5J57B

V5e1-rta complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
124
Chain Sequence
VQLAETGGGLVEPGGSLRLSCAAPEFRLQYYTAGWFRQAEREWVACISAGGGVTYYTGSVQGRFTISRDNAKRTVYLQMDSLKPEDTAVYSCAADLEYSQIMPSCRGSYGVRGQGTQVTVSSAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Ricin
publication title Structural Analysis of Single Domain Antibodies Bound to a Second Neutralizing Hot Spot on Ricin Toxin's Enzymatic Subunit.
pubmed doi rcsb
source organism Ricinus communis
total genus 31
structure length 124
sequence length 127
ec nomenclature
pdb deposition date 2016-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j57B00
3BFOA 5B4MC 5EDXA 3CSGA 2Q6WA 3MGOB 4R7NA 4DQOL 3QNXA 4DQOH 5J6HB 3MBEC 3MJ9A 2FO1A 2FHCA 4ZD3L 1MLBB 2LU7A 3MODH 1CU4L 5FIEA 2ZCHH 5AUMB 2H9GA 4YPJA 4L3ED 3QG7L 4U6YA 4MCZB 1VHPA 1ZVSB 2MQ0A 2Z9TA 5TDOA 3ARSA 2A6KB 4WEUD 5L7XL 5M94B 3L3GB 1F6LL 1CG9B 2XNAA 3GI9L 3HMWH 2J6EL 3GI9H 2A74A 2VLKA 5DJYB 4KV5F 5ID0A 2VNCA 1OF2A 2R15A 1BFVH 1NH6A 1R3JB 4M6NL 1ZHLB 4MNGB 1J8HE 2HT4C 3SKOA 4G43A 2ADFL 5EFIB 3D69B 2X4TB 2WIIB 2LE9A 3D9AH 3T0EE 1UJ3C 4IRJA 4BSWA 4WW2C 4X99B 5GIRB 2DMBA 5C0AA 4H25A 4WHCA 1JHLH 4NKDA 4ELMB 1AGEA 1I8LC 3I6GB 3U9UB 1RUKL 4OF7A 4ZNEE 4WIQA 4OKVB 2OMBA 5HD8D 4IRZL 4LCUA 2Z35B 4ZXBA 4ESKA 1MRCL 1DQMH 3TZVD 4BQCA 4ONGH 3RWHB 3HI5L 5GRJH 1BP3B 4JQXA 3ARGD 4R90L 1JZ5A 2BSSB 4PBWD 3DROB 1OQOA 5EU5B 4BZ1L 3AMKA 4ORGB 1IKNA 4LU5H 2ED8A 1IL1A 1ACZA 1XF5A 4XX1G 3SDAB 4XNMA 5DVKA 4EI6A 5DJ0A 5EIVA 4UOJA 4MVBC 1INDL 2FO4B 1B2WH 4G8IA 3LOWA 1A21A 2DAVA 5DLMH 5C0JA 4JFXA 4JM4H 4UUJA 4Y4HB 4UBDD 3JWDL 5BMFL 1BPVA 3F7RA 3H9SE 1F3RB 1U3HA 2R69L 4NBXB 1QBLL 2DQUH 5D7IB 5L8JB 4G42B 5EZIH 5ISZB 3KNBB 1WAAE 1SHMA 5DA0B 5IB5A 1E0OB 4F2MA 2VISA 4AG4H 1IGTA 3EHBD 2H3NA 4JM2F 4M6OH 4FXGA 1LO3H 4GKZA 3MRMA 4C56E 4G7YL 3C60D 2ZUUA 5HHQB 3G6JA 4U3XA 2NY2B 1NL0L 1A2YA 1CTNA 1KJMA 5EPMB 1WEJL 5IHBA 5JA9A 4OD3H 3QAZB 3MUHL 1VFMA 4U1IA 3GMNB 4PY8J 1R5IA 2Z91B 3HE7B 3P3YA 3MRIB 1M05B 1MPAL 1SJVA 1KEGL 1NGYA 1TJIL 5AAWA 5C09B 2Y25A 3UTPE 3H8NA 1I75A 4G6ML 4YE4L 4NQCB 5IQ9B 2VL5B 4GUPB 5CP3A 1YN6A 3MCLH 2R1WB 1ZSDA 3X11A 3O9WC 2NX5A 2X44D 1T0MA 2V2TA 4D0DA 1VGEL 3K2UH 3FZUC 3EOTL 5MEQA 3H9HB 3QXDA 5FV1L 4LLYB 3NCYS 3AU1B 5B8CA 4P46A 4V1DA 3S88H 2AQ3A 2DYPB 2OJEB 4I13B 4UDTA 3MRGB 4U05A 5SWZD 3OKYA 2YRPA 4S1SH 1IARB 4GKNB 5FGCB 3RDTD 3B2VH 2DWDB 3P4MA 4HS8H 4QXTA 3NTCH 5D7KE 2IJ0C 4MQXD 3OV6A 3TC9A 3OF6D 4I5BA 3L5XL 4I9WE 4KK9C 3L5XH 2B5IC 4Y2DC 2IEPA 3U6RA 3FO9A 2N7AA 1KB9K 3LZFL 3LZFH 3UJJH 1G6RL 2VDRH 1HHKA 5SV4A 2YUZA 4KI5C 1ZLSH 3KLSA 4HIHA 3OR7B 2EE6A 3N0PB 3TA3B 1N0XH 4HMDA 5CD5C 3DXAA 2BNQB 5TE6H 1GOFA 1QBMH 2KQNA 5DC0A 5E2VL 1YPZA 3HTLX 3TNNA 3GI8H 5JOFA 1C16B 3TH3T 3U30C 5INCB 2FSEB 4OZIA 2DQGH 4L29A 3GGWB 3TF7C 1FVDA 4X8JA 2A1WH 2R4SL 4Y16B 3ZKNC 2RR3A 2O5XL 3PWNB 3DV6B 4XZUA 5EULV 1MCEA 4PGBA 5ETUB 3SOBL 4XC1H 3ROLA 4G9DB 3NACL 2HN7B 5DHXB 3QO0B 3NACH 2ESVA 5ALBL 3SJVA 5ALBH 5C0BA 5HYFA 4J8RB 3GMMA 4ZOCA 5CP7A 3P11H 4W81A 1P7KB 1VEOA 3T1WA 4OZHF 4IDLA 2R2HB 1O5DT 2E9JA 3ARDD 4HC1H 4L8DA 5FO8A 1WBXB 1RUQH 5FUZH 4JPIA 5DC9B 2FH6A 1CLCA 1D5XA 2F74A 4M4RA 4W70A 4X9HA 1AGFB 3L3DA 3C5JB 5A2JH 3BKJL 2MPAL 1T04A 1D5ZB 2CLRB 3OZ9H 4JFQB 1KB9J 1UM6L 4OBSA 3RWGA 4M7KL 3MRBA 4F7TB 1G7LA 2P24B 4RQQB 4DGIL 1MUJA 5AYUH 1MFEH 3VMNA 1HQ4B 5J8OA 1UCBH 3IDYC 4MNQB 1CVRA 2VZ3A 3R1GH 3PF2A 3BDXA 1UB5B 2R29L 1A3RL 1AXTH 3QRGL 5EU6B 5J7CC 2G2RA 1BX2A 4PJGF 4G8EA 2FCBA 3AREA 5FB8A 3FQTA 3OAYK 1YEDA 4U2YA 4RX4A 4ZNCD 4JLRA 4ZFOA 2JCCA 3TN0B 3IRZA 4N9GB 3MV7A 4R4BB 2JK5A 5CZXC 4KUCD 5F7DA 2EDTA 3KPRE 3O6FC 2Q20A 3GRWA 2OJZH 3PV7A 3PQYB 4NKMB 2NY1D 4D8PB 1YN7B 5HGDB 3NBNA 5I71C 4G7VH 1G0XA 2IBGA 4OFYA 1F90L 4DCQA 1TIUA 1I9IH 3HI1A 3U9PH 1Q1JH 4X6CE 5DDHB 3FO1A 2BVEA 5I1EH 1ZWIB 1T2QL 3K7UA 3UJIH 5AG8A 2X4QA 3GSXB 5CWSA 2PW1B 4ODHL 3N1MC 2FBOJ 4CAGA 2AJSH 5CSGA 1H0DA 2A2QT 1FZMB 1VGKA 4Y4FA 2PKDA 1PDKA 1OGAB 2W0FA 5HY9B 3RQ3A 1U8HA 1M7IB 2X4NB 5BRZE 3QHZL 3NFSL 1QA9B 3NFSH 2APFA 5A1AA 1LGVA 5J1TC 5DI8B 1G7IA 3DX7B 5EU4B 5CAYB 4EJ1C 1FG2B 3TPKA 3WO3B 2IH1B 1FFPA 2ICWA 1U6AL 4NQEE 3MJ6A 4LLUA 3G5XB 5I6XC 5IBTL 5TE7L 3V6OE 1BQUA 4TULH 2IG2H 1MFNA 1TFHA 4X9FA 3MLYL 5EOQH 3E2HB 1FNGB 2DM2A 2GYSA 1ZLUK 5I1GL 1A1MB 4ZTOH 5GGUB 2FBJL 1T7WA 3WL9A 4GXVL 2DQEH 3VXMA 1FC1A 4S1RL 5EO9B 3EO9H 4JFFB 4RIRA 1XAUA 3OAZH 2Q76B 1NCDH 1AKJD 3LB6D 3Q6GH 3RL1B 1CICD 1DSFL 5C3LD 2IANE 3MA7A 4NQSA 4WI9A 4XMPL 1J8HD 4XAWL 1NFDA 1QNZH 2HRPL 4XAWH 4XNZB 2ZOKA 4YO0A 3SDDD 1IJ9A 3T0ED 4IDJL 4K3JL 4IDJH 3GO1L 1T1XA 2Q7NA 2P5EA 2OBGA 5D1XD 4MXVF 4MSWA 4GBXA 4PRIB 4LARL 4I3GA 1I1RA 3V0WL 5IJVA 5I1HL 1YNKL 2VUYA 3EYQD 4UIKL 2GITA 1RHHA 3SCMC 4JN1H 3LMJL 1U58A 4L4TE 5I19L 5EU7C 5TF1L 4K7PX 1AY1H 5TF1H 5C08B 1RIUH 2F15A 3NFPA 1XF3A 3PWUB 2YA2A 3HE6D 4P23A 2HT2C 4FQJL 2OMNA 4Y4KA 1HSAB 4U1NB 3W0WA 4RZCB 2WSKA 4XXCC 4HH8A 4FTVE 1OWRM 3A6BL 3OX8B 3A6BH 4H88L 4XWOC 3H7BA 3LDBB 5D1ZA 1A7BA 4HWUA 4PJEB 1MVFA 4XAKE 5EBWB 5JIHA 5F6HJ 3KPQA 3LKSA 3OG4B 4KJYA 4NO0D 3TVMA 4ZYKB 2J5LC 4NSKA 2NTFB 2ZUQC 2EDJA 