICES 3B9DA 3HZYA 4KK9D 3MV9E 2PYEA 4NHUA 3Q1SL 3B8SA 5F1SA 3WJJA 1MCSA 2CUMA 5DQ9B 3BD5A 4HF5L 4FXKB 4KTEL 4TN9A 4HK3N 3MRQB 4LQ1A 4G6FB 4OT1H 3RWEB 2Q76B 2P4AB 4I0PA 1IAOA 2BXZA 3MRMB 1RJZB 1EA9C 2VJXA 4CN1A 2VXTL 1WTLA 2AEPL 2RIKA 4YPGB 1QFHA 4LARL 2DYPB 3BH9A 4HIJB 4MLSA 2Z35B 3PV7A 4UT9L 4KKAC 3CDCA 1IQWH 3PV6B 2P5WA 3H9SB 4XPBH 4IOSD 1TJHL 2BVOB 4YBLB 1OP3H 2I07A 1BFVH 3U6RA 4XVSH 2M2DA 3DV4B 1HNFA 4HS3B 4F15C 4JCMA 1R3JA 4CMHC 5HJ3B 3FCTB 4FFZL 2X4SA 5INCA 1FLRL 4OCRH 4NQCD 4Z7VB 2BK8A 5GS0D 3NZ8A 4ZYKA 4OCXL 3D85B 2HJKB 3VFPB 1WEJH 3B9AA 4X9BA 4ELMA 3UYRH 5F7LB 3BZFB 3JVGC 5TQ2L 4ELMF 4LK4A 3RTQA 2ZCKL 1AGDB 2H26B 1P4BL 4Q74A 4QGYA 5GRYA 2NY7H 1T5XB 1ZHBA 2CQVA 1QBBA 4H0IA 2WBKA 3TCLA 4AIZB 3FAXA 3LV3A 4PRBA 1BHGA 4ZSOA 5EN2A 5EU6D 1MFBL 2P8LB 3KPOA 3LKOA 1MJ8L 4FFYH 5CHNB 4NPYA 4F7MA 5K9QI 3NCMA 5GGVL 3D3VA 2I26N 3HR6A 1CFSA 1NH6A 1T4KA 2XYCA 1NLDH 3QXAB 4KK5D 4LSTH 4MNQB 3MRJA 4YK4C 4O5LL 4KMTL 4LMQE 2GIYA 4X6EA 1JHKH 4YR6A 3VXMA 4DGIH 3BRDA 2VLJE 3CIQA 1ES0A 1G7LA 1HKLH 2ITCB 3B8YA 2W0LA 1FBIH 4R96A 5IVXF 5ADOL 4X5LA 2NY5L 3W9DA 4X98A 3PF2A 4QY8A 2O5XH 2M1KA 4OTXH 1I7UA 5F9AC 3QG6A 2XQYK 2O5YH 1TLKA 3DURA 3QXVA 4XB7A 5IG7A 3X3GH 4PY8J 3HE6C 5FIEA 4NGHH 2J6EL 4HXBH 1DUYB 3T2OA 3LIZH 3BEWB 4F7EA 3U7WL 2PR4H 1OB1A 4B41A 3MOQA 1VGKB 3QO0A 5SWSE 1A6TA 3IDMA 3ZSSA 4NBYB 5DT1L 2PXYD 3MPCA 3VXRA 4XPGL 1JK8B 2NTFB 3QNXB 4JFHE 1HEZB 2PKDA 3DJ9A 1C5DB 3REWB 5E94B 3TBVB 2OZ4A 3BKMH 1TFHA 3QZWG 4UNVA 1RAMA 2W0FA 1S8DB 3T0EC 1YEKH 2XFXB 4M1GH 5HPMB 4OCXH 4MS8C 4XPAL 5I66A 3T04D 2LVEA 4QLRA 4M1CD 5D7IA 4WI9A 3HA0A 1WWCA 3O9WA 1CE6A 3ABZA 4ISVA 2V5MA 3QUML 3SQBA 2PYFB 1H5BC 1R3HA 1EEQA 4XVJH 4I9WE 2BJML 1IC4L 2VIRA 1MQ8A 3U2SB 4JKPH 4IRSA 5DRXA 4NC1E 5DVLA 4EUPB 5JXAH 2ZJSL 2ZG1A 4PREA 1U6AH 5I66B 5HD8D 1MJUH 1GHFL 3X17A 3WDHA 1H3TA 1NAMB 3NPSC 4PJ5B 5DDHA 4AM0B 2HG5B 5EIIB 5DI8B 3BFOA 2IWGA 5T1DH 5CEZL 1NCAH 3EYSL 5F88B 3TBTB 4BSWA 3CFCL 3PHSA 2FX9L 1N6QH 1HKLL 5IIEB 4OM1H 1MPAL 1MJJA 4RQQB 2R2CA 2FEDC 4O2EB 4WFHE 2NY3C 3ULVL 4PLKC 4QGTA 4EOWH 2ZG3A 3DX8A 2J1KA 2AQ3A 1Z3GL 3MFFA 4KHXL 1XF5B 4FZ8H 2C3WA 1SJEB 2WBJC 3EYUH 3ROOA 2F8XC 4KQ4H 3X3GL 3FJTA 3SDYH 1URLA 3I9GL 5E6YA 3PHQB 1LO5B 3ZTNL 2EYTB 3DV6A 3T4AB 4RFNC 4Z7UB 3K74B 1TJGL 5EORH 5AUMA 3WL9A 1KJMA 3ME0A 5CEXA 2XQBH 5DD3H 3SOBL 4APQC 5EDXA 5GRUL 4QXGH 3CK0H 4YXLH 3UTZA 3ARED 1YEFH 5ESVB 1AHWA 4NN7B 4OCWH 4XB8A 4P23C 3AY4A 4KZDH 1NGYB 4MB5A 2NX5D 1UH2A 3VXTB 4HQQL 5FM5M 4ZMAT 5E1AB 3FN0H 4Q6IB 4EDWH 4LVNB 3L9RB 4NKOB 4QXTA 4ZTPL 5D7JD 4I1NB 4JKKA 1A5FH 4NOFA 4MYWB 4HUMB 4D2NA 1UZ6F 2UY7A 5FB8A 5INDA 1NGPH 3RWIB 4Z7VF 2R4SH 3CU1A 3BUYB 5DC4B 5H2BA 3O8XA 2R69L 3PWUA 4MQSB 2A9ML 1ZHBB 1QRNB 3ZT5A 3IDXL 4XBPB 4LGSB 5F6HJ 4YO0B 4NJ9H 1ZLVH 4LF3B 1JF1A 3JV4A 4OZFB 3B3IB 3OAZH 4HUXB 5JO5B 1P6AB 3HE7A 3RL2A 4ODHH 5JW3L 1EAPA 1NFDA 3JV5A 4W4NA 3T08A 5T1DL 3UDWC 3BP5B 3QEGL 4JPWH 5GRXG 3DECA 3NTCH 5EU5B 1FO0B 4I3RH 1CU4H 1RVFL 2DTML 4DZBA 3CFCH 2QL1A 2XNAA 1UQSB 4EI5B 2WUCL 3QIWA 3FRUA 5IR1A 3FZUC 1KXVC 1VESA 3IF1A 1K3ZA 1T7XA 2JE8A 1N7ML 3WLBB 5AYUH 3DETD 4YPGA 4KUZL 1R24A 3DHJA 1GRWA 4KKBD 3IRZA 5D70L 4BZ1H 3QFJB 1G9NC 2X10A 5BS0D 3EDEA 4H0HB 2L7UA 2IAMC 3P9MA 3DETC 5BV7C 3IGAA 1I1RA 4WGVB 1NMBH 2VKXA 3OHXA 4OIIL 1R3IL 3CH1B 1XGTA 1FORH 3L3KB 3KJ6H 1MIMH 1FL3A 1WT5A 5GGSA 2ZUXA 4KKAD 4P3DB 2LFGA 1OGTB 3TIEA 1IFHH 3JWNC 5EU5A 4Z77B 3TP4A 4PJAA 4UOW0 4Z78A 4C58B 1OL0A 3KLSA 1CD1A 3G6JF 4NM4L 2BSTA 4EDWL 1CE6B 1TETH 5GGSY 5T33H 3TBWB 4UAOC 3H9HB 1KF9B 5C8JB 1NGPL 5CFHA 1WQVT 4NWTH 3AS2A 3BW9B 5D1XA 2WW8A 3MUGA 3W0WB 1IAII 5C70A 2IAMD 1A8JH 3QPQD 2APVA 4Z0BL 4DGVL 3DXAE 4WRLA 1U8HB 1UB5A 3HB3D 4J2XA 4TQEH 3LEXB 1ACYL 4NCC1 1NKRA 3FT3B 4RX4D 1P1ZB 2QSQA 3W0WD 1UA6H 3DPBA 4Y4HA 2KQNA 4OZGA 3FO1B 2B5IC 1L9NA 4ODHL 1AKJA 3U46A 4WI7A 5DA0B 1MIEH 3BKYH 2M26A 3GDBA 3V4PH 3X13A 1SY6L 4UBDC 5EBLB 1NMAH 1T0PB 1R5WB 4R4NC 3B9VA 4HJJL 3MNZA 1G6RB 3MOBL 1J86A 3S96A 2J12B 2LU3A 4K7PH 5FA4B 2HRLA 2G75A 1F00I 5D2LB 3QG7H 2IF7A 2UWEB 4NZRL 4IOFC 4R2GC 3BW9A 4YFEA 4P4KC 5IB2B 3VA6A 4Y16C 