5T3ZD

3.5 angstrom crystal structure of a fully and natively glycosylated bg505 sosip.664 hiv-1 env trimer in complex with the broadly neutralizing antibodies ioma and 10-1074
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
229
structure length
229
Chain Sequence
EVQLVESGAQVKKPGASVTVSCTASGYKFTGYHMHWVRQAPGRGLEWMGWINPFRGAVKYPQNFRGRVSMTRDTSMEIFYMELSRLTSDDTAVYYCAREMFDSSADWSPWRGMVAWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Natively glycosylated HIV-1 Env structure reveals new mode for antibody recognition of the CD4-binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
total genus 32
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2016-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t3zD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t3zD01
3IDNB 3GSRB 5GRVL 4DFIA 4N68A 1KG0B 2DM7A 4QRUA 1HWHB 3LKSA 3HPJB 5IP4A 1Z3GL 5LGKA 2CIIB 3VXUD 2BNUA 1XGTB 3MGOB 2X4PB 1I7UB 3SY0B 4RZCA 4JDZA 5E5UB 1BF8A 3ARGC 4PLKC 4YO0A 3SKMA 4PJCA 3F7YA 2AK1H 4X9HA 2Y5TA 3QEGH 4GW1B 5EPMB 3SDCC 4PS4L 1AHWB 5A43C 3RHWK 4JRYE 4PRDA 1YC8A 4I8DA 1U3YA 3FONA 4L8DB 1F6AB 4PJHB 2P5ED 3REWB 1JHLL 3MQIA 3GBMH 2WM0A 3JVGC 3N1QC 5E8PA 2HLFC 4LP5A 2EIZB 2CKNA 3VFVA 5HI4D 3VD7A 2QTEA 3PIQB 3MRPA 3ZDXE 1G9MC 4Z7VF 3L7FA 4YDIL 5DXWA 1WTGT 4HWZB 4UB0H 2F58L 1J5OL 3BKYH 3UP1A 4JPVL 3OJVC 1F11A 4BA8A 2J4WH 1MFNA 5DZNA 3IXTB 1ZGLM 1X5KA 5ICYA 3W9EA 3I6LD 3U4EB 4YFLF 1MWAA 3LKQB 5EU4A 1AO7B 2UZIL 3D25A 1U8JA 3IXTA 3VXNB 3UO1L 5JR1L 3MV8B 1G7HA 4OLWL 4QHUA 3L9RB 1WWBX 3RL2A 2GCYB 1E4XH 1H15A 3B8YA 4P23D 5I16A 3PDOA 1U9KA 4LIQH 2ZUXA 3L5WB 3X3GH 4J3XA 1JF1B 3JV0A 1FLRH 3S97C 3B5TA 3GSUB 3TH2T 1C5DB 2BVOA 1S8DB 2BOCB 1BD2A 2X4UB 2X44D 3VWJD 3MRLB 3RUGB 5L9DH 5BXFA 2V9TA 1BBDL 5DEFB 3DSFH 3QDMD 2R4SH 3VDCA 3M07A 4OF3A 3CD4A 3QWQB 2XWTB 4PV8A 4ZOEA 2VJXA 4GKZA 5IBUB 1CXKA 3RWFA 4YHPA 5KVEL 4R4NC 3MACL 4ONFH 3H3PL 4YE4H 3MXWH 3W0WB 1Q0YL 4ELMB 5K9QI 3GB7A 3NABH 4KRMB 2NNAA 4NQEB 1OPGL 3MPCA 1N0XH 4CGTA 3SDAB 5B39B 5D7JB 2IADB 1QO3B 4RFOH 2KPNA 4HC1H 4KJWC 5CINH 5CEYA 3AREB 3WJLC 3QEGL 1ADQA 3NACL 1HNFA 4CVXB 3DV6B 5GZOC 1YUHB 4JREC 5E1HB 3SGDH 5LXGH 5FCSH 3PJSA 4P4RB 3RX5A 3DXAD 2C4FU 3AAZB 2Z9TA 3ARWA 2RJMA 5F3HB 3P40A 3QWRD 2H2SD 2RFXB 1Q94B 1NC2A 1UB6A 3MRJB 3CLEL 4W4OC 5HGHA 3VD4A 1MHPH 3DX7B 3DURA 3VE0B 4X7FC 1CLZH 4N9OB 4TOYL 1EUUA 1ZLUK 1CFSA 1NUDA 1FVEA 2WV3A 2F19L 4GAYB 3CMGA 4HLJA 4I2XA 3VXPA 1WZKA 5ILTH 1PYWB 3MGTA 4P23C 1LO4L 5CIPB 5C0FB 4ODUA 3WUWA 4EBQH 4D9LH 2XG5A 4OCMC 2DQCH 4GRLC 4OCXL 3E6HB 3S8WA 3ZTJH 3PHSA 5MEOA 3VFPB 4Y4FB 1G6RH 1A47A 4N8VG 4ODSL 3I02B 5GS0C 3KYMB 3U9UA 4C54A 4WRLA 1X6LA 4LRIC 3NCCB 5FYJH 1K4CB 2EO1A 3VA6A 4M1DL 3BMVA 3QXUA 4N5EC 5HGGS 3GJFB 1KN4H 5JDJA 3S34L 3WNKA 1A6PA 2FEEL 3K4DA 5FYJE 4XAKD 4KQ3L 3B3IB 1U3ZA 2GJ6A 3BN9D 1RIUL 1UB5B 1W0VA 3C60B 4JEGB 1NGZB 5FYKU 4R0LA 2Q7NA 1KULA 2HH0L 4OI9A 2EXYC 3GB7B 1QSEA 2R0WL 3PQYE 1FZKA 3RTQD 1MFCH 1I3UA 1ZSDB 4JM4H 5FO9B 4G43A 4LF3A 2C4XA 4OCYH 1T5WA 3RVXC 3H0TB 3G6JA 2OBGA 3D39E 2V7NB 3OKMB 5FV1L 3FQRB 2ICES 1AGFB 3ZYOA 1QBAA 5DSCA 1AR2A 1Z6JT 3PQYA 1FG2B 4HD9A 1T20A 1S78C 5D96B 4MVBC 3SJVB 4FQXB 2XA3A 3T2NL 1T83C 4RMVA 2YPLD 4LCUA 3RJQB 1EVTC 1NC4D 1NLDL 1KB5A 4QRQB 3QQ3A 1F5WA 4G9FE 5A40E 3LEVL 4K7PY 2WUBL 1BJ1J 4TNWK 4LP4A 2IQ9L 1CLYH 1LO2H 1F4WH 1H15B 2DQFB 2HG5B 3TZVD 3VXTA 3ULUE 1W8OA 1BFTA 3CLEH 1NFDB 3O6FD 1MFBH 2VR9A 4F58L 3V4VH 4GQ9L 4ALAL 4OQTL 4R96B 2XXMB 3H9SB 2HKHH 2Z91A 3DETD 2YS4A 1TPXC 3LMJH 3P4LA 4UTAL 2NY2B 4N8VB 2DQJL 3IU4L 4PGJA 3O8XD 4CJ0A 2YC1B 2V5SA 3LS4L 3MO1A 4NJAH 1NCNA 3VRLE 2XPGA 3BPLC 3U0TB 3FRPA 4PYGA 4P4KB 5GHWL 1I7RB 3RVVD 4Q7DA 5FA4B 3WIHH 4N5ED 4XAKE 4RDQG 3ROLB 1WGOA 5CEXA 1YMME 4MNGB 2AEWA 5HI4C 4I0CC 4QXTB 3RDTC 3UJTH 4BZ2L 4P57A 1A1NA 5HYQB 2EC8A 4J3SA 2QJDA 1GH7A 1UWEL 1WZ1H 2FJHB 4MMXC 4JKLA 4PRNB 5IMMA 4XHQA 3G6DL 1L9MA 3K4ZA 5F7EL 2XN9D 4ODVH 2NYYC 4MAYC 1H3GA 5CLWA 3RY6A 2J3SA 2NNAB 4NKDA 4PJ7F 1I8KB 3QDJD 1INDL 5F9AC 2FGWH 5FHAH 3VD5A 4ZUSA 4MQSB 4U1SB 1DQJA 3S4SG 1IZKA 3H9HA 3S7GA 1XFPA 4BFIB 4Z76A 3DMMD 3STZA 1HIML 1EIBA 3BYTA 1RURL 3QQ9C 1P7HL 5IVZB 3PJSB 5L2KE 1JIBA 1MHEA 1UKQA 4JE4B 4X9GA 1C1EH 4M7JL 4BQ6A 4JAMA 5FCUL 4YK4B 3IB4A 4I3SL 2DLFH 4KPHL 4QRRA 4UTBH 5F9OL 3WFEH 1CK0L 3QUZD 5DO2D 1OAUL 4PJHE 4I3GA 4P48A 3KJ4B 1OTUC 3GBNH 1FNSH 3MV9E 3S36H 4GRMB 1OF2A 5DK0B 3WHXA 1HQRA 4WTWA 5DJCA 1OSZB 4Z7UA 5IVXB 4OKVB 2EEDA 3OWEA 3B2UC 4GKZB 5DD3L 1IGJA 1S3KH 4KJWD 1KIUA 1TXKA 1JBJA 3KPRB 3QO1B 1C12B 4HKXB 2HJFA 1GC1C 1LEGA 1KB5L 1BJ1H 3O3BB 4Q9CA 1TNNA 1A64A 2NW2B 3VFPA 4P2YA 1VFOA 3L95A 4BJLA 1UZ8A 4P5MB 2WIMA 3DO7A 3OX8B 4NC1C 3OR7A 1YYLL 4WCYL 3TJEH 2ZPKH 5LBSH 1FNEB 4P2OD 3ARBD 3GIZH 2VAAB 5E8DL 4EOWH 3HAEB 4F37F 4OLXL 2YD4A 2PW1A 5K9KA 2XTJD 1MPAH 4P0DA 1VFBA 5DI8A 2F5AH 4ZUWB 3CSBA 1QVOA 5EN2B 5C07D 3QIBA 4KV5E 4QCIB 2OXGA 3BPOB 1LDSA 2LU3A 1WIUA 2XZCH 4XMKL 4RAUB 3WSQH 3QT2A 4BZ1L 3TWCH 3LKRA 3GIVA 4IIQA 1GZPB 3NMEA 4G43B 3ULUD 1Z0MA 3VXMB 4BYHA 3OQ3B 3SE3A 1V7NH 4JVUA 1XGYL 4M8QA 4WUUA 2F74B 4HWUA 2H26B 5KSAD 1P4IL 1ZLUH 1MWAB 1QLFB 4LKXB 