5T3ZD

3.5 angstrom crystal structure of a fully and natively glycosylated bg505 sosip.664 hiv-1 env trimer in complex with the broadly neutralizing antibodies ioma and 10-1074
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
229
structure length
229
Chain Sequence
EVQLVESGAQVKKPGASVTVSCTASGYKFTGYHMHWVRQAPGRGLEWMGWINPFRGAVKYPQNFRGRVSMTRDTSMEIFYMELSRLTSDDTAVYYCAREMFDSSADWSPWRGMVAWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Natively glycosylated HIV-1 Env structure reveals new mode for antibody recognition of the CD4-binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 32
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2016-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t3zD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t3zD01
1IQWH 4IM8A 2J6EL 1FIGL 4WO4C 4IJ3C 3C6LA 5FYKE 1B3JA 2YPLE 2HFEA 5DWUL 5IEHB 1YEGH 2FHBA 3QI9B 3C5ZD 1ED3B 4ZXBB 4JY5H 4ZFGL 2BHZA 1ZT4B 3K4ZA 5GJSL 1NGXB 3OKOA 3VFSA 3WL9B 3KLDA 4NC0B 1C5DA 5AG8A 3I6GA 3HR5B 5D1XD 5FK9B 4IIQA 4FQHB 1IAMA 5DJCA 2ZG1A 4KUCD 3SDAD 3WJJA 1WITA 1MPAH 4OLXH 2QHRL 5HD8D 3QDMD 3IDIA 2IAMD 5KSBB 4EN3A 4PJ5A 5KS9E 2A6KA 2WUCL 5AD0A 4XNUL 1QPPA 3MV9D 4HCRA 4PJHB 1ETZB 3VWKB 5CWSB 1LK3L 1J8KA 1L0XA 5H94A 3O3EB 5DD6A 4EIZC 3OTTA 4WRLA 3BQUD 3QHZL 3IYLW 5KN5A 4M6AA 1A9BA 4OF8A 4Z7QE 3BKJL 1GH7A 4WCYH 1J1PL 1HSBA 3HPJB 1IAKB 4L3CB 5K9OA 4WWID 2Q86A 1UKTA 35C8L 1AD0A 1HN1A 1YMHB 4D9LH 4P23C 2NNAB 4YDVA 4A6YL 3EYQD 5KG9A 3U36B 4F7PA 3IDMB 2DKMA 4DVRH 1Q8MA 5BO1L 5K59F 4HFUL 5DJXA 5ENWB 1VGKA 1BVZA 1N8ZB 1WC7B 2D7PA 5FDWA 4U1GB 2YKLL 2VL5B 4R4NC 3QXDB 3KJ6H 5JW4R 2DLEA 4NQDA 2ICWI 5CSBA 5TF1L 5E6IB 5D7LB 5F8QC 4QOKD 3U83A 3SQOH 5DSCB 2GJ6A 2YPKB 2JTDA 2YUVA 3AUVA 4KKBD 2R39A 2WINB 3UTQA 1JZ2A 2I25N 3KPLA 1N6QH 4N0UA 3AFLA 5KANI 3ARGC 1UM5H 3H9ZA 5F88B 3EOTH 1Y18B 1MFEL 4JRWA 3BPNC 2I5YH 1F4YL 5CSZB 3L5WA 1CLZH 1AXTH 5MERA 2NR6D 2H3NA 1DQJB 1MFDH 4DGIH 5IVNA 5JOFA 3CC5A 4YO0A 4PY7B 3ZMRA 4ZO6A 5HYQA 2CDEA 4O2FB 3MYZA 5BZWB 3TWCL 1T7ZA 2AXFB 3O4OB 4QRTB 5A2KH 3RKDC 2XZCH 4EUPA 3IGAB 3C6LC 3JUYA 5FHAH 1CXKA 3X14B 5TE6H 3TCLB 3GSWA 4KVNH 2HT2D 4J23A 5DVMA 3BUYA 4L4VB 1R3HB 2IH1A 2DN7A 4P3CL 1FNAA 3EYFB 4G5ZL 3SGJC 4YBQC 4XNYH 2OQJA 3KPNA 1KGCD 5ETUB 1ZLWH 4NSKB 5FHBH 1UEMA 3LDBB 1JUFA 4WTWA 1NC2A 1KTLA 1U8OA 4DQOH 4U1NB 1ZHLB 3RKPA 1IAIH 4YHKL 3MO1A 3WIHL 1OAXL 2ZJSL 2BERA 5DUPL 2R4RH 3FN9A 2ICES 3NFSL 3SJVD 4UOW0 4BQ9A 3IFLH 1L6XA 3QUML 1NBYB 4WI4A 5CAYB 3GSNH 1ADQH 4JQXA 2CDFA 4BQCA 1QSVA 1QSFD 2ADFL 3LEXB 4G8IB 4XVUC 3RVWD 3JWDH 4Q58C 5B38A 1FL5A 5K59E 4XI5C 3O4LA 4LSVL 3BP7A 3Q1SH 3P9WB 4N90E 4K8RH 1KXVC 4W6WB 4HMEA 3LRGA 1UQSB 3ZDZF 1BZ7A 4L3AA 2P45B 4WI6A 5GZND 5ICXA 3S96A 4JREC 3ULVD 2HVKB 5GIRA 5I18H 3MJ9H 5I1GH 1HQRB 3G5ZB 4GFTB 5D71H 1RFDL 4NWTH 4PRIE 5JOEA 2CUMA 2ENSA 1RZJH 2FNBA 2HLFC 4PJFB 2Z31B 4PD4J 4MDIB 1JGDB 1Q9LB 4X6FB 1R5IA 3D39E 1QP1A 2QQLL 4X7TB 2NY3D 2X10A 3FFCB 5ID1B 4JPKH 3LKSA 4NO2A 4G42B 7FABL 1X5IA 2D3VA 1FFOA 2CIIA 3WDHA 5IHBA 5IB5A 2WWMC 1YNLH 1I9IL 4AJ0A 5I1AA 4M1CC 3PWUB 1T0MA 4E42A 1BWMA 2DAVA 3B6SA 4X7SL 1SBSL 1MCOH 3ESUF 3NA9L 1H0DB 4G6KH 3D3VA 4H1LH 3P4OA 4OD3H 2A73A 1G7HA 1QLEH 2G5BA 1AQDB 3STZA 4IDJL 5IBUG 5E24E 1B0RB 3RIAK 1NCBH 1CL7I 3VFMB 1OLLA 3VH8G 5FYKD 2IAMC 1MCSA 4XPHH 3RY5A 1ZHNB 2DD8L 2I24N 1BFTA 1CFTA 1EAPB 4X8JB 4LLQA 1KLGB 3O6MH 2D7TH 2WIIA 4TN9A 1CDIA 3QDAA 2YOCA 3PGDA 1OARH 4UIKH 3VXSD 5HHNA 3HG1E 1JN6A 1MWAA 1G7LA 3ZKND 3Q3GB 1A1NB 2NQCA 2QQKL 5LXGH 3TT3L 5KSVB 3PF2A 3PWPA 3PWJB 3HNTH 3UTZB 1LEGB 3ZDZE 1NFDF 1J0JA 1L4IA 2J8UE 1CYGA 1P7QA 3WFDL 5IMMA 4JQXC 1DLFL 4HHAB 1F6LL 3LPFA 4YK4B 5IQ7L 3V0WH 3CVIL 3GO1H 4I2XE 4EDXA 5FM4A 3OR6A 4PR5B 3T3MF 4PRBB 3BPLB 4ETQB 4MXVF 2HLAB 3C2SA 3X3FL 4ORGA 3HC0A 3T77A 1X44A 3N85H 2VAAB 5L9DH 4ZUUA 4KKBC 3T0EB 3T2NH 1M05A 3FONB 3BE1H 4UT6H 4L9LC 4Q6YA 3HE7B 4YC2B 2ARJQ 4WENB 2CKBL 1OPGH 5FKPB 1CICD 5MENA 2HTLD 3BGMB 1URLA 1J87A 3L6FA 3U30B 3JV0A 4PJIB 1N5YL 3BPCB 3NAAL 5EUOE 3HNSL 3A6OA 1PW3A 3NTCH 4NQVB 3IJSA 1KJ2A 4OGXH 4U05A 2BFVL 1EHNA 2QSTA 3W9EA 1RURH 2YPLA 4N8PA 3ORJA 4ELMA 4YXKH 3RGVA 1T66D 1CGYA 1QO3B 4YPGB 3VMNA 1FP5A 5D6DA 1CS6A 1D3CA 3VFUA 4OT1L 1EFQA 3K2MC 3O81A 4OZFH 4Y2OA 2HT2C 4MSWB 2BX5A 3CAFA 1U92B 2ARJB 1G6RL 1YEKH 3SKMB 4PBVC 1GPOH 4K7PH 4JDZA 3GSRA 1BJ1J 4Y1AE 1KF9B 1WBZA 2AKRB 3CSBA 3HE6D 3DGCR 5IFAH 2B8OT 1FV1A 2EYRA 4JY4B 4LLVA 4FQQA 3P9MA 3VXRE 3B2VH 1D7FA 3RNKB 1OOAA 4JFEA 3T1FA 4DZBB 5DT1H 1CE6B 1WFUA 3MV7E 4OKDA 4EI5A 1H15A 4OI9A 2BSED 4P2YA 1BQSA 5HYEA 5E2WL 4OJFL 2AVGA 1CFQB 3F7QA 2X1XR 1ZMYA 4I0PC 1FZOB 4LCUB 5HVGB 3WE6B 5EUKA 4JZJA 3CXDL 1Z5LA 1E4WL 4XWOC 2FX9L 3MREA 4GW4A 3G5XB 3OXSA 4P59L 1KT2B 3WFZA 5BRZB 2YC1B 4JDTH 1UADC 5TQ2L 2HFTA 4NNXA 1YN6A 3WUWB 4PUBL 1A7NL 3ISWA 3SO3C 3TNNA 2DLHA 4FHBD 2HTKC 4NZTH 2VQ1B 4MD0B 2AI0H 1BBDH 3EZJB 4MNQD 3TVMA 5KANG 3S88L 4X5XB 1Z3GL 3TJHC 1AH1A 1FL6A 3KYOB 1U0QA 2EECA 4R97B 5C0DB 2F8OA 3DV4B 3RL2A 3GKWH 1AHWB 3WNMA 3F12A 1O5DT 3QFJB 4YFLI 1CE1L 2ZOLA 4ZSOA 4GG6A 1SY6H 5KTEL 1J86A 2VYRE 3MCKA 4AG4H 1IM9B 4NBZB 1FQ9C 1KCVL 2NLJA 