4N68A

Crystal structure of an internal fn3 domain from human contactin-5 [psi-nysgrc-005804]
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
EPSAAPTDVKATSVSVSEILVAWKHIKESLGRPQGFEVGYWKDMEQEDTAETVKTRGNESFVILTGLEGNTLYHFTVRAYNGAGYGPPSSEVSATTKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of an internal FN3 domain from human Contactin-5 [PSI-NYSGRC-005804]
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Contactin-5
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n68A00
4N0CC 4EKXA 1DUZB 4M8QA 1FAIL 1B3JA 2OQJB 4TQEH 5D2NE 1AO7E 5C08E 3VJ6A 2XXMB 4L8SC 3GBLA 2VXTL 1MJ8H 2YD4A 5FHBH 1U8JA 1LE5B 1F45A 2A1WL 3DUUB 1VKXB 4CL7A 2CK2A 3P4MB 3GBNL 3MBXL 4K3HA 4OZ4B 4DUXA 5E8OA 4JHAL 1OHQA 2IF7A 5CBEA 2Q7YB 1EO8L 3DETC 3CSYA 4K2UL 5I16B 3FB5A 3O11A 4LRNL 1SY6H 1ITBB 2X70A 2GCYB 3VH8G 3FOMB 1NGZB 4NJ9H 4QNPF 1LP9E 1GAFL 4EBQH 3QDGE 1G9MH 3LKQB 3SDDC 2HLAB 3IKCB 1I1AD 5IQ7L 4G80B 3QIBC 5CGTA 4YNYB 3LS5H 3KHQA 3LDBB 1A7NH 3HZVA 4XPGL 4KZDH 5E8DL 3OJVC 1PGRB 5EULV 5E8EB 1FL5B 5A3IC 1MI5D 2M26A 1J0IA 4PP2A 1I9RH 1MELA 4JRYD 3V6OA 4ZYKA 5TPWL 2G5RA 4L3CB 5A1AA 3HNSH 5IG7A 5K59F 2OMNA 2ATKB 2V7HA 2YPLE 2DDQL 2M1KA 4M7LL 3LMJL 3TBWA 1BGXH 2MTPA 4ZS6C 1KGCD 3SE8H 3WS6C 2AJXH 3QWOB 2B1AL 3LH2H 3ROOA 3RTQB 5I18L 4Y19B 5ADOL 1OW0C 2CDGB 3QR2A 4JVUA 1YNKH 3MBED 1UACL 1Y0LA 5F1SA 5KSUB 2WWKT 1CXFA 1KJVB 2WLZA 1BJ1H 3QQ4A 2VN4A 5I30L 3O4LB 3A6OA 1LMKA 2NTFB 3MLVH 3V5DA 3F7RA 1YEIL 4K9EC 2GJZA 2H45A 3SDAA 1PG7X 4GAGL 5E7FA 4HKXB 2DLTA 5HHQB 1CK0L 1ZA3B 3VA6A 4LCCC 5IR1B 1A3LL 1GL4B 2V5SA 5GGQH 2W9EH 4ODWA 3N9GL 1S7WB 2Z92B 2ESVB 4OB5H 5CFHA 1F6LL 3QSKB 2QHRL 3HR5B 1K4CB 3QQ3A 3ULUD 1AGFA 5JPNB 1V7NH 4TUOA 1IBGL 1YUHA 4GXUN 4L4VB 1F58H 1QA9A 1EIBA 2C3VA 3LB6C 1DBBL 4RWYH 3M8OL 5IEKB 2QSCH 3X3FH 3BEWB 1E4WL 3VWKD 1IGCH 5IB1B 1MEXL 3SJVB 5I8CB 5C0IB 2B4CH 5I71C 2EE9A 1WIOA 3CFJB 4KY1L 3TP4A 4C56E 1RUQH 4JRYE 3VGAC 1YYLL 4G8GD 4FABH 2ILLA 2HVKA 1A7QH 4QXWA 2G9HA 2V9RA 2DYPA 1JWMA 5M95B 1ZXQA 5IESL 4I77H 3MRRB 1CZ8H 4OF8A 5HGHB 4OV5A 2ZZUT 5EBWA 2AJUH 1P4IH 4LQ1A 1CFVL 1J18A 4PBXA 4G6KL 5I17A 1YJDH 1BF2A 3TBWB 2XY2A 2ZCKH 1T80A 1D9KD 5HHOA 2NLJB 4JQVC 1UXSB 1EEQA 1GC1L 4U7SA 3C6LC 4OCWH 4HLZH 3K81A 3L95A 1VSCA 1IAKA 5JHDE 2FIKB 4L3EE 1FLRH 2PCPA 3UJIH 4PJ7B 2F19L 5F96L 4D0BA 1EPFA 2AERT 3IDMA 3SCMD 1P69B 3LEYL 1NH6A 3BPNB 4NYLA 3SJVD 4Y1AE 3QXAB 2ITCA 4WJ5B 2NZ9D 1HQ4B 3GSNH 2P43B 1CD1A 4DTGH 4FFWC 3KLHD 2H9GB 4HBQA 3DV6B 4NO0A 3WNPA 3FB5B 3GSNB 3PWLB 1I7UB 4JFXA 2GY5A 2W0FA 3KPSD 4S1QH 4OLVL 3GSUA 3DLQR 3B9KD 5CEXB 3I75B 4RMVA 1R5WA 4TUOB 3QFDA 2X6MA 4Y4KD 5IMLA 3BKYH 2WNGA 3LHPL 4HCRL 3I6LE 4HH9B 4LFHG 3TZVA 4P5KA 3OR7A 2OJZH 2OSLA 2J4WL 1OPGL 4EDWL 4NZTH 3V0WL 5DK0B 4MJ6A 1M71A 5I19H 4RMTA 4NRXB 4JZOB 1RUPL 2VXUH 2ZPKH 3NCYP 3FAWA 1KT2B 4KVNL 2YSSA 3C5ZB 4PUBH 4JFDD 3RX7A 1C1EH 1BP3B 4IRJB 3N1GC 2DBLH 5I9QC 4Z7WF 1IAII 1OSZA 1CXEA 4ZXBC 3F12B 2W60A 3MBXH 3BQUD 1NCCH 1HCFX 5I1EH 4YBQD 2FATH 3RWHB 1OTUD 5MENA 5C0BA 1RZ8A 3HI1B 5TQ2L 3RWFA 2NY5L 3K8LA 5A2IH 2FECL 2LFGA 3EOAB 5HYSG 2A9NH 4PRHA 3ROLA 4JQXA 3PQYD 1GOGA 1MHPH 4K3GA 4HEPG 4Z7UF 3IJYA 5ERWB 4YXLH 4ODXA 5IR1A 5D5MA 3QXWA 4R4BA 1KG0A 4XVTL 3BGAA 3EYOA 2MQCA 4MJ4A 4EI5B 1EVUA 3MACH 3VWKC 2DIAA 3QIWC 4NKOB 2Z35A 1U8IB 1D9KB 1DVFA 2YBRA 3TN0D 5FGCE 3CSGA 4EUPA 3ARWA 5H94A 1U92A 2UUDK 3BIAX 1IKFH 4E5XA 1TZIA 1T2JA 1FC1A 4FP8L 3EFFB 4FRWA 4WHYG 4YXKL 4U7KA 5IQ9A 4TSBH 4KI5F 3KJ4C 1AR1C 4MQXC 4QRQB 2BERA 2XZAH 4RWHA 4ZUTB 4D9RE 3MRKB 1JVKA 5JW5B 1KV3A 1R5VA 3JZ7A 3O3AB 3OAYH 2YPKB 3D3VB 5GSVA 1L0XA 4ZUWB 2FZ3A 2HLFD 3PG2A 4U3CA 3L7EB 1HZHH 3R4DA 5FK9B 4TPRL 4JY6A 2ARJA 4RFEB 5DJCA 5GGVH 5L8LB 4IOIA 5T3XE 5IVXA 1VGKA 3DETD 3LRSA 2YC1A 5CD5D 1A6AB 4Y2DC 5IFJB 5CP7A 3IETB 3QJFB 4ZAKC 4NQEB 3VGHA 5IIEA 2R2BB 1NCTA 1KJ2L 3QHFH 3O81A 3VXOB 2RIKA 2VE6A 1P7QB 2JELH 4KMTL 3GSRA 4YHLL 2X89D 3BP4A 3O9WA 4YX2L 4RRPA 1AKJB 3QEGH 4WI8A 1HI6A 3SGJA 5CD3A 3DRQA 4P59H 5E5MB 2J6EH 4LIQH 1AY1L 3GMOB 5EZOL 2F5BH 5HI3D 3MV9A 2QJDA 2DQTH 4YEEA 4F15C 3GI8L 4KC3B 1E28B 2JIXD 1D6VL 4Y89A 2F58L 3FRUB 2D4DA 5DHVA 4APQC 1QFWM 1N5AB 3LQZB 4M1DH 4LSDA 3O45B 4F33B 4YXHH 3I02B 4K8RC 5KG9B 5DF0A 1HXYA 1JHKL 2A6JA 1G7HA 2D03H 1IAIH 1FZMB 3VXNB 3F7VA 3OXRA 1H8NA 1N8ZA 3VRJA 2NXYD 5EIQA 5JR1H 5IMKB 4KZEL 4NNXB 3ZKXB 2NY1D 3MQIA 4AT6B 3CGTA 1CG9A 3Q6GH 4EIZC 2FR4B 2WIIA 4OIIH 3ULVH 4Q58C 1YMHB 3OKDA 3WFEH 1RAMA 3V6FB 1ZGLA 2Y36L 3TCLB 4FQLH 1A6PA 3TA3C 3DMMD 1AXSA 3MGTB 5F7MC 2ZOKB 5INDA 3EIFA 1CDCA 1T1ZB 2IBZY 2P5WD 4JO1L 3QPQD 1WV7T 5ALCL 3U7AA 4RBPH 1O0VA 5BXFA 3L3HA 5DEGB 2EYTB 4KVNH 3B3IB 1P7QD 2E7LC 4LARH 2Y5EA 2FDBP 1Z2KA 3GNML 3MTRA 1JF1B 3RZCB 5F89A 5CBAB 3EFFA 3EGSB 3I2CH 5FUCC 4PJFB 4ZTOH 5EBLB 3RWEA 2R2CA 3QUMB 2CLVB 5C2BL 1PLGL 5AZ2H 1PYWB 2OJZL 1MCRA 3L3IB 4WRLA 2XTLA 2ZUYA 5TH2B 1IC5L 2ICWJ 2XQBH 3MV8B 3C9NB 4MNQE 4NQUA 1FL5A 3T09A 1I1CA 4PJCF 3BWUC 5KSBB 2XICA 4YHOH 2X4UA 1UEMA 4WW2A 2Y23A 4PRPD 4WO4C 5DC4B 1KIPB 4LNVA 5D8JL 1I9JL 2ZCLL 4RQQA 4P9MH 5C8JB 1C16B 1CQKA 4OCSL 3DX7A 5KTEL 3IDMB 4YDLC 1LEKA 1FE8L 