2HYMA 1T1YA 4NZUH 4Z9KB 4JFXB 3KG5A 1SYSB 2WP3T 1AP2B 4LLYA 3SDXB 1R24B 2BVUA 3C9NB 4HWBL 5DO2C 1RZIB 1OAQH 2DQEL 3QP3A 4XNMB 5CWSA 5J11C 3WL9B 5EOCH 2D7MA 1E6JL 3GSNB 1CDGA 1K4CA 3MLZL 1VACA 3GSXB 5M95B 5D1XB 4LAJH 3BZ4B 3FAWA 3MRBB 4WU5A 2UWEB 5GGUA 2ZWLT 4PLJC 3GNMH 3UTOA 4I48A 1GPOH 4Y4FA 1XCQB 1V7ML 4WO4A 4HK3N 1I7TB 2E7HA 3DX8A 3CDGA 2FWOA 2FYYB 4K9EH 3DGCR 3VXUE 4ORGA 1A7NL 1G7PB 2VDOH 2X09A 5I8OL 3CK0L 4G7YL 4PLKD 4M6AA 1RVFL 4UNVA 2R4RH 3GGWB 5C08D 1ZS8A 3PNWB 4RBPH 1LO3L 3T8XB 2X4RA 5A2KH 2HAZA 2FH8A 2RGSA 4HK0B 4NO3A 4I0PC 2CGRL 4YZFE 4RFOL 4WHCA 5F1IA 2LU7A 5DD5L 4K7FB 4P49A 2XKNA 5TQ0L 1ZA6A 2NY3B 4YXLH 3W2DL 1NAMH 2OTWB 3EO9H 1J8HE 4Q2ZA 4MJIE 2AJUH 5IR1B 3ZKNC 5IG7A 5KOVC 2C3XA 4ZUWA 3CU7A 4MNQB 5IVXE 4N9GA 4TNWF 4UINL 4F8TA 1AIFB 4LRIA 3F8UB 3K8KA 1AXTH 1DBAH 1OW0C 3HI5L 2VZTA 1HHIA 1QRKA 3KYAA 5E6IC 2VLMD 4ZUUB 1AQKH 5I1LA 4GAGL 5FXCH 1BBDH 4TYUA 1V3JA 1W72H 2ICCA 1B6DA 1YYML 2Z31D 4JO4L 4XGZB 3AROA 1VADA 3P4MB 1NEZA 3SDDB 4ERSL 4NQCB 2R23A 1LEIB 5I73C 1GXEA 5D5MA 1H8SA 5EA0L 5FK9A 1JYWA 3VWKD 3BRFA 2NY5C 2I9TA 5C09A 5LGJB 3ZKXB 2JB6B 5IM7B 4D0BB 3M17B 4DKAA 2PYED 1MHCA 15C8H 5C0ND 4HS8L 5CSZA 4YUEH 3UTQA 3KPLA 3VFUB 3TPUB 3NFNA 1IGJB 1IGFH 4HC1L 3UBXA 3WD5H 3JV6A 2IPTH 3T4AB 4ODSH 5FOBA 4Z7UB 5GGQL 1MJJB 5FO7B 5FDWB 4QT5A 4QRPE 5I1CH 4YGVA 2Q8AH 3ZMRA 4NSKA 2P24A 1EHLH 4M1DH 1GGIL 1S7UA 2OL3H 1QR1B 2G75A 1DVFC 2QSQA 1J5OH 1CFTB 3QFDA 4UAOB 4Y1AD 1FDLL 1XH3B 5GS1A 1V7MH 2EDKA 3KYKH 4P5KA 3T1FB 1JWUA 3TO2B 4TPRH 5FKPA 3KLHD 3QI9C 2GTWB 5BOZG 2P8MA 2AEPL 4YHNB 4FXKA 3CFKB 2W0FA 5ANMA 5EB9A 3FRPG 4UILL 3FT4A 5H37H 3MTRA 1AE6L 2ENSA 1YPZA 4LSTL 3IDXH 4XNUH 5E8NB 5AZ2H 2XKNB 5F6IB 4PIRF 5EIVA 5EN2A 4RWYH 3BDBA 5KVEH 3QUZC 5KSVA 3QQ9D 3RFZC 2DTMH 3GI9H 5E6IB 5FYLE 3T0EC 1HHKB 3PWJA 1NMAH 1U8KA 5KSUA 5C6TH 3L3IA 1FO0A 1I9EA 2Z92A 4APQC 4BFGA 3OR6A 4ZTPL 3KYNA 5ADPL 1T03H 1HKFA 4JFDE 4M8QB 5IHZA 3QSKB 4Z0XA 3QXTA 2OXHA 4Z18A 3WKMH 4P2RB 4HFWA 5BRZA 2AJ3A 2P7TB 3GMLA 3HE6B 4UT7L 3CJJA 2F19H 2NW3B 1BQUA 1Y18A 1X5IA 3CXDH 1SHMA 1D9KD 4QHKI 12E8L 1YJDH 5L8LB 3N50A 3VJ6B 5C7XL 3CVIH 4FRWA 3THMH 2ITDB 4ZOAA 5C0BB 2DQDL 4KZDH 1P84J 5LG1A 4OF0A 4GRWF 3BT2L 1N5YL 5KVDH 1M05B 4M3KB 4WUKL 2EO9A 2HLFD 4KXZH 3G6JE 3E2HC 4U1NA 5F9JB 4QYOA 1DE4B 2EDWA 1K5NA 5CJQL 1LNUA 1IGCH 4CDGC 1MCSA 2R69L 4W6YB 1T6WA 4XCEA 1A1OA 3GSOA 4LHUA 1NGPL 4HXAH 5FDYA 3BAEL 2AP2A 3OJ2C 4ZDHB 1HHGA 2C4FT 3LKRB 5C0AB 4GW5B 1T89A 4G9FA 5F1SA 3WXVH 3GSVA 3EYQD 3F7YB 4MJ6B 3O6MH 5FHAL 4XI5C 4DGYL 2H8PA 3EYSH 2EDQA 1KN4L 1CDJA 4OUUB 4OGAD 2R2CA 5JO5A 1YMMA 4G9FD 4HAFA 4Q2ZB 5EU5B 2BNRB 2NTFA 2WBWB 1EVUA 4CVUA 2DAVA 4GAJL 4RA3A 4DN3H 5C0GA 3ALWA 3JBG7 2ZJSL 1KLGB 2VXTH 5EO9A 4J8RB 3RZWA 3KDMA 4PRHB 5BW7A 2HJFB 1W0YT 5EBLB 3KXFE 1U0QA 1UEMA 2IBGA 3I75A 2PCPB 1UB6B 2C26A 1UM5L 2CLRA 5C6WH 4YEEA 2DI7A 4DVBB 3FCTB 3NA4A 4ODBD 4ALAH 2NY5L 5J6HA 4FABL 2F54E 3IAGC 3P2TA 4I18A 3FB8A 3DPBA 4Y19E 1UADC 3F7QA 4YEFA 1YDPB 1IL1A 5SX4I 2AK4B 4OLEA 4R2GD 1G7JB 2YUWA 3QCVH 3WFBH 1U92A 2DRUA 3FB8B 1J10A 5HVWA 4JHZA 1EAPA 1RJLB 2X42A 3QO0B 4LLUB 5C09E 4DK3A 4MS8D 2VABA 5IK3B 3MRLA 3G6JF 4PY8I 3KHQA 1WEJL 3RI5F 4YX2L 2NY6B 4I3RH 4YHPB 1M6OB 1K5NB 1T7ZA 4XMLL 4GRWE 2XWTA 2PO6A 2CDEA 1NGYB 2Z93A 1EJOL 1CE6B 1SYVB 1IGCL 1D5MB 2IQ9H 1T4KB 3I6KA 4WW2B 25C8L 5DD6B 4CU8A 4MD0A 3ES6A 3AREA 5DD3H 4KDTA 5I9QB 3D6GA 1JGVL 2NYYD 3MNVA 3HB3D 4F7EA 2R9HC 1D7FA 4OQTH 3O9WD 3WIFB 4NZJA 3JV4B 1AQDB 2ZUUA 1H9VA 2F74A 1I8LC 3ARUA 2AABH 3FOLB 1SM3L 4X6CB 3HR6A 3SE9L 3HAEG 5DVKA 1ZA3A 3BYYA 3SKJH 2GUOB 3FQXB 5K59F 5TF1H 3MLUL 1T89C 2WK2A 3DMMC 4XVSH 2R8SH 4LASH 5C08A 4C4KT 2JB5L 1UG9A 3UPRA 3ARFD 4NQDE 4MD5A 5DQJA 1G6RA 3BN3B 3VGAB 1JPSH 3QEHA 1UCBL 1XIWB 4KKNA 3ULVH 1H3PL 4WHYH 1WAAE 4I13B 1B0GB 1TCRB 1DBML 4RGNE 1D3CA 5GRYA 4FQ2L 4PJDE 4N0UB 4PJ9D 5TDOB 4PRPD 4NBYB 5A2FA 4ISVB 4YPGB 3U2SA 3JTSB 4XZUA 3FAXA 5GSRB 1AGEA 3S4SA 5I16B 3QI9D 4LPXA 2R1WB 2B0SH 4NQDD 3EHBD 2FX9L 2AJZA 2HFGL 3TO4C 4TSBL 3CFKA 5BZDB 1P4BH 1DSFL 1VPOH 4X98B 4HT1H 1KCUH 3DJ9A 4PJEA 4XRCB 2X4TB 3OG6B 5MERB 5DMYA 1JTTA 1AD9A 3TNMB 4MJIB 3L3GA 2JCCA 2BY1A 5L88H 1CFTA 1EGJA 3QFDB 2QKIB 1S78D 5DD0H 4LBEB 3O4LE 2MSPA 4K7FA 4U3XA 4FXKB 5ANMB 4PLNC 3RZCA 3D18A 1GOGA 4CN4A 4FMKA 4KK5C 5GS3A 2R2BB 3DTXA 4RX4A 2EYTA 3GK8H 2G5RA 4TUKH 3ZTNL 3QZWB 4TNVK 43CAA 3MGAA 5IGXH 1F3RB 4HLZH 32C2B 5E2TL 4OD3L 4ONHB 3CC5B 1CXHA 3NCJH 5T3ZE 5B39A 1Q1JH 4IDJH 3GKZA 4GRLD 4TRPL 1FIEA 2BNRA 4X4ME 3O4LD 2X05A 3IKKA 2OM5A 3QIBB 1HZHL 4J6RL 1AD0A 1U2CA 5BS0B 3IRZA 4K9EL 1NL0H 3F7VA 1FBIH 2VL4A 5LQBL 1MRDL 2JTDA 5ICZA 3V5KA 4EQ3A 1IC4L 2WLYA 1E4XL 3PWPE 3NBNA 4JPWH 6CGTA 1KNOA 2XQBH 5T5FL 3VGAC 2AXGB 3M17A 4LVEA 4JKPH 4MCYA 2DIBA 3BWUC 3QIWB 1SM3H 1JWSB 4KC3B 5SWQB 4JG0H 1HWGB 3SKJL 3GSWB 3MO1B 3A6CL 4KAQL 1OY3B 2JJUA 3MXVH 1HN1A 2C1OB 2ZCHL 1T0NB 3U36A 4HUWB 5C07E 4HJ0D 5HSFA 5TE7L 1IQDB 4XVUC 1FV1A 1BWMA 3FHAA 1KCRL 3ROLA 3WFDH 2VLJA 3HR5A 4HW6A 3DBXB 1K6QH 4XTRC 4EUPA 4UOW0 2NXYD 1QFPA 3QUXC 5JPNB 2ZZUT 4FZEH 4L9LC 5SV4A 3C2AL 4MZ3A 3QULA 1BM3H 1RZJL 4EBQL 1MCCA 1QVOB 2ESVE 3QUMB 