5T3ZD

3.5 angstrom crystal structure of a fully and natively glycosylated bg505 sosip.664 hiv-1 env trimer in complex with the broadly neutralizing antibodies ioma and 10-1074
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
229
structure length
229
Chain Sequence
b'EVQLVESGAQVKKPGASVTVSCTASGYKFTGYHMHWVRQAPGRGLEWMGWINPFRGAVKYPQNFRGRVSMTRDTSMEIFYMELSRLTSDDTAVYYCAREMFDSSADWSPWRGMVAWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Natively glycosylated HIV-1 Env structure reveals new mode for antibody recognition of the CD4-binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 32
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2016-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t3zD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t3zD01
1GOFA 1FPTL 1ADQL 2X4TA 4Q0XL 3L3OB 4P5TC 2P7TB 5E7BA 5F7DB 2YUZA 3WDHA 1R3LA 4U1SB 3QIUD 2MHAA 1MCWW 3FQRA 3FO9B 4XPGH 4X6BB 3GMLA 1G1CA 1RIVH 3VJ6B 3G6AB 3IVKB 2H3NB 3O6LL 5FYLD 2BRRL 4I77H 4L29A 3OAYH 4OLYH 4TTDC 5DVNA 5SV4A 4QHMA 3QUML 3KPSA 3ARBB 3U48A 5JZ7D 2DKUA 2BNQE 4JFEB 4D9LH 4F3FA 2N7AA 3DETC 2MQCA 1G6RL 3FQNA 4PJFB 4J4PA 3ZKND 3V5KB 1RJCA 4LCUB 3GMMA 4EUPA 5IHZB 4J6RL 4HG4K 5ESAB 5CSGA 3QG6A 2B8OT 1O7SA 1OAUL 4PREB 4FQ1L 1YQ2A 1H0DB 4D9QD 3L6FB 3FO1A 4X98A 4YK4B 1NDMA 4JG0H 4NQCE 4UMGA 2CMRH 2OJEA 2FWOA 3SDCD 1S7QA 3V6FA 5DJAB 5C3TA 3O9WA 1FC1A 1Q9KB 5EOTB 2UWEB 3KYNA 3VXOB 1J1PL 3GSQB 4QXGH 3NGBC 4OFIA 3VFPA 3QUMH 2GT9B 3QWOB 2A6IB 2FIRT 3LN4B 1AIFA 4I13B 4DZ8B 2FATH 4P23B 4PRIB 4H25B 4RNRA 1EGJH 3CPLB 3TVMA 4PJHE 2W0PA 4P2QD 1JK8B 2R2BA 5FA4A 3DX7A 3UDWC 5D7IB 1QHOA 1OAUH 2YMXL 1V5JA 4HUWA 4XBGB 5F8RC 1OTSD 1EEYB 3O3DB 4Q9QH 2VDKH 4LNRA 3EUUA 4I3GA 4AL8H 3CFJA 4N8VB 4ERSH 4P59H 5D7JD 1E6OH 3F8UB 4PJ7F 2QL1A 4XCYA 3SDXA 4OUUA 5IMLB 3LKSA 4LF3A 5EUOB 5JA9A 1BD2A 1YEFH 4FZ8H 5C7XL 3O6KH 1TNNA 2YRLA 4GKNB 1R3KB 4L8BA 3RDTA 1DFBL 1G9MH 2GI7A 3QDMB 3ZDYF 4D9RE 3NZ8A 2GJJA 3S96B 2AI0L 5I1EH 5JOFB 1NCCL 4U1KA 1R0AL 2X4TB 5E9DA 2WQ8A 4LCWA 1QFWI 3ZHLA 3GSNA 1F6FB 1R3LB 5MENB 2PO6D 1V3KA 2MHAB 1D5IL 4PY8J 4KK6C 1NGWA 3FQRB 3TH2T 5FF6A 4OZHF 3GMLB 4MS8D 3LQMA 1MCIA 4G43A 5ADOL 2YK1L 3BP5A 4L29B 5T5FL 1DFBH 5DFWH 5CBAA 5BVPL 3BKYL 4QHMB 1ZTXH 3LQAC 1EMTL 1X5JA 4AEEA 4X4ME 1C08A 4BQCA 1SJVA 2B5IB 1UEYA 3EO0A 4F3FB 4P2CG 2Q8BH 4OQTA 4KK8D 4NO3A 5JW4Q 3P11H 4EUPB 3GMMB 2O26U 3S37X 5C6WH 3QG6B 5JHLL 5DT1L 1IGFH 3PV6B 3IDJA 2OTPA 2D31A 2QADD 4LEOB 4M6NH 4N1EA 2D7PA 1FSKC 1D5IH 3FO1B 2GJ6E 4RA3A 4X8XA 1G0YR 4M1DH 4FQPA 2FWOB 5BXFA 3O9WB 5D93B 1HOCB 2NY0C 3KYNB 2MKLC 5HGAA 1E28A 1WLHA 3VFPB 3UJJH 5T5NF 3MOAH 1AIFB 4WW2A 5SWZD 1KCUL 4Q6IC 4RNRB 3TVMB 2WBKA 1I3GH 3L5XH 2J4WL 4IOIA 1Q9LA 2R2BB 5FA4B 3DX7B 5EN2A 4KJWC 5E5RB 3RZCA 2VMFA 3AY4C 4NN5B 2O61A 3CC5A 4XNUL 4HUWB 3U0WL 1QRND 4GQ9L 4O2CA 4LNRB 1EPFA 1JNLH 4GMTL 5SX5H 4OF5A 4RFEA 3C08L 4EDWL 3CFJB 3VFSA 3WKNA 3CZFA 5D2LF 1T22B 2F54D 4FFWC 4F9PA 2DQIL 1R3HA 1FNLA 3NA4A 5GZOC 2I60H 4LGPB 3CDYA 4IS6B 4NRYA 4Q2ZB 4XCYB 5BQ7A 3SDXB 1NCNA 1V7NH 4OUUB 4LF3B 3T77A 1BD2B 4H8WC 3RUGE 3QDGD 3QIWC 5IG7A 3FOMA 5FYKH 3JZ7A 4I18A 1CXFA 3RDTB 1HXMA 5I30L 1QTYT 1A7PL 2VZSA 2MTPA 2WBJD 5EU4B 3NACH 3NZ8B 3HR5A 1DBJL 4GMTH 4MLIA 4QHLB 1AO7A 3DMMD 1AGFA 3DXAD 1QSEE 1I3RA 1CS6A 5J4MA 2L4OA 4R26L 1CXHA 1U3YA 5E9DB 1GXEA 5F89A 1ZHLA 3EOTL 3GSNB 2EICA 3S4SG 1ZKAA 4NP4L 4GRMA 1EX0A 5FF6B 1DBBL 2R29L 5AAWA 2NR6C 2NY6B 2L7UA 1FRGH 1B9ZA 2BY1A 5GHWH 3IFNL 3MXVH 3OZ9L 2JK5B 3BP5B 4ZUTA 3REVA 2NY2C 5CBAB 2FJHB 2XQBL 1IC4L 2W92A 3EO0B 4LLQA 4ELMF 1IGJA 1MF2L 4PJGA 4Q97A 3CXDH 1SQ2N 3SGDI 5LXGL 5EZOH 4Z78A 1LK3L 3SKOA 5D1QC 1P5UA 4AEFA 4OGAC 2D31B 3WNNA 4DVBA 2AJXH 4TULH 4TVSa 3V7MA 5ISZE 3LHPH 2DLFL 5BXFB 4OSUH 2ORBH 3PWJA 4HKJA 1JP5A 2AK4A 5TFSL 4A6YL 5HGAB 5E8NA 4HT1L 5DJ6A 3UTPD 4WW2B 3HC4H 5B4MC 1RUKL 4GSDH 2DQJL 1N4XH 3O2DA 1NGYA 1MF2H 1KJ2B 4IOIB 5L2KA 3MRJA 1Q9LB 3D39D 3PXJA 3FN0L 2WW8A 4NT6A 3RZCB 4EN3B 35C8H 3CC5B 3G9AB 3BKML 1RHHA 3EOAA 1ZWIA 3BISA 3NAAH 4Z18A 1S7TA 3H9YA 2VC2H 4O2CB 2ZG3A 1Z0NA 2DLFH 1EFQA 4RFEB 5BOZG 3VFSB 2RBLA 1Z6JT 2MWCA 4JQXC 15C8L 3VFUA 4NRYB 5BQ7B 3WYRA 2QQNH 4MQSB 1RJLA 2HG5A 3T77B 3ROOB 4PJ9D 3QAZC 1JVKA 5IG7B 1J87A 3H7BA 3BGAA 4MQXC 3FN0H 2ZPKL 1OAXL 1RZJH 3SGKC 4HAFA 3ZHKA 3WFEL 5CJ8A 4XNQA 1HXMB 4LRNL 3VD5A 1AQKL 3HR5B 4OZFH 4QEGA 4POZD 3I6LE 1AGFB 1I3RB 4XTRC 5F96H 1GC1C 4EEEA 5BVJB 4B7LA 5F89B 4K7PH 2DQUH 5E4IA 3BN9D 4LGRB 5T1DL 3AUVA 2ZOLA 5GRXG 2VRAA 2ZPKH 1PG7W 2N4IA 4OGYL 3GSXA 4R2GC 3ULSA 1NL0L 4ZUTB 3REVB 3WFEH 2YD6A 5I75B 1LNUA 4LRNH 4O9HL 5I9QB 3RU8H 5C0CD 1IM3A 4LLQB 1XGUA 1IGJB 4G9DA 3HTLX 3OKDA 3HAEH 5DJCA 4BJLA 1KTRL 3UC0L 3QPXL 4JFHD 2J2ZA 1NFDA 3SKOB 3V0AC 4MA8L 5HHXH 2XZQL 1JNNH 4G6FB 3WIHA 3L5HA 2VN4A 3PWJB 1T04A 4XCNA 5GRJL 4HKJB 1NL0H 3G6JA 1TJHL 2EDJA 3P30H 3DSFL 3EKCA 3O2VL 4O9HH 5DJ6B 5E8NB 2VSDA 2DI7A 2A74A 3C60D 4ZS7H 4YBQC 3DVNA 2BVQA 2DJUA 5SWSE 2VLRE 2W0FA 1NGYB 5L2KB 4KK9D 2FCBA 3O6FD 4QNPE 3R0MA 3UC0H 4NT6B 5J1TC 1GCFA 43CAA 3R8BB 1RHHB 3QEQE 4MJ6A 4N90E 4Z7NE 1IZJA 2X1PA 1S7TB 3WEXA 4ODHH 5HHOD 5BS0A 3OPZH 3DX9A 