2EIZB 3KJ4B 3H9SD 2Y6SC 4AZ8A 2JIXB 2G5BA 5IM7A 5GS1A 1BQHA 1G9EA 1LO4H 5B21A 5JHDE 3IKCB 3HFML 4C56D 1FZOA 1S9VB 3WSQH 3SDCA 4N8VA 3TIDA 3QUMA 5FYJE 3BGFC 2HFEA 1ES0A 4MDIB 4ZAKC 1EUTA 3DRQA 1KJ3L 1YYLL 4R2GD 1YYLH 4WV1A 3D3VE 1NUGA 2DD8H 2CRIA 1TVHB 2DIBA 5T3ZE 1L7TL 4PY7B 2OZ4H 1L7TH 2UWEA 2V5TA 4ZSOB 4HAFA 1GRWA 3QDJE 1KLUA 1Q0XL 4NJAH 5C9JB 3IXAB 1DQQA 3UTPD 4NO3A 3D18B 1A9EA 4MQ7B 5EIIB 1HYSC 5I8KH 4HK0B 2MMXA 3D2UD 3LEVH 1R3HA 4IIQC 1OB1B 2ED7A 2YPKA 4RRPA 5F1NA 5GPRA 3C2AH 4L9LC 1T5XB 3TCLA 4PJIB 4FN0A 3GBNL 3ULUE 5E9DE 4PR5A 5D7KD 4EEEA 1S9YA 2FWOB 4I9WD 2ICWI 3THML 4DTGH 1KIPB 1CS6A 2YA1A 4PPTA 4M43H 4X6BB 4KY1H 3MPCA 5J4MA 4PUBH 3CXHK 2YOCA 5ITFA 2FJGB 1BBJB 3BKML 2YUXA 3BKMH 5I1CL 4XPTL 2YMXL 3REWA 2BY2A 2BMKB 5E5UB 4Q97A 3QIBB 2N1KA 1PLGL 1RZ8B 4EKXA 4OSUH 5BQ7A 4IEFB 4RMRA 4WUKL 4WUKH 4CVZB 3DX6A 2WLZA 2Z93A 2ZCKL 5C0CB 3BO8A 5C0DA 3U7WH 3MCG1 1XGUA 4QHUB 4XPFL 3FQNA 1X9QA 4PTTA 1RJYB 2J88L 5E00B 3QI9B 3E6FB 4JGJA 2J8OA 1Y6MR 4Y5YB 3KYAA 2W9DH 1IRAY 1NUFA 5FA3B 3KYMA 3ALXA 1P84K 4N90E 1YMMA 4LIQL 4YHNA 4MD4A 1QLRA 5LGJA 1XGTB 5JDJA 5IMKA 2HTKC 4FNLH 4O58L 4LLAA 1N2RA 3HZVA 4HEME 3HPJA 4WDIA 3CUPB 1I3GH 4LPUA 5DRNB 3QWQB 3FOLA 1WBZA 2V6HA 5FECB 3GMRA 1ZLVH 1KIQB 1JF5A 1KSRA 5DQDL 3TYFA 2KDGA 2GK0A 5EN2A 3V6FA 3CXHJ 5FUCC 1AR1D 4B50A 3BOVA 3AS0A 2ZP0T 4LHUG 4U0QB 3U4EB 4K7PL 4LBEA 3DETD 3W9EA 3MBEB 1Q94A 2QJDA 4X5WA 1K9TA 1QSEA 3I6KA 2ZUTA 3I2CL 4QHNB 5IQ7L 4GG6E 1VCAA 1NMBH 4GMSH 2OM5A 4YEFA 4ENED 4NWTL 1CDHA 1G9MH 1UWXK 4R0LC 5CSZA 4LFHG 1T89C 5I1LA 1IC5L 1NCAH 1U93A 4HD9A 2BOCB 5ECJE 3IU4H 4YNYA 2HJFA 2C4FT 2VLJE 1BD2E 4JKWA 2F53B 3EUUA 2XWJB 3BP6B 3BWAA 2G5RA 3KPRD 2AJZA 3FB5A 4Z7UB 1S3KH 2FD6H 5HHNB 1CDBA 1OHQA 2DQCH 4UIMA 2XG5A 2FLBT 5DS8B 3FFCE 1I8KB 6CGTA 5I18H 4M5ZL 4M5ZH 5DGQA 1XCTB 2OR9H 1VEPA 5KZCD 1KPRA 4PYHA 1UJ3B 5D6CB 4WW2B 5JXAL 4HUVB 5CGYC 1DDHA 5DK3A 3MV01 5C2UB 2DQHL 2VIRB 2GK2A 4M61B 1BVLA 5AEAA 5FDYA 2D7TL 3BGMB 5FYJU 1KG0A 3C6LD 3C5ZC 3CFIC 3KG5A 5BRZD 4K71C 4XBEH 5EBLA 1I1CA 4PJ7B 4JY4A 5L2KA 3WFHA 3GK8L 3P9LA 4WO4C 5FYLE 2BRRL 4XI5D 4NQED 2VITA 5CBEA 5KW9L 4N0UE 1OAZH 2BNRB 3WXWH 4XGZA 3MRPA 1KBGL 4I2XA 4L4VB 3UTZA 2R1YB 5F97E 3X3FL 4LKXB 2C4FU 4GAJL 1G0YR 4OZGF 1NGWA 4GAJH 1ED3A 3ZKXC 1T83A 5FM5O 1F45A 2YUVA 1UM5L 4DN4L 2P5WB 1JFQL 1W0WA 2AKRB 1QFWM 3REVB 3QEGL 2D7MA 3OPZL 3OPZH 2IAND 5IOPA 4U4BA 1V7ML 4GQ9L 3KGRA 3QUZD 1V7MH 3M1BA 4J4PC 4ZQKB 5EUOB 1TITA 3JTTA 4PGDB 4BH7B 4JDTH 4PJBE 2J7LA 2F58H 3F7YB 4K2UL 3Q48A 4AT6A 1M1SA 1A3LL 4NKIL 1U3JA 2EYTB 4X9IA 4IRJC 3SE3C 1H8SA 4URTB 4OGYL 1SJEB 4GLRH 4U1SA 4IOIA 1IGFH 3DI2B 4L4TD 1BREA 1A9BA 1K4CB 2VWEC 4WJ5A 4EXKA 1IAMA 2QKIA 4IHOB 4ZXBC 5HGHA 3ZSSA 1IQWL 1FZJA 3MRHB 2X4SB 4JZJC 4OIIL 3RIFK 1PKQA 2HYMA 1VFAA 4HUXA 1PW3A 1RUAH 4IOFD 4JO1L 2XKUA 5CJ8A 2FDBP 3O9WB 4FTVD 2H2SC 2F5BL 4LPCA 1IAII 3ZZ1A 1DR9A 5J06A 5CUSH 3N1GC 4XCNB 2FNBA 2P43B 4HFWB 4HUWB 5CS7A 2PCPA 4XAKD 3QDGE 1JPSH 4KDTA 1WT5A 3V0VA 5H35B 4HJJH 3CCHA 4RFOH 1CGXA 2LVCA 3MRRB 1S9XA 3SDXA 4PRNB 5DFVD 3BE1H 4L8SC 3VMPA 1P4LA 4FP8H 2QADC 3QH3B 5FK9A 4KAQL 2B5IB 4Y2DB 2CSPA 5IVXF 5LG1A 4W4NA 1AFVL 1NDMA 3KPSE 1AFVH 3Q5OA 2CKBH 1K3IA 2C7UB 2UZYB 5SWQA 5JHDD 3U2SB 2VMFA 3TT3L 3VFGL 1LEIA 3RAJH 3PGCA 4F37F 1EBPA 1IFHL 3JV4B 2G9HB 5D7LB 3X14B 3B9EA 1QVOB 5FYJD 5ILTH 2I27N 3UDWA 1S8DB 4K7PY 3GKWH 3TLRA 5DHYA 4IMKA 5C0EB 3D3VD 5EA0H 2ITCA 3WS6A 2VE6B 1Q9OA 1WZKA 5J6GA 5HDLA 3JXAA 5T3ZD 1FZKB 4FQXD 4MDJB 1I7RB 4XP6H 2HJLB 2CKBB 2Z31D 3C6SA 3U30B 4CW1B 3QDJD 1L0XA 1RUMH 3MA9L 5KN5B 4WI8A 3PJSA 3BP7A 3P0VH 1FRGH 4K7FB 1LD9B 3BISA 3O2DH 2AAVA 3V4PL 4Z7NF 1KXQE 4IRSC 2W60A 2ZWLT 4JRYA 2ZUWA 4N8CH 5DT1L 4NC2B 3VRLE 1Q9LB 3HUJB 2E27H 3W11D 3B5HA 3W39B 4Y19B 1PYWA 1VESA 3C87A 1WFUA 3MRQB 1CXKA 3S36X 5JHDA 1NCCL 5AWNH 2WINB 3VDCA 2AI0L 4E41B 2AJUH 3ULUD 5E9DD 2YD2A 2IC2A 3DWTA 1NAML 4JFED 3TBWB 5JPMA 1YMHB 1YNTA 3MLUH 1K8DA 4P5KB 4AYFA 1NCNA 1UVQB 2YPLA 4LCWE 3QB7C 5F9WC 3RWCB 1AIFB 3D39A 4QRRE 5A16A 4HBCL 4Z7VF 3N06B 1KCSL 4KHTH 1SVCP 3WFEL 1CFVL 1CFVH 1P7QA 1SYVB 2VDKL 1RULH 2XI9A 4OQ1A 1RUPL 4KJQC 2FATH 3IDYB 4JFDB 2GCYB 4BH8B 4QRUA 4CADA 3MR9B 1I9EA 1OW0A 2GT9B 1WZLA 2EDNA 3QEUA 1L6ZA 1ZANH 3VXQB 2Q8AL 4KV5E 2Y07L 5SWSA 3RGVB 5BV7C 1FHGA 3L9RA 1H3XA 4XNXL 4YXHH 3T08A 2X4RB 1Z6JT 4XCCH 1IE5A 5FO9A 3F7QA 4FFZH 1LEGA 2XKSA 4JFPB 1F42A 3QDAA 5BZWB 3O6FB 4U33A 4N90D 4LCIH 3BUYB 1A4KB 1HQRB 3VJ6B 1NMAH 1T03H 5CEXB 3KXFA 4ODXB 5I71B 5JIKA 4Y8DC 1IEBA 2RB8A 1U8MB 3UZVB 2OXHA 1TVDA 1MJJA 3UTTA 1PEWA 4JN2B 5IFJA 1N5AA 5KSAC 5BO1H 4JG1H 5DJ6B 3T77B 1XIWA 2P7TB 3MUY1 2PNDA 5DRWB 4NJ9L 5B38B 4DVBA 5B38G 1D9KC 4UU9B 4AEHH 4NUJA 4LSUL 5EUKA 5I1JL 4EN3D 5GHWH 3TT1L 4R8WL 1U8QB 5E2WL 3ARTA 3QUXD 1QSFB 3TBYA 2PW2B 3T0AA 2XYCA 3VXSB 3MREB 5KJRL 5KJRH 4PJFA 4FXKA 4I3SH 3CFDB 1BBDL 1FAIL 4EDWH 1HHIB 5H8DA 4HUNB 4KJWD 1CTOA 1KB5L 5FKPA 3UCRA 4S2SA 2WWKO 4LPVA 2UV3A 2IADB 1EBAA 4O51A 4ELME 2VLJD 1BD2D 5D71L 3PUCA 4X6DB 4P9HC 4PJHA 1DUYA 4YGVB 2HVJA 4KMLB 3B2UD 1T66C 3FT3B 4WHYH 1T3FA 5K59E 4DW2L 4WEMB 2IALB 2AJYL 1H8NA 3FFCD 