5T3ZD

3.5 angstrom crystal structure of a fully and natively glycosylated bg505 sosip.664 hiv-1 env trimer in complex with the broadly neutralizing antibodies ioma and 10-1074
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
229
structure length
229
Chain Sequence
EVQLVESGAQVKKPGASVTVSCTASGYKFTGYHMHWVRQAPGRGLEWMGWINPFRGAVKYPQNFRGRVSMTRDTSMEIFYMELSRLTSDDTAVYYCAREMFDSSADWSPWRGMVAWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
publication title Natively glycosylated HIV-1 Env structure reveals new mode for antibody recognition of the CD4-binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 32
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2016-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t3zD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t3zD01
3LQZB 4PS4L 1A9BA 2DQGL 3QUZC 3BPOC 4BZ1H 4WUUE 3B2VL 2PO6C 2D31A 3VFNB 3RZCD 3NABH 1M4KA 1VGKA 3GJFH 2OYPA 3MRPA 3K8MA 5I1LB 1FCCA 12E8H 3UJJH 3R8BB 5JZ7D 1IT9H 1X7QA 3WUWB 1PSKH 2DBJA 4CU7A 1JZ8A 3VGBA 3WNLA 3ZL4H 3RZCA 4WTZA 1ZOXA 4QRPD 4PJFF 5GJSL 3MUGA 1NMBL 5HYIA 4R7DA 1BX2B 5HGAB 3ARTA 2HFGL 3BKJL 3HI6H 4X6DE 1WZ1H 3G5YA 1BMGA 2VH5L 3GMLA 4JGJA 3OHXA 5E4EC 5C0AD 4JAMB 2ZSWB 4PJ7F 1RV6X 3F5WB 1B0RA 5KSAC 4QRRD 1IM9D 2H32A 2W9DL 2VLME 3OG6B 3D69A 4NCC2 2GK2A 3ILQD 3UEZA 5C0AA 2OJZH 2VQ1A 4IRSB 1LE9B 3QHFL 4N0YH 3GMOB 2XA8H 4G8EA 1IM9A 1KFAH 4QRRA 4KRNA 2P46B 2YPKB 5DHXB 1NLBL 3DETC 1WLHA 3SDYL 5DJAB 3FQWB 1U6AL 5CILL 1QQDA 2YC1B 3SDDC 1JGVL 3T65B 3A6BL 2HTKD 5IVZA 1KSRA 4IOFD 3VFMA 1XF5B 2DQEL 1XGPB 4AZ8A 4NKQB 4V2CB 5DA0B 4Z0XB 3MA9H 1EGJA 1OAQH 4K94H 5CKAA 2HG5A 1FV1B 4YDKH 5IW3A 4ZS7H 5C08D 3RU8H 3MV9E 3PG2A 1U3HB 1KTKE 4GRLB 3MLWL 2IGFL 1WV7T 1G9NL 2I9LB 9CGTA 1BJMA 4NZDA 4LKCA 1IAOA 3FN0H 5E08L 1HIMH 3V4PH 5GRVK 3V5DB 4PREA 3BPNB 2VDOL 5C08A 2LVCA 1A0QL 2GHWB 3UTPE 2UWEF 1MCWW 1CFVL 4C56E 3G5VB 1LO2H 4OM0H 4BH7A 4R4ND 4XNZC 4JHWH 4PJ8B 4KHXH 5BMFH 2JJVA 1UXSA 2FX8H 2OP4L 4RA0C 3TPUB 2CDFA 4FZ8H 5DD1L 1VB9A 4R3SA 4OZGE 3KPRB 5GGTA 5GS3A 1DL7L 4JRWA 4I3SH 1U58B 3OKMA 2K7PA 3SJVE 2ATKA 4UUJA 4LPUA 4KJYB 3LQAL 5F88B 4WTXA 5GJTH 4YXLL 3OKDB 4I18C 1S7XB 3CPLA 3AXLB 4JGMA 4O5LL 4F7EB 5E8EB 5T1LD 3EZJB 3S35H 1IEBA 1AFVH 5E1AA 2HFFA 2NY1C 2A0LD 4TSCL 5B3NA 3ZDXF 2ZUTA 3P4MA 4LMQI 3MRHB 4TSBH 3VGHA 1SVZA 4PTUA 4JPKH 1BJ8A 3TBVB 3T3PF 3ZHLA 4HCRA 5J1TC 4U1IB 1XF3B 3BRGC 2MKLC 3NPZB 3OXRB 4PYGA 4ZS6C 3VXOB 1BPVA 1NCCH 3PHQB 4MA1B 2A6IA 2E9BA 1CD1A 3TNMB 4H26A 3FQXA 1N5AA 4MD5A 3UBXA 1G0XA 4LLWB 4FHBD 1CXLA 2NW2B 3BGAA 1EO7A 3VWKC 4PJCA 4OD2A 4POUB 2D7PA 3KR3H 5CWSB 3AUVA 4XHJD 3P2TA 1YDPB 3EDEA 2COQA 3RI5K 3THMH 2PTTA 5EZOH 1J1XH 4GBXB 3VD9A 4LGPB 4MZ2A 1MRCH 1U8JA 5CEZL 2ID5A 2HKHL 2OJEB 2F53E 2WUCH 5I1JH 2X44D 4P4KD 1WZKA 2A38A 4KKNA 4UIKL 3RGVB 3RTQD 3FT2A 1BFOA 3UP1A 2YKLL 5FOJA 3WIIL 2WBKA 5LXGL 2XRAL 3TYFB 4XBGA 4QRTB 2J2ZA 4NUGH 2FHFA 1JBJA 1RUKH 1CGWA 3D18A 1JNHA 2EZ0D 4AT6A 1QVOB 1S9VA 4HMEA 4P4KA 4LCCB 1TVHA 1UGNA 1NMCC 4BKLA 4F7CB 1MLCB 3ALXA 3V0WL 1AD9B 4ZUSB 5T3XD 1WJ3A 2VZTA 4JZNA 2Q7NA 1F3DH 3SGKA 1EEQA 5DJ8B 3GKWH 4IRZH 4TSAH 4WEMB 1HYSC 3KPNA 5DVMA 3WL9B 2Y7QB 3EYFA 3MR9A 3V95A 1XCTA 8CGTA 1N3NB 1DUYA 4X6DF 5GIRA 3QDGE 2W0PA 2WWMC 4Y16D 5CINL 3BH9B 5J06A 3NZ8B 4LLDB 5HYJA 4G6FB 2HKFH 3U9UB 5EU6D 4EIZC 1YYMH 1P4LA 4P99A 1HHIA 4XPAH 4Y16A 1KIUA 3RWGA 43C9A 2R1WB 2VDQL 4MQTB 5JW5B 2XG4A 4DUVA 5EU6A 3S36X 5F1OB 1OWRM 4N8VB 3C8KA 4HXAL 5BO1L 5FXCH 4DKEH 3ZKMD 4J3VA 4QHUB 5DRWB 4I2XE 4B53A 1RZJH 1ZVYA 2QTEA 4JG1H 4M8VA 1GIGH 3T0EB 2R2HA 5JNYB 1NAML 5DF0A 4PJFB 3DUSA 2VDRH 1OP5H 4G9FB 4Y5XA 1E28A 4U1GC 3L7FA 1W72A 4MDJA 2G9HA 1OM3L 5F96L 5DDHA 3Q1SH 5TH2B 1AP2B 3GSNA 4PYHA 1H3GA 2VC2L 4FG6C 4PJ7B 1HHJA 1T4KB 1IT9L 4WEBL 4XXCA 3UJJL 1PSKL 1PY9A 3RVXC 4WO4C 3ZL4L 4XC1H 5ESAB 5EWIH 1N4XH 5ICZB 4R4BA 4XRCB 3CSYA 3DVGB 3V5KB 1A1NA 2VLKD 4ONHA 4KQ4H 1DLFH 3HI6L 1PZ5A 5DJDA 1WZ1L 4DCQB 5K93A 1FL5A 4QGYA 2YA0A 4JHZA 2FJHA 3HC3L 1R3HB 4XNMB 4JFPA 3WFEH 3OGCA 4G42B 1HH6B 3MXWL 4HIXH 3T04D 1K3IA 3OAZH 5ANMB 2K9UA 4JFHD 4LSVH 4M7LT 4JFFD 3HE6B 3DX6B 1PG7W 3VRJB 2CH8A 4X4ME 5C0EB 1T6WA 4NKOB 1T5XB 4NKMB 3UXFA 1VFMA 3CUPB 1WAAE 5E8OB 3KYAA 1TQCC 2VR4A 2DKMA 3O3EA 5DS8A 1IMHC 3FQTA 3O2DH 3GIVA 5ITFB 3WO3B 4R0LB 4QOKB 1GC1C 3BT2H 5CJ8A 2EKSA 1ZTXL 2V2WB 1BF8A 1OAQL 3SDCC 3VXUA 3CJJA 2UWEB 4K94L 3DV4A 4MJID 4KU1A 4RAHA 1H5BC 5IMOB 1CXIA 5GS1C 2DJUA 2HJLB 3RU8L 4ETQA 3L3GA 1KB9K 2A6JB 4K8RL 3QIWB 1PX3A 2YA1A 1S7QB 3TN0D 5HHNA 2I9TB 3IDYB 3HCVB 4MJIA 4Z7OE 2P8PB 1DBJL 3TIDA 2CR6A 1HIML 1I1RA 1KJMA 5CEYA 1OVZA 4OCNC 1ZEAH 1W0WB 3K1DA 5AD0B 1LP9E 4OCRL 3EYQC 1LO2L 4OQTH 3TN0A 5MEPA 3TO4C 3WO4B 3GMMB 4KHXL 4E5XA 2GTWA 3P4LA 4IM8A 4PRIB 4YK4B 1A7BA 2VXVL 3EYUH 4FZ8L 3HAEB 4RGNB 1J8HE 1VEOA 3IJYB 4ODUA 4M5YH 4I3SL 4U1KB 1HNGA 5GJTL 4U4BA 2AK4E 5CCKH 1M71B 5EULV 2WBJB 4BA8A 3PUCA 1N59A 1I9RH 4LLQB 1UVQB 1YNKL 1UM5L 4WI7A 1YEEL 4PY7B 4ISVA 1AD0B 2BXZA 3S35L 1AFVL 1U3YA 2VXSL 1QNZL 3CLFH 4PJXF 4OLXL 4TSBL 4JDTL 1RZ8B 4TN9A 3B2UC 1B4JH 5I8KH 1RVFH 2FR4A 1M6OB 1NCCL 2XQYK 1ADQH 1UKQA 1MVUA 1E0OB 2WANA 