3EAKA 4C4KT 1AD0B 1IT9L 5DJ0B 2LE9A 1TJHH 1CR9H 4QTIH 4TYUA 3ABZA 1TQBB 1RMFH 4HC1L 3GMQA 2R1YB 1HWHB 3VFUB 5TQ0H 3L3KB 3EYQC 3PABA 4OM1H 1TQCB 2HG5B 4CN1A 3LMJL 1XGPA 4QHNA 3H7BB 3RKDD 1JHLL 2A6JA 4YO0B 1AHWB 3VFNA 2ZKHL 4LCIH 4OI7A 3E8UL 4K94C 5CP3A 4ODUA 4XNQB 2HN7B 4ZXBD 1BQLL 5CEZL 1W8NA 1TTUA 1KCRH 4PJEF 4LARH 1RUQL 4H1LA 1LK2A 4JY4A 5E56A 1JWUA 1ODAA 1RURH 1JPGB 2ARJB 4W68A 1ACYL 4XP4L 5DMYA 1KGCE 5TF1H 5LJYH 1A6ZA 4ZOEA 5T1LD 2M8XA 4ELKA 5C07D 4X6CA 3LMJH 4H26A 2Z4QB 2PW2A 4ODXA 2ZOLB 3EJYD 5D5ME 2HTKD 3GSXB 3RGVA 4KAQH 5T1MB 2DJSA 3ULSB 3WXWH 3NFNB 4I2XE 1ZGLA 4ISVA 2H45A 5CEZH 4G9FD 1JWMA 3O3UN 2E7BA 5IOPB 1ED3B 2R2CA 4U4BA 3PDOB 1IM3B 4M7JL 5HYFA 1XGUB 2VDQL 2NW2B 4G9DB 4WIQA 1OAYH 1C16A 5JXED 3QFDA 2FEDC 4CN6A 4URTB 1NFDB 3F7PC 1RK0A 5JXAL 4MCZA 3BFOA 4Y2DA 1IMHC 4I0KA 3WHE1 3ARWA 4KI5C 2IQ9H 4WNQA 5FDWB 1BWMA 5CJ5A 3LZFH 2J8HA 1T04B 3G6JB 1YEGH 4C54A 1S5HA 2VISA 5L6YH 4YDLC 4TSAL 4GKZA 4U33A 4LSPL 2A74B 2SEBA 5C09A 1IAIM 4ZTOL 4HS8H 4R90L 4EDXA 2W0FB 3FRUA 3EO1A 1KEGH 5CEZD 4OBRA 1VGKA 1YZZA 3DOSA 2Z0BA 43CAB 5CD5D 1BFOA 2B4CL 4MJ6B 4KKLD 2YXFA 3T1FA 3KG5A 2XA8L 3MV8B 3DX9B 1I8KA 1UM6L 2R69L 5E2VH 2DBLL 2VUOA 5DK3A 1UM4L 2E7LC 4KH2A 1FL3A 1TENA 3QIUC 3ZL4L 5AWNH 3AS3A 4TSAH 1IC7L 1MFBH 4P2RA 1OP9A 2FH6A 4M48H 3PWPA 3GMQB 4ZTOH 2OZ4L 1G9EA 2C3XA 2H8PA 1WTLA 1QSZA 3IJYA 5J13C 3UPRB 3PABB 5BZWA 3KLHD 2DWDB 1XGPB 4QHKI 4N68A 1JJUA 3VFNB 2DLHA 5JZ7C 4N8CL 2B4CH 1DQTA 3WNLA 4LAQL 5C0FA 2NTSP 5FOJA 3JWDL 3ZKNC 4JHAL 4H1LB 1UM4H 4WGVB 5BRZA 2DQCH 3EZJB 3ZL4H 1SYVA 4YXKL 1CD1A 4Y16D 3SDCC 1A6ZB 3Q1SH 3LD8B 4U6TA 3RP1A 5I8OH 3VWJA 4ELKB 5I1HH 5EU6E 4X6CB 1FFNA 4H26B 4Q9RL 3A6CL 2PW2B 2VXQL 3ES6A 4G6MH 4MWFA 4ODXB 3TT3H 4WEMB 3TM6A 4TSBL 3RGVB 2EKSA 2VAAB 4LAQH 5LAXA 5J6HA 1A7OH 1BM3L 1IQWH 1ZGLB 4P46A 4ISVB 4LK4A 3UP1A 5MERA 1MIML 3VXMD 4PJCA 4MZ2A 5JW4M 1OTSC 1C16B 3QFDB 5C71A 2FX8L 2BK8A 4RMSA 2ITDA 4MJ5A 2B2XL 5A43C 3BUYA 3S3SA 4QRQA 1UGNA 3RWCB 1OWRM 1MY7A 1RK0B 1MFEL 4JM2F 4LGSB 4Y2DB 3SDAA 5B38A 5D7JC 3V95A 4LHUD 1KB5L 1BOGA 4WNQB 4NZUL 1I8LC 3HI6H 4NGHL 4O58L 5IB4A 5HYJD 1Z3GH 4L4VD 4NPYA 1KTDA 1S5HB 2VISB 3SKUD 4F7EA 2UZXB 1QFWM 2SEBB 4OQ1A 5C09B 1KJ3L 5E24E 1DZBA 4EDXB 3FRUB 3EO1B 1KC5L 4KI5E 4R4ND 3QYCA 1RVFL 3MACL 3HMWH 1MH5B 3O6MH 2LU3A 1XR8B 2CKBA 5T3ZE 3MLPA 1CGUA 1XF5A 5C1MB 4HCRH 3TIDA 1MWAB 5IEHB 1WVZA 4P3WA 1AQDA 1MFEH 3T1FB 3SGJC 3GBMH 4HMEA 5DVMA 3I85A 4L3EB 4F8QA 4N0UA 1I8KB 3VFTA 1WICA 1XGYH 1JZ5A 3V4VL 2PO6C 1FL3B 4OCWL 4KZDH 3KJ4B 2ERJB 1F4YL 1FH5L 5IB1A 5F9WB 3IU4L 4XPAH 4O5LL 1CGTA 3PWPB 4IM8A 5IT2H 3S97C 2H8PB 4HWUA 5CJOL 3IJYB 4YFEA 3RPIA 4GAFB 2YS4A 3TPUA 3INUL 3UTSD 2VDPL 4CBPA 2D7QA 5BZWB 5DLML 1RVFH 4BFBD 3DVFA 4ZO6A 3E6HA 2XPGB 4UAOC 1TVDA 4Z0BL 3WIFA 4MHHG 1T83A 5FFLA 5C0FB 4U31A 2BJMH 4KK8C 4DKFL 4HLJA 3BZDA 2FJGA 3KYMB 2BXYA 5FYLE 4BSWA 4V2CB 3I6KA 5EOCJ 3TBWA 4NQCA 1S9WA 4OT1L 5EO9A 3E3QC 3T1WA 1C7TA 2QADC 4YHOH 4XPTL 2ZUTA 3LH2L 1KELH 3HN3A 5I8KH 4RWHA 4O02L 1U8NA 3BJLA 1BREA 1XCQA 4NUGH 1CD1B 3HS0A 4NQDA 3VGDA 1F11A 3P4MA 4NDMA 3HZYA 1ZA3A 4C58B 3VWJB 1IBGL 1IAOA 1IL1A 1DBKL 2DWEA 1FFNB 4YNYA 3ES6B 4D9QE 4MWFB 1OY3B 4Z0BH 4HF5H 3NVQA 4ODVL 4LASH 4A2MA 2EKSB 5LAXB 5J6HB 4DKFH 5ID0A 3TZVA 4P46B 5MERB 3DECA 4PJCB 2AXGA 2APWA 1L7IL 5KSAA 5A3ID 1LEIB 2Z35A 3SE4C 1QSFD 4F9LA 2P47B 4FXGA 4P2QE 2OTUA 5CINL 3IAGC 3R4DA 1WZLA 3BUYB 5DJXA 2JIXA 3OAYK 4LLUA 1E4XI 1J8HD 3SDAB 2GY7B 1MJUL 5B38B 1FGVL 1MJJA 1G7IA 3G5VB 4LSVH 3A6OA 5FGBC 5IB4B 2MCPH 1AXSA 1ZT4A 4OBSA 3TBSA 4CVUA 4NPYB 1KTDB 3H7LA 5DHVH 4F7EB 4ZFZA 1XGRA 4NBYB 3W81A 1GAFL 4JRXA 3BRDA 1NAKL 4BYHA 5DUPH 5E95B 2YSSB 4WI8A 3QSKB 2HVKA 4LSDA 5AYUL 2WBJC 3JWOL 4CU7A 5BCAA 1E6JL 2CKBB 3EHBD 5CINH 1FIEA 4KUCF 1XF5B 1A7BA 4FNLH 3TIDB 2X44D 3DMMC 2DQEL 4KK5D 1AQDB 5F7EL 5L9DL 1YEIL 2BHYA 2D2OA 4N0UB 1FGVH 3VFTB 2DM7A 2VIRA 5GISL 1WCBA 5C0ND 3JV5A 1CXKA 2R56H 4P5TA 5IB1B 5CMAA 4P2OD 3QNZB 4Y5VC 4PLJD 2V7HA 3TPUB 2X89A 4JDTH 2OL3H 3BT2L 2J8UA 5DJYA 4PLKD 3E6HB 1SJEA 1E6JH 3WIFB 4HULB 1GGIH 2DQEH 2FHBA 2FJGB 3ARRA 4XH2A 3DSNA 5C0DB 4X5LA 3TBWB 3I6KB 5C0AD 4GRWH 4NQCB 1S9WB 1RY7B 5F44A 5EO9B 1FFQA 4I4WA 1QKZH 1H3WM 8FABA 2I07A 4OLWH 1U8NB 1XCQB 3MUY1 3HS0B 4NQDB 1F11B 3P4MB 5J12C 3QRGL 3HZYB 2VDNL 1ZA3B 1UM5L 4JFXB 1IL1B 2DWEB 4ZUSA 3BT2H 3C87A 3PQYA 3E3QE 4YNYB 4NRXA 3QZWB 4D3CL 4K9EL 4JO2L 2FX9L 1D5XA 4B41A 1LO4L 3QBTB 5ID0B 3TZVB 1UWGH 3VXUD 4K8RH 4ZNEE 4YHYB 2E7CA 4K3JH 3T0XA 5ENWA 4WTXA 5SWZE 5JLZA 2Z35B 5CSZA 2EH7L 5I1GH 2OTUB 2QSTA 1TVHA 2JIXB 4LLUB 1UACH 5I66A 5JO5A 3BGMB 3SQOH 1MJJB 1G7IB 3H9SD 4K9EH 4JO2H 1MCJA 4RIRB 4RMUA 3X11A 4FP8L 1AXSB 1ZT4B 3Q5OA 4N5ED 4PJ9C 5I8EA 3TBSB 3WL9A 4ZFZB 1XGRB 1FQ9C 3REWB 1RI8A 2UYLA 4JRXB 2F15A 4E42A 1URLA 4HGWA 3MFFA 2F54E 4KFZC 2BOBA 3MROA 3P3YA 1CLOL 2WUBH 1JRHI 2HVKB 2A6KA 4OD1L 4FFYL 1MI5D 2EH7H 1YUHB 3LEYH 3QDGE 1UT9A 3SCMD 5M95B 4POZC 5I18H 2HKFH 4GS7C 4U1LB 5KVMC 4XVSL 3D2UD 4LLAA 4PS4L 2VIRB 1WCBB 1OB1B 4WWKA 3BN9C 3D85A 4X5WB 2FDBP 5I1JL 1A3LL 3DXAE 1GGYA 4XP6L 2V17L 3GM0A 1HHJA 1WZ1H 3QDAA 5T3XH 1D6VL 1MCWM 2WAHA 3S98A 