3FONB 2YKLL 4LPCA 3D5OF 4MXVE 4WFFE 3L3JB 2ZG3A 4IIQA 2ZSWA 1F00I 2XKNA 2AJVH 4GKSA 4CVWA 4ZSOB 4A6YH 4R4NC 1HIML 1NLBH 1CE6B 2BHUA 4MJ5A 5E9DE 5HYJD 5J89A 3ESVF 3BKJH 4AIZB 4B0MM 3CU7A 1V05A 5IW1B 4DGYL 5KW9L 1RUKH 3ARPA 2ZPKL 5IBLD 5TE7H 4AT6A 2IEPA 1I3GH 3DI2B 2HJFB 4BH8B 4FQXB 4HGWA 3V0WH 3WO3B 4L9LA 1WWCA 3JWDH 2VSDA 4WW1B 1W0WB 5ANMA 1NMAH 5EOQL 2FJHB 3WHE0 1NEUA 5JOFA 2DM3A 4N9GA 4QHNA 2XOTA 1A21A 1HKFA 5BZWB 1EHLL 3T0EC 1A7QL 5DJXB 1HCVA 5D71L 5ID1B 3JBG7 3ARBA 2OP4L 1HKLL 4KJWC 1N6VA 3P9MB 1K8IB 4LSVL 4Z7WB 4XNMB 1QFWI 2GT9A 4M93C 1SEBA 2F53D 4M00A 4ZD3L 4XVUD 5ID0A 4O5LL 1EXUB 4M43L 5I74B 5FFLA 1WWAX 2UWEA 3MJ8A 3U2SA 3MA7A 5F6HJ 4IIQB 2A77L 3M8OH 2Z91B 4KJQD 5EUOF 4X4YA 4ZOEA 1K4DB 4HFWB 1UKTA 4L8CA 1MSPA 1UM6L 1M6OA 3S36H 1R3HB 3RJDA 5JMRA 1OSPL 3WKMH 2AJZB 3QXAA 5CLTA 2FGWL 1MRDL 5BV7L 1WCBB 4HK0A 4YPGA 1Q9LA 3MYZA 1DLFL 2EYSA 2X4UB 3HG1E 1JZ5A 2UUDH 3HCVB 4JLRA 5D1ZD 4APQD 4OLWH 2F54A 5LG1A 1A5FH 2BNUB 2J12B 3HTLX 1FJ1A 4KKAC 2OLDA 3D6GA 1Q9OB 5EOQH 3DURB 4MJ2A 3HUJE 3PUCA 4H88H 3VWKA 1A6WH 2DQFB 2EH7L 5E5UB 1AQKL 1UJ3C 3IDGB 2I60L 5I15L 3MODH 5I18H 3FZUD 3GMLA 4NRYA 3CMGA 1FQ9C 4WUKH 4DCQB 1NKOA 5E6IB 4IHOB 2P8LA 1CYGA 2HG5A 1SEQH 3SDXA 1TJHH 4R3SB 3W11D 3LCYA 4KI1A 5EN2A 2OP4H 1QO3A 4A6YL 3QEQE 5KVMC 5IB4A 4K7PH 5BRZE 4JGJA 4RMUA 5D1ZB 2CRIA 5HYFA 1SM3L 1YUHB 4LP4A 4NO5A 4WCYL 5EWIL 1K4CA 3QQ3B 5I75B 5KVEL 1T1XA 1HHJA 3PV6A 2JKXA 4WV1C 3KNBA 4H0IA 4NJ9L 4B50A 1FDLL 4AENB 2AJ3B 4DGYH 1JF1A 3VI4F 1WIUA 1H5BC 2IQAA 4OZIB 3CUPA 2AV1B 4XCFL 5I1IL 4N0UE 2OR9H 1K2DB 2LAGB 4NQXA 1QNZH 5KSAD 4R90H 4R9HA 1WWBX 4U1MA 3KS0H 4MD4A 5F1IA 5EBMA 5CEZD 1AQDA 5C2BH 5C0BB 4ZTOL 3SDCA 3MPCA 4BSWB 2HG5B 1EFQA 4MZ2A 1IM3B 1PKOA 5AYUL 4AK1A 5JLZA 1LP9A 1I9JH 3KPLA 1KEMH 3TVMD 1NCAL 2VZSA 3G5VA 4GUPB 2BY1A 4I5BB 3ROOB 3BMVA 5KVEH 4LU5L 3MNVA 3IF1B 1KLUB 5GRUL 4UQ3B 4HJJL 5F3BA 3BYYA 1KTKE 1S7RA 4NKIH 2J8OA 4PGEB 5MENE 2OSLB 3LRGA 4H8WC 3L5XH 2Y6SC 3QWRD 4LDLB 1FGNL 3D25A 4R7NA 1JF5A 1OAZH 2IBBA 4FQJL 1C5DA 5HY9B 4PD4J 1NDMA 2NY4B 5T1MB 1GGIH 1JNJA 2LTQC 4FXGB 3CVHA 4PRPE 5GS0H 3TN0A 5C6WH 5B38B 4D9QE 2FX7H 4HAFA 2D31B 4ZFOA 4ZXBA 3X3GL 2AEQL 4ZOCA 1K4DA 4ERSL 4L4JA 1VEOA 2R1WA 2VLRE 1XF3B 2Q7YA 3TV3L 4ETYA 2Y36H 2VH5L 1ODAA 2DQIL 4MYWB 1GHFL 4JY5L 3BN9D 3KWWA 4QF1A 4ZDHB 4KZEH 3PWNB 3GJEB 1DQLL 5EA0L 1FZKB 3RWJB 3UP1A 4O2EA 5E6ZA 3ALXA 4AEFA 4JAMA 5IB3A 4NOFA 5EU6B 4RFEA 3O6FB 5DJCB 4QRPE 2WZPD 1JHTB 1WK0A 1A14H 3EOTH 5EU7E 2C3WA 3E3QC 3VU2A 2NLJA 1AI1L 1FORH 4Y1AB 1OSPH 3WKML 5J9PB 1BEYL 4PRIA 4NCDA 2VLLA 5E2UH 2HRPH 2IANE 1NBVH 1PKQB 4ZFFA 4FXLA 2DIJA 3LIZH 5J57B 5DS8B 5AD0A 5IHUL 2VITA 5EO1B 3QDGB 3C5JA 4H20L 3QDHA 2E7CA 3GHEH 3JWOC 2H6PA 1TNMA 1F4HA 4KGJA 1NC2A 3O8XA 3N1PC 4LLMB 2QADD 3ULUF 3RWFB 1WF5A 2JJUA 4PG9B 5IVXE 5FYJD 2BNRB 3T1FB 3QIBA 4U6HA 3BKCL 1G7JB 3RU8L 4NQDD 4KMTH 5DRXB 5DRZA 4JFYA 4JCMA 4F7PA 2W92A 3IGAA 4JZJC 3FHAA 1BD2E 4U1IB 1FLTX 2R2EA 3W5MA 3WFCH 5BV7B 5DRWB 3P73B 4L8SA 4WTZA 2D7MA 5SV4A 4UBDC 1LDPH 5MP6L 4YBHA 4QRPB 1IAOB 1I1FB 2PUQT 4K3DH 1CDJA 4K94L 3CH1B 5FXCH 4NQEE 1TZGL 3EW3B 4XNXH 3ZT7A 3MO1A 2XI9A 4YUEL 1G9EA 3QDGD 4TN9A 5IF0B 1QSEB 5HHVH 3NACH 4MA8H 5GS2H 3AB0C 1FH5L 4XMLL 1J86A 1XF3A 2IPUG 4U6VH 4HH8A 4K23H 2VLRD 3OJ2C 5GGSA 2R0ZL 2V17H 4P4KD 2J8UB 3OG4B 5DEGA 4L5FL 1B88A 2IPTH 5IUSA 1ZOXA 1LK2A 1J1PL 3U4AA 4M8VA 4HUNB 1R0AL 1KSRA 3MLWL 3A6BH 4X5WB 3RVTC 5J9PA 1CQYA 1CN4A 3O41A 1YPZE 1F4AA 3BRFA 5BS0D 1CU4H 1I1AC 3OKMB 5FUZH 3V6ZA 3OB0H 4QHLB 2FIKA 4QRPD 1DQQA 1N4XL 4R26L 3U48A 4UB0H 4XRCA 5DRNA 4ZG1A 5TDNA 1VFUA 5DVLA 5DVKA 4IMLB 4S1DD 1ZLSH 1IAMA 2PYEE 3V4PH 3STBA 5D93B 1FN4A 3TJEH 3S8WA 4I5BA 3NZ8A 3HE7A 5DUMH 3VGGA 1L4IA 4PTTB 2RCSL 2AK4E 3D69A 5D1QC 5ICXB 4JRXB 3STLA 4HWUA 3ARFB 5JO5B 3TBTB 4RGNC 4OLYL 1HH9B 2DQEL 1B0RB 1AKJD 2FCBA 2FATL 1HILA 3MBEC 5FO9A 1JFQH 1NAML 2VLJA 5SX5H 3QQ9D 4CBPA 1Q0YH 3WIHA 2BRRL 3ZL4H 2VQUA 4MVBD 4Y16C 5ESVB 2FLBT 4GAJH 1RIUH 4AL8H 2CRYA 3UYRH 2AXGB 3S4SA 1WSST 4P2QD 1LILA 3FOLB 4DTGL 3VXUA 5MI0C 4CRPA 3O6KL 1QP1A 3VJ6B 2GHWB 1QLRA 3FO0L 3RA7L 1HHGB 2FYYB 3OSKA 3D85B 3QUZC 2B1HH 2P24B 2I07B 1TTGA 4V1DB 4Q9RL 5HDLA 1NAMA 5KZCB 9CGTA 2HP4A 4JR9L 4K3EH 2F8OA 1H3WM 3M17B 1TDQA 3BYTA 3RY6A 1DSFL 5GIRB 3S96A 4KXZH 5FK9A 4GKNA 4WHDA 4LHUG 2JLLA 4OSUH 1OAXL 1P7HL 1J1PH 4PJDE 1I7RB 1WZ1H 2Y7QA 1F5WA 1B4JL 1ES0A 1P4IL 1MCHA 5TJWK 3EAKA 2QR0B 3PWPB 4XMPH 5IBUB 5IKCA 1RIHL 4YH6A 3RUGE 3HFMH 4I77L 5CZKA 2RHEA 1ORQA 4MWFA 3BHBB 3WUWA 2GK2A 4M1GL 5KSVB 2HH0L 1ACYL 4LSRH 1FL6A 3A6CL 3IJHB 1MH5B 4JFPA 4TULL 1U8KA 2DQDL 3CU1A 1ED3B 1XF2B 1BIIA 1ZEAL 5EPMA 3EYSL 4EUPB 4RFOH 4LVHB 3LVEA 5ICXA 1KCSL 4G6FD 4ODUB 4YHMH 4HF5H 4LEXL 1H15B 4LCCB 5T1KA 5KSBA 3VWJD 3GHEL 4QHUA 2V7NA 3TF7C 3MRFA 4JO4H 4OT1H 5EOTA 3FT2B 3L3KB 4G6KH 4E5XB 5LQBH 1TVDA 3HZVB 2D9QB 3ZDXE 3QUML 1WEJH 4U1JA 1KG0B 4OQTL 2IFFL 2GY7B 5KVFH 1RK0A 2PXYB 2BNRE 2VIRA 4FFZH 3SQOH 1KJ2B 4FABL 5DQJB 1IVLA 3O3BA 1ZWIA 1CK0H 1HQRA 5I16A 3FO1B 1ZKAA 2HT3C 2YMXL 3P3YA 4JZNA 5CBEB 4HQQH 1I3VA 4MMZC 3HI6H 5JW4N 5E94B 3EYFA 4XWGL 1E4WH 2P5EB 