4MCZA 3FT2A 4KHXH 4OSUL 4H0HB 4R3SB 2Y23A 1VADA 3D39D 2W07A 3RTQB 3NBNA 2BNRA 1E4XH 3G6JA 4MNHA 1I1AD 3ULVH 3UJIL 5I1LA 1MF2H 5GGRY 3B9AA 4E0RA 1MCCA 1W72L 4O2CB 2ZUUA 3ABZA 3MNZB 3UC0L 1DUYB 2UWEB 2IBZX 3FRUA 1RMFL 3RGVC 4M48L 4MMZC 3WLWD 3V5DA 1RUML 4E5XB 5D6DC 4UDTB 3LY6A 3RWIA 4ONOA 3ARWA 1LO3L 5A43C 5IHUL 3A67H 3V7AG 3J8F7 4PJ8D 4UB0H 5DC9B 1WAAE 1DLHA 4I48A 2QADC 3S4SB 4TRPL 2UYLB 3WMSA 1T6WA 2GEEA 5FYJU 4MB4A 2IANA 3HB3C 3PXHA 5JHDB 1F8TL 1D5ZB 3F7YB 1YJDL 4QHLA 4PRPA 4YHPA 1G0DA 3B3IA 3MRCA 2P4AB 1HZHL 5HVHC 3P11H 4A6YB 4BA8A 3VDAA 3TH4T 4IMKC 4GRLA 4J3SA 3VFOA 4EI5C 2MHAB 4M9OA 5IBLD 3O45B 3U0TB 4G9DB 4MA8L 2IPUK 5K93A 4UNVA 4LU5H 5LGJA 4JVPA 4DK6A 5ACZB 2APXA 3LN5B 3DTXA 1J1OL 3U0PA 1QBAA 4LLAA 4LQ1A 3BKCL 4JZJC 2AGJL 3DRTB 3RIFK 4N0YL 3MNWA 4YDJB 1YEHL 3TA3D 2HKFL 3U9UA 2EDEA 1U36A 4PRIA 3E6HA 3NMEA 5I17A 1KB5A 4RAVA 2ZCHH 4R4FL 4ZQKA 2O61B 3BD5A 1A7OH 3QSKB 1MELA 1FGNL 3MV8E 1LMKA 3TF7C 3DOSA 2Q6WB 5F7DB 4MQ7B 1JF6A 4JKKA 1JK8A 3TO4D 3GMPB 5F7NC 3TVMC 3UPRB 2CK0H 4NNPH 1W8NA 4HIXH 4PP1C 2J3SA 3QEGL 2R23A 1XGQA 4ELKA 4EDWL 5DMIL 3MX0A 4ZUVB 3HCVA 4JKPL 4GLRI 3EJZD 4NJAL 4OFDA 1JF1B 3MJ6A 4ODUA 1I3GL 1PLGH 3H9SA 1XFPA 1V7NL 4HUVA 3P4MA 1JGUL 4KXZI 1KENH 4OBRA 5IW6B 3QEQD 3OKDB 4XCCL 3EKCA 4GLRH 4HS6B 5E56A 3RA7H 3KPMB 1KEML 1F3JA 5CZKA 1K5NB 5B8CB 3TNMA 2GFBA 2FH6A 5J11C 1DUZB 3HZMA 5LQBH 5KSBF 3D9AL 4NQCE 3EGSA 4YIQA 3HE6C 1IAOB 2YR3A 4G8GB 4JO4H 4FQIH 4OD1L 4Y5XB 4M7LH 4NYLB 4ONFL 3EFFA 1CFVH 4PJHF 3QUMB 2NPLX 3C8KA 1VEOA 4I3GA 1N5AA 2ERJC 1GVIA 3B8SA 1RULH 5TDPB 2F54B 2OSLA 5EBMA 1JF5A 2COQA 2MKLC 1XMWA 1AXSA 4Y1AD 1U3YA 3O2WL 5FKAA 5J6GB 1NGYB 1MLBA 2HKHH 4APQD 1L0YA 1OSPL 3I75A 1JPTL 2V2TA 3B83A 5I75B 4S1RL 2FH8A 3MV7D 3IAQA 5IW1A 1OAYL 1BBJB 4I2XA 4DCQB 5GGUA 5I8CA 4HQQL 4L29A 4E9LA 4Z78B 4X6BB 2E3VA 4GRLC 4WTZG 2OYPA 3QIWD 2FR4B 3O6KL 4X8XA 1WICA 4UQ3B 4UV4L 1EK3A 5C0IB 1YY9D 1F2QA 1WQVT 3QDJE 3GGWA 1IGYA 4KJQD 4Y4FA 2K7PA 5DO2D 4C4KO 5JORA 1GXEA 5C09B 5CEYA 4RFOL 4I0KA 4ONHA 3UPAA 2AAVA 3D85B 1EHAA 1BEYL 3EOBB 1PJ9A 4KI5F 2H2SD 3ETBF 3KS0J 3TZVA 2X4NB 2WLYA 4IRSD 1PG7L 3MJ8B 2EDYA 2EXWC 4LSPL 4DAGL 2FECI 5B3JF 4CU6A 5GGTA 1FPTH 1I1AC 3D18B 4AM0A 5CLWA 1MEXL 1NCWH 1J9CT 2JE8A 1FHGA 3O11A 3ZL4L 4HKJB 2PW1B 5CIPB 3MFFA 3OL2A 1Q38A 5IFHH 3BO8B 3V7AE 4R2GB 5JQ6L 3UP1A 4K9EH 1FDLL 4Q9QL 4PJXA 1FH5H 1T22A 3RWGA 3BAEL 2DYPB 4U2ZA 3ZSTA 4MA3B 5IHZA 2LE9A 3IAGC 1AP2B 2XWBB 5D72H 4LHUD 1ZEAH 4NP4L 5HI3D 1CD8A 1T5XA 3RRQA 3EO9H 3V9FA 4NZDA 2XNAA 1NFDA 3U7AA 4JM4H 4KK9D 4O58H 4H8WC 2XT1B 1WFTA 5GISL 2NY4C 3QRGL 4L8SB 1RJZA 2UVFA 4UU9A 3MBEB 4C4KT 3D0VB 2ZUQC 5E2UL 1WV7T 2JB5L 1C1EH 3PHOA 3LD8C 4PREB 1KOAA 4F57L 5JDSB 1MY7A 1K6QL 1KCSH 5AEAA 3GIVA 4M1GH 4WGWB 3GBLA 1U8KB 3P3YA 4KDWA 1DN0A 4NFBA 4UV7H 3CFBB 4OZHB 4A2LA 1NPUA 2BSTB 2CKBB 4M7JL 4CVZA 1U8JA 4DN4L 4U1JA 4OD2A 5IV2B 1TETH 5GGSB 5H8DA 1VFBB 2KZ1B 2K1MA 4NDMB 1YDPB 4P4KD 4XGZA 4XC3L 1J1XH 3BKYH 3HUJE 1N64L 2PTTA 4YAQB 5B3JE 3VFVA 4R0LB 5I6XB 5FYKU 1FORL 1JRHL 3NACL 3MCLH 4L5FL 1CFBA 2BHYA 4Y4FC 3FL7A 3EJZC 1VFAA 4G7YH 1VCAA 5TQ0L 4CDGC 5FO7A 4D9RE 1T0PB 2VH5L 5F7YC 4YWGL 5ID0A 3D6GA 4PJEB 1IEBA 2Y5EA 2VDPL 2X4QB 5INCA 2DQDH 1YY8B 3DVIA 5DK0A 4YUEH 3FQRA 1G6RB 4WI3A 5JZ7D 3TZVC 3VH8A 1MRDL 5T33L 5HPMA 4HIIA 3H7BA 2V2XB 2WBKA 2HJLB 5A3IC 3PXJA 5JO5A 2DQJL 5DHVB 1LEKA 5D7KE 2R2CA 1J8HE 1IQDA 2AQ2A 1UZ6F 4NOBA 5IESL 2WIMA 8FABA 1U93B 4LARH 4L3EA 1B2WL 1F4WH 4X6DE 4M7ZC 5T3XL 4TSBH 1S5IH 2A9NL 2P5WB 1QLRB 1QHOA 4GKSA 5I1HH 3MV01 1T1XA 1MCIA 3BJ91 3CIQA 1I9JH 4CBPA 3S5LG 1EJ6A 1QFWM 4LLUA 2SEBB 1JWMB 3HZYB 3LB6C 5TDOA 4R8WH 1JFQH 1P5VA 1UYWH 2BVPA 2QJDA 4KRMB 2RHEA 1SM3H 2DIBA 5GS1B 2CO6B 2W0KA 3EYSH 3TV3L 4AQ1B 1HI6A 1R5VB 1I8IB 4RIRA 3WUWG 1S9VA 4F7EB 3PL6A 5GSRA 1JGLH 4R90H 5F3BA 1I3VA 3QIWC 1PBYA 5EO0B 4HGWA 1AGCB 4PJ9A 4LAQL 5SX5H 3AM8C 4KHTL 3FB5A 4CN6A 2CMRL 4N5UA 4AEIH 3C6SB 4NNYB 5CHNB 2XXMB 2KDGA 2VKWA 2P5EA 2BK8A 4X5LA 4KJPC 4HLZH 3CLEL 1C08A 3S97C 5DO2C 5L2JB 1J0KA 1C16A 2DB8A 3NCFB 4WEMB 4G8FA 1FYTB 5EFIA 1X4ZA 5F7EH 5DMYA 4JG1H 4YFLF 3KYNA 4OM0L 5IGXH 1WZLA 4K7PX 3QDGB 4MD4A 2H2SC 4GKZA 5D7IF 4AEHH 3QUXB 3QDJD 4ZUTB 3HS0B 3RPIA 5FA3A 4XVJH 2ZSVA 1LO5B 5A2LH 2PW2B 2ITDB 5F9OL 2W9LA 1W72B 4P2RA 4XNZB 3BX7C 1G7QB 3BP6B 3DGGB 3RZCB 4TSAH 1U2CA 5IQ9A 1QKZH 4XAWL 4XCYA 3N1QC 4K3GA 4XVSL 4JKWA 1TPXB 2YBRB 1B4JL 4ORZC 1ND0B 5JLZB 4KKNA 1PAMA 3IF1A 1IEAB 3ARVA 5EU7E 1MSPA 4NQCA 5GGQH 1E6JH 1IGTA 1L0QA 3KR3H 4M1DH 4MJ6B 3GJEB 1KTRL 1XF4B 5IKCB 2VC2L 2AJ3A 3VGFA 1VEMA 1N4XL 1XZ0B 1YNTB 4HV8A 3G5VB 4AT6B 4QRSA 5L6YL 1G9NL 3O2VH 1J05B 5BZDA 1KN4H 2VITA 4M6NH 5DMJB 4NUJB 5JUEH 2GJZB 4MZ3A 4XP9H 1KPRB 1KELH 2A77H 4XPBL 4KROB 2QLVB 4JANB 2R1WB 1GGCH 3MGOB 4QNPE 4NKIL 1U8HB 2IBBA 3G9AB 1HINH 3DURA 2ADGB 4LRNH 5A40E 1A3LH 4LASL 1SJVA 5BQ7A 2GAZB 4M6OL 5F1SA 2ILLA 3DIFB 4CU7A 3MRDA 5C07E 2W91A 4BZYA 1DBAL 2AJVH 3V52L 1MJ7H 5I1CH 3Q6GH 4D8PB 2E7LC 5I1JH 5HGGS 5EA0L 5IF0B 2A0LC 2AP2A 3AC0A 1I75A 3DBXB 1CQKA 3PL6C 4Y16A 2D0HA 1WZ1L 3LV3B 5SWSA 5ICYB 1BIHA 1X5HA 3V6OA 4FNLL 5D7IE 2PYEB 2VDQL 2Y9RT 1Y6MR 