2J8UB 4MNGE 5KVEH 1GIGL 1SJEB 4KKBD 4Z95L 2V2WA 5SX5K 4GW4A 5HPOA 1MCSA 3QNYA 4Y5XC 1YJDH 4AJ0A 1CG9A 4M3JA 5IB5A 3BVNA 3NCBB 4U1JA 4XH2B 3EYSH 4GXVL 5DSCA 4Z7OE 3IAQA 3WFCH 5ISZA 4I4WB 1F3DJ 4CKVX 3U83A 4OF6A 5HHQA 2R1WA 8FABB 4UQ2A 2I07B 5ALCH 2Z93A 3A67L 5DFVD 3UTZA 1N2RB 1A3LH 1BZQK 2Y06H 3DGGA 3LDBB 5E2TH 3MOQA 3TWCL 2V17H 3BP7A 5DTFA 2QQKH 3QI9A 4MX7A 1JHKH 1FNHA 2FGWL 2AXFB 4FQQA 4ZUSB 1LO5A 3PQYB 3VFGL 4NRXB 1MLCA 5DJ2A 4NWTL 1KOAA 1CCZA 4GRWF 1ZS8B 5FKPA 5T3XD 3DV6A 3S3PA 4KK9C 3O6FC 4N0YH 4WFED 1BFSA 4BKLA 3P9WB 4TPRH 3K8KA 1QLFA 4QGTA 5B39G 1OAQH 4Q6IA 4EIZC 3QFJE 1BHGA 4OZFG 1G7LA 3ILPA 5ENWB 5FYJL 2HJKA 3A67H 1OM3L 1OD7A 1I7RB 5DQDH 1Q0YH 3D39E 3QH3B 4NC2B 2FGWH 1JWSB 1TVHB 4QXTA 3OV6A 4NKDB 5C0EB 3QXAB 5D72L 4NC1C 1IEHA 1WIPA 4KHTH 4ZMAT 3DO7B 3X11B 1RUPL 1KACB 3U1SH 1AP2A 5I8EB 3WL9B 1QEWB 5E2JA 3ZE2E 3S4SA 3RKDC 2UYLB 4E42B 2KPNA 1TCMA 5I76A 4HGWB 4IHOA 3MFFB 1FIGL 2BOBB 3MROB 2VJXA 4I0PA 2NLJA 5LVEA 1MIEL 4XWGH 2A6KB 4ZXBC 1PY9A 1YPZF 1IC1A 4LHQB 3T0BA 1YNKL 3RIAF 2ADGA 2VL5A 5GJSL 3O3AA 1U3JA 3VXSA 4RFOH 2H6PA 3ROLB 1A22B 7CGTA 3FQWA 3PV7A 1WTGT 1I85C 3QCUL 4MHHI 4KV5E 1DCLA 2B1HL 4WWKB 4KPHH 1UXSA 4LPWA 4ZNCD 5C70A 4NZRL 5E2UL 4Y8DC 1KCVH 1WISA 3EJYC 4JG1L 2HTKC 5J06A 3Q5YA 3AMKA 1HHJB 2RB8A 5K59E 3TFKD 3I9GH 3PXHA 1MIEH 2HMID 1LD9A 3MO1B 5F7NC 4OZIE 3M1BA 1INQB 3PHSA 4M6ML 2V2WB 1WJ3A 1FDLL 1MUJA 1YNKH 4QRPD 1FCGA 5GJSH 2EDFA 1A6PA 1E27A 3QNYB 3FTGA 5ILTH 4EXPX 3ZYOA 3H9HA 3BVNB 3WBDA 5JXEC 2P49B 4U1JB 4HG4J 1QBML 5FYJD 3VI4F 1UENA 2I24N 3SO3C 1AGBA 5HY9A 4M03A 1S7XA 3QCUH 4MNQB 4LFHD 4L1HA 1LQSR 5HHQB 2R1WB 2R4SL 4NOFA 1NMCC 1BFVH 5C0CE 1MRDH 3HKFA 4NZRH 5GS1C 4HUVB 2Z93B 2MCG1 3CVHH 3NZHL 3VRJA 3S8WA 3MRDB 2EDTA 2CUIA 3GFUA 1Q9WA 3VFRA 4DUVA 1FG2A 4JFHE 3LVEA 3QI9B 1A6UH 4MX7B 1A7QL 4OM0H 5SWSA 2VLRA 1LO5B 1YMMB 2NY7L 4JFED 4DGYH 1MLCB 1QG3A 1EEZB 5DJ2B 3BGFB 1G7PA 2ATPA 2NY0B 3N50A 4G8FA 2IQAA 1NGPH 3DV6B 4H88L 5IR1A 4RDQF 2QHRH 4BKLB 1X5FA 3BIKA 4K2UL 3TLRA 4ENED 1QLFB 4Q6IB 5CD5C 5H2BA 3MX0A 4KKLC 3QCVL 5EOQH 3ILPB 2MPAL 2BVYA 2AEQL 1S3KH 4K7FA 2HJKB 5EA0H 2D7OA 4XCEA 4HWBA 4KJYA 2DI8A 2ZOKA 1BEYH 4QXTB 3HNVL 4K7PY 3Q48A 2NY7H 2W0KA 4Q58C 4P23D 4PRID 5GGRY 3GRWA 4KTEH 3BPOB 1P7QB 4K3EH 5JIPA 3KLHC 3P73A 4H0HB 3IJSB 4RMVA 5GRZA 4JQXA 3GK8L 1EHAA 1I9RL 5DZOA 4ZFFA 5I76B 4PD4J 1RZFH 3ZE1F 4I0PB 2NLJB 4NC1E 5CJXC 1G7HA 5F71A 1U92A 3TJEL 3SGKA 2NMSA 3WJLC 2YKLL 4HK0B 2NW3A 3MGOA 3MGAA 1AGEA 1PLGH 3UEZA 3V6BR 2VL5B 1CDBA 3ZTNL 5DI8B 3VXSB 2WBWB 3M45A 4HJJH 2H6PB 4KMTH 3RWGA 2AEIT 4UT7L 2V7NA 4BUGA 4IJ3B 3S35X 4Y16C 3FQWB 5IHBA 4L3CA 4OZ4A 2EEDA 4GW1B 2F8OA 3S36X 5D5MA 4ETQA 1UYWH 2ICCA 3UPCA 1O0VA 1RJYA 4U1HA 4XWOD 1UXSB 3UMTA 3RWEA 4M4PA 3MLZL 5E94B 3JTTA 2QSVA 9CGTA 3QDMD 4QRRE 1LD9B 3N9GL 3FFCA 5C08A 3W82A 5IB3A 3M1BB 4KQ3H 4UU9A 5C07E 4U6HA 1MUJB 2CH8A 2B4CC 4BH8B 1SMOA 1E27B 1A7NL 3CU1A 3FTGB 3QQ3A 3WKML 3BP4B 3KYAA 4XVTH 1AGBB 5HY9B 5MEND 1S7XB 2OK0L 4X0KA 1TIUA 4G9FE 4XPBH 3QHTC 4GBXB 2JE8A 3MA7A 1N6QL 4TSCH 1J1OL 1PBYA 4H5SA 4LVNB 1J12A 3HRPA 4HSQA 4JFQA 4Y4KB 3VRJB 4UDUA 4NUJA 3MLZH 1ZLWH 1Q9WB 3EDEA 3VFRB 3OQ3B 3VI3F 4CGTA 4C59B 2VLRB 4APQA 2PYEA 5IHUL 4YFLF 3CFEB 1AC6A 4J4PD 2GK2A 2ATPB 3JUZA 4Y19E 5ICZA 4XP1L 5HYEA 2IQAB 3JWDC 2OXGA 4R4NC 4UT6H 3WKMH 4X7SH 1HHHA 4FS0A 1UKTA 4DN3H 1QPPA 3HPLA 4OFDA 3OXSB 1OL0A 2H1PL 3BIKB 5HDBF 1WT5A 5H2BB 3QUXA 3NCJH 3S35L 1PW3A 1AJ7H 5KS9E 1HI6A 1JV5A 1EEQA 3T4AA 5F7HA 3GSNL 4K7FB 3DUHA 2Q1EA 4XCEB 3O9WD 5TE6H 5L7XH 5CEZE 1WWAX 2R0WL 1A2YB 4KJYB 2CRYA 4LHUG 1CFQA 4Z8FL 1IFHL 3LS4L 3T8XA 1PZUB 2DIBA 4NO0B 2P5EA 2APVA 4X83A 2XWTA 3KDMA 4G42A 5DD5H 4PBXA 5IW1B 4M3KB 3F12A 4ZFFB 4Y4HA 2H26A 4KRLB 3PGCA 3QAZB 4UTAH 2YC1B 1U92B 5ESVA 2OQJA 3PGFH 4DKEL 3AM8C 4HIXL 1FL6A 2NW3B 3MGOB 1AGEB 2XY1A 5EZIH 5IGXH 4PJDE 1BVLA 3BH9A 3T3MF 1KB9K 4MA7H 4Z8FH 3HUJE 5EC2B 3U4BH 1XF2A 5EU6A 4ODSL 1IM9B 5GSVA 4L3CB 4OZ4B 3K1KC 2EYRA 2WUCH 1RUMH 3U7YL 4ETQB 4L9LC 5E08L 5EORH 4U1HB 1RJZA 4YEEA 1EDQA 5HVGB 1S9XA 2B20A 2VUYA 3RWEB 1MNUH 3JTTB 1EXUA 1KJ2L 3LKRA 4XX1G 2AW2A 2H32A 1XGTA 3G5ZA 2W9LA 3FFCB 5C08B 3GSUB 2RAMA 5IB3B 2YD9A 4UU9B 3EYFA 4M5ZL 4L8CB 5DDHA 1C12A 3F58L 1QD0A 1FZJB 5A3IC 4UQ3A 1T1XA 5E9DD 1R5WB 4ODSH 1NDGA 1T2JA 3VFMB 4NQXA 1K8DA 4X0KB 1PVHA 4JVUA 3VXME 5E03A 2FEEL 1NBYA 4Y8AA 3RWDA 4HGKC 4QRSB 4JFQB 4S0SD 1VFAA 4M62H 4UOW1 4B5EA 1KCSL 4NUJB 4UDUB 3BMWA 1J88A 5DD1H 1KJ2H 4NSKB 5IQ9A 2ZJSH 1MJ8H 2XZZA 3ZMRA 3SE8L 4FRWA 4HD9A 4JE4B 4APQB 5KAQG 2PYEB 2HTLD 1NUDA 2DLEA 5ICZB 5C0RH 1A4KA 5F6IB 1HHHB 1DQLH 3HPLB 4EQ2A 5HYJE 1IGCL 4WHYG 1TZGH 1TJGH 4L4VE 5F1SA 2BNRA 4P3DA 1MHEA 2E9JA 1LEGA 4PG9A 4AMKL 3QUXB 4KK5C 3H3PH 3UBXG 2X7LA 1HI6B 1JV5B 1XF1A 2FB4H 3T4AB 4PJ7A 1H5BA 1XT5A 3MXWL 1KCSH 5IMOA 4NZTL 5FCUH 3L3IB 3CK0L 5C0NC 1CFQB 2EO1A 3T8XB 2WM0A 2A2QT 4P2OC 2XWJA 4ZFOB 4U7KA 2EC8A 2E7LA 3QIUA 2P5EB 3KDMB 1KBGH 4G42B 5JMRA 4EN3D 3RZCD 5DS8B 4PJIF 3BDYH 4PLKC 4K71C 3QHZL 3N1MC 1T89C 3F12B 4Y4HB 1AXTH 1Z5LB 2H26B 4AMKH 1DLFH 2VTFA 3FCTA 4RMRA 2YA2A 5ESVB 1A7RH 2OQJB 5A2LH 3UTSE 3HE6A 3QB7C 5DVKA 1FL6B 