4U2ZA 2XTLA 2IFFL 1OAKL 3ECBA 3VMPA 3ZDZE 5D2NC 1HSBB 1X4YA 3LPFA 4LSRL 3NMEA 2AV7B 2F19H 4BQ6A 2HLFC 1VPOH 3EYVA 4J3WA 4IDLA 4X7SH 1A1MA 5B8CB 1T0MA 1HZHH 4HKBA 3QXDB 5E00B 4OD3L 1C5BH 1N6VA 3OJVC 4CN1A 3P9LA 1FNGB 2PCPA 4FQXB 5EZOL 4XP6L 4NC1C 1MRCL 1DBML 1A6WH 2CLRB 4L5FH 3U4BL 4WUUB 1HILA 1OTTC 1FIGL 3CZFB 5IFAH 1WK0A 1KCVL 3KPQA 4UMGA 5I1JL 5F7YC 4X5WA 4P2CG 2ED8A 4LBEB 4N8PA 5I76A 4NQXA 3EOAA 1Q72H 1S7VB 2VL5A 3NFNA 1KPUB 2R39A 4NUGL 4HGKC 5JXEC 2X9YA 1R5IA 2BFVH 4JY6B 5IMKB 4U6VL 2EE3A 4PJGB 2A73A 2NY6B 5IT2L 4C4KT 4EOWH 3Q0HA 1EXUA 5FO8A 1M7IB 2DQCH 4DW2H 5I1CL 2NQCA 4RSVA 2VDMH 3L5IA 4OUUB 1MUJA 4YFLI 1ND0B 3J7HA 1NJ9A 4XPFH 3F58L 3WHE0 4IRZL 2PYEE 3NACL 1MCRA 3OKEB 3V5HA 2A6KA 2CLVB 2KKQA 4O9HL 4JDVB 1IBGH 4U6XA 2WQ8A 1Z9LA 5IVNA 4JHAH 1DQMH 2BVYA 5CP3A 1W8OA 4I77L 3MJ8A 4KKLC 2OR7A 1QHPA 1VADA 5HHVL 1HQRA 4GXVL 1OLLA 5I1HH 3D85B 5DZNA 3MOQA 3AAZA 1TCRA 1A4KA 2HKFL 2W60B 1U3HC 4GRLC 5F3HB 3O6FD 5FV2A 3JBG7 4IJ3C 1YYML 5IOPA 4KROC 2P47B 3QXVA 1OSPL 1S9WB 2ZOLA 3WNPA 4JRXD 4ODXB 3AU1A 3JWOC 3BE1H 5ADOL 1B3JA 3MRDA 5TGBB 3O6FA 1WAAF 2X6MA 3ULVC 1TENA 4QT5A 2P1YA 3MV9B 5GRZA 4AQOA 4PJ8C 4U49A 1S3KH 3AS2A 4DKEL 4KKCD 4JRXA 3GSUA 2X10A 3BEVA 3MV7D 5DD5H 5JA8B 3PV6A 3KS0J 2HFTA 1QBAA 1ONQB 5DFWH 5ERWA 4XB7A 1YN6A 1Z5LB 1C12A 2XA3A 2YMXH 3MNVA 4C56B 5ID0A 5J8OA 3UTTD 1EX0A 3UO1H 1XR9B 1QO3A 1YN7A 3HUJE 5F7KC 4GAYA 3DRQB 3Q1SL 1FNAA 4Z7OF 4YFDB 3NOIA 1OB1B 1QSFE 4WVRA 3SJVB 3K2MC 5TPWH 3UTTA 4XC1L 1FAIL 1N4XL 2CLZB 5FDYA 4HUWB 4GMSL 4ZYKB 1LP9F 5SX5K 4KQ4L 1OGAD 3EO1B 4GQPH 5IB1A 2MCPL 4MA1C 3MLRH 1I4FB 1NBYB 3W5NA 3MRNA 1DQJB 3UPCA 1UM6H 3BP5B 2WW8A 3WNMA 2ZCLH 3HC0B 4XWGH 4J8RA 1OGAA 3HMWL 4YDVB 1BZQK 4HJ0D 4JPVL 2XQBL 1ZS8B 3KNBB 4KDTA 3QWRD 5F7DB 1T21B 5FO9B 2VRAA 1I7TA 3OAUH 3GSQB 3LPWA 1ZVSA 4KUZL 2J8UB 2ZJSH 2H2SC 3T4YB 4YPGB 3MUY1 1EIBA 3DX7B 2WIIA 4AIZA 1CTNA 4Y19E 3SDXE 3QWRA 4Z7UE 3PWVB 2HTLD 3HFMH 1NGWA 3QEUB 4X9IA 1MCLA 1XF2A 2ICEA 2VZ3A 4LHJB 3MROB 3MRKA 3MRCB 2NMSA 3RIFF 3GSVA 2YD6A 3O3UN 2VLRA 5D1QD 3RGVC 4P2OC 3MLYH 1CFQB 1IGCH 1VACA 3T1FA 3ZHDA 3SDAD 3ZDZF 3MMEB 3HZKA 2BNQD 3O3DB 5HHXH 1Q38A 3ARZA 3U0PB 5D1QA 5HGGS 3O3AA 2GUOB 2FO4A 5MEND 3LZFH 5EU5B 3SDAA 2F53B 5BS0E 1ZEAL 3EIFA 4M6OH 4XZUB 5BCAA 2BNQA 2DLEA 1RUQH 4OQTL 3OR7B 4TRPL 5BVJB 1CGYA 3BP7A 5E6IC 4BUGA 2YBRA 3LDBC 2ADIA 4KVNH 1IC4H 3EYUL 4PRDB 2ZUQB 3IJHA 5MENA 5FB8B 2HT3C 4XNQA 4HGWB 4PJXB 3L3IB 1PKOA 5EO9A 3P4NA 1G9NC 1I7UB 3U7WH 4OFIA 1I8KB 3IF1A 4HG4K 4YHOL 1NBZA 1CXEA 4Z6AT 4QXWA 2D0GA 2P5WB 3C08H 1MJUL 2J4WL 4P0DA 4HWBL 3H9HA 4HLJA 3OKNA 3EO9H 2Q3ZA 3MX0A 3H2WA 5BVPL 1U8QB 4TTDD 4TNWK 1MFDL 3RX8A 1LEIA 3GHBH 2GK0B 5C0CD 7CGTA 3CFCL 1HSAB 1AQDA 2N7BA 1MI5D 3I6GA 1RJLA 3MQIA 3QDGB 5CGMA 1B4JL 4PGBA 1TNNA 2QADB 4Y4KB 4NYLA 4M5ZH 5DGQA 3TT3H 5HYSG 4PJEA 3ARGB 4KJPC 1D9KD 5C0CA 5ICYB 5CGYC 3LQAC 4XWOC 4Z95L 1MI5A 1ED3A 3GGWA 3UJTH 1VGEH 3E0GA 4HWZA 5MEOA 3STLA 1CLCA 2V9QA 5AYUL 4U7MA 4X7SL 4E9LA 1U3ZA 4H25B 2XIDA 3K1KC 1D9KA 4WFFD 1LE5A 1KACB 1RUAL 5EPMA 1HZHL 5DD3L 2PW2A 1LEKA 1C5BL 4HMDA 4HH9B 4MJ5B 5GZNC 4D8PB 1HEZA 4I2XB 5CD5C 5ESQB 3AREC 1UM4H 4XBPB 3GSWB 5EU3A 3RVUC 3VWJC 5JHDB 1YEHL 4BFBD 1LO5A 3BQUD 4Z0BH 4XNXH 5C0NC 3WEXA 1IEHA 5JLZB 5H37G 5KAQG 4NHCH 4K9EC 4O2CB 4Q6YA 4HUKB 2YXFA 2ICWB 1N6QL 4K3EL 3BQUA 3PIQB 5D2LA 3FFCD 3W9EA 1MCEA 1NBVL 3MGTB 5B39B 6FABL 1U92A 2R1XA 5JQ6H 2X4QA 1QSVA 1VA9A 1EVTC 2KBGA 3MRIB 4OIAA 3LH2H 1S7RA 2DQCL 3QSKB 2IBZX 3FFCA 2VDML 2AVGA 1MCIA 3HUJF 2N1KA 4Y5YB 5TDPA 4UV7L 3TJHD 2HLAA 3VG0H 4XC3H 4R0LC 3FMGL 4M48L 3PDOB 1CGUA 3D2UD 2CK0H 2J6EH 4H8WH 3BJ91 1IBGL 1BQHB 3TZVC 1CR9H 1CDIA 5HD8C 4QF1A 4YC2C 3MCLL 2DLFH 2XFXB 4OSUH 5FV1L 1X5HA 3GK8L 5I1HL 4HUUB 1JWUB 1FO0A 3D2UA 4F7MB 4ZD3L 1LHZA 3B3IA 1F00I 1X5ZA 3KPSD 2W9EH 3HZVA 2DAVA 1KB5A 3IDYC 3OG4B 1YPZB 3ARWA 5I16A 2UZXB 1NL0L 1AGCB 1DUZB 3BE1L 5IB4B 3QDAA 5IG7A 1B90A 2IQ9H 3ZLQC 3KPSA 5KN5A 1QLFA 3GSXB 4H5SB 3TJEH 4P46C 4ZXBD 3WO4C 2NY4D 4YK4C 4OTXL 3PHSA 3NVQA 4Z7UF 5EU4B 4N1CA 2FL5A 3HE7C 5CD3B 3E2HC 5AAWA 4Q9QH 3MNZB 2K7QA 1UB5A 1ZA6A 1E6OH 1SM3H 2CDGB 4L8SB 4LVHC 4ZXBA 4JFOB 1EBAA 3IXAB 3R1GH 4S1RL 2J88L 5EB9A 4ORZC 3W39B 1LP9B 4GAJL 1A2YB 4OZHE 4EVNB 4LLMB 3MBEB 2WBJC 3BIKB 3TBYA 5L2KE 2NY3B 3WN5B 4BZ2H 4JRYE 1KENH 3LEVH 3QCUL 4YH6A 5D7IE 1KGCD 5HGDB 1QTYT 2IPTL 4PRPD 4S0TD 4XCCH 1G1CA 2XZCH 5CSGA 3C9NA 1JGDA 3KYMB 3ZT5A 1PGRB 5ISZA 1S5HB 1P1ZA 1YY9D 2QBWA 4LCIH 2A1WL 4LPTA 5GRJH 2AK4B 3IFPB 3EFDH 4PRPA 5CAYB 2AGJH 4MAYA 4M6NH 4L4VD 4HGMA 3NH7L 1BECA 4S1DD 3RWJA 4QTHA 1I9IH 3CDFA 4D9LH 5A2KH 3PL6B 1UM6L 3RWEA 4PJIE 1R0AL 5EZJB 1K4DB 4XWGL 3G04B 3NBNA 4PFEA 3QI9C 4DGIH 1NEZA 3OB0H 1MLBB 3O3BA 2LE9A 2XWJA 5EOTB 5CJOH 1BQLL 1SYSA 4HWEL 2X4RB 4URTB 3AB0B 4HF5H 5A2JH 3BKYH 2X4SB 5EO0B 3T0WA 4U1SA 5D70L 5GGRA 1JHKH 4LLUA 2D7QA 3L6FA 4CW1A 5SWZB 4FQXC 3QA3B 4Y4HB 5CHNB 1Q0YH 4EXKA 3RWHA 4M1CD 4AENA 1QACA 5CZKA 4P23B 4S2SA 5I0DA 3HFML 4PRNB 4XAWH 4PJAE 2JJTA 1CXHA 4LCWB 3OZ9H 5I1DA 1IGCL 1QRNE 4YBQC 1X5JA 1ZLVH 3RAJH 1EO5A 3B9EA 2EDTA 2NY6C 5FYKL 1SBSH 2R23A 5T1DH 5B3JE 1MHHA 1EA9C 3LZFL 1K4CA 