4DW2H 4OZ4B 3H3PH 3GHBL 4DKFH 4LOUD 1WWAX 3MRBB 2VISB 3QI9A 1ED3A 2AJXL 1WEJL 4ZXBA 5T1LB 1OCWL 1ZT4A 1U8PA 4LLWB 4F9LA 1NGXA 4KTEH 3HR5A 5FK9A 4NRXA 5CKAA 3CH1B 1OP9A 2XQBL 1GJIA 4QXTB 1YEJL 3CFKB 1FVCB 4HWZB 3A6CH 2VLRB 3IS1X 4PPTA 1X6LA 3DI2B 3LQAL 4FZEL 5KSBA 5BW7A 2UWEF 4P5KB 4D9RD 3QIUA 2DQTH 1CF8H 1R3JB 2HN7B 3OG6B 3Q6FB 4ODWA 1KPVB 1HHIB 1KJ3L 4JR9H 4PJHA 3G5YA 3TLRA 3VWKA 5CWSA 2EDRA 5D93C 3QXAB 4CVWA 3O3EA 3ZTJG 4PGCA 4KRPB 1CZ8H 5ALBL 3WKMH 1TZGH 3HI1B 3MUGB 3QUYD 1F2XK 1VENA 1EGJH 4OGYL 1EFXB 3X13B 3GBML 1IE5A 1MCBA 1BECA 3OB8A 4HJ0D 2XI9A 3ILQD 1IAKA 4L3CA 1J0IA 3UO1L 5D7KD 1YMHA 3BIKB 2NNAA 2NZ9D 1J8HD 3C09C 5DVKA 4I9WE 1IT9H 3U36A 2BMKB 1N0XL 1MHCB 3GMRA 1E27B 3FO1A 5ENWA 1N8ZA 1WC7A 3H6JA 3EO1B 4OB5H 4F8QA 1BVLB 3GUTB 1A7RL 2VL5A 4FQJL 3QXDA 4FFVD 5E6IA 5D7LA 1BM3H 1FL3A 1TVHB 2MOVA 3I50H 2X9XA 4YDLC 2YPKA 3GRWL 1E28A 1XF3B 1OAQH 1MCDA 4WHTB 4B50A 5DD5H 3PWLB 2BC4A 4GG8B 1F58L 4H26B 5F88A 3LEYH 1UKSA 3AS1A 3QFJE 4H1LA 1OM3L 5CSZA 4PJGB 4XZUB 1NLBH 4EXPX 4NPYB 2NY5C 5CEXB 2P47B 4I13B 4NHCH 5FA4B 2CK2A 1JGVH 5E08H 4IRJB 2EYSA 5K33A 3UZEA 4UINL 5F7MC 3FOMB 1I9EA 2VLME 4U6VH 5ANMB 4Y16C 4PY7A 1MVFA 1H8NA 5EC2B 3F65A 2APTA 3L5XL 5BZWA 4LEOB 3OAUL 1QFHA 2AXFA 3LSOB 4QRTA 4XP5L 1ACZA 3IGAA 1NCUA 1HILB 4Z5RB 2UWEE 1IM3B 3X14A 3TCLA 2DS4A 3QI9C 4ZXBC 2VN4A 3H8NA 4L4VA 1R3HA 5DYOB 1XH3B 5C2UB 4F9LC 2GKIA 4WUKH 3EYFA 5DVNA 5C3LD 1KG0B 3NIDF 3OPZL 5ETUA 4NSKA 4NUGH 3BDYL 5DJ8B 5E2VL 1WWBX 4U1NA 1ZHLA 3ILPB 1OHQA 1AD9B 2FD6H 2LABA 5AZEL 1NKRA 4P9MH 3ROOA 3VFTB 1MHHB 3OXRA 2NY0D 2NY5H 5BW7C 5JHDE 4NQEB 1BJMA 4UILL 2DQGH 1U8LB 3M17B 3ESVF 2DQEL 4Y4HB 3VWKC 1NMBL 3LEXA 3IXTB 1B90A 2IMMA 1QBMH 4IRZL 5DRXB 1UWXH 5HDQL 1FO0L 3KNBB 4W68A 3C08H 3MRIB 3CXHJ 1RUAL 4NZRL 3WFEH 3WSQL 3U48A 2R0WL 3L3JB 2VLJD 4PGZA 5KSUB 1UQSA 3MOAL 4UUJB 3E2HC 2NXYB 3E8UL 3T3PF 1H3XA 1EERB 3RY6A 3PGCB 2DIAA 2AJSL 5KW9H 4ZTOL 5FXCH 2HVKA 1HQRA 2QSVA 4N8CH 3EYOB 3G5ZA 4HSQA 4WTZA 1EEQA 3IS0X 1HIMH 5DURB 4A2MA 5KVGL 4PJFA 5MI0B 2Z31A 5BS0B 5C0CD 5D6CA 4M02A 2MMXA 2R29L 4LKCA 1Q9LA 4X6FA 5D4QA 1V7ML 4X7TA 3FFCA 4CVUA 5ID1A 1MQKH 3ZHDA 5GS0L 4YHYB 1IC4H 1WF5A 3O9WB 4TUJA 2NY2D 5DR5L 3PWUA 4XHJD 3SQBA 4PFEA 5C07D 3TJEH 1DDHB 3ARRA 3C5SB 2H1PH 3HE7D 3IVKA 3QULB 1H0DA 1OT2A 4TNWK 4F80A 3HI5L 4XP1H 4NM8L 5FOBB 3I9GH 1KCUH 1UH2A 3ZKMD 1AQDA 5E99H 1MCPH 1ZGLM 2F19H 3NIDE 4KI5C 3PDOA 1EMTL 1B0RA 4JG0H 2AK4B 2DTMH 4RGNB 1LE5B 3MTRA 3VFMA 1T1YA 3MPCA 2CSPA 5I19H 3NPSB 1IGCH 3BH9B 4G8GE 1ZHNA 3K7UA 1A7PL 1EAPA 4OCWH 3L7FB 3BEVB 4GXUM 1PEWA 3IDGB 4U2YA 3RVVC 2R4SH 5MEPB 1V3LA 3WNKA 3DYPA 4L4TB 1L7IH 4MQTB 5BVPL 5C0EB 5EPMA 3LIZH 3LDBC 3Q3GA 5FV2A 1IGIL 2RCSL 4XWGH 2EKSB 4LDLB 2C3VA 2W60B 2EEAA 3PWJA 4HXBH 3UTZA 3ILQC 1LEGA 4DFHA 4OIIH 4QT5A 3T3PE 4P3DA 3G6AB 2R9HD 4Z7WA 4N1HB 2NX5E 4R96B 4HHAA 1CD9B 3VJ6B 1MJUL 3BP4B 2Z93B 4RFEB 4OKVB 3QZWB 5EZIH 3QRFM 3MLWH 4PR5A 4PRBA 4ETQA 2HLAA 4FFVC 1YECH 3K4DA 1AI1L 1YNKH 3GSUA 4CADB 1FAIL 4GKOA 4LSTH 3LZFH 4HMDA 4OUUB 4X4ZA 2WBJB 4FXGB 3RY6C 3T0EA 1ZTXH 4I9WD 2VDRH 2H2PD 1SY6A 4GO6B 4BM7A 4X9BA 5SWZE 3UYRL 1QBLH 3FONA 4Z8FL 5C09E 3IU4H 2A6JB 2Z8VC 3RWCB 1OAZH 4OZHF 4MNGE 5FKPA 1Z9MA 3BGMA 3C2AL 4QXWA 3FQTA 1CR9L 1D5BB 2Z31C 2G60H 2XN9D 4YX2H 3WDJA 4PJIA 4AENA 1UM4L 1NL0L 5H2BB 4GRMB 2VOTA 2JIXB 3MXVH 4NQVA 4Z7UA 4XX1G 1QSEB 1T0NB 2YN5A 1JRHI 2UZIL 4MDJB 5SV4A 3DMMB 5DQJB 4P0DA 1QO3A 1Q9OA 1W0YT 4PJEF 2D2OA 3B9KD 3MBXH 1CLYL 1XGYH 3FHQA 1A7QL 1U92A 1A5FL 3MUZ1 2ARJA 1Q9KA 3JBG7 2VLMD 2NW3B 3MGAA 1FVEA 4HUXA 3RTQD 4FABL 5SWQB 3PGFH 1I3UA 5GGSY 2NY1D 4NRZB 4WFGD 5EO9B 3W81A 2X70B 2IQ9H 3ELAT 2YD9A 4PJ7B 5EOQH 2FX7H 3IFNL 3NPZB 3O3BA 2Y07L 3TBYA 1MI5E 3RNKA 1JZ7A 4JFDA 4DZBA 3EYVB 1CE6A 2OJZH 1I1FB 1SMOA 2WUBH 1UWEH 2BY3A 1OSZB 5HHOB 3NFNA 3S5LA 3KYMA 5CUSH 5I16B 4XMPH 1CFQA 3GSXB 5IR1B 1X5LA 3WE6A 1SYVB 4HWUA 4GRWE 1A4KB 3MXWL 5J12B 1IL1B 2JCCB 1T2QH 3HFMH 3G5XA 1KT2A 4QXGL 4UQ2B 5BRZA 1YMMB 2YC1A 4TUKL 3W0WB 4RFNB 3MYJA 1BAFL 3QQ3B 3IU3B 3T0DA 3L3OB 3PDDA 4YK4C 3MROB 1CXHA 1YEFL 3AVEA 4OZHE 1UWGL 2VQ1A 1DE4B 4JFYB 1X5YA 4S1QH 1UA6H 3DETC 4X5XA 1CGSL 3BPLC 5L88L 3KYOA 1ZANH 2GYSA 1TENA 4QRPB 1G9ML 2Y7QB 3DV4A 1TQCB 1AHWA 2IBGA 2IFFH 1JYNA 1DQTA 4FS0A 5D2LA 3T0EC 2NY2C 3DVGB 2OZ4L 3BP5A 3QFJA 1QACA 2J6EA 5C9KA 3VW3H 3RNQB 1IM9A 4RDQG 3HE7C 4YC2C 4PJEE 4JHAH 3U4BL 1AKJB 5KVEL 5EU4A 2ZCKL 4ZD3L 4I3RH 4R3SA 4ODSL 2DM2A 1U91B 3WXVL 3NCJL 3MRNB 3OF6D 4RA0C 1RZKL 4FQ1L 1CDHA 2IGFL 1MCKA 4LQFL 5ISZE 3NIGE 2YK1H 4GMSL 4L9DA 2NTFB 4O2CA 5HI4D 1DUYA 1RK1B 2EH7L 2BVYA 4TULL 1WBYB 5ALCL 3QIBB 3QB7C 1P2CB 2NXZB 1F97A 4E5XA 3MODH 3TBVB 5LKNA 4UDTA 1UGNA 2FB4H 5C2BL 1V3MA 5DTFA 5DQDH 4XNXH 1DSFL 3R1GH 3NN8B 3ULUE 4J3UA 1CVSC 2P5WE 4FTVB 1JWUB 2XZZA 1DQDH 1AGEB 3PWNB 15C8H 3L3DA 4X9HA 3N1MC 2IH3B 1MWAL 3D2UB 5DK2B 2CQVA 1YYLH 1D5ZA 4G8GD 3MR9B 1X5GA 3MLYL 3K1DA 2NY6D 2R9HC 1HHGB 3VRLE 2W65A 1VACB 3KLSA 2MHAA 3O45A 3U0TA 4G9DA 1U8MB 5DFVD 4OCRH 5HHPB 5E4IA 5ACZA 8CGTA 3LN5A 4X5WA 2I9TA 3DRTA 1T2JA 5EU6E 4S2SB 1KCRH 2NX5D 4Z77A 3SCMB 4PJCB 5C0RH 2BNQB 2WNGA 4G6JL 4YBLC 3FO2B 