1WFTA 2V9QA 4ZTPL 3BH9B 4OZHA 3RIFK 3W0WA 1XF2B 3QDJA 2VR9A 5GSVB 3AS2A 4JKPL 5KOMC 4CVWA 4GO6B 4JGJA 1A6VL 4KTDL 1A1OA 1RJZB 3SDCA 4S1SL 5I2IB 4MZ3A 5I71B 3O2DL 3FT2A 3MUJA 1S9XB 2X1QA 1EXUB 3LKRB 5EU5A 2H32B 1XGTB 1ZHKA 3G5ZB 3JWOC 5GGVL 5DDHB 1QSVA 4P2QA 3H42H 4P0DA 2A9NL 2DLGA 3PL6B 1BAFL 1T1XB 4U1IA 1VDGA 1NDGB 2BVPB 5KN5B 4RAHA 1FLRH 4NQXB 1K8DB 2NY5L 1A6VH 2N56A 43C9A 1G9NH 5DK0B 1Q0XL 5DJZA 3BE1L 4CVXA 1MHHA 2O5XH 4CNIA 4PGZA 4JKLA 1RZ7H 1LP9E 4JAMB 1QSFE 5IQ9B 1I7ZA 1ITBB 4M61B 4N5EC 1JYXA 3WIIL 4WHDA 1CFVL 1V7ML 1I8LA 1F3JA 4PRPD 4KV5F 2GJZA 6FABL 1J8HE 4OCRL 5CEYA 3QUMA 1HHGA 1C5BH 2LAGB 1WITA 1EGJA 2BNRB 4P3DB 3SCMC 1MHEB 4G6FD 4WY7L 4OZIF 1LEGB 4PG9B 3O3EA 2X7LB 3BE1H 2HH0L 3WLBB 4PJ7B 4Y4FB 4YHPA 1H5BB 1W0YT 4PGDA 5JIHA 1J0HA 5IMOB 1J0IA 3QG7L 2F19L 1XZ0A 3FQXA 3SGJA 5EOCH 1GJIA 3Q3GA 3DWTA 5C8JB 3CX2A 1CFVH 2XWJB 3N1QC 1HEZB 3QIUB 5C0IA 4K9EC 4X6DF 4NBXB 3CFCL 5DD3L 5E6ZA 2Y07L 1F58H 1BGXL 4KKBC 3SOBL 1P6FA 2E7HA 2IPTL 2ZCLL 5K9OA 1XF3B 2ILLA 3FCTB 4PJAF 5KSUA 5F7UA 1UB6A 3T3PF 1J05A 1INEL 5IBUB 5HDQH 4CL7A 3FQTA 1T20B 3HE6B 4OCYH 3ULUH 1F6LL 3QG7H 4XP5L 1P6AB 3W0WB 4OZHB 5DRZA 4JGMA 1HQ4B 3QDJB 5DFVC 4BM7A 3ARYA 5SX4I 1C5CL 1CVSC 2Q6WA 5IQ7H 2HFTA 3CFKB 5C0AE 3VXTA 2Y07H 4OB5L 3EOBA 3SDCB 5C3LD 3VXPA 3L7EA 2EO9A 4ZNEA 2BCKB 4AENA 2XNAB 1CD9B 2ZCLH 2IPTH 4ODTH 5D6DA 5EU5B 4YJZL 5ABDE 1HHIA 1ZHKB 4DUWA 5KSBF 1DDHA 4CMMA 1SY6L 5JPNA 1CE6A 3VMOA 3C5ZD 5FGCB 1D5MA 3VA6A 4XP5H 1TTFA 1Y0LA 5TE4L 4HIIA 1S7VA 4U1IB 5EIVA 2MFNA 1P4BH 4UV7L 4LSTL 4MMXC 2IBBA 2HAZA 1QRNA 3VXUE 4BZ1H 1A0QH 2DOCA 3MTRA 4OB5H 1A64A 4ZS6D 1MHHB 1T7XA 1LDPH 3WS6C 5FEBA 4JFDA 4ZFGL 5D7KD 1I7ZB 1A47A 3TV3H 3CGTA 5JHDD 3GSRA 1IAIH 3KLSA 3K4DA 2GJZB 4RRPG 3DURA 2FL5B 4NKQB 5CEYB 3QDGA 5DEFB 1HHKB 1HHGB 1OAKL 1WWWX 3H9SE 3IT8D 4HBCL 1KPRA 3V7AG 4X99A 4GKSA 3WE6A 3H3BC 1KJMB 5D2LB 3GMOB 1ZHNB 5FAAA 2WBJA 2OX5A 3HRZA 4YHPB 1R3JA 5EPMA 5KTEH 4PGDB 3V9FA 4MDIA 1KN2H 1MI5E 1IEBA 1U8KB 3PP4H 2BVEA 4JRYD 3VD4A 2AQ3A 3V79C 3T09A 5C0IB 4YX2H 3G04A 4JKKA 4TUOA 2R0KL 3SHSA 3TFKC 3UPAA 4C55A 4Y5VA 1OAKH 5IBLD 2XWBA 1YNLL 2ZWLT 3P40A 1EO5A 1ZE3C 4NKIL 3KVQA 4HV8A 4PJXE 4OV6F 3GHBL 1IARB 3GKZA 2ADFL 5CP7A 2IEPA 3MV8D 5DMIL 5KSUB 1LO2H 4BFIA 1UB6B 5D6CA 3CDGB 1J05B 1KENH 3RIAK 1HINL 1MRFH 1B4JH 3N85H 4J8RA 3IGAB 5DRZB 1RPQA 2X1WL 2G75A 2R2EA 2QADB 3SDYH 4KJQD 2APFA 5FO7A 3BP6A 3MODH 1AXIB 4PRNA 3VXTB 3EOBB 5D71L 4ELMB 3L7EB 5HHPB 3QCTH 1DQDH 3ULUF 3TO2A 4AENB 3OKLA 3VXQA 3WN5B 1CBVL 1HHIB 4GG6E 1QFWL 1MREH 4NNPL 1DDHB 4CMMB 4YE4H 1CE6B 2NTFA 4ENEC 1MWAL 4YK4C 5C6TH 4J3TA 2E7MA 3MLUH 1Y0LB 5HJ3A 3TBVA 3D39A 4HIIB 3CAFA 3BEWA 3L5WA 3ET9F 4WFEE 4XNXL 1QRNB 3X3FL 4DQOL 1OGAB 1CDGA 2J1KA 4ZG1A 3RGVD 3QUZA 3O2WL 4P23C 5GGQH 4JFDB 4RGOL 3NCMA 2Y5EA 3MJGX 2DKMA 5IP4A 3MCG1 3GSRB 1MAML 3DX8A 5IVXF 3WHXB 4NQVA 2ED8A 3UBXI 2JCCE 2AABL 3DURB 4PJ9A 1F90L 4TN9A 1DEDA 1D5BA 1KPRB 2WMPA 4DAGL 2P43B 3STLB 4X99B 5TQ2L 2GK0A 4GKSB 4QY8A 3WE6B 3X3FH 5BMFL 5CUSH 4Y2DD 3JBG7 4DQOH 1ULVA 5FUCC 3UJIH 3QO1A 4PB0H 3BSZH 1P9MA 3HRZB 1R3JB 3IDMA 5EPMB 3F6IA 1A5FL 3O2WH 3U7AA 1Q72L 4JFYA 4MDIB 4OCMC 3RWJB 3L1OH 1A14H 4F7TB 1KN4L 4RGND 5J6GB 1N3NB 1IEBB 4Z7UE 4N0RA 5EIIB 4U6YA 4XWOC 3TBYA 4Z7VE 5C09D 1JYNA 1F3DH 3PE9A 5ACZA 5EU7C 3OKMA 5M94B 5IIEA 1NCUA 4PUBL 1XMWA 3CX5J 1YEKH 4Y5VB 3I3BA 1DBAL 3VRLF 4UV4H 5TQ2H 1QLEL 4HV8B 5E99H 2EEBA 1OSZA 3FAXA 1IC5H 4NKOA 1I75A 4L3ED 5CP7B 3HE7A 4LLWA 5DWUL 5TPWL 4BFIB 4G7YL 3V52L 1OQOA 5D6CB 1K6QH 5C0CA 4RISL 5I1CL 1OGTA 5H35A 5EZJA 5B39A 1Q9OA 4J8RB 3PWPD 4LSQH 4QRPE 4OZFA 5K9QG 4JM4H 3ARDB 4HK3N 2R2EB 1L6XA 1MCFA 2OP4L 5FO7B 5FYJE 3BP6B 3MLYH 2PNDA 2Z8SA 1U95B 1TETL 5FHBL 4DW2L 1QBBA 3B6SA 4CJ1A 2B5IC 1DBAH 2A1WL 3IETA 3GHEL 4HDIA 2PKDA 3NFSH 1FNFA 1OQXA 5C2BL 4J4PC 3KPLA 5ERWA 3TO2B 3OKLB 1TZIB 4YDIL 4KROD 3GKWL 2CKBL 1ZT7A 3C60A 2EXWD 5FM5O 3Q0HA 4RISH 2NTFB 2YPKB 3VGBA 4JFEE 1ZLVH 2R23A 4O4YL 3O6FA 4HMDA 2NNAA 5HJ3B 4PJFE 3OKYA 4OIBA 5DZNA 3VGGA 3PDGA 3O9WC 5D93C 1VKXA 4UINH 3BEWB 3L5WB 2ZZUT 4JFZH 3ZKXC 1J5OH 2OP4H 2BSSA 1GPOL 4JR9L 5HHOA 1H3PH 2CDEA 5C2UB 5F1OB 3NIFE 4JFOA 4M7KL 2A1WH 1IGIL 3QUZB 3KPRA 1D7FA 1CGSH 4P46D 3U79A 4L4JA 5I1AA 5CS7A 2QQLL 4EUPG 4WV1A 2A0LD 1JGVL 2UWEE 3KJ6L 4NN5C 3DX8B 2EDNA 1QO3A 1U2HA 3TA3D 2DMKA 5SWQA 2Q8AH 4FQJL 4MD4B 1A02N 4LPXA 2Z31A 3WFHA 4PJ9B 3VW3H 4PRIE 2CPCA 3LSOA 4NQSB 5D7IE 1KPVA 4QY8B 3SDAD 2AEPL 4JR9H 3QO1B 3NH7L 1A3RL 3MV9A 5DJ8A 3IDMB 3WV0A 4GQPH 3PNWB 4JFYB 2RIKA 1JMXA 2EIZA 4Y5YB 3DI2B 1OW0A 1VEOA 2AJSL 1X5LA 4MGXA 4U6YB 3KJ6H 3TBYB 1NC4D 2GW5A 2C3WA 1RIHL 5ACZB 3CXHJ 5FUCE 3OKMB 5IIEB 4HPYH 2UY6A 4OCNC 4PRHA 4NQTA 4KKAD 3L3DA 1E4WH 3MBXL 5EUOE 4JO3H 1RUAH 4N0CD 1J9CT 4WI6A 1KT2A 2YD4A 2FBJL 1OSZB 3EIFA 3GI9H 2X05A 4QOKB 5EU7E 4NKOB 3FQUB 4G9FA 4WFHD 1N26A 4X7CC 3O4LA 3HE7B 4LLWB 1RZ8A 2YD5A 3NH7H 2JJTA 1WCQA 3QDME 5C0CB 4PRDA 2M1KA 2VDOL 3GSOA 3TT1H 5H35B 5EZJB 1T66D 3D9AL 3FOLA 4D94A 5F6HJ 1VFBA 3P0YH 2R39A 4XCFH 3MSPA 4OZFB 3K2UL 2W38A 3NA9L 4WHTA 3MV7A 2F5AL 4PP1D 3CIQA 4JPKH 1MQKL 5MENE 5GS1A 1DVFA 1U0QA 4HC1A 3B6SB 2HTLC 