1Y18B 5A16A 4NNYB 1IE5A 1MWAL 3BUYA 2WAHA 4DKFH 1FLRH 4LNRA 4XI5C 4MB3A 3QQ4A 5IKCB 4GKNB 5D7LD 3WUWG 4L3CA 3I84A 4KVNL 4K94C 1IC4L 1GL4B 4XX1G 5J1AA 3SGDI 4M6MH 1F97A 5GGVY 5GS0H 3L5WA 4K8RC 3L5XH 2APBA 3U7WL 1R3IH 4TUOA 5JIHA 3ZT6A 2GSIA 2GCYB 4X7DC 1PD6A 2PYFA 3QFJE 2PYEB 4JQVC 1BVKA 2QQNL 3EO9L 2JLLA 4JPWH 4JB9H 3AM8A 3GJFK 4OFPA 4MNGA 4NQDD 5CSBA 2VB5A 2VZSA 1YJDL 3K8KA 5F1SA 3ES6B 2H3NA 3GJEA 4WHYG 3DO7B 1BZ9A 3DXAD 4M5ZL 4KKBD 2FWOB 3AY4C 3IU3A 4NQDA 4HKZB 3F7RA 2P48B 2JIXD 2X4UA 3WE6B 5TF1H 2DQDL 5E2UL 1F6LL 3REVB 3T2OA 2GT9A 3UJTL 2IAMB 4L8CB 2MJWA 8FABA 2Y5TA 2HN7A 2JIXA 3GDBA 1OTSC 2OR9H 2E7LC 2Y06H 4NRYA 4NPYA 3NZHH 3VXRB 4PUBH 3Q6GL 1BZ7A 4P59H 2HH0H 2WWKT 1UM4L 1FH5H 1PKQE 5ALCL 1I3RA 2JF1A 3RWDB 3SCMB 4Q6IA 3T09A 4FFVD 4HZAA 3OB8A 5IBLD 1FFQA 1P4BH 4LMQE 1L0XA 1MAJA 5DYOA 2RQ8A 1MFAH 1PQZA 4C83B 4NHCL 2IH1A 3I3EA 2BSRA 2X05A 3HUJB 1M1SA 3L3HB 1T1YA 1JF1A 3DWTA 5DUBB 1FSKC 1MCKA 3C5JA 1G7LB 3BO8A 4NQSB 1MHCA 4JPIB 4NNXB 5TJWK 4BQBA 1QSFB 4RBPH 3FB8B 3QUYB 3V8OA 5JQ6L 2PO6D 1FVEB 5K9OA 2DB8A 3MNWA 4OZHF 3UAJC 4PTTB 3QISA 1INEL 2ZG2A 2V7NB 3QUZA 5FECB 4I0PB 2O5XH 5EIQA 1OGTA 1T7VA 4GW4B 3QNYB 4KFZC 4R26L 5D7IF 5DK2A 3CH1B 2Z91A 3EHBC 5JDSB 2PO6A 1NGPL 4W6YB 1JNLH 2P7TB 3FQUB 4CJ0A 1QFOA 3QIUD 4XXDB 4MNHA 1RZIB 5FHBH 2CK0L 4H8WL 3K4AA 2DMKA 4FQLL 1KCLA 3OF6D 2NZ9C 3L7EB 5IM7A 5GGTL 1NMAL 1YC7A 2DLFL 5EOCH 3B9VA 1SBBA 4ZPTA 5I8OH 1ZWIB 5KW9H 4LPWA 3QIUA 2EYSB 5L9DL 3AS1A 5KSAD 3V6OE 3OF6A 4PJIF 1F3JA 4NT6B 4Y19B 3H9SE 4YHPA 3VFUB 1FFOA 1P2CB 2W9EL 5I73B 1MWAB 1PBYA 5HHPA 1CZ8H 5FA3B 3ZYIA 5C92A 3CX5J 4D0CA 2CUHA 5B22A 2HWZL 4MQ7B 5KSAA 2E7CA 2QSVA 5TE6H 1CGSL 1T80A 3WD5L 4PRHD 3A0OA 5DC0A 3TJEL 2Y36H 3QEHB 5CBAA 5LBSL 1YUHA 4UINH 1UZ8B 4GRMB 4F7TB 3QQNA 1CLYH 2OZ4L 1JGEA 4Q9QL 5H2BA 4PRHA 3G5ZA 4NBXB 1E6OL 1SM3L 2VR9A 4PJAF 2H9GA 3LN4A 5BS0B 3TYGH 3WKNA 4D0BB 1CGVA 2EO1A 2BCKB 1QYGL 1UKSA 3VI3F 1SJEA 4FMFA 3QUMH 4X6FB 5GSRA 3TM6A 1RIVL 4YHLL 1T3FB 4BZ2L 1S9KC 4HMCA 4XCCL 5FKAB 2XZCL 1F6AA 1KELH 2M8XA 4GFTB 5EUKB 1D5MB 4ACPA 4LCIL 3RY6C 5GRJL 3S4SB 2ZP0T 3SE4A 5C0DA 4N9GB 4Y4KC 5CP7B 2XTJE 3HG1D 1U8HA 5TDOA 2AGJL 2BMKA 4UOJA 4JANB 1MFCH 1I9IL 5DJYA 2OTUB 1RHFA 4D9LL 1WISA 1N64H 2AI0H 4XVTH 4MJ6A 1KIPB 2I5YL 5LGKA 3HG1A 5FYJE 3MJ9H 4JFDD 4HFWA 4PIRF 1ORSB 2R0KH 2X7LB 4DGIL 2XPGB 4PG9A 1NLDH 5CJOL 3MLXH 1NGYB 5BXFA 2R4RH 3C6SB 3MACL 1EVUA 2VLLB 5IF0B 4HS8H 5IW1B 3U46B 4LHUG 3T8XB 5JIPA 2NYYC 1JHKL 3BZDA 4L29B 3MYJB 2IBZY 4JFDA 4OZFB 4NQTA 4PV8A 4I18A 1VESA 4NM4L 1MJ7L 4U1LB 1Q0YL 4PLKD 4ZAKC 1S9YA 2B5IB 3DX9A 5FM5M 3I6LD 1FQ9C 4ZS6D 1ACZA 3UJIH 3BEWA 4FRWA 4NC2B 4JFEB 5FYJH 5D5ME 2IMNA 5IB2A 4OZIA 4D0DB 1G7MA 3BGMB 3F6LA 1MREL 1PAMA 1F4WH 3HA0A 4CDHA 2ZSVA 3CU1A 3RAJL 3F7YB 1CFTA 2EDOA 3DTXB 3QG6B 3H9YA 1WC7B 2BNRE 2OL3H 2PR4L 3UTQB 3S36L 5I9QB 2YEZB 2CO7B 3VWKD 5I75C 4I1NB 1F4XL 3RL1A 4BFIA 3SY0A 3E8UH 3V4VH 4PJ5A 1FLRL 4DVBB 1I1FA 4HK3N 3VWKA 2D0FA 1N5YH 1NC4B 6CGTA 5FGBA 4PGEA 1UWGH 2R1YB 2XACC 4DGVL 3O9WB 5FUOH 4M6ML 5GS0L 4BZYA 4NQVB 1DANT 1NGXB 3KJ4B 3ALWA 2IPUK 3VGAB 3QO1B 4ZPVA 3HLAA 3LKQB 3GNML 1OP5K 3UZQA 3PWLA 2NY2C 2OSLA 1FZMB 3P0YH 5K9QG 4JPWL 5T1KD 2DL9A 3CDYA 2KUTA 5CJQH 4G8GD 3V8CA 5T3ZE 1JGUL 1A3QA 3PP3H 3QYCA 3IDGA 4WU7A 5T1KA 4N0UA 4OCXL 5E2JA 4WIQA 3L3DB 4G8GA 3VJ6B 4NO3B 1SEBA 4S1SH 5TF1L 4HIIB 2W0KA 2AXGA 5DR5H 4NWUL 5E0QA 5HYQA 5BOPA 4L8SC 2WWMD 1OHQA 3INUH 3OAZK 2A83A 2AP2A 4HC1A 2EEDA 2NLJA 3F12A 3MBEC 3QUKB 4LVOB 2JJWA 2Y06L 1MJJB 1N2RA 1NFIA 3KXFE 5GRXG 2NY3C 4P5KA 3WN5C 1JWMB 4QO1A 3VXSD 4L3EB 3FRPG 4PUBL 3DX8A 3EOBA 4XP9H 4RA3A 3MUJA 1NKOA 4KY1L 1F8TL 3L9RA 1W0VA 3QDJE 5FO7B 1ZK9A 1WBXB 1CDCA 3VXSA 1IEAB 4X5XA 5JPNA 5T1MB 1JFQH 1S8DB 5DMKB 2XWBB 2OMNA 3H3PL 5L2KB 4NJ9H 1RHHA 1XCQB 4JRYB 4R6UA 5D7IB 2RBLA 4OCYL 3HAEG 3HTLX 4WFHE 3L3KA 4NBYB 3GKZA 4X98B 3WS3A 5GGQH 4FABH 4WY7H 4RAVA 1Q1JH 3DURB 1Q8MA 5L8KB 1AI1L 3AB0C 3MLSH 1WBZB 2O5ZH 1KCUH 4WO4D 5I1KL 2H1PL 4AY0A 3S34H 4ZO7A 1FJ1A 4NFDA 4Y4HC 2FBJH 1M05A 5SWQB 2C7UA 3DSFL 5DD6A 1FVDB 1JWSB 4P23C 4GOSA 5K9KA 3CFIC 2V5RA 4X7TA 4M6AA 3UPAA 3IVKA 1NANH 4WO4A 2QKIA 4K3GA 5I8OL 5KW9L 3JV6A 2VITB 5IK3B 1BWWA 5MI0B 4TVPD 5FOBA 3KPOB 1I1YB 5H35B 5FYJU 1NUFA 1CZ8L 3MRRB 1KEML 2QR0B 1LO0L 4NN6C 3FO0L 3QDMA 2P24B 1UYWH 2WM0A 5EZIL 5TE6L 1K5NB 2CMRL 2QJDA 2GAZB 3MUHL 1CDHA 5I8CB 5CSZA 3KLHC 4UINL 4LAQL 3CMOH 1CLYL 5CZXD 15C8L 5LGJA 2H26A 2R56H 3O4LE 4QHNB 5SWSD 5ICXA 1F90L 1DFBH 3QUML 3QCTL 1JPFA 3U83A 1H5BA 4PP1C 2KPNA 5GS1A 4WV1B 3VXME 4KXZH 3Q5YA 5FKPA 5E7BA 5J13B 2ZPKH 1IC7L 3IDUA 4M00A 3RIFK 4AEEA 3LMJH 1A6AA 5E94B 5J1SC 1BVLA 1DN0A 4OJFH 5ENWA 1KPRA 1LWRA 2XY1A 3QNXA 3QFJB 1I1AB 1V5JA 1R3JB 5FCSH 2M26A 3TO4A 5JO5A 4XVTL 4RGMB 3X11B 3EYSH 5C09D 2R0KL 4KRMB 1XEDA 3MLXL 1VFOA 4CGTA 1EFXB 3MXVH 2R4RL 1U8IA 5IB5A 4HS8L 3LD8B 3SKMA 1C1EL 1LEGA 1RURH 3GMQB 1G7IA 1I85A 2B4CL 4BH8B 2ICES 2AW2A 4GRWE 1GGCL 3SCMC 4E0RA 3C5ZC 3B2UD 2VXQH 5KSBE 3BPCA 4ZMAT 3R0MA 4M7LH 3IGAB 5GPRA 3VA6A 4CNIB 3WKMH 5INDB 3QBTB 1TETH 3UJIL 2YD2A 4X9GA 1T5WB 3VXQB 2WUBL 4N9OB 1UH4A 5FYJL 5E56A 4OD1H 4NQCE 