3MRQA 4F33B 3D69B 2Q6WA 5F7DA 4C56B 1CBVL 3GMPA 1FFQA 4FRWA 4XX1E 1UCTA 3UPRA 4ZOEA 4HFWA 3I6LE 3QPXH 5ADPL 1RJLB 1U3HB 1KBGH 4ALAH 4ZUVA 1AHWC 4G3YL 5SWZD 4LCIL 3BMWA 4JZOB 4KVCL 5MEOB 1JF1A 2BVQB 4MNQA 4TPRL 5C0BE 4FFZL 2VE6B 1CLOL 4POYA 1BIIA 5IW6A 2XQYG 5I15H 3OKDA 1GHFL 5JIHA 4XC1L 4HKBB 4HS6A 2AJZB 2P8MB 5E2TH 4OLUH 2QQQA 3RTQC 5JHLH 3KPMA 4FQXD 1K5NA 3GNML 1AJ7H 1ZVHA 5B8CA 2LV4A 2EDDA 2DBLL 2V5MA 4DWHA 1FYHB 3DO7B 3EOAA 2PR4L 4NKDB 3ARFB 2X5PA 3JTTA 4Y5XA 1P1ZA 3GHEL 5DRZA 2GHWB 1KTKE 3GMNB 3HRZB 4J4PA 2CIKB 4JRXE 4K2UL 4K3JL 4NYLA 4Y88A 3QUMA 3EHBD 2VLKB 4JFHE 2I60L 1KIRB 4G7VH 1R3IL 4R2GD 1TNMA 3ZT7A 4LSQH 2F54A 5TDPA 4PS4H 2EDFA 3W5MA 5E8OB 4LAJH 4KJYA 1OLZA 3HC4L 2DYPD 1FO0B 5FV1L 1SYSB 2EC9T 3BDBA 1EH9A 2C3XA 4RQQA 5J6GA 4OLVL 4GBXD 5AAMA 3HMXH 1LNUB 3WHXA 3FB6B 5C1MB 1MI5D 4X4XB 3KPPB 5HDOA 1BBJA 3TP4A 3QNZB 1NEZB 5E8DL 3G6DL 4X6BA 3DNKA 5TFSL 3SOBH 2H32H 3ECBB 2DKSA 2BVEA 5DMGD 4UQ3A 5D96B 5K9KB 5C0IA 5KVDL 2DDQL 5AYQA 3VD5A 1S7UB 1FGVL 4HZLB 1LE9B 4G9FD 5LCVL 4RMTA 2WK2A 2MTPA 5C09A 5KVFH 4JB9L 4OCLC 4OCYL 1WBXB 4G8EB 5AWNH 3UJTL 4PJGF 1A22B 3P2TA 3D85A 2HFEB 3QWQB 1OAUL 1SQ2N 5HVFB 1PY4A 2AJYL 3MRJA 2X4NA 4WWKD 1RZFH 1KCKA 4YGAB 1IKFL 1TITA 1ZK9A 3FT4B 3D18A 1RQ5A 3I6GB 1H3GA 4K94L 5HGBA 3P30H 5DJCB 1EO7A 1F90L 2KUTA 4HKJA 2PW1A 4X0KB 5CIPA 1DVFD 5T5NG 5F1NB 4WEUD 4ZNEE 2K7QA 3JV5A 3M8OL 1PZ5B 2HT4D 1S7TA 2A1WH 3BO8A 1WIUA 2A6KB 4HWEH 1UACH 2IG2L 1RIHL 5GHWH 2WAHA 3FQXB 2CDGA 3EO0B 5ISZD 5B8CC 4N0CD 5IMLB 3ARXA 1EJOH 3QEQA 2BRRL 1IZKA 4Y5XC 5DK3A 3O3UN 3PHSA 1QRNA 3RFZC 2VUYA 1AD0B 2NY6C 3B5GA 1WCBB 3ULUD 1S9YA 3PE9A 5C9JA 3MRGB 1MCJA 1E4JA 2P5WD 1U3ZA 2MCPH 3MBEA 4NC1E 2FDBP 5CMAB 5FEBA 5DJXB 5DFVC 3D0VA 3LN4B 2Y4SA 3OAYK 3QZWG 3ARSA 1GGBH 5CD5D 3BYTA 3VD4A 5T1DH 4NQDB 4U3HA 4YHMH 4LNVA 1AE6H 5INDB 4WI9A 3ZSSA 4U49A 4ZAKD 2YXFA 1XGPA 5JW4M 4U1HB 4RZCA 1U8KA 2GJ6B 4XT1C 5I75C 4XP6H 3U7WH 2NCMA 1CDYA 1JZ3A 3L9RA 4NT6B 4U6XB 3HKFA 4OZHA 3V6ZB 1HH6B 2VXVH 1KXQE 1AY1H 2BSTA 2CKBA 2H8PB 3GK8L 3O0RL 3V4VL 5D5MA 3W5NA 2F5BL 3HTLX 4KQ3L 5I30H 2WW8A 5GGSA 1VFBA 4NDMA 5DUPH 5ANME 3RBSA 3RWJB 1TXKA 4O9HL 1JHLH 4U0QB 1P4IH 1BREA 4YAQA 3VXMD 4DOHB 5CJQL 5EU6D 3CC5B 1NCAL 4R0LA 3BHBB 5C0AB 1MRFL 2CDEB 2ICCA 3NZHH 5IJKC 1G7IB 4CU8A 2Q20A 2X4QA 3VGEA 1MCHA 4LHQB 1YY8A 5IB3B 3GSWB 5EU5B 4GQPH 4H88L 1G6RA 3OBAA 2HFGL 3I6LD 1S8DB 3OKMA 2OXHA 3BN9C 5I8KL 3QXUA 2OQJB 2V2XA 5HHXL 1IRAY 3FHAA 2HJLA 5LGHL 2RGSA 4QXUL 1A9EA 4FXLA 5I1KH 2X42A 1C5CH 5C0BD 5CEZL 4NQEE 5CGMA 3CDYA 1ACYH 2F53B 2R69L 2CH8A 1U93A 1G0YR 4X80H 1G7MA 4O2EB 3CVHH 4JRYE 4JPVL 4R2GC 1P4BH 3HZKB 3DXAE 1QLRA 1SBBA 2R2EB 4EBQL 3ARED 3SDYL 4P49A 1FL5B 2ORBH 1I9IH 3BP7B 1DBMH 3HZYA 3LH2H 4JHZA 1RUKL 1RU9L 4KRLB 4NFCA 5GRUH 4ODBD 4JRXD 5I1EL 3AXLB 1SBSH 4PY8J 4BSJA 3P0YL 2X4TB 4JFHD 1ZSDA 3T0AA 1VDGA 2JELL 2DOCA 3DARA 3RDTD 5CZVL 5GS1A 3DHJA 5I8OL 3S96B 5LWYL 2JJSA 3N9GL 3BRDA 4D0BA 1JTPA 1R5VA 4K3DH 5T1KB 4L8SC 4F58H 4F7EA 3TFKD 4IDJH 3MBEC 3SDDD 5EO0A 1AGCA 2PETA 2VDOL 1X9QA 3FZUD 5DMGC 4X4YB 3IDJA 4NM4L 4PLJD 4NNYA 4TYUA 5GZOD 5CHNA 2EXYC 3UTOA 1ZOXA 1UCBH 4NO2B 1GOGA 2D7NA 5L2JA 3DSNA 2CIIB 4R7NA 2IF7A 3SE4C 1FYTA 5I1AB 2PYFB 4Y19B 4ZUWB 4BKLB 1T0MB 2VZOA 2ZPKL 3SDXE 2CXGA 4JGUA 3QDGA 4KUZH 5DRWB 5E9DD 3TT3H 1X7QB 1BFSA 2Q3AA 3QUXA 4ZUTA 4KKAD 1G7HB 2E7BA 4BK5A 3FO0L 1ZVYA 3W2DH 3NH7L 4RGNE 4FMKA 4XPGL 4CDHA 1D6VH 2PW2A 5GGTL 2ITDA 4TOYH 1I1CA 4R0LC 5I6XC 1W72A 1EHLH 4XBGB 1G7QA 3BP6A 3DGGA 3QHFH 3RZCA 1NAMH 1TZIB 1NKOA 2HT4C 1JTTA 4P48A 9CGTA 3OJVC 3WNPA 4GRWH 1EGJA 4PRNB 2YBRA 3KPRD 1CFTB 3AAZB 1ND0A 3BUTA 4CMHC 1Q0YL 5T3XE 4LLQB 1IGFL 3V4UL 1IEAA 4TTDD 3PGDB 4NWUH 1MWAB 1G7LB 4MJ6A 3KVQA 4PJ7F 3GJEA 1FFPB 2OTPA 1XF4A 1M7IB 3HNVH 1KN2L 1BFOA 4ERSL 2ED7A 1YNTA 2QQNH 3G5VA 4RWHA 4AT6A 1EZVX 1AXIB 3P77B 5FUOL 4JQIL 3T0WA 5EC1B 1J05A 5IW3A 3VRJB 1ZHBB 1P7QB 1DANU 5IMMB 5ILTL 4MJID 2GJZA 2XTJB 5BV7H 1T5WB 5CZXD 1EEUA 4JANA 2R1WA 3MGOA 1L7TH 1TJIL 4LLDB 2F58H 2ADGA 3U4AA 2JCCF 4DN3H 4FP8L 2ZKHH 1V3KA 2C4FT 3T77B 2GAZA 4BZ2L 2R0LH 4HKZB 5FGSA 1QOKA 3DIFA 2VZTA 5IB4A 5CBAB 1QPXA 4QHNB 5E6ZA 4U6YB 5H37H 2ENYA 1M05B 1H3TA 3MRLB 4P9HL 2W1NA 3DBXA 4IOIA 1D9KD 5E2JA 5FCUL 3LV3A 5ICYA 3RVUD 5T3ZL 2YMXH 4M5ZL 1NUGA 2PYEA 5FYLL 3B2UD 3B8YA 4KMLB 1QSEE 2OI9C 3WNOA 2PXYD 4NO3B 3GKZA 4OZ4A 5D8JL 3LQZB 4O02H 4Y8DC 5JQHC 1PDKA 3ULUH 2VISA 3IJSB 1N7MH 1CVRA 5SX4I 4OLZL 5C7XL 4QF1B 4ELMB 5I76A 2PNDA 5EIIB 3VFUB 3SE8H 1FRGL 4N0RA 2B1AH 2FJFB 4JFOA 5I0DA 2F9BT 2FLRT 3CH1A 2X4PB 4BZ1L 3UJJL 5HHVL 2IFGA 1FVCA 3QUXC 4HWZA 2VLRA 4PJDE 2O5XH 4JDZB 4P5KA 4QWWD 3Q6FA 1R3JA 2HN7A 1WBZB 1EEZB 4PJ7E 1KPVA 4XNZC 1HHIA 1CXFA 2VABA 5JOPE 4JGMA 4L8DB 3QXAA 4UMGA 3LEVH 4PV9A 1FV1B 5IVOA 4XHQA 3SKNB 2EYRB 3KDMB 4FQQB 3HI1A 3MUGA 2JKXA 2M1KA 4Q9CA 3K8KA 2D31A 1OGAE 4JFEB 3JWOL 3X13A 1EFXA 2MJWA 1JHTB 3OZ9H 2PO6B 5J0BA 1NCDH 5LG1A 4WVRA 1B4RA 5LBSL 4UT9H 4NC2B 4XVTH 1NMAH 4NQED 2IADB 2BMKA 5EUKB 1YMME 1YJDC 2YEZB 3BD3A 1HKLL 1Z5LB 1T7YA 3KHOA 4K23L 1MHCA 4JPWL 3RDTC 4JRYD 1E27A 5KSAD 1I8LC 3VE0A 3OXSB 1LHZA 2OX5A 2D03H 1X3DA 3DXAD 