3IETB 4HDIB 4YHLL 3KPLB 5ERWB 4EQ3A 5GGRB 3SDDA 3VGAB 3TNNA 3VE0A 4EBQH 3C60B 1CDJA 1ZT7B 2CLVA 3SE9L 4GAGL 3SGEH 3MUGA 1N6UA 1U91A 1CF8L 4NKMB 4CAGA 4JM2A 2R23B 1KIQB 4OTXH 1RK1A 4MD5A 2NNAB 4NQDD 3K2UH 1P5VA 4N0FA 4YDKL 2F5AH 5JQHC 2G5BB 2F9BT 5MP6L 5GGUA 3HAEB 3S3JA 1JPTL 2OSLA 5HHOB 4MLSA 2AGJH 1QUNA 5ADPL 1KULA 3CLFL 4JFOB 2WLZA 2K7QA 3KPRB 1SJHB 3LPWA 4ODWB 3TZVD 2XQYG 4XP9L 5I1AB 4EN3C 3RZCC 4WV1B 2VQUA 1PKQB 2Y36L 4M93B 3FJTA 5HGBA 1W72H 2GSGB 1DJSA 5SWQB 1CF8H 1PZ5A 2IPUG 5TDOA 3ZE0F 1OT2A 2Z31B 3WFHB 4F2MA 4PJDA 2P8PA 1J0KA 4ZAKA 1KIPA 4NNXA 1HCFX 3BZEA 3HUJA 4OLZH 3PJSA 3LSOB 5I15H 1ZLWK 4OKDA 3TJHD 4J3SA 4C57C 4WCYL 4LP5A 3ILQD 3HC3L 2PCPA 5GJTL 3WJLA 5D70L 2BY2A 1JPFA 4R96A 4F9PC 5ICYA 3CLFH 3MV9B 4KRPB 4G3YL 1WIOA 1HYRC 4R4FL 5B3JE 2EDLA 2ZUXA 2EIZB 3GGWA 5FM4A 4XP9H 1FG9C 2ADIB 3MRCA 5DD6A 3G08A 4JRXD 4Y16A 1MLBA 5CCKL 1T0PB 1MEXL 4LQFH 4G6JL 1CFSB 2ENSA 4FA8A 1W0VA 3LPGA 4PRHB 3L3DB 3FO0H 3NBNA 4R4BA 1MOEA 3C09B 1I1FA 3BWUC 4NCC1 1VPOH 1YYLL 3IKCA 1KT2B 1P2CA 3C2AH 4DN4L 3WD5H 1DQQB 3O4LB 5GJTH 5D70H 3VXMA 1RZ8B 2FRGP 4W6YB 4PRDB 3VWKA 4JY6A 2W9DH 3FOLB 2LFGA 3ZYIA 1W8OA 2OMBA 5GS2H 4XVJL 1KCLA 3O0RH 1FZOA 1BX2A 1MEXH 3QA3A 4WHTB 3MV7B 3I2CH 5E9DE 1MHCA 2Z8RA 1NMCB 2G9HB 4Z77B 4OD3H 4FQ2L 5I9QC 4YPJA 1DVFB 2C26A 4HZAA 4LHUA 4Y89A 1A4JB 5HYJA 3HZKA 1JPSH 1OSPL 2NYYD 2DQDH 3SDDB 4KQ4H 3TNNB 3VE0B 4P49A 2CLVB 2GITA 2JLLA 5GS0H 3MUGB 1U91B 4LNVA 4JM2B 3CMGA 4M1GL 5MEPB 3IDYC 4Z7WE 1RK1B 4MD5B 4P9ML 1Y6MR 1G7MA 2CRIA 3D3VB 4JY5L 3QXDA 2W0LA 4CUCA 1OLLA 3MYJA 4F58H 2YD1A 1G9NC 3PQYD 1GGUA 1ZSDB 2OSLB 4NO5A 5GS2D 3RZWA 1LO3H 1YEDA 4JGUA 1HKLL 1CU4H 4QF1A 1OCWL 3HPJA 4YFLI 5KVDH 4S11A 5HGBB 4OF8A 4HWEL 3UTSA 5DUML 1OPGH 1PZ5B 5TDOB 2X09A 4FTVB 4F2MB 4PJDB 3HNSL 4ZAKB 5FXCH 1KIPB 3VH8G 4NNXB 3MJ9H 5TDPA 1JZ6A 4MA3A 3HUJB 4AY0A 2FX7H 3PJSB 5GS0D 4HS6A 4O00A 2C4XA 3FMGH 2NY5C 2R1XA 1WEJH 4S2SA 4HUUB 1TQBC 4I8DA 3BPNB 5AD0A 1V3MA 1JPFB 1AH1A 2Y1VA 2D03L 5E0QA 4HCRA 5L8JB 1IGYA 1XGQA 1TQCC 2QHLA 1DQML 3GGWB 2VQ1A 3MRCB 5DD6B 3G08B 4HIJA 4Y16B 3EO9L 1AHWC 1MLBB 4MXWH 3HR6A 1KB5A 2ZCKL 4L9LA 4HWEH 5DUMH 1VEPA 3EDFA 4B53A 1W0VB 5I0ZA 2EDXA 3BN3B 4X7EC 4U6VL 4R4BB 4AIOA 2R0LL 1I1FB 4PJ8A 5ELIA 3C5ZC 1A9BB 2EDHA 3IKCB 3U36B 4BELD 5K9QI 2HVJA 4OLEA 4C56D 1GZPA 3VXMB 2YUWA 3TF7C 1U8OB 1MCPL 25C8L 5HI4D 1EV2E 1JFQL 2XTLA 4PIRF 3VWKB 4DGVL 2J3SA 4JY6B 1LP9A 4WWKD 5HHVL 2EC9T 5D4QA 2BFVL 4LLDA 1T2QL 4ZS6C 1FZOB 1BX2B 3UBXA 2ZCKH 1ZGLP 1MHCB 4PJ5B 1ZLSL 5FCSH 4U6VH 3GDBA 5IROA 4N1HB 3RHWF 1NC2D 1YDPA 3U7WL 5HYJB 3U4EA 2WV3A 4HKXB 4IRZH 1T2XA 4JO4L 3K4ZA 3SN6N 25C8H 5EU3A 4MNQD 5GGTH 4AIZA 1WF5A 4DGVH 5MI0C 4L5FL 3CSYB 2CLZA 1T2QH 2UZYB 5GGSA 1G7MB 4NO2A 3AGVA 3WFZA 3B43A 3QI9D 4U3XA 5F70A 2ICES 1FN4A 1YMMD 4D0DA 5F1IA 4NO5B 4GW5B 4KZEL 4K55A 5HSFA 1YEDB 5HHNA 2NY4B 3UTQB 4P9HH 2RGSA 2XG5A 5IBLC 1EIBA 4TUJA 2VDML 2DMCA 3B9KA 3UTSB 1I9JH 3B9VA 4PGEB 5FB8B 5DHVA 3ZDXF 1HNFA 1BIHA 3HG1D 1T89A 3KPPA 1S8DB 3BH8A 4MA3B 1W2KT 4AEIH 2R1XB 4NWUH 4LCCA 2HJFB 5AD0B 4U0RB 4KZEH 4NM8L 4AEHL 1B0RB 1P7QD 3X13A 4TNVF 1IGYB 4KJQC 3GO1L 4WW1A 2DQHH 2VQ1B 2IAMD 2IG2L 1BMGA 2VH5H 4JDZA 4HIJB 1CL7H 1WUNT 4N1CA 4R6UA 4HEME 3I50H 4TQEH 3FB7A 4I0PD 2PR4L 4Q6YA 5E8DL 2FD6L 3W11D 4OCSL 5I1LA 1QFUL 2FO4A 3ULVL 4PJ8B 3VXSD 4QXUH 2UWEF 1NKOA 2HVJB 4BZ2L 3L95A 1KIRA 2OL3A 1MY5A 1GZPB 3VXUA 4Z0XA 1YEEL 4HWBL 4BH7A 4JJ5A 4AEHH 1AE6L 3LD8C 2WP3T 5J56B 1N5AA 1N6VA 3CLEL 3RL1A 3T2OA 4LLDB 2B0SL 1FP5A 2XFXB 3D18A 3RGVC 3GRWL 3UBXB 2PR4H 2R2HA 4XBPA 5HHMB 4TOYH 2FD6H 5IFJA 2DIJA 2Y72A 4WEUD 5DRXB 4L8SC 3G5XA 1KF9B 4OAWB 1GSMA 3MBEB 1YDPB 3V4PL 2DTML 4JFPA 5D7KE 1YEEH 5EU3B 1UA6H 1V8HA 3J7HA 4GBXD 3ZT7A 5FUOL 4Y2DC 2CLZB 4HW6A 1BBDH 1MCOH 1MI5A 4Y4KD 5GGSB 4XNZB 1ZVHA 5JW3L 3SCMA 1GC1L 2WINA 5ID1B 1IAKB 1LE9A 1FN4B 3EJZD 4RGNC 5EIQA 5TF0A 2E9WA 3U46A 2X42A 3QISA 4Z7QE 4D0DB 4HPOH 2CO7B 3AS0A 2VERN 2NXZB 3CVIL 4KY1L 3BI9X 1BF8A 3KLAB 3RWHA 1PAMA 3DX6A 2DTMH 2NZ9D 3G6JE 4K3GA 4OGXL 4XC3L 4WO4A 5F7KC 4TUJB 3EZ8A 4YLQT 3ULVD 3B9KB 4FXKA 4PRAA 1A6AA 5LWYL 3BMVA 1NBZA 4JRYE 1P53A 5CWSB 2VABB 4K71B 3GMRA 3MLWH 1PG7L 1T6VN 2CDFA 3BH8B 3KPPB 2J6EH 5JW3H 2RCSH 2EE2A 1HNGA 3KJ4C 2ERJC 1CN4A 4LCCB 3X14A 1CLZL 1P4IH 5F9WC 2R8SH 2JJVA 1DUYA 1T0MA 4NO0D 4R9HA 2NXYD 3X13B 3MV8E 1K3ZA 5EBGA 3WUZA 4WW1B 1M6OB 1EJOL 4QYOB 2O5ZH 1CLYH 4JDZB 1ETZB 1BJ1J 1AI1L 4XB8A 3GBNH 1H8NA 4O2EA 4WUKL 5LWYH 3FB7B 4AH2A 3KHQA 1I7UA 5EFIB 4KROC 3EFDL 5I1LB 1J7VR 2FO4B 1PG7H 5AZ2L 1J1XL 2EXWC 4KJPD 4UILL 5JW4R 3GSVB 2VXTL 2EDRA 4WGWB 3L95B 2OL3B 1IM9D 4RRPA 4WI5A 3VXUB 4Z0XB 4FABL 1GZQA 3LRGA 1ZVYA 2XN9B 4ONFL 3RAJL 4BH7B 4JJ5B 2BVTA 1PD6A 4JHWL 5INCA 3WSQH 3KXFD 1N5AB 3RL1B 4J3OC 5LGKA 1EJOH 4J3VA 1BZ7B 4DTGL 4ZFOL 5EULV 4GRWB 3D18B 4TRPL 1UXWA 2R2HB 4XBPB 4GG8A 2JCCA 3NABL 1S7SA 4P46C 2PYFA 3FFCD 5C08D 1JZ8A 3DHJA 2A0LC 4X6CE 2KDGA 3MQIA 5A40E 3G5XB 4WDIA 4UILH 3TA3C 3DYOA 3FB5A 4JFPB 1YY8B 2Y23A 1IE5A 3O11A 1CTOA 2EYSB 1CFNA 3EDKA 4JHWH 3MUHL 3SDXF 4PP2A 5K9KA 1QOKA 5GS3A 1NMBL 1LWRA 3SDAC 4XMPL 2NPLX 4YHKH 3F7VA 2DTSA 2BHZA 3SCMB 