3I6GB 5C0DB 4HBCH 4ZS6C 4KK6D 5K59E 4QRSA 3G6DH 4R4BB 1MRCL 4S1QH 4DKFH 3MUY1 2EYTA 3WNNA 3CUPA 4ODTL 1N64L 1X7QB 2OTWA 4ZOAA 5ITFB 5D7LA 4I18A 2ADGA 5LKNA 3PWJB 5D6CA 3PQYA 4D3CH 3MR9A 2DQJL 4Q0XL 4GMSH 2EYSA 3SGEI 2P5WE 4FA8A 2XACC 2AK4B 1TCMA 1U8LA 4RFOL 3F12B 4MCZA 5MERA 1NEZA 3QDAA 4HFWA 4ZO8A 1MLBA 5J6GB 4JFFA 4PJ5D 1F5WA 3H7BB 4NO5B 4JFEB 4LVNC 2N4IA 4JZJA 2UZYB 2NZIA 1RUPL 2DB8A 1WFOA 3R4DA 4ZODA 4XAWH 1DBMH 5BMFH 1QSFE 4EUPA 3QWOB 2EIEA 1A1OA 4LSQL 4ZFZA 1JGEB 4N90E 5EG6C 1JNHA 5E6ZA 4UIKH 1KSRA 3FN3A 1YYLH 2GITA 5B38A 5I71B 1XCQB 3GI8L 1U36A 4HLZH 3MLPA 2YUZA 2W65A 2A9NH 1KN2H 1IAMA 1L9MA 4P57A 1NQBA 1X5FA 3UJIL 1EO8H 5DD1L 3NN8A 5LWYL 1EEYB 1AIFB 4NFCA 4WCYL 4XMPL 3DHMA 3EOTL 5LGKA 1T7WA 3O81A 2P8MA 4OGZA 1AFVL 12E8L 2QHLA 3QIBA 3D69A 4HCRL 4ODSH 5KVFL 4NGHL 4YZFF 3HR5A 3IFNL 4TTDD 4OT1L 1S7RB 1ZKAA 1GC1L 5GISH 5E6IB 5I16A 3O4LB 5TGBA 1JZ8A 2O26U 3RVWC 2VXTH 4YGAB 4PJGB 4C83A 1CDGA 5HI5C 3EZ8A 1U95B 3QA3B 2YEZB 4HBCL 5HVFB 5GGTL 4G7VL 4HF5H 1U58A 2X9YA 4P23B 3OKMA 4U31A 2GQHA 3IKCB 3C5ZB 4FXGB 5SWSA 3W9EB 3LOWA 1VFAA 2GY7B 4O51B 3L6FA 5FHAL 3W9DB 3KPSD 3E6HB 1RFDL 2PO6A 1J9CT 2D03H 5IF0A 5J3HC 4MD0A 4RX4A 1GZQB 1XGYH 3VG0H 5FO9A 4AG4L 2NY7L 5GZNC 4J8RA 1VSCA 2F54D 5MEND 1L7IL 2OR9H 4FXGA 4NPYB 1MEXH 2HLFC 4ODVL 3U0TA 3VFNA 2XT1B 3A6OA 4LLYB 4AENA 3DUSB 5C07A 3C5SA 3UYRL 4K7FA 1WCQA 3VFRB 4HJGA 1CLYH 1I9IH 4ERSL 1JTPA 2EC9T 1I9JL 2HTLD 3VGDA 2VAAA 2CLZA 4M6ML 5CEYA 5C0BE 4HGWA 2V2WB 1FIEA 4GMTH 5E5MB 3D39B 4J6RL 1KGCE 3OKOA 2YKLL 3VWJD 4IRSD 1T21B 1ZT4B 2E9JA 3HFML 4GKNB 1BVLB 2GFBB 2OSLB 3DX7A 5LCVL 1OTSD 1F4AA 3EYUL 4FZ8L 2ZCKH 5FYLE 3U0TB 4JO4L 1WV7T 4BQBA 2XKUA 5JA8B 3C8KA 1MJ8H 3QP3A 4IBLT 3P9WB 1PY4A 2IPUG 2YN3A 4LCYA 5I19H 1X5AA 3UJTH 2GKIA 1YEJL 4U0RB 5FO9B 2HLFD 1BAFH 5KVEL 1DE4B 4WWKA 2AV1A 1U92B 5F1KC 3VWJB 1JPST 1IGFL 4R4BA 1GSMA 2XKNA 2B0SH 4PFEA 1UKTA 4K94L 5IB2A 1P6FA 2UWEA 5L9DH 3JV4B 5DUPH 1ZHKA 4R0LA 4AH2B 3NAAH 1R3LA 3ARFB 3CH8A 3VXPB 5HYSB 2GJ6A 1FLTX 3C60C 1YJDL 4JFDB 4GLRI 4L1DA 3VH8G 1CVRA 3AXLA 1UENA 2YRZA 3QZWB 2EECA 1YEKL 5DHVA 3QEHA 4MA7L 4NO5A 4DOHE 4Z7OF 3NACH 1F11B 2PR4L 3LSOA 4XVTL 4P3CH 4G5ZH 2QBWA 3SE3C 1C8PA 1HKFA 3U9PL 3I3BA 1AI1H 4TULL 1OY3B 1HNGA 2AJSL 4J3OC 2AJXL 4HD9A 3GBMH 3T0VA 4ORZC 2FH6A 3GSWB 4M5YH 4PGCB 2NMSA 2A6IB 2HMID 2AABH 5B38G 4NSKA 1G7MB 1PLGL 1IC4H 3IYLW 4YC2B 2OX5A 1V7NH 2WAHA 1N3NA 3UTZB 3H7LA 4YPJA 3T4YA 5J1AB 5JW3H 2NY2D 4XMLH 4WHTA 5IB4B 5KG9B 3ROLA 4BSVB 3IXAA 1ACZA 5CP7B 1A4JB 4PY8I 4JDVB 4GS7B 3QWRD 4OF5A 2QTEA 4WTZA 5KSBF 3DXAB 1MFCH 2HJLA 1FYTA 4XPAH 2AK1L 3H9ZA 1TZGL 1FRGH 4BYHA 2NY6C 4DCQB 4OD2B 3X12B 1Y18A 4Q9RL 4HXAL 1ZHLA 1AY1L 4F80A 4QRRE 5I1KL 2YC1A 3TFKC 3WSQL 1PYWB 5C0GA 1OGAB 4LASH 4XNUL 5ESAB 5KZCB 4P9MH 3DVIA 2J8UF 2VUOA 2Z92B 5C09B 3ZTNH 2ORBL 1GZPB 4YDVA 1INDL 4YHLH 3T2PA 5EZJA 1JRHH 1YNTB 4MA8H 3OWEA 5CJXC 5J89A 4LPCA 1UJTA 5CGYD 4K3EL 3NCCB 4LRNL 2XQBL 4G8EB 3P77B 4EOWL 5E8EA 5GRUH 4IOFD 3CK0L 4YXLL 3TYGH 1OTUC 3UTPE 3ZHKA 4M7KL 1XGQB 3NZ8B 4QCIB 3QHTC 3CXHK 4R3SA 4ZYKB 5BRZD 4PG2C 2VN4A 2E27H 5DRWA 1EDQA 3BP5A 1TETL 3MV7B 4LCYB 2VDKH 5I73C 5IT2H 3MNVA 2Z8WC 2DM7A 4AEIL 3IXTA 4ZFZB 2CIKA 3VFTB 5D2LA 4MB3A 3HC3L 1OSZA 4JLRA 2F5AH 4PJAE 4NOBA 2AJXH 3KPMA 5HGBB 1YUHA 4TQEL 1M7IA 3OHXB 3HNVL 5CILL 3FO0H 5KVMC 5DUMH 1A4KB 3LEYH 3OKNA 4JFEE 4PJBA 4OI8A 4H26B 4N0UB 2GK0A 3OAYK 3RWEA 1FNLA 4R4ND 4OFDA 5DD3L 1I1FB 4UBDD 3SOBH 5J6GA 1UWEH 3AAZB 1YZZA 4M61B 4HFWB 4W68A 4JFHD 1HSAB 2JB6B 3GKWL 1F4WL 4WIQA 3NABL 4YHML 5C0ND 4DVRL 3GHBH 4JGJA 5SWSD 1OTTC 3QR2A 4QHMA 3GIZL 1G0YR 4MSWA 1HCFX 4Y4KC 3ARXA 5B8CA 1TZGH 1UM4H 2CMRL 5E9DE 3NVQA 3IB4A 3T3MF 1BBDH 1JGDB 1LEGA 3QISA 1IEHA 2Y5TA 3QWRA 1KJMB 1FHGA 1JN6A 3ARDD 3WUWG 1UCBL 2HRPL 1WBYA 1HE7A 5I1EH 5EC1A 3T4AA 1FFOA 4RAVA 4GG8B 1KB5B 4AY0A 2BNUA 35C8L 3H42H 2RFXB 5A2FA 1CU4L 1RVFH 2DTMH 1CXEA 3KPPA 3BPCA 5HY9B 4TVPD 5DMJB 3W11D 1KCVL 1HI6A 5EO9B 1AKJB 3MRFB 4L3EB 2VDRL 5JPNA 1GPOH 4XPTL 4HLJA 4TUKL 1TVBA 3L9RA 4Y0GA 1V5JA 2E27L 4Z95L 2VLJB 2NZ9D 3CVHB 2FIRT 4XC1H 1S9KC 3SQOL 2A73A 4P0DA 