5E8NB 1KFAL 1YEDB 3Q5OA 4LPWA 1BVLA 3U1SH 3GUTA 4NNXB 4LMQI 1TTFA 2UVEA 4D94A 1NEZG 4N5EC 2B4CL 3UJIH 1S7QB 1JP5A 4NBYB 3GBNH 1GIGH 1P53A 1YEIH 1X5FA 1XF3A 3WNLA 3HHRB 1IQWL 4GAGH 5E8EA 5GZOC 4WHTA 4KZEL 1EBPA 3PWLA 4GG8A 3HC3H 4H26A 4PJCF 1NFKA 1YEGL 3RHWF 3UTSD 2CD0A 1A2YB 4PJGA 4XZUA 1H9VA 4NPYA 5CEXA 3F12B 1CXIA 4ZPTA 4BQ6A 4IRJA 4ZSOB 5L7XH 4GG6B 4F7CA 3FOMA 5MEQB 3MCKB 5ANMA 1PKQB 1F3DJ 5EC2A 1NGPH 3FT2B 1YJDH 4KKAC 4LEOA 1MPAL 3FQNA 1FSKC 4OLXL 3LSOA 1HZHH 4UOJA 3MLXH 3G6JB 4DJMA 1HILA 4Z5RA 3T2PA 1IM3A 4G6AD 5I1LB 3WN5B 3HA0A 1HE7A 2OBGA 4E0RB 1JGEB 5DYOA 5IK3B 3FRUB 3STLA 3MLZH 4HC1H 5KJRH 1AFVH 1KG0A 1N3NB 3VRIB 4LPYA 3H42H 5DJ8A 4RMRA 5TPWH 5J13B 5DLMH 2IEPA 3ILPA 1UZ8B 1AD9A 4WCYL 4RGND 3KXFD 4TTDC 5DJ0B 3W82A 1MH5B 3VFTA 1MHHA 3L3GB 4PRHB 1JYXA 4O00A 1XIWD 4D9LL 2W0FB 3AY4A 3CFCH 1AIFB 1U8LA 4MCYB 5F9JB 4C83B 4Y4HA 4I0CC 4DVRL 4PRPB 3IXTA 4X4MA 3MRCB 4WEBH 3L3HB 4WDIB 2PKDA 3FQWB 5DRXA 5TE4H 3BW9B 3KNBA 3QQ9D 1BVKB 3MRIA 3QDHA 2E9BA 3KJ6L 5DJZA 4KKLD 3L3JA 3I3DA 3B5TA 5E4EB 5KSUA 5CZXC 2OR9H 4UUJA 3SQOL 5A1AA 4MX7A 1G84A 4NJAH 1CG9A 1IC1A 3L3IA 4MS8C 1EDQA 4TQEH 4P2QE 1N6QL 1UM5L 1BD2B 3EYOA 3EOTL 4PJCE 1YC7A 2I5YL 1MFCH 1CLZL 4RX4A 3LAFA 5BS0A 4JFFE 1AXTL 3CNKA 4NC1C 3CDGB 4DGIL 1FCGA 1EO8H 5I17B 4C56E 5C08D 3WJLA 1UH3A 1J10A 3LOWA 2L0DA 3VU2A 3RVUC 3D9AH 3GI8H 2WBJD 2HVJB 2VXQH 3B2UC 2FLBT 4OD1H 3O9WA 4WUUE 1QFWH 1T03H 5D1ZD 3WKNA 3C5SA 1H3VA 5FHAL 5TE6L 4IMLB 1NLDH 3QULA 4KVNL 1YPZB 4M7LT 3L5HA 5FOBA 4OF6A 5F9AC 1I9RL 4IRJC 1QR1B 2EKJA 1X5AA 3BJLA 3H9SB 4M93B 5DD1H 1WSST 3R06B 1ZT1A 2UV3A 3GMLB 2AK4A 1LE5A 3VWJD 1MJ8H 4JCMA 4HAGA 2R4RL 3GJFB 4YDIH 1F3JB 2MCG1 3IFLL 4QWWC 3BH9A 2GFBB 5TF0A 4JGJA 3GSNL 1ADQL 3RUGA 2VLKE 3L7FA 3BEVA 3PQYA 4Y4KA 3JWDL 5MEPA 1FE8H 2D9CA 3QPQD 4L4TA 5C0EA 1N5AB 3Q1SL 4UV4H 4NCC1 4ODXB 3IJYB 3G08B 3NA4A 1I3RB 2EKSA 4K8RL 5D7JB 2W60A 2OSLB 1UB6B 2VIRB 1S7VB 5BJTB 5DD0H 3WHE1 5JOPD 3MJ9L 1FJ1B 5I1GL 4OFKA 2J4WH 5FO9B 4R96A 2HJKB 3D0LA 3VJ6A 2GJJA 3ZLQC 4NWTL 5DC0A 1LEIB 3BP4A 1RZJL 3L1OH 3PABB 4LFHG 4NO0B 4OKVA 3QZWA 1OGAD 2XA8H 2H41A 3GFUA 5IW1B 4DTGH 1U8QB 4FQ2H 1X4XA 1B0WA 4JZNB 4CADA 3WFBH 4JPKL 4OUUA 4PB0H 4FXGA 2O26U 2NXYC 1N2RB 1ZS8A 1K8IB 1EVTC 4P57B 1YNLL 4ESKA 2WBWB 3LRSB 4KZDH 1MQ8A 3E3QC 2GUOA 3KHQA 2YZ8A 3O2DH 5J8OA 1MCOL 1WIPA 4KGJA 3RWCA 3KPTA 4G6KL 4Q9QH 3N50A 4UDUA 3OKLB 5MI0C 4OD3L 1D5BA 1M7XA 1QLEL 5DGRA 1KYOK 5H2BA 3LS5H 4NP4H 1MAKA 2JIXA 2A9ML 2UUDK 1QSEA 1T0NA 4YHYC 5IP4A 3MMEB 1NCBL 3RU8H 4PD4K 4MDJA 1NC4B 4GOSA 3DMMA 5F7FA 3O9WC 2Z8SA 1DQLH 3IDYB 5GISH 3U0WH 4XPHL 4MAYD 1A8JH 5ACMA 5IJVB 3QXWA 4G6AC 4UTBL 4DVBB 1MUJB 1AKJD 1F42A 4PJ5E 3O6ML 2D7TL 2FATH 2NW3A 4M4RA 1OARL 4UIKL 5F21B 5F1IB 5SWQA 1PEZA 2ESVB 3HZVB 4NRZA 3TEUA 5EO9A 4PJXB 5LXGL 2DIJA 1K6QH 3DJ9A 4RGNC 2R2BB 4I4WB 4PG2C 4JFPB 3HNTL 2X70A 3MGTA 2GI7A 1CLCA 4PJ7A 3NPSC 1F3RB 1GCFA 4X6EB 2D0GA 1BGXH 4Y2DD 4R7DB 3BSZH 1BHGA 3V0WL 3GO1L 5D2NB 1OSZA 1ZT7B 5HHOA 1D5IH 5I16A 5GJTL 3GSXA 4XMLH 5IR1A 5J3HC 3ZE1E 3WLBA 4HWNA 5C8JB 5D70H 3UBXB 3N85L 5L9DL 4LEXH 1IL1A 4B7LA 3BT2H 2JCCA 5F1OB 4NQDE 4UQ2A 2EIBA 1YMMA 1XGUB 3W0WA 3T2NL 4ZODA 3QQ3A 1FVDB 3PHOB 1SVZA 3IU3A 2GJ6E 3BE1L 4UT6L 4EJ1C 1Q9WB 3J7HA 3MROA 3EJYD 4JCLA 3UXFA 1OPGL 5J56B 4N0UE 4QY8B 3OG4B 1DBBL 4JFYA 3WV0A 4LBEB 1OP5K 1UXSB 4QRPA 2XQYK 3NTCL 4JM2D 4MD5B 4CVZB 4OGXL 2WBJC 1MHPH 4HBQA 4P2QD 5KBNC 1RURL 3DVGA 4YXKL 4CUCA 5C0AE 1TVBA 2PTTB 2BVOB 5F44A 2B0SL 4PTUB 2DLTA 5I9QB 2V5SA 4JLRB 2A9NH 3GSOB 4JFFD 1KXTB 4GAJH 5EBLB 3QUZB 5CJBA 5J9PB 1VFAB 4C56D 4U1IA 3ZYZA 2QSQA 1YEKL 4P2OB 4WHCA 2OK0H 5ID0B 1GPOL 4FFYH 1U91A 4K7PL 5KVMC 1IEBB 1AR1C 3LS4H 4MLIA 3EAKA 2VRAA 3MUHL 3MV11 3F7VB 1TJHH 4WUUD 4PIRF 1U3HD 3VWJC 3FQRB 2GT9B 5A2IH 2NTFA 3O6FB 3VH8B 2HWZL 1RK1A 3DMMC 1WBYA 5IFAL 3IXAA 4HIIB 3QIBA 2WZPD 3TBVA 2FCBA 4V1DB 3DWTA 1REIA 3B2VL 4PP2B 2F53E 2Z4QB 1JZ6A 1A7BA 2D7QA 4PLKD 5JO5B 1CDBA 1LEKB 3OMZA 5DT1L 5LVEA 3NN8A 5JIPA 2KKQA 3CZJA 3QPQC 4FTVA 3KPQB 4S11A 4L3EB 1AGEA 3PWNA 4QTIH 3S34H 2IH3A 3D2UA 5DK2A 3HMXA 1LVEA 5IMKA 3ARFD 3CLEH 3TT1H 3QQNA 3NFPB 5C0JB 3MR9A 3BZFA 3TPUA 2R0KH 2Z0BA 3AMLA 4JDTL 5HYJD 3KLAA 4M62H 3ARDD 1HHGA 2XOTA 4P23D 5EWIH 5HYSG 4MA1C 5HI5D 3WCYA 1K4CB 4LPUA 1LQSR 5E1AA 3UBXI 4FA8A 1NANH 4NZTL 1G9NC 2AI0L 1BBDL 2CRIA 5L2KB 4IS6B 5HHPA 1R0AH 3MLRL 1RV6X 4R4ND 4RIRB 5F9OH 5IBTH 5GSRB 1T83A 3SKOA 1R3LA 3GKWL 4POZC 5J12C 5FUZL 1WT5C 1LILA 2XRAL 4S2SA 4PJ9B 3SCMA 5HJ3B 4D3CH 4RFNC 1H3PH 2BNQA 1SY6L 5DZOA 1AC6A 1M6OB 4AG4L 1QD0A 3FO2A 3UTPE 4F33A 4XVSH 3FRPG 3D69A 1Q0XH 4G6FB 1C08B 3AGVA 2QL1A 4KHXL 4FXKB 1NCCH 5GS3A 3UTTA 4G8FB 2XWJB 4WI5A 4OQTH 1A6UH 3D3VE 4UBDC 3V4PL 1E4XL 3VG9B 4XPFH 3ULVL 3ZHLA 4OLEA 3H3BC 1MF2L 1TQCC 1DBKH 1LO0H 5JA8B 4JZOA 5CP7B 3RPIB 5MEOA 2BVQA 4ELMF 3H9HB 2Y6SD 3RWHB 3C6LD 1FCCA 1I85A 3W39B 3O41B 4KK8C 5TGBA 2BSRA 4HKBA 3A67L 1IGML 2AJZA 2P8MA 3U4EA 4UB0L 2ZG3A 4WHYG 2NW2B 5I1IH 4YBQD 5E7FA 4RBPK 4OV5B 5GRVL 3ZE2F 3MSPA 4WO4B 3DSFH 1F5WA 3DO7A 4LF3A 5CJ5A 1S7XB 3WIFB 4NKDA 1QA9B 3RX7A 4MXWH 5CGYD 3GMNA 3HRZA 3LQAC 2CIKA 3QIBC 2NXZC 