4LF3A 2CLVB 1E28B 1RJLB 1K4DA 5FV2A 1GSMA 1HINH 1U92B 4UDUB 3RUGF 5BOZG 2CGRL 3OKNA 4XX1E 2VDLL 4HKBA 4ZO7A 2W38A 1UYWH 4ETQA 4GW5B 3QQ3A 4NNYA 3PWJB 5DJZB 4Y2OA 3SCMB 3SDYL 4Y4FC 4DKFH 2NY4D 4JY6B 4WHYG 3WJLC 4AL8L 2VLRB 4JHBA 4PP2A 4AL8H 4XXDA 3I3EA 5D6DA 3KPPB 4XBGB 5FYLD 1DQLH 5D7IE 1QOKA 3DYPA 4PGZA 4S10A 4BJLA 5K9QI 5ISZE 4OT1H 3VRIB 4P2RB 1CD1B 3BIAX 1ZHKB 4HQQL 3WXVH 4TNWF 4Q0XL 1UADC 4Q0XH 1JTOA 1JNLH 1K2DB 1M71B 3PWPA 5FYKH 2JF1A 3S36L 2R0LH 5C07B 4JPKH 3PL6C 1EJ6A 3OKLA 2J5LB 5C6PB 3MMEA 2ZUQB 5I16A 4G6FD 2CKNA 4BFBD 1GC1L 2J12B 1R24A 2WK2A 3VXNB 1A6PA 4RNRA 3ULSB 1S7VB 5GGSY 43C9B 3TV3L 1NUDA 2WBWB 4AK1A 1EEYA 2WBJD 2OTPA 2V17L 4NQCE 2V17H 3EYFA 1KIRA 4F7PB 4ZFFB 5KSBF 5D8JL 3U36B 3QEHA 4MNHA 1S5HA 1BQLH 4M8QB 1MHHA 1I1FB 3RA7L 3BGFB 1I4FB 1R5WB 35C8L 3EOAA 5GGVH 4CN1A 4PLNC 4JFYA 4ZAKB 5J3HD 2IAMD 4J3TA 2R0WL 4G8GE 3NA9L 3FOMA 3MLPA 3WIIL 1PZUB 4PRPB 1CDGA 2XA3A 4Q9BA 1MWAL 3I50H 3WIIH 4LEXH 3HS0B 5D2LA 5FGCE 3DX9A 5IMMB 2NY5C 4JZOB 3ARBA 4YHIA 4GRWF 2BDNH 4D0BB 1AQKL 1VFUA 1W72L 2BY0A 1EH9A 4XWGL 3SKJH 1WTLA 4MJIA 1D5BA 3EOBB 4NRXA 1JGLH 4PLJC 4NQXB 2R2CA 5KAQG 3FT4A 1MNUH 4IIQB 4UINL 4UINH 5AAMA 1JN6A 1HIML 1ZA3A 3QDGD 5EU3B 1DLFH 1BJ8A 4YEEA 5FA4A 4L9LB 1L0YA 2EDXA 1JHKL 2BNQE 1FL3A 3TO4A 3BH8A 4EI5A 3ALWA 4CUCA 3NCJH 4EQ2A 4FQQB 1KPUA 4YFEA 4RMSA 4M7LL 4WCYL 3FQUB 3QIWD 1WZMA 4LK4A 1D6EA 2AXFA 3KPSD 1W2KT 4QXWA 1S9WA 2VLLB 4ETYA 3WKML 5SX4I 3WKMH 5EZJA 3G08B 4OAWA 5L8LB 4W68A 3QUYC 2OK0L 1LP9B 4YUEL 5KVEH 4ZUVA 2NLJA 3WEXA 5FOJA 2RCSH 1T0NB 3PGFL 3GSQB 3PGFH 4RSVA 4UZGA 1LK3L 1XGPB 1RMFL 2VH5H 2BVPB 4PJ8D 2H6PA 3VDAA 3ISWA 1WFOA 1F3DH 4OFVA 4JGMA 4TVPH 3QIUC 4R3SB 2VZOA 3BP4B 2ATKA 1MRFH 1U3YA 3DYOA 5DUPL 5TF0A 3ZMRA 4NC1C 3WHE1 1XGYH 3O3EB 1KV3A 3KPSA 3QXTA 4HWEL 4HWEH 4M7LT 1NAKL 3ZKSD 1NAKH 1GHFL 3RWIB 3GJFA 3FHQA 5HDQL 4QRPA 5HDQH 1D5IH 2X1QA 3BJLA 1HKFA 4MNQE 3LIZH 4K3EH 4QHKJ 3BZ4B 1U8PA 3ARFA 1KCUH 3V6ZB 2FL5B 5BW7C 3O4LB 2HLFC 3JWOC 2B1HL 4LCWD 1AO7B 4M1DL 3HC3L 5EU6E 1B3JA 2EKSA 2ZPKL 4OM1L 1QRKA 4PJAF 1BIIA 4OM1H 5JXEA 1F6AB 4BYHA 2W59A 4QRRD 2JB5L 1S7QB 3ZE0F 1YECL 2JB5H 4XH2A 1VFBA 1YECH 2E7BA 4XVUC 1EERB 3LS4H 1QR1B 4PTUA 4NT6A 2D7NA 3MV11 2RIKA 4NHUB 4HMCA 2W0LA 4PIRF 2IQAA 4UB0L 5IJKA 3QEQB 3I3BA 1Q0YL 5GGQH 1Y18A 1GGBL 1J18A 4K3GA 4F9LC 1K3ZA 4PJXA 3QNYB 4X80H 1TVBA 4R0LB 3RPIA 5EORH 3BVNA 3OMZA 4FQ2H 4U3HA 3VWJD 3L5IA 1MH5A 5I1AA 1CFTB 4S0SD 2XA8H 3VFTB 3O3BA 3KPNB 4QNPF 1B4RA 3VE0B 3MGTA 1LNUB 2CH8A 4ZUUA 3FQWB 5D5MB 3JZ7A 1IGJA 4P4KA 5IESL 32C2B 4K8RC 4ZUTB 5F9JB 4UV7L 1J0IA 4DN3L 1CCZA 1U91A 3FB6A 5HI3D 3OBAA 4X8XA 5IEKB 1NUNB 4RDQG 4JO3H 3GNML 3MRKA 5FKAA 2KH2B 5D9SB 4PGCB 4X7FC 1NANH 4C59B 1T1ZA 4WFFE 4Q6IA 5CEZE 4GSDL 3GMQA 4GKOA 2QR0B 1S5IL 1I1AC 3C5ZB 2X4UB 3FQRB 4J3OC 3IGAB 3MOBL 4K71B 2APWA 5KS9F 4RFEA 1CZ8H 4PJ5A 4OZFA 2X05A 3F5WB 1BZ7B 3VG9C 3CC5A 2I07A 5DRZB 2Q6WB 1ZAGA 4WO4B 2Z4QA 5L6YH 2HAZA 5CZVH 4XMKL 3NZHL 3QISA 5DD3H 1A14L 2SEBB 1JZ6A 4KKAD 1VPOL 1CK0H 1NBVH 4OCWL 1KXTB 1B9ZA 2GUOA 1F4XL 4U6YB 1MFDL 1F4XH 3CX5K 4GJTB 1UM4L 1MFDH 3ZKXB 5D7SL 5TDOB 1L7IH 1FPTL 3BX7C 1CL7L 1OAQH 2A74B 1NGZA 2JJTA 4MAUL 3CK0L 4NWUH 5ID0B 1JPFB 3CK0H 2LTQB 5C08E 3F12A 3OXRB 4AIZA 1A64A 3GSWB 2KBGA 1QO3A 2A6KA 3L3GA 2ICES 3T2QA 4P0DA 3QUKB 1ZVYA 3HB3D 3SKOB 2A0LD 5DJYA 5J11C 5GS0L 1AD9B 2QTEA 4HGKC 4Z78A 4IRJB 4BSWB 3SDAD 3BPLC 5C0AB 2KQMA 1R3JA 3LQZA 4NN6C 4MNGA 2YWZA 4YHKL 4YHKH 4NKDB 1AGEB 1FO0L 4D9LL 5EFIA 4Q9RL 4Q9RH 3D69A 2X4TA 5CEZL 2WIIA 4Y4HD 4X99A 4LCUB 43CAB 4ZXBB 1CDYA 4U3CA 2HKFL 4W4OA 2J6EA 2HKFH 1FG9C 4JZJB 1WFNA 2OR7A 1LMKA 4KK6C 5TDPB 1SYSA 3ZT5A 3IS1X 4PRHB 3U9UA 4PG2A 4A6YH 3EBAA 2Z35A 1XZ0B 4EXPX 5F8QC 1IGYB 2DQFA 1X6LA 3GBLA 1IL1B 4HK3N 4R6UA 3RWHA 1XF5B 4XNMB 2GSIB 1S7UB 4EI6B 3CX5J 5DYOB 2UUDK 2NY2D 4UV4L 3QULA 2BSSA 5GISH 2KKQA 3DROA 5EU5A 1T22B 4L8SB 4JFXB 4ORGA 4Y1AA 3TP4A 5C0JB 3FB7A 1MRDH 3RFZC 4A6YB 1MY7A 2QADB 3SDAA 1FE8H 4N0YL 3SE4C 2XWTB 4N0YH 3LKRA 3INUH 4M3KB 1SEQH 1UZ6E 2QLVB 3QPXL 1QFPA 1C7SA 2ED9A 4Z5RA 4I1NB 4NQCD 2VISB 4U1KA 1IGTB 5FFLA 2P42B 1OQXA 1DZBA 3DSNA 1LEKA 1T2JA 4G42A 4G8GD 5ISZA 5D93C 2ZZUT 3G6JB 1HDMB 4OQTH 1U9KA 4AM0A 2J8UF 4TQEL 2DYPD 2NY7L 4M1GL 4OLXH 1HHGB 4M1GH 5EC1B 2VXQL 3O0RH 3CLEL 4G9FB 4U1IB 4PJIE 3PP4L 4P2QA 1KENH 1NGYB 2YEZA 3RVVD 1HH6A 4DZ8B 4WI4A 5DA4A 4W6WB 4IRSB 2WWMD 3LRGA 3MFGB 4F7CB 1GOGA 1NMCC 2VRAA 3GMNA 2Z91A 2NMSA 3HE7A 3MRIA 3NH7H 4ZS6C 2JJSA 1MCWW 3VW3L 1XR9B 1OARL 3ZSTA 1T0MB 4D0DB 5C09A 1EPFA 4HWBH 3TA3D 3QXDB 3TESA 1HCVA 2VL5A 4GUPA 4RWHA 3RZCA 4TSCL 2BNQD 1QPXA 5HGAB 2DLTA 4YHMH 5SX5K 1WT5C 5C0CE 3ROOA 3U7AA 1Z0MA 2FHFA 4QXTB 3OXSA 1J1OH 1DBMH 3IYLW 3RKDC 4FFWC 1OTUD 1H8OA 3FMGL 4LLYA 3HNTL 5F9WB 3HNTH 3WFCL 1KOAA 2V5RA 3U6RB 1MJUH 3EYSL 4Y16D 5BV7L 5CCKL 3FO9B 4NOBA 2YN3A 4GKNA 5CBAB 4CBPA 2XT1B 1HHKB 5E94B 1E4KA 5AZEL 3MRDA 4XP9H 4TUOB 4F58L 3ZKMD 3QQNA 4HGWB 3VI3F 2AV1B 3ARUA 1AGDB 1FSKC 4IMKC 3VI4E 4D2NA 2WUBH 2UZXB 4AMKH 1W8NA 1S7RB 3OR7A 3ECBB 2VAAB 3TNNB 3TA3A 5LCVL 4ODVH 1NKRA 4OZIB 4MA8H 2VOTA 1M7XA 1KCLA 3QPQD 4KRPD 4FA8A 