5E9DA 2P44B 4NT6A 3VG9B 4ZO8A 5F8RC 4C57C 5ID0B 4KK6D 1H3UA 1LE5A 4JO2L 1G7QA 3VXPB 3U0WL 4P4KC 3IB4A 4P2CG 3WFDH 3PHQB 3QUYA 3ILQC 2X2YA 4FNLL 1YNKL 1UVQA 2VZ1A 3ZTNL 1MJJB 5ESQA 4HUVB 4UINL 5C0GB 2AJYL 1EEYB 4NQCA 4HXBH 5F6IB 4XAKE 4DZBA 2CUIA 3KLAA 4FFWD 2GITA 3M17A 2XN9D 3LMJH 5D1QD 4BZ1H 3KLHC 3HG1A 2JIXA 1OLZA 3CPLB 3IKCA 4U33A 2PYEA 2MHAA 5IVZB 3T0XA 4CMMB 1HK6A 1BJMA 1OL0A 4D3CL 2LABA 1QEWB 2VLRB 1BIHA 1U91A 2G75A 5KS9F 1DBAL 4HPOL 2CLRB 5GPRA 3U7WH 1EVTC 3ULUH 1OARL 5C0AA 2B39A 3IJSB 3MA7B 2LTQB 1LEGA 1NFDF 3F6LA 4X7SH 3ZDYE 4H26B 2HKHL 4Y4FB 2MCPL 5C0CA 3TVMB 4EJ1C 2HFEB 3H8NA 4Y2DD 1CL7I 2XRAL 2ZUTA 1HI6B 2MFNA 5CD3B 5AUMB 3BVNA 4NBZB 2G5BA 3TESA 2I9LA 1NCAH 3T2NH 3EO0B 3WCYA 3IFLL 3MC0A 3MV7A 1BAFH 3O8XC 1IZKA 3KGRA 1IGJB 3NCEB 5JOFB 1AR2A 2J1KA 1LO2L 4DQOL 4X6EB 4FQHB 2XWJB 4H8WL 4MS8D 3D3VE 1OAQL 1PBYA 4PTTA 2L0DA 1NAKL 5GZOC 4MA7L 4HUXB 1NBQA 4OCRH 4BQ8A 5E2JA 2F74A 5J6HB 3QUXC 4Q6YA 5C9JB 1V8HA 1M7DB 1LDSA 4R7NB 3L7EA 2R4SH 3EJYC 2IH1A 4BSVA 3RUGF 4GFTB 4S0TD 1ZT4B 1CFTB 3RGVA 5D1XA 4LIQE 4F3FA 4R2GC 2NYYD 4WCYH 2C1OA 4ZUSB 5MEQB 5CJBA 4UT9L 4HX1B 1KCLA 1UFUA 1CFQB 1Z9MA 3L3GA 5DK3A 5EBWB 1YNLH 2ZOKA 1CGSH 2R0KL 1KIRA 3MRQB 2LU4A 1QNZL 3TO4B 3O3BB 2ZOLA 3KPLB 3O6FD 1HHKA 1T04A 5ELIA 5DUPH 1T0NB 2KQMA 3U46A 2OCFD 3IDIA 3QDJA 1FGVH 5FYKL 4PRHE 1H8OA 4QGTA 5DDHA 3BXNA 4JKWA 4BFEA 5L9DH 5DJ2A 3JTSB 3U9UA 1AR1D 1NDGB 2HFTA 1RUAL 5JOPE 5C0BE 3ULVL 43CAA 1WBZB 3T4YB 5SX5K 5ERWA 1MCCA 1XF2A 4PG2A 3TIDA 1TETH 3ORJA 5HSFA 3EOAA 2GJ6A 4PV9A 4X6DB 2NNAA 4JFYB 5LAXA 4J2XA 3QFJE 3WXWH 4PIRF 2Z8RA 5HHMB 5IVZA 1DANT 1NCWH 1PG7L 5EB9A 4PGDB 2WV3A 2J7LA 3QEQB 4QEGA 2J8UE 4WUUD 5EU5A 2EE6A 4RWYL 4NDMA 3B5GA 4TTDC 2I5YL 1A6UL 1KCKA 5C3TA 1MWAA 5EZOH 2XPGA 1RIHH 4PJIB 3BSZL 3LD8B 4GRLC 3UDWC 3MJ9A 3JV6A 5BMFL 4OM0H 3SKOA 1NEZG 4DCQA 2IG2L 2FECI 3QEGL 1NQBA 4QTIH 3VDBA 3UPRA 4OSUL 3GMRA 5MEPB 2DMBA 1D5IL 4LAQH 4UT7L 2D7TH 3EYUL 3DXAB 4FHBD 5HYIA 1ZTXL 2W59A 4HW6A 3SCMC 4O4YL 5JW4Q 1E4XH 2X4PB 1FG2B 5FGRA 3HE7D 5CJOL 2YA0A 3QUZA 5I30H 2B1HL 1WBYA 5D1ZA 1UEYA 1AO7D 5C08D 4PGZA 5D7LE 1UACH 1TPXC 1E27B 2H3NA 2VR9A 5SV3A 3FT3A 5FIEA 2IGFH 3TO4A 5SWQB 2VQ1B 4AIXA 1G7LB 3U0TA 3BH9B 3BKJL 4G80A 3BZ4B 2NXYC 3DRTA 1G7LA 4MNGE 4TULH 4EI6B 3X13B 1YN6B 1HH9A 1YYML 2ADGA 3QP3A 4X7CC 4PB9H 3IETA 3OF6D 4EI6A 5LCVL 2JB5H 4NNPL 4UTAH 3FCTA 3N1QC 3VWKB 3ZE0F 5C0CB 4XHQA 2KDGA 2VNCA 3CNKA 1NCDH 2QSTA 4KRMB 5K9KA 4KK9D 2YD9A 1CWVA 1LEGB 1NL0H 3RHWK 5JHDA 3LS5L 4P4RB 2H2PD 1JTOA 4HBCL 3RZWA 1QLEL 3LKNB 3OGCA 3Q1SL 1BFVL 2VC2H 5I8KL 4PJEA 1A3RL 1JGVH 1IFHH 2DL2A 3HCVA 4XMKL 5F1NA 3CZJA 1WFTA 3RWCA 1UB5B 1RD6A 4MAYC 3O2VL 5DD5H 3VXRD 3HZKB 3JV6B 3O6LL 4K55A 3QPXL 4UNVA 2C9AA 4N0YL 4POUB 2V9QA 4PJ9B 5BO1L 2O5YL 3SPVB 2Q8BH 4ONFL 3UPAA 4C55A 5F97E 5EFIA 3MXWH 2EYRA 3G5ZB 5I8CA 4HWBH 3VRIA 2DQGL 3KVQA 5C6PB 1DVFB 4LCWE 3U4EA 1HHGA 2FYYA 4ZSOE 3RVVD 2W91A 4FQCL 2OZ4H 3BQUC 4XPTH 1YN7B 3S4SB 5L2KE 2OTWB 3VFSA 4PLNC 3FZUC 4HIIB 3UROR 2LQRA 3NFSL 3CH1A 3VGBA 4O2CA 1AGFB 5JPNA 5I1CL 4R4FL 2NXZC 4L4VD 3P9WB 2BXYA 1BFOA 1I7TB 3MJ7A 4X9GA 1AP2B 4OZIE 1E0OB 5ADPH 1QQDB 5T3ZH 5ESAA 3ULUC 4QXTB 4TNVK 4LHJB 5T3XL 5KJRL 3MYJA 5J7CC 1YMMD 2WSKA 2EXWC 3MLTB 2W9LA 1HINL 5C0NC 5BRZB 4PR5B 3O2WL 3L3IA 1INDL 4HMDA 3U46B 3O4OB 5JUEH 2F58H 4KJQC 5B39A 3OAZK 5KSBF 2DN7A 4HS8H 3IU3A 2BNRA 4AEHL 4LCIL 1VADA 2YUZA 1FL6B 5E4EB 1F8TL 1B6DA 5DMKA 1Y0LB 5CILL 3A6BL 5B39G 3WLBB 3UTSD 4ZNCD 5SWZB 5CEZE 4QRTA 4HUUB 1YC7A 4NOBA 5KAQG 4XVUC 3H42H 1T20B 5IHUH 4MXQC 3SBWC 2JCCB 1RZKC 2Y7QB 2JELL 4EVNA 1QYGL 4DN4H 3MGTA 2GQHA 3FB6B 3NGBB 1ZGLB 3MCLH 3WMSA 1GGCH 4DJMA 2VJXA 1IC4H 4WEUD 1RPQA 2OK0L 1TZHB 4HG4J 1NAMB 1FIEA 2E27L 3ZYJA 4G8FA 4KI5C 5ETUB 1CD8A 3WLWD 3LQMA 4LF3A 1T0MA 5B3JE 3NCMA 2ICEA 4MQ7A 3NN8A 4NN5C 5CBAA 4Y5YB 1LDPL 2P7TA 3SJVE 2X70B 4X7DC 3JWOL 3UTTB 1BJ1J 3CVIL 4XWOC 2X4OA 2AXGA 2VH5H 1NSNL 4QWWC 2JCCF 3QFJD 2JJTA 4LEOB 4GW1A 4NKQB 3D2UB 3KPSA 2OTWA 1FZJB 2FX9L 2RBLA 1WBYB 3PHOA 2DF3A 1J0ZA 3MRMA 3ULVE 4QY8A 3FQTB 2EKSA 3GIVB 1I8IA 4HC1L 2OQJA 1UWGL 4FQ2H 1VGEL 4OCMC 1UENA 4G7YL 3ARFA 5T3XH 1D5ZA 5H35A 2V2WB 4PJXA 2F9BT 2SEBA 5EIVA 5L6YL 1DLHA 2YEZA 2Y5TA 3OB0K 4HLZG 2V2WA 3LIZL 4PJXB 4PJBB 5SX4H 1QFUL 5HHME 3KJ4B 3Q3GB 3RVXC 2WUCH 4P57A 3SDAB 1G0YR 3RIAF 4LSQH 2AXFA 5J8OA 3D87B 5DD6B 2AW2A 3PWPE 1HYRC 1I4FA 4KK5C 1G7PB 1JZ4A 2X89A 1XGPB 2A6IA 4EOWL 1SJEA 3MRPB 5CHNA 3NPSC 5F7FA 3V7MA 4WFGD 1IZJA 1T7ZA 1ZHBA 3ZSSA 4YC2C 4OQTA 1C12A 2WMPA 1X5FA 3VXTB 1I3UA 1S78D 4X6CB 4XB8A 5E9DB 3QG6B 1BD2A 1Y18B 3HMXH 3O6FC 1HH6A 3HZMB 3Q48A 4HWBL 1EJOL 2NY5H 4ZUTA 4V1DE 1T6VN 1KBGL 5D2LB 3MV7D 3E1F1 1S7SA 1EUTA 4ZYKB 2VB5A 5I8EB 3RNKB 1F4XH 3SDYL 3B9AA 1UQSA 4DUWA 4G5ZL 1GYAA 4K71B 3SKUD 4LF3B 4LPWA 5DQJA 4ODSH 3WS3B 3FTGA 1W2KT 4LSSH 5D2NC 5E70A 2R4SL 1BFVH 3EJJX 4NWUL 1VFMA 1G6RB 2HFGL 3ZE2F 2PW2A 2R23A 1YEHL 2BY0A 2HT4D 4OFKA 1G6RA 4PJ8C 4ZNEE 4X6CF 5F89B 3VE0B 2NY5C 2F15A 5FHAH 2A9ML 4M48L 5FM8A 4BFBD 5TQ2H 3FB6A 4MLSA 2CIIB 3W0WD 3G6AB 3AU1A 3BEVB 1OF2A 4GBXD 4XBEH 4YK4B 3QZWG 1I75A 5IBTL 