3DRQA 1KIRA 3PWPE 3S36H 4EN3D 3VD7A 4PJ5D 4JVWA 2HH0H 3P0VH 4GAFB 1WJ3A 1WK0A 1ULVA 2MPAH 3P73B 2BDNH 3TN0B 3VI3E 4LIQH 5E8OA 3U6RB 4HV8B 5DD3H 4ZS7H 1DN2A 1OTTD 3RP1A 2AXJA 1FO0A 1SYSA 2XTJE 4LU5L 4IBLT 4QRRB 3ZTNH 2VITB 2EDKA 2VNCA 5IROC 4WU5B 1CT8B 1LNUA 2F74B 3FB6A 2AJXH 5J1TC 2DWEB 4X4XA 5FYJD 5CKGA 3KPPA 2BZDA 3DLQR 3QNZA 1NEZA 4LGSB 2RAMA 2ZCHL 1KIQB 4LVNC 2OLDA 4K71B 1GOHA 4DKEH 1YEJH 3ECBA 2PN5A 2DBJA 4OLWH 4WFFE 2B39A 5K9KA 1M1SA 2CK0L 1UT9A 1F4XH 2IQAB 4HIXL 1T83C 1MNUH 4HZLA 1LE9A 3DX6B 5HDBF 1KJ3H 1BX2A 4I8DA 4GSDH 2C5DC 2GJ6D 2WWMD 2MWCA 3SCMC 1WBXA 4G8EA 1CQYA 4M1CD 3X11B 1PLGL 2AQ1A 3SGEH 3CU1A 3S3SA 2J88H 4ELME 5ESQB 4GG6F 1KENL 1F13A 3WUZA 4NZUH 1DZBA 3OKYA 1U8PB 1OL0A 2E27H 4I1NB 3RA7L 2EDBA 4TVPD 3RAJH 1GC1H 3FT4A 2EE6A 4HKXB 1D6EA 1OD9A 5ADOH 3ZE2E 3G6JF 4NRXB 1U3HC 3ARGB 3SDCA 5LQBL 3CSYB 4ZFOA 4JO4L 4FQIL 4X0KA 4M7LL 5F1NA 4XNQB 5F7HA 1CFVL 1HNFA 2YA0A 2E7MA 3CVHA 4JHBA 1PZ5A 3GSNB 3V0AC 3QIUB 4ODWB 2VZSA 1RULL 3O8XB 4PLKC 3LKPA 1F4AA 1Q72H 1MCEA 3G5YB 3FQXA 2W9EH 4S0TD 3EO0A 3GRWH 2W0PA 4JFEE 4PGCB 2QEJA 2LTQB 1C5BL 3WEXB 4X7EC 3IJHB 4NQSB 5IMLA 1NC2D 5J06A 1C8PA 2DJ4A 4W4OC 2HKHL 3ARFC 2EDHA 1KC5H 1BJ8A 2X4RB 3FQUB 3IDNA 4OF0A 3N1PC 3ARDC 4MQXD 1WCBA 3ALPA 2FBOJ 2I07B 3MRGA 4LCWB 4NHUB 5EU3B 5HI5C 2R56H 1Z0MA 4LL9A 4LNRB 1LP9B 2EIEA 5IM7B 3GMRB 5CMAA 5BXFB 3C8DA 3BVNB 3FO1B 4XTRC 2DMKA 3LN4A 4OFYA 4U6TA 5JXEA 3O4LD 3WS3B 2YD6A 4XP5H 2Y06H 4MGXA 5INDA 3UROR 3GSVB 1FL3B 1N59B 4MJ4A 3BRGC 4U1HA 1VGEH 5HDBE 1JNNL 3IETB 1E28B 2WQRA 4QHKJ 4NT6A 4U6XA 4P5MA 1JJUA 3V6ZA 1HH6A 2BC4B 1XT5A 1VKXA 2H8PA 3FN0H 2YZ1A 4H1LB 5KZCD 4ZSOE 4GG6E 4GS7B 2BSSB 2JJUA 4WNQB 1AC0A 3RWJA 5D96C 2EYSB 4P46B 1FPTL 1HSAB 1ITCA 1FAKT 1TZHB 1INDH 5GS0C 3BHBA 5C0AA 1NCWL 2BNRE 3G6JE 1DQML 1WVZA 1G7IA 1YPZF 3C60B 5JMOC 3EYUH 3UTPD 2FECL 4O4YH 3W11C 3O3AB 2Y36H 4BQ8A 1H5BA 3DX8B 2Y6SC 3KPSB 3U79A 2HYMA 4YDKL 5E8PA 5IB3A 4K9EL 4LSSH 5F6IB 5EU5A 1FH5L 4XPAH 4PY8I 3D3VD 1A6TA 1IAII 1ERNA 1S8DA 3QHTC 4ZMAT 2FWOB 1IC7H 5E5MA 4PG9B 4J1UB 4XCNB 5D72L 2GY5A 4C55A 1ZEAL 1FIEA 3EO9L 4FN0A 2G9HB 3CU7A 4IIQC 3OJDB 2PCPB 5CGYC 3C5ZB 4R9HA 3HLAB 3WJJC 4YXHH 4O58L 3MLPA 2F53A 3ROOB 5M95B 2IANE 2JJTA 3OXRB 4O2EA 4NFDA 3R8BB 4EN3C 1CK0H 2EEDA 4PRPE 4QTHB 3HZKA 5D1XB 4GW1B 4DK3A 5CP3A 2R2EA 5HHQB 5DC4B 3BWAB 3SDAB 1KEGH 4P3WA 1OTTC 5GGVH 5K9QI 1CXLA 3QDMB 4HUNB 2IAMB 3RHWK 1C1EL 5E5RB 2FIRT 1INQB 3VGGA 4I0PD 3UBXG 3AXLA 1KCSL 1YUHB 2X4TA 4IOSD 4M1GL 3PWPD 4XWOD 3QT2A 2C1OB 4EIGB 1KLUA 3N1FC 1M4KA 1TCMA 1JHKH 1BD2E 1K3ZA 5GRXG 4QHMB 4OI8A 2R8SH 3BGFB 2FSEB 3BQUB 2DM7A 3MRFB 4UV7L 4Z7VB 5T1KA 1A6WH 1P7QD 1P9MA 3C87A 5E00B 1VFMA 4QLRA 3CX5J 1TETL 2HTKD 2OS7A 5JXEC 4X4YA 5D6CB 3KYKH 3V5KB 1J1XL 3UAJD 3L95A 4WY7L 1GZQB 3BKYL 4LKCB 3TJHD 5F7LB 3SGDH 1EXUB 2O5YH 1HH9B 1HHHB 1NCNA 4JVUA 5FGCB 4KQ4H 5DVOA 3W9DB 3CCHA 3MCLL 3QH3A 4MAUH 2OZ4A 4G7YL 4HCRH 1U8NB 4MHHI 4TUJB 2PYFA 1RUQH 4Y19A 4ZUWA 4BKLA 1YPZE 4WW1A 3U46A 4OZFB 4QHUB 2VXUH 4WFFD 3IVKB 4K7FB 4YUEL 1JNLH 4QOKB 5DRWA 3H9SE 1X7QA 5MEND 3EBAA 5E70A 4OZIB 3RVTC 2DQHH 3MRMB 5FYJH 5M94B 2CO7B 3PDOB 2WANA 3QG7H 1SEQH 1CIUA 4XBGA 1T1YB 2YPLD 1FN4A 1TZIA 1XR9A 4Z18A 3RGVD 4I77H 1WWCA 3QO0B 4LARL 1F4WL 1X5KA 4JFQA 3INUH 4PRNA 4TSBL 1S5IL 3AAZA 1U8IB 2ZUTA 5I1HL 3V79C 3KAAA 1WUNT 4HS8H 4PJXF 2X7LA 2YD4A 2C1PB 4Z95H 5EPMB 2QADD 5K9JH 2DQUH 1FFPA 4Z8FH 4R8WL 1JFQL 1M7IA 5FIEA 2C3VB 4F9PA 1UYWL 3HB3D 3LKNB 4GMTH 1Y6NR 1SM3L 1IKNA 2YPVH 2FGWH 2BP3A 2M8XA 3P77A 4KY1H 4QT5B 3DROB 4P3DB 3TYGH 3VXTB 3EYSL 4MQXC 5EC1A 4MXQC 4TVPH 3VRJA 1ZHBA 3S35H 4Z7WB 2DQCH 5IG7B 2FEDC 1JGLL 4FG6C 3GSQA 3K8MA 1HHJB 3QWRA 5C71A 1T5WA 4S1DC 4EI5D 1BOGB 4LLDA 4DGVH 3SJVB 1GGIH 3I2CH 1F11A 1I7UA 2Z9TA 3GSUB 4EUPH 5EOCL 4HKZA 4PRAB 1A7QH 5GPRA 5E95B 3OJMB 2VLLB 2EYTB 5CJOH 5CBAA 4QHNA 4U6YA 3T2QA 5F7EL 2X40A 3E1F1 3MRLA 4JG1L 5IGXL 3QAZC 1P9MC 2H26A 4RWYH 1H8SA 4AEHL 3FQTB 1NUNB 4LGRB 1QRKA 3TVMD 4NO3A 4AENB 1MRCH 3ARBA 3LQZA 1G9MC 4Z7UB 1FLRH 4PP1D 4DGYH 1CTNA 5I2IA 2OL3H 4U6HB 4QF1A 4TSAL 1QKZL 1UG9A 1E6OH 1Q9OB 3ALWA 3KWWB 5EIIA 3T1WA 2VQUA 2FJFA 4H25B 2GY7B 1QFUH 2NY3B 2X4PA 1IILE 3K81A 4N9GB 1Q9KB 3JTSB 4AYFA 3FKUS 4PJXE 1FVEB 1I1YA 4HUXB 5GGQL 2BNRD 1E6JL 1RZKC 3PP3K 4M1DL 1EEZA 4OM1H 3WFCH 4L8DA 1GYAA 3SKNA 3STBA 1A1MA 3KDMA 1NFDE 3O2VL 3O3BB 4CRPA 3TBYB 1KN4L 5M7QA 4M6NL 4JFDB 1JHTA 1JTOA 5JUEL 4KTDH 2PO6A 2ZCLH 2A77L 3NFNB 3S5LB 1GGCL 4PRDB 3KYMB 1MFNA 2Z91A 1HINL 4LRNL 2Q8BH 1OD7A 4H20H 3T3ME 2GTWB 1A3LL 5HYSA 4MXVE 2IADA 2YEZA 2IAND 2IBZY 2P8PB 1NMCB 4PRPD 2AJVL 4S1SH 1MJ7L 5I1CL 5E8NA 1JPSL 1YEDA 2KQMA 2YD8A 3VXSB 1YYMH 3MYJB 5I1JL 1LO4L 3NCJH 1F3DH 1S7QA 2XTJC 4GRLD 2VSCA 4Q74A 4N90D 2WMPA 5CCKH 3UAJC 5T3ZE 5JR1H 2B2XH 4X6CB 5FYLE 3H3PL 3THML 1PGRB 4WTXA 4DKFL 5C2BH 2HT3D 3FRPA 4XCFH 1ODAA 5HGHB 1A2YA 4NCDA 5D2LB 4YXLH 5AG9A 4QRUA 3BP5B 4I5BB 4UTAH 2IALB 4NQUA 2CLRB 1Z9OA 3QNYB 4PRID 5E6YA 2VN7A 1E4XI 5MEQA 3FCTB 4KTEL 6FABH 1PKQA 1Z2KA 4LHJB 5EU4B 4YLQT 4FQLH 2OXGA 4G80B 2EXWD 3MLYH 3CPLB 4KKCC 2DQTL 1CF8L 3BIAX 3WN5A 1D9KA 3MJ7B 4XH2B 2X41A 1S9XB 4QGTA 1JGEA 