4X8JB 4GMTH 4IM8A 1IC7L 1IC7H 3O6KH 3TJHC 2R0ZL 3RP1A 3O41B 3ZHLA 1A4JA 1C16A 3P4NA 2NXYD 4UT9L 1U0QA 2FSEA 5INCA 1G6RA 1RZJL 4BFIA 3ROLB 1QG3A 3GGWA 1BEYL 2ESVB 5JUEL 4GQPH 1FL6A 3SJVB 3X3GL 1L6XA 2QQQA 3GMMB 5CP7B 4GH7B 3PWNA 3DV6A 4MNQD 5ETUA 3BSZL 4H1LA 3MACL 3MACH 4K9EL 1PQZB 2HN7A 3QO0A 2F74B 3I75A 2OL3H 5KSAB 5EU6D 1WZ1L 3L3DB 2HG5B 4J8RA 4Z6AT 4Q74A 1Z3GH 1T04B 2GW5A 2PYEB 3HMXH 1P2CA 4POYA 4ZG1A 4MXQD 1K6QL 2R2HA 4P9MH 5D1QC 4M1CC 3RWGB 5IEHA 1WBXA 1QRNA 1D9KB 3MRLA 3MRBB 3N1PC 5HHXL 6FABL 3ARYA 4M00A 3C5JA 1GVIA 5ESAB 1A7OL 3LHPL 1D5ZA 3U7YL 4ZO8A 4JFQA 1CI5A 4P9HH 1EO8L 2ARWA 1UWEH 4Z7UE 4O2EA 1S9KC 1V3LA 2OL3B 3HI6L 2EDRA 3C09C 3V4UL 4F7TA 1WIOA 2P24A 4L3CB 4DKEH 1RURL 3WDJA 1J5OH 2IPUG 2EZ0D 4RQQA 4EIZC 3IDUA 1X6NA 1HQ4A 4G8EB 1YEGL 3O2WL 3FQTB 4MXWH 3V8CA 1ADQL 4PP1C 1PD6A 3RJQB 4LQFL 2IPTL 4PY8I 4R4ND 2JK5B 5F7DB 1IM9A 4YHLH 5JHLL 4PJ7E 5EZLB 2E8ZA 3O11A 3OKKB 1B88A 5GS0D 3TN0A 3QQ9D 3L95B 4R4BA 3KAAA 2COQA 3HI1B 4KROD 1HH9B 3MRNA 1EV2E 1KJ2L 1Y6KR 2X4QB 3PQYA 4GXUM 2C3WA 2ZKHL 4WFFD 1HE7A 5CEZD 1YN7A 3WV0A 1FCGA 5HGDA 2YD6A 2ZG3A 1VGKB 4Y4FB 5TPWH 2QSQA 3W81A 5C0ND 3GMLA 4YZFF 1T1YA 1ZWIA 1KTDB 1P7HL 3CJJA 4DKAA 2BNUB 1DQJA 1QQDB 4LGSB 5KG9B 2XQBL 2XQBH 1D7FA 1I7ZA 4BQ6A 1ZLWH 1DFBH 5F7FA 1FFPB 1OGAA 2ICWB 1M7IA 1OY3B 5JW3H 5EUOE 4LLUB 3W82A 4NO2B 1FLRH 5DI8A 2BY3A 2EC8A 2O61B 3DX7A 4XPBL 2DQTL 4NDMA 2FYYB 5BS0E 3F58L 3L6FB 1FFRA 4LSQH 1JRHL 1JRHH 4LSSL 1JPTL 2DJ4A 4OFPA 2H32A 1JPTH 3P4OB 5T1KD 4KZEH 3G5XA 3PL6B 3BPNC 5FEBA 1U8IA 3KR3H 1W0VA 1MI5E 1FNGA 5C08D 5HI4D 5HDBE 1A1MA 3MA7B 1RJZB 1PSKL 1JPGA 1E6JH 1JNHB 2NY5H 4JFFA 4LSVL 5GRZA 2O5ZL 2O5ZH 1OTSC 4PJDA 1NFDB 2Q76A 4MB5A 4YO0B 3TWCH 4MQSB 3CMOL 5I8EB 1T1XB 5DMGC 4JEGB 1MLCB 2WZPD 1OSPL 1OSPH 1C5CH 4UTBL 1FJ1A 1P4IH 2GJ6A 4Z7NE 3QXVA 4MWFB 4JCMA 4F7MB 3HRPA 1XT5A 1MAMH 1NLDL 3MRCB 3NCBB 5CJQL 1U36A 1A6WH 4LEOB 5D6DC 4PRIA 1IGCL 2E7MA 1CF8L 1F3JB 3U1SH 3T0VA 5TJWK 5F3HA 4P59H 3AB0C 3MUJA 4G5ZH 2YBRB 2XRAL 2QQNL 3W0WB 3KPOB 4GG8A 1KTLB 5E5RB 1DEDA 1P4BH 3NIGF 5D7LE 4XB8A 5E8NB 1UZ8B 4EUPA 3MLSL 4F37K 4ODTL 4BQ9A 1K5NB 4U1NA 3G5ZA 4PRAA 4RZCA 3WIFB 1N5YL 4KTDL 1N5YH 3CZJA 3OX8A 4KJYB 2EDHA 3TVMB 1OAKH 1AE6H 5GJSH 4NZDA 4PJEA 2ZJSL 2ZJSH 1NCUA 3PGDB 2I9TA 1S7XA 2G5BB 3RY4A 3FRPG 2CO6B 1A6AB 1J1XL 2VDQH 3GBMH 5I17B 1BQHB 1BQHG 2BSTA 5ITBL 4CRPA 4ZYKA 3QUYB 5HVHC 3C08L 3OKDB 4N8VB 1NGQH 3HUJE 3TIDB 4E42B 2JIXA 2MQ3A 4N8VG 2HFEB 4OD1H 1ES0B 3NPZB 3ARQA 4FQHA 4QXGH 2X89A 3IKCA 4E41E 3RWFB 4W6XB 1S9VA 2JTDA 3MRJA 4MDIA 4HF5L 2AJVL 2B2XL 5D72H 5MHSE 2FZ3B 1TVHA 1GIGL 1CN4A 3JWOL 5HI5D 3JWOH 1A9EB 3KPLB 3HG1B 3T3PE 3BEWA 2DTMH 1OP3K 4ZSOA 3P9MB 2DRUA 1SBSH 3NMEA 5D2NC 4DVRH 5DSCA 5C9JA 3IXAA 1CDJA 3BKYL 4HJ0C 1KC5L 1N6VA 3QIBD 4NN7C 2BFVL 3GSVB 2BVTA 2E7CA 5HHME 2YWYA 2ORBH 3JWNC 5EIIA 4Z0BH 4RRPG 3WIHL 3WIHH 2J8HA 5FDWA 4JKMA 5C0CD 4E5XB 1J0ZA 3TO4C 4EI5C 1G7JB 4PR5B 4FQIH 3O6MH 1P5VA 3VA2C 1OB1A 3TBSA 5HXMA 3K46A 2OZ4A 3BXNB 4R97B 4ZFGL 4DUVA 1UWGL 3EFDL 1UWGH 3MNWB 3RTQD 2EXWC 1T1WB 2J4WL 5ITFB 4XHQA 4P5TA 5IMLA 4WENB 2FWOA 5HD8C 3PP3H 1HWHB 4U1GC 3SN6N 3VGBA 3REWB 4ZOEA 1TETH 4JQVA 4X6BA 3VFRB 3DUSB 4FFYL 5BQ7B 1AC6A 3ARGC 3MLTA 3DX6B 4IJ3C 4IOSD 2FJGA 4K8RL 4K8RH 4Z7VB 1XGUB 4HIJB 2BMKA 4PTTB 2E8YA 4UOW0 1E6OL 1RZ8A 1UKTA 3S9DB 1I3VA 1WAAF 9CGTA 4UQ2A 4CVZA 1S78D 1A6ZB 1DE4A 3MOAH 1LE5B 4QHUA 4TPRL 4KQ4L 4LHUD 1RJYA 4UBDC 5I9QC 1IAIH 3KYMB 1H9VA 5DVMA 3MLWL 5B4MD 3DMMD 4Q2ZB 3BMWA 3QI9A 3E6FA 4YHNB 5IVOA 7FABH 5LGJB 5GZOC 5GRYA 2VXVL 3VXSE 1N2RB 4WDIB 3HPJB 2FX8H 1JGDB 4FABL 4KUZH 1N3NA 2UZIL 1V3JA 4OD2B 1ZS8A 3C60C 1HKLL 1JNNH 4LFHD 3GMRB 1D6VL 1A7RL 3OB8A 4PGJA 1I1AB 1X5AA 2EH7H 3TYFB 4TSBH 2KZWA 4Z8FH 2GK0B 4OF8A 4JPWL 3CUPA 3BI9X 4JPWH 4UI2A 1GL4B 5JXEC 5E8PA 3K8MA 5FOBA 4X6DE 3EDKA 1AGCA 3VG9B 5LWYH 5AD0B 3IJYA 3RVTC 5FECA 2YD4A 1KIQA 2FX7L 1GGTA 4MA1C 4Y5VC 2X1XR 1UA6H 1B0GB 3W9EB 1Q94B 4X5WB 5LBSH 2O5YH 1MHCB 3LH2L 1OAYH 2FIKB 3BRFA 5GRUH 2ICEA 1IZKA 2WP3T 3MBEA 1ZT7A 2VC2L 4GO6B 1Y0LB 5F9OH 4AEIH 3B5GA 5I30L 5IK3B 5DURB 4LAQL 4O02H 3RDTC 4WI7A 5EU7E 1MEXL 2VLRE 4OLYH 3ZL4H 4MQXC 4NUGL 1HN1A 3DUUA 3P4LA 5TQ2L 2EDOA 3VXUB 4ELKA 1KPVB 2F53A 4FZ8H 3BP6A 4XNQA 5M95B 5J11B 4PJCE 2OXGA 4X4ME 3RGHA 2X4OB 1DDHB 1V7NH 1U8NB 3MLRL 1QLFA 3MNVA 5IHUH 4NN6B 3QFJB 4GRWE 4Q6IC 5DS8A 1Q38A 4TNWK 4U0RC 4NN5C 2QQLL 5C07E 4KVNL 1U41A 3IFPB 1UJ3A 3K4ZA 5D6CA 4HUVA 5BVJA 4OLVH 1RSFA 1MQ8A 4DFIA 5DD5L 5F96L 3QG6B 5IKCB 4M61A 5F7HA 2BSRA 4DJMA 2LU3A 4JY4B 5DWUL 2KPNA 1I8LA 4HS6A 3WFHB 3BGMA 3P9LB 3SGDH 3IDXL 4YDVB 2NY3C 2VITB 5CBEB 4JFHE 5ANME 5FYKE 4NZJA 1CLYH 1UKSA 4KXZI 4XGZB 3MRPB 3KLDA 2B8OT 5ELIA 5BS0D 2P8LB 3O6LH 5I73C 1N64H 3ESUF 2D0HA 3FHAA 3SY0B 2CIKA 3ARDC 2IGFL 1RFDL 3UXFA 2BNRA 1MI5D 1DEEA 4LRNL 4NNPL 4L4VA 1KEMH 2JJTC 2R1YA 5E6YA 3JBG7 4LKXA 3WLWD 4IMLA 3UPCA 4U49A 1DBBL 3JTTB 2P5WA 3DIFB 3O9WD 5JR1H 2XZQH 2HTLD 3NZ8A 3FT2B 4XP5H 3LQMA 1H3VA 3FZUD 4UMGA 1ACYL 5DEFA 5D93B 1P53A 3S6CA 2Y06L 2DWEB 4ZQKA 4PB9H 4U1SB 4PGDA 4YXKL 2K1MA 4YXKH 3EYUH 3F7YA 2B1AH 2GY5A 5DZLA 2HMIC 3AVEA 