3OHXA 5IFAL 4NJ9H 1TMCB 2WINB 1EUTA 4OIIH 4QXWA 4APQD 4MNHA 2P48B 2FH8A 3TCLA 5JR1L 5CGMA 1C5DB 3TBTB 3T0EB 2LVCA 3AS1A 2C1OA 1AY1H 3RWHB 4KTYA 4KKAC 4LCYA 2A9ML 4LQ1A 5D7SH 1R6VA 3WLWD 1YPZB 4WO4B 5GIRA 5GRUH 4N0CC 3QT2A 1U6AH 1A6AB 3QUXD 4FXKB 1DLHA 1UFUA 4PRAB 2XZAH 32C2A 1DANT 5JDSA 4G80B 1NBZB 4GT7A 5C09E 3K3QA 2ZCHH 4NFBA 3W39A 3GMRB 3WFBL 2CDFB 2BHUA 5B38G 3L3OA 1T66C 1WBYA 4Q74A 3X14B 3DJ9A 5IVNA 1FYTB 1DUYB 3V0VA 1T0MB 3VDAA 1YN6A 2P5ED 4PB9H 4YEFA 2EC9U 4L3EE 3RA7L 3FO9A 1M05A 2ESVA 4PP1C 3M8OH 1JBJA 4NM4L 1FNSH 2H3NA 1EK3A 1R5IB 5HYSG 4Y4HD 4X6FA 2A83A 4O2EB 5T3ZL 3OKOB 3P9LA 3PWPE 4K07A 4XNMA 1CGVA 4AH2B 2W07A 1I7UB 3PGDA 5D7LA 4UNUA 1TVBA 1RIUL 2Q7NA 2YEZB 3WFBH 1O7VA 3OJMB 4H20H 4J7RA 1NLBH 4UB0L 3MZGB 2A77L 2VITB 4WW2F 1H0DA 2XICA 3FONA 3U30B 4F37F 2AJVH 3O81A 3PF2A 4OUOA 3LB6D 3EYUL 4NM4H 3ZYJA 2IFFL 3TO4B 3KPNA 1UXWB 2EDQA 4W4OC 5DR5H 3TZVC 4GG8B 2A6IA 2JCCB 1S7SB 5DHXB 2PYFB 1T6WA 2BOCB 3HZVB 4PRIA 1ZA6A 3CVHA 1RIUH 3CPLA 5I74B 4WDIB 2DLTA 3AC0A 3ZDZE 3PL6D 2XXCB 1MFDL 3FB5B 4Y0GA 3O11B 1CFNB 3ZTJH 1MVUA 4NQED 4PJCE 4PP2B 3TJHC 3UAJD 3B3IB 2OR9L 5DYOA 3ILQC 3WHE0 4F15B 4WENB 4KGJA 3F7VB 3OHXB 3QZWG 1RZKH 1V3JA 1GH7A 3P0VH 2C3HA 4MNHB 5D2NA 5DJDB 2QR0B 4XPGL 1RIVL 1MFDH 2HFEB 4GKNA 3B8YA 5GIRB 2BNRD 4I77L 1U8IA 3G6DH 2A73A 2GTZA 2OR9H 5BJTA 3MMEA 4LIQL 4Y4FD 3W39B 4DVRL 1TLKA 1WGOA 2L7JA 4KDVA 1U8PB 1WBYB 1F00I 1IAII 1EJ6A 4LLMA 4X7DC 3V0VB 5MENA 1A3QA 1BFTA 2HJLA 1YN6B 3UJTH 5I19L 4WFHE 4PJGF 4DK6A 1M05B 2ESVB 4N0UE 4JG0L 5DXWA 1ZMYA 2CMRL 1X7QA 5DRWB 4X6FB 2ID5A 2A83B 3DV4A 3G5YB 4QXGL 1CTNA 3P9LB 4XNMB 1QNZH 3PGDB 3AXLA 2NYYC 4LIQH 2FATL 5D7LB 3MLSL 3HE6D 1TVBB 3QWRD 1ZANH 4G5ZH 1EGJL 1FFRA 4DVRH 3WNMA 1AR1D 4HUKB 3W0WD 2X4OA 2CR3A 4PFEA 2X1OA 2OI9C 1QA9A 2JTDA 3QDJD 2H2SD 4NN6C 4XPHL 1BP3B 3PV6A 3LDBC 3ESVF 3FT4A 4LEOA 5BV7H 4PPTA 5I19H 5FGSA 3FONB 1OARH 1RFDH 3FB6A 2LU7A 4Q9QL 2VDKL 4AL8L 5I1KL 1HOCA 3L5IA 1EVUA 4RWYH 4LSRL 3KPNB 4NQDE 1OP5H 4XCCH 4P59L 4ERSL 4B50A 3BYTA 5HVHB 1E6OL 1CGYA 1L0XA 3MLSH 2BSRB 4U6XA 1ZA6B 2DD8L 3CVHB 1YA5A 2DN7A 1NLDL 3HB3D 1YEFL 4FZ8L 5I6XB 2K3TA 3TH3T 3ALPA 3O6KL 4XPHH 5E2WH 1RAMA 4YZFE 1MRCH 1G9ML 5GS0C 1MVUB 1IKNC 4KKNA 5DYOB 1QPXA 3WS3A 5BO1H 1J8KA 2CIKA 5I1EL 5I1KH 4LSRH 1T22A 4DZBA 3FT3B 1FYHB 4NJAL 3MA9H 4IS6A 4Q2ZA 5FO8A 3V5DA 1BVKA 2DD8H 5D2NB 1MFAH 4ZO8A 3BHBA 1NLDH 1X5HA 4JANB 1B0GA 4PD4K 5C0BA 5CEXA 1EEUA 1U8IB 5J9PA 4JRXE 1ZTXL 1WAAF 5EU4A 2A73B 1MJ7L 2GTZB 5BJTB 3MMEB 1ZXQA 1J10A 4QHLA 2ATKB 4M6AA 1JHTB 5HI4C 2Q8BL 3R06A 4GAJH 3P11L 4AG4H 1ORQA 1JPST 5TGBA 3P4NB 5HXMA 4WWKC 4KDWA 3QEHA 5HDOA 3UTTA 4LLMB 4NJAH 1IGFL 1B90A 3PG2A 2CRZA 2HJLB 4M6NL 3RPKA 5FUZH 4M1DL 2E9BA 1SYSA 3HFMH 5IJKC 4J23A 1X7QB 5F7WC 4KMLB 2OMNA 1NFDF 2XV6B 2JK5A 3X3GH 3BXNA 5F1NA 4WWID 5CKGA 3DV4B 2FJHA 4Y1AA 3WCYA 4MJID 1MJ7H 3UJJL 2WWKO 3MOAL 3AXLB 2NX5A 1NMAH 2CJUL 4WI9A 1N64L 4Z7WA 4MMZC 2IGFH 2J8UE 2EDWA 3L5XL 1I3GL 4MAUH 2PW1B 5LGHH 2X4OB 5A16A 4M9PA 1QA9B 4ONHA 5D96B 4R8WL 5J57B 2KUTA 1L7TH 1MFCH 4BK4A 5KSVA 3FT4B 4HJGA 1XFPA 1F4XH 4ZD3L 3QI9C 1EHNA 3FB6B 4UBDD 3N1PC 4FZEL 1EBAA 1JNLL 4WUUD 1PFCA 4BQ9A 3BGFC 1LO0L 4LVEA 3ZKXB 5K93A 5CILH 4XGZA 4HGMA 4MXVE 5HTSA 2VLKD 3EFFA 4Q9BA 2C4FT 2VLLA 1RU9H 2CJUH 1N64H 2I60L 1ZEAH 4U6XB 5HVFB 1V7NL 3BIAX 3PQYE 3RHWK 4YH6A 1KJ2A 3QUYA 5GSRA 3CZJA 4EN3A 2YXMA 3ZYZA 4R8WH 2EDOA 5FYKL 1DANU 3A6BH 3ZZ1A 4ZD3H 4LMQI 1OGAD 2UUDH 1JGEA 3NACL 1DEEA 3SKNA 3JV0A 4FZEH 1U8MA 4WEBH 2AS5M 4G6KH 3WS3B 1NAMH 1LO0H 2CIKB 4JFDD 3T2QA 3BPOC 1N8ZA 2EE6A 4X6DA 4BK5A 4DZBB 3IFLH 1TXKA 2VLJB 1D9KA 3CMOH 4M5YH 2IAMC 1FAIH 4BZYA 3I3EA 1T7VA 5FO8B 3KGRA 3V5DB 5AG8A 1BVKB 3BHBB 3ROOA 4I0PC 4EVNA 4DJMA 4PJAA 1FRGL 3W11C 5GHWL 1B0GB 3MXVL 4O2FA 4XZUB 3MRHB 5C0BB 4JQIH 5JQ6L 2VDLH 5CEXB 3SKJL 5J9PB 4X6CF 5JIKA 2LVEA 3TNMA 1PX4A 4GLRH 3RBSA 4NFCA 4IJ3C 3ZKSD 3MOBH 1OT1A 3BAEH 1AKJD 3R06B 4YBLB 1ORQB 3CXDL 5TGBB 1YEHH 5EO0B 3CDFA 1ORSA 2D0GA 5EZOL 3QEHB 2A6DB 5BVJA 1FE8H 3UTTB 3WJJA 5L88H 3CUPA 1SBSH 2AJXL 4TULL 1SYSB 1N7MH 1I4FA 3LHPL 3OBAA 1JGDB 4OSUL 2ORBL 3CJJA 3PIQB 3BXNB 5JQ6H 2J5LB 5F1NB 3SKJH 4K7PX 5HD8D 4Y1AB 2GAZA 1WIUA 4KGLA 2VXUL 3MRNA 2NX5B 3HC4L 4GSDL 5FYKD 4YDVA 5HI3D 1N4XL 4Z7WB 4PRPA 3AB0B 1Q1JH 4JFFB 4GBXC 5BW7C 2FR4B 5A16B 1QZ1A 5DVOA 1N0XL 4ONHB 2FJFB 4LVNC 35C8L 4Y4KC 2I9TA 3MR9A 3ARDD 3NIGE 5KSVB 1NGQH 1J11A 4HJGB 5AEAA 3NAAL 5JTWA 3VH8A 2FHCA 3D6GA 1DBMH 2VC2L 4NC0B 3C8DA 4JPWH 3EJZC 4MNQE 3VG0H 4CU6A 3RX8A 3B9AA 2DQTL 5F9OH 2F53A 4M7LH 4XGZB 1II4E 3EFFB 2VXUH 2B1AH 1JYVA 2VLLB 2X9YA 3JV4A 2A38A 2NZ9C 4BQ6A 2QQNL 3ULVC 1YMME 1U8LA 3T0WA 3QUYB 3I75A 5GSRB 1KCKA 5AZEH 2F58H 2X9XA 1N0XH 1C7SA 1RZJL 4D0BB 3LAFA 3IS1X 2FECI 3QNXB 1MHPH 1JGEB 3SKNB 1DEEB 1AD0A 2CK0L 1U8MB 5DJ0A 3QUZD 3FB8A 4U05A 4UIMA 2NXYC 1P7HL 2DQTH 1N8ZB 4M43L 5F96L 4X6DB 3S34H 1FVCA 1D9KB 2R1YA 4K7PL 1G0DA 2DQUL 3SGEI 3L3KA 1BOYA 1X44A 3C9NB 3EYOB 4EVNB 4PJAB 4YO0A 1AHWA 3OG6B 3WFDH 1JGUH 4O2FB 2CDGA 4KJPC 2HN7A 3MLXH 1H15A 3SPVA 3TNMB 2AQ2A 1I8IA 1HQRA 3RU8L 5A1AA 2CK0H 2YWZA 2PXYD 4P48A 3C5ZA 1JPGA 4YIQA 4M43H 