4NKMB 5FEBA 1JWMA 3GM8A 1LWRA 3L1OH 43C9B 5BRZD 4Y0GA 3KAAA 2F8XC 1SJEB 3D0LA 1FL6B 3ULUF 4PGZA 4HT1L 2BNQB 3UJJH 1AGBB 4MX7B 4JRXD 3RL1A 1FH5H 1T20B 4JZOA 5IW1B 1OT1A 3C6LA 1J1PH 3D9AH 3QRGL 4H0HB 4PJ5E 1TTFA 4R8WL 4XWOC 3CFJA 5EIIA 4ZODA 4UDTA 2V5RA 3RWJA 1J1XH 4QRTA 1A7QH 4ZUSB 4J3OC 2NY1C 3KR3H 1N8ZA 4L8DA 3REWA 2AJSH 3PUCA 2XOTA 4X0KB 4FQQB 3TNNB 3NZHL 1CR9H 2MTPA 2V2WB 1MCRA 4LMQE 4YDKL 3ZHKA 1HH6A 5IGXL 1SY6H 4BSVA 3L5XL 1MLBB 3BQUA 3DARA 3O3AA 4UB0L 2APWA 1K4DA 5FM8A 1IAMA 3QB7C 1WICA 1QTYT 3JTTA 3P4OB 4UV7L 3WS6C 2W38A 4QWWC 5D8JL 1DQQA 4L8CA 1ACYL 3ARQA 3OHXA 3SDYL 4TSCL 2H26A 2H32A 3E3QC 1EEZB 1KIPA 4YAQB 2YXFA 2HN7A 1XGPA 1JTOA 4L8CB 2HFFB 4Z6AT 3U0TA 1R24A 2CIKB 3TFKD 1IC4H 5JOPD 1LQSR 5AYUH 1AR1D 2HN7B 5HHOD 3V0WL 1RUPH 4J4PD 1RU9H 1UFUA 5I75B 1RK1A 3QXDB 2DOCA 2AJUL 3P0VL 3CPLB 1P7KA 2P42B 1MIMH 4U7MA 4RMSA 5EWIL 5HDBE 5GGUB 3FQNA 4KAQH 3UZQA 5DRWA 4QNPE 4WEUD 3MRDB 2V5TA 4DAGL 4JR9H 2JIXB 4KRNA 5TF0A 1U41A 5KANI 2EE9A 1K85A 4PJDB 4BSWB 4UBDD 3RVTD 1AI1L 4ZPVB 3UCRA 1YYMH 1WZLA 5DMIH 1FLTX 4O2FA 4JRYD 4JZJA 5CMAB 4C56A 4XCCL 1MI5E 1ES0B 2F53B 1GSMA 2CR3A 3U46A 4OF6A 2AXFA 2CLVA 5B38A 4TULH 3EYSL 1DN0A 1H3VA 1BFVH 5BVPH 5C08E 3OXSB 4K8RC 3ZL4H 5D70L 1OPGH 4QRSB 1ITBB 4PY7B 3MR9A 4JGUA 2YWZA 4PJBA 4LNVA 4ZFZA 3RL1B 4C56D 5IBLC 4HPYL 4KZDL 3FB6B 4U6YA 2B4CH 3BZFB 3CFCH 1YEKH 4LCWE 5EOCJ 5E95B 3CFBB 1N2RA 1EA9C 2Q1EA 4X6EA 3SGKC 3V4UL 3G6DH 5INDB 4FG6C 3LEVH 3QDGD 4Q9RH 1DQLH 4OIIH 4F2MB 4CN1A 3DV6A 4EI5D 1OGTB 1CXIA 2QADB 3VMNA 3W11C 3GSQA 4YLQT 3PGDA 1K4DB 3QIUB 1CG9B 5L0QB 2PYEA 2DQGL 2LAGB 1SYSA 3RWHB 1JZ8A 4ZPTA 1UM4H 4FTVE 1ZVHA 4WDIB 5F96L 3BDXA 5C7XH 2EYRB 5EBGA 5KG9A 2ICWA 1FNLA 2DQJH 1U6AH 2Y6SD 3ZKXC 2A2QT 3LDBB 3DVGB 5F6HJ 1HCFX 3LV3A 5HHME 4M93C 4HS3B 3WFBL 5AZ2L 4WUKH 4RX4D 1QRNA 5SV3A 3U7WH 2VDNL 3BW9B 1FZOB 1QFOA 3OG4B 4HKZB 4HPYH 4FMFA 5IQ9B 3UDWC 1BWWA 1HE7A 1R3KB 1N6VA 5DGQA 2C1PA 1I8KA 1OLZA 4JO1L 1NGPH 4HXAL 1ZGLB 1KN2H 4LARH 1QSFE 2D03H 2F8OA 4YHML 2P43B 3K8LA 1EFXA 1RQ5A 2PUQT 4UNUA 1I3GL 1A7PH 4YIQB 5D7IF 5DJDB 5EORH 3CU1A 3D3VB 3QBTB 1MFEL 5EZLB 3U6RA 5IB5A 1MCLA 4IOIB 3QUXB 2O5ZH 3K0WA 4G6MH 3AVEA 3E6FA 4PRPA 4LSVH 2DIJA 3TO4A 2IF7A 5ESAB 5CILH 3VXSA 4PR5A 4JJ5A 5ICYB 1MCQA 3NN8A 4YFEA 3QCTL 5IFAH 1JZ6A 2NY3C 1BOGB 3HNTL 4RRPA 2DJSA 4ZS6C 1EERB 4PRIA 4WFGE 1T3FA 5F9DC 4TTDC 3UYRH 2HVKB 4EIZC 3R8BB 2DL9A 3RWGA 4ZYKB 2JELL 4U0RB 1KLFA 3PWNA 3VFNB 1R0AH 1EBPA 3WJJC 3OHXB 2A9ML 1BVKB 3MROB 1GAFL 3QXWA 1UM5H 1BGXH 2EC9T 3MRGB 1IKNC 5CHNB 1S5IH 4G6KH 2X1WL 1ADQL 1BECA 2A6JA 4YHMH 5TDOA 5HJ3A 1G7MA 2COQA 4P3CH 5J1TC 1RZKL 5I1GL 2I9TB 4TVPL 5IMKB 1II4E 3HFML 5CBEA 2X4UA 4POYA 1MFBL 3BVNA 3K3QA 4U7SA 1HSBA 1JNNL 1QEWB 4E9LA 1KFAL 2YR3A 3JV5A 1IM3A 2OTPA 3RAJL 4QOKD 4U6XA 3C5SA 2QHRL 2J8HA 3DTXB 3TJHC 2DB8A 3I50H 1LP9F 1CN4A 2YPLA 5TPWH 4OBSA 4MS8C 4YHIB 1A0QH 3LQZA 1H5BC 2ZOLB 3QDJE 1A6UL 4O02H 4Y2DD 1KELH 1SY6A 3ZDZF 3PP3H 4IRJD 3H42H 2FH6A 5JIHA 4M6NH 2J6EA 4HEME 2E5EA 2IMMA 3GMNB 4FQQA 2Z4QA 1NSNH 3BP7B 1WBZB 3RU8H 3MODH 5I1DA 2QADD 3CXHK 3WJLA 4BZYA 4D9LL 4EI5B 4JN1H 5TDNB 3F7RA 1TTGA 4NO5A 3CSPA 3QDGB 2VKXA 4AIOA 3PQYB 3K46A 1ZT7A 3KYNB 2Z93B 1ORSB 1UH4A 5KW9L 1E4WH 3PWLB 3VH8A 1NL0L 4YGAB 4Q9BA 1MUJB 1N64H 5JQ6L 4L4VA 3PWJB 1NQBA 4MDIB 1EXUA 2RHEA 1KFAH 3HI1B 5KSVB 1MHHB 1A6AB 3HMWL 3QZWG 4LSVL 4KI1A 1UM6H 2BRRH 4A6YA 3FCTA 1QD0A 2LQRA 4K23L 1H3WM 5CIPA 1QBBA 3R1GH 2RFXA 2DLFL 2F53D 5HYJE 9CGTA 5JHDB 3BZEA 4OD1L 3FO9B 4KMTL 1EEYB 2ZCHH 4XMPH 2YEZA 4QXGH 1CGTA 4MXWH 5I15L 1MOEA 3G5YA 3EYUL 1A7OH 4KRPC 5GS0H 3FT3B 1LMKA 2I26N 4AQOA 4KUCF 3MRQA 4XNQB 1NCWL 4MXQD 4OCLC 4O51B 2WINA 3HZMB 1MIEH 5EIQA 5BZWA 1RUAL 3UTPD 3HZYA 1YEJH 5I1GH 1H5BB 1U8NB 5CZKA 3ROOA 3SHSA 4YUEL 3CAFA 2FO4B 5DUPL 3BP6B 3TJEL 3VG9B 5E9DE 1SVZA 4FQPA 5FKAB 3D0VB 4HWEL 4L1DA 3D9AL 4GMTL 5KSAA 2CKBL 4YWGL 2BSTB 2KKQA 1CXLA 3WLWC 4LK4A 1FORH 3OAUH 4X6DE 3M1BA 3PWPB 1A1NB 1OQOA 4LGPB 4HZLB 3FB5A 2HJKA 1OAKL 2ESVA 4V2BA 1Q9KB 2QSCH 1HXYB 5DD0L 3HRZA 3QFJA 2XRAL 5ECJE 3LD8C 1PG7H 2ICEB 2CLRB 4B53A 5ERWB 4I2XB 4P2OA 4NGHH 3OAYH 4X6BA 3NOIA 2GKIA 4MSWA 3W9EB 2ARJQ 1A4JA 4WFFD 15C8L 5C0EB 2CXGA 2OL3B 2BNQD 5FO7A 5D7IA 4M62H 2GY7B 1O7VA 2HFEA 1EEUA 1Z3GH 4OFYA 2ZPKL 5LBSL 5F9WC 1IFHH 4PJXB 3QAZC 3MV7D 3QDMA 3FTGB 3MV7B 5HPMA 1CGSH 1R5IA 1P9MA 1NLBH 3ULVF 1B2WL 1P6AB 3WBDA 5I1HL 3MJ7B 2FL5B 2NXYB 2CK0H 4AIZA 5CP3A 3N85L 5E08H 1R5IB 2JJTA 3U30C 1PFCA 2CMRH 2OZ4L 4ZSOE 3MNWA 4HS6A 1DUYB 3CDCA 2VTFA 1SBBA 1H0DB 2VDOL 1L4IA 4M7KL 4G3YL 4JFEA 2P49B 1ZSDA 2VDMH 1N6QL 1NMBH 1V5JA 3QIWD 2E7LA 2Z4QB 2ATPA 1O5DT 2A1WH 2E7CA 3BUTA 4MYWB 3ZL4L 3LKSB 4JPVH 1YNLH 4K3DL 5ICXA 4QTHA 3RZCC 4XH2B 3AUVA 1Z9LA 1T2QH 2BMKA 2NX5A 4IIQC 1OOAA 3PWPD 4GFTB 5IB3B 3GBLA 4GRLA 3G5ZA 3F5WB 5BS0D 1JHTA 4MZ2A 1E6OL 5DK2A 4GMTH 1RJYB 1OAZH 1CGSL 4JG1L 4OZIE 2ED8A 3OZ9H 2AV1B 4OGYH 1JZ4A 4GRLB 4OIIL 4C57C 1MRCL 1I8IA 3PV6B 1IGIL 4RAUA 4FA8A 2BVEA 3Q0HA 4KVCH 2W9DL 4NKOB 1D5BB 3QH3B 1QSZA 1RI8A 2VR5A 4EDWL 3DXAA 4P9HH 3TH4T 1SEBB 5IVXF 3H3BC 5D1QC 5DF0A 3QG6B 2AJZB 4PG2A 3MLPA 1YA5A 4PJXE 1JNLL 1RUKH 