2AXHA 3A67H 2CPCA 2EYTA 1UACL 5D96C 4P4RB 4HG4J 5T33L 1FYTB 2QKIB 5HGHB 4XVSH 4Y2DD 1FZJB 4OGZA 4RBPH 1BWMA 4LCCA 4WFGE 5GRVK 1NMCB 2DJSA 4N0CD 4JHWL 4X6CF 4U1JB 2NXZC 1K4CA 3GZKA 2AS5M 2E3VA 4IHOA 2EEBA 1EAJA 4RMQA 2DLHA 5D7LD 1U2CA 3HNVH 1LP9E 2DBLH 1CGTA 4NM4L 5GJTL 1J1PH 2MQCA 2IMNA 2NY1C 1BF8A 3KPTA 3O2VH 3T2PA 3B3IA 4I0CC 3V0VB 2IH3A 3ZE0E 4XTRD 3SDXB 2GAZA 2A77L 4O4YL 4JKPL 4NQUA 3UPRA 5CILL 4XCNA 2X10A 4Z95H 5AYQA 4PV8B 2MKLC 3ZKND 3IFNL 5H35A 3MRRA 5DJ8A 5IBUB 3OAUL 4HXAL 5SWQB 4B53A 1LEIB 3PGCB 4NNXB 3QH3A 3EDFA 4L5FL 3QCVH 3D85A 1Z2KA 2VDOH 1NCTA 1KCRH 1YEIL 5T3XE 5DHYB 1FSKB 4Z7WB 2ITCB 5J6GB 2A73B 4E41D 5FGBA 1ODAA 4TVPE 1QVOA 2BRQA 3X14A 5ICZB 5DJXB 2XN9B 3O4LE 3PJSB 1RVFL 4YFLF 2DDQH 5MHSD 3JWDC 2VE6A 4J7RA 4MDJA 4WWKD 1I7RA 3IETA 2HJLA 2CKBA 1ZGLA 3CH1B 1N6UA 5KN5A 4NP4L 3LSOA 2PUQT 4NP4H 4K7FA 4ODBD 5FM5M 1LD9A 1OD7A 1QBBA 2X40A 5HHMD 1QUNA 2PR4L 3IU3A 3RZCC 4BA8A 2R4RL 5DEGA 3QEQE 4K94H 3I9GL 2NY0D 4DAGH 3ULVH 3W39A 4QYOB 4Y19A 3M17B 3CFEA 5K9QG 5DD1H 1K8DB 2L0DA 3VGHA 5C7XL 3RGVD 1A5FL 3MRQA 2FECL 2WINA 4RGOH 1B0WA 5D1QB 1NKOA 5I76B 1T4KB 3D39B 5A16B 4XC3H 3TCXA 3DTXB 3TBWA 1YMHA 5L9DL 4P5KA 3SO5A 4APQD 2D9QB 2CRMA 5D5ME 4ERSL 3RWCA 3ZTNH 3UO1L 15C8L 3HE6C 3C09B 2QSCL 3UX9B 1U8KA 4Z76A 4XNYL 5T3XL 2VDNL 4CADB 4JRXA 4XPHL 4BZ2H 1I9RL 1UCTA 1SYVA 1FNAA 1I9RH 1CFNA 5IVZA 1JWMB 3UJTL 5SWSB 1OD9A 4JKLA 1NAMA 2ITDB 1TTGA 2D4FA 4JFDA 5FYKU 2GCYA 1ORQB 5GGSA 1FFNA 3MR9A 5IB2B 5IW6B 4B0MM 3CVHL 3BZFB 1LEGB 3VXQA 3ZKQD 3OQ3B 3IVKA 2Z0BA 5CJOH 3BAEL 2VZTA 2X4RA 3S4SB 5ENWB 3S4SG 5KANI 2J1KA 4OLUL 3DBXA 3VXSD 1DBJH 3UTTB 3O6FA 4HPYH 3N85H 4JRWA 3ARRA 3BUYA 5L2JB 1HQRA 5IFJB 1N5AB 3VJ6A 2PXYD 1DBAL 2XZAL 5CEXA 4CL7A 4KKBD 4ODXA 1JYXA 4R2GC 4EBQH 1OT1A 5SX4H 3H0TA 4DVBB 4JN2A 4P57B 1A7PL 2UYLB 2UVFA 2EO1A 4NUJB 3OTTA 2VLKE 5EUKB 3SE8H 5DJ6A 1RIVL 3ZDXE 2P7TA 1ZT4B 5D4QA 2C1PA 1KACB 1BGXL 2GY7B 4GLRI 2ZG1A 3TBYB 5B38A 5D7JD 3CDYA 2Y1VA 3X12B 3ULUF 4UU9A 3DV4B 2AEPL 4M62H 3VWKA 2DLIA 2E9IA 2GJZA 5CZKA 1U8QA 1T20B 4WY7H 1G0DA 4YWGL 1QSFA 1ONQB 5JW5B 4KHXH 2C26A 5C0AE 3VXSA 1A0QL 4IBLT 5KVFH 3CD4A 3MREA 1R3IH 3BPNB 1C5BL 3CFKB 3WD5L 3CFDA 2OX5A 5ADOL 1LK2A 2VLRD 2VWEE 3DNKA 4H8WL 4YQXH 4PJHB 3AM8C 4M8VA 1KFAH 1MFBH 3BQUD 1TJGH 1OM3L 3UZQA 4MA3B 5A2KH 2IADA 2VJXA 4OZ4A 4G8FA 1MCOH 2CK0L 4ISVB 1G1YA 3OJMB 1HWGB 3T0XA 4OCRH 1K4DB 2ZUXA 4YGVA 1IGIL 1V5JA 1F5WA 2XACC 3MJ9L 1J0JA 2G60H 4BK4A 4OGAD 5I1DA 3OB0K 3QQ3B 2CLVA 1KB5A 5C07D 3HLAB 1U92A 2WUCH 3CDCA 1IEHA 4PJFF 1XGQA 4PP2B 1LO2H 3DX8A 3FRUA 2Y6SD 3MJ7B 2P4AB 4GW5A 2XZCL 3PWJA 5DJZA 4JZNB 3AB0B 3SCMA 1FAKT 4HV8A 4P3CL 2HFGH 4JFHD 1SY6L 5FYKD 4OCSL 3I6LE 1ZKAA 1FNSH 3P40A 4XBGA 2AK4B 3Q1SL 1UJTA 1ZTXH 2DM4A 4KDWA 5E6IA 4XNUH 1EFXB 4AQOA 3G6JE 4P2RA 1VACB 4HMEA 3B83A 2WBKA 2BOBB 2EXYD 3C8DA 5ADPH 3OKLB 4EIGB 3MMEB 4YHYC 2EICA 2VL4A 3UC0H 3OWEA 1WCQA 1R24B 4PFEA 3V2AR 5F3BB 1J0YA 1M71A 4I0KA 4WGVB 1VFOA 3VFUA 1FH5L 3AS2A 1JYVA 1HYSD 3UTSA 4GG6F 3EYFB 1KIRB 4LAJH 1EHXA 3IF1B 5HVHB 1AR1C 2LAAA 1LDPH 5GGRY 1QACA 2NX5E 1MHHB 1S7VA 4K3DL 3BEVB 3V4VL 3DETC 4OTXH 3IJHA 4JFYB 4LGRB 1CGSH 3KLHD 3ZO0A 3WE6B 1MREH 3GHEL 2H26B 1NEZB 3FOMB 3QCTH 4F7PA 4V1DE 5IVNA 5T5NG 2DICA 2CDEB 3T2NL 4M8QA 1HXYB 2ZOLB 4Y89A 1R5WA 5D2LB 5LQBL 3E8UH 4ZAKA 1LHZA 4ONHA 4L3EB 3VFSB 3LKNB 4ENEC 3RNKA 1YNLL 4UTAL 2DLFL 4WFGD 3MLXH 4HIEA 2NYYD 3QR2A 3OGCB 4PRPA 2V2XB 5INDB 2J8UB 5MP6H 2WW8A 2EDKA 4MJIB 4JM2A 4OI7A 1D5BB 4O9HL 1JE6A 3WN5C 3I02B 5FGRA 5D2NB 5IMMA 3NABH 4JZOA 2P48B 3BYYA 4WU5B 4LSRH 4YXLH 3D0LA 4NN7B 1R3KB 4D0BA 4HWNA 3ILQD 4UILL 2H8PB 3M8OH 4MAYA 1KJVA 4MMZC 3U0WH 5FA4B 1UEMA 1WC7A 5DF0A 3DXAE 3T2OA 3TO4B 3BH8B 4QRQB 4EI5B 1KPUB 5GXBB 2QHRL 2AEIT 4KKLD 1NGPL 4N5UA 3EIFA 4IIQA 1YPZE 4MB3A 3WUWA 4XRCA 5EU3A 2JJUA 4OZIE 1DLHB 3UYPA 1NLBL 4ZTPH 2BZDA 3IB4A 5BVPL 4FQQA 5DRXB 4JHAL 3RIFF 1JI1A 3VXTA 3FQUA 4NFBA 4FZEL 4U1GB 1WLHA 3QDMA 4JANB 4XCFL 4ZUVB 4ONFH 5T3XD 2R9HC 1CBVL 5I0ZA 3TNMA 3UYRH 1CBVH 4GW1B 2ESVE 1RZFL 2VLLA 3SJVE 2VB5A 5C0BE 4F8QA 5CGMA 1F4YH 2HTKD 4IJ3B 4NO5A 4XI5C 5CINH 1E27A 4TVPD 1YQVH 1TZHB 5TQ0L 3NAAL 1NFKA 2GTZB 3GJFH 4RFNC 5I1KH 5JNYB 4OB5L 3O4LD 3L3OA 2H6PB 3LQAC 1XF1A 5C6WH 1IC4H 1X3DA 3ZTJH 4PJBF 5JW4M 4DOHB 2YD7A 12E8L 1RK0A 2ATKB 1Z9SA 2VXSH 5H2BB 5I9QB 1IKFH 1XGPA 5I75C 3OHXB 2BVPA 3VG0H 2DIJA 5HYJA 1HXMA 3ARXA 3EJYD 5F9AC 1I7UB 2WM0A 4R3SA 2GIYA 5HDOA 3QUZC 4BUHA 4M93B 3GJFB 4XPGL 3DOSA 1ZXQA 2APXA 4QRPB 4PGEB 3QEQD 5FCUH 5IT2L 4TYUA 1MCDA 1VENA 4HDIA 4AY0A 3O3EA 3ZTJG 2AJXL 2AJXH 3C60B 3PDOB 5GGTL 1B4JL 1BMGA 4XCYA 5GGTH 4RA3A 3RWIA 5IGXL 1FC2D 1FGVL 2EKSB 1FGVH 1AH1A 2JCCE 1VFBB 4I0PD 2FL5A 3JV6A 3VMOA 1AO7A 4P5TC 3MV7E 3UEZA 5KTEL 4NT6B 4MA1B 5AZ2H 4ALAH 2XTJE 4G80A 3VGAC 2NR6C 1F6AA 4JQVC 3HZKA 4OZHA 1S7QA 2IQAB 4IOFC 3ZE2E 5E2UL 1EGJL 2V9RA 5E2UH 1MCHA 4C83A 4PS4L 1QR1A 5E95B 4ODSH 3K81A 4NHUA 1TVBB 3F65A 2O93L 1PG7L 1CXEA 4JO2L 5I1AB 2D03L 3CLFH 2C5DC 4MA7H 1X7QA 5SWZB 3O3BB 5E2TL 5E2TH 2ZSVB 3PWVB 4JPVH 3QNYA 5DFVC 4N9OB 2R0KL 3DI3B 2F8VA 2R0KH 4GAFB 1UG9A 4R0LA 3U0PB 3BRDA 4RAUB 