1F4WL 1I7ZA 4XCNB 5GXBB 3PWUB 4N0RA 4XMLL 1NDMA 4H1LH 4JFQB 2OL3L 4XMKH 5JW4Q 1Z0NA 4NGHL 2L7UA 2XYCA 7FABL 1QSEE 3NCFB 5D2NA 2DWEB 4R2GB 4RQQA 4PJ9C 1T1ZB 4GRWH 4M9PA 3X13B 1AQKH 4I0PC 2XI9A 3E8UL 1G6RH 4TQEH 3X12B 5MHSD 2C3VB 2FCBA 4XPTH 3VFNA 3K0WA 3O6MH 1KUMA 1FGNL 4JM4H 5F9DC 5I1LA 1RK0B 5DC4B 3DVIA 4U0RB 4PGDB 5FUOL 1NSNH 3QZWB 3P9MB 3WUWA 1ES0B 2BSSB 3DBXA 3JWDH 1KTRL 1XGRB 1XGUA 1JPST 5HGAA 1BX2A 5JXED 1OAXH 1A1OB 2YUVA 1ZT7B 3QRFM 3HR6A 4LOUC 4GG6B 3Q3GB 3WNOA 5I73C 3WIFB 4IRSD 1NCWH 1FCGA 4JAMA 2ZSWA 5GZOD 3F5WA 3EJJX 2R2CA 5JXEA 4IHOA 1T6VN 3REWB 3WDIA 1J5OL 2BJMH 3ZSTA 1INQB 4W4OA 3ESVF 1BEYL 3GMPB 3B8YA 2W0FB 1LE9A 3GEWB 1EAPB 1YMHB 3P40A 1C8PA 3GMOA 2RIKA 3MRJB 2JE8A 4KKLD 4Z7WE 4JM2F 3U0WL 3PP4H 5DJAA 1IGML 5DR5L 2VOTA 3FQWA 3QUMB 4KK6C 5IFHL 2YC1A 2FBOJ 2EDRA 4XP4L 3T65A 3INUL 1OT2A 3KPLB 1XF5A 1EHLH 1KCRL 1U3HD 4GRLD 4Z0XA 2YD1A 3PWPB 3U30C 1DSFL 5ALBH 1KB9J 1YJDC 4M1DH 3GHEL 3L3JB 4OUOA 4KTEL 4AH2B 2E3VA 3BVNB 2IF7A 1WBYB 1FV1A 4YHZL 2P45B 2B2XH 4XP9L 4DOHE 1U3HA 3P3YA 1KJ3H 4GRLA 1A4JA 1TJGH 3RL2B 2FEEL 5DVLA 3G6DH 5JZ7C 3DNKA 2V7HB 4PJ8D 3V5DA 1UXWB 3IDJB 1JFQL 1Q9LB 3OAYH 1GZQA 4YFLF 3CK0H 3TGXA 3KPRD 3BZEB 1HHKB 1HI6B 1CU4H 3G5VA 4LDOB 4GMTH 3CVHA 4O2FB 4MNQA 2J8OA 3S6CA 4PJ8A 3TPUA 3V0VB 2BVOB 3GO1H 1FN4B 1C7TA 4FABL 3KPRA 4WY7L 4MA8H 1NFDE 4F9LA 1SJHA 3IB4A 4CBPA 2XTJB 4WFEE 4MJ2A 4HJGB 4OLYL 5FM8A 1FYHB 3JVGC 1U58A 3MLSL 5I71B 3C6LB 4KJYA 5F88A 2O5ZL 2AV1B 4FQ1H 5TF0A 5EBWA 2ZCHH 4UV4H 4LASL 3S34L 3VDCA 4LFHD 3OKDA 4O51B 5IHBA 1S7XA 3AXLA 4L3AA 4F7EA 2DIAA 3P0VH 5E8EA 2EYTB 1DBAL 5DQ9B 1RUPL 2HTKC 4KVCL 1WIUA 1DQDH 3MRHA 4IOFC 4Z7QE 5E95B 2IPUG 2OL3B 4B7IA 2X4PB 3TBVA 4L4TE 4KMTH 3ISWA 2ARJQ 2X4OB 1E4XI 4U1IA 1XF3A 3VXOA 4RWYL 3VFGH 2GQHA 4M3JA 4P5TB 2CSPA 5CIPH 1JPTL 3TNMA 2YD7A 3BN3B 5I9QC 1TTUA 2Z93B 2IPKB 2H2SD 4LLWA 2P44B 1FFPB 1JGLL 2NW2A 4H8WC 4GBXD 4G6MH 3H42L 4UB0H 3A67L 2WLZA 5CWSA 2BNRB 1WIOA 4GRWF 4OLZH 1YDPA 5KSBF 4P2QE 25C8L 1EEZB 2IANE 3O9WC 4UU9B 4GBXA 2PKDA 1UKTA 2R56L 3GBLA 3RGVD 3KJ4C 3VGAC 2F54B 4BSVB 5IWLC 3DO3A 4MWFB 2ZWLT 1DFBL 3WNNA 4D9RE 2OJEA 1I9JH 2Z9TA 3RGVA 1ZGLP 4P2OA 5B39G 3OV6A 5L6YH 2X9XA 2AJ3A 3TYFA 2NX5E 4QRTA 1MH5B 3B9AA 1KN2H 2HT4D 3W5MA 1DQLH 3TIEB 1QVOA 2A0LC 5FUCC 4PBVC 3K4DA 2A74B 4LCCA 4QXUH 4F7CA 4OJFL 3K8LA 1MLCA 4M93C 3O4OC 1AD9A 3QO0B 2MMXA 4WDIB 4ZUSA 4PY8J 1KT2B 2EEBA 4WI9A 4MSWB 2F15A 5IVXF 3VDAA 3DUUB 4EZMA 1A47A 5DJ8A 3LKSB 3EYSL 2X40A 1DBBL 2R69H 3HNVH 3WL9A 2ITDA 1RZFL 2Y7QA 4G6FD 2NY7H 4QLRA 2NTFB 3VI4E 4EQ2A 5DO2D 4QRRE 4V2BA 2YRLA 1A9EB 2F74B 4JKMA 2Y07L 3BH9A 4M4PA 4XHJC 4LLDA 2J5LC 1TQBB 1WCBB 4CMHB 5FUZL 3U9UA 3FB6A 1ERNA 3ZKNC 3H9ZA 3OKLB 5IESH 1FZOB 2V17H 1RZKL 1TETL 5BQ7A 1MFNA 2R1WA 3KXFB 4XWOD 1UEYA 2ORBL 2OTWB 4MD4B 4RIRA 5JW5A 4OD1L 3D1MC 1EPFA 3HKFA 4N8VA 3T0ED 4Z7WF 1T2JA 4LRIC 1T7YA 3S97C 3RTQC 1IM3B 3P11H 3SN6N 1KLGB 3QDJB 4G9FD 4FFWD 1RU9H 4QHUA 2FHBA 5DRWA 4M4RA 4EDWL 5C08E 5MEQB 5F93C 5JW4M 1T03H 5JNYA 3T0EA 4LSSH 1QR1B 2DQFB 5JTWA 4PJFA 4X80H 5CD5D 2M1KA 4TQEL 4G9FA 1EGJH 3P73B 3V0AC 1IQWH 1T0NB 4XPTL 4WW1B 3RVUD 3EDDA 1GAFL 5C0ND 4PJHB 4JM4L 1TJHL 1CK0H 2F58H 5TH2A 3BH8B 3CFKB 2R0ZH 2ARJB 4PJ7A 2YD8A 3AFLA 1N26A 1NSNL 1T4KA 3AREA 4UAOB 5HVFB 2F5BH 4JFZL 1L4IA 3JWDL 5ESAA 2P43B 2XG5A 5ICZA 4XRCA 1E4WH 1TFHA 3DVGA 3V5KA 1CF8H 5JOFB 1OAXL 1VEMA 4DCQA 4FQCH 5MI0C 2EE2A 3HE6D 4J4PC 2VABB 1EJOH 1GGUA 1R3HA 1FE8L 4XNMA 4G6KL 1R3KB 4JM2B 1NCWL 5D6DC 4G42A 1NFDF 3MLUL 2E5EA 4EEEA 5CEZD 2FH8A 5ANMA 3T4AB 3U0TB 1QFWI 2BJML 2VZVA 3ZSSA 3WSQL 3HE6A 3DX6A 2QHRL 4NKOA 4QOKD 1T5XA 5C3LD 3GI8H 2P8MB 4NUJA 4ZO8A 1KJ2L 3CUPA 4X4XB 5E8OA 4YEFA 3VCLB 5HD8D 5KVEH 5EORH 2FATL 3PP4L 5E8PB 5ITFA 4R0LA 4X4YA 4QOKA 1G7PB 4Z7QF 2IG2L 2YR3A 4LIQE 5JOEA 3OB0K 3QIWD 1X4ZA 2V2WA 3IAGC 5L7XH 2UWEA 5DJCB 5ALBL 2A9ML 5E5RB 3MLZH 3TH2T 4HCRH 5IMOA 5E9DE 5JMRA 4WV1C 4CVUA 2HJLA 2WLYA 4AEHH 2A6JA 1KJ3L 3QIWA 3O4LB 1KTDA 3B83A 1S7QA 3G5XB 1CD0A 1NDGB 2P8PA 4YWGL 4L9LB 1LO3H 4PRID 3CVIH 1NCUA 4P4RB 2V2XB 1PEZA 4I4WB 1W0WA 3SGDH 2DBLL 5AD0A 4LIQH 1I75A 2GJ6B 1IGYB 3PABB 3VFWB 4P46A 5C0FB 2Q86B 4I3GA 3NPSB 4PRIA 1ZLVK 4M43L 4R96B 3E6FB 2D3VA 5BV7H 2WBJD 4MA8L 1PYWB 3IJYA 5E24E 4U1KA 2HJKB 3DUHA 1II4E 3LD8C 4XNUH 1R5VB 4RFNB 3CX2A 5IMMA 2EIZA 3TVMB 4TUJB 4RMTA 1M71A 2ZCHL 2WBJA 2Q8AH 4LLQA 1UVQA 2AJSH 3H7BB 2J7LA 4FS0A 3HRZB 4PY7A 5D7JB 1CT8B 4PD4J 4YGAB 4APQB 2DTSA 4OCLC 2VXTH 3ARBB 3VG9B 2B8OT 1DQDL 2EEAA 5JW3H 1D5BB 5C8JB 4WTWA 3BWUC 5D7SH 4RRPG 5I66B 5INCA 4KMTL 3RJQB 5HYJE 5HGHB 1QLEL 5IR1B 1IAKB 1M6OA 3VFGL 4GRWB 4MD0B 5KSBB 2ADJB 1KNOB 4Z8FL 2FIKB 2JTDA 1HSBA 5I1GH 2K3TA 3VI4F 3TN0C 4X6CB 5EU6E 2LTQB 4FQXD 3O11B 5B8CA 5SV3A 3V7AE 3K2UH 4UB0L 5EA0H 3FL7A 1PY4A 3QXDA 5E00A 3QUXB 4WUUD 1GOFA 4Y2DB 4U0RC 1FNGA 3QJHB 1QSEB 4FQXA 1P5UA 2HA1A 3IDIB 3RUGA 3KG5A 1FL3A 1ZXQA 3AS0A 4KI5C 4JG0H 2HVKB 1T7WA 2Z92B 2AXFA 3MCKB 2CLRA 4D2NA 4WUUA 4HWUA 3B9KB 3A6CH 3CZFA 3O45B 5J57B 3KYNB 2NY6D 1F58H 5IVXB 4X7CC 4E41E 4LBEA 3T0VA 1S7VA 2P5EA 1KPUA 3QEGH 3UTZB 5EBMB 1KJ2B 2HVJB 4P49A 3I02B 4XI5D 5GGSB 1OL0A 2XZQL 