2NX5A 5F9WB 3V8OA 3HAEH 4I0PA 3VFNB 4WENB 4F2MB 2QSQA 1N59B 1IEAB 2AGJH 4F2MA 3DO3A 3ZE2E 4P5MB 3R0NA 3O3DB 2IGFL 2VLJD 3MODL 2IH1B 1IQWH 1OGTB 1KXTB 2A6KA 1G6RL 1ONQA 4J6RL 1WFOA 1DVFC 2P47B 4Y4KA 2APFA 2A1WH 2P5WB 2VDOL 1RZFL 4M1CD 2X5PA 3ULUL 1AIFA 4BK5A 4N90D 3SN6N 4Y5XA 4G6ML 3JTTB 2NW2A 1AQDB 5JHDD 4WGVB 1Z6JT 4HK0B 3FFCD 4UV4L 2YK1L 2AS5M 1FDLH 5L7XH 5HPMA 3DECA 4TSAH 4S2SA 4JFDA 4KROB 3ARGC 5D1XC 5DTFB 3OHXB 1BHGA 2R8SH 1C5CH 3TA3B 2Z0BA 5LBSH 3C5SB 3HB3D 4CAGA 1WBXB 5ISZD 2BHZA 1V7MH 5SWZE 3S34L 5AYQA 2NY1C 1IEBA 2DM7A 3CMOL 4YQXH 1UC6A 2X09A 5IB4B 1I7UA 4JFXB 5HDQH 3K4AA 3IFPB 1BX2B 3I3BA 2B4CL 2LVEA 4W70A 2VLRA 2C4XA 5T5NF 4RCAA 2H2PC 5EN2B 2V2XA 3Q0HA 5DJYB 2X4QA 1CD9B 1AQKH 3DBXB 1VCAA 4XXDB 3P11L 1XZ0A 3MCKA 1F2QA 1KJ3H 3BZDA 4M5YL 4PJHB 1RZKH 2VXVH 1NFKA 3RAJL 2IFFH 3DMMB 4DEPC 4GG6B 5EO0A 1A2YA 4Z5RB 3L9RA 3B9EA 5K9KB 4OIBA 5C92A 1FRGH 1C8PA 4X0KB 4Z0XB 1BBJA 1NC4B 2NY2D 1KIUA 1AD0B 4Z7VE 4CU6A 1N59A 4KY1H 3OAUL 5JHDB 4HGKC 1YY8B 3EYSH 2CKBH 5GHWH 4LOUC 4OGAC 4KK5D 4X8JB 2FNBA 2QSCL 3L3JA 4XBGA 5CD5C 4K3JL 1ZANL 5SWSD 3O2DL 2G9HB 4NJAL 4PJHF 3H3KA 4N8CH 1RK0B 2ADFL 1MQKL 1KB5H 1FO0L 4I8DA 3BRGC 4GG6F 3MXVH 1RUML 5LGJA 5ALBL 3HKFA 5D93C 1UM5L 3RBGA 1OWRM 3B6SA 1HYSC 3SDAD 2V2TB 1LO3H 3NMEA 3TA3A 2HJKB 3RWIB 4H0HB 4GMTL 3FN0L 3C6LB 3HHRB 2B8OT 2R15A 5GS0C 1K3IA 5E00A 1F2XK 2EDRA 4HHAB 2XQBL 3PV6B 5GRXG 1NGWB 5F1OB 5E2VL 5ID1A 1W72H 3EJZD 5FO7A 4JN2A 2BK8A 4J3WA 2PXYC 3QI9A 5HGHA 1FO0A 3RA7H 4H8WH 2E6PA 3KS0J 4JRXE 3WJLC 1MIMH 1NBYB 4GKOA 3MJGX 2C7UA 3WDHA 2Q86A 3PP3H 4NP4L 1DP0A 4AL8L 4JFEE 4F9PC 5C0AD 4O58H 2QSVA 3MOAL 3FB7A 3OF6A 4Q2ZB 4R8WH 4WEBL 3IAGC 4U2ZA 1AE6L 4KUZH 4JGUA 1U42A 4YHYB 1ZA6A 5I1HH 1URLA 2EO9A 2GJJA 4F7CA 4LSQL 1OAYL 3P4OB 2CKNA 4J1UB 1JGLL 4I0PB 4ZSOA 3STZA 3C6LD 3Q6GL 4I4WB 1OF2B 1W8OA 1CDBA 5DK0A 3EZ8A 1UZ6E 3UJTL 4KJYA 3UXFA 1PKQA 4GRWH 2D03L 4CVUA 2EDFA 1A9BB 1B90A 1OM3H 5D7KD 3T0ED 2D9CA 5I6XC 3ZKQD 2JJSC 1AO7B 4O2EB 5C08B 4YHIB 4UINH 4NC1C 4CN1A 4Q97A 4EI5D 1MHCA 5D7LB 1U9KA 4LLQA 3EJYD 5CP3H 4BQ9A 5JDSA 2R1XA 2NYYC 3CFIC 2H9GA 1JYXA 5LGJB 4LARL 2IPTL 5IFHL 3DYPA 3CSYB 3W5NA 4I9WE 1CF8L 4PLKC 4Y19A 4XPFL 4FQQB 3QXUA 1XCQA 3BQUA 3D9AL 1TVBA 1J0JA 5EZJA 4BSVB 1UZ8B 5EUOA 2UVEA 3Q5OA 5F9OH 4I18A 1NGXA 3MLPA 4EVNB 4PJEB 2DI8A 2BJML 4P5TC 3K2MC 4G9DB 3WSQL 1W0VB 3KYMA 3M45A 2QQNL 1TCMA 5C9JA 4MCZB 4Y4FD 1KTLB 3MA9L 2NR6D 4W68A 1QYGH 3MLXL 5DQDL 5C0FB 4K07A 4G8IA 2APBA 1J8HA 2HKFH 1KCRH 3KXFD 1CG9B 5CSZB 1T22B 1JHKH 3N50A 3QQNA 1IQDB 1J7VR 3AM8C 4QCIB 2R4RL 4YPJA 3QA3B 1IILE 2FBJH 2CPCA 3VXRA 2V9TA 4OCXH 5I9QB 4JQXC 3O45A 4YE4L 5D70H 3MRMB 3BPLB 1MCEA 2RJMA 4H26A 3TCXA 1D6EA 3BP7A 4YXKH 4C56B 1HINH 1MF2H 1OGAA 4YDIL 4ETQB 3CFCH 4PTUB 1K2DA 1FNEA 4UIKH 1BFOB 1I7TA 3MJ7B 4PJ5D 4WFFD 2IQAB 1C16A 1CDGA 3ZSTA 4Y0GA 1DSFH 4PV9B 4JDTH 4GS7B 4LHUB 4UIMB 2F8XC 4PJEE 1ZA3A 3ILPA 3LQAL 1OLLA 4EQ3A 4HHAA 2JCCE 5DGRA 2LVCA 4Z8FL 5JW4R 2VE6B 2X1OA 1RU9L 3MCLL 4FQ1L 1AGCB 3UC0L 4AM0B 5DGQA 1WITA 3UMTA 5CMAA 3O4LA 3RPIA 4HKXA 3FQUA 2X9XA 4YXLL 1XAUA 3TBSA 4LBEB 1KNOB 5C71A 2R29L 4MJ5B 3UTZB 4TPRH 3U6RB 1OB1A 3JWDC 1XGQB 5I1JH 4YFLI 2AK4A 2L7UA 2V5TA 3HC4L 3QUYB 3QWOA 2XKNB 5M7QA 4HSQA 1PY4A 3BESR 1JPTH 1K85A 2YXMA 5IM7B 5BO1H 1BBDL 2OI9C 5CCKL 4JN2B 2GAZB 4KH2A 3BT2L 5JW5A 4FFYH 3EYFB 3MLRL 4D2NA 5GS0L 5D7SL 1M71B 2ERJC 2FSEA 4LLVA 1F42A 4FP8H 3MJ6A 1U3HB 1FVDA 3ULVF 3B4NA 2ESVE 3T3MF 3O6FA 4P46D 4F7TA 5GS2D 3VE0A 1JN6A 3BZEB 1EFXA 3MRFB 5EOTB 5I1GH 1NFDA 2MOVA 2KPNA 1JP5A 4IEFB 2E6QA 3MACL 1FC2D 4PJBE 1YN6A 2CLVA 4HULB 1MCDA 4G9FA 1H8SA 1I9EA 4NN7B 3HNTL 4XPBL 4JFHE 1VEPA 2K3TA 5FUZL 4L8CB 2X4NA 4YPGB 4D0CB 1JV5A 5CAYB 3MOAH 2H3NB 4BKLB 2AJZA 1MLCB 2CKBB 2EE3A 4CVZB 1CFQA 4U6TA 1MH5A 4JFPB 4LHUA 3FL7A 4ODXB 1RUMH 4HGMA 5HJ3B 2ID5A 1L7TL 1KB5L 5F7NC 5CJ5A 3AVEA 4NJAH 1DUZA 2AV7B 5HVHB 1A3QA 5D72H 3NIGE 3O6LH 4DGIH 3QJHB 5J56B 4NIKB 3U6RA 5DHVH 2OR9L 4PG9A 3HI5H 1C1EL 2CKBL 2AQ1A 1I85A 3L1OL 3MRPA 5D2NB 5CSGA 5C0CE 4LAQL 1B2WH 3J8F7 1RUPH 2VXUL 4KPHH 2FO1A 4HUWB 4F33A 3QHZH 2F8VA 4CMMA 5CGYC 2EDDA 3BJ91 3B9KB 4M7KL 4TSCH 2V5MA 2J4WH 5A2LH 3MXVL 1PZ5B 2P49B 2XWJA 3FRPG 3P30L 4QOKE 4MDJA 5AAWA 4UOW1 3K4DA 4U6XB 4OD3H 3I6KB 1CFBA 3QIUB 1J9CT 4K8RH 4HS3A 5E08H 5K59E 1FYTE 1IKNA 5E2TH 5B8CC 1CTOA 4HWBA 5IHZB 4S1QL 3BKCH 5GHWL 2YZ8A 5L2KD 5HJ3A 2VL4A 3DUHA 4JHBA 5E7BA 3V52L 1YEEH 2VXSL 1XMWA 4OGYH 3KNBB 2C3HA 4N0UA 4H88L 3X14A 2QQQA 1QSED 3WUZA 3DGGB 4U1KB 3MFFB 2E8ZA 5TGBA 3OKKB 5K33A 4F37K 5IFAL 1S7VA 3M07A 5D6DA 1E4XL 2IC2A 5JW3L 1ZTXH 2N7BA 4M6OH 2IADB 1MCOL 1PG7W 2ORBH 3BPCB 2CIKA 1D5XB 4Y4HB 3CDYA 4YHZH 4G6AD 1BZ9A 1ZLUH 4MSWB 1UWEH 5CKGA 2X1PA 3BSZH 4J4PD 4ZPVA 5L2KB 4HUMB 2VDOH 3O0RH 3P0VH 5E94A 2OL3H 2DS4A 4ZPTB 1Z9SA 5BZDA 3HLAB 3SGEH 1F3DJ 5GISH 2Q76A 2V7HB 2X1WL 1ZHBB 3GBML 2VIRB 4HIHA 4ZAKA 2FR4A 2HVKB 1IGCL 4LSVH 4BQ6A 5SWSE 1NCUA 1OB1B 1FIGL 4MJID 3X3FL 2HJLB 5FGCB 2VN7A 3L5WA 3NCJH 1AXSB 4EXKA 1EBPA 2R69L 2VZ3A 1KNOA 1QKZL 3CD4A 4TUJA 4YAQA 5JNYA 4S1DC 3PGFL 5JQHC 3OKEA 1D5BB 3C8DA 2FJFB 2GTWB 4YNYA 