4NWTH 3TYFA 2QADC 3KPQB 2XZCL 5BVPL 3X14B 3CH1B 1U93B 3IT8D 4L8BA 3WHE1 2W60A 5CEZD 1XF5B 4Y4KA 2VXQL 3SGEH 4CN6A 1BEYL 4HGKC 3FT2B 5E4EB 2YA2A 1RZIA 1LE5B 2QEJA 5F7MC 5JHDD 1BD2E 1TITA 2AEQH 4U0RC 2GSIB 5AD0A 1OM3L 3MUJA 1ZEAH 3S5LB 1J05A 3QI9B 5EUOB 1WISA 3WXWH 4HUNB 4Z7WE 1R6VA 1XR8B 1NGWB 3E1F1 2R2BA 3MLTB 4PRPB 5IMLB 4TUJB 4K7PL 4FFZL 1T5XA 4LU5L 4U1HB 5DQDH 5JORA 4R7NA 3VWKA 1XIWD 5I1DB 1JI1A 1JPFB 3LN4A 5CFHA 3TNMA 3WFHB 1NCAH 1NGQH 4UU9A 5J4MA 1G1CA 2J8OA 3ARFB 3TVMC 1JHKL 1QYGH 2RCSH 3PQYD 3DUUB 4HIIA 1M71A 1S7XA 2R0WH 4HKJB 2C3VB 4P3WA 3OMZA 4AEHH 1HHJB 4HEPG 5KN5B 2WBKA 2OZ4A 3FB7A 1QPPA 4KKAD 4OM0L 5CINL 3MYJB 2PW1B 3V8CA 1NMBL 5HVFB 3HLAB 3NZ8A 4PJFF 2FJGB 2A6JB 3VFMA 2OMNA 5IKCA 1T2QL 4IRJB 4G8IA 1IGFL 5GGVH 5K9OB 1MAKA 4ODWB 4Y2DB 1CFVL 1NDGB 3DRTA 3ULVC 3R0MA 4XCFH 5CBEB 1VEMA 2E7LC 3GJEA 5JIKA 5E99H 2XFXA 1JNJA 4Q6IA 1AD0B 1YEGH 3ALPA 3FJTA 3W11D 35C8L 4NC1E 3WL9A 5CUSH 4AJ0A 2FEDD 4QOKB 3SPVB 3GMOA 1OCWH 4W81A 2HMIC 5DRNB 4ETYA 1GC1L 4PJCE 2Z92B 3WMSA 1VESA 2GCYA 1FC1A 4JQVC 4A2LA 3VXPB 1OB1B 2CRZA 4QY8A 5L2JA 4KKBC 3UTTA 3ROOB 1QLEH 1FIGL 3F12B 3NH7L 2ZSWA 4OCYL 5C86A 2G60H 3HPJA 3W82A 4J3VA 5ESQB 1KEGL 1A02N 4GAGH 1HOCB 2VH5L 2HT4D 4R2GB 5H37G 1SJXA 4JM2F 4GRWB 4UUJA 1M4KA 5GSVA 2YC1A 1XCTB 2FLRT 3O41B 4OAWA 2VLJE 1EMTL 1VSCA 4MWFA 5HHNA 5GGSB 2ERJB 3MUY1 3O2VL 1VFUA 4PJXF 4PRIE 4ELKA 2JELH 5DYOB 2PN5A 3T8XA 5FKPB 3MYZA 3QXAA 4LSPH 4L8SB 1U3HC 4F7MB 3P77B 3BOVA 2YN5A 2FO1A 4Y5VA 5HGAB 2UUDH 5E8PB 25C8H 2C3HA 5DHXB 5GS0D 2G75B 1GHFH 4BKLB 5JMRA 1LO5B 3BWAB 4G80A 3VRJA 2FLBT 1F3DJ 2DQGH 2HVJA 2HKHL 3GJFK 2X70A 3PDDA 2N1KA 1F90H 3QUXD 5DLML 1A9EA 2O5YH 3D3VD 2NTSP 3EO0A 4LHQB 3HKFA 3TH3T 4DW2L 4APQA 5HHQA 5LKNA 1JN6A 3LS4H 3RKDD 2A74B 2BNRD 3L3KA 5IJVB 1YJDL 1M7IB 2YEZB 1G7IA 1SBSH 3NZ8B 5GGVY 1MVUB 5MI0B 5CWSB 3BKJH 1DEEA 3I50L 2BVQB 1EFQA 1YPZF 2E6QA 3TT1H 4K3EL 3R8QA 1FN4B 4X83A 4KVNH 2E9WA 3QNZA 2ICWB 3R4DA 3TT3L 1BZQK 3EOBA 3P30L 3S88L 4NBXB 5C0AD 4PJ5A 5I15H 3RIAF 3IYLW 4P3CL 3M8OH 4YR6A 3FQWB 3T4AA 3LS5L 4OZGF 4G8EA 4AEIH 2OJEA 3QDHA 3KPPA 3LPFA 5EO1A 3LD8B 4AYFA 4ZNCD 4ZO6A 1H3UA 2AJXH 2Y36H 3ILQD 3QIUD 1FFQA 2E9BA 1CF8L 3MCG1 3S5LA 2VWEE 2F53A 3U46B 1QSVA 2IFFH 2R2HA 4Y2OA 1BIHA 3L7EA 5C0BD 4HWNA 1RZGB 5L7XH 5I66A 3C09C 4PJDA 4BSWA 3EDDA 1D9KB 4IHOA 4YBLC 5D4QA 1G7JA 1JRHH 3WFDL 4ODTH 3LEXB 2EIZA 1N4XL 4Y8DC 4L8SA 4R90L 5HYJA 4RGMB 4C56B 1PG7W 4IDJL 4JRXA 4YH6A 3Q3GA 4HFUL 3ARFA 1J8KA 3TBVB 2PYFA 4NQXA 3ULSA 3LKNB 1G9MH 1UJ3B 1ZWIB 2DWEB 2Z31C 5TGBB 1RZKH 2Q6WA 3ZT6A 4NYLB 4WJ5A 3DYMA 3EDJA 1WWWX 5IHUH 1XEDA 1G9NH 4RMWA 1BP3B 3QEQA 5E6ID 5GZNC 1ZTXL 4OZIA 4JRYB 1EX0A 1ULVA 1MCWW 1TETH 2YN3A 4LVHB 5BW7C 3QUKA 1T66C 1IAIH 4PJEF 5T1MB 2AABL 2JIXD 4HUXB 4YK4C 3W9DA 5E8DH 5KANG 4H25B 2X1OA 1S7RA 2XNAB 3BIKB 2CQVA 3OSKA 5DFVD 5KS9E 5DJ0A 3TYGL 3RP1A 1L7TH 5CP7B 1QA9B 3RNQA 5FGCB 3P3YA 4I18C 4NM8L 4JY6B 1W72A 3WFCL 3TBTB 1U8OB 1VGEH 3V52L 4M61B 5HHOB 4L4JA 4Y1AB 4HIXH 5ESVA 1FL3B 5HHPA 4KY1L 4JFPA 5I1HH 1NBVH 1C08A 4GW4B 3GMMB 3IDMA 4M61A 5HHOA 1JZ5A 1Q9OA 3WS3B 3PF2A 3C2SA 2L0DA 3T1FA 4D2NA 3X11A 3GSOB 4YNYA 2BNQA 1IQWH 2JK5B 3QCUH 2OMBA 4NZUL 1JFQL 1OAUH 2Z0BA 1FFNA 1TLKA 5CD5D 1I4FB 3C09B 1D5ZA 4UT9H 2QLVB 1NGXA 1BBJA 1TVHB 4O5LL 2IAMC 1IGTA 1B3JA 3TWCL 2KDGA 3BGMB 5KJRL 4NFCA 4EOWL 2ZOLA 2IFFL 3VWKB 2FCBA 3CZJA 1BAFH 1H3TA 1CDCA 5FO9A 2P5EE 1KBGL 5DGRA 1TVBB 4NQCD 5IB3A 3SDDD 4LEOA 4JRWA 1ZHKA 2XTJC 1J87A 1P1ZB 3LKOA 2OR9L 2Z31B 3OJDA 5DD1H 1QFWM 1XGRB 3MOAH 3DSFL 4JRXB 5I2IB 1IC5H 5T33L 1MAML 3RPIB 4Y5XB 3RNKB 4B7LA 3KPOB 4ZAKC 5DJZA 2UWEF 2NQCA 5C0GB 5BRZB 1A7NH 1B0WA 5C9KA 2BX5A 3QPQD 4FXGA 5FUOH 3S35H 2ZCLH 4XNXH 4NN7C 2HJKB 3WEXB 1JVKA 2P5WA 3HAEH 1EEQA 1PKQE 1B6UA 2F9BT 2NY3D 4U4BA 4PGCB 3QQ3B 4RGNC 1MPAL 1GGUA 1FO0H 1A21A 1J1OH 3BEWB 1XIWA 5HI5C 4I18B 4GLRI 5DS8A 5BS0A 3WO3B 5HVGB 3N06B 2I9LA 4XT1C 3FO1A 1I75A 3FOMA 3BGFC 1JGEA 1B2WH 2HFEB 3MOBH 4WNQA 3NFPB 5J06A 5HGDA 2DBLH 1LK2B 4NT6B 4OLZH 3Q6GH 4LCCB 3DV4B 3BH8B 5GGSA 1F4AA 3QWOB 1LP9B 2W9EH 3MRQB 4XNQA 1PKQA 1B4JH 5D1XD 1N0LA 3ECBB 4DZBA 4FZ8L 2YKLH 2FEDC 2WNGA 3DV4A 2YD3A 5TE4L 1BZ9B 1HZHH 3QIWC 3QIBD 5C8JB 1QKZH 1BM3L 1RZKC 3QR2A 4XPGH 4O2EA 5IVOA 3O4LB 5IJVA 4CVXA 3GFUA 4GJTB 3DLQR 1CXEA 4HIEA 1DQJB 4I4WA 3VFRA 4C83A 4JO4H 1UJ3A 5J3HC 5FUCE 2XQBL 5B39G 5KSAB 4OLVH 1CDYA 1PEZA 2L7UA 5IHZB 3OPZH 4DUXA 5EZIL 1YY8A 2BC4A 3VXMD 1CGYA 5BJTB 5HYFA 3JWDC 1NDGA 1IE5A 4MJID 3VH8B 2YD9A 3OKDA 1A1MB 4XP1H 1XF2A 2HRLA 5F6IC 4KI5D 1QFUL 3CXHJ 1HKLL 5C07B 3VI4E 4UZGA 2IPTL 1LD9A 4PGDB 3WIHA 3L5XH 4Y7MA 2CUMA 1I7RA 3IDYB 4JRXE 4FQ1L 1B90A 4UUJB 4OFYD 3G04B 4NQDB 4HULB 5BMFH 1UYWH 4OGYL 3IDXL 2R0ZH 5F1NA 2B5IC 2QV2A 5HY9A 3ARBB 4IMLA 4PJ9B 3G04A 2R0KL 3FO9A 3CK0H 4PJGA 4OM0H 3TIDB 5JW3H 5A16B 3TLRA 1RUQH 1YQVH 4HUUA 4EUPB 1GYAA 3CMOH 1BQLL 2GITB 2G2RB 5DR5L 3V0WH 4BKLA 2JKXA 1T2JA 2XWJB 3EOAA 5GIRB 5I71B 3DO3A 1RJZA 5GZND 3OX8A 2AQ3A 3LVEA 4LGRB 4NN6C 1N3NA 1MRCH 4Z7WF 1GIGL 2FRGP 5DQDL 1IKFL 1T4KA 5GRJH 4OCNC 4JO3H 4P23A 4PRDB 4OCWH 3AM8A 4M6MH 1KIRA 5CUSL 3TIEB 5MEQA 5FKAA 4PYHA 