2ARJA 2VDRH 4GOSA 3OGOE 1HIMH 5IW6A 3CU7A 1ORSB 3DYMA 3QXTA 5HHXL 4OZGF 5IJVA 3VXSE 1MCEA 1JNNL 4WTZG 2G60H 2XG4A 2BRQA 3CUPB 3RKPA 4X4YA 5DGQA 2Z4QA 3UYPA 2NCMA 4LPCA 2XRAH 1X5GA 1JI1A 1I4FB 3SO5A 1PYWA 5KSBB 5T1MA 3JV6A 3NFNA 3P30L 4FFZL 4QOKD 4P57A 2GAZB 1S9YB 5IOPA 3HE7D 1ED3A 5JHDA 3MRNB 4ZS7L 5L0QB 3PDOA 5J0BA 2EEAA 4YDVB 1GGBH 4PRPB 3HMXH 4PGJA 2NW2A 5KG9A 5I17A 1PEZA 4ZO9A 2I25N 1EUUA 4GMSH 2I9TB 5BOPA 1I9IH 3MR9B 4FMFA 4DFHA 3VCLA 4TTGA 3VH8B 2PTVA 3IDYB 2HWZH 4ODHL 3OPZL 3B5HA 5IVXA 1M4KA 4APQC 5FDWA 5DA0B 4ONGL 2C7UB 1A6WH 1CR9L 4FFZH 2F53B 4QTIL 4GKOA 5F6IC 1RMFL 1CDUA 2H9GA 3JV4B 4JRYA 5IW3A 2AJUL 3WLWC 5TQ0L 1K4DA 4OM1L 1IQDB 1WT5C 1ZVSA 1U8LB 3QUXC 1L9MA 3I75B 1KNOA 1FNGB 3NTCL 1T21A 4LCIL 1SY6A 4GAYB 5MEOA 5DO2D 4CDGC 2UY7A 1KCRL 3EDJA 4LARL 3MV8A 3ULVE 4YHNA 1UZ6E 1KYOJ 1M7DA 3BD3A 4CMHB 1NKRA 3FB8B 3KPRD 4ONGH 1BQSA 1RURL 4UIMB 2ADJA 3V8CA 3HI5L 4BSJA 1FVCB 2BVUA 3OKNA 5TF1L 5KOVC 2AJUH 1T7YA 4Y4HC 3UPRA 1QFHA 2Z31D 2VYRE 3PHOA 2DWDA 4TUKL 5FYJU 3BRGC 3DIFB 3NTCH 3D25A 2AKRB 2APBA 4KAQL 2CDGB 1K3IA 5CGYD 3WXWL 3V4UH 3SJVA 1K8IA 3LN9A 2EXYD 1H15B 3MGTB 3SPVB 1I8IB 1HQRB 4PJHF 2IWGA 3MV9D 4KRPD 3O8XD 4YHZH 3RVTD 1NCBH 3C5ZB 4YIQB 1OAYL 3HI5H 5IW6B 3I84A 1TCRA 4Q7DA 4S1DD 3VMNA 3LB6C 5IJVB 5I71C 4UNTA 3MLVH 4JZNA 4X4YB 4PRHD 2AJ3A 1BIIA 4TUKH 2HRLA 1PJ9A 4LKCA 1PYWB 1D5ZA 2IQ9L 4YGAB 1X3DA 2CUHA 3LZFL 5A2KH 2VAAA 4S1RH 1YEGL 3JV6B 1GHFH 5CZVH 2C4FU 4YHMH 5L6YL 4P57B 3PL6C 3O4LD 1JF1B 3W5NA 5JHDB 2IPKB 2OLDA 4LVOB 4HS8L 4L8SA 4UI2A 4DCQA 1QLRB 1VFOA 1RV6X 5E1AA 1DSFH 5F88A 4OF7A 3FFCE 4HWNA 5KG9B 2CGRH 5C08E 3MRLA 5LGJB 1D6EA 4M8VA 4S1QH 5I17B 1KEGL 4UT9H 1GVIA 3UAJC 3IDUA 3ZKMD 3MV7D 4WI3A 3RWCA 1X4YA 4G7VH 5MI0B 3O45B 3VCLB 3LY6A 5FK9B 3CFDA 4K3DH 1DVFD 1J18A 4OKVA 3VFVB 5IVXB 5E2VL 3R1GH 3GSWB 4NQUA 5AWNL 1JN6A 3SDDD 1MFBL 2H9GB 4M48L 4NHCH 4JRYB 1K4DB 4JKMA 1LDSA 4JM2D 1ZVSB 2PYEE 1MH5A 1KNOB 1BJ1H 1XR8A 1T21B 4Y4FC 3D3VD 1H5BC 1IGMH 3RY4A 5MEOB 1MWAA 5IEHA 3THMH 2YPVH 3ORJA 4Y88A 3P9MB 4L3EA 4YHNB 1EVTC 4F57H 1M7DB 4LBEA 5E6YA 2DQCL 1R24A 2ADJB 4LPVA 3NCFB 4LSSL 3OKNB 4L4TA 3OGCA 3Q1SL 5I8OL 5I1HL 1S7RA 3PHOB 4FTVD 4ZAKD 4G6ML 2XPGA 2AAVA 3TT3L 2P5EE 1MCBA 3D25B 4I48A 2OR8A 3MNZB 2MQ0A 2W60A 3HE6C 2C3GA 4S10A 4KMQA 1A7OL 3IS0X 3SJVB 1K8IB 1IQWL 1AR1C 4YHIA 3KYMA 12E8L 3ZTJG 1FZKA 5C9JA 2H2SC 1A9EA 3QULA 4JDVA 3U9PH 4IDJH 1JZ2A 3D0LB 2CD0A 4ZPTA 4LSSH 1TCRB 3TCXA 3K74B 1J0JA 2DQGH 1LHZA 1U2CA 1FJ1B 1QQDA 5E4EC 4JZNB 3GNMH 2AJ3B 1BIIB 4Z6AT 2YRPA 4I9WD 1HH6A 4LKCB 1QBLH 1D5ZB 2IANA 2GUOB 3HI6L 5IBUG 4H8WH 1Z3GL 3HB3C 1F4AA 12E8H 2GEEA 1MSPA 4GUPB 3RUGF 4L8SB 4DCQB 3TA3A 3VWKD 5DQ9A 5E1AB 3T65B 3R0NA 5F88B 2HFGH 3RL2A 1LEIA 3MRLB 1D6EB 3HMWL 2EH8H 3O6ML 3F7RA 1LMKA 2YD3A 1CL7I 4QLRA 3QR2A 3VXRB 4HCRL 3UYRL 3BKCH 5BV7C 4PJ5D 1EA9C 3GBML 3CFDB 3KR3H 2GQHA 4OKVB 3PHQB 5E5MB 3G5VA 4YC2B 3FN3A 1XGYL 4NQEE 4XMLH 1CQYA 4KZDL 1JN6B 5MHSD 1HZHL 3ARUA 1WBXA 4RGNB 4PGBA 4XPAL 3DPBA 1NC4A 5IT2L 5ESQA 3Q6GH 4MA1B 1VGEH 2YSSA 4LEXH 5HYSA 2X4QB 3I6LD 4FQLH 3B2UD 5C6PB 5T5NG 1U42A 3UYRH 1OAZL 2BJML 3DRQB 4PRBA 3VXNA 3SBWC 2BNRE 4LBEB 4YHOL 3GMPA 1R24B 2NY4D 4ZDHB 5EC1A 4PJ7E 1KELL 1HZHH 5I8KL 1DUZA 3QNZA 4MS8C 1T5WA 3GIZH 4NUGL 3VG9B 4M7ZB 4L4TB 3OGCB 4KUCD 2AXJA 3VMPA 3DNKA 1AR2A 1S7RB 3CX5K 1T03H 3L3GA 3CCHB 2ZG2A 3GB7A 4HF5L 4I48B 5LQBL 1PY4A 2W60B 4LASL 1VACB 3ZDYE 3IDGA 1VB9A 1OAZH 1KJVB 3VFOB 4BA8A 1G9MC 4YHIB 3PDDA 5C0DA 4KROB 1H3VA 1QRKA 1FZKB 5C9JB 1A9EB 3QULB 4LP4A 4JDVB 4LSUH 5DF0A 1UVQB 1JI2A 3FZUD 4AT6A 1FBIH 4UBDC 4ZPTB 5F7YC 3H0TA 2CK2A 3W0WE 4OZHE 5EO1A 3VDBA 2FIKB 5HGDA 1QQDB 3KS0J 4JFXA 4ALAH 3QDJE 2X6MA 3QDHA 3WN5C 5D6DC 2FBOJ 3QWQB 4I3SH 3TIEA 1HH6B 1WC7A 3QZWA 5B3NA 5LQBH 1I7TA 1INDH 2IANB 4IMLB 4PJ8D 4LSVL 3N1GC 5ITBH 3QXVA 3UTOA 2MCPL 4W4OA 4HUXA 4XBEH 1NUGA 3P0GB 1FGNH 5B4MD 3VD7A 4CVZA 2BDNL 1NCDH 5DUPL 3VDCA 1KUMA 1U58B 3TA3B 5DQ9B 2NY3B 3RL2B 3MRKB 1NPUA 5FGCE 1RULH 3P77B 5F3BA 3IU3B 4UOW0 1YC7A 4FNLL 5HHMD 4LIQE 2QJDA 3BGMA 2G5RA 1CFBA 4YFDB 2V9TA 2YPLA 4RIRA 3IF1B 3MBED 4R7NB 4QRTA 5D9SA 4UIKL 2FZ3A 2R56L 1WBXB 4X9HA 4PGBB 3REWA 1NC4B 4HX1B 2BDNH 2NY1D 4KVNH 5ESQB 1P7KA 1JNJA 4YAQA 1NFKA 4L1DA 4LPTA 4JDTL 2OL3L 4M6OH 1K9TA 5HYSB 2BVOB 1YUHA 4K23H 1GGIL 3X12A 1BZ9A 4XAKD 1LVEA 4U1LA 4OD2B 2VOTA 1OP5K 4PRBB 3AMLA 3VXNB 1CE1H 1OHQA 5D2LE 2NXZD 5T1KA 3ARSA 1QKZL 1CZ8L 5KJRL 3GMPB 4UIKH 5EC1B 1T3FB 3ARGB 1OB1A 1DUZB 1YECH 4OLWL 4X5WA 3B2VH 3ALWA 1T5WB 2JJWA 2Y5TA 2COQA 1N5YH 4X9IA 3CXHK 1NUNB 3B9KD 1P84J 3OAUH 3L3GB 5HD8C 1C1EH 4J1UA 2IF7A 3GB7B 5GZND 2VQTA 2AQ1A 5HI3C 3EYVA 3TP4A 3IDGB 4HQQH 1UWGL 1I9EA 2X10A 1VFUA 2KZWA 4K8RL 2DQFA 4YPGB 2O93L 4HIEA 2M2DA 4QNPF 3ARDC 4K3JL 5KJRH 1CZ8H 1B4RA 2RJMA 4JCLA 3AU1B 4AT6B 3DBXA 3H0TB 4Z7NF 1N2RA 5I1GL 4EI6A 3IJHA 5EO1B 1B88A 5HGDB 2AXFA 1UACL 1X6NA 2IALA 1WFOA 4MYWB 3SQOL 3TIEB 1WC7B 4JZJA 1I7TB 3WUWB 5C0GA 3C5JA 4LU5H 1ZS8A 4KUZH 4HJ0D 4HUXB 4WUUE 2DL2A 3MPCA 4ELME 4NN7B 3V5HA 2XN9D 1U93A 4CVZB 2HP4A 5IFHL 5MEQA 4K94H 2VXSH 2WUBL 4HZLA 2W9EH 1H3GA 4ZPVA 1I7RA 2VB5A 3LEYL 5F3BB 2D0FA 2WSKA 