3P30H 4MJ6B 4H25A 4Y4HD 3NCCB 1I3RB 3OGOE 5JOEA 4ZUUB 4D0DB 2H26B 3S3JA 5L2JB 2AJ3A 2NY0C 1YQ2A 1OVZA 3MNZA 1YY9C 3RIFF 1ZS8B 3VRLE 4Y4FC 4HUKB 3UJJH 5SWSA 3KDMA 4G5ZH 4NQDA 5K9JH 1BOYA 4RISL 3RWHA 3KPSB 3GMPB 2XYCA 2CDFB 4DVRH 5DQ9B 5IKCB 4FTVD 1IE5A 3MV8E 2HTKD 5IBTH 3UTTA 4XP5L 2H6PB 1QR1B 3B43A 1A64A 4P2OA 4NKDA 1I8LA 1AGBB 3SKMA 4IRJA 4JB9H 3DSFL 5IJKC 3SQBA 2IMMA 4PJFE 5D7JD 4NQDE 1A1MB 4TNWF 3G04A 1DN0B 2YWYA 4MDIB 1QHPA 3E6HB 3TPUB 4J8RB 3NZ8B 2PCPB 4C83B 4Z7QE 1DUYA 4HUWA 4LKCB 1N3NB 2NPLX 4Z7UA 4BQCA 2ESVD 1UCBL 3MRBA 3BI9X 4FNLH 3GDBA 3T0BA 1Q94A 3UTTE 3L3OB 3S5LA 5E8DH 3VRLF 5I1AA 3OKLA 2OMBA 1QFUH 4L1DA 1MCBA 4PJAA 1OAQH 4XZUA 4HUXA 1RIVH 3T2QA 5C09A 3U9PL 3HUJB 1ZWIB 3GO1H 4UDTA 4IRSD 4RQQB 1SY6L 1VADB 4JFOA 3NIDE 2UZXB 4JFFE 5B38A 4TVPL 3F8UB 2FO4B 1Z9LA 1F97A 5BS0A 2PTTA 1HDMB 4BZ2H 5HD8C 1FSKC 4Y19D 4ALAL 3N06B 4Y2DB 1JPTL 4F7MB 4JPVL 3F7YA 5GJSH 5DZNA 1WEJL 1L7IL 2A6DB 2MSPA 1JUFB 1A6VH 1HEZA 4JY4B 4JFFA 4J3SA 1K8IA 3K74B 1QKZH 4MA1C 5KSAC 2IPUK 4WHTB 4TQEL 1PKQE 4XH2B 4JFDE 4KKBD 3MRCA 1CICA 4MQSB 4M6OL 3SE3A 4IJ3C 2OK0H 3B3IA 2NZ9C 1KLFA 2YD2A 3F65A 3LEVL 2X4RB 4Q9CA 5FYKU 4HKBA 1JJUA 3H3BC 1CLYH 3OKEB 3VXMA 4X7EC 1ACZA 3OPZH 4L8SB 2BSSB 3H7BB 1RJZB 3HPLA 5E4IA 3S36X 4OLXL 1AGBA 4I1NB 3UTSB 3JWOH 5A3ID 1AIFB 4M4RA 3TBSB 4DZ8B 3U7YL 2NY7L 5E03A 4ACPA 5D6CB 3V52H 4P59L 4LNRA 4DN3H 4XHJD 3PWVA 5EU6E 3PGDA 5AG8A 4LL9A 4O2FA 2DMCA 1QRNE 3BE1L 2EXYC 3DNKA 1V3LA 4LLMA 1GJIA 2XZCL 2IFGA 1U3YA 1ZT7B 4LCIH 3HPJB 2ZSWB 1OSZB 3CVHH 1IM9D 5DEFA 1WBXA 4HS8L 1IGIL 3BKMH 1NBYA 1QSZA 1MNUL 1BM3H 1KB9J 4GQ9H 3DHJA 1I3RA 3TNMA 1MAKA 4P2RE 4TSCL 5TF1H 5J4MA 5KJRH 4YGVA 4U1JB 2HFFB 1G6RH 3EDKA 4LEXH 4OCNC 1NFDE 1IGYB 3QUYC 4FMFA 4PJAF 4AEEA 4N90E 7CGTA 3P0YH 3L5WB 1YPZA 2R23B 5KS9E 4IRZH 1JPFB 3WO4B 4JFZL 4DGIL 5J12C 4DKEL 3GSRB 4JHWH 4OKVA 5DK2B 5F9OL 4JO3L 3SPVA 1MIEL 4ODVL 4TSBL 4KKAD 4YDJB 3O2WH 1FVCB 2DQJL 5JDJA 3EYVB 4ONHB 3FQNB 3GHBL 4IRSB 4LQFH 2D7NA 1CF8H 1J8KA 3HB3C 2H32B 5C1MB 1TNNA 1AFVL 3NIGF 2ICWB 1NJ9A 2YC1B 3UZEA 2C1OB 4ZUSA 1KTLA 2IAMA 3ARDD 1B2WL 5F93C 3RGVB 4HX1A 3MCG1 4HWNA 4OM1H 5DJ8A 2O5YH 2IQ9H 1CIDA 4HIEB 2YXFA 1FL3A 5ISZB 3EZJB 5F3HB 3KXFB 4CUCA 4OLUL 4L4TD 1R5VB 3P4LA 3MJ9L 4N1HB 2WK2A 5EUKA 1X5XA 2XFXB 4MX7B 2WM0A 3CXDH 3TO4D 1WAAA 3VGFA 3O6KH 2XWTA 4P23A 5GGSB 1MHPL 4KV5E 3O6MH 5FB8B 4PJBF 1KCVL 4PLOB 4KRLB 1NL0L 4GAJL 3GZKA 3HRPA 4G3YH 4KQ3H 5KVDL 4NHUA 3FRUA 1P9MA 3X12A 4ONFH 1G9MC 4PJFF 3SY0B 1FFPA 4QYOA 4PP1C 5CJXA 2EECA 2DWDA 2NR6C 2EIZA 5E56A 3O2VH 4K7PY 1IGYA 4X6DA 2DWDB 3HC4H 4XNXL 4N9GB 3IJSA 1XGTB 4X4XA 4OI9A 5JXEA 3Q1SH 2ESVA 4MJIA 4Q74A 4X98A 4Y4FA 1I8KA 5DC0A 4JEGB 1RVFH 4NFDA 5FA3B 5MEPA 3PF2A 2FIRT 5D2LF 1MI5A 3GSOA 3VWJA 3D39D 1OAUH 5DEFB 1KPUB 5C6TL 1S7WA 1OP5K 3LS4H 3SOBH 4NQTA 4ZQKB 3P4OA 1JI1A 4JM2D 4DW2L 4C58B 4XRCB 3S35L 1Q1JL 4DZBB 4OM1L 3SE9H 1IM3A 4P5MA 1NLDH 3F62A 1B4RA 3CFEA 4GMTH 1NGPL 3GFUA 1BLNA 3CCHB 4M6NH 1LEKB 3C09C 4ODHH 3L5HA 1RZIB 2NY7H 3OZ9L 2VDNL 2IAMB 5I1KH 5JPMB 3WLBA 4YE4H 3B5HA 2M2DA 3QB7C 3UC0H 2E6JA 4XI5C 1T89C 1WBZA 3T4YA 3SKJL 1FFOA 1SYVB 4PP2B 1CCZA 3BEVA 3GSQB 3MLSL 2OYPA 4DKFL 5HTSA 5E8EA 5F44A 1FSKB 3F7QA 3WXWL 4RGNB 1KB9K 1UWXK 1YNTA 3B6SB 1YEDB 4XCCL 2F54B 3U83A 3MRJB 5EORL 3QNXB 5J3HD 4IDJL 4OUUB 1X4YA 5GRVK 1L6XA 3WE6B 1H15A 5IWLC 5LWYL 1Q9LB 4X8XA 3UTQB 3INUH 2VLME 2EC9T 1F8TH 3FT2A 3L3KA 5D2LA 2FSEB 1TXKA 4JQVA 3HUJF 4XPHH 3X3GH 1IGIH 1T1ZA 5E6IA 2X10A 3IXAB 2OBGA 4J4PA 5T5FL 3HE6B 1JHLL 5GGRA 1IM9A 1LO0H 2HKFL 1UG9A 1WZMA 2ATPA 4UU9B 5KANI 4O51A 1N8ZB 3VRJB 3AXLB 4GH7B 3EBAA 4M3JA 2QR0A 2P48B 3PWPA 1SMAA 3UBXA 3B9KA 4ZOBA 1AI1H 4HJJH 1IT9H 3ZDYF 5HHXL 4D94A 2CLZB 1DQML 2RFXA 3ZMRA 4U0QB 4PJ5B 3TFKC 3RI5K 2EKJA 1W0YT 3KPNA 1KLGA 5D1QB 1S5HA 4MNQB 4BYHA 1JHTA 4FMKA 2WWKO 1R3HA 1QR4A 4J3VA 3MUJA 3ARBC 4WDIA 4O2CB 5DFTA 1F6FB 5DURB 2P1YA 4XCEA 3RVTD 1MPAL 4UUJB 1JWSA 4N0YH 3ECBB 1KN4H 1JK8B 5ADOH 1OP3K 4Z7OE 3IVKA 1MCPL 1P4LA 5EOCL 5TDPA 2K9UA 3MRHA 2X44D 4XMKH 3NPSB 4P2OD 3DV6A 2DDQH 4M7LH 3WN5B 2FO4A 1HQ4A 4S2SB 3MMEB 3C60A 3QZWB 5DFWH 5JZ7D 1NDMB 2E8YA 2X42A 4JRXA 2VQ1A 4FXKB 1SM3H 1HXMA 4X7SL 5GGRY 3B8YA 3GSXB 3K8MA 4O00A 1OARH 1ONQB 3DJ9A 2OXGA 2EXWD 1R3IH 4MCYB 1AO7A 5C08A 4PJAB 4R3SA 3O3AA 5FYKD 3TWCL 2ZNXA 3K2UH 1GGYA 4CU8A 2HT4C 4O51B 5IK3A 4ZFZB 4NM8H 3R1GH 2DQUL 1Q0XH 1O7SA 3ARTA 2PO6B 4ZPTA 4XI5D 2ADIB 1EO8H 4C83A 2XRAH 2PO6A 4OLZL 5HYQA 3WBDA 1RZ7H 1ZSDB 1LK2B 3ULVC 1F4XL 5DK2A 1JZ2A 1MQKH 2OL3L 2GIYA 5T3ZE 4ZFGL 5C0CD 4KVCH 1N7ML 4NQSB 4KRPB 1BQHA 2EICA 3U0WH 1CIUA 4I13B 2H8PA 5HYEA 1D5XA 1EJOH 2Z35B 1L0YA 2J8UA 5F96H 4RISH 2EZ0D 3EYQC 1MY7A 3WIFA 3H9HA 4GG6E 5ESAB 3L6FA 3EKCA 2Q86B 1P6AB 1EAJA 5DHYA 1EO7A 4PJHE 3QEQA 2LV4A 4BZ1L 2AEPH 4EOWH 4PJDF 3CUPB 2RGSA 3WL9A 1ZS8A 4HFWA 1IT9L 4M9PA 3FAXA 3ZTNH 3ILPB 2BVQB 1I1AB 5KVGL 3QRGH 1P4LB 4U3XA 3T0DA 3U1SL 1FFOB 5IV2B 1ZVSA 43C9A 5IESH 3JXAA 4OBSA 3U36B 5DI8B 2BSTA 4RFNB 1AD9B 3OBAA 4J12A 2D3VA 4OGYL 3PGDB 4U31A 3T08A 2DLEA 2QLVB 4S1SH 3QDJE 3MLYH 3RWIA 1FNLA 5JMOC 1FIGH 5D6CA 4HS6A 1P4BH 4ZD3H 