5H37G 3VFSB 5TJWK 2FBOJ 4OB5H 2X44D 3MRRB 5I1DB 1K4DB 2R15A 5DMYA 2NXYD 4XXCC 2VLMD 3BRGC 3KPLB 3AS1A 4HIEA 5EC2A 4YUEH 2F5AL 4XWOC 1F8TL 3AS3A 3QRFM 1MCJA 3ZDYF 5EFIA 2B2XL 5KSAB 3WLWD 1G0DA 5A16B 4H1LA 5AZ2L 1ITCA 4OLZH 1ZT1B 2WBJD 1EAPB 4X6BA 3AREC 3V7MA 4MQ7A 4NQCE 1P53A 5J8OA 4E41E 5GRVK 4IIQC 1UGNA 3A6CL 3EOBA 1FL6A 1FP5A 2P8PA 1IEAB 3AROA 4NQDB 1P7QB 4KV5E 4PYHA 3V5DB 5KBNC 4GS7C 3MRRA 3V79C 1CTOA 1SY6H 3M17B 2AJVL 5D1ZB 1S78D 4NM4H 3IT8D 4LSPL 4M5ZH 4L8CA 4LHUG 3QFJA 5C07B 1B0GB 5B4MC 4HIHB 1JI1A 4L29A 1IGML 4Z0BH 1QTYT 1LEKB 5DJCA 2X6MA 4R6UA 2WIIB 2XRAL 4IRSB 5D2LF 3DUHA 1IBGL 3HI5H 1BOGA 5JTWA 4N0FB 4XPHH 2A77H 3V6OE 5K9QG 5FCUH 2EYRB 3L5XL 1C16B 5SWQA 4M4PA 4IRJA 4KJQC 3LD8B 3N85H 5DEZA 2CH8A 4XPTH 5CP3H 4P5TB 1H15A 4XTRC 3N9GH 2GJZB 3SKUD 3P73A 5FOJA 3PHQA 2YD8A 4KJQD 4PRHA 1JHLH 4Y19B 4K8RH 1OCWL 1SBSL 3QUKB 5I73B 2ID5A 1ZAGA 5JW5B 3C2SA 2OTPA 2QQKL 5H2BB 4XP6H 3WIIH 3JUZA 2YEZA 5HGHB 2J8UA 2RCSH 5AZEH 3VXRB 5IJVA 1CXLA 3SPVA 1CLYL 2X4QB 4MJ5A 3IFLH 4PJ8A 2DQDH 4PJIA 4JQXC 5DEFB 4JHWL 4UIKL 2DMBA 3UTSB 3OKNB 5DHVB 3UEZA 4MJIA 2QQLH 4PJCF 1NC4D 4P2QA 2WWKO 3QDMB 3PWPB 2DRUA 3BMVA 2J3SA 3WXWL 4XC3H 4RFOH 1F2QA 1XGRB 5D5MA 4I2XE 3CSYA 2P46B 1OAZL 4CMMB 2BCKA 4LSQH 4QT5A 3SKJH 3VFGL 1JMXA 2K3TA 1Q9LB 4C56D 3EO0B 5KVEH 3GSUB 5ID1A 2FEEL 2ZCLH 4HS3A 3VDCA 1A9BB 5GGUA 4GRWF 1JNJA 3MRJB 4B53A 2DQCH 4D9LL 1F13A 4S2SA 2XZAH 3SKMB 4LIQH 4LQFL 1D5IH 3W2DH 3ALPA 1JZ7A 2X9WA 3PWPA 1MJJB 5E5UB 2ICWI 3ARQA 3U1SL 3K80A 4NUGL 1S8DA 4KHTH 4OFKA 5IHZB 4JFQA 2ZOLA 1NKOA 3S34H 4BZYA 4DUXA 4N90D 5FCUL 2Y36H 4JG0H 4E42B 4PJDF 3CVHA 1ZLWK 4L1HA 5B4MD 1D6EB 5J9PA 3F5WB 4L3EA 4GO6B 3VXRD 1J18A 5FHAH 1GGBH 4FQCL 3MC0A 5F89B 2HKHH 1CL7I 1Y0LB 2JB5L 1NCUA 1YEDA 2XTJC 5JZ7C 2CJUH 2HFEB 4PJFE 2I60L 2UWEF 3JWOH 4OLYH 4PTUA 4HX1B 3FTGB 4AQOA 1DL7H 4OCRL 4I0KA 4M8QA 4OD1L 2E8ZA 4KK5C 1FNSH 4GAFB 5D4QA 1CD9B 4JFPA 3CFDB 4H1LG 4J4PC 4R96B 2IANA 3V6FA 2PO6B 4R9HA 1RZIA 2QSVA 1RFDH 1RIHH 3LKSA 4U1NB 2ESVB 1KC5L 4RWHA 5FYLH 1ZXQA 1INEH 4AEFA 5HDLA 1I3UA 4DFHA 1MFCL 5DD6B 1WBXB 4I8DA 4NT6B 4L5FH 4YX2L 3WNMA 1FL5B 5CINH 2VKWA 4KY1H 3ZZ1A 1EJ6A 1D5XB 2Q7NA 1D5BB 4O58H 3QI9C 2ZSVB 1VGKA 5E00B 5MEPA 5A3IC 4R2GB 1A7BA 3V5KB 2HVJA 1I9IL 3GMLA 3KPPB 4ERSH 5I19L 5JLZA 4YDLB 3WIHH 1DQDH 2RFXA 4KTYA 3F7YA 2QLVB 4NNPH 4B0MM 1AD0B 2IALA 5MEQA 3MUGB 3W0WA 1DUZA 4QRRA 3RZCA 3VXPA 4XNQA 1UM5L 3WFCH 4G6AC 1KENH 3O11A 3RWFB 3V6FB 5ECJE 3FQRB 3JTSB 4NP4H 1NUNB 3KXFE 1Q8MA 3MO1A 5I74B 3QEUB 4UDUB 3SCMB 4NKIH 3HI6H 4AMKH 1T04B 5E2VL 2BNQA 3PXHA 4PJEF 2WP3T 3FQUA 4PJHB 3CGTA 2AXFB 5JORA 1EHLH 1DCLA 1Q9KA 1LE5B 1A02N 4A2MA 1CTNA 4F7PB 3H3PL 2DQTL 3ARDC 5KVDH 3HFMH 5LCVH 4OF0A 5ADPH 2DM2A 3MRKA 1K4DA 4G6MH 1TNNA 5TDNB 4EVNA 4YDVB 3GJFA 3V6OC 4C57C 5IFJA 1E4XH 2Y1VA 4XNMA 3GSOA 4M6NL 1B90A 1MLCB 3KDMA 4JO3H 5BVJB 4OD1H 1NAMA 2R2EB 3D2UA 2ENSA 3ESUF 5F7KC 3MV11 3E2HC 3QUXB 4R0LC 3VFRA 4OSUH 5EUOB 1G9MH 2CDFB 4I9WD 1Q72H 1SJXA 3PGCB 1NFIA 4PY7B 5BS0A 5FGCB 2D7PA 3BPCB 5HY9A 3VFPA 1OWRM 1EO5A 1JHTA 1C12A 2DBLH 2VSCA 1DFBH 4RAHA 5IB5A 1IC7H 4QRTB 4RBPK 3RWDA 3UZVB 3DVGB 5B21A 3OJMB 4YHYC 1L7TH 4JFYA 2EH8H 2WLZA 3MLWL 4ONGL 2C4FT 1V7NL 2BXYA 1AO7E 4NQVA 5DR5H 3WIFB 3RX5A 3ZHLA 3MXWH 1H3PH 1T0NB 2GAZB 4NQXA 2D2OA 5FA3B 5EZJB 4ZUVB 2HWZL 3BD3A 3ILPB 4LHQB 4LSTL 4HIXH 5C1MB 1Z0NA 3NCBB 4Q9BA 4CDGC 1A3RH 4AK1A 1QHPA 4FTVE 5BRZA 5C3TA 2VISA 4OLEA 1KCLA 1WEJL 3T2NL 4YHLL 3PQYD 1T6WA 3FO1A 1HH6B 3IFPA 1EVTC 4M02A 4AEHH 3BEWA 1T22A 2X89A 1K5NA 2AKRA 3ARYA 4M7KH 4QRPD 1QFOA 2AK1H 2H2PC 2DQTH 5KVDL 1FRGL 4ZO9A 1UJ3B 4QYOB 3HR5B 4HKXA 5ADPL 2DBJA 2IH1A 3V95A 3S36H 3IDNB 1P4LB 3FRPA 3MZTA 2AW2A 3QDGB 4GRMB 3WIFA 4GG6B 2VC2H 3LPGA 1CK0L 2B2XH 2Y5TB 4GQPH 3T0AA 3CFJB 2A0LC 2GJJA 3FHQA 4PTTB 2IQAA 1YA5A 4ZO7A 1ZK9A 3DX6B 2R1YA 3LN5B 4JFOB 3F7QA 3RAJL 5CJXA 4H25B 3Q6FB 5GRJH 3HS0A 3GSNA 3UCRA 5EOQH 3IDYB 1JP5A 1SYVB 4XP4L 3RTQD 1G7IB 4ODUA 4OCSL 2HLAA 4F7TA 4OQTH 4RGND 2A74B 1KIPA 4PP2B 3QWOA 4WUUA 4OZGE 1FCGA 3S8WA 1GGIL 1ZGLA 1KPRB 1FGVL 4K71C 5JMRA 1IKFL 3DRQB 5FO7B 3RI5K 2VWEC 