4JY6A 5IMKA 3N85H 1DVFB 1IC5L 4PJGA 2FZ3A 2QHLA 4QXUL 4QYOB 2VLMD 1AY1L 4OUUA 3V79C 5HHQB 4JVPA 1ND0A 1A7NH 3EGSB 2XNAB 3RI5F 3IS0X 5EU7E 5H37H 3EDFA 3WIHL 4UNVA 3B6SB 3OKEA 3CFBB 3D85D 2CLVA 3KPPB 1BGXH 4RBPK 4JDVA 1MCOL 3Q6FB 3O81A 2KH2B 5DJ2B 4XH2B 5HVHC 4LPXA 5I17B 1TZHA 1AJ7H 2CUMA 3IXTB 1XIWB 3SKUD 3D85A 5L88L 5GRVL 3VFVB 5F3HA 4JQVA 3QQ3B 4QRSB 3KS0H 5I30L 3BKCL 3WFHA 3MV9D 2C3WA 3MFGB 3VXUE 2N56A 1AXIB 1S9WA 3OPZL 5ESVB 1G9EA 4RMRA 2OBGA 5TGBA 4A2MA 2AJZB 3UYRH 5DA4A 1KEGH 4GG8B 2NPLX 4YE4L 4HUNB 4EI5B 3UTPD 3MV9A 5D96B 5MERB 2MOVA 4BJLA 4C56D 3ULUE 1V3JA 1RU9L 1OTSD 2B4CC 3ROLB 4ZFOL 1RAMA 4NDMB 5J9PA 2RCSL 1ONQA 2GJZB 2DI8A 3F6IA 2C5DC 4C56A 3SJVD 4LSQH 2G75B 1CFSB 1XR9A 1NCBH 4HIHB 3DSNA 4I13B 1DZBA 2FX7H 2F58L 5E2VL 2YPVH 2BXYA 4GS7C 3QCVH 4KWUA 1NFDB 1OB1A 4ZTOH 2F5BL 4HUXB 1GGBH 3CSBA 2AJXL 4AYFA 3ULUH 2CLZA 5AZ2H 4HUWA 4ZYKA 1E4WL 3CH8A 4OCSL 4JLRA 3EO1A 5IV2B 2UV3A 3HPLB 4X0KB 3UAJD 3ME0A 1DQJA 4HK0B 3T0XA 3O6FC 5DJXB 3ZTJG 3BP5A 5J11B 1A7RH 3S37X 4GKSB 3HC0A 4QWWC 4YDVA 4L4TB 1JRHL 1ZS8A 2IH3A 3L1OL 5D7KD 5F7DA 4WHCA 5E8NB 1FBIL 2ESVB 5FO9A 5CMAB 1EUTA 2J8UA 4J6RH 1J88A 3T4YA 4YPGA 5EORL 2Y6SD 3AVEA 1X6NA 2OTPA 1OD9A 3B43A 3DX7A 3VFRB 3O8XB 2VAJA 4ZFZA 5DFTA 2QQLH 1K6QH 3PWVA 3TFKD 4FTVA 3QAZC 1U93B 3QEUA 4JO1H 3MROA 3MRCA 1FRGL 3W9DB 2D4FA 4MMZC 3F7VB 1V3MA 2O26U 4XVSH 2IANB 1VFAA 4JVUA 1QOKA 2F53D 3MMEA 1KTLA 4FNLL 3O3DA 1TTGA 4LL9A 4L4JA 5EBGA 3X3GH 4QHMB 3CVIL 5DFVC 2D7TH 4OGAC 4YDJA 1VGKB 3BIBX 3MRPB 3WFCH 3QR2A 2O93L 5EU5A 3G6JB 2F53A 4XZUA 2DQUH 3OR7A 2DQIH 5BVJA 2NX5B 1L9NA 3BW9B 1WICA 2P5WD 2XY2A 5BV7L 4R7DB 4S11A 5FB8A 3QH3B 2B7DT 5IBTH 5JXAL 4HGWA 4PJXA 3L3IA 4D9QD 4HJ0C 4XPHH 4BUHA 1I7UA 2FGWH 1I8KA 1A7QH 3GMLB 3OJ2C 2P5WA 4KK5C 1B0RB 2Q8AL 1HCVA 3GBNH 2BHYA 4CMHC 3QDGD 2QADD 4Y4KD 1U8QA 2DLHA 1A02N 1OLZA 3ARGD 2VXTL 3MLVH 1KIRA 3V4UH 1HSAA 5JW3L 3MJ7B 1AE6H 1EMTL 1RJZB 4Y4KA 1UQSA 2PUQT 3FONB 4ZFOB 1A5FL 3ARGA 5D1QC 5F9WC 5ICYA 4YIQA 1LILA 4HIJB 3LKNA 3TV3L 5F6IB 3SDAC 1BFVH 3V6ZB 1VERA 2EYRB 5EOQL 4IMLB 2NYYD 3CD4A 1QBML 4H25A 4P48A 1XT5A 3S3JA 2YPLE 5CP3H 3PP3K 1F5WA 1NC2A 4ZAKD 3LEYH 5JHDD 4LAJH 4KTDH 1U8NB 4LKCB 1IFHH 4HH9A 2ITCB 4WHYH 4YHYB 4MJ5A 5L0QC 3U7AA 4D8PA 4I2XA 1OSZB 5ESQA 4XBPA 3GSWA 4ZAKA 5F71A 2QLVB 4RX4D 5JHDA 2DICA 2KZWA 5ID1B 1VHPA 4BH7B 4AIOA 2OR8A 5JLZA 1Z2KA 4CADB 1YEJL 2HMID 1TNMA 3MPCA 4NQEE 2GSGB 1INDL 3CSPA 5F7WC 4F8TA 3ULUF 1QHOA 2ICWA 4RX4A 2AABH 2VYRE 4JM2C 3PIQA 1IZJA 4HFUL 3UTTE 2BDNL 1G9MH 1OF2B 4PY8I 4IRJB 4UUJB 3IAPA 4M7ZC 2EH8H 4HPYH 4TTDC 4M8QB 5B39A 3N85L 4L8DA 1X9QA 4UILH 1OY3B 2MKWA 3U82B 3MRIA 5D6CA 1BLNB 2NY0B 3ALPA 4Y5YA 5E1AB 3I2CH 1VSCA 3D25A 4LARL 4N5ED 2FX9L 4P57A 1D9KC 3L3OA 2HYMA 1OGAE 4WUKH 4PTUB 1FYTB 2XKUA 3PDOA 5F8QC 1NH6A 1BQHA 3BKML 3FQNB 4K3JL 2A6IB 3T77A 1CD1B 4P9HL 5DUMH 2XFXA 4Q74A 4F80A 1FFRA 4F37F 1WAAA 4HUUA 2P4AB 5ACLA 1U8PB 4HQQL 5LGHH 4F7MA 2ENSA 1A21A 4GAGH 3EKCA 3K7UA 2KL6A 3R4DA 4AEIH 1YPZA 4OQTA 4L9LC 1K8IA 4ORGB 4IIQB 2VLRE 5D72H 3BQUC 1AGCA 1DUZA 2DJSA 5B38G 4MQXD 5IB4A 5E9DB 5BV7B 4PGJA 1KEGL 3GSXA 4S0SD 4BYHA 2AAVA 1OPGH 4MGXA 4Y7MA 4KPHH 1U8JB 2APVA 3BMVA 2LFGA 4I5BB 5EU4A 1CWVA 1A7OH 4MDIB 4JGUA 3S9DB 3KLSA 3MBED 3ZT7A 1IVLA 3MREB 5CD3A 5IQ7H 3A6OA 3I85A 4N1EA 3V52H 3GZKA 2NY3D 3G08B 3MNZA 3KDMB 4F15B 1V7NH 2W65B 4HWBA 3RWCB 4L8SA 2CDGA 1FG2B 1M7XA 2XN9E 3IXAA 2BNQE 3W39A 3CAFA 3UTSE 2BNUA 4LLMA 3MBEA 2OQJA 4IOSD 1RZKC 5MENE 1FNFA 1S9VB 4PG2C 3WN5A 2FX7L 4CU8A 1PLGH 3D0VB 4P2RB 4J7RA 5HGDA 4DN4L 1H3XA 4K7PL 3VG9C 3KYMA 1S5HA 5C6WH 3CCHA 3PL6D 5EG6C 3LOWA 3QFDB 1H8NA 3BRFA 3ZKSD 1HH9B 2J12B 4UQ3B 5FCUH 1BBJB 5IEHB 4JJ5B 4ONGH 5HVWA 4XNYH 2BY3A 3EYFB 5CBEB 3PL6A 4A2LA 4FQHB 4UT9H 1A7RL 5EZJA 5HI4D 1K4DA 3G04A 5ETUB 5F44A 4ZUTA 5SWZD 4PJEE 1MLBA 4Y4HD 1RIUL 5EOTA 3E3QC 5HYJB 2X4RA 5HYSB 2X4SA 3JWDC 5EO0A 1P4LB 4P23D 1HHIB 5C3TA 3VMNA 1MI5E 4J6RL 4Y2DC 4ZXBC 1KLFA 3KJ6H 2VWEE 5SWZA 43C9B 4K23H 4LCWD 3QA3A 1ITBB 4Y4HA 5CHNA 4LEOB 1QFHA 2RB8A 1ZV5A 3OQ3B 5GISH 2QQLL 3NAAL 1K6QL 5C2UB 4P23A 3T2NL 4FXGB 3GMRB 4EI6B 2FB4H 1CLZL 3C8KB 4OV5B 4PRNA 4JO1L 4M7JL 1P84J 2EIBA 4LCWA 1NGZB 3DI3B 5I1EH 1DLHB 1F6FB 4NO2B 3FTGB 3JUYA 3U9PL 1PW3A 2GFBA 3OTTA 3MOBH 2FEDC 2IBBA 3VDBA 2OS7A 5HPMB 4O2EA 5KTEH 3PWJB 4HXBH 4Z7NF 2W92A 1PJ9A 3CIQA 3L7FB 2D7TL 4JVWA 1YY9C 1JN6B 4CVXB 3VW3H 1Y18A 4NNYA 2J8HA 4E41B 5D2LE 2UUDH 2DQIL 5IKCA 2V5TA 4NSKB 4GKNA 3TA3B 3QZWG 4S1DC 5HDQL 1XGTB 1ZLSH 5DTFA 1ZHKA 1DR9A 4YX2H 1FNSL 2PYED 4ODVH 4P5MB 3FFCE 3QXWA 2VDKL 4XPHL 1FL5B 5TE4H 3FAWA 4Q9BA 2FGWL 4IDJL 4ZOBA 3OGCB 1QEWB 4OT1L 2GCYA 2DLGA 3GBNL 4ELMA 2PYEA 1BAFH 2JJTC 3W0WE 3MLVL 3V4UL 2I07A 3ES6A 5ACZB 4BSWB 3KYOB 4TOYH 4UT7H 2IAMD 2OI9C 2FWOA 2V6HA 4PJBE 1JTOA 2R9HD 4PLJD 3LKPB 3WE6A 2EKSB 4LSPH 1ZHLB 1BFVL 3I9GH 4MYWB 2Q1EA 3REVA 2XKNB 3VXUB 1KLUA 2IAMA 3EO0B 4Q9CA 2ICWJ 5F89B 3VXRD 3RRQA 5F7UA 1JI2A 1FGVH 3HB3D 3L3GB 5GHWH 4F7PB 3SCMD 2ZZUT 4LLYB 3RPIB 4FQJL 5I74B 4MA3B 4XGZB 1UWEH 2JB6B 1FO0H 3L95B 3VXRA 1EBPA 2DM7A 3BHBB 3S88H 4G7VH 5AZEL 3VGGA 3LIZL 3RWDA 3SCMA 1KB5H 1JCKA 1NCDL 