4JR9L 5MP6H 1CICB 4LPVA 3S36X 3WXWH 5IK3A 3UZVB 1FC2D 2J1KA 4F7TB 2R0ZH 4IHOB 2FIKB 1DBJH 1N3NA 1NEUA 3H9SD 3VRIA 3WKML 1TZGL 5IB2B 3BDXA 3D1MC 4W70A 1T3FB 1QVOB 1EGJL 1KIPB 5DTFB 1UZ8A 2V17H 4Q97A 4L3EE 1TCRB 2NZIA 5DJ0A 4N1EA 1MH5A 4HH8A 3L3GA 2UY7A 4PRHA 3VXNA 3L3DB 2W0FA 1SJEB 3QBTB 1AIFA 3T08A 4MCYA 5F9JA 1IT9L 4C83A 1TTGA 1AO7A 3RBGA 5K9QG 1CBVH 3L3HA 1RD6A 1WWWX 2R1YB 4WDIA 3FQWA 1HWHB 4OB5L 4P2CG 3BW9A 1BVKA 1GGYA 2NY4D 2W65B 3OX8A 3Q2CA 4RMWA 4LPXA 1BM3L 5BMFH 3ZE0F 4HXAH 3QNXB 3HG1D 2PO6C 2OJEB 3I50L 1KJ2H 3U2SB 1MVUA 3T4YA 5FYKH 5C92A 1OAQL 3NCCB 5BOPA 2Q8AH 1TQBB 3RL1B 5DD5L 1HKFA 4X5WB 1BD2A 2R2HB 2I9TB 1MIMH 5HHMB 2GSIA 4KJWC 3S3JA 1NLBL 1EEYB 4Z77B 4NHCL 2P5EE 5E08L 1JGVL 4AQOA 3HPLB 3CDGA 1MIEH 2D7OA 4RMQA 3MRQB 4U6VL 4H1LG 5EIQA 4MHHG 5AAWA 2ARWA 2HVJA 4JHWH 4BELD 4B0MM 1FLTX 3WIIH 4HFWB 5TDNA 3HMWH 4G6MH 3UX9B 2E5EA 4IMLA 1CGTA 1YPZA 1QFOA 4BJLA 4Y4FD 4WI2A 4WUKL 5DUMH 4Z76B 1QR1A 4MNQB 4P2RE 1AGFB 1BIIB 3R06A 3LMJH 4NUGL 3K2UH 2ED9A 3GMLA 1NGWB 2FD6L 4GW5B 3TZVD 2JLLA 3MRPB 1RHHB 4P9ML 1K9TA 3GJFA 1QZ1A 3MLSH 1HK6A 1GAFH 4K94C 3S8WA 2DQGL 3WN5C 5A3ID 3EOAB 3MLTB 2AXHA 2XYCA 2LU4A 1D5MB 3JTTB 3FO9A 4KMTH 1P1ZB 5DRZB 5HHNB 3BEWB 1QBML 3D39B 1JPGB 1ITBB 1BQHB 4ODXA 3C08L 2AEPH 3IJYA 3G08A 3WFEL 1I3RA 2FZ3B 5D1QA 2G75B 5D7JA 4KDVA 1CU4L 1UB6A 4KJYB 3ZE0E 2VIRA 1S7VA 1DJSA 5BJTA 5KW9L 3OGOE 1NDMA 4RQQB 3LCYA 1FJ1A 3LB6D 5FO9A 4N8CL 2HJKA 3WHXB 3VXRD 1LEIA 3KXFA 2AJYH 1HOCB 1P5UA 4YHOH 1T21B 1LP9F 4NO0A 3PABA 4PJ8B 3H7LA 1MOEA 3PNWB 1U8QA 2KL6A 1FNHA 4JZNA 5ESVB 4HT1H 2F8XC 1QNZH 4PJAA 2ZOKB 2FJHB 5E4EC 1MQKL 1T1ZA 3ZKSD 1F90H 1N2RA 2XZQL 1K8IA 4P57A 3K80A 1IC4L 4W6YB 3LRSA 4AIOA 3CXHK 5SWSE 1UKQA 3TJEL 2VB5A 3V6OE 5IVZA 1DEEA 2HMID 2H1PL 1RZIB 2HT3C 4XMKH 1EX0A 4KJPD 4M5YH 2V7HB 3QJFB 4HG4J 1Z6JT 4AMKH 3OKLA 4XP1L 2VDKH 3I9GL 1KCUL 5C6PB 1MCPL 1JWSB 3S9DB 2O5ZH 1P84J 4OZFG 2F19L 2AEWA 2BCKB 2VWEC 4JG0L 3MMEA 2DTML 2AERT 3MRJB 5AYUL 1NBQA 1NC4A 2J8UB 5FYLD 3TA3B 1RY7B 5I19L 4P5TA 5IJVA 1IGCL 4EQ3A 3VFWA 4DVBA 3QFDB 5HGBB 1MUJA 1UEYA 5KSBE 5F3HB 4OCWL 1PSKH 4ZO8A 4I18A 5IB1A 1AGDB 1WZKA 1K85A 1EPFA 3HAEH 4OCSH 2R4SL 1A6PA 1CXEA 3TO4B 5F1IA 5IT2H 1T7XA 2VDNH 3E6FB 3L5IA 4M93C 1L7IL 4PJHE 1S7TB 43CAA 2EDQA 2ESVA 3HZVA 3LIZL 4ODHH 1G7JB 4XWGL 5DEGB 4D0CA 2R2BA 3F58L 4C58B 4I4WA 1A4JB 5I73B 4JFPA 4HXBL 2CDGB 4OIIL 3WS6A 12E8H 5IFJA 4JFXA 2IPUG 3X12B 3OB0K 4HS3B 4X6EA 5FDYA 1KB5H 5CBEB 3QEQB 1JMZA 2Y5TB 4R7DA 3DO3A 5I74B 5D2NA 4CAGA 5EUOB 5J89A 1ZT7A 4LCWE 1QRNB 5EZIL 4KAQH 1LP9E 3MLWL 4XXCA 4L3ED 3S6CA 2VZ3A 3CMOH 1S9YB 5C9JB 1YECL 4NRYA 2EH8H 1ROWA 1YNKL 3VXUA 5C8JA 3UBXA 5D7JC 2JF1A 2WSKA 4LSTL 5DRNB 3LZFL 3WFHB 1PQZB 3ZO0A 4F2MB 2LFGA 2V9TA 1ZTXL 5D7LE 4ENED 1T6VN 4B41A 1XGUA 2VDRL 1D5XB 3OR7B 3IFOB 1FVDA 1QBLL 3QP3A 4L8CB 1Q9WA 3IU4L 3QUKB 4Z7VF 1OAZL 3BOVA 1UC6A 1XGPB 4RZCB 1HNGA 1VFUA 4QY8A 3MZTA 2G60L 4YX2L 4LBEA 1ZV5A 2CXKA 4Y1AB 3L9RB 4PJFF 1R24B 5HHXH 2A0LD 1UXSA 2V9QA 1TMCB 3MXVL 4MD5A 1Y0LA 5A16B 3FMGH 2DI7A 5D5MB 3PL6D 1IC5H 4LLYB 1ZA3B 5DI8A 5F96H 3VDCA 4APQB 5TE7H 4KI5E 3Q5YA 4ACPA 3CLFH 1ZLSH 4H8WH 1G7PB 2O93L 2BVOA 3T0XA 4PTUA 5I71C 1FZKA 4JLRA 3MBXL 3GSOA 1XCTB 2P5ED 2C9AA 1XGYL 4J3XA 1CGVA 5EBLA 5FGBA 3QUZA 3KPSE 5J9PA 4H5SB 2BXYA 4LSDA 4P2OA 1RK0B 3SDYH 1X4YA 3LKOB 2VDMH 5B22A 1HWGB 2X1WL 4OZIF 3MV8D 4RRPG 3PGFL 4Y5VB 4L4VE 2L7UA 3F7VA 1JPFA 4OIAA 4YE4H 2GT9A 3O6FA 4JQVA 1DQQA 3OKMB 2IQ9L 2XY1A 1U6AH 3IT8D 4ZPVB 5EOQL 4QEGA 5HGAB 2FX7L 4V1DA 4PP2A 2Z4QA 1RIVH 3WD5H 4P2RD 1A9EB 4HUUA 2OJZL 3S35X 2WUBL 1UWEL 4HUMB 1JZ4A 5EULV 4IRSB 3KPQA 5CUSL 1G7MB 5BVJB 1ZGLA 4HIHB 3A6BH 4XMPL 4J3VA 4PGEB 3ARYA 2ZWLT 3B9DA 4K7PY 4LSUH 5JMRA 2EDXA 3KLHC 3QDME 4CNIB 4X7DC 1A6VH 3NFPA 5C0JA 5BOZG 1T2QL 1KUMA 3WS6C 4NQCD 3QCUH 4MA7H 2NY7H 5AZ2H 3MUY1 4LVOC 4FMFA 2V5YA 1K4CA 4Z7WF 1ZSDB 1GZPA 1NFIA 4Z7VE 5IVXB 1ZLVK 5DEFB 1I8MB 5L2KA 2HA1A 2BY1A 4IS6A 4CGTA 1HCFX 4S1QL 1UA6L 4D0BB 4AIZB 4LHUB 4PTTB 3CFDA 3KJ4B 2AK1H 4Q9RH 1ZANL 4PJFE 1X5JA 5ERWB 4Q6IB 2HAZA 4S0SD 2BJMH 2IFFL 3WO4B 2QSCH 3IDJB 3FFCE 5FGCE 5HJ3A 2HJFA 3VW3L 1M6OA 2M26A 2HMIC 2B1HH 3T09A 3V7MA 4JHAL 1Q0YH 4R7NB 1TJGH 4FXKA 4I3RL 3GJFK 3QEHB 2XWJA 5JPNB 4P9HC 1FBIL 4M4PA 3IRZA 4PBXA 1M71B 4PJIF 1XF5A 2OR8A 4Y16D 3ULVF 5EORH 5SWSD 2YK1L 2FBJH 4Z7UF 4ONGH 4CN4A 3E0GA 4CVXB 5CP7A 2DL2A 3MODL 3H9HA 3BZEB 1V05A 3RWHA 5I9QC 5GS2D 2FB4L 4EEEA 4N8VB 3W39A 1PD6A 3O41A 1SHMA 1OF2B 3QI9D 4OAWB 5DQDL 4ZXBD 4XNXL 1CDGA 4JY6B 5FGBC 3R1GL 5GRZA 2BY0A 4HK0B 4P2OC 4WIQA 2RIKA 5F70A 3AS0A 4NKOA 4P4KB 2NW2A 5T1MB 3QO1B 1UZ6E 1UB5B 4EVNB 1NQBA 1DQDL 1J5OH 4PBWD 2A6IB 15C8L 4OV5A 3I3BA 5GGRB 3FT3B 4WO4A 4KPHH 4YGVB 2W59A 1SMAA 2X89A 1S7XA 3WIFA 4XBEH 1FNSH 1QA9A 1YYLL 4FFWC 3O6FC 4JQVC 3V5HB 2AEQH 3EW3B 3FOLA 3FFDA 2OR7A 1BFVH 2AABL 4E41A 3SPVB 4FQPA 3QIUD 4HPYH 3BWUC 4LPTA 1BFOB 5FCUH 1CGUA 3P73A 3TN0A 3U6RA 4X9IA 3VWKD 4KC3B 4Z7WE 1OQOA 4KK6D 2VDLH 3MOBH 1FNGA 1IEHA 1IMHC 2IMNA 1JNHA 3NABH 4QRRA 3JWOC 4K8RD 5L8JB 2KZWA 4WU5A 1CT8A 2XIDA 2F74A 3SJVE 3ZDXF 2HP4A 2DWEA 4ENEC 3SE9H 4TTGA 1KCRL 4H0GA 1NDGA 