1FG2A 3CSPA 4P4KB 4JZJB 1L0YA 5I1CL 1GIGL 1OQOA 1FNAA 2YZ8A 5JIIA 5DUML 4WFHD 4YBQD 2BVQB 4JZOA 4K94C 2VQTA 4U1SA 1LP9B 3IDJA 3N1FC 3HUJA 3C8HA 5LQBL 3R8QA 4HCRA 5SX5K 1I7ZB 1S7SB 2GTZA 3SJVD 4P2OA 5AG9A 4U1IA 3KYMA 3NABH 3PQYB 4JG1L 3HC4H 2BSED 3MOAL 5JDSA 5F3BA 5DRWB 1CGXA 5GSVB 2IFFH 1U3ZA 2XXMB 1WLHA 4J12A 3BJ91 3ESVF 2CKNA 15C8L 1C5CH 4O4YL 5I8OH 3L95B 4S1SH 2X4NB 4Y5VA 5HDBF 5DFTA 5GZND 1S9VA 3NFPA 1VFBB 4X9HA 4YAQA 1TVDA 4EQ3A 1QEWB 2MMXA 4P2CG 5CBEA 1QSED 4OBSA 4HLZG 5DSCB 1LD9A 1M7DB 5D2NB 1CXIA 2NTFA 4F37K 3RKDC 1OLZA 3BIBX 1B6DA 1G7JA 3F7RA 1HN1A 3D0VA 4NIKB 3AB0B 3RX7A 1YQVH 2FHCA 4XHQA 5C71A 5DQ9A 4Y4HB 3MLSL 4X7SH 4CVXA 4NHUB 4XRCB 4NUJA 5TQ0H 4GKZA 4RAUB 4WFEE 4JPVL 3BIKB 3RVTD 2CRIA 3RGVA 3WFZA 5HI4C 2XZQL 3WXWH 4XC3L 4YAQB 5HYIA 4ZPVA 4OFVA 2X05A 2BOBA 1CDCA 5J56B 2XTJD 1T66D 4JN1H 1TXKA 2NY1C 2XXCB 4IRJB 3EFDL 4WI8A 3O6LH 1ZVSB 4P2QE 4IHOA 3TO2A 3KPRB 4DAGH 2J2ZA 2RGSA 2ZCLL 4WDIB 3GRWH 1LP9E 3A67L 3GSWA 4PGCA 5IB1A 2JF1A 1VKXA 3IU4H 4M43H 3V8CA 1F6FB 2BNRD 4X4XB 3S98A 2MQCA 3AM8C 4XAKD 3BZEB 5C07D 4Z18A 1FL3B 1NEZG 3D9AL 1U58B 1GGCH 3BZDA 1CQKA 3PABB 5BW7C 1T03H 3D39A 4OCWL 2XWTB 3SDDB 3E8UH 5IWLA 3NBNA 1A6AB 3O2DL 3AREA 2NY3D 4JG0L 1CICA 4QWWD 3MREB 2ED7A 1IKNC 3P40A 2KKQA 2A77L 1HXMB 2BMKB 4UB0L 4MCYB 1D9KA 1Z9LA 1RV6X 3QRGL 2PETA 4ZQKB 1QFUH 4J3WA 3BZEA 5IKCB 3W5MA 1RMFH 3TV3L 2FIKA 3NPZB 3IETB 4PJGF 1H8SA 2CLVA 4LBEA 1U92A 4HWEH 1JF6A 3G5YA 1RUKL 5TE6H 3TPKA 5EFIB 5M94B 4PTTA 4U1HB 3HE7C 4BQ6A 2GITB 2NW3A 4IM8A 2P5EA 5JHDE 1JGEA 1Q9OA 3IJSB 1YNTA 4JPIB 3C09C 2J88L 4QWWC 3VMNA 1FG9C 4HW6A 1INEL 3NTCL 3S96B 1SJVA 2ATPB 2WUCH 3MQIA 1XF3A 1QPPA 3OGCA 2W0PA 1NJ9A 4MJIB 4RMRA 3K8MA 4KY1L 2ICEB 2F5BH 1QNZH 3SJVA 3UAJC 4KRPD 3WO3B 4GLRH 4JCLA 1ZLVK 2AJ3B 5F97E 2EZ0D 3RY4A 2A9NL 3QCVL 4KXZH 4ZD3L 5L7XL 5IB1B 4NCC2 3LHPL 1A4JA 1U8HA 5CSBA 4PRPE 1PG7L 2Z31D 5K9JH 1R5IA 5D1QB 5LWYH 2HFGL 3FQNB 1LVEA 5IBLC 4PRPD 3X14B 4JQXA 5F71A 4Y2DC 5MI0C 3MV8D 4WHCA 4BH7A 3DRTB 4PJFF 3OR6A 5CP3A 1QLEH 1DQQB 2O5XL 1D5IL 3W2DL 4KU1A 4OGXL 5F3BB 3TN0B 3U1SH 5GS0C 4P5KA 4JQIL 3G5VA 4XX1G 1G6RA 1JNHB 4WEBH 5IQ9B 4FOMA 4NWTL 1AQKH 1O5DT 1UACH 1N4XH 4KMLB 4LHUB 3P0VL 1L0QA 1HWHB 2GK0B 5HGGS 1V05A 3FAWA 5I1GL 2NYYC 2Q1EA 5FHBH 1KLGA 4KTDH 4M7ZB 4PBWD 4RMSA 4V1DE 3MTRA 4GAYA 1I3RB 1A7PH 3NMEA 4AM0A 1AXTL 3C8DA 1INQB 5F96H 4WUUB 2BHUA 5DRZB 3WLWC 1AH1A 1YNKL 4LIQL 5IJKC 2AV7A 2P5EB 5ETUA 3QB7C 4MMZC 4LP5A 4POZC 4ZUUB 5HHOE 2J88H 3MX0A 2YD6A 4K3DL 1AIFA 1FVCA 2C9AA 4HJJH 1RURH 1ZEAL 3GJFH 3ZT6A 2E3VA 4G42A 1NSNH 1YY9D 4G7YL 4POZD 3ULUH 1UWGL 4L5FL 4LDOB 4N0UE 4Z77A 1T1ZB 3DUUB 4YWGH 1SEQL 4K7PX 3MMEB 5C09D 5DRZA 2H45A 2AI0L 1RHHA 2V7HB 1VENA 2WANA 2YR3A 4J3XA 2XTLA 1IQWL 3JBG7 1CDIA 3ARBC 3BYYA 3EDKA 4WI2A 2HKFL 3D3VE 5I1DA 4HH9B 1NUDA 1BFOA 4XVSL 3TVMD 4EN3B 3SBWC 4QEGA 3SDDA 5C07E 1GXEA 2VLJA 1I7TB 4D9QE 1EO8L 1JYXA 2DOCA 3RVVD 4NP4L 4MNGB 5DC9B 3BN9C 1IM9D 5E1AA 5HYJD 3PP3H 4P2QD 4ONFL 5D7JC 4FQHA 1BVKB 1X3DA 1NGWB 5EOTB 3IFNH 3N1QC 1IGFH 3FO9B 1WFNA 2BNUB 5DHXB 3MA9H 4K94H 5BMFL 3QCTH 1ZMYA 1H5BB 5JIPA 4V1DB 5KOMC 4HULB 3MJ9H 4YDJB 3ZE1F 4KK9C 3QEUA 5C0AD 3SCMA 1JN6B 1HINH 4OIAA 3UBXG 1IJ9A 5D2LE 4OZHE 4X5XA 2H6PB 4GQ9L 4MJ2A 2R9HD 2B1AH 4Y19E 4D9QD 4LSDA 3TEUA 5BZDA 2GYSA 4JHAH 4F9LA 5KS9B 1YNKH 5D7SH 4XP4H 2DWEB 32C2A 3C09B 3E0GA 1B2WL 2VDNL 1ZTXH 1F45A 1NCBL 2FB4H 2OL3A 3ES6A 3OKYA 3OB0K 4X6CB 1RURL 1ZEAH 5D2NA 1S7WB 2PXYA 1BJ8A 1E4XL 2NNAA 1QEWA 4WNQB 2GCYA 1RUMH 5KAQG 1T80A 1R3LB 2IMNA 5D8JL 4GUPB 1MVFA 2QQQA 2X4PA 1ZGLM 1CFQA 1HHIB 4HUNB 3WV0A 2IEPA 3IDXH 4OSUL 3MRGB 1G9ML 5I1AA 1JNNH 3UTPD 2QKIA 1K4CB 2BVUA 2Z8RA 4WO4D 3RWJB 3F6LA 4X6BB 1TIUA 1ADQH 1HHKB 3RU8L 5GGVY 1CGWA 5HI3C 4FN0A 4AT6B 1A21A 3A0OA 2IFFL 3HUJE 3IVKA 4OUOA 4APQD 1OD7A 3WCYA 3EFFB 1Q72L 2EICA 2XZZA 5ERWB 5EUOF 5KS9F 1CG9B 4Q6IC 2XZCL 1KELH 3QIUC 2XN9B 2W9LA 3LS4H 3HMXA 5D5MB 5DWUH 1XIWC 4KUZH 5F7DA 1OLLA 4HWZA 3VG0L 1RIVH 2ORBH 2ZSWB 3EJJX 2R56L 5FO8B 2EH8L 1EFXB 4XH2B 4UU9B 1UM6L 3CLFL 3MJ9L 1KNOB 5AWNL 3CMOH 4JFDE 4P5TD 3VRJB 3VFUB 1FORL 1ZA3B 