2YZ1A 3IDMB 3GSRB 2R29L 4E5XB 1CFBA 1QSFD 4LP5A 5C2BL 3AM8C 1OT1A 3QUYD 4C83A 1BP3B 4U1MA 3L3HA 3R0NA 3MV8E 3JV4A 4ODUB 2AABL 5C86A 1G7LA 3FQRB 4NQSA 4PJ9D 4ZO6A 4DVRL 5ISZE 1T1XB 4NNXA 4OI9A 4QXTB 4HV8B 5J11C 1QSFA 2B0SH 4I0PD 3WLWD 4XBEH 2EH8L 3FB8A 3QUYA 1MJ8H 1KGCE 1FVEA 2K1MA 2VSCA 4PRPE 4PTTA 1XGYL 1CG9B 1NCTA 4PJ9A 1Z3GL 2V7NA 1GGIL 3OAYK 5FECA 3BWAA 4I0PA 3I2CL 1DANU 3VRIB 4GW4A 3QNYA 2FJGA 3DMMB 1IKFH 3CH1A 5JDSA 5FGRA 2E27L 4WUKL 4NP4L 2P7TA 3FQUA 2RR3A 4XXDA 3ZE2E 1E4XH 2B39A 4AM0A 5FYKD 3L7EA 4Y19D 1C5CH 1SYVB 4O00A 4YNYB 1L6XA 3ET9F 5C0BA 4ZDHB 4JQIH 1ZWIA 4NM8H 2EYSA 4Q6IC 3MOAH 5C6TL 5LGHL 3C2AH 4NT6A 1EFQA 1FL6A 3VFUA 4J1UB 5DGRA 1A1MB 1P2CA 2A9NH 3CMGA 1MWAA 1T0MB 3S7GA 1NAKH 3C60B 4PJEF 5FA3A 2DYPB 3O6LL 4U6YB 5HY9B 1KPVB 3KHQA 4FFVC 2GKIA 4MQ7A 1JVKA 1CL7I 4JN2B 4GQ9H 2IALB 4DAGH 3QEHA 2YK1L 5BS0D 4KPHL 5HBBA 1SY6H 1A7OL 3MRBB 4GRMA 4POZC 4HZLB 1HILB 4F7TA 1AC0A 5LWYL 2FIRT 5LCVH 3LV3B 4QHKJ 4YQXH 5IHZB 2W0LA 4KRPB 4PBWD 4NRZB 5BS0A 2CO6B 5DZLA 3SE9L 2WQRA 4IBLT 4D0BA 4S1QH 3WUZA 1HHGB 1UJTA 2BCKA 2VDNH 4HAGA 1HWGB 4X6FA 4WW2C 1T3FA 5J6GB 4O4YL 3SQOL 2A73B 2BVQB 3MJ6A 5FKAA 3QQ9D 5DQDH 3QIUC 5EUKA 4U3XA 1U9KA 3JV0A 1MUJB 1D5MA 4YHNB 1Z9MA 3S4SA 5I15H 3N9GH 2WINB 4N9GA 5CP7A 2YUXA 1O7VA 5FCUL 1MFEL 1AR2A 4QRPA 3QXUA 4JANA 4XNYL 5KG9A 2OTUA 5IGXH 4MNGE 5F6IC 2XV6B 2ED7A 1XF4A 2YN5A 3B4NA 3VFOB 3D9AH 2EDYA 3O2VL 1VADB 1KIPA 1UACH 1NUGA 3N1PC 1ORSA 2X7LA 2YD4A 4H0GA 3AAZB 1JPSH 2XPGA 5JW4N 1NGYA 1TCRB 3C6SA 2VLLA 3JVGA 3U46A 5IW1A 3WLBB 3S5LG 3T8XA 3MLPA 3HI5L 3MYJA 4L29A 4YHYC 4OZFA 3BZ4B 3IDXH 1ZANH 3ILPB 2C1OB 3P77B 4U1LA 2EIEA 2R4SH 4JFED 3C09B 1KC5H 4MMXC 4DWHA 3NN8B 3C5SB 1GPOL 2BVUA 2YPLB 3LHPH 4KJWD 4PJBF 5F1KC 4JFEA 5D8JH 4LDLB 5JPMB 5I1EL 3BEVB 5JUEH 4LF3B 4D0DA 3BGMA 5EC1A 5ILTH 2BVTA 1BIIB 3F7YA 3SE4C 2Y5EA 3ZYZA 3DTXA 4IRJC 1H8SA 5ERWB 3QG6A 4FQIH 1WC7A 1C12B 5KTEL 4P9MH 3G6AA 4HXBL 3UTQA 3MRGB 5GSVB 2YEZA 2ZOKB 5C0RH 4U1HB 1NC4D 3VW3L 4NQEB 4X99B 3O9WD 4BK5A 2H6PB 5E5MB 5E2WH 4DVBA 1BD2E 3UPRB 4RDQG 1YMME 1H3WM 4GXUN 2HRPH 1NC4A 1MRFL 2IC2A 2R1YA 4K71C 4N0CD 3O9WA 5DT1H 4ODVL 1CLOL 4K3DH 2ZUVA 4YLQT 3SKJL 4PB0L 4NQVA 1NGXA 4NCDA 3MRNB 3QO1A 3LKQA 5CZVH 5IWLA 4NN5B 4POYA 4LKXB 1S7UA 3EJYD 3D3VE 4LPCA 5HJ3B 5I1AA 1QFWH 1FZMA 4TPRH 5HPOA 1F42A 1BAFL 1CE1L 3OMZA 5C7XH 2OXGA 4PLKC 4ODWB 4YDIH 5T1LA 4WWKB 2XWTB 2AEQL 5D93B 1E27A 4TOYL 4UT7L 2WIIB 4AIZB 2OZ4A 3LS5H 1LDSA 5L2JB 2EECA 3L3DA 4R90L 3S37H 3VJ6A 4NO3A 3LAFA 3ZE2F 1NGWB 4PJDB 3CFJB 3MBXL 1UCBH 4HIIA 1R3LA 4LSPL 4OFVA 1LK3H 1OQOA 5LAXB 4L3ED 2VLRB 2Z8VC 3NFPA 3JV5A 2PETA 1FGVL 1DE4A 1ZGLB 1JHTB 5GHWL 3RVTC 3WYRA 5FGBC 3QUKA 3RFZC 1MJJA 3ZKND 4YUEH 1OARH 4NRXB 5FHAL 1JWMA 4L3EA 2E7MA 4PRHE 1DCLA 5L2KD 4FQPA 1RD6A 1J86A 3GRWL 3NA9H 3P4OB 4JRYD 5HYFA 2WP3O 1UH3A 2XN9B 5FO7A 1WWBX 3UTSB 1IEAA 1JNNL 4HULB 4XP1H 5T1MA 1S8DA 2DD8H 4M7KH 2XWBA 4WNQB 4X83A 5DMKA 1U95A 3IFOB 5L2KA 4DN3L 4FQ2H 1XCQA 3QNZA 4JRYA 2EDJA 1T2QH 5D7IA 4RFOH 4LRIA 3RNKB 3RTQA 3IF1B 4X8JA 4X98A 4QXGH 1IAIL 3H8NA 1OQXA 4YHMH 4ZUVB 3TT1H 4EUPA 2DTMH 2DQJH 2Z31B 4H0IA 4LRNL 1FFNA 4FFZH 4KQ3H 4P3CL 4ZFGH 4NOBA 4RZCB 1N0XH 1ACYH 3TPKA 3HG1E 1AQDB 4EDXB 5SWQA 1OOAA 1AIFB 2G5BB 1FVDA 4H1LG 5FYLE 1MIML 2HJFB 3WFBH 1C5CL 3TBSB 1QFUH 3WFDL 1K2DB 3HC4H 4GLRI 4J4PD 1PDKA 4LHUB 5GRUH 3ARQA 4JFDE 4NM8L 1AGDB 2VITA 3AGVA 2EC9T 1JHLH 4HDIB 1HOCA 5EO1B 1FORH 2A9NL 3KPOA 4J4PA 4KAQH 1I1YA 5H35A 1NAKL 4JKPL 4W68A 5GS0D 2D9QB 3MRRA 5D6DA 3TWCH 4KZDL 4Y88A 3BP4B 3P30H 5HHOB 2P24A 4M62L 1K5NA 1KJVA 3LSOA 3I6LE 2GAZA 5FYLH 1A3RH 4GQ9L 5KVFH 3MSPA 4DAGL 5DRXB 3OXSA 4EIGB 4P9HC 4AMKL 1SY6L 1JYXA 3HRPA 1P6FA 3KPMB 5DLMH 4BZ1L 4F57H 1XFPA 4HX1B 1RZGB 4QHNA 3RBSA 2DDQH 4EKXA 2CRYA 3NABL 4PJ5E 3VE0A 1QFPA 1ETZB 3P0GB 2VDNL 12E8L 1H3TA 2X4QB 2DIBA 2LAAA 1UEMA 5TE7H 1NEUA 4KDVA 4WV1A 3VH8G 4I9WE 1TVBB 1S7RB 3QFJD 1I1AD 2DJ4A 4OLWH 1MHPH 1ZGLM 3BPLB 2DM3A 1MEXH 1JK8B 3D48R 5E94A 4MB5A 5F21B 1KCSH 2HLAB 4MJ4A 2DN7A 3K46A 4OZGF 3QFJA 1I1AA 4WI4A 1T83A 2NNAB 1R3JA 2BY1A 2VLKA 4G8IB 2EDQA 1EFXD 5FF6A 4QTIH 3O6KH 3D9AL 3W0WB 3DI2B 4JR9H 1XMWA 3SBWC 1OAZH 1UACL 3MGOB 2CQVA 3ABZA 2OJZL 1FO0B 1JPSL 4N0YL 4N0UE 4U7KA 2XA8L 4C55A 1EFXA 1KFAL 4G8GE 4PJBB 2ZNWA 3HZVB 4JFFA 3GMQA 2D03H 4BH8A 3RA7H 3MA9L 4AL8H 1L7TH 2R8SH 1BREA 4OB5H 5CZXC 5JORB 3IGAA 4MCYB 4CNIA 4FA8A 5INDA 3CXDH 3LHPL 4J3SA 4YDKL 5BRZB 3VXQA 1T5WA 4ZS7L 1B0WA 1U8MB 5JUEL 3LKOB 4N0FA 3SE8H 4XCNA 1QBLH 5IHUH 5D1ZB 3PWUA 1YYLH 3FN0L 1IJ9A 3V4PL 4JFQA 4EJ1C 3VXSE 4QKXB 1A6VH 1VCAA 4XCYB 2F8OA 1T66C 2YZ8A 5C0JA 2VMFA 2DWEA 1MPAH 3NCYP 4OM0L 1T1ZA 3X13A 4HC1H 4JHWL 5BMFL 4UTAH 2FX8L 3TBTB 3X12A 3MV8B 4KI5D 3U36B 3DMMC 2C3VA 3MA7B 5ISZB 3D39E 4ZSOE 2OK0H 1N7MH 1R5WB 2HRPL 4Z7VE 1RK0A 1ZA3B 4PGDA 3S3SA 5DT1L 3P9MA 4MAYB 1GHFH 1I85C 1ES0A 4K3DL 5KSUB 4OV6F 4QTHB 4TYUA 2O61B 1UB6B 5CZVL 3IU4H 4NKIH 1F4AA 3EFFB 1A1OA 1ZT7A 5DEZA 2H8PB 1QFWL 1GGTA 1GZPB 4GG6A 3Q3GA 4HAFA 3O3BB 1ZT4A 1AGBA 2FDBP 3HPJB 4JPKL 3C60C 1X5IA 1AR1C 5C7XL 2X1OA 3SGJA 2VO5A 4CMMB 4YDIL 4U1SB 5GGRB 1W8NA 2VQUA 3REWA 2V5YA 1C08B 