1J1OH 1UWGH 3MOBL 1CGWA 1XIWD 1MEXH 3EDDA 4LSUH 5GZOD 3DRQB 3IGAB 4DGVL 2AXFB 3TCLA 3O9WD 4NM4L 3UYPA 1TETL 2YZ1A 3RIAK 2P8LB 4PJDB 1EHLH 4M1GH 1GRWA 2A6IB 1R3KB 4LLWA 5F6IC 5HGDB 5A16B 3QIBB 1SY6A 4WV1A 1NMAL 5LBSL 3NVQA 5GS3A 2YSSB 4TVSa 3TM6A 5LQBL 4EXPX 2GJ6B 3QXDA 3N1MC 4OLWL 1NANI 4FZ8H 4JPKL 4WHTA 3GJFK 4JFFB 1T66D 1KCSH 3BD3A 4WTZG 3KYMB 5BV7C 1CGTA 1U8LA 4QT5B 1XR9A 1FL3B 3K7UA 3A6CH 3FCTB 5FKPB 4U1NA 1GGCL 5DJ8B 5C7XH 5DDHB 4WWKB 3VI4E 4PJ5E 4J3XA 2ZCHL 3MRKA 3LSOB 3IDYB 3PIQA 2VLMD 1JPGA 4MZ3A 5FDYA 1BQUA 3QO0B 1U2HA 3FB8A 4QRQA 1KIPA 3BP4B 3O9WB 2DAVA 3KWWB 2Y1VA 4QF1B 4WW2B 2O5XH 3MRHB 4TTGA 1QUNA 1KCUL 3MRQA 4OI7A 1IAKB 3CLFH 3CX5J 3LN4A 3PQYA 4FQPA 4AQOA 3OKLB 2DQCL 2AABL 5GRWA 1NAMH 5E08L 2J5LC 1X5ZA 4Z7WA 2P42B 4S10A 2ERJB 5EUKB 3QUMA 3LRSB 4PJ7A 2VXQL 4YDKH 1INDH 1FCCA 4GBXB 1Z3GH 3B9DA 2FH8A 4YHNB 3IDXL 3RWDA 2YUXA 5T33H 5JZ7C 1EMTH 3JWDL 3V6ZB 1MOEA 3PL6B 4J6RH 1YEHH 3OR6B 5HHOB 1MCQA 4NRZB 2YPLB 3TZVD 3DVGA 5KW9H 2PTUA 4I0PC 4Y4HC 5DRWA 2BX5A 4WV1B 3I3DA 1UZ6F 3JSSA 5HGDA 1LHZA 4LLUB 3QUKB 2D0FA 2EIDA 1YMHA 3OKDB 5D72L 3NFPB 3GBNH 3AS3A 1XEDA 3C8KB 1S8DA 5I73B 2UYLB 4OIAA 2EDOA 2I9LB 3DTXB 1E6OL 3LRHA 4WWKC 3MO1B 5L0QB 1U6AH 2A38A 3NABH 5MEND 4G8EA 4L4VA 1HNFA 2YR3A 1S78C 1BZ7B 1FP5A 2P5EA 1I8KB 2HFFA 4LPTA 3S5LG 4OF6A 4JZNB 2OJEB 2V6HA 3BX7C 3PL6D 3G6AA 1R5IB 4Y16B 3H9ZA 5H2BB 4EDXA 4NO5B 3KPOB 5E4EC 3MRCB 4P5KB 4HKJB 3DARA 1KFAH 1BQLH 3C2AL 3R8BB 5C0EB 1IFHL 1QSEE 3U4EB 2AXHA 1TMCB 3HG1B 4NO2A 1NCBL 5D6DC 1INQA 4XHJC 4QXGH 4WY7H 1JZ8A 2EYRB 3G5ZA 2IJ0C 3QDJB 1BFTA 1XCTA 3VFOA 2YS4A 1FYTB 3CH8A 1OGTA 4JG1H 2CH8A 2V17L 1CT8B 1JNHB 2W60B 5ALCH 2AKRB 4MXWL 3NZHH 4DZ8A 3UPCA 5KSUA 2F53A 5DJ6A 1MIEH 4ODVH 3C5ZD 4RX4D 3JV5A 5DWUH 5JPMA 5DT1L 1AC6A 1XIWC 3LSOA 4KTDH 1NCNA 3WFEL 1BD2B 3QG6A 4YUEH 3BGMB 3OR6A 5J11C 3P77B 5F3HA 4MD0B 1YJDC 4RBPK 3IDGA 1QG3A 1B0GA 4IDJH 3DVNB 3ZKNC 1ZT4A 4OKDA 1S7VB 1MJ7H 2BDNH 4YXHL 5F3BB 5DD6A 1JGUL 5L0QC 1Z5LB 2COQA 1CE1L 1CFNA 3WFHB 2C3XA 4KGLA 2KZWA 3SDAC 2HN7B 5EU6D 2B4CC 1GIGL 4APQA 4QHUB 4JANA 3VGAB 3T8XA 5F6HI 4G8GB 1CS6A 3AB0B 4M6AA 3BIKB 1GZQB 4R0LB 1U92B 5FDWB 3FOMA 1T1YB 3P4MA 4JPIB 4P23D 4NZDA 2FRGP 1Y6KR 2KQNA 3GUTB 3CVHB 5FEBA 1L0QA 3CFJA 2DJUA 1FNGA 1UXWB 5IW6A 3VXUB 3OKYA 5H8DA 5FF6B 2BOCA 2QADB 4LCYA 5FKPA 3KYNA 4OD1L 3DVIA 2QL1A 1FZJA 4ETQA 3H6JA 3D2UD 4Z76A 1UH2A 4BA8A 3BWAA 2VDKL 3MRIB 5CINH 3FFCB 4WFED 2QTEA 1QTYT 5DR5H 5KN5B 1I7RA 4AENA 5DD1H 4HV8B 2FJHA 2DM4A 3GGWB 4K9EH 3ALPA 5CZXC 4Y19E 5KSBE 1XF5A 1OGAE 1U6AL 1EEYA 1YY9D 4F7CB 3MLXH 1YEJH 4P3DB 3P2TA 1GCFA 3P4NA 3NAAH 4WW2C 2AV7A 1S7TA 2FWOA 2X4TB 1T2XA 4NKIL 4JPVH 4NNYB 4AIZA 3J7HA 2EKSB 1AGDA 1JFQL 4C4KT 5TDNB 2HWZH 5JUEL 4MD4B 5F1IB 3ZYZA 4OF5A 5IWLA 1H5BA 4YHPB 3BEWA 3RBSA 5DQ9A 2BNQA 2EDYA 3PP4H 4OZHE 4BKLA 2NY2C 1KEML 2DQHL 3E8UL 2KBGA 1IKFL 2ADIA 4FQJH 4XWOD 4P2QB 5EZJB 4N1EA 4QHMB 5HYQB 4LAJH 3UBXI 5A2KH 2PXYA 3QI9C 1I7ZB 4MNHB 3VD3A 1Q72H 2CIIA 3TBVA 1FNAA 5EC1B 2GSIA 4ZUVA 3KPQB 4OLUH 4H25B 1QRND 3L3DB 1NFDB 3AREA 1V5JA 2L7JA 4EI5A 3OTTA 4TUJB 4YAQB 5JNYB 2Z8WC 4X6CE 5DJZA 1YA5A 4YGVB 4LLVB 5KSAA 3IFOB 4XP1L 5JW4M 1AFVH 2Z4QB 4NO3B 1CICC 3RZCA 4U49A 3GHBH 2J8HA 1JGLH 4U0RB 1T3FB 4PD4K 4TRPL 1ORQB 4MWFB 1KIRB 3TPKA 4UTAL 2B2XL 1MVUA 5IMOB 4UUJA 5JA9A 5C7XL 4NQED 1YY8A 2I24N 4KUZL 4XCEB 2DQCH 4RGMB 4EN3B 1XGRA 5K9JL 1W72B 3P9MA 2EIEA 3V6OE 1FJ1B 1SJEB 5CHNB 1ADQL 1S7TB 2BMKB 4K3DL 4L4TB 5FKAA 4RMRA 4HWZA 1MCKA 5GGVY 3P4NB 4U6HB 3REVB 1A6WL 1S5HB 4MNQA 4NZTL 1JWMB 4CVXB 4FXKA 5J12B 4OJFL 3QDGA 4K7PL 1DLHB 2YEZB 3RWCB 4YWGH 1JGEB 1MVFA 5LCVH 4U05A 5DHXB 4OZHA 3T0EA 4X99B 3VFVA 2QQKL 4LVHC 5IW1A 1MFNA 3GGWA 3TYGL 1PX4A 4JFQA 3ECBA 2CJUH 3OKNA 5DHVB 4E0RA 3KDMB 1JGDB 1BQSA 1UXWA 1DTUA 2QBWA 3U7YH 4F7MA 4QYOB 5FECB 4I0PD 3VXRB 1FFNB 4KJPD 1EUUA 5I75C 5BZWA 4ZUUA 4D0DA 5EFIB 2XTJB 3O2DH 3GRWA 3DHMA 4U6XA 2OL3B 4LLYA 4RNRA 5F7UA 2FJFA 2GTWA 1PZUB 3STLB 2HTLD 3BO8B 3G08B 1J1OL 1UGNA 2APXA 3BIKA 4X6BB 4BH8A 2YD6A 5BVJB 5F9JA 3QHTC 1TPXB 3LKPB 4GXVH 2QKIB 3SGDH 2QQKH 4FXGA 1R3JA 4DOHE 4PJGE 4FZ8L 1A7OH 5JIKA 5ENWA 3THMH 3LKNA 3OGCB 1JWUA 4Z7WE 3BMWA 3FMGH 2DWEA 5FM5M 5FUOL 1KELH 1XGRB 4MB3A 4XVJL 1GHFH 1FNHA 3ALWA 1QSFD 3WNKA 1CZ8L 3PQYE 1ADQA 4RGND 5TDOA 5L9DL 3GSQA 4Z0XA 4NCC2 4BZ2L 3LKRA 3V0AC 5ACZB 1JMZA 1N2RA 5EO0B 3SHSA 4JJHA 4OLZH 4GXVL 5EIIB 3PWNA 4E41A 3LH2L 1G9NL 4PLJD 3O41B 1A1MA 1ADQH 3UTPD 8CGTA 3VFNA 1ZEAH 2ADGB 2AGJL 1FVCA 5BOZG 1FG9C 3CMOH 2F53B 3QUXA 2EE2A 3GSWA 4GOSA 2XN9E 5KOVC 5D7LA 3ZE1F 1P9MC 4XNZC 5IF0A 4YWGL 1RURH 3GMPA 4TRPH 1FE8H 5F88A 4JM2B 3SDCB 3B2UC 5FHAL 1D9KA 5HHOD 3S98A 3T04D 3QH3B 4KZDL 1QBMH 4JCLA 3VH8A 4N68A 2NY4C 3PWUB 3VI3F 1PYWA 5F21B 3W9DB 4QRPA 4XNQB 5GGQL 1IGMH 3S97C 2HFGH 3BH8A 3RPIB 2X4PA 4M9OA 3FKUS 3N85L 2VAAB 1S7SB 3K2UL 1M4KA 4M7ZB 4PGJA 4RAUB 1IC5H 3MLVL 3DSFH 3MV9B 5D5MB 4OZIF 2NZIA 4GS7C 1NAKH 1BZQK 5IROA 1NMBL 5DRXA 3OG6B 3ZYOA 1CDIA 4NN7C 3I6KA 3FO0H 2W0PA 1ORSB 1S3KH 3KYKL 2VLKD 1AKJA 4DQOH 1H3PH 3ZZ1A 3DTXA 3B9VA 4HWEL 3ME0A 3QDAA 1RIUL 3RKDD 4F57L 3IFLH 