4IOFD 3O9WB 2DLTA 2PXYA 3QUZB 1KJ2H 4L3EE 1ZEAL 4KK6C 3MRHB 4E41A 1YEEL 3NIGE 4FFYL 2YA1A 3KLSA 3PP4H 2NY7L 1Q0XL 3CLFL 5TPWL 1SVCP 1HH9A 3ALXA 1CGXA 5J12B 3L3OA 3UTTE 1IILE 3QUYA 2FX7H 1OTSD 2H3NB 2BJML 2Q7YA 2VDPH 1N0XL 4K94L 3N1FC 3DMMB 5HYSB 5JW3L 2NY6D 5D2NA 1AP2A 1TNMA 1TIUA 4ZFOL 4MB5A 3QHFH 1QFHA 1WCBA 3QIWA 3QDJB 2EDDA 3LN5A 1JMZA 4ESKA 2AGJL 1UENA 2FHFA 4K55A 3SDCA 1F2QA 1KCSL 3OKNB 4ODHL 4U1IA 5EO9B 2XN9B 4IEFB 4JB9L 4JKWA 3IXAB 3NIFE 4YZFF 5CGYD 2AK4D 5ICZB 3TPUA 4LIQE 2PCPA 4JO3L 3CVHB 5GISL 1F8TL 3IXAA 4JDVA 1BREA 2HMID 5DJ2A 4IRJC 3SO5A 1IVLA 4IRZH 3SJVE 4Y4KC 4LLWA 5FO8A 5KTEL 3PGCA 4NUJB 5ACMA 3O8XB 2FR4B 4HMEA 5I8EA 4O02L 4QXTA 2NY2D 4YDIH 4PRHD 4LFHG 4O2FB 4PTTB 5B21A 4OCXH 3S37X 5I66B 3A0OA 4ORZC 1L7IH 3TN0C 5BV7B 2FATH 1RUQL 1FYHB 3ARGA 1YNKH 3ZDZE 5TJWK 3LZFL 4V2CB 4F3FB 4X6FA 2Y23A 4PJCB 3VG0H 3TZVB 2HJLB 1MAJA 4F9LA 2VQ1B 1JRHI 1ND0A 3OKYA 1T6VN 1UQSA 4LSRL 2QSVA 2D03L 4G9FB 1SQ2N 4LEOB 4KMLB 2JF1A 3H2WA 1NC4B 5JXED 4KWUA 4DGYH 4NYLA 2C7UA 3ARFC 4OCWL 1MCPH 1F8TH 1QLEL 4FQXD 4GQPH 2FZ3B 3SJVD 4X4YB 4JFFA 4Z77B 3OKKB 3MNZB 3DVFA 2BFVH 1T1YB 4YHLL 3EKCA 3B43A 3BQUC 4U6VH 4U1JA 4G42A 5CZVL 1F3JB 4L3CA 2P7TA 3B5GA 2IAMA 1KJ3H 1S9XA 3B2VH 3UAJD 1K3IA 4RFNB 2OQJB 2BSRB 3SOBH 1M7IA 2VC2L 3D25B 1B9ZA 1QBML 1JGDA 4S1DD 1C16B 4LHJB 1P5UA 4HCRL 4KRLB 1A2YA 4WV1C 1A7OL 1WV7T 3O0RH 3BP4A 2CPCA 3X3GL 3STBA 2B8OT 3BI9X 4PG9A 3RHWF 1I85A 4PGBA 4ZFOA 4AL8H 3AC0A 1PLGH 4KHXL 4MQ7A 4OSUH 3E0GA 4EVNB 2P4AB 5IB4A 1F02I 3TYFB 1MJ7H 1RHHB 3S3SA 1NBZA 4R7NB 4NT6A 3FQWA 4O4YH 3WUWG 3SKOB 1Z0NA 4E41E 3HE6D 3K4AA 2BZDA 3FRUB 4P2RD 4W4NA 5T1LA 1U3JA 2GTWA 5FF6A 2BRQA 4JZJC 4GSDH 4M5YL 2AJVL 4PJIF 2DYPA 4UI2A 2UV3A 2DMKA 2JCCB 3O3EB 1IGML 4R0LC 1EH9A 4GRWH 3S9DB 4KJPD 2VDQL 4O58L 4NM8H 1U6AL 5D6CA 5J0BA 2Q3AA 2P1YA 5E08L 2NR6C 1NFDE 1IT9L 4PGCA 1EHAA 1M7DB 1S7SA 1AO7E 2X89D 3LEXA 2VDNH 1CFSB 1L0XA 1NKOA 1CLOL 2EDNA 5EU5A 4KU1A 4WFGD 4WY7L 3DXAB 4P9MH 2VISA 3Q5TA 3Q3GB 4L9DA 1KV3A 1DQML 1MFAL 3MCLH 3CFEA 2A6DB 5JIPA 4X7DC 5C0FA 5HGHB 1L0QA 2C3WA 3MRCB 4ZQKB 3DX9A 1X5HA 1IKNA 3SBWC 5EBLA 2AERT 3SDAD 3RBSA 2IGFL 2GAZA 4KKLD 1IGYA 2AJYH 2NPLX 1I3GH 1IFHL 1V3LA 3JWOH 2V17L 1NAMA 4WV1B 5D7KE 4NKOA 1XIWC 2DICA 4WFHE 3GI8H 5M7QA 4CW1A 1G0DA 1S7WA 1CZ8L 4AM0B 5DJAA 2EC9U 1YMHA 2P8LA 2XQYG 1OF2B 1IAIL 2YMXH 5DTFB 1A6WL 2IH3B 4PJFA 3SE3C 2PYEB 4GMSH 3MOAL 5IEKA 1YMHB 2P8LB 2GHWB 1FZJB 1BMGA 4RIRA 4JHWL 3VWJB 4NKIL 3O2DA 4GXUN 1F3DH 3LRHA 1W8NA 3C08H 4OT1H 3GJFA 3GMPA 4XHJD 2I25N 4NRXA 1RZFL 3ZYJA 5EU3B 3NPSC 2BVTA 4HIXL 4HUKB 4N0CC 5MERA 3NTCL 1NFIA 3N1GC 4RWHA 4P23B 1NBVL 3H9HB 2EDFA 1DCLA 3I2CH 3ARBC 2CR6A 2QR0A 1IARB 3QG7H 3MRHA 3P11L 3U83A 4MNQD 4XWGL 1R5WA 1T21A 4K3JL 1XF3A 4R8WH 3Q1SH 3CUPA 2VOTA 5CBAB 3EO0B 5E2TH 4XVJH 4KJPC 4ZTOL 4X6CA 5IHLB 4ONOA 4CJ1A 4M7JH 5IMOB 4B50A 3OJDB 2UWEE 2DQHH 1N5AB 1EBAA 1SY6L 2P44B 5C08B 5TE6L 4MLSA 3KWWB 3TCLB 5L0QC 2CLZA 3VW3H 3NN8B 4NZRH 2LV4A 4OT1L 1F3JA 4N8VA 5F9WB 3OKNA 4U1IB 5L6YL 1EXUB 3VXOB 2IQAA 3VFSA 3DI3B 4R4ND 5JQHC 4D8PA 3SQOH 5C0JB 3I2CL 4R26H 4O51A 3VD3A 1HSAA 4ODXB 1CFVH 3BHBB 3QYCA 2HT2D 4CW1B 4XPFH 5IVNA 5CD3A 2YZ1A 3K1KC 3SGEI 5FB8A 4PGBB 4YHYC 3ET9F 3WNPA 5ID0A 2RQ8A 5F3BA 4GW1A 3WKML 2A0LC 1R5VA 3SDAC 5E2JA 3UZEA 2SEBB 3P9MA 1T80A 1PDKA 3D85D 4MNQE 5I1AA 2P8MB 5D8JH 1A5FH 3HNSH 1IEAB 4UQ3B 5GQBA 2CIIA 1AI1H 3R1GL 3OV6A 4YDLC 2DKMA 3HTLX 1LK3L 3GSNL 2KBGA 4LLQA 1Q9LB 2IBZX 2M2DA 3K7UA 1UWEH 1WZ1L 2YSSB 3PWVB 1J8HB 2E6JA 2DKSA 32C2A 3X3FH 1NGXB 1MRFH 4IRJA 1CD1B 1O0VA 1Q9WB 4N0CD 3O2DL 3RY6C 2BJMH 1K8IB 1RZ8A 2X2YA 4RMRA 1RUPL 4XXCA 3HN3A 3KYOA 4HGWB 2GW5A 1NC4A 3MV8E 1RK0A 4ONFL 5E2WL 5F88B 4TQEH 2XTJB 3V5DB 5JHLH 5B38G 4FHBD 2UVFA 5E94A 3VXNA 2NZIA 4RAHA 1HQRB 1ZHBB 1ZWIA 3QQ4A 4OCSH 3UDWA 1I9RH 2ADGA 1FVDA 2FIKA 4PRHA 5HD8D 1G9NC 4XP1L 1AGCA 4P2OB 3VXRE 5GXBB 5FYLH 4BK5A 2ZSWB 4G8EB 1GIGH 3IKCA 3RWJB 4LPUA 4HIJA 4PRBA 4Z0XB 3H3PH 1U8LB 4F9PC 5BOPA 3KPRD 3H6JA 3OR7B 4J2XA 4DAGH 2NY7H 3VFSB 4G3YH 4LLWB 5FO8B 1MI5A 4KUZH 3ZSTA 1SJVA 4OI7A 3ESVF 1Y0LA 4KVNL 5DMJB 1OARL 5FECB 7CGTA 4GLRH 1JPGA 4FQHA 3HE7C 1AKJB 1L7IL 4H8WL 5B4MC 5BMFL 5GGTL 3OTTA 1M05A 2EDOA 4NRZB 4Z7WA 5DRWB 5CSBA 5DEGA 1JV5B 4F15C 2ED9A 2VL5B 5LWYH 3LEYL 1PX4A 1FE8L 3NAAH 3H7BA 1G0XA 3MGOA 1XGTA 1YECH 4I0PA 5MP6H 1BBJB 1L9NA 1ZS8B 4FQJH 3AS1A 4YDJA 3BKCL 4OZGA 1N6UA 5T3XE 1YEHL 4HIHB 3VRIB 3NVQA 2VDKL 4G6FD 4GG6A 1D9KA 4IHOB 4PJGF 1DL7H 4G8GE 4V1DA 1FYTE 2FEEI 4GH7B 3B9VA 1REIA 1DFBL 3QZWA 1B0RA 1DLHB 5I71C 3QFJE 1HDMA 4QRSA 2CH8A 4U1GB 1IGYB 5DRXA 1AO7A 3R06A 2BHUA 2UYLA 4M48H 4MGXA 4O9HH 1NCBH 4JM2A 5GRXG 4E41B 4OZFB 3KXFA 4XH2A 5DC9B 2FD6L 3QHFL 5I75C 1XF1A 3RIFF 1A8JH 2V2WA 4D9RD 3LCYA 3L7FB 4IMKC 1HILA 1KJ2B 3MYJA 4NWUL 1WBXB 4HX1A 4NHUA 2X7LB 1WWAX 5D5MB 1B0GA 4P4KD 1OAYL 2XT1B 3PHOB 3WE6A 4OLUL 4HUMB 3C8KB 4JFQB 1BVKA 2M8XA 4J23A 4K3DH 4NHUB 2FBOJ 3JTSA 4XZUB 1T7YA 5J56B 3H9SD 3RVUD 2VZOA 4PB0H 2VLKE 3HPLB 5AEAA 3RJDA 1XH3A 1ZLVH 4JANA 3PHQA 5D7IB 3EO9L 3O6FB 4F33B 4Z7UF 3P0GB 2P8PA 3OZ9L 3TJHD 1XR8A 4Q9RL 4JREB 1X4ZA 3WN5C 5C0CD 3F6LA 3ZKMD 