1J1OH 2UYLA 4W6WB 4JZJC 1INQA 1NANI 3X3FH 3GMPA 3FHAA 1CICB 5FGSA 2W0FA 1L0YA 1EAPA 1YMHA 1KG0B 3S37L 1URLA 3MRJA 4G7YH 2A77H 3GJFB 3QDME 3PWPD 1LK3L 4PV9A 4R97B 4W81A 3QUMA 5I1DB 1WTGT 1OD7A 4TVPE 4XVUC 1YEIH 3KPLA 4O02H 3KR3L 1LD9A 4NJAH 1XH3A 3DRTB 3THML 3PWPA 4YUEL 1J1XL 3L3JA 1KBGH 3BVNA 4UOW0 1WBYA 4PP2B 2L0DA 4Y4FB 3F7PC 3NA9L 1L7IH 3BUYB 3RL2A 4F37K 4LNRB 3QQ4B 2WUCL 4R4FH 2V7HA 5DWUH 1UXWA 3IDJA 1Q9LA 4M7KL 1KXTB 3FOLB 1AGEB 4UQ2B 1MAMH 4TVPH 4WTZG 1HHKA 3QJFA 1HI6A 1RUKL 4RFOL 2XTJD 3DROB 4O2FA 1RZ7H 1FIEA 3C6LD 1I7RB 4ZNEE 4W4OC 4EBQH 2CIKA 3BSZH 2BVOA 4TUOB 5EC2B 2L7JA 1FN4A 4IRSC 4KXZI 2D4DA 4X6DB 3BYTA 5KSVB 5GZOC 5IB3B 4OLVH 4M9OA 5JA9A 1IAIM 4HJGA 4GSDH 5FYJD 2CKBH 1P53A 3C6LA 2G60H 2ZNXA 2DQJL 3GKWL 5B4MD 2AV1A 4TSAL 1L9MA 4FFZL 1IAMA 3GMNB 4IOIB 4O51A 4YZFE 5EH1A 2YHGA 4R7NB 3KWWA 3C09C 4HS3B 1AXSA 2EYTA 5DQ9A 2GTZA 3DIFB 3FFDA 3IU3B 4P5TD 4ODHH 1A64A 3RX7A 4OKVB 5GRUL 2OL3A 43CAA 2X4PA 3ESUF 5D9SB 4NN7B 1V7MH 4AIXA 4QWWD 4XPAL 3F7QA 8FABB 3CNKA 4P5TA 1FORL 1CN4A 1UENA 3BPNC 4W6XB 1CVRA 3TWCL 2Z93A 2IPKA 1WT5C 2BNRD 3P30L 3SGEI 1YEKH 1FFPA 1BZ7B 3U6RA 1JZ5A 4XVJH 5FYLL 3MRLB 3TEUA 1VKXB 1G7JB 5TQ2H 4HKJB 2I60H 1RULH 1WWCA 4PBXA 1GOGA 3EYOB 4DZ8B 1RZJL 2F54D 4JG1L 4F9LC 2BNRA 1QLRB 5DEFB 2B1HH 1GIGL 3MRMB 2CJUH 5D2NE 1A7PH 1EEZA 1JI1A 2VDRL 4UU9A 4XP5H 2Z35B 3CFEB 3HI1B 1T1YB 3MV7A 1JZ3A 2F54A 1JYVA 4MXQC 4BSVA 3R06B 4MWFA 1LDPH 4NN5C 3FO9B 2E9WA 1BD2B 1FP5A 3LRSB 1YMMB 4OZGB 3UYPA 4HJJH 1KV3A 3DYOA 5DFVD 3MNWB 3GB7B 4NC1E 2X70A 4OGAD 5EWIL 4OLWL 1MH5A 1DEEB 3QUZB 3BPOB 3PJSB 1MHPL 5T5FH 1DLFL 3TIEA 1MEXL 2NZIA 4GUPB 2A74A 5D4QA 4LK4A 3D3VB 3WFEL 4X7FC 3QO0A 4R8WH 4WDIA 4HIXL 1KT2A 4MSWA 4Z7VF 1XZ0B 3BZFB 3DUUA 1BBDH 1NCAH 4LSVL 4JR9L 1OAZL 3LKSA 1P69B 3QB7C 2D0HA 1JYNA 3CDGB 4KK5D 3RY4A 2E8YA 35C8H 2DI7A 3HZMB 2NTFA 3HR5A 3UBXG 3O2DL 1I8LA 4GBXC 1A9EA 2F74A 3UX9B 3BT2L 5C9KA 4RMWA 3KXFD 3RA7L 4TULH 1WCBA 2YD5A 1HDMB 4MAUH 2VJXA 4AL8L 1L7TL 2R8SL 3OKLA 4NZUH 5I8EB 4CAGA 1FZOA 3CXDL 4G6JH 3QDJD 4PGCB 5GRWA 1RY7B 1C16B 2OTWA 1Q9KA 4MD4A 5SV4A 2LU7A 1TLKA 4WENB 3NCCB 3G5ZB 3SE8L 3SDDB 1V3LA 3T0DA 4LCCC 3GBMH 3LN4B 1IM3A 2Z8WC 4WFHD 4LU5H 2HT4C 1YEFH 1QR4A 5MEQA 1MPAL 1QR1A 2DQFA 2D7MA 5F70A 5DHYA 4UTAL 4EN3B 2Z31C 3ULVE 1BJ1J 4B5EA 4MNQE 5T33H 1T0NA 4WW1A 2OK0L 4M5YL 1N8ZB 4PJHA 2JJUA 3KPRE 4X4ZA 3ELAT 3BH8A 3CFKA 5E7FA 5IMLB 1IGJA 5TDOB 1OP3H 2FRGP 5CCKL 1SQ2N 2BHZA 5TFSH 4J3TA 1I9RL 3I75B 4JM2D 4R9HA 4NKIL 4S10A 5EIIB 3DGCR 5DO2C 3JWOH 1IARB 4ZQKB 3CLFL 4KHTH 3IETB 3ULVH 2VABA 3CVHH 5I0ZA 5KVGH 3EAKA 1QFWM 1R3KA 4JM2A 5BZDB 3CDCA 1CBVH 3ORJA 5IIEB 2R2BA 1H9VA 5E1HB 3FN3A 5I8KL 4XPBH 1RVFL 3T4AA 4JFDB 1J1OL 1ADQL 3U0TA 1PVHA 2YD3A 3MRFB 1JTPA 5KOVC 3SPVB 4Y1AE 4OF8A 1XGQA 1B2WH 4YZFF 3DX9B 2P8MA 4X4XA 2CR3A 4UNUA 4G7YL 3VCLA 2F19L 2NY1B 1DBKH 3T0EC 3DVNB 1VPOL 3OKOA 4LCYB 4C58B 5E8PA 3V7AG 2MHAB 4FFWC 3FOMB 4I3RH 2C4XA 2A6DB 3BD3A 1CVSC 2CDEB 1GCFA 3FZUD 3O4LD 3ZTJH 1BM3H 2W9LA 2DQHH 5FA4B 1A6WL 4PS4H 4L5FL 2DQGH 3O4LA 3SY0B 5IFAL 2CRMA 4XMPH 3G5XA 2GJ6D 1AHWB 2ADGB 4PJ5B 4WU5A 3CZJA 1DQQA 3B2VH 4XCEB 4L9LA 2E6JA 5LQBH 5IW6A 2V2XA 1Q72L 2IADB 4I4WA 4PGEB 4WFGD 3PGCB 2JKXA 2GJ6A 2BFVL 1IGYA 3PABA 1RZ7L 3VFWA 5C0FA 4FQQA 3HE6C 4EBQL 4EOWL 3BSZL 3TVMD 3HLAB 4R96A 3E6FA 4DW2L 1NMBH 4KUCF 3W11D 3BKJH 1PYWA 2OSLB 5DMYA 2HJKA 4YHIB 2CKBL 3JTSB 5D7JD 1R5VA 1CE6B 1REIA 4XPFL 1K3ZA 4APQD 5A40E 2VH5H 1EZVX 5BZWB 3TVMA 4TUJA 3ARBD 1JP5A 4L1DA 3DLQR 3RGHA 3TESA 2UUDK 4ELKB 3H7BA 1JV5B 4JHAL 4MZ3A 1DQML 2AJVH 2W9DH 4PG2A 3HRZA 3N0PB 1CT8A 1NMCB 2EICA 2JK5B 4DTGH 4APQA 4WHTA 2QL1A 1XR8A 3FB5B 3ARBA 3FT4B 4WEUD 3H6JA 1D5BA 2Q3AA 5C8JA 5I66A 2PF6A 3QIWC 3SDYH 1V7ML 5HGHA 5IR1A 5D1ZC 1IAKA 1JGVH 2YUWA 5FK9B 4ENED 5KSBA 2ADJA 2DQEH 1JYWA 1KNOA 2F8XC 1CTOA 1IC1A 2EDBA 1BQSA 1CS6A 3QUXD 4X6CA 1YEKL 4Y2DD 1VFBB 4ONFH 1QSED 1S3KL 3O11A 5CUSH 4ZOCA 3SDXF 1SHMA 4RGNC 1NFKA 1MCSA 1G9NH 1W0VB 4K7FB 4QCIA 1EEUA 1OW0C 4MB4A 5DD5L 1KXVC 3IRZA 2EKJA 2B1HL 1ZT1B 3QUXA 4Y2DA 1MHEB 5E08H 4U6HB 3B9KD 5F97E 2GIYA 4NZRH 5JPNB 3QJHA 3IDIA 5E03A 4X6BB 2YMXL 1A0QH 4XP5L 1RHHB 4PJFE 3RWFB 1MY5A 1CFVH 1TZIB 2HVKA 3UO1L 3KLAB 4G9FE 3MCKA 1CCZA 1B6DA 1YA5A 1YEDA 4Q2ZB 4M61B 2FEDD 2VXUH 3B9KA 2YSSB 1J8HB 3O45A 3D39B 4ZSOB 1DVFD 3KYNA 1U91A 4OCMC 4HJJL 2EC8A 4Z7VB 3I50H 3KGRA 5IVXA 5TPWL 1DL7H 4Y8AA 1Y0LB 1IGTB 3U48A 4ZNCD 5DD0H 4NO5B 2ENYA 3LQAH 3UTZA 5EBMA 4YXLH 1KJ2A 2HVJA 3HNSH 5HI5C 5GGSA 3MLRL 1G6VK 1DVFA 4ETYA 3ULVF 1M7DB 1IL1A 3E6HA 5C07E 5C0GA 1D5XA 2J1KA 4O5LH 4U33A 4R8WL 1G1YA 4ODSH 2ZCLL 5HHQA 1U8LB 2EDKA 5IVOA 4TSCH 1ZLUH 4OFYD 1FLTX 3EGSA 1BBDL 1ZKAA 1ZSDA 2XNAA 4L4VA 5ANME 5DZOA 1XIWD 3B6SA 3NCBB 5B8CC 4MVBC 3JV6B 3QWQB 2G2RB 3OAUL 3Q6FA 2ZJSL 5DJ2A 4LSUH 4OF3A 4OFYA 4XH2A 5CEZE 3IXTA 1XIWA 2X09A 5J56B 3IAQA 1MAKA 3QDMB 4Y4FC 4K9EH 4AJ0A 1CL7H 3IRPX 1HKFA 3QHTC 4QOKE 1X6LA 3VFVA 3N06B 3T08A 4MAUL 2C3HA 3QQ3A 4QRSA 3CX5K 1F2XK 4NZUL 4EI5D 2MTPA 2UWEE 3MLYL 4G6JL 5ESVA 1TQCB 1ORQA 2AJZA 5JOPE 2NR6C 4GG8A 5HHXL 3RP1A 3MLTB 2VLJE 4DKAA 4EI5A 2CKBB 5MERA 4DKDC 4PRBB 2MQ3A 