1JYNA 2GJ6E 3SGKA 2WUBH 3RRQA 4KQ4H 3SDCD 3WNNA 1MCSA 3BN3B 4X83A 1S9YB 2BC4B 3ZHKA 1XGYL 4XPBH 2XT1B 3QA3A 2DQEH 1A6AA 5MEQA 4WWID 3MROA 2WUCL 1N2RB 3U7WL 3GJFA 3P0GB 3X11B 3TH3T 2ZG1A 1J8HB 1RSFA 1KXVC 5DUML 4JY6B 3QULB 3PL6A 2CIKB 4MNGB 5FOBB 5FO8B 1I8IB 3RWJA 1II4E 5DSCB 5E1HB 3FQTA 4JAMB 1V3JA 4Q0XH 1VGEH 2Y9RT 1R3JB 4HXBL 3O3UN 2FX8L 2CKBA 1T04B 4NWTH 2P5EE 3MFFA 4J3OC 3ARXA 1JMXA 1S7QB 1N4XH 3X12B 1SJXA 4PJGA 3VGEA 4NCC1 2XNAA 4G8GA 3ZE0E 4V2BA 2DKMA 4LGSB 4FQLL 4IS6B 4YDJA 5B38G 4GRWF 3IFNL 5E99L 5FO9B 3BAEH 4YFEA 2R2BA 3CVIH 2XNAB 1Q72L 3GSNA 3HAEG 3GMQA 3ILQD 5GS1B 5HHPA 2PO6D 1X6NA 1KB5A 4YLQT 4XX1E 4Y7MA 2ARJQ 4IMLA 4BSJA 2VKXA 4E41B 1DFBL 4J4PC 3HI6L 5DJ0B 5C09B 1VFAA 2R9HC 2YUWA 2CSPA 3T4AB 4M7ZC 3DROB 5I71B 3WHE1 4BUHA 1BFSA 3UTOA 1E4KA 2VLKE 4HXAH 4M1DL 3VI3E 1HHIB 3N1FC 3K3QA 5DR5L 5F7WC 3ZKMD 1IC4L 3TT1H 3IRZA 4PB0H 1QRNA 2ED7A 4IJ3B 1S7UA 2GYSA 2NXZD 4CJ0A 2GJ6D 3E3QE 3WNLA 4PGEA 3B9KC 5DJXA 4UTBH 1P5VA 1MJ7L 2H32A 3MBEB 4JO2H 5JQ6L 2XWBA 1T03H 1OTSC 4Y4KC 1MRCH 4IRSA 5EO9B 2Z93A 1XCQB 5DYOA 4RNRB 3DX9B 4HQQL 1OW0A 2W0KA 4Y8DC 3RL1B 3C60C 5J3HC 4LHQB 4GRMB 4I2XB 5K9QI 5EZLA 4UAOB 1MFCH 2NY0D 5AEAA 2NY4D 4W6XB 3CFBB 2XZAL 4IM8A 5CEYB 1ZV5A 3NCYS 4F37F 5CMAB 4XVSH 3MREA 2DI7A 2EDBA 4EDXB 1MFCL 4R97C 2BSSA 1A4KB 3RUGA 1OAUL 5K93A 5K9OA 4CN6A 1ZVSB 3OZ9H 1J5OH 3D2UA 3CC5B 1IMHC 3ARED 1S9XB 3Q6FA 2C3VB 3FO1A 3HN3A 4YBQC 1RVFL 1JPST 5FGSA 4C4KO 4QXGL 1MCJA 5JQ6H 1QSFA 2VISB 1CI5A 3AS0A 1I1AA 3DMMC 1EEUA 3U79A 1HOCA 4RRPG 1W0WA 4C59B 3WL9B 1Q9KA 1ITCA 1A7PL 3D0LB 4I9WD 2BJMH 3KPSE 1F4WL 3QAZB 3WSQH 5IB2A 1RMFL 1T1WB 1VERA 4PLKD 4PJ9C 2HJKA 5E24E 4BUGA 4G9FD 2IALA 2HTKC 1A1NB 1EGJH 1HNGA 4ZAKB 1CLCA 1X5LA 4EZMA 4JG1L 1CD1B 4I2XA 2Q76B 1NUNB 5B3NA 4A2MA 1HYSD 1BVKB 2BRRH 1K3ZA 1WWWX 2FHFA 2HT2D 4P2QA 3IFNH 1QZ1A 4AMKL 1MUJA 1G6VK 3MBEA 4LMQE 5F1NB 4N8VG 2AEQH 4GG8B 4NC1E 4UILH 2BVPA 4KK8D 4Q9RH 4MCZA 3CXHK 3PE9A 4XVTH 5EZIH 2R1YB 2DBLL 4JKLA 2WP3O 5CZVL 3P9LA 2FEEI 4HFUL 4Q0XL 4XXCA 3V7AE 3CFEB 5I1GL 4PREB 4MB4A 3NABL 4P2OC 4MCYA 4R0LC 3GNMH 1ZLSL 4IRJC 2JK5A 1RK1B 4EDWH 2WBJD 1NKRA 3EO1B 2CK0L 3OKKA 3PWLA 4HFUH 5T33L 3G5YA 1T4KA 3U0PA 4XXDA 1V3MA 1ND0A 5FYJU 1A8JH 1JRHH 1BIIB 3FQWA 4R26H 3BT2H 2X4QB 5MERB 3ULVD 4EN3C 3S37L 4NGHH 3WKNA 5E8OB 5JIPA 3CLEH 2CR3A 1VPOL 4P2OB 2D31A 4ZFOB 2MJWA 2HT3D 1SEBB 2UY6A 4PJXE 1U3HC 4Q7DA 3BP5B 4RGMC 2MPAH 1XH3A 2Y06H 3BP7B 4WDIB 4NSKA 1MAMH 4B41A 3OKNB 5TF1L 4JJ5B 2FJGA 1YC8A 3MRBB 4A6YB 3O4OC 4IBLT 1HILB 4YO0B 1R3LB 5IGXH 4OBRA 3OHXA 3Q5YA 3GSVB 3HC0B 4LKCA 4Y5VC 2YWZA 2DJSA 1QRKA 4D8PA 1FLRL 1YMMA 2XA8L 4U1GC 1RJCA 1NUGA 2CGRL 2DLIA 1NBZB 5IT2H 1GC1H 1UKSA 2VC2L 5I8KH 3VGDA 3AGVA 2GJZB 1MREH 2EH8H 1AC0A 4ZS7L 4QTIL 3PWJB 1IGTA 1T7VA 4DN3L 4L9LC 1U93A 3NTCL 5CWSA 2GFBB 1KENH 4Z0BL 3VFRB 4K23L 1Z3GL 4LEOA 4I3RH 1X3DA 2ED8A 3UO1H 1MUJB 4IIQC 1QA9B 1KJ2H 2KL6A 4Z95H 4MA8L 3BKML 5HHVL 1FNGB 1ZANH 3W39A 1DZBA 5C0DA 3C5SA 1NCWL 4G6JL 1BWMA 2RR3A 2DYPD 3V5KA 1KCUH 4P4KA 4QRUA 5B8CB 2VUYA 1RULH 1T4KB 4NQCD 4XTRD 3FHQA 3PDDA 1Q8MA 1ZLVH 1CT8A 1JNHA 3BH9A 4H20H 1G0XA 3QWQB 4LPYA 1VACB 1A6TA 3ARUA 3NOIA 1MI5E 4M1CC 4LCWD 4GMSL 1BEYH 1Q9KB 1E27A 2ICCA 2MQ3A 5IVXF 2Q8AH 1GPOH 4HKZB 4OUUA 4PFEA 5T1LD 3THML 2X41A 1SYVA 3QUZD 1WFUA 2N1KA 3TBVB 2HVJB 2GUOA 3QFJA 4ZUWA 4ISVB 4GJTB 4O02L 5F8QC 4X80H 2DL9A 1MRDH 1LP9F 3NA4A 3K80A 1AHWA 3WUWB 4F9LC 1RIVL 4OD2A 2L4OA 1EK3A 3G5XA 3AROA 5IBUG 2HRPL 3HPJA 2YA1A 5DJAA 3M1BA 5INDB 3QRGL 1WJ3A 2O5ZH 3KPPA 5EG6C 3VD9A 1NGQL 4JFFD 5H94B 4M8QB 4ONGL 4MA3B 3QCVH 2VSCA 5EU3B 3DBXA 2IPKA 2N56A 5I1DA 3TYGH 5CWSB 4NNXA 3GO1L 4CMHC 1OAZL 3OKOB 3MMEA 2VL5A 2Z8SA 4GAGH 1FZMA 3ZYIA 4FN0A 5BVJA 5L88L 3HZYA 2CUHA 2A6JB 12E8H 2XIDA 1CFSB 5C70A 4KHXL 3D85A 2A83A 3VWJB 1QRNB 4N0UB 4NFBA 4Q6IB 5E8NA 2XZQH 2UVFA 3ABZA 3QBTB 5KN5A 3WDIA 4D8PB 2FH6A 3WHXA 5KS9B 4X98B 3LKOB 4XH2A 4U0RC 2WUBL 1FZKA 5J1SC 2AI0H 1X9QA 1T7WA 2W65A 1S8DB 3SDXE 5E1AA 3HMWL 1OTSD 3LN4B 3PQYB 4HWEH 4ZNEA 3HNSL 1WT5C 1RHFA 1LEIA 25C8L 4Y2DA 4HLJA 2HKHH 4ELKB 1U0QA 4XP4H 3MRDA 4FS0A 1OPGH 1NMBH 1QLFA 4PJGB 2AQ2A 3WD5H 1PEWA 5E2VH 3QO0A 1DBAH 1F4YL 3MUGA 5C0AE 1FN4B 1SVCP 4WW2F 2IPKB 4PRBB 2PR4H 4UDTB 4GO6B 2WBWB 2FHCA 3H7LA 4NQCB 5IQ7H 5EIIA 1AD0A 1WVZA 5DSCA 4P4RA 1U8NA 2SEBB 2BFVL 4YDVB 4L3ED 5ACZA 3WLWC 1UA6L 1P7KA 4LCUA 1LO3L 5FGBC 4CNIB 3S5LB 3EOBB 5HGBB 2ZUSA 3QFDB 4FQXD 3DX7B 5T1LB 4LASH 2VAJA 1DL7H 3LKPA 4DVRL 4BM7A 1JV5B 4YR6B 2VUOA 1Z0MA 2LU7A 4RIRA 4U4BA 4JFHD 1PDKA 1I1RA 1SJHB 4JKPH 1JHLH 2AI0L 3KPRE 1I8LC 4FQHA 3QDMD 1NMCC 1XR8B 5GRVL 1TJIH 4LKXA 5JORA 2ED9A 4U1GB 2FLRT 1OTUC 5AWNH 3PABA 4JRWA 1WCQA 2HWZL 5FYLD 5BRZA 5IFAH 2VDPL 1IRAY 2CDFA 2XZQL 2D2OA 3MUY1 1UQSB 4QT5A 3TNMB 4L3EB 3W11C 3KPOA 2AVGA 4YGAB 1IJ9A 4M5YH 1A9BA 2A73A 4KKCD 4WI6A 3V5KB 3MV7E 1T1XB 1YEEL 2J5LB 3EGSA 1RZIA 2RB8A 4HUUA 5FV1L 4YJZL 3CDGB 5HGGS 4W6WB 5DD1L 3EDEA 4PRIE 1RZJC 4JM2A 4X6DF 3NA9H 1FYHB 4PGCA 2O5ZL 3KLAB 5IMMB 5ACMA 4WVRA 2BOBB 1D6VH 2HH0H 5D7JC 3ISWA 5IHLB 1XGPA 4OD3L 5JHLH 5HXMA 2X1XR 3VFPB 1PD6A 5B39B 3UTSA 