4ZXBD 4PJXA 3RWHA 2YUXA 3ZDXF 4AEEA 4F33A 2HWZL 2BHYA 5FA3A 1AQKL 1CVSC 2ZCKH 1S9KC 1KG0A 1BIIB 1TVBA 2K9UA 2J2ZA 2D3VA 1CT8A 5TQ2H 3V4PH 1LHZA 3EFFB 2YOCA 2YPLB 1T1WB 3RWCB 2VZ1A 3ZE2F 1X3DA 3LMJL 3NA9L 4JGMA 3PNWA 3A6OA 3IJYB 5FGBA 3RGHA 1CE1H 3BMWA 3PWUA 1JNLH 1RUKL 2IEPA 4CUCA 4XB7A 1Z9MA 1U58A 3SGDI 1SJHB 3X12B 3WLWD 1F4WL 4M9OA 5J1SC 1JZ7A 5BO1L 1P2CA 1VADB 3P4MA 5KAQF 1JPTH 4KHTH 3RTQB 1LE9A 4F37K 4YHOH 2PXYB 3QUZA 5A2JH 4HHAA 3NGBC 4I4WB 5IQ7L 5C2UB 3C60D 3QUYC 3FFDA 1P2CB 5I8CB 1VCAA 3QDAA 4Z7OF 1DVFA 4HKBB 3QISA 2EE3A 5JQ6H 1DEDA 1I1YB 1FNGA 2J5LB 3KPNB 1X4YA 3GMQB 3TBTA 4F57H 5KSBB 5FYKD 3UPAA 5GHWH 3CZFA 3LHPH 2PETA 5SWZE 3RWGB 6FABL 1TFHA 2ZOKB 1FGNL 3CCHA 4OZHB 4L5FL 2KQMA 1KT2A 4HIJB 3Q6FB 4M5ZL 4PTUA 1CFBA 2A9MH 5F89B 4Y4FD 1RURH 3IFPA 2VXTL 1MVUA 1QZ1A 4ZOCA 2Y7QB 4N0RA 2G5BA 3PG2A 2KL6A 3V5HB 3G5VB 3IDYC 1N5YH 2AW2A 1U8QB 2VXVL 1XGUB 4M8VA 5CCKL 3T77B 1AKJA 4W68A 4K07A 1NUFA 3E6HA 4NJ9L 3SDDC 1BQSA 2P24B 4ZPVA 4NO0A 4OJFH 2RAMA 3DROA 3BPOC 4QHNA 1UWXH 3VD9A 1PQZB 4U6VL 3CUPB 4H8WC 5IB1B 4YXKH 2NZ9C 1EV2E 4Z7WB 5GS1C 3AXLA 2EKSA 4NQEE 4L4TA 3LN4B 5CD5C 3MRIA 3TN0B 5BV7C 1A6VH 2X70B 4WU7A 1MJ7L 2FGWL 5C0AA 1RD6A 4LDLB 3CSYB 4NQVB 4Q97A 5CP3H 4WHTA 4QXWA 5E8NA 2GTZB 1KCVH 4Z8FH 4PP1C 2VXSL 2Z8SA 1U8MB 1K6QL 3ARED 4ZSOB 4XP6L 3P77A 1HINL 1R3IH 5D7JD 1PZ5B 1R3HA 2Y1VA 1BHGA 1HHHA 1JZ3A 4NQED 4WHYG 5ADOH 5E94B 1U8MA 3O3UN 2OR8A 4PBVC 5CJ8A 4JFDD 3LRSA 3V6FB 3W0WD 4WHDA 1BQHB 4XP9H 4ZO7A 3RVWC 1F4XL 4LPTA 4O2CA 5K9QG 1HEZA 4KDVA 5HHMD 5F7UA 1WAAA 4PD4J 5D2NB 1MELA 2ITDA 3QEUB 2WQ8A 5DRNA 1IM9B 2R2EB 5DHVA 3B9KC 2ZUQC 3F7PC 1RIHH 3FTGA 3QDMB 4PG9B 4NQSB 2HA1A 2XG4A 2V17H 2XN9E 1GGBH 4OZIB 1CLOH 3BPCB 5F7DA 4PRAA 1OB1A 4QY8B 4F57L 1MCDA 2BVQA 4KKLC 2EIEA 4EN3A 5HJ3B 3CVHA 1IEAA 2GAZB 4N1EA 2OK0L 3UTZA 4K94C 1NCUA 1JRHL 5IJKA 2VE6B 3DVNA 3OXRA 5ACZA 1M6OA 1QHOA 2VXSH 2G5BB 1MI5B 2A73A 2YBRB 1T04A 3GEWB 1CFQB 5ETUB 4LLMB 5EU7E 3MV8D 2CK0L 3W0WE 1JWMB 4OF8A 5C0BE 1QHPA 4LPWA 5ADOL 3GI8L 1FNSL 5HYSG 1AO7D 1QUNA 5ITBL 5D1ZD 2GK0B 3WFHA 3U4AA 1U8PB 5D72H 3VFRB 4C83B 3O8XA 2FR4A 3EFDH 4YPJA 5ALCL 3VH8G 5H8DA 1HHKA 4QHNB 1OL0A 4IS6B 1XMWA 1ZTXH 5TDPB 1F6AA 1E4WL 3MOQA 3LN9A 4UOW1 4P3DB 4XVUD 4XP5H 4M7ZB 5JXAL 3MUGA 3U6RB 4AEIL 3X13B 4EDXA 4WJ5B 2HJLA 3ZKSD 4LPCA 5E2WH 4FQIL 1OLLA 1RY7B 3ETBF 3TYGH 4MXQC 4K8RL 2P5EB 2DLHA 1E27A 3KNBB 1QBLH 4JPIA 5HXMA 1ONQB 2ZG2A 3RRQA 1TJIH 5A1AA 1MH5B 4FN0A 4MQXC 1CGWA 3DMMA 3ARZA 3QPXH 4OZHA 3MRRB 4G7YH 5E2UL 1ZLWH 3VXUB 1JPGB 2Y6SC 1NLBL 3V79C 3VWKC 1IEBA 1WF5A 5JW5A 4X8JA 1C08B 4NQSA 3P73B 4I9WE 1V05A 1OTTD 4ZO9A 4XPBH 5HI3D 4XNZB 1OWRM 1CU4L 1S9YB 5KVFL 2J5LC 2EDLA 4JM2C 3O81A 3C87A 3ULUH 3HPLA 4H0IA 4NCC2 4ODHH 2PTUA 4MQTB 4D8PB 1F13A 1BF2A 5I0ZA 2FJHA 1HSAB 2VLKB 4ODXA 1ZV5A 1XZ0A 4L29B 4X7SH 4AH2B 2AAVA 2C5DC 4HKXA 2BY3A 3STLB 4OFIA 1I4FA 3BH9A 4NRYB 5L88L 5MENB 4U3CA 3AMKA 3WD5L 4FQJL 4MAYA 1WEJH 4FQCH 3C5JA 4J7RA 5EBMA 2JB5H 1CLCA 5EBWB 4F80A 4U1HA 1U95B 2VLRD 2B20A 2QKIA 3D0VA 3WFZA 1CDHA 1J11A 3RY5A 1JGUH 1ZT4B 5I1EH 4PJIB 3T0ED 4UINH 2ESVD 3B9EA 3ZZ1A 4D3CH 1BX2B 4CVWA 3U48A 3GHBL 4U6HB 4XC3L 1IAIM 3R06B 2DL2A 2YHGA 2YSSA 3SKNB 4KI5C 1MUJA 4Y8AA 3SEPA 4HWZA 3PDGA 3QEHB 4XP4H 2XQYK 2ZP0T 2DD8H 1P53A 2AQ2A 1XGQB 2FX9H 5DMGC 1I8LA 1TQBC 2B1AH 3OKLA 4K3HA 4LSTH 3GKWH 3EHBC 3V5HA 5DEZA 4ZQKA 4K8RH 4DZ8B 1AJ7H 2DQEH 4Y5XA 3RNKA 3WCYA 5HHXL 3QA3A 5CSGA 1EEYA 4WI6A 2ZSVB 5GZOD 3TZVC 5T1KD 1FVDB 4F7CA 4WO4B 5CD3B 5F7DB 3MBEA 4TVSa 1A6ZA 2V9RA 3TCLA 1UEYA 4Y2DC 1IAKB 4OCSL 4J1UA 2J8UB 2NXZC 1GPOL 1T1ZA 1PQZA 3WNMA 3NH7H 5GRUH 5CEXB 3KPMB 1J7VR 3MA9L 1OARH 1AH1A 2VXQH 4QRUB 3HNVL 2CK2A 3GJFH 2R0KH 1KF9B 1Q1JL 3DX6A 4TRPH 4KDWA 2E9JA 3WO4C 1J18A 3O3EA 1FHGA 5ISZD 1MWAH 1ODAA 4OFPA 1CI5A 2BSSB 3A67H 5DWUL 4Z0BL 4H1LA 2IG2H 5E1AB 3UROR 3SCMD 4W4OA 2WBJC 3KGRA 3WXWL 2APFA 1INEL 2K3TA 4WI8A 3QFJD 1CIUA 4WNQB 2O26U 1JYXA 1D6EB 1MCKA 4Z76B 4ZS7L 3G5XA 3GIVB 1RFDL 4NRZA 1KGCE 2GSIA 5CIPH 5EU7C 4Z78A 4URTB 1UWGH 3PABA 1HH6B 2Q20A 3MV01 4LNRB 4N0UE 1EFXB 1DBJL 3RTQA 2KZ1B 3GBML 3U1SH 4L3CB 3VRJB 2E7MA 3F65A 4NNPH 4PJ8D 4FS0A 1U3HB 1WC7B 2F54A 1YEGL 1NC2B 35C8H 2X89A 3SDDA 3ZE1E 5EIIB 4IJ3C 4DEPB 5EC2B 4FTVD 1VEPA 4EDWH 5T5NG 1X5GA 3RWDA 4N5UA 1G7LB 1NEZG 5T3ZH 4PJAB 2X4NB 3I3EA 4RFEB 1S7WB 1W2KT 4BUHA 3DX7A 4ZUUA 4LSSH 1T5WB 5EA0H 3MXWL 1AE6H 2NXYC 2YD1A 4X7TB 4LVOC 4YR6B 5EC1B 2VLJB 8FABB 5HY9B 2FB4H 1AGCB 4AEHL 3ILPA 2WAHA 4BH8A 1UZ6F 3ARDD 5GJSH 1HNGA 1P84K 4XPHL 4WWKD 2A9NL 5SX4H 5ID1B 4Y1AE 1NAKH 3A6BH 2V2TB 4RNRA 5E6YA 2ERJC 4M03A 5IT2L 4L4TB 4YBQD 4OLYH 1EGJH 5INCB 2FECL 1A4KA 4U33A 1LEKA 2ID5A 5DTFA 4LCWB 1HHGB 5KS9B 2QQLL 3PWPA 2H9GB 3BJ91 4U7KA 3W0WA 4ELMF 1CFQA 1LO0H 1P69B 5C0NC 1XR9B 4R3SB 2EECA 1QFWH 2CDFA 2HTLD 3MJ9L 1NANH 4X4ZA 4TUOA 5EOQL 1QNZH 2AVGA 1TCMA 2BY0A 2ZUVA 5DZOA 3O2VH 2FSEA 1KIRB 1X6NA 4DOHE 4DW2H 3GRWA 2VITA 4L3ED 1MWAL 3B9AA 2CLVB 4DTGH 3IJSB 4JZNA 5KSUB 2XZQL 4XP6H 5GGRA 5KN5A 1XAUA 3QEUA 5IJKC 3T3ME 1FLRL 1I9IH 1MFDH 4TNVF 5JPMA 2YD8A 2Y06H 4ELKB 3MRRA 1QSFD 5CJQH 5F71A 5I74C 2JJWA 4JM2D 3IS0X 