1IGJB 5F7NC 3WKNA 2VAJA 3VFTA 3MUZ1 1U91B 1BHGA 3UYOD 3EYVB 3GJEB 4X7EC 1LNUA 2IFFL 4U7KA 1E4JA 3R8QA 5F7LB 4QF1B 1J05B 4RWYH 32C2A 4PJGA 5F9JA 1DQTA 4G6AD 1F8TL 4Q6IB 4M3JA 2WNGA 3GMQB 5IR1A 4U0RB 5JW4N 3U46A 4KZDL 2NQCA 4UT7H 1YEHH 5D9SA 2DB8A 1RI8A 3FN0L 2YKLH 3MCKB 4FQXC 3VXME 4RFEB 3UTOA 2EYRA 2AK1L 2VLKD 2RFXB 3QXUA 2YPVH 3TJEH 4ZFOL 5B3JE 3CC5B 2I07B 1RIHH 2QR0A 3GFUA 2NY3B 3C5ZA 2UVEA 2ZCLH 1NSNH 3IGAA 2B0SH 1JL8A 1NFDE 5CEYA 4E9LA 3F5WA 2UY7A 1BZ7A 5DRZA 3W11C 4XP1L 3UROR 4IRJD 4WO4A 2P5EE 2JJWA 5IIEB 4I18A 5C0AD 5I73B 2GUOB 2W1NA 4LDLB 5KOMC 1YUHA 3ARDB 1TTFA 3JVGC 4JCLA 1CIDA 2SEBA 4ZD3H 1CU4H 1BVZA 2IBBA 1NGZB 1X5HA 4ZXBD 5HHPA 4MX7A 4LPYA 5KVMC 1HOCB 3QG7H 3F12B 3LCYA 4ODWA 4AIZB 4HIXL 1QO3B 5L7XH 1F11B 2BK8A 2XY1A 5KVGL 2J6EH 2H2SD 4LKCB 2MJWA 3G9AB 4D3CL 5LAXA 5ACLA 3W0WE 1JPFA 4LSDA 1BFSA 3OXRA 4Z78B 1X5JA 2D7OA 1A1OB 2EDFA 2FGZA 25C8L 3GSWA 4J4PA 5C70A 3B9KA 3FN3A 3QUKA 4KI1A 4M6NH 3LQZB 1TQCC 5F72S 4HAGA 1YY8A 5EZOL 2ADFH 1AD9A 3FJTA 2V5YA 4JO4L 1HI6A 5T1DL 2CUHA 5D96B 1DN2A 3SE3A 3SO3C 1U8JB 1VADA 1WGOA 3TYGL 1U3HD 5GSRB 1SYSB 1EX0A 2X1OA 1RUKH 1JGEB 2NXZB 1EK3A 3I6LD 1OCWL 43CAA 1ITBB 4IRZH 3D25B 3DHMA 2QQKL 1MRCH 2QQKH 5IBLC 4MJ5A 1VSCA 3X13A 2PTUA 2DQFB 4JZJA 1QR4A 5TDPA 1C5DA 2NY1B 3HI5H 4PRHA 3K4AA 4S1DD 4R90H 3QULB 2E7LC 1R3LA 3S34L 1XZ0A 5DGRA 4Y1AB 4BZ1H 1IGYA 2A83A 3FB7B 3SPVA 1FO0A 2ICWJ 2UWEE 1QPPA 3T0DA 2GSIA 3LKRB 1S7UA 5DXWA 5DYOA 4YAQA 1BAFL 2P47B 5IUSA 3SGEI 4IRSD 4YX2L 2EH8L 1INDH 3S37X 1BIHA 4Z5RB 1HNGA 1T22A 4L8SA 2OLDA 4U1KB 4OFIA 5DJAA 1U8LA 3RBSA 3JWDH 3MRFA 5EBGA 1DN0B 4A6YA 5BMFH 3L3KA 3EAKA 2AQ1A 2XWTA 4JFOA 2NX5D 1LEKB 4EN3C 4HFUL 4HFUH 1AP2B 2R69H 1A3QA 1QBLH 2W91A 3QUXC 4ELMF 2NTSP 4P46D 4AM0B 2YXFA 4V1DD 2DBJA 4A2MA 1NCWL 3WJJC 2NY6D 1TNNA 4G7YH 4HHAB 1RZKL 4P2QB 2YEZB 5K59F 4OUOA 3LD8C 1HDMA 1HH6B 3L5JA 1MIML 1NL0H 1HHGA 4LCCC 5EC1A 4KVCL 1WEJH 4G9FA 4X7DC 1QHPA 2DLEA 5L0QC 4F7EB 1AKJB 1MPAH 1XH3A 2NW2A 1KEGH 1H3PL 1TJIH 4DZ8A 3ALPA 3DO7A 5GSVA 4IRSA 4KJQD 3DGGB 4F7CA 4G6MH 4L8CB 4YE4H 1J8HB 3RZCB 3DXAD 3MNZB 3QUML 4OQTA 3OSKA 1NC4A 1QYGL 1MAKA 1XR9A 2EYSA 4WW1A 3ROOB 1OP5K 5K9KA 5B3NA 3OXSB 1VGEH 4OLZL 5FAAA 4OLZH 3EOTH 5D7IF 4RGMC 4QRSB 2ATPB 3DHJA 4GAGL 1N8ZA 5HGAA 1QEWA 1MY5A 3V5HB 2V9TA 4P99A 3LPWA 3WHXB 4S1QL 1NANI 2MTPA 3MRDB 4J6RL 2ESVD 4QWWC 4X6EA 3SJVD 5C0BD 1YMME 3RIAF 1CE1L 5CBAA 4LVNC 4HWBA 3RVXC 5EOCJ 5E94A 4NRYB 1G6RH 1ZOXA 1NDGA 4LLVA 4J1UA 5FGBC 3KWWA 1HNFA 1Z0NA 4TUOA 4HGWA 1WWWX 1RY7B 2AV1A 1AGDA 4H1LH 1V3MA 4G6KL 5IMOB 5E8OB 4RMUA 5E2VH 4NO0B 3RU8L 2CDGB 4QO1A 4XT1C 3RU8H 1S7RA 3HR6A 3ECBA 2VAAA 3ZDZE 1A4JB 2HKHL 3P4NB 1G6RB 1WWCA 4BFIB 1ZT1B 5KVDL 1QLEL 5KVDH 1FL6B 2R4SH 2VR9A 2WBJC 2O5XH 2VSCA 3Q6FB 3O41A 1CL7I 1QSEE 4H1LB 3SOBH 5DMIL 3TFKD 4H1LG 3U4BL 1YZZA 2Z8VC 3BIKB 2GI7A 3I75B 4LVOC 3FKUS 2IAMC 4R2GB 3ARED 1P2CB 4I48B 4RX4D 1TQBC 5IEHB 4Z77A 1QRNB 3MRLB 5C2BL 1SM3L 1PQZA 4HPOL 3MV7D 5KSAA 2F8XC 2HG5A 2XTJD 3EJZD 1T66D 3BKJH 2MPAH 2APVA 2PYEA 4I3RL 4K3HA 4M02A 5GZND 1URLA 3OJ2C 2RGSA 3UP1A 4O2EB 1UM6H 2CJUL 1D9KA 5C0RL 4OFYD 5C0RH 4M7KH 3L5WA 1RPQA 2EEDA 4KQ3L 3D2UB 5JW4R 5ESAA 1F4HA 4DGIH 1MVUA 5DR5L 3N9GL 5DR5H 3N9GH 2OL3A 3O4OC 2NZIA 4L3CA 1O0VA 3HMXA 4HCRL 2FH8A 4Y4FD 1TCMA 3BDYL 3CFBB 3MYJB 3BDYH 1FBIL 2R29H 1A3RH 3QRGH 1H5BA 5DK2B 1IM9B 4FMKA 4WEBL 2JELL 4KTEL 4WEBH 2JELH 3O11B 5DEZA 2I60L 4YK4C 5L2KE 2FGWL 4WU7B 1FDLL 3KDMA 1FDLH 1XF2B 1UXSB 3MRNB 4YHOL 1AHWA 4CVUA 3EGSB 1HEZA 4JR9L 5EZLA 5A3IC 1M7DB 3OKKA 4I2XE 4Q7DA 1X5LA 2HRLA 3OAYH 1KULA 3L95A 3PL6D 1F90H 4P3WA 3VXMD 5JQ6L 3STBA 3GMLB 3BZDA 1HH9A 2A6DB 3EFFB 1T1YB 4JY5L 1T2QH 1ADQA 4X9BA 1DQJB 2H32H 4PJ8C 3VCLB 4P2CG 4ODHH 3QYCA 1I7ZB 3CVIL 5LGHL 3WJLA 4FQ1L 3CAFA 1AXSB 1KTDA 4AIXA 1EJOL 1EJOH 3QHZH 2CR3A 2BNUA 3CDGA 1QQDA 5KG9A 2X09A 4FHBD 3VWKC 2P5ED 2AXGB 4NDMB 2OTWA 4GBXD 1YEJL 3UTQB 3MUGA 1U6AH 5DQ9A 2H32B 2VQTA 3LEYL 2EDWA 4NO2A 3LEYH 1U8IB 5IBTH 5TE7H 4YHYB 1TZIB 3RWEB 1W0VB 2AEWA 3S35X 2O61A 4IS6B 2LFGA 4ZOAA 5I8OL 5I8OH 3MLYH 1MF2L 2FYYA 3DVNB 3L6FA 5I1GH 2A9NL 3P4OA 2FBJH 3PL6A 4GXVH 3BD4A 1PKQE 1R5VB 1JPGB 4P23D 3G5VA 4S1RH 2VXTL 4PJDB 5J89A 2Y72A 4RISL 4Y4KD 3W0WD 2PTVA 4RISH 1INEL 4LLDA 4RMVA 1NFIA 2BERA 1DVFA 5FGSA 1DSFH 5DFWH 3VD7A 4OZGA 1RJZA 1OAXL 5D1ZD 1ZLUH 4NQVA 1JNHA 5CIPA 5IB4B 4XMPH 1FJ1B 5LKNA 4LSTL 2GJ6B 4M7JL 2HRPH 4M7JH 4KH2A 2OYPA 2ARJQ 5I8EA 2Y36L 3BW9B 4JFZL 2OCFD 3SDXE 4K3JH 3TVMD 4EUPH 1RJCA 2QBWA 3GO1H 5ALCL 3LPGA 5ALCH 1FN4B 1MLCA 3HRZB 1JI2A 1MCLA 2R56L 3VWJC 3MBXL 3L7EB 4NBZB 2Z8WC 3UAJD 3LN5B 4LARH 3V0WH 3VFOA 5I1HH 5F3HB 4MWFA 1YNKH 2M8XA 4UIKH 3UZEA 2FX9L 3WN5B 2FX9H 1JK8B 4F7MA 3LMJH 3MXVL 5F7EL 5I19H 4GG8B 1OAUL 3MRCA 4KK5D 5C71A 4LEOA 3SDCD 3VFPB 1T5WB 4RGNE 3IFLL 3OKEB 1F3JA 1G7HB 4EUPB 5HI3C 2YBRA 5E6IC 4EUPG 4FQJH 3G5ZB 4PRAB 3KPOA 5KZCB 4DK3A 1PX3A 1KTLA 4U6HA 4PLKD 1HHHB 4H88H 5E8NA 3P2TA 1UZ8A 1SMOA 5JZ7D 3ZHDA 4P3DB 3F8UB 2I9TB 1K5NA 1S7XB 1EEUA 3WIFA 3JTSB 4O2FB 2Y5TB 3GHBL 3LQAL 2BSTB 5BRZB 4JRYE 4HWZB 1OTTC 3QQ4B 3FRPA 1YC8A 5B39B 3PGDA 1A6AA 5I17A 