3U82B 3K0WA 4DWHA 4Z0BH 4XMPL 5GS0D 2BVOB 3BW9B 2VITB 5EO1A 4BFIB 5IOPA 4R6UA 4M6NL 4X80L 2W9EL 4JN1L 5DJDB 4YX2H 5E8PA 1MREL 1K5NB 3EUUA 3QIWD 3H9SB 3RTQA 1D5ZB 5E2TL 4GRLD 3C87A 5EUOE 4ISVA 1E28A 3V4UL 3QHFL 3HR5A 2XA8H 1CLOH 3RDTC 3QCTL 4JZJA 4A2LA 4MA1B 3V0VB 3TVMC 1S9WA 4HDIB 3SOBL 4I3SH 1ZGLM 1T21B 4PJ8B 1CE1H 5LXGL 1KXQE 2YPVL 5LWYH 5HHNB 4KROC 1OT2A 1T66C 3S6CA 4M7KH 1HN1A 1LE9A 1NEZA 4X6BA 3RFZC 4HF5L 3SDXF 3GSUB 4Y5YA 1Z9OA 3T4AA 3BP6A 3F58L 2GTZB 4PRDB 1XR8A 3LKQA 5I8EA 1LO5B 1M7IA 1A9EB 4TOYL 3FQWB 4IHOA 3RZCD 5DT1H 1EO5A 4E41D 4GLRI 1M7IB 3VMPA 2WINB 1NUDA 5FECA 3X14B 2N7AA 4PJ9A 4NUJA 2VLKB 3NZHL 2AK1L 4APQB 5F7LB 4C56D 4CADB 3KPTA 4JPWL 5TDOB 3D25B 1WTGT 3QUXD 5C0RL 3ULUE 3R8QA 3RP1A 5GSVB 2IAND 3VG9C 2YUVA 4UQ2B 4EBQL 5C9KA 3PJSA 1X5IA 1AHWC 2ARJB 2QKIA 4XP6H 1BQLL 3KLSA 4YK4C 4KJYB 1S7XB 4M6ML 1KLUA 5FOBA 3TJHD 4PYGA 1BWWA 1HWHB 3Q3GA 5HGAB 3LS4L 3NFSH 2AEWA 4FFVD 3TLRA 1A1OA 5DMIH 1IGJA 1LP9B 1A0QL 1MCWW 5I1JL 1F3DH 1AGEB 1C08B 3HMXL 4FQXC 4PRDA 3GEWB 2P8PB 3MRLB 1FBIL 2ZCLH 4ENED 5HYJB 2R29H 1ZHLA 1CXKA 4GXUM 1O5DT 3MLRH 4U6VL 3VXSB 1VB9A 5C0AB 3RX5A 3MJ9H 1ZHKB 1C5BH 3RKDC 4P0DA 1FCGA 5DD5L 2H26A 4JVWA 2IQ9L 3OV6A 5F7DA 3CSBA 1X5KA 3CDCA 1LD9A 1TZGH 2DLHA 3IFOA 4KFZC 4K94H 1CBVH 3ULSB 5DJZB 3OMZA 5EU4B 4P46B 4AY0A 4UOW0 2DLFH 1GZQA 4R0LA 2A2QT 4FQXA 2XY1A 4HGWB 2D7PA 4O9HH 2HJLA 1NCDL 1D5BA 1YECH 4G9FB 3F12A 4RMWA 5LXGH 3PHQA 5EBGA 1OD9A 3KPQA 5HYJE 4JO1H 3QO1B 3HI1A 1I9IH 1CL7L 5A2JH 4DKEH 3NFNA 3CX2A 5MI0B 3BZEA 1KPRA 2VZTA 2AJSL 4XCNB 3HRZA 3LKSA 1R0AH 5ILTL 1VDGA 3HLAA 2EDWA 1U3HA 4E42B 5DO2C 1DEDA 5T1DH 5I8OH 5ICZB 5FO7B 1CICB 1KT2A 3T3PE 2CXKA 3ARGB 1DDHB 1T03L 2EC9U 4YHLH 5HI4D 1AXTL 4D9LH 2YA2A 1EEZA 2P5WE 1PVHA 4FA8A 5IM7A 1RMFH 4OAWA 4PR5A 1VEMA 8FABA 2F53E 1A6ZB 4V2CB 5JXED 2UWEE 3LQAH 3MLUH 3QNXA 4HKZA 5TH2A 2EYSB 1QFWL 3P0YL 3MRNA 2F5BL 2A74A 1U8MA 1BECA 3BE1H 4LVNB 1KCRL 5FM4A 3FQUB 1EH9A 2P4AB 2W9DL 1F3JA 2ZSVB 1GZPB 4G42A 3LPFA 2EC8A 3V2AR 1A6VL 1J5OL 2G60L 3ETBF 4X4YB 3BAEL 2MMXA 4XBGB 2VQTA 3WFCL 1CGUA 4BQBA 1PAMA 1MY5A 4OZ4A 1BOGA 4OTXL 5A43C 1HE7A 3DUUA 2YOCA 4RGOH 1AGDB 1NANH 1U95B 4KK6C 1C08A 2WP3T 4PJ8D 4PGBB 1JGDA 5F71A 3KPRA 4GRMA 1XIWB 5GGTH 3AS1A 4URTB 5DD0H 1NCBH 4H1LH 4JM2C 4XC1L 5E8NB 5C3LD 3IAQA 4MVBC 4OLXH 2WW8A 4HIXH 4JDVA 1Q38A 5L8JB 1RI8A 2JB6A 5DVOA 5ITFA 3RVWC 1KPUA 2YD1A 1LNUA 2P24A 1MHEB 2RFXB 2EEDA 1P1ZA 4UAOC 4PJIA 3GSOB 4QRSA 3OL2A 2CDEA 5C0IA 4IMKA 2I27N 3FFCA 1R3KA 4LLWB 2W0LA 2WWMC 5AWNL 5D2NA 1P84J 4Y4KB 3PL6C 2NY6B 4GKZA 1XF4A 4PBVC 3QI9D 4OCLC 4F80A 2MWCA 4UMGA 3DIFA 1PFCA 3DUSA 5T3XD 4NQXB 1E6JL 2I26N 2IAMC 5KAQF 1RY7B 5DJ6B 1DQJB 5DI8A 4F7EB 1R24B 5I1LA 3EYVA 3ARRA 5D1ZC 1BREA 1ETZB 5I2IA 3C60D 5CGYD 4DEPB 3HG1D 3VW3H 4MXVF 1FYTA 5B4MC 2HT2C 5SWQA 3SE4C 3W9DA 4UT6L 1A7BA 4L29A 1A3RH 1JGVL 3WUWG 4G42B 2GEEA 4NP4H 1U8OA 3FB8B 1TJGL 5TE6H 5FA4B 4J7RA 1T5XA 3QWRA 1U8OB 3IT8D 3L5XL 1QBML 5E6IC 2H1PL 4OZFA 1R3IL 3QUZB 4NBXB 1W72L 3IDXH 2Y72A 1A4JA 4KHTH 5BJTB 5BZDB 5J1TC 1L9NA 4PS4L 1T20A 4PY8J 5L88H 3OX8A 5FYLL 2EYTA 1YYMH 5EPMB 2NX5E 1YEGH 1N0XL 4XTRC 1ZSDA 4PUBL 3QCVL 4M62L 1EAPA 5ICZA 3VW3L 3CFDA 4X6CA 2I60H 2R9HD 5D96C 2D4FA 5DFVC 5JXEC 3LZFL 5MHSD 2C26A 4P23C 3JUYA 4LVOB 1UT9A 2OS7A 3QG7H 4QGYA 3PGFH 4J3TA 3G9AB 1RJZA 4HS6B 5GQBA 3BO8A 2A0LC 3DX6B 4XCFH 5I1IH 1J10A 1R5IA 2AXJA 1RZJL 3T0AA 4LLYB 4MD5B 3W0WB 4LCCA 5T1KB 3IDYC 3GBMH 3WN5A 2XKSA 5ISZE 2H41A 4YO0A 1GPOL 3MZGB 3NIFE 5BOPA 3RGHA 4PRHB 3ROLB 1QLRB 4JJ5A 5SWZD 1ULVA 4HMCA 1ZT7A 4N8CL 2CXGA 4H1LB 4MLIA 5F9WC 3LEYH 4JFEA 5F7EH 5GJTL 4WIQA 1UM4H 3PWVB 3UEZA 4GW1B 1OGAB 2AAVA 1RUQL 3CFBA 1MCLA 2E7MA 1D6EB 3WFBL 4C56A 4LLUA 3VXOA 4PJAE 3OQ3B 3FQXB 1GZPA 5TFSL 5HDQL 5FYKE 5FB8A 1H0DA 5GISL 1YDPB 2VWEE 3SDDD 4S1SL 4U2YA 1B0RA 2YPLA 3HR6A 4U6YA 1J0YA 1U58A 2OR8A 4JDVB 1KTRL 4OV6F 1SYSB 4U1HA 3GKZA 5D5MF 3ES6B 1TQCB 3OJMB 3T8XB 5LGKA 3MLZH 3KXFA 2VKWA 3DV4A 3NTCH 3OJDB 4JRYA 5C0FA 5IHBA 3P9LB 5EORH 3LV3B 3MSPA 1LQSR 4XCCH 3MGOB 1R5WB 1DLFH 3ARQA 1RZGB 2YN5A 4WUUA 4YEFA 3BQUB 1NJ9B 2Y25A 1B0GB 4ENEC 4XAKD 1DEEA 1WISA 4L1HA 1WLHA 4GSDL 1YNLL 1TVBB 3MCKB 4PJHA 1V7NL 1EZVX 3PXHA 1VENA 4ELME 3NFNB 4ZOAA 1KPVA 2XZZA 2WINA 1QFHA 4OCSH 2VDNH 1C5CL 3RY6C 2IBZX 4NKDB 2ENSA 4G8FB 5GZND 4Q9BA 5CP3A 3RTQD 1KN2L 3PXJA 3CFKA 3RJQB 1EFXB 5ECJE 5E1AB 3U2SB 1HKLH 1JYVA 1KIQA 4H1LA 3VFTA 2CO7B 2P8MA 5J6GB 4X4MA 1YEIH 5EC1A 3RI5F 4QHKI 1U41A 3V0VA 2OTUB 2Z9TA 2F5AH 4MA7H 5I76A 3UTSE 2QADC 3VFVB 4R2GD 2Y07L 3TYFB 4I0KA 1E4KC 1RZFH 2GAZA 3QXVA 1S9WB 4HDIA 5KSVA 4EN3D 3KYOA 4KXZI 4LLDB 4HZLB 1S9XA 3HS0B 4LP5A 25C8H 3JUZA 1S5IH 2DYPB 5FYJE 3D85D 5EU3A 5LVEA 4WI4A 3QNYA 1TJGH 4KPHL 2Y06L 3BW9A 5IOPB 1EERB 4ZO9A 1GAFH 4YHPA 2I9TA 1BZ7A 4RAVB 1DCLA 2P46B 1K5NA 2EIBA 4NFCA 2NW2B 4Z7UE 4K2UH 1EA9C 3CCHA 1CGYA 3FQXA 4IRJD 5EZIL 1MCPH 2IBGA 3KJ6H 3CLEL 4F7PB 4W6YB 2E9BA 3QAZC 2BXZA 4R7DA 1KJVA 1A02N 1U8HA 4NDMB 5DMGC 3AXLA 5D9SA 4AMKH 1X7QA 4KI5E 1ZMYA 1K6QH 4GW5A 4P46A 4XPGH 2APWA 4RSVA 2WLYA 3PDOA 4P2YA 4PJGF 5JR1L 3RY4A 4ZFZA 3FQRA 5F7DB 3VXME