3WLBB 3CFBA 3LPWA 4FNLH 4P2QE 4XI5D 1PSKH 3RGVB 4PRID 1UVQA 1KENH 3MV8A 2XACC 4X0KA 3KNBA 1CD8A 4JPIB 4MA3A 2VQTA 3L3JA 3ARSA 3O6ML 4XC1H 3DXAE 3BZEB 3BP5A 1IC1A 1KC5L 3RGVA 2J4WL 3FFDB 4BFIA 1NFDA 1FG9C 1FL3A 1KXQE 4YHOL 4JANB 3RTQC 3OAZK 2VB5A 4PJBF 1Y0LB 4P2RA 3PGDB 4H26A 3VI3F 3IKCB 4U1KB 3D3VE 4WW1B 4UIMA 4LHUD 2C1PB 2HKFH 2KQNA 4JDTL 5D7LE 4J1UB 2ZJSH 1D6VL 1KPVA 2VDPL 5JDSA 4WW1A 3IETA 5ACLA 3UPCA 1T7WA 4ZXBA 3TA3B 3SGKA 4I5BB 2V2TA 5FAAA 4ODTL 4FQHB 2CD0A 5FA4A 2CKBB 3QNXB 3BUYA 3P4NA 3G9AB 4P46D 1BPVA 1A1OB 5EZLA 2MJWA 4PP2B 5JUEL 4PY7A 3MLTA 5IMLA 4U2ZA 4O00A 1INQB 3EGSA 1UQSB 1X44A 2C9AA 3KJ6H 4JDZB 4FG6D 3STLA 1C12A 3HS0A 1WQVT 1P1ZA 2XI9A 5EG6C 3LDBC 5D2LE 3ZKND 4YC2C 4GSDL 4M5YH 3QIBC 5T3XD 1GL4B 2I5YH 5AUMB 4XBPA 4MNHB 3D3VA 5HDLA 4KK5D 1OGAD 3AS2A 4GG6B 1KJ3L 4QXUH 3MUZ1 4DKEL 2Y36L 4F2MA 3O2WL 2OLDA 1F45A 1QNZL 4HKJA 1HXMA 5F44A 4OB5L 4OFDA 4P5TB 1MREH 1MJ8L 1JI2A 3HNSL 3MJ8B 4JM4L 1OP5K 3HHRB 2WBJB 1S5HA 3T3MF 1G9ML 2X7LA 3ZHLA 1WUNT 2VIRB 3MBEB 4XP9L 5D6CB 3OBAA 1UC6A 3GRWL 1LE9B 1Q72H 4EKXA 5K9OA 4M7KH 1G7MB 4RFEA 3MJGX 3FT2A 1G7IB 1YEFL 1DANU 4NIKB 4H5SB 5E2UH 2VIRA 4OBRA 4LLYB 4N0UA 2JCCE 1MHHA 5ISZA 1J1OL 1OGTA 2WIIB 4XPTH 4HX1B 5CP7A 3RNQB 5C0IB 4JDVB 4H1LB 1OSPL 4ZPTB 5L2JB 1S9YA 1ZHNB 4YHZL 4MMZC 4P4KC 2XWJA 4Y4HC 5GIRA 3V4VL 2I5YL 5I1AB 1PJ9A 5EZOH 2O5XH 4FQIH 3HZVA 1YN7B 1WVZA 3BE1H 5FYLL 3RWIB 2A0LD 4B0MM 4LSQL 4KMTH 4EZMA 5C0BA 3KPMA 1E4KA 3BP7A 4JQIH 5C8JA 1YEIH 3G6AA 5FYKE 3IDUA 1QR4A 3RY4A 1A6UH 1ZK9A 3V9FA 4HAGA 1DUZA 3QCUL 5DA0B 2VAAA 4FTVA 1PW3A 1QO3A 1K8IA 2DYPB 1LP9A 3BZFA 4HCRA 5DFVC 4F9LC 4YHIA 3T2OA 3HB3C 1VENA 1FFOA 1EJOH 3MX0A 4HGWA 2B4CC 4N8CH 5D7KD 4NUGL 5JO5B 2ZNWA 4P5MA 2YUVA 2BOBA 4NP4L 4D3CL 2F58H 2H2PD 1JUFA 3QJFA 2W0LA 4U6HA 4GG6F 5JW4N 4NKMA 4S1RL 3ZO0A 1AY1L 2ADIB 5D7JA 1KEML 1ZT7B 3WO4B 1ORSA 1RZJH 4HWEH 4NO5B 4KQ4H 2ZSVA 2ZUWA 3QDGA 2PF6A 1OTSC 1I9JH 1T0MA 4J3TA 4J12A 1VFBB 3AB0C 3RPKA 8CGTA 3BO8A 3BPNC 4NZDA 1LDPL 3HMWH 2WBJA 1VFMA 3WIFA 3D2UD 1FCGA 3WUZA 2QL1A 2CSPA 4AQ1B 5ENWA 1NCAL 1NGQL 4ZUTB 4ISVA 1F42A 3MCKA 4KK8C 4POZC 4KPHH 1HEZB 3RDTD 1Z5LA 5L2KA 1YY9C 3UTTB 1UA6H 2J6EL 3OL2A 4WV1A 4X6DF 1PG7L 4PJGB 5DJ0B 4ZAKD 5SWSD 1QRND 4H1LG 4PJ5B 1I8MA 3D85A 4KUZL 2VDLH 5SX5H 1P7QA 1KGCD 2K7QA 5D9SA 3EYUH 5GS0L 1ZVYA 3L5WA 2WW8A 3BKYL 4PJEB 3ZE0F 3V7AE 2OP4H 2LFGA 1CFNB 3MZTA 4EUPG 5T3ZD 4EQ2A 1NAMB 1P4BL 4ZD3L 2JCCF 3QDME 3CMOL 1BQLH 3K8MA 4XCFL 1CL7I 3PABB 1P7QD 3KS0H 4IS6A 4LCCC 5MEQB 2VZ3A 3UO1H 5JR1H 3F62A 2AK4A 1ND0B 1QBLL 4NQUA 4PLJD 1HKLH 3T2PA 2NY0C 4LAQH 3SO3B 1NDMA 4LKCA 5BVJA 5BS0E 1DLFL 1H5BA 4HBCL 4UBDC 2IALB 3MSPA 4OGAC 2VSCA 3RVWD 7FABH 3ULUL 3QRGH 3S3JA 5C3LD 5CAYB 5JXEC 5MENE 2VXUH 1T3FB 4OQ1A 2DQHL 2R29H 1R5WB 2YZ8A 1YPZB 4P2CG 4Q9QL 4JFEE 4JN1L 2Q87A 3U0WH 5FGSA 2YRPA 1HHIB 2MQ3A 1VKXA 3LKOB 3REVB 5SWZA 1EDQA 1YQVL 4NUGH 4NQVA 2DLGA 1U8IA 4NKIH 4PGEA 1U42A 3HCVB 3WSQL 1QOKA 1N64L 1TPXB 4TQEL 3T0EE 1N5AA 5SWSE 1DVFD 3HCVA 4JFED 3FFCA 4UMGA 4GG6E 5E0QA 1EUTA 5T1MA 4MCYB 3LH2L 2IQAB 2AGJH 2J88L 4EXKA 3PP3K 4HJJH 1X5FA 2GT9B 4HWBH 1DLFH 3T0VA 5ACZB 2NX5D 5DC4B 3T77A 4XWGH 4ZUTA 4OD2A 1OAQL 5DLMH 4MD5B 5ITFB 4E42B 4MLIA 3UX9B 3BIBX 4QOKA 3P0VH 5IT2H 1INQA 1T22B 4JQXC 1T7VA 4PRAB 4P9HL 4R96A 3U0WL 4JFZL 6FABH 4XXDA 5ID0B 4X5XB 3OXRB 2H9GA 4MCZB 5JIIA 2B2XH 3HZVB 4DKFH 3IJYA 3HAEA 2P45B 4KI5E 5DMIL 1U8NA 2Q76A 2FX8L 3O2DH 1I7UA 4NRXB 4D0DB 4P2OC 3BHBA 3J7HA 3VW3L 1L6XA 2IC2A 4UT6L 5DD6A 5MHSE 5J1AA 3VGEA 4LLVA 5CKGA 4N90D 1URLA 1FZJA 1KLUB 4PJEE 4HK3J 1BFVL 1GRWA 3CC5A 4LMQI 1IGTB 3IAQA 4WGVB 1MCFA 1M7DA 1HHHB 2BK8A 5IR1A 2J88H 1BJMA 3OAZH 4JFFD 4Z77A 4U1MB 1PZUB 1JPTL 4EI6B 2JLLA 2B4CL 4RGNB 4K7PH 1RPQA 1YUHA 3MLXH 1WJ3A 4WI4A 1DR9A 4MA8H 3DRQB 5FIEA 2QQKH 3U7YH 1T7XA 2Z8VC 5IUSA 4JR9L 5HYEA 4JFYB 1EHLL 2QSCL 4G5ZL 1UVQB 4TTGA 3NIGF 2FNBA 3CSGA 2VERN 1FO0B 1PVHA 2ZUYA 4PTUB 5F89A 1CD1A 3S96B 4XCCH 5HHPB 5H2BB 1FGNH 3BDYL 4UV7H 1NCBL 4OI8A 3CDYA 4X5WA 1ZHNA 1U3HA 1C8PA 1MY7A 4YC2B 5JXEA 1QFWL 3UBXG 1QA9A 2Q86A 3RGVC 1AGEB 3MLRH 4X5WB 5DHYA 2D2OA 1XGUA 4ZNEE 4OZFA 1MHCB 4I48B 2DJUA 4G9DB 3EOTL 5C0JA 1JGDB 3QHZH 3G6AB 3EIFA 1S7QA 2H2PC 5JW5B 3HMXL 3MRMB 2BOCA 1A2YB 5K9JH 3A6BL 3MMEA 5IHUL 4EN3D 1I9IL 4JO2L 4KTDL 4XXCC 3WS3A 1FAKT 5FB8B 4JHBA 5T1LD 4U1NB 2YPVH 5E1AA 3D1MC 4LLAA 3TA3A 3T2NH 1OP5H 3U1SL 1Z9SA 4N90E 5K93A 3VG0L 4MA8L 3SDAA 2OJEB 4IRZL 4QHMA 4YO0B 4NUJA 4GUPB 2Q8AL 1FL6A 3TBYB 1RIUH 2D31B 3LQAH 4UDUA 5J6GB 1M71B 1PKOA 4LSUL 1NCDH 2HP4A 5T1DL 1D5IL 1PY4A 1CLYL 4K9EC 5T3ZL 2HWZH 4MQXD 1FFOB 3OAYK 5AWNH 1MFCL 5HHNB 2OTWA 2P5WD 5D1QA 3WFCH 1OD9A 3KPSE 3KYKL 2GJ6B 3B4NA 3CXDL 4L4VD 5JORB 3TIEA 3U9PL 4JJ5B 1LO3H 5E5MA 1TMCB 1FYTD 1MLCA 3QUYD 4AK1A 2ATPB 4JFOA 3MRPB 3BGAA 1YMMD 4NWUH 3HE7D 4UILH 1CE1L 1VKXB 2EE6A 1HI6A 1XT5A 1S5HB 2OI9B 3GMNA 4XPAL 4M02A 3EJZC 2VQUA 1WWCA 4XGZA 4X6FB 4PRHE 3RWEB 1A9EB 4P2QD 3GMOB 2PYFB 4NQXB 1JWSA 2Y07L 4MD4A 1A3QA 3K1DA 4CDHA 1WC7A 2F54B 2FJFB 2VDRL 1KC5H 1NBYB 5JW4R 4RSVA 1GVIA 5H2BA 4HPOL 2E8YA 3GSXA 4RGMC 4ZFGH 1KBGH 4F9PA 4BQ8A 4K71C 1FQ9C 5EOQH 