3LKQA 4NQEB 1U8OB 3JV0A 3E1F1 4B7LA 4FQHB 3QUYA 3OKDA 5FXCH 3HFMH 2L7JA 2E6QA 4RFNB 1T7XA 4KKAC 2HLFD 4E42A 1TNMA 2VSDA 1IT9L 3MRJB 4BK5A 5IVXA 1QHOA 1KJ3H 2YPLE 1GC1C 1GGCL 2E6JA 2G75B 4NC0B 1GGCH 4WUUA 2VQ1B 4JB9L 3RWFA 3BEWB 3D39E 5I75B 4XVUD 4JM2C 4OGXL 2VZUA 4KXZH 1Q0XH 2RJMA 3RKPA 1I9JL 3QIUA 3GB7B 5DSCB 1I9JH 4LGPB 2FZ3A 2VN4A 3QUZB 4PJEF 4UQ3B 3KPLA 3HG1A 3ULVE 1CGUA 1U95B 1DCLA 3CSYA 3P9MA 4MAYC 5FDWB 1Z5LA 2A0LC 4R26L 5I66B 3MLVL 3WNKA 3LS5L 3ZYJA 1NEUA 3TBSB 3GSVA 5SWSE 5LJYH 2F19L 5E0QA 3IDNB 4E5XA 3KYKL 3KYKH 3T04D 1G7JA 4L4TB 1I7TB 3GBNH 5A2IH 5BW7A 2X9WA 4P5TB 5IMLB 1IC1A 3BXNA 1L4IA 5F1IB 1GZQB 4PRBB 3THMH 4CJ1A 3VGAB 1A7QL 1GYAA 1JZ4A 2PO6A 3MNWA 1YMMD 5DJDB 1T1WA 2Y9RT 3KXFE 3MLTB 4FTVB 3WFBL 3VA6A 3RWDB 3WIHA 5I1CH 4NGHL 3UTTE 1BJMA 4XPTH 2YMXH 1W8OA 3VFRA 1UZ6F 1PLGH 3DUSA 3QO1B 2W0PA 4HT1L 4HT1H 3L3JA 4UQ2B 5FYJL 1D5MB 2ZCKH 3L7FA 1DE4B 1F4WL 4F9LA 4Z7VA 3NCYP 4B41A 4HIJA 4XPFH 1JWUA 1S7TB 3S35L 2AQ2A 5DD6A 2WMPA 5T3ZL 2J88H 2VDML 2YD8A 3LV3B 2GJJA 3H9YA 2VTFA 1H15B 1XFPA 2ARJB 5TE4L 1JRHI 1A6ZA 1LE5A 1N26A 2Y4SA 4PJIF 1X5ZA 2VN7A 1QSED 4QXUL 3TM6A 2DI8A 1Q9KA 4PJFE 4Q2ZA 3DPBA 4OF3A 2R1XB 3OR6B 1N3NB 3W2DL 1ZS8B 3W2DH 4LIQH 3RZWA 3V52L 3D3VB 4YPGA 3TO2A 1KF9B 1YC7A 4FXLA 3WNNA 4O58H 1CFQA 1NC2B 4FQXB 1JGDA 5E8PB 5FOBB 2V7HB 4LSPL 4LSPH 1AGCB 3O3UN 4OD2A 4OCYL 1FORL 4PJHE 3IJYB 3ULUL 2AEQL 1I1AA 5DQDH 3HNSL 2WWMC 4CGTA 3QCUL 1I85C 5E24E 5DVLA 4K7PH 5AD0A 4LCYA 5E5MA 4M03A 3AS1A 1M4KA 2NZ9D 3QZWA 1B0GA 2I5YL 1S7WB 2ICEB 3WHE0 2HLAB 1ZT7B 4V2BA 2N56A 3P0YL 4XVJL 5DMJB 4NZUL 1AJ7L 1T7ZA 4M6ML 4LMQI 5E9DB 3B8YA 3CMGA 1MQKL 2XZZA 3QWRA 1UGNA 3I2CH 3PHSA 5IQ7H 1MHCA 4QTHA 4JFEB 2FIKA 3VXOA 3RY6A 5ICYB 5KSVB 4NWTH 3G6AB 1OTUC 2M26A 3DUUB 1YEEL 4KK6D 1Y0LA 3T09A 1IC5H 3VI4F 5L2KD 2WQ8A 5IK3A 4L1DA 4Y16C 4ELKB 1EXUB 3S3JA 3MTRA 4CMHC 4XNQB 1LO0L 3FAWA 3D1MC 4OI9A 3MROA 3KVQA 1F2XK 2ERJC 3VXUA 1UWXH 2N4IA 3MNVB 3ZKMC 1QLFB 1XCQA 2D3VA 1KPVA 3QJHA 1TQCB 4K07A 4YDLC 2XWBA 2V2WB 1EMTL 3PWPE 1T6VN 3ES6A 2Q8BL 2HFTA 3O3AB 2X4OA 1PGRB 3SO3B 5BVJB 5JXAH 3PWLB 2RQ8A 2DQHH 1U8NA 1G7QA 4R96B 3QFJA 2BSRB 2NPLX 3S8WA 3GEWB 4HS6B 4KRPC 5DK0A 2D7TH 3KS0J 3R4DA 3IFPA 3V5KB 4U6XA 3RUGA 1F58L 3QG6A 5IKCA 2NXYC 5I8CA 4YBQD 3GK8H 4YDVA 2Q7YB 2AGJL 3QXWA 5F7WC 2BRRH 4I18C 4FS0A 3WLBB 5KW9H 5M7QA 1ORSB 4JDVB 2CIKB 3GSNL 1DEEB 4JJ5B 3GSNH 2XPGA 1CXHA 1KBGH 3CXDL 5D2LE 3KYOA 3WYRA 2P8LA 4TSAL 5E2JA 4Z7UF 3SQOL 3X3FH 4IMLB 3DJ9A 3SY0A 4MXQC 3RRQA 4NPYB 4MJIE 1UM5H 4U6VL 4DN4H 3SE4A 4CKVX 1JFQH 3NZ8B 4WW2F 1NBQA 2F54A 4EN3B 1PFCA 1JHTB 3QEGH 1J12A 3VD4A 4MD5A 4ZDHA 1R0AL 5JDSB 5DEFB 4GQ9H 4KRMB 3B9KC 1GGIL 3DIFA 4GG6B 1RZGA 3MV8A 3FT2A 4K2UH 4Y88A 1LWRA 2VKXA 1A3LH 2GSGB 5KANG 2CMRL 4NKIH 4XCEA 3STLA 2EZ0C 4FFWD 4PJ7F 3RKDD 4CN4A 3LD8B 4N1CA 3LKOA 2DWEA 4OGYH 2AXJA 4LCCB 1MHEB 4GRLA 3DURA 3R06B 4G6JL 5KSBA 5L0QB 1Q9WA 4P4RA 1AQDA 4R4NC 1FYTA 3CPLA 1KLFA 1FLTX 4QRTA 4RGND 4JREC 1IQWH 3ZYIA 5EB9A 4OIIH 1CT8B 5EO1B 5GS0C 2ZUVA 1JF6A 4P2YA 4DGYL 3B3IB 4U1JA 4JO1H 4YHZL 4CN6A 2C3VB 4YHZH 5FYLL 4C57C 5FYLH 2IH3B 4Z7QE 2F5BH 4KROC 2GAZB 5T5FL 4DGVL 4LRIC 3UPRB 4RGMB 4HKZB 4ZUWA 5ABDE 4ODUA 5BOPA 4U31A 3DVFA 3K0WA 5GS2D 4I77L 5J13C 1CFSA 3M07A 5EUOF 4JJHA 4K55A 2IQ9L 5HJ3B 5L88L 5DJ8B 3VU2A 2X41A 4JRYD 2P1YA 3FO0L 1FNEB 4CU7A 4R4FL 2C9AA 4KAQH 4PV8A 3D85B 4F9PA 3CZFA 4PREA 3EDJA 3QHFL 4LVNB 2X4PA 3BJ91 4N0UB 4PD4K 4GRMA 3TT3H 4HH9B 3VFGH 4NNXA 1CFBA 4QRPE 1W0YT 5BZDB 5HHOA 2HWZL 3EDDA 1IFHH 2P44B 5HDBF 1KELL 1JZ3A 5EBMA 2YPLD 5J57B 4M5YL 4Z7WA 1QFUL 4NZTL 4M5YH 2JB6A 5IB1B 1E4WL 2A73A 5F1OB 4M1CD 1E4WH 3EDEA 3D39D 3PNWB 3IETB 5TGBA 5ICZA 1ZGLB 5DJXA 2XN9A 4O2CB 3AAZB 3MA9H 3LSOB 3G6DL 5DQJA 1MCBA 1JF1A 4XVTL 1KN4L 1P7QD 2PN5A 3O8XA 4H5SB 5I1IL 3V4PH 3MXWL 3ULVD 3U0TB 4H26B 4XHJC 3IU3B 4YDKL 4M9PA 4UOW1 3CH1A 5DEGB 5DT1H 5C9KA 3VFMB 1A47A 4NQDA 2W9EL 5FM8A 2W9EH 3CFEB 2X2YA 4PJXE 4LVOB 5SWSD 1GXEA 2IAMB 5K9JL 4H0IA 4LPXA 4KPHL 1M6OB 1NCCH 3KYNB 1MHPL 2AI0H 3GMPA 1TQBB 5LXGL 4EOWL 4QYOA 1NAMH 3M17A 1A1NB 2OP4L 3ME0A 1DQDL 4NCDA 2Z92A 1JV5B 2EKJA 3IDIA 5ESQB 1JYNA 5D1QA 5IW1A 1N6QL 5I76A 1N6QH 1T4KA 4PD4J 4MCYB 1E4XL 3KXFD 1MIEL 1VA9A 4XP4L 3DTXA 5JQHC 4HBCH 1U8KB 4Z76B 1KCSH 4JRXB 3SEPA 3UTTD 2BJML 3WFEH 1F2QA 2BJMH 2XIDA 5K9OA 2VDKH 3LAFA 3VFWB 1CFNB 5IVZB 4NM8L 1T2XA 1RUPH 3WO4C 1NAMB 4WNQA 3SGDI 3SE9L 4PJAA 1XIWD 3O4OB 3J8F7 1JGVL 1IGML 2CLZA 5GGSB 3STZB 1FFNB 1WBYB 1PX4A 3VRJA 3O3DA 2Y23A 2F5AL 1N7ML 4HEPG 1JWMA 1I1YA 3HUJF 2Q8AH 3IVKB 4PJ5E 2Y07H 5ICXB 1P1ZA 2ITDA 4MD0A 4XNXH 1ORQA 2FB4L 2H2PD 5DZNA 4YK4B 1BM3L 2HFFA 5IB2A 4NRZB 5IW6A 4BKLA 3DBXB 3BZFA 5EG6C 3F6IA 4FQCL 2DMCA 2GEEA 3S4SA 5ENWA 4N5ED 2YD9A 4QGYA 3GSOB 2A6IB 3T3PF 1B6DA 3S98A 4TRPL 2A9ML 2DQDL 2EDYA 4TRPH 1OPGL 3H0TB 5JLZA 2R2BA 5L2JA 1ZK9A 5T1LA 2B4CL 2C1PB 1FV1B 4N1HB 4NCC2 1CE6A 5HI5C 4NJ9H 1RZJC 1OTSD 4P57A 3VXRA 2YK1L 2UYLA 4MGXA 4LSUH 1IAOB 3TBTA 3VWKB 4P2OA 2GJZB 4ZUSB 5CSBA 5I1JH 3TT1H 1ZT4A 5JOPE 4R8WH 5E2WH 2Y5EA 1UFUA 4K9EC 3BHBA 1T0PB 5C3TA 3X12A 4HGMA 5T1MB 5I6XB 4HIIB 3DV4A 3QFDA 