5IBUG 4X6EB 2HKHH 4Y2OA 4LU5L 5HHME 4M6OL 3SDCB 1YEFL 3ROLA 4AG4H 5K59E 2FECL 2OM5A 1RUQL 5FAAA 4UIKH 5GS1B 2GJZA 3HMXH 3VD4A 1VFUA 2YKLH 5HDOA 5FKPB 4AEFA 4FN0A 5LXGH 2XRAH 3UBXI 4WFED 4YXKH 5T33L 2G75A 3FJTA 4JY4B 1CFSA 4J3UA 4NCC1 1JZ7A 1JPGB 3SKOB 1U8OB 5D7LA 3V0WH 4UDUB 3DARA 5ABDE 3C08L 4HUXA 5TFSL 3AROA 5KJRH 2HFEA 3DOSA 4NN7C 3TO4B 1CDBA 2BSED 4OIIH 1R6VA 3IJSB 4L4TD 3GHBL 3HPLA 4KHTL 1ZHNB 4U1NB 4X0KA 1P6AB 2DL2A 5EBLB 4HK0A 2ESVD 4FP8H 3SKMB 4QY8B 4GKSA 3TT3L 4XPBL 4KGLA 4RNRB 2EDXA 5AG9A 4L4TA 5J6HB 2NXZB 4KGJA 4RCAA 1PG7X 3O8XD 2FH6A 5E8NA 4JFYB 1B2WL 1MCPH 2ESVA 4ZFFB 5CMAA 4LLVB 5CJXC 4G9DB 3DXAA 1VGEL 4HS6B 4OZ4B 5EN2B 2VZ1A 1UJ3B 1E6JH 1S7WA 3TCLB 3VFRA 2VDQH 5LVEA 1CDJA 4ONOA 4FMKA 2UY6A 4L1HA 2IAND 5T5NF 2BHUA 1U93A 3PV7A 4HXAH 4MHHG 5BO1H 2BSTB 3W9DA 5F3BA 3F7VA 1BM3L 2V5SA 3RUGE 3SKNA 4Z78B 2CRIA 4D9RD 2IANA 4Z0BL 4XNXL 1NAMH 3BXNB 3EBAA 4XHQA 3FO2B 4XMPL 4YR6B 4HKXB 2W38A 4QHMA 5DRNB 2NX5D 2D2OA 5LQBL 32C2B 4XAKD 3WIHA 4U1JB 1OM3H 2C3XA 4POZD 5F96H 3G6JA 1T7ZA 1Q9OB 1D6VH 4F2MB 2VC2H 4WEBH 2P5EE 5BJTB 3DBXB 1QPXA 5H94B 4X8XA 2NX5A 2DWDB 3BW9A 1XGUB 3LH2L 4HW6A 4PJGE 2IFGA 2VN4A 4QNPE 3WJJA 3QH3A 4N1HB 1ZLWH 3FT3B 2LQRA 4ODTH 3HC3H 4QHLB 1ITCA 3MV11 3VG0L 4XC3L 4G80B 3TLRA 3MXWH 5A43C 2KQNA 2J6EL 4IHOB 4WW2A 5AYQA 2AJVL 1CR9L 2Y6SC 4DK3A 4DTGL 4OSUL 5E99H 1IRAY 1AGFB 2Q6WB 3TFKC 2RGSA 3UTOA 3MJ7A 3SDXB 1RJZA 4Z7UB 3BFOA 1MCJA 4K3HA 3FONA 4ZFOA 1S78C 1EV2E 3EUUA 5TDNB 2C9AA 4HIJA 2CIIB 4LHQB 1ZTXH 1KYOJ 4NFCA 3TH3T 3V6ZA 3GUTB 2EYRA 2IQ9L 1E4KC 5KANG 2R0LH 2YWYA 4IMLA 2KDGA 4QRQB 4ONFL 4EN3C 2AKRB 5CUSL 1I8IB 2ZUQC 1GOHA 3AMLA 1A4JB 4K8RH 1UFUA 4IJ3B 1OTUD 1U8NA 2BK8A 2ITCA 4KROB 1DBJH 3TBWB 2X1QA 4NZRL 3R1GL 1CQYA 1OSZA 1GZQB 3FO1B 1BQUA 4UDTB 3MYZA 4OCRH 3CVHB 5ID1A 5CJ5A 4MNQB 3RVVD 3FKUS 1KENL 2VXUL 3LEVL 4IRJD 4G43B 3ULSB 4CADA 2GW5A 2VE6B 2VXVH 1J05B 1W2KT 2GSGA 3MRQB 3MZTA 3I50L 5B3JF 3LVEA 1SJHB 3OL2A 1JZ6A 2JCCA 2BVEA 5DD0L 2NY0D 1OF2A 2GITB 2XOTA 3EFDL 2QADC 4IRJA 4LVEA 5K59F 1RZJC 1BFTA 1TDQA 2Z0BA 3HNSL 4M8QA 4V1DE 3ARGC 5EBWB 4M6NL 2AS5M 5EFIB 1YNKH 1FYTD 3ZYJA 1T20B 1UM5H 5J89A 2FSEA 1FHGA 1YEEH 1BLNA 1AXTH 4XCFH 4NO0B 4ODSL 2EDFA 4GLRH 2VXSH 1QNZH 4OLXH 2FYYB 4JDTH 4Y5VB 1FYTA 4HF5L 3BKYL 1R24B 3IDNB 3FQNA 3GI9H 4YJZL 4Y1AB 4LSUL 1L6ZA 3N50A 5E6YA 2J8UE 5HSFA 2C1PB 1MCCA 2YUZA 4GH7B 2IFFH 1OAKH 3MUZ1 2W91A 5E4IA 1U8PA 3NCYS 4LSRH 5D7KE 1EZVY 4K9EL 1CL7L 5E9DD 4XAWL 4FTVE 5C6PB 1J0HA 1AHWC 3OZ9L 1P7HL 3ZKQD 4OD3H 2BY2A 5AUMA 4PGZA 4BFEA 4HSQA 4ORGA 4IIQA 5IQ9B 5E9DA 2OXHA 4XP6H 2HMIC 2LU4A 3RKDC 1DBMH 5EUOE 1SBSL 5T1DL 1A6ZB 4I5BA 3GIZH 4MDIA 3RVTD 3U4BH 3MTRA 1FIGH 1G7HB 3MREA 4MCZB 4JKLA 4Y5YC 3G08A 1KCVH 4AG4L 4DKFL 3KDMA 2W65A 5GGVH 3RWCA 4P2RD 1FG2A 4P2OB 3HMXL 1RI8A 3MCG1 2AJ3B 2ICCA 2R15A 4H88H 4YXKL 3RUGF 3BRDA 4U6VH 1EDQA 3D0VA 4N5EC 1T04B 4P2RA 3STBA 3L5XL 5IT2H 3PDGA 4PJXE 3OR6B 4GKZB 1R3IL 5I1CH 1GSMA 3ROOB 3U2SB 4JY5H 5KJRL 2P5WE 5E6IB 3QFDA 4KMLB 5DK0B 1A3LH 3F58H 2V2TA 4JB9L 4O58H 3LDBB 1HH9A 4UQ3A 3NACH 4WI2A 1BBJA 1P9MA 4OIIL 3LN5B 4G5ZH 4O9HH 4D9QE 1CXFA 5IEHA 4JJ5A 2ITDB 5HYJD 1IQDB 5CBEA 4PJGF 4KKAD 1Q94B 3D0LB 4FP8L 4I77H 4QNPF 4FQHA 2CKNA 3DGGB 5HHVH 4GXVH 5ETUA 2QSQA 2Y4SA 4J3XA 4B0MM 4MQXC 5HYSA 3FB6B 1MCPL 5MP6H 2VISB 3BGFB 4YEEA 5GS2H 2VIRB 2LAGB 1Y6KR 1E6JL 5BQ7B 5J0BA 2Y23A 1OSPH 5ADOH 4LEOA 4RIRB 3RNQB 2OR9L 3QPXH 5T3ZH 5KBNC 5DJ0B 4Z18A 3T2QA 4FXGA 3GMRA 3OGOE 3PWNB 4EI6A 4OV5A 3NZHL 1QA9B 4P59L 5F1NB 2HH0L 1NGZA 1FH5L 3EJZD 2LVEA 1DLHA 4NO2A 3FTGA 4FXLA 4A6YH 1P4BL 4OZHB 5JIKA 5JHDE 4XTRC 1MFAL 4E41D 5HPMA 4LEXH 3PWJA 1C5DB 3TA3D 1JF6A 3PL6C 4X9FA 1JN6A 4CVXA 3FCTB 1D6VL 5DEGB 1MIEH 4E41A 3AREB 2EE6A 4JO4H 4NSKA 1J12A 4BM7A 3TA3A 3HN3A 1FAIH 1XGTA 3VWJB 4GMSH 2O5YH 2OX5A 5J3HC 2O5XL 5HGBB 5HI4C 1X5LA 4P5MA 1O5DT 2MCPH 5C07B 2ATPB 4PJIB 4ODTL 4MHHI 2VDLH 1JNLL 1NEZG 5DC9B 4ZUUB 3RBGA 1QEWA 1SEQH 1X5AA 5FHBL 3UDWA 4NKDB 1B6UA 3HMWH 4F8QA 4JPVH 2XQBH 2QEJA 5EOCL 2Q8BH 2E6PA 4OGXH 5E99L 1H0DB 4U2YA 3JTTB 4NUJB 2HT2C 5BOZG 4KK9D 4KUZH 5ADPH 5ACZA 4BSWA 3DYPA 1I3UA 3KYOA 3VXUD 1JUFB 1DN2A 3MO1B 1AO7E 4X4YB 3V6FB 3LEXB 4MXWH 3TH4T 2UVFA 1YPZE 3LKPA 2ZKHH 4MA7H 4MS8C 3TZVB 4PJAB 3J8F7 2EXWC 1ZHLA 2IMMA 4YC2B 5JHLH 1CFNB 2XKNA 2R0LL 2WP3T 3EO0A 5DMJB 1RK1B 3SBWA 5F89A 3ULUD 1QRNB 3TNNB 5B38B 3V2AR 2Y36L 2J8UF 3RHWF 4UOW1 5GGUB 5ITBH 4F7PA 2VLJB 4LLYA 3RPIA 3U7YH 5F9JB 1KTDB 1OCWH 1LQSR 4MA3A 5KS9E 4XGZA 2JB6A 3L95A 5HHMB 3QEQE 3TYGL 3BHBA 2X4TB 5D5MF 5DURB 3HS0B 1JF5A 1MCQA 4W4NA 4KRLB 4TRPH 3IDMA 5I2IB 2FEEI 4P46B 3GSRA 4KMQA 2X1XR 5SWSA 3L5JA 3TF7C 2FJFB 2BVPB 1KELL 1T66D 3HE7B 5EUOF 3E2HB 5KZCB 3FQRA 2BOBB 1T1XA 5DQJB 4LVHB 4QXTA 4HV8A 4I48B 5IMMB 2EIZB 3PHOB 4YHOH 5F7NC 2JJSC 3TO2B 2QQKH 2DQTH 3DMMD 5KANI 2VZOA 1MJUH 2J4WH 1MFCL 2NXZC 2SEBA 4HWBH 1F4HA 1CG9A 3PDDA 1N64L 4X9HA 1AXTL 2DRUA 2AI0L 4XCFL 5BVPH 2IAMC 1MFDH 5AEAA 3VRIA 1UJ3C 3FHQA 3MJ9L 2QSCH 3DMMA 1MF2H 2R9HC 4RISH 3CFCH 3X14B 4MLSA 4PLJC 1NLDL 3OSKA 5INCB 1HQ4B 1AKJB 5J12B 2ZG1A 3GI9L 3BD5A 5C09A 1SYVA 3L5HA 1NAMB 4YNYA 5CEXB 4ZDHA 3HB3C