1U6AL 2X4RA 2DTSA 3QFDB 4JDTH 1NBYB 2C3GA 4WV1A 4AEHL 2OJZH 1CE1L 2EH7L 2PTUA 1FO0A 1QA9B 2W60B 2YKLH 1X5JA 1ZLUH 4X6CE 4M62L 1MHEA 3HE6D 2CLRB 3G04B 4PYGA 1E4KA 4E41A 1N6UA 2R2HB 1VFAB 1N0XL 3UJTL 3BT2H 2ICWJ 3FFCB 1VACA 4HS6B 1R5IB 5D1QA 5E70A 1YMMB 3HMWL 1RUML 2HT2D 3F7YB 4XPFL 4JDZB 2AXJA 4NC2B 3VG9C 4Z7WE 1BJMA 3UBXB 5C9KA 5CHNA 5TDPA 4KZEL 5JXEC 1CK0H 3C60A 3TZVB 1AGEA 4LHJB 1E27B 3P4NA 1I7TA 2GJ6D 5E4EC 4X7DC 3STZA 3TYFA 2R23A 3O4OC 3ULUD 2ZOKB 4MHHG 4PJAF 1IQDB 4I48A 1WBXA 1J0KA 1HHGB 1KJ2H 5BOZG 1CR9L 5F8QC 4HQQH 4Z7NE 1YMMA 2X4NA 4J4PD 2NY1D 4MZ2A 4Y5VB 4XGZA 5E6IC 5ESQA 4P46B 4K9EH 4PJ8D 2FZ3A 5E99H 5C0JB 3LQAH 4HUKB 5GJTL 3VJ6B 4XCNB 3BRFA 5E9DA 3W11C 1IC5H 4XNUH 4U1IB 1FV1A 2AABL 2DLGA 2A6KB 5B38B 3HC4L 3MOAH 2W9DL 4C55A 3B2VL 4Y2OA 3D5OF 4FFWD 3QPXH 2MPAL 1MRFH 5DJAB 5DMIH 4F7MB 1C08A 3BI9X 5FGBC 4Y5XB 5I8OL 3T0EB 3QDGD 3AU1A 1K8IA 5DVMA 4K3EH 5MHSD 2ARWA 4S1SL 4Z95H 2JCCE 3BHBB 2R2EA 4HFUH 1D6EA 1RZJC 4G8GB 1X5YA 2BSSB 4MCYA 4QHKI 5T1MA 3H9SE 5TQ0L 3OJDB 4I0PB 3CPLB 4M3KB 3FFDA 4H0GA 2CLZB 4XAKE 1ZVHA 1CICB 4OBRA 5GGQH 1P69B 3RIFK 4IJ3B 4CAGA 3HAEH 2APBA 4GW4B 4OLWL 4Q9RH 2F54E 3HZKA 5MENE 1JWSB 1F8TH 4PIRF 2D7NA 1KOAA 4I2XA 1IZKA 1DANU 3ULVD 2R0LL 5IMMB 2AQ1A 2ARJA 3LHPH 2A0LD 1E6OL 1M71B 3CUPB 3KPSE 1A6ZB 2BVPB 2XPGA 5F7EH 3F7VB 5HJ3A 3KXFD 1BWMA 1NFDB 1A3LH 4Y4HD 3NCFB 4HUVB 3LEYL 2OMBA 2A6DB 3WDJA 3GSXA 4UTAL 1JIBA 1JF1B 4OZFA 3SKNB 3UTTD 3SDAC 2BDNH 2DQIH 4RBPH 3T0XA 1TZHB 7FABH 3LS5H 2NXZC 4XMKH 3PWPE 4O51A 3M1BA 3PWNB 2V6HA 4RCAA 3RVWD 2ZKHL 4HCRH 1RU9L 1NGWA 2NY3B 1IFHL 3S5LG 1XF4A 4G9DB 3ARGD 3GMLB 3RY6C 3D3VB 3ARTA 5BO1L 3IU4L 2OZ4L 4Z7OE 5KSVA 3EO1A 2CUHA 3L3GB 1RULH 3B4NA 2Q7YA 2D31B 4ZXBC 3LKOB 2KPNA 4MAYB 4ODWB 2JJSA 5BZWA 4CGTA 3MYJB 3UBXA 1V7ML 4JGMA 2YPVH 3L3HA 1T03L 4JO1H 3TIDB 2OCFD 3FO0L 5DUBA 5IMKA 3VD5A 1AXTH 2EC8A 4LAQH 1BFTA 5E8PB 1MRFL 3QXDA 1I7UB 3OV6A 3BP7B 3UTQB 3MODH 4GRLC 3MV8A 5C8JA 3IDUA 4F33B 4XNYH 1RIUH 3IJHB 43C9A 3C9NA 3O2DH 1OARH 2JELH 5EZIL 3EDFA 2VR5A 1CXKA 3O2VL 3V0WH 4G7YH 2X41A 4ZOCA 2UY6A 1K6QL 4MAYC 2VDPL 1P2CB 4I5BB 1Y6KR 1YEDB 3MBXL 1RZFH 2DQEL 5I8CA 3WO4B 4EI6B 4BQCA 1CD0A 3MLZL 3DX8B 3A6BH 4NKDB 5IP4A 2Q6WB 1I7ZA 3H6JA 4M6OL 1NBQA 1T1YB 2R0LH 2AGJL 4XBEH 5JW4Q 2G2RA 2YHGA 1QFPA 4LLVA 3PGDA 5C0CB 1I1FA 1J10A 4X4YA 5GGRY 4NCDA 2BVQA 1I3RA 4N0UA 3U0WH 4WI5A 1I9JH 3LZFH 4L4VA 1FNEA 1SVZA 1AC0A 1U8PA 1JMZA 1YC7A 4PLKD 1MWAA 1UKQA 1J11A 4P4RA 1TPXC 4OLVL 3CDYA 1MY5A 3QCUL 4HKZB 4UT6L 2E6QA 4Z7NF 4L4JA 2XV6B 1I9RL 1WBZA 3N06B 4KROC 4LDEB 3IF1B 1KIPB 4HHAB 4PP2A 4EI6A 2R8SH 3LS5L 4XMKL 2YMXH 4EI5C 5I8EA 3TA3B 2V2TA 4YFDB 4F57L 1G7IA 1U8QA 5HXMA 1QLEL 3DUUA 3GSNB 4QF1A 3RPIA 1V3KA 1IT9L 5F7MC 1J87A 2WLYA 5SX5H 5BQ7B 3HRZB 3PL6A 4JY4B 5F1IA 4ZDHA 5ISZB 4X6DB 4QRPE 4X99B 3EKCA 1DUZB 5I75C 2Z35A 3L3IB 4G9FD 4Y1AD 1RUAL 1CF8H 2VLRE 5E94A 2Y6SC 4YHNB 3Q1SH 4CDHA 4I4WB 1MCEA 3SDCB 4MNGA 1DN0B 4CVUA 1QR1B 3H0TA 2VR9A 1TQBB 5DHVH 5DD1H 3D39D 1CFNA 3SE4A 3LKNA 4PJHE 3LKPA 4GW1A 3MJ9A 3DMMB 3FQTA 5EZIH 4NT6A 1FNGA 3T0EE 2V17L 5HHXH 5KVFH 2XA8H 3MBXH 1JWUA 3HCVB 5DQDL 4L3EE 3VXMD 5JDJA 4WEBL 1S7UA 1A7PL 5FYKU 1RHHB 4FFZH 5HTSA 3INUH 3MLRL 3UYPA 1TJHH 2ITCA 3UDWA 5C08D 1EEZB 3QEQD 5FECB 3KYAA 5SWZB 1RUQH 4FFWC 1SQ2N 1KCSH 4HZAA 4NWUL 1EHAA 4XCEA 3FFCE 2OQJB 2C4XA 1JTTA 4KDTA 4P3DA 2AJZA 2XZCH 1F4YH 3HUJF 2VITB 1SEQH 5DWUL 1UT9A 3N9GL 4D8PB 4JB9L 2D9CA 2H32B 5DGQA 1MFEL 3V6ZA 3CXHJ 4JM2F 3CPLA 3WBDA 5KSUA 5AD0B 4EN3A 4OZFH 2DQUH 3KDMB 4PS4L 4NRYB 2DL2A 4G6KL 2QV2A 1JRHL 2X4TA 4LLWB 1HHHB 1RJYB 4YC2C 4OV5B 5DZNA 3NIGF 1PKQA 4WW2B 1RUAH 2ICCA 2UWEE 2WUBL 3CXDL 4L9DA 4N8VA 4LRNH 3OZ9H 1YN6B 4MDJA 3MR9B 5CP7A 2VQ1B 1X9QA 3J7HA 5ALBL 4I0PD 2FX8H 4IHOB 3TO2B 4LLUA 5ITBH 4L8DA 3WJLA 4RFEA 5IF0B 1CL7L 1OAZH 5ADOH 2YZ1A 5B3JE 1HSBB 4LPVA 4WFFD 4NZJA 5GJSL 5B39A 2DI7A 1GGBL 1FNHA 5ID0A 2G5BB 4ONFH 2V9TA 5IBLD 4LSUL 1Z6JT 4QRRB 1HXMA 2BMKA 4XPFH 2YPKB 1FO0H 3KNBA 2GTWB 4GQ9H 3ZE1E 1BJ1H 4QHLB 3EW3B 2V7NA 3S35H 4D9LH 3PHOB 5CBAA 4N0RA 1RHFA 2NX5E 2V5RA 2OI9B 3BKCL 3BGFC 1D5ZA 3CDFA 2APTA 