2YK1L 1JPST 3KXFB 4PBXA 5TFSH 5CJ5A 1FN4A 1JK8B 3NCEB 4NN6B 5JPNA 3BP5B 4I1NB 1BLNA 2IPKA 1IC5L 5T33H 1OSZA 2B1HL 5FM4A 3E2HB 4K3GA 1CFNA 1H3XA 1QR1A 2IJ0C 2FHCA 2HFFA 5MENA 1DE4A 4WDIA 1HYRC 4JFQA 4FXLA 2LTQB 5C0CE 3BSZL 1CIDA 2FATL 5AD0B 1IBGH 4R4FH 5EU6B 3BT2H 1RUMH 3QAZB 2IANE 4UIMB 5D1ZC 1LE5A 3MRFB 3MV11 3DX6B 5D7SL 1NBZB 2QHLA 3H42L 5KSBE 5E56A 2BVPA 4IMKA 3WV0A 3H7BB 3DUHA 2Q76B 2IALA 1NGWA 1K8DA 4NP4H 3C5ZC 4L3EA 1WIPA 4V1DE 4F58H 3FFCD 1OVZA 5E6ZA 5F88A 2OCFD 4OM1H 1KXVC 4U1LA 1B0RB 1DLHA 2AKRA 2H6PA 2HVJB 3AS3A 4PGDA 4XWOD 1EO5A 1JF6A 3B5HA 1C7TA 1G7LA 1LO5A 1I9JL 4R9HA 4O4YL 5C0DB 3AXLB 4YDVA 2W92A 4NJAL 5D5MF 3B2VL 1ZANL 4YFDB 5HHVH 1U58B 3MFGB 1I8MB 2EDXA 5CJXA 3LN5B 3U82B 2RIKA 2VMFA 2VISB 3OGOE 3WNNA 2ITCB 3GMRA 1R0AL 3RU8L 3TIDA 1RV6X 3WLBA 5H35A 2L4OA 4Y19D 3KPLB 2Y5EA 4M4RA 1R3JB 3BPNB 4HMCA 1U36A 4XMPL 3SE8L 3O11B 4CRPA 3Q5OA 2R0LL 4AIXA 4H20H 2P46B 1FNGB 1U8JB 5CJOH 3HG1A 5KVFH 3O6KL 4X6BB 4XBGB 2VSDA 5IROA 5KS9A 3HUJE 4R26L 3RIAK 1SEQH 5E2VL 1YEFH 4UQ2B 3O6FA 1RVFH 5GSRA 3S4SB 5DQ9B 3IFOA 4JJHA 4XCNA 2GFBB 4RNRB 3K2UL 4Y4HD 3W5MA 3PGCB 2GYSA 2R1XA 2VH5H 4F15B 1O7SA 4NNXB 1TCRA 3GDBA 3VXSD 3B8SA 5DZLA 4GAJH 4NO0B 2NMSA 3K81A 3IJSA 4JZNB 5HHVL 4XVSL 1KELL 5EFIB 2XKSA 3ZKQD 5INCA 4MVBD 2AI0L 3I3BA 3QULB 5HD8C 3B9KB 3H3KA 4YBQC 2A6KA 4RISH 1QQDA 3SY0A 2X9WA 3O9WA 3LSOB 5AAWA 1JCKA 2A38A 5AZEL 3Q1SL 3BISA 1I1FA 4X6CF 4XMKH 1EZVX 2WP3O 3V8OA 2J6EH 4RIRB 4Y5VC 4WO4C 2D7OA 1MNUH 4FQ2H 3DRTB 1EK3A 2JJSC 1S9WB 1KYOK 3ARDC 4GMSL 2AEIT 2OZ4H 3K80A 2F15A 2XN9A 1YEJL 2NXZB 4F7EB 2WWKT 5DSCB 2VLLA 5D71L 3CGTA 3SE4A 3Q2CA 4KRPB 1S7TB 2VR4A 4Z7NE 3KYOB 5F1OB 2R56L 1G7HB 3V6FA 5JPMB 4PBWD 2HRPL 5C07A 4I0PD 5IVZA 2OL3A 4AEFA 1IKFH 3I75B 4HZLA 4KROD 1ZXQA 1I9RL 1E4JA 4ZUVB 1UWGL 1DTUA 2EDEA 3QO1A 1PZ5A 4JFPB 4MJ5A 3DX9B 5D6DC 5E9DD 5M94B 1ERNA 3ARGD 2D4DA 1NJ9A 3QXVA 2UZYB 3OF6A 4JKKA 1Q9OB 1MCOL 4Z7VE 4BM7A 5KZCB 3WHXB 3EW3B 2A77L 5CKAA 4N8CL 4P99A 5GS2H 3MJ7A 2N56A 3OB0H 4YPGA 2A6IB 3ARRA 2Z8RA 4GAYA 3RVUC 5IWLC 4M1CC 3VFTB 3HG1B 1NEUA 1LVEA 4MAUH 4DKFL 2H32B 4JLRA 3VGHA 4Z7VA 3JXAA 4HF5L 2FWOB 4FP8L 4U1KA 5SWQA 1KOAA 5I0DA 4HXBH 1CU4H 4AMKL 4KTEL 3BWAA 4G80B 1KTLB 5DC0A 3DHMA 3V7AG 4DUWA 1E4KC 4MJIA 2CO7B 1MVFA 4HC1A 1HI6B 5EU3A 3DBXA 1LNUB 2H1PH 4JFYA 5DVNA 5IB2A 3BXNA 4YDLB 2WUCH 4NKDB 1JWUB 2DQUL 2NX5E 1MCEA 2YD6A 3F5WA 3CFJB 2DIAA 1N4XH 1H3PH 5GGQH 5H94A 4WW2F 2EIDA 4QRRB 3KPRE 4EN3C 4EUPH 3NGBB 4OZGB 3BH9B 4NRYA 4ZS6D 4A2MA 2V7HA 5D2NE 3GK8L 2ICWJ 5IFHL 1C5CL 3HRZB 1FRGH 4K2UH 1TZHB 1MAMH 1WBYA 2IANA 4HQQH 4MDJB 3KPNA 1RZ8B 1SJEA 5GGRB 1UACH 2RR3A 4ENED 5CBAA 1WCBB 3QEQB 4F8QA 1BQHA 5I8OH 3DUUA 4HIIB 3MCKB 1IAOA 4MAUL 2XY1A 4WUUD 2XZAH 2I24N 4PJIA 3KWWA 4XBEH 5C9JB 1MLBA 3BQUB 4DTGL 2Q8BL 4IBLT 1YY8B 2HTKC 3UTSD 1FVCA 4PJHF 3IAPA 1IAOB 4GKOA 5EOTB 1BD2D 3ARVA 5C09B 4X8JB 3HI1A 3IDMB 2VLRE 4X9IA 3L3JB 4BQCA 4LU5H 3HMXH 1A4KB 4LEXH 3ME0A 1TVDA 1JF1A 3FO2B 1TJHL 2YD2A 1KENL 5J13C 4JY6A 2NY4D 4UQ2A 4BQBA 4OLYL 1DDHB 4L3AA 3LQZB 5FYJD 1A3RH 1A7QL 1OM3H 1RZ7H 4XBGA 2H32H 5MEPA 4BFEA 1T04B 1MCOH 4KVCL 5BVJB 2B2XL 3G5YB 4QHLB 4BQ9A 4G5ZH 1IQWL 1YN7A 3VGDA 1I1CA 1ZHLA 2GITA 3GMPB 2JK5A 4OGZA 3MC0A 5K9KB 2VDML 1NUNB 3C2AH 1N6QH 3I6KB 4RQQA 4X4XB 4PTTA 4RMTA 3EBAA 4HK0A 4OZ4B 1CVRA 2HT4C 2A6KB 1A6TB 3OXSA 3BZDA 1TVHA 5KJRH 4ZMAT 4OTXH 3O45B 4JFFE 2DTML 3V6ZA 4S1SL 1EHXA 5B22A 4X4YA 3QHZL 3O4LA 5E7BA 4TVPD 3V0VA 5SWZD 4O2CB 4Q6YA 5CMAA 1D5MA 3ZDYF 4Z7QE 1LD9B 3PXHA 3VFVB 5EWIH 2UVEA 2DDQL 2DQIL 1F4HA 4W70A 3I6LE 5D1QD 4I2XE 2OR7A 2VDRH 2RB8A 1T83A 5MP6L 1FRGL 3E6FB 4QEGA 3Q6GL 2FX7L 1I1AA 1FBIL 3JWOC 1CDBA 4XNZC 3LOWA 4U31A 3QIUA 3BIAX 3ULVE 4IRSD 2EXWD 5JNYA 4OLWH 3JUYA 4LSPL 3WDJA 3RWDB 2I9LB 3NABL 3F6IA 4XNUL 1I1AB 2IH3A 4PJDF 2YRLA 3P0YL 4GKNA 4TVPE 3HRPA 5IEKB 2WIIA 4KHTL 1CTOA 2KZWA 5IF0A 4JB9H 3DOSA 3IFNL 2RBLA 3D39D 3EZ8A 4IRSA 5A3ID 1QEWA 1CGUA 1ACZA 5CJXC 2O61A 1FE8H 2XIDA 1A6ZB 5J3HD 1DBBH 2DM3A 4WTZG 5FYJL 2AJSL 1G7QA 4DVRL 1RSFA 5AAMA 5C0RH 2BSTA 4U1LB 3UAJC 2ILLA 3S3PA 5EFIA 3NFPA 4PLOB 2IGFH 4NO3B 4OZIF 3DNKA 1WFUA 3TV3L 4S11A 1N3NB 1OSPH 5GRVK 4WHTB 5F1KC 3GHEH 5B3NA 3LIZH 4U1SA 2EH7H 3MJ8A 2BSED 3LB6D 5IESH 3V4PL 4MJ6A 2D7QA 4HS6B 4FFWC 1JHKH 4MNGA 5BV7H 2EKSB 1TQCC 1J0YA 3PL6A 1RZGA 3L1OL 4FQ1H 1QFWI 3CLFH 5LAXB 5DDHA 2NY1B 5MHSD 2VYRE 3S88H 5CEZH 4ZO8A 3JWNC 2IANB 1D5IH 1ORQB 1UH2A 4LVNB 3HNVH 4RAVA 5INDA 3VFWB 4U1MA 3P0YH 4M1CD 3PWLA 4JPKH 1Y18B 3QQ4B 4ZSOA 2ADGB 5JW4Q 1YY9D 4M7LH 3BSZH 3QNZB 2C7UB 1JPSL 4RDQF 3BN9C 4IOIA 3EJZD 1I3RA 3ULSB 3B6SA 3RX7A 3O9WC 3X12A 3QRFM 1INEH 1MCHA 5FGRA 2X10A 1CR9L 5IV2A 2MKWA 3F12A 3VMPA 2Z35A 1F4YL 4LKXA 3T2QA 4IOSD 1KT2B 5F7FA 1G9EA 1KTLA 5FHBH 5DURD 3ABZA 1Q0YH 5F8RC 5L2KB 1DSFH 1VPOL 4GAFB 1TETL 2W65A 2NY0D 2YD7A 3SE4C 3WKNA 5C0CA 1YEEH 4FFYH 3KPSD 1IRAY 2ZUQB 2FBJL 1NDMB 4LKCB 5CGTA 1VACB 1YEKL 4OIAA 1G6RL 5D1XA 2P8PB 5JOFB 3QXAB 4LGSB 3ORJA 5IF0B 5TF1L 5DYOA 1MJUH 3F58H 4DQOL 4NZRL 4P5KB 4Y16B 4NOFA 3EYVA 3QO0A 3RVTC 2V7HB 2DBJA 1S9VB 3LSOA 1X5ZA 3TO4D 3C6LB 2G9HB 2XWBA 3DGGB 5EU6A 2CRIA 3PWUB 1S5IL