4MNGE 5KS9A 5E99L 4QHMB 5DD0L 3ARWA 1T20A 4DK6A 5GRXG 1LK2B 1BBDH 1X5IA 1FAIH 4ZPTB 1C08B 4O5LL 3T0BA 1KB5H 1ONQA 1H5BC 5JW5A 2DQIL 2R39A 4TUKL 2DL9A 2FIRT 4OZ4B 3CFKA 4G8FB 4QRRB 3B43A 3RTQC 3FQXB 5D71H 2H1PL 5DUML 5C0GB 1T7YA 4HKXB 3HPLA 4Q9QL 3ZHKA 1F02I 4LOUC 5A2LH 4MA3A 1AHWC 1J8KA 4DW2H 4ISVA 2AJYH 3PWPD 3KPMA 2X70A 3U82B 5I1DB 1RU9L 2GFBA 1KB5B 4LNRB 1XGQB 4Y1AE 2CGRH 3DX8B 2IBZX 3FRUB 3VWJB 2VDLH 4KK8C 1TCRA 3G5YA 4M6AA 1XMWA 2Q86A 1YYML 2CUMA 1YYMH 5D70L 3HLAA 1S78C 1ROWA 3SDYH 4HV8B 2AJ3A 3MJ7A 3DMMC 1F4AA 4UNTA 4JZNA 5E6IB 4KMQA 3IAPA 4OCXL 4OCXH 1P9MC 4X6DF 2FJFA 3MODL 4HQQH 3FTGB 3SKMA 1P5UA 2ZCHL 2A38A 2AK4A 2FR4A 2P46B 4P2QE 3ARBD 1EFXA 4KJPD 1VACA 1L9NA 3S36H 3VFUB 4NCC1 1JWSA 2BOBA 2GTWB 3HMWL 4MJID 3UTSB 4QCIA 4JVUA 5FHBL 1GC1H 5DHVA 5FHBH 1YDPB 1RV6X 4HBQA 4HJ0D 4X7TA 1BFVL 5DVNA 2ADIB 5F3BA 1SY6A 4ZO6A 3C5SB 1XR8B 4L1HA 3IJHB 5C09E 2FECI 4BFGA 1DVFC 3TV3H 3BZEB 4X7CC 4CDGC 2IPKA 3IF1A 3TO4D 3K1KC 1G9MC 2WANA 5FUOL 4EI5D 3QNZA 5D8JH 5FUOH 3W5MA 3E3QC 3D9AL 3BEVA 3RA7H 1Z9OA 35C8H 4ONHB 4YIQB 2R0WH 5C8JB 3WE6A 3RNKB 2H26A 1JHLL 1NEZA 2EXWD 3NA9H 4HIEB 1HSBA 4PJCF 2N7BA 1MWAH 2CDEA 4JM2B 1HXYA 2ZOLA 2H41A 5HVFB 3NIFE 1MCNA 4L3EA 3VFSA 3LKNA 4WTZA 1DQML 3D0LB 3N1QC 1TTUA 4HW6A 4ONGL 1AQKH 1W72H 5GRJL 3OGCA 2V2XA 4XWGH 5INDA 2J8UA 4MAYB 1KJVB 2ADJA 5TDNB 1WC7B 5F88A 3I02A 5D2NA 1UC6A 5CHNA 1QSZA 3FB8A 4WU5A 1IMHC 3RIAK 3QJFB 4LU5L 1JJUA 1R3KA 5TH2A 1SMAA 1MWAB 2P8PB 4OJFL 3WUWB 4OJFH 4XRCB 2K9UA 4Y5XA 3WUWG 2H8PA 1L0QA 1HIMH 1QD0A 4S0TD 2PETA 5GS3A 1B2WL 1JHKH 1PKOA 4QRQA 5DLML 4JM4L 1W72B 3VXTB 4M7LH 4C55A 5ACZA 4WCYH 4NYLB 4LDEB 3QDMB 5FHAL 5LVEA 5FHAH 3OJDB 2DQUL 2E5EA 1DLHA 5EZIL 3RI5F 3TNMB 1JUFB 5JMOC 5GZOD 5DRXA 4AG4L 4HUUA 4NO5B 4M6OL 4QRPD 1E27B 1LO3L 2OQJB 4JANA 2OK0H 3T3ME 3ARFD 4YUEH 3TZVA 2HP4A 1PEZA 3DO3A 3SBWA 4GW1A 3L3OB 3ARGA 4NIKB 5JXED 4OD3L 2ZSWB 1RK0B 2APBA 3SGJC 1TZHA 5KAQF 2GTZA 1QRNE 1LK3H 1RMFH 5JNYA 1N4XL 1N4XH 3FO2A 3RVTD 1T7VA 5HYJB 1HXMB 4JDZB 2LAGB 3WLWC 4ZOBA 4X0KA 3WDHA 1FNLA 3MCLL 5H2BA 5LGKA 5DUPH 3OHXA 3H42L 4MZ2A 5EC2B 3AS3A 3H42H 4CU6A 2HTLC 4HDIB 3K2UL 1I7UA 1BVKB 5GQBA 3B4NA 4G8GB 4XCYB 3ARVA 1GHFH 2HVKB 1CWVA 4MQTB 3SGEH 3S88L 4X4YA 4PGEA 3GMOA 1V8HA 4S1SL 3B2VL 3MC0A 4HS8L 3NTCL 1LP9F 2EC9T 3MOQA 3C60A 3JV6B 3PDOA 1NQBA 1CDCA 2B1HH 4M1DH 2FJHA 3HC3H 4P4KD 4N68A 1B0RB 4G80B 1U42A 2ZPKH 2HT3D 2PO6C 3GUTB 1A22B 4N0CC 3HZKB 4OZHB 3UJJL 4OF0A 2VDRL 1A7NL 1TLKA 1K85A 1ZLSL 1A7NH 2Z8SA 2K7PA 1R6VA 1FIEA 3OGOE 4C83B 3WMSA 4Y5VA 2UY6A 1KTRL 1N0XL 3PQYE 5TE6L 4UB0H 5GGTA 3GSUB 1BZQK 1I8MA 1X7QB 1QBML 1Q0YH 4U7MA 1GGBH 1T80A 4XTRC 4PJ5D 3GI8L 2DQGL 1AC0A 1ZGLM 1INQB 2A1WL 2VUOA 1AD0A 5SWZA 2NY3D 4NKOB 2ZSVA 3RDTA 4CMHB 5FF6B 3PWVA 1OGAE 4XC1L 3OF6A 4U1LB 5DFTA 3U0PA 1BLNA 4RAUA 1EGJA 2ERJB 2YSSB 3IDGB 4PJGB 5IESH 4UV7H 3V5DA 1IAKB 4DN3H 5ESVB 4YDLB 4L4JA 3P11L 5DO2D 3EYVA 3GJEA 5IR1B 2EC9U 3HZMA 2WV3A 1J88A 4HC1L 3U46B 3GNMH 1RUQL 4QF1A 5FUZL 1J05A 4E0RB 1X44A 2EYRB 1DANT 4M7ZC 1WF5A 3B9AA 3NCMA 4KRPB 3OZ9L 4GSDH 4BSJA 3K8KA 5J1AA 4DUXA 5HHVL 1S5IH 2BSED 5HHVH 1FIGL 1FIGH 2IMMA 3MCKA 4WWKC 1ETZA 3MOBH 4JFFE 4PJDE 3S96B 2RFXA 3BPCB 5CEYB 2NXYB 5JOPD 3CNKA 2I25N 4DZBA 5AYUL 1MFEL 1QFWL 5DUBA 2RBLA 1QFWH 4QY8A 4I18B 4WI3A 4XMKH 1UCBL 4YLQT 1KYOK 1EO5A 1EEZB 2XV6B 3NZHH 1YUHB 3R1GL 1A14H 2GJ6E 1RZIB 3OJVC 3ZYOA 2HMID 4PV9B 1J0HA 2NY0C 1AXTL 4J23A 5D5MF 1WITA 1VPOH 4ZPVA 5HHPB 4MX7B 5C0IB 3RY6C 5J9PA 4OCWH 3RGVC 5IIEA 1X4YA 1EHAA 4ODWB 5BCAA 1UM4H 5EO0B 4GAYB 4PRIE 2VERN 4RDQF 3ARDA 5D7SH 2AV7B 2NXZD 1FPTH 1CL7H 4KKCC 3TGXA 5LAXB 4MAUH 1VDGA 1A6VL 1A6VH 2I9LB 1HOCA 4APQC 2OJZL 3RWJB 3B9KB 5F93C 1F11A 4G7VL 4LKCA 1I9IL 3L3HB 3U9PL 1Q1JL 1YY8B 1DANU 4YJZL 5GS0H 5I1EL 3CFCL 4Y1AD 1HI6B 4J3WA 4PJ9C 3CFCH 4KRNA 3UJIL 1A1OA 3HAEA 1VADB 2AP2A 1BFOB 3ZT6A 2AJSL 5F7KC 4PJEE 4J12A 2YXMA 1FO0H 4X6FA 4D9LH 3S3PA 5CEZH 1GCFA 1WICA 4NQTA 3AROA 3IDJB 1U8JA 1G7PB 3ZDYE 1YEKL 2R8SL 1YEKH 1BJ1H 4JREB 4MJ5B 3X13B 2R8SH 2ZNXA 3AY4A 5GSRA 5ISZD 1C5DB 1Y6NR 1KYOJ 4LVHC 1JGEA 4L8BB 4ONOA 3OAZK 1R3LB 3D25A 4KRLB 4KROB 4TULL 1FFOB 2A83B 2IG2L 2ZG2A 1FO0B 3SPVB 5EOQL 3ZDXF 3EO1B 4P2QD 1X5FA 3MJ8B 2PXYC 3SGKC 3UBXA 4YAQB 4ZTOL 4KKBC 4QT5B 5J13B 1MAJA 2DQEL 4UV4H 1MOEA 3GSRB 3EO9L 1U2HA 3BN9D 1NCDL 3BN3B 5DJAB 3HE7D 1U8LB 5DTFA 3MRFB 1REIA 4ZSOE 3Q6GL 3L3KB 1O7VA 4JFOB 1CXFA 5C09D 1BOYA 3QPXH 2IBZY 1EVTC 1FVCA 2UUDH 5D7JC 3PG2A 1QNZL 3RZCD 3BYTA 1AGBB 1DN0A 1G9NC 2EIDA 3F62A 2VDPL 2VDPH 1AP2A 4JAMB 1F13A 1H3TA 5HYQA 2KUTA 5T1KB 1N59A 4TQEH 2NY7H 2XICA 4GRLC 4RMTA 2W0KA 4JN1L 2VXQH 1KTKE 3CLEH 4BSVB 3PP4H 4HHAA 1AY1L 1ERNA 2D0FA 1XH3B 2NW2B 4DUWA 1RIUL 4M4PA 3BQUC 4GKSB 5DJCB 4AQ1B 3DO7B 4R9HA 5GSVB 4WWID 4F7EA 5JPNB 1AKJA 1NC4B 2EYSB 3VW3H 4WW1B 1OARH 5K9KB 3IRPX 1CICA 1AI1L 1AI1H 3DGGA 3NA4A 4L8CA 1XGRB 3E6HA 1J8HA 4OGAC 1N8ZB 4TSCH 3MNZA 1QEWB 3L3IA 2YHGA 1NBZB 4HX1B 3SDDA 1RAMA 4QTIL 2IF7A 3T0EA 2EDBA 2FEEL 4QTIH 5C86A 5F89B 5IROC 5D1XA 1J11A 3S3SA 1FP5A 1X5KA 4OIBA 4QRSA 2ATPA 3FMGH 4UNUA 2YA0A 3WFCH 2E7HA 3G6JF 2X9XA 4X6EB