3C5SB 1S7QB 2VDNH 4OI7A 3E6FA 5L6YH 1SMOA 1WK0A 3ULUE 1DFBL 5EZLA 2B1AL 2FEDD 1F4WH 3R06A 4F9LC 1M6OB 4LCCC 4JHAL 1A3QA 1I8KA 3C6LB 2FR4A 3OXSB 3EBAA 4YIQA 2XWJA 1DVFB 1E0OB 4NRXB 1FGNL 2AK4D 5FYKD 3D1MC 1MCIA 3K4ZA 5F9WB 4A6YA 3OJVC 1T1XA 3G6JE 5IEKA 1ZVSA 5BV7L 1IAIM 3O2DA 3DVFA 2CKBB 4QOKA 2AXHA 3WL9B 4ZDHB 6CGTA 4KVNL 4Y4FD 1KEGH 4YFLF 1BOGB 3QH3A 5CMAA 1BM3L 9CGTA 3F7VA 5D8JH 1X5LA 4FZEL 1E4WL 3VFUA 1ZLWH 3W39B 1T83A 5DMIL 4IIQB 2MTPA 1N26A 4JZNA 3EJYC 3U4AA 2HP4A 4WENB 3AAZA 4DN3L 3RWGA 4GXUM 4XP5H 1OAQH 3ULUF 4FTVA 5CEZH 3FB7A 4MS8D 3AXLB 5FO7A 2OJZL 1ZGLB 3VXUB 2XI9A 4JFQB 3V0VB 5IBUG 3QIBB 5K9KA 2G60H 3PWVB 5GJSH 3TWCH 2HLAB 4F7TB 1JWMB 2P8MB 3L5IA 1EZVX 4JKMA 5AWNH 3TBSB 4PREB 2LTQC 4I77L 2PW1B 2ZPKL 1BQLL 3MBEC 1EFXD 2VDOL 5EBMB 4PLNC 2OTWB 4PJ7A 5BV7B 3WS3A 2R56H 2E9BA 1TTFA 1XGQA 5DA4A 5L2KB 4TPRH 4M93B 5JOPE 2R1WA 4MDJB 2BFVH 4PRIA 1EEUA 3B9KA 2FYYB 4ZTPH 4N8CH 3IDGA 3HPLA 5JNYA 1CQYA 1QSFB 4G43B 3ZMRA 2YRPA 3FN9A 4KZDL 4EIZC 5HSFA 4H88H 1CE1H 2EH7H 4XGZB 5ESQB 3SE9H 1ORQB 2V2WA 2O5YL 4NQEA 5T1KD 1WZKA 4CJ1A 1UZ6E 5SWZE 2D3VA 1UFUA 3GBNH 3O3EA 3WKNA 1BLNA 2LTQB 2I5YH 3VXNA 1PG7W 2YC1B 2ZG2A 5I1LB 5CIPA 3B6SA 1Y6MR 2VDKL 2MNUA 4KZEH 1YEHH 3CVIL 3JWOC 5E99L 1P7KA 2HT4D 4YBHA 4PB0L 5F7YC 2P48B 4EUPG 3THML 3K2UH 2H1PH 5TFSH 5I15L 3BWUC 4LAQL 4MQXC 3T1WA 4FZEH 3X3FH 4S1DC 4I18B 4ZFOB 5JR1L 3EYFB 3KYNB 2VLJD 1DQML 4O4YH 3GEWB 4HEME 4D9RE 3QG6B 4RISL 4X83A 3BESR 5JPMB 1JGDA 1WZ1H 4B5EA 4E41B 1RQ5A 4LLUB 2CSPA 1WJ3A 4PBVC 4LPWA 5I1JH 1IC7L 1QFWH 5D70H 4FQHB 1T20B 3DV6B 2K7PA 3FTGA 4Y7MA 3UC0L 4YE4L 4WHDA 2E7BA 3SE8L 1A6WH 1OCWH 1WIPA 1OP5H 5SV3A 5K9OA 3QFJD 3WN5B 4JAMB 4DUWA 4OQTA 4P2YA 5JQ6L 1R3IH 1IVLA 1Z9SA 4FQQA 1WIOA 3LKQA 1TJIH 2YN5A 4ZAKC 4MQXD 2BRQA 1REIA 3KPOB 4TVSa 2HA1A 3U0WL 2EDEA 2JJVA 3VGAC 3TJEH 4QHLA 3LDBB 4PJHF 4IRSC 4Y2DB 4EI5D 4KUCF 1AJ7L 4L4TD 1NCAL 3LEXA 5F7EL 5IHZA 5IFJB 4TSAL 5AG8A 4R90L 3L3DA 2OI9C 4HC1H 3UP1A 2EDOA 3GHEL 4LPXA 3TN0C 3KJ6L 4F9PC 3RTQB 1MIML 1A7NL 3EGSA 4NFDA 3ZLQC 1YN7B 1J12A 5FYJU 3BQUA 4WWKC 4M1DL 4KJYA 2OK0H 4HWBH 2LVCA 3LKRA 2AXFA 5GGQL 1KPUB 4JANB 1IKFH 1A6UL 4M9OA 1AE6L 3BOVA 3PXJA 1KCUH 4MQTB 1T1WA 1U8KB 2O93L 4NNYB 2OZ4H 4KJPC 1GGCL 1JPGA 1NDMB 2HFTA 2VC2L 1KTRL 1IGTA 3GSNL 3L3DB 4MAYD 1LP9A 3IDJB 4KGJA 3LEVL 4W4OA 3S37X 5DQJB 3T2QA 3THMH 3CH1A 3R0NA 1NC2D 3MGOB 4GAYB 4OAWA 1U8PB 4BK5A 4OKVB 5IOPB 5AZ2H 3ZL4L 4APQA 3RL1A 3FN0L 5C0CD 4YH6A 2GSGB 3T09A 1F42A 1U8NA 3LPFA 4G8FA 4KJWC 1KCKA 25C8L 2IQ9L 5B3NA 2WWKT 3VE0B 2ZKHH 3MLVL 4JVPA 4IMKA 2CRZA 3QUKA 3DX9A 1MVUB 3D18A 2KZ1B 3UBXI 3BGAA 3HZVA 2RQ8A 2VDPH 5L0QB 5ESVA 5CLWA 5L8LB 2JJSC 4HKJA 2ZUQB 4X6DA 3SDXF 5T1KA 5FYJH 5HHVH 4F33A 4NZUL 4YDJA 1HQ4A 1RIUL 3RWFA 5DRNA 5TF1H 1EMTH 5IFHL 2P44B 1G7LB 4XBEL 3ZDZF 1MHHA 1KPVA 3OBAA 4LNRA 3SDAD 4GKZB 3SDCC 1WWAX 2P5EE 3IS0X 4ZNEE 3HLAB 5HHOB 3BH8B 2D7TL 3OAUL 2DLTA 3LKPB 1HSAA 4HPYL 4HIHA 4L29B 5FB8B 3AS0A 4RQQA 3VXNB 2PCPA 1EFXA 3UTSD 1VDGA 1I1YB 3KPRD 1XH3A 4FQ2L 5C0AA 5FOBB 5J06A 3GSOB 4X7FC 2VLKB 1PG7H 3MLYH 3WHXA 1FE8H 3MNWB 4P49A 5CLTA 4LMQI 2EZ0C 3UZQA 5L88H 4FNLH 4LRIA 3A6BL 5DLMH 1YUHB 3QHFL 1F6LL 5ILTH 4E5XA 3GSNH 3ZE2E 4MGXA 1U91A 4JLRB 3S37L 4PV9B 3MLSH 1FAIL 3C6LD 1UCTA 3F62A 4XMPH 3EOTH 5F70A 5EU6A 3F65A 5C0RH 4UIMB 4PJ7B 4OZHA 5DD0H 3ZYOA 4OZGF 1E4XI 3WUZA 4G42B 4PP1D 3C9NB 1LO5A 4YXKL 1BREA 5GISL 1S3KH 3QIUB 4L4TE 4KJYB 5GSRA 1X5ZA 4UB0H 4WTZG 4OLXL 1VGEH 5ISZD 1NMCC 4OQ1A 4F57H 1X4ZA 4DAGL 5FYJD 4QRRD 3F5WA 4C56B 4DGVH 4XHJC 1U8JA 3WEXB 3WHXB 4OF3A 1BX2B 4WTWA 5DI8A 1DANT 2PTTA 4D0BB 4P5MB 2WINB 3BP6B 3EYVB 2P5WD 1LQSR 4JREB 4LLYA 1H8OA 3GSRB 3W81A 4YDIL 1QG3A 1NC4B 3QUYC 2ENYA 5DD6A 4NN5B 1PW3A 2V17H 5HHXL 4HMCA 2BC4A 3B5HA 1NGQL 3DURB 2Z0BA 4LGPB 4U0QB 4MA3B 2EXWC 3RHWF 4IMLB 4OFYD 4ORGB 4XCCL 1IGIH 5BV7H 1GGUA 3QDGA 1X6NA 3WS6C 4U1GC 2Q3AA 1LK2B 3M8OH 3MGTA 2YPLA 3IDNA 3NH7L 1YPZB 1SEBA 4YO0A 3PL6D 3RA7L 3DO7A 2MQ0A 1J5OH 4HWEL 4PJXF 3MRDA 3MV9B 2IALB 2JB5H 3IKCA 4NFBA 4FABH 1G6RH 3ORJA 1IM3B 3JWOL 4I48B 4MNHB 3E6FB 5E9DD 1DLFH 1MCKA 4GMTL 4J6RH 