3QUZC 5JUEH 3K2MC 5I18L 3QH3A 4ZSOA 1JWSA 2HKFL 1IKNA 4NKDA 2VXVH 5C0EA 3QXAA 4HH9A 1XAUA 3IDXH 1QRNE 2YPLB 4UDTA 4G6AD 4ZQKA 5GRVK 1OGAE 3DO7A 4QGYA 2YD7A 4QRTB 4R3SA 5D9SB 3JSSA 4ZOBA 4I1NB 2FZ3B 1QEWA 4JFDE 2EIDA 2XTJB 2KBGA 3L9RA 5IFHH 4BSVB 1P7KB 1WZ1L 4YAQB 4KVCH 5D5MF 3U2SA 5T3XL 2VKXA 5KVEL 4O51A 3LRHA 4JREB 4K8RD 3N06B 1P9MC 3X12B 2PXYC 1R5VA 2I9LA 1W72B 1YJDL 1BZ9B 1T80A 5HGGS 4Y5YC 3ROLA 4C56A 4M8QB 3EYSL 3KWWA 3MJ9A 4GH7B 5LBSL 4BQ8A 3WFCL 1Z9MA 3LS5H 4ZUVA 5T1KB 3T0ED 3K81A 2QSCH 2Q3ZA 3O4OB 2HLAB 2I26N 5ALCL 2Y5TB 3S88H 4WO4D 4P3CH 2Y06L 1KLFA 5E2TL 2QQKL 2LU4A 1JHKL 5FOBA 4XNYH 5IJKA 3MO1A 2D4FA 2UUDK 3LKNA 4J1UB 3HE7C 1INQA 5J1AB 2G2RB 1RZJC 3LEXA 1QYGL 3KYKH 1QBAA 1CDYA 2APTA 3EYVB 2DKSA 1NC2A 4M7LT 5EWIH 1UCBL 4N0YL 4JRWA 5ETUA 1CGWA 2DQFB 1FYTD 4TPRL 5LBSH 4HIEB 1OAQL 4MNQA 4I5BA 5IWLC 3BX7C 1KSRA 2OI9B 5FYKE 4AIXA 4E41B 3DBXB 4OCLC 4HUVA 5CJQH 4NN6B 5DFTA 1MCQA 3MRDA 3IJHB 4EI6B 5DQDL 1Q0YL 1BVZA 1F4WH 4R0LA 2W59A 4KXZH 2E27H 5DD0H 1YMMA 3VGAC 2IALB 3IXTA 1EEZA 3OXRB 3C60C 4KHTL 4JZJB 2YUVA 1QYGH 5C0GB 5FYLH 3C5JB 3T08A 2O5YH 3U1SL 1HCVA 1UCBH 4RMQA 3V5HB 3CH1A 1U93B 2D9CA 5MEQB 3IDIA 3W2DL 4QT5A 4U2YA 3UTPE 3I02B 5DO2C 1EAJA 4XWGL 4HZLB 4EIGB 4ZPVB 1FO0H 3LQZA 3HG1A 4HXAL 4U7SA 3AAZA 5GGTA 4M9OA 3TO4D 4ZSOB 4RFOL 1Z9SA 4HH9B 4WV1C 1U8JA 3MJ7A 1CICB 4M93C 4UDTB 4OLVH 4ZQKB 1P7QA 3FHAA 2F74A 1WBZA 2ITCA 4R3SB 2Z31C 3IJSA 2Y4SA 4KPHL 2IAMA 1KCVL 1BQHA 4OCXH 1NANH 3RNKA 3L9RB 1T0NB 5CGYC 3W2DH 3I9GL 3U2SB 4QTHA 4RAVA 1TJIH 2EXYC 4O51B 4HXAH 3HAEG 4HK0A 2FSEA 2HRPH 2WIIA 4PJBA 4KRPC 2J12B 3O8XC 3UO1H 5JW5A 5IMKA 5HYIA 1R5VB 2I9LB 5ILTL 3RVTC 5DI8A 2YN3A 3E1F1 1FPTH 4C56B 1ADQH 1OW0C 4Q0XH 4ZUUA 4S1DC 3HNTL 5IHLB 3KWWB 4GW1A 4ZUVB 3ZSTA 4LAJH 2PETA 1BFVL 1MRDL 3U9UA 3TC9A 3C09C 3CVHL 5E94A 3F7YA 3O6LH 2BRRH 1A6UL 4OM0L 2YRZA 5FOBB 3OG4B 3LKNB 3IRZA 4DGYL 2JJTC 3FO2A 4P5MB 2P5WB 3LEXB 3OTTA 4BH8A 4PJEE 4C83A 1G6RH 4DUXA 1NC2B 1UQSA 3V2AR 1NGPL 4J6RH 4PG2A 3BP4A 5ETUB 2QHRL 3QIBB 4U2ZA 1F3RB 3HNTH 3AFLA 4ORZC 4KI5F 3KLDA 4QOKE 4FQ1H 5F6HI 3ZKMC 5EOQL 2CLRB 4I5BB 4GBXA 2ESVD 5HPMA 5BW7A 1S3KL 1DVFC 5EA0L 4Y4KA 5DMGD 4WU5B 3OX8B 2X4PA 4R0LB 1BEYL 1J1PH 3BIBX 4LKXA 3SDDC 5D7LD 2DIAA 1RZGA 3IXTB 4LRIA 1DQJA 1EH9A 3CFEA 4KTEL 3GEWB 4K3EL 3RVWD 2D4DA 4JM2C 4RQQB 4UTBL 4Y2OA 3OXSA 2X4RA 3CH1B 4P4KD 2YMXH 3ME0A 1H9VA 5JW4N 3IDIB 1RZFL 4RA0C 5CJBA 4QT5B 3BQUB 1KPUA 3LQZB 2X4UA 3HG1B 2P46B 3AAZB 1PLGL 1A2YA 4W4NA 1RD6A 4HJJL 4KMTL 4M1CD 1ZAGA 2OXHA 5DVLA 1U8JB 3MJ7B 4NO0A 1L4IA 1UYWL 5HHOE 2F74B 1WBZB 2ITCB 3Q2CA 4UTBH 2ZUVA 2ENYA 4WTZA 4ZAKC 5C7XH 2IAMB 3KPRE 5IW1A 1U3ZA 1BQHB 3RNKB 1PKQE 2YC1A 4QTHB 4RAVB 3BPNC 3KPSB 2DM2A 5J8OA 4KQ3L 2FSEB 2WIIB 2AI0H 3L5JA 4PJBB 3FFDA 2XKNA 5JW5B 5IMKB 4LHJB 1NCCH 3FQNB 5ALBL 5F3HA 1R0AH 5EC2A 4LVHB 1P1ZA 1IM9A 4ZUUB 1YNTA 4XVTL 5F1KC 4XPFL 2J6EA 4XPBL 3KXFA 1UWEL 4X98B 1NDMB 3MV9E 3OR7A 4TSCL 2VZ1A 3U9UB 2OJEB 4G8GD 5ADOH 1S7QB 3V6FB 2YK1H 3F7YB 5T5FH 4YXLL 5BVPH 3BKYH 4KDTC 1EMTH 3QXWA 3GSUA 4DFIA 4DEPB 5T33L 3FO2B 4PRHE 4L8CA 5H37H 3LKQA 4C83B 4WTWA 3VWKC 2C1PA 3IKKA 1FZJA 1UQSB 5ALBH 4IRSD 4UT6L 2CIIA 4X7SL 4DN3L 1R5WA 3OWEA 3VFMA 5JHLH 5DT1H 1QP1A 4XPFH 3O4LE 3NCJL 5HPMB 1AJ7L 1UWEH 4U7MA 4RMTA 2E6QA 4QRSA 5TE6L 1FV1A 5DGRA 5L7XL 4NSKA 5B22A 4EZMA 2DLIA 2X4PB 3DTXA 4OGZA 3QO0A 4M02A 4YXLH 4LKXB 4GLRI 3MV7E 1RZGB 5T33H 4NIKB 1BJ8A 1DQJB 1KCUH 3LKSB 2J4WH 2DL9A 5DD5L 3B2UC 2X4RB 2YD8A 4XNUH 2VL4A 3S37L 4L8BB 4UTAL 3U0WH 4IRJA 2ICWJ 4GQ9H 3PGFL 2AK1L 1KPUB 3H9ZA 2X4UB 5EZIL 2V9RA 3C08H 5IGXL 4EDWH 3L3IA 1VHPA 2NY4C 4U1KB 4MA7L 4W70A 3U4BL 4JCMA 3D3VE 2DQIH 4HUNB 4LCWB 2IBZX 4JN1L 4ZFOA 3EOYG 2WUCL 1I1AA 1RUML 2NXYB 5EORL 1NGWB 5DS8A 3T2NL 2J8OA 1WFUA 4G43B 1MNUL 1Z5LA 3S37H 1VEMA 2APXA 5I30H 3PWLA 5I1DA 1A7PH 4RAUA 2AK1H 4U0RC 4YGVA 2HKHL 1DBJH 1C08B 3WO4B 4GJTB 3FFDB 2XKNB 3IB4A 4FTVE 1A21A 3RBGA 2ZP0T 4NO3B 1JUFA 3DI3B 2VLJD 3D69A 3FZUC 5F3HB 4R26H 5IF0A 1P1ZB 2C9AA 1YNTB 3EOTH 4JN1H 2GY5A 4PTUA 2X70A 1M7IA 3IDJB 4FMKA 4NP4H 3KXFB 5IVZA 3OR7B 1DBBH 2R29H 3T2NH 2Y9RT 5I2IA 2W65A 3WXVL 5JORA 4M62L 5C0BD 3IFNH 5KBNC 4PJ8C 3OZ9H 2K1MA 5DD1L 2CKNA 1X4ZA 2ZJSL 3BZ4A 1MJ8L 1YY9D 2KQMA 1E28B 3QFJD 2XQBH 3RY6A 3FRPG 4IIQA 1IC4H 2HKHH 5E70A 3OF6D 2Z8VC 3LKQB 4I9WE 2C1PB 5C0RL 3PL6A 5IB2A 2CIIB 5LXGH 1DQLL 3UTTD 5EN2B 1LK3H 3T4YA 2O61B 2BVPA 5KN5A 1TZGL 1TJGL 3DYPA 1G1YA 5DK0A 4NQEA 3RTQA 3TPKA 3H3PL 4OJFL 4OIAA 4UZGA 2FB4L 1GL4B 3WXVH 3CD4A 3LKOA 5IROC 2PF6A 4JAMA 1FV1B 1RHFA 5FCUL 4Y1AD 3MBEC 3DTXB 5CIPH 3CZFB 1U8QA 3QO0B 4M61A 5TFSH 4A6YH 4HT1H 5JDJA 2NX5D 1MELA 2IADA 1R3HB 4PJ5E 1RUKH 2ZNXA 2DQJH 2NY1C 4JFFD 1ONQA 1BJMA 1KBGL 2Q7YA 3BDYL 2WIMA 1GGCL 3FOMB 1JTPA 3BKMH 3EHBC 4XNZC 5MHSE 1AXTL 3RVUD 4I18B 4RBPH 1DLFL 4IRJB 4OJFH 4EI5D 3WLBA 1A7RL 4Y4FA 5JOEA 2NXZC 4JJHA 5DZLA 2AXHA 1EBPA 1AO7B 4F33A 3BDXA 2BSTA 4QWWD 4FQXD 4F7MA 4HWZA 4Z7OF 2EDDA 5TJWK 1UH3A 5C8JA 1XR9A 3BDBA 4PLJC 15C8H 1ZHLB 1HEZA 5D1ZA 1I1AB 3B9KC 1BPVA 2BXZA 3QUYD 4GRMB 1WAAA 1DP0A 2QSQA 1GGCH 1SM3L 1OAXH 4XHQA 5GZNC 4X4ZA 2ED7A 1XF3A 3PWLB 5I1DB