5C0RL 4HJJH 1S78C 4LP4A 3T0EE 1KIQA 5IB4B 3TC9A 2C3WA 2R1XB 4R26H 2B4CC 4K07A 2RQ8A 1RIUH 2IQAA 3QPXL 4IOIB 4QCIB 2CKNA 4X6CF 5E6ID 5D7LD 4PJIE 3TIDA 2VAJA 1KBGL 2EC8A 3DX6A 3ULVE 4PJ9C 4NGHH 3VG0H 3FTGB 4HWBH 4Z7UE 3X11A 5D2LF 1EUUA 3ZKXB 4TSCH 1ONQB 5ESQA 4F15B 4OFPA 1HXMA 5I15L 2Q7NA 2CGRH 3HAEG 1S5HB 2E6PA 5I76B 3D5OF 5E2TL 4OLUL 5JHLL 4YHNA 3H0TB 4HKXA 1AJ7L 1B6DA 1HYSD 3PUCA 2DQIL 4KI5D 4JFOB 3ARGA 3CSYA 1ZLUK 4I3SH 3RX5A 1R3KB 4GUPB 5JXAH 4JPWH 4ZTPL 4XNQA 2A6DA 3K1KC 3R4DA 3GSNA 1ADQA 2XFXA 4G7VL 3O8XA 1DFBH 2B4CH 4LSQL 2EO9A 2ICEB 4PS4L 2APFA 2VABB 4L4VD 4WV1B 3FB8A 3QDJB 4ZFFB 2OMBA 2VZ1A 4PV9B 3RVVD 5L0QB 4JFDE 1BQHG 5KAQG 3OGCB 4QHKI 3T04D 3WEXA 2G2RA 4NCC2 4M6MH 4KZEH 3IJHA 4NQSA 2D31B 1A1OB 1CFSA 3T0BA 2XKNB 3HMXL 5CSGA 5C6TH 2ADJB 3ZDXE 3QJHB 2X4RA 2QKIB 3SGJA 3FQUA 3BH8B 3MJ9A 2J5LB 1NJ9A 4J6RH 1MFAH 2I07A 4NHUA 4LCWA 5EU3A 5BRZE 2W9DH 4LNRA 1LP9A 5IM7A 3TN0C 3VXSE 3DX9B 3TCXA 3GIZH 2YWYA 4KH2A 3BVNA 3SOBL 5BXFA 3VE0B 1KB9K 3RVXC 2UZYB 3WS3A 4XCEB 3TO2B 1U42A 3GSVA 4J7RA 1N59A 4X6CE 1TLKA 4OV6F 4J8RB 4KI1A 5KVFL 2OP4H 3QA3B 3IETA 1VHPA 1AQKH 5AWNL 5E8EB 1RAMA 3NCBB 5D2LE 3LHPH 3S37H 5J6HA 4K71C 5DF0A 2VKXA 2BSSA 1RZFL 3E2HB 4WNQA 1MHEB 3QEUA 2Z31D 4ZPTB 4P46A 4F7CB 4RSVA 3DYMA 1HSAA 4HZAA 1TZHA 1MJJB 3FFCD 3P30L 2EE3A 3V6OC 2EE9A 1UJ3B 3C60A 3FQNB 4D0DB 1FG2A 3O3AA 3G04B 2J7LA 3DX8A 3KPSA 3Q5TA 5JDJA 2A1WL 4EOWL 3P4LA 2YSSB 4HWEL 5DZLA 1UACL 3N06B 5GHWL 4YHIB 4YHZH 1JCKA 2FWOA 25C8H 3STLB 4U1MA 3IDXH 4PG9A 4J1UA 4XCNA 1A3RH 2G9HA 1T04B 5EBGA 3OJDA 2PCPA 1EJOL 3C5ZA 3HLAA 4FZ8H 3NZ8A 4DZ8A 1V8HA 2DQFB 2F8VA 3SKJL 3QIUC 4QTHA 4JKMA 3O8XC 1LWRA 4GW1A 5D1XA 5KAQF 3BZ4B 2MCPL 3CX2A 5HHQA 3HUJB 3BWAA 3JWDC 3SDAA 4KK6C 1MAJA 2LTQC 3QDMA 1GGBL 2IAMA 3VXQB 4K8RC 2FO4A 2EDOA 5T1DL 1INQA 3CUPB 5DJZB 4YHML 1AE6L 5GS2H 3MV9A 1YUHA 5CILH 1QFPA 2C1OA 4MX7B 43C9B 3D25A 3VD3A 1CG9B 1Z0NA 4M8QB 4XP6L 3U7WL 3MZGB 3L3IB 1I9RH 4QHMA 5HHME 2FSEA 1VFOA 1UM6H 2AJUH 3BQUA 3MRFA 4NQXB 5E7BA 4Z7VA 3MRHB 3QUYB 2VXVL 3D87B 1SEBB 4JO1H 4ZTPH 3SY0B 2D9QB 4HGMA 4HLZG 1AY1L 5E00A 3DVNA 5I30L 1RZJC 1CGXA 5D9SB 3V5KA 4U1GC 4EZMA 1JHLL 4UNUA 1GZQA 1P4IL 3DETD 1A6AB 1EXUA 1HHHA 1HH9A 1J8HB 4ZO9A 5E6IC 2X44D 3W9DA 2OL3A 1V5JA 3R8QA 2QHLA 4G43A 4HPOH 4X6DB 3O6LH 1MFBH 3NZHL 1U8NA 2E9JA 3T0ED 1YEEH 2VXSL 5DA0B 4OZFA 5DZNA 1I7TB 4QHUA 1U95A 3CJJA 2ID5A 4K7FA 4MNQE 4QOKA 4KV5F 4GS7C 4OZIA 2VZVA 4HF5H 3U7YH 3MRMA 4P46C 4ZNCD 2J8UF 1HYSC 2CR3A 2XZAH 4OFVA 1ZT1B 1KYOJ 4L9LA 4WJ5B 5HGDA 5I1KL 1C5CL 1NSNH 4ZFOL 1ACYL 5HYFA 3C60C 1NGQL 1XGRB 3O4OC 3QO0A 4X80L 5I1DA 3CVHL 4JO2H 2X4SA 3R0MA 1P4BL 1U9KA 5F6IC 3FJTA 2APBA 1U8IA 3RUGB 1Q1JH 5GRWA 5T5FL 2DLFH 2KH2B 4P4RB 3PQYB 4Y4KB 3X17A 2ORBL 2F54E 1IVLA 4XPTH 1DBML 2C1PA 3WNNA 4EI6A 3LH2L 4NQTA 5GRUL 3C5ZC 2CJUH 3LKNA 4NZJA 3JV4B 3TBWB 1SJHB 5HSFA 3DROA 4XB7A 3VXTA 3GZKA 5EUOF 1ZWIB 1E0OB 3MQIA 1CN4A 4K3DL 5IG7A 5D1XC 4F58L 2A9MH 1DCLA 3D0LB 1W2KT 4JFDD 1HHJA 3SDAC 1BOGA 3ZZ1A 3ARZA 2EC9U 1KTDB 5DVLA 5HD8C 3I6KB 1QEWB 3SJVA 2NY0B 4LHUG 4R4BB 1KPUB 4UTBH 1UCBL 4PRAA 5CINH 1CL7H 2VLLA 5F7WC 1QSFA 1ZS8B 2HRPL 5ESAA 2EYTA 1S9KC 1ZLWK 5JNYB 3ZYIA 5BRZD 4YQXL 3BGFC 2FJGB 3BQUC 2GUOB 2GW5A 2VQTA 2BRQA 2P24B 4RAUB 1FZMB 4I0PA 4KUZL 2VLJB 4UDUB 3ULSB 5FECB 5D5MF 4PB9H 4KV5E 3W2DL 3AS3A 4HBCH 1D6VL 4PYHA 4PGJA 4NJ9H 4TOYL 5GRJL 1R5WB 1S9WB 3EYQC 1EHLL 4PJBA 4U6HA 3QHFL 1J0HA 1NAML 4RGMB 3OAZH 5C0CB 3QFJD 2W38A 5EN2A 3KWWA 4BFBD 1YQVH 5EB9A 4RRPA 5GJTH 3X3GH 4JKLA 4X99B 3TYFB 1IM9D 4N8VG 4H25A 4M61B 4N9GA 1DL7L 3JTSA 4U4BA 1IGJB 1K4DA 2NY2B 3CFIC 4NWUL 4OCXH 4D2NA 3VDBA 4JPIB 5CJ8A 5C07B 4UT7H 4ODVH 4PV8A 3HNVL 4JFZH 4K3EH 1ZVSB 3MGTB 2QQNL 1DBBH 2NR6C 3CK0H 3T8XB 3QEQE 4GQ9H 1NBVH 3N1GC 3V6FA 1QRNE 5D7IB 1CDUA 1K8DA 5BV7L 1MAMH 2XWTA 5EH1A 4PRDA 5I0ZA 1L7TL 2F58L 2Z35B 1NH6A 4DN3L 2GTWA 5H35A 3IKCA 1I4FB 2B0SH 3CZFB 2ZKHL 3WLBB 2GSGB 2R0LL 5JHDD 1VPOH 3GI9H 4PGBB 2P8PA 1A21A 4O5LH 3T2OA 3BKML 5TJWK 3VXSA 5IVXF 4WHDA 2VSDA 4XP4H 5DGQA 4HW6A 1LO2H 2X6MA 4FQCH 1N6VA 5EZLB 3WHE0 3RPKA 2YMXL 5KS9A 1BOYA 2HWZH 3MRRB 5DJ2B 2YRZA 5D5ME 4X6CA 5F7KC 4U1KA 2QV2A 3RWFA 4O02L 3ULUL 2V6HA 3UZQA 1N7ML 5HHMD 5HGHA 4IMKA 3JWNC 4M7KH 3RVWC 1P4LB 4HD9A 1WAAF 4I5BA 2IALA 1TVBB 2CLRA 3ZKQD 3QNYA 5DQ9B 3SE8L 3FCTA 5DUBB 2B1AL 1INEH 2N56A 3UPCA 3CH8A 2DKUA 2ATKB 4U1IB 3MLVH 3U30C 4G80A 5GZNC 1IBGH 2O5XL 3CPLA 3REWA 3ULVC 4AIXA 4OTXL 1NAKH 5F89B 1PG7W 2N4IA 4OCMC 3MJ7A 4YBLB 4XH2A 5JA9A 1S9XA 4QYOB 2PF6A 1QG3A 3OAZK 4HX1B 3GMQB 1CICA 4HUKB 4F7TA 3IXAB 3DECA 5FO8B 3LEVL 2WWKO 2XN9B 5DJAB 4IHOA 2FIKA 5IB2A 2VL4A 3MLRH 1T3FA 1QVOA 1KIPA 2NY3C 3HI6H 1MCQA 3OZ9L 1TCRA 1FFNB 3JV6A 1NCDL 5FUZH 2XRAH 4RGOH 3U9PH 4GKNB 3PP4H 4UT9L 4XVTL 1SJEA 4OCNC 1NMAL 3B9KB 5C0FA 4O51B 5MHSE 5IMKB 2YN3A 4B53A 2FYYB 4J4PD 3BZFB 3TPUB 3VFPB 2R1YA 2D03L 1RZ8A 3KLAB 3U1SL 2Y25A 3V4PH 5IVXE 1HQ4B 2NY1B 4RISH 4RNRB 2BY2A 2F54D 5HTSA 5E1AB 3QNXA 3HE6A 2H32B 2OJEA 3GBNL 3U2SA 1GIGL 5D7SL 3VFGH 4HMCA 1T7VA 1II4E 1YEIL 3WDIA 4GAGL 1LDPH 3QCTL 3RL1A 3HC3L 2R2HA 2MQ3A 1Z9SA 3SKOB 1R3LB 2HG5B 2DJSA 4JN1H