1D5ZB 3W0WE 4Y16A 1FYTD 2MKWA 2VAJA 4IRZH 5EU7E 1KB9J 3O0RH 3LSOB 4PJBF 5EN2B 2QADB 3K2MC 3DXAD 3CFEA 4I4WA 3SDXE 3R8BB 3WNOA 3LD8C 3HZMB 2YD4A 1XF4B 3KYKH 2LV4A 4G9DA 4P5TC 1DVFC 4ZAKD 2C7UB 5IBUB 4NC0B 1ORQA 5HYFA 2J6EA 1U93B 2FJGA 3KPNB 4GAGL 3BEVB 1IEAA 1H15B 1QLRB 4RMWA 2YPLB 1QFWM 4HJ0C 3AY4C 3V0AC 3VD7A 3ZTJH 1FJ1B 4R97C 2DJ4A 3JXAA 4K23H 2RAMA 5EPMA 5HGDA 4PS4H 4PTUB 1IC1A 4KKCD 1KGCD 4UIMA 3RVUC 2CLVB 5AYQA 3CX2A 1ZE3C 5FXCH 3RI5F 5GRJL 5CJOH 5T5FH 43CAA 2H2SC 4HK0B 4LSVH 4PGDB 2HAZA 2NY1B 3NFNB 4XVTH 4R26H 4H88L 1LDSA 4O2EA 2YD7A 2YD2A 3HZMA 1U8IA 1JGLH 5EWIL 3RZWA 2AJSH 2SEBA 3QI9B 1FGVH 4LSSL 5JMOC 3OPZH 5FOBA 3OJDA 2ZSWA 3MREA 4JJ5A 4MA7H 1RY7B 3FB7B 4X7TB 5I1CH 2AXGB 1OGAA 2AQ2A 2ADFH 3HG1B 1JGVL 1PLGH 5IW1A 2EE9A 4I3SH 2Y72A 3SKMA 3BXNA 3X12A 2B4CH 2ZP0T 3I50H 4HGMA 2AI0H 3QDJB 3K2UL 2CDEB 3W39A 3BKJL 3LH2H 1AGFB 1A9BA 4BQ8A 4X7CC 2EXWD 1MJ7H 3MRIB 4P4KD 2OBGA 4X6CF 4MXQD 3QH3B 1VPOH 4G80B 3D87B 3P30H 3DRTA 5T1KB 3MRPA 3QNZB 4XTRD 4K3DH 3D0LA 2B1HH 4U7SA 3PDDA 1MI5A 3CSYB 3OL2A 2YWYA 5K93A 2HT3C 1ZS8B 2JCCA 3KYKL 5ICYA 2A6IA 1A1NA 2R29L 2HTKD 2NNAB 4Z7UF 5E08H 2F74A 2VZUA 3QNXA 4UV7L 4RIRB 1DBJH 3QCTL 1XT5A 4B7LA 2PTTB 4D0BA 3R0MA 4S0SD 1EXUA 4U33A 4K23L 3TYGL 2GUOB 3MXWL 2NY0D 1JHKL 2V7NB 3QZWA 4PGBB 5KS9E 3OGCB 5HHMD 3GJFK 1TVHA 3MRNA 4ZS6D 1AGDA 2H26A 4GRLB 3L3IA 4K9EC 4MA8L 3VH8B 1QUNA 4JFDA 3BDYL 1QQDA 3TZVC 5DYOA 3ZYIA 2F53B 5D7SL 2NY5H 3P4MA 5IT2L 4ZUSA 4WU5A 2C4FU 5BQ7A 3L3JB 4WUUE 1EEYA 4P2RE 1BQLH 3V2AR 5I30L 5M95B 5IMMA 3U7WH 5KSAD 1U2HA 2F19L 3O9WD 3S3PA 2VSDA 4RWYL 4JRYB 4PJXB 2R2BB 1K2DA 2RBLA 1L6XA 2YSSA 2BFVL 2DYPA 4HIJA 3KS0J 4EIGB 4WW2A 1CFQB 5BJTA 2CUIA 4TNVK 2DMKA 1YEHL 1IZJA 5DJZA 2NXYC 5FYLD 2A6JA 3PP3K 1Q94A 3ULVC 5IVXA 1JTOA 2RB8A 4XCYA 3RU8H 3RDTD 3GBNL 2ATKB 3AU1B 2CMRH 3GMOB 3VCLA 3OKLA 2H41A 5HBBA 3VGHA 4D8PA 3Q3GA 2BVYA 2DI9A 4UTBH 3WIHA 2C1PA 1VFMA 4KI5D 3L7FB 1MSPA 4I0PC 3U9PH 1FIGL 2XNAB 3GMNA 4LKXA 5JORB 4TULH 4JKLA 5TH2A 3JV0A 2BJMH 3ELAT 5ID1B 2VLRB 4Q9CA 4BH8B 4QO1A 1MUJB 1I1AB 5HYJA 3FT4A 1BBDL 3GK8L 5BCAA 3DX6A 1OAXH 3NGBB 3MLTB 5KSAA 1W0VB 1YDPA 2VERN 4Y8DC 4QXUL 2DLEA 3BPNB 3KJ4C 3KPLA 3BWAA 3O6KH 4ZOEA 3OKEB 1YJDC 4M7LL 3OB0H 3H42L 4PGBA 4JDTL 5SWSB 1AKJD 1VEMA 3W9EA 1AD9B 1LGVA 2FX9H 1BGXH 4Y2DD 2H8PA 1U3JA 4K8RC 4OLWH 1MFDL 4XRCA 1RZJL 3VW3L 3QUMB 3JVGA 2QR0B 4U1GB 3EHBD 2F5BL 3DMMA 1GPOL 4G6JH 3ARGB 4RGMC 3LKNB 4ALAL 1U95A 3O6MH 4TRPH 5DVNA 3I85A 4HAGA 1QSZA 3ET9F 5C08A 1E6OH 4ZNEA 5I16B 1S5IL 4LP4A 2CO7B 4PGJA 4ZD3H 2Z93A 4PD4J 3SE8H 4KFZC 5L2JA 1A6WL 3MRDB 5L88L 3WFBL 1Z9OA 3CC5B 4ETQA 1FFRA 1P4IL 1WWWX 5ILTL 2WSKA 3SN6N 2ED9A 3CMOL 4WHTB 4QXGL 4KRNA 4TTGA 3DSFL 3OKKB 5GIRA 4HKJB 3Q5YA 5C0RL 4M3JA 1T3FB 4U1HA 4KROD 4U6XB 2N7AA 5C6WH 3TLRA 1P9MA 1AGFA 1UYWL 4WJ5B 1N8ZA 1BQHA 3QQ9C 4O2CA 2XZQH 1FVCB 3KR3H 3TVMC 1FZOA 5EU6E 5TPWL 3NOIA 1KJVB 4GW4A 3FB8B 3MJ8B 2FEEI 3GSVA 4RGNC 1BZQK 1QVOA 2R0ZH 4JFZH 4NO3B 5FHBL 3ZDYE 5GJTH 2EXYC 3WUWB 3ARPA 4LSPH 3VXOA 5ISZE 3BX7C 2APFA 3CSBA 1QYGL 4YHKL 1I3VA 1OGAD 5JXEA 1FFPA 4KRPC 2A6JB 3QIBD 2PO6C 3ZL4H 4HS8H 4FG6C 5HHQB 3R1GH 2QADD 4NQDA 1ZLUK 3DUSA 5HGAA 1LEIB 5KANI 3KPQB 4JHBA 4X0KA 3KLAA 5FYKL 1YEGH 1NEZB 2XRAH 4MJ6B 5JHDA 1N0LA 4LLQB 5EU4B 3K8KA 4P5KB 3NIGE 5A2KH 2RJMA 3FB6A 1CR9H 2EDXA 3BDBA 3LKRB 3MBED 4IJ3C 1MFDH 2XY1A 3RNKA 4AZ8A 4QT5B 4RMVA 5TE7H 3PV6A 5IEHA 3O9WC 1F90H 3L3JA 3C8KB 2FJHB 1W0WB 3GMRA 5D1QD 2H3NA 3UYOD 3K0WA 5HYQA 1BMGA 1J1XH 1KIUA 1OW0A 4Y4KA 5EB9A 3QXWA 5I1EL 3GUTB 4RNRB 3SGDH 1G84A 5EO1B 3BGMB 1I75A 4NYLA 3WFBH 3R06B 2XN9D 4EBQL 1MCDA 2MHAA 2QQLL 4PJ9C 1R5WA 1OT2A 2FHBA 3AREB 4UT6H 2ITDB 1AGEB 2DLFH 1S7QA 2P5ED 3D25A 3G6JB 4GG6E 2W9EL 1GJIA 2ICEA 3OX8B 4NN7C 1WAAF 3HG1E 4X6FA 2V9RA 2EKSA 5K33A 1FAIH 3EO9H 1KCRL 3SDCA 1QR1A 2HJLB 1HOCB 1JZ5A 3MJGX 1H9VA 1KN4L 1A1NB 3IDGB 1U41A 4HV8A 4KVCL 4FNLL 5DLML 5B39B 2FJHA 1MHEB 3QJHB 4H8WL 1VADB 4IMLA 3SKJL 1QHOA 3SDXA 2HTKC 2Y07H 1P7HL 3RX8A 2E7LC 3MLTA 1G7MA 3CMGA 4HUUB 5ICXA 4X6EB 1HWGB 3G5YB 3FT4B 4LIQE 4DGIL 1ETZA 2CD0A 3E2HB 1O7VA 4Y88A 4LRIC 1A3LL 2VYRE 3MRIA 4OFYA 4QRPA 1V3LA 3QAZB 1QKZH 1ZA3A 1JI2A 1HOCA 2IC2A 4U49A 5BVPH 1U8QB 1ZT7A 1OAYH 3S37H 2IG2H 3RWCA 3H2WA 5DO2D 1AHWC 1ROWA 3H9SD 3RGHA 5C9JA 5K9KB 3MUHL 4JEGB 1WBZB 3L5JA 5ANME 2ZNXA 4Z5RA 1J1PL 1MCPL 4MNGE 3DBXB 2A2QT 5C6TL 1ONQB 5F72S 1WCBB 5CJQH 3DIFB 3QIBC 1LE9A 2VWEE 3ARDB 1QVOB 5L2KD 3I02B 4F3FA 1MFAL 2LU7A 2DMCA 3VFTA 5ABDE 3NFSL 1LP9F 1MCQA 5BJTB 1HH9A 2HKHL 3MLXH 4NKDA 4NDMA 4ETYA 3C87A 5F44A 1QACA 1NBVL 1PJ9A 4S2SB 3FRPG 2YBRA 4G6AD 1XZ0B 4U1KB 3CZJA 4R3SB 4KI5C 3P0YH 4NBXB 1W0YT 2WBWB 5KJRL 4LCUA 5E7FA 5GHWH 5E8EB 4AL8L 1F4YL 5GIRB 5LBSH 3ARFC 5C0FA 3DROA 3FQXA 4ZPVB 3O45B 3NA4A 2R8SL 1MFNA 3I02A 3EYOA 3O2VH 4P46A 4K3JL 5E5MA 1J5OL 3RJQB 3UJJH 4NO0A 1K8DA 1W72A 4DFIA 4Q9QL 1RZFL 2DQEH 4IOIA 3OKMB 3O41B 2FCBA 1TVBB 4KDWA 3VXOB 3VFWA 4QHNA 3WS6A 2YD5A 4UV7H 1T2QH 4XCCH 1MI5E 1IGIL 3RVXC 2EDNA 2WM0A 4ODWA 1X44A 3U36A 5IV2B 1NANI 4YBQC 1HI6B 4C83B 3VWJC 3PHOA 5FGRA 3FB8A 3OZ9L 4GBXB 5BRZB 1OPGL 1KIQA 1G6RL 2MJWA 3EZJB 4MNQD 3WXVL 3TO4D 2OQJA 2FNBA 4MWFB 3KYOA 3ROLB 4GRWH 5DK0B 3FOMA 3L1OH 1GAFH 5DTFB 5DMGC 3LRSA 2GJZA 5EA0L 3HI6L 1KBGH 3HNTH 4N8PA 1WSST 4JFYB 3VFMB 3STLA 1NCDH 3EDJA 5LXGH 2E9WA 1FO0L 1E6JH 3FT2B 5HYJB 5B8CB 1DVFA 1CYGA 2X42A 4NN6B 4MA3A 5E1HB 3FB6B 1VB9A 3PL6C 4EUPH 1JGLL 2EIZA 5ACZB 3H3PH 3VE0A 4YR6B 5FV1L 3S35L 3VXMB 1KIQB 4NO0D 3I6KB 5DQDH 4CUCA 4N8VB 1Y0LA 3QDJA 2Z8VC 4U1SB 1FZKB 1I85C 4PRHD 1W72H 4KXZI 4APQB 5DT1H 4LLMB 4P4RB 5J6HA 3NZHH 4NRZA 4ZFFB 1V8HA 4UU9A 3KGRA 1FNEB 1IKNA 4CU8A 2Y7QA 4X8XA 1FFNB 2VLKE 4ZS7H 4Y5YC 5EIIA 3TCLB 4AIZA 1FGNH 5D1ZA 3OPZL 3D69B 5C0CE 5T5FL 2HFFA 5D9SB 5D1XD 3BHBA 5I2IA 3ULSA 1Q9OB 4UTBL 2ADFL 2FSEB 3MRKB 2HJFB 4R26L 3PP4H 5T5NG 2P7TA 3ZKXB 5CD5C 5DHYB 1BQUA 4HKBB 1FAKT 1R5VB 5DR5L 3VGGA 1KPUA 4JANA 4LSSH 5EIQA 4F2MB 4EXKA 1BM3H 4FQXA 3GK8H 4P3WA 2VDMH 3O2WH 5HGDB 5A16A 2APWA 1DL7L 2DQUL 4QF1B 3QNYB 3RPIB 3OKKA 3VGAB 3TH3T 3U4EB 2VLLB 4HUXA 5JO5A 4UDUA 2VB5A 3KXFB 5D7IB 5D9SA 5A2JH 4HMDA 1H3PL 4RDQG 1X6LA 3QEGH 4JPWL 2QEJA 2ATKA 5HPMA 1XGUA 3RTQC 2O61A 5FYLL 4F37F 5HD8C 3VRIA 1VPOL 1ADQL 3FQTB 1CLCA 5IVXB 3O4LD 2R23B 2R9HC 2Z31A 5C0AB 4K07A 4ZXBB 1UH3A 1MPAH 4X6CA 1R0AH 4M7LT 2WK2A 5JHLL 2PO6D 2J8UB 2ZPKH 3SKOB 7CGTA 1FZOB 4OUUB 1Z3GH 2BP3A 3M45A 3O3BA 4N0CC 1IM3A 3PIQA 4NM8H 4JQVC 4TPRL 2IAMB 4GG8A 4M1CC 2B7DT 3C60D 3JV6A 4OD3L 4MJIE 1HQ4B 3CX5J 4XVUC 3RL2B 3QNZA 1F6AB 3NZHL 4OQTL 3UTQA 4Y5XC 4PJEE 3HI1A 2XWJB 2YWZA 4XCFH 4UMGA 1DDHB 5DZOA 3UTTB 1RU9H 3GMQB 5I8EB 3TA3A 1HCVA 1T22B 2FD6H 4DZ8A 4UQ3B 1UH4A 3MFFB 4RSVA 3VGEA 4PRDA 2JB6A 4N68A 3GMOA 1D5BA 1CFNB 1TMCB 1JNLH 3QHZL 5J9PB 2HMIC 5DK2B 2I9LB 1I8LC 4W70A 1WAAE 1PX4A 4P9HL 1CZ8H 5C86A 3SGJC 1QR4A 2VXSH 4HGKC 2X5PA 3L7EB 5C09E 4M5YL 2Z91A 3CNKA 2PNDA 4KJWD 4M6NH 4X4YB 4YHOL 5CKAA 2P24B 4CVWA 2FYYA 2NR6D 5LQBH 1BEYL 1AHWB 3S5LA 1J88A 2X7LB 3FB5B 4RMTA 1FL6B 4PR5A 3IAPA 2R4RH 2IMMA 4L8DB 4U3CA 3CFDA 2BRRL 1CDBA 3O6KL 5FUCE 4NQDE 5IROA 4W81A 4XCNA 5IKCA 1MCWM 4F2MA 1BF2A 4OZIF 3S4SB 2BCKB 1LO4H 2R0KL 3O3AB 5F89A 1A9EB 3BXNB 1HHJA 3TM6A 2Q86B 1QRNA 2C7UA 1OP9A 1I8MA 4EEEA 2J8OA 5IFAH 3TN0D 4XXDA 1MLCA 5A43C 1J8HE 4GMSL 2UYLB 4JREC 5E4EB 1INDH 3KPSA 5EULV 5JIHA 3LZFL 2LU4A 1JK8A 5I1IH 1E27A 1JUFA 5F1NB 3T65A 3I75A 2A74A 2VITA 4WI3A 3UO1H 4PJDE 1S9WA 5FCSH 3RDTC 4LU5H 2YMXL 1A6VL 3BSZH 4QRUB 4JPVH 5F1OB 5K9OB 1MCOH 1KACB 1AE6H 4EDXB 3MV9A 3C6LC 2W0KA 2UZXB 1TZHA 2Z8SA 4OV6F 4GT7A 3WE6B 3P4OA 4NNXB 4DK6A 4JR9L 4TRPL 4LF3A 5TPWH 4H1LH 5CEZE 4GBXC 1EVUA 3TA3D 5EBGA 3MCG1 2ERJB 4JPKL 3RGVB 1S5IH 2C26A 3FOMB 2V9QA 2VZ1A 1TVHB 1S9XB 3MRNB 3PJSA 3QJFA 1FQ9C 4O2FB 1QKZL 4FMFA 4P23A 1B6UA 4CVXB 3QDJD 3EOAA 3CCHA 1UYWH 4NHCH 1OAYL 4LCWB 1G9NL 1LK3L 1AXSB 2DKMA 1FZJA 4P9HC 3GMMA 2EO9A 3R1GL 1G7PB 1YY8A 2E6PA 4LEOB 1J1PH 1R6VA 2VXQL 2FO4B 5CBEB 4LCWD 4PRBB 1PZUB 2GTWA 1GC1H 2DF3A 4U6YB 4C56A 3SEPA 1S9VB 5ICYB 1BBJA 4KK8D 2JIXB 5BO1H 1LO4L 2R0KH 1QFUL 2XN9A 5F7HA 5I76A 1ODAA 1UCBH 2HRPH 3V9FA 5JZ7D 3E1F1 1EAJA 4KWUA 3MV01 5DURD 5AUMB 1KJ3L 4JY4A 1EERB 5F1IB 5IFAL 2YPVL 2IADB 1RUQL 4FQJH 3S97C