4N68A

Crystal structure of an internal fn3 domain from human contactin-5 [psi-nysgrc-005804]
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
EPSAAPTDVKATSVSVSEILVAWKHIKESLGRPQGFEVGYWKDMEQEDTAETVKTRGNESFVILTGLEGNTLYHFTVRAYNGAGYGPPSSEVSATTKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Contactin-5
publication title Crystal structure of an internal FN3 domain from human Contactin-5 [PSI-NYSGRC-005804]
rcsb
source organism Homo sapiens
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n68A00
1CE1L 4I1NB 4NIKB 3WE6B 1SJEB 4XPGL 2JB5H 3GSWB 5KVFH 1XGRA 4X6DB 4DEPB 3IDIB 3EJYC 35C8L 4NQDA 2H2SD 1RI8A 1DEEA 4OGYL 4FZ8L 1UZ6F 3BVNB 4JAMB 4ORGB 4OZFG 3VH8G 2NW3B 4WU7A 3EZ8A 3I75A 3QBTB 1K9TA 2DD8L 1MJUH 3BI9X 4X6DF 3LS4L 1IAKB 2EDRA 2J8UE 2X05A 4TPRL 1BLNB 3MROA 3C60A 4YDLB 3ZYZA 4PGZA 5GGVY 3SY0A 5HPMB 3MV9E 4IRZL 4XNZB 3QEGL 4JRXA 2WWKT 4YO0A 3SKNB 1MLBA 1QO3A 2APTA 4O00A 5E08L 4W70A 3MRQA 3SBWA 1QPPA 4XX1G 4NN7B 5MEQA 1QBBA 3QDJD 3SDDA 4YHPA 1OAQH 2VISA 5EH1A 5HD8D 5JW3H 2WUCH 3VFTA 5D93B 4JO4H 2R69H 1DQQB 2ZNWA 4K7FA 4ODBD 4WFHE 3WXVH 1JRHI 1RZKC 3KR3L 5ICXA 1IMHC 1WVZA 4JRXD 3LH2L 1YNTB 3PGDA 5EO0B 1ORQB 4DWHA 5IQ7L 2FJFA 2YHGA 3T2NL 4LFHD 2Z31C 1KPVA 3SDDD 3LRSA 4E42B 1YDPA 2R9HC 2UY7A 3NIGF 3VXNA 3VCLA 5AZEH 1DP0A 5GPRA 2DQDL 4X98B 3K2UH 4G5ZL 4BSVA 1EJ6A 4B0MM 4TUJA 5DR5H 3ZHKA 4M7JL 4ZXBB 1YEIL 3BFOA 4XNMB 1QVOA 2V9QA 3PQYB 2W0LA 1CGYA 5DWUH 5HHOE 4Q9BA 4UIKH 2G2RA 3SCMC 4OBRA 5IG7B 4ZFFA 3WFDH 4U6HB 5I1IL 1I8IB 4F2MA 1QSFD 1C7TA 2VAAB 4ZFOL 4M61B 1OL0A 1T21B 2EKJA 3RWGA 4EUPA 5HPOA 4KHTL 5BV7C 4U0RC 1ZTXH 4FTVB 4OCLC 1FLRH 5HGDB 5I74B 5HYQA 5BVJB 4XNXL 4HWBH 4PRPA 4IDJH 5GISH 2FJGA 1OTSD 4KKCD 2H2SC 1X44A 2ESVA 5FOJA 3KYAA 1NMCC 2CH8A 4JFEE 1U8QB 4R7NA 4M48H 2XZZA 5B8CC 2WW8A 4U33A 3DVNB 4YZFE 1EXUA 3MGAA 3VXMA 4G9FE 3B43A 3MZTA 3QPXH 1GGBH 1UEMA 1ZSDB 4X4ZA 1A47A 4WJ5B 3DURA 5D96C 4AYFA 1MI5B 1F4XL 2ZUUA 1YEJH 4JO1H 1D5IL 1MOEA 3TWCH 4LSTH 4OFIA 2VDMH 2CRIA 4H0HB 5GGQH 4ZDHA 4LGSB 2JCCE 4R4FH 3ARSA 4KZDH 3C9NB 3C5ZA 5FUZH 2LE9A 3VDCA 1BHGA 2N7BA 4PD4K 3X14A 1J7VR 1T20B 4EIZC 5GGUA 4XGZB 3QIBD 1DUYB 5FYKU 3HUJB 2EZ0C 4LIQL 3M07A 4TSAH 1NGXA 3LV3A 3DSNA 3L3GB 3QIWA 1Z3GH 4ELKA 1CR9H 5I66B 4JRYD 4S10A 5L2JA 2HRLA 3HUJF 1C5CH 3TJHC 5HHVH 4M6MH 4KDVA 4LQ1A 3RFZC 3SBWC 1BQHG 1UM5L 3GHEH 4L1HA 2HG5A 4N0FB 3OKMA 3HE7D 3SDDC 4MXQD 2A1WL 1EX0A 3AY4A 3IFPA 2NX5B 3ARFA 3DMMB 4WWKA 1AXTH 1WAAA 4LPWA 4J3XA 1ERNA 4C56D 1RJCA 1OVZA 4PJCB 2ICEB 3PG2A 1P5VA 3GMLA 3QIWD 3HG1D 4K07A 3KLHD 4YX2H 2IGFH 4IMKA 3S5LA 1P7HL 4FQIH 3TFKD 1EFQA 5E2TL 1MNUH 1CD0A 4Z7OE 4C83A 1W0WA 1YY9C 4QYOA 3ARQA 1PEWA 5IMMA 1WCBB 4MHHG 4PJCF 2AAVA 1K6QH 1FP5A 5DJ2A 4K55A 3SGKA 1QBLH 2ICWI 5E2VL 4Y16D 1F6LL 4KJPD 1F4WH 4FXGB 4NN5B 4I2XE 1RIUL 2NY1D 4NQXA 3BDBA 4V1DA 2OM5A 2GSIA 3OJMB 3TP4A 4HC1A 3EYFB 4JDTH 1XGUB 5E2JA 2IBZX 5ECJE 1CTOA 4M8VA 4PJ8D 1ONQB 5D2LA 2R0WL 4KQ3H 5KSAB 4OZGE 1W0VA 3T0XA 4HH9B 5DJ8B 5EZOH 3ARBA 4FQCL 2MPAH 1UCBL 4PRHA 5I17B 2I27N 3T0WA 1IAOA 4JKWA 3DUSB 3G6JB 1J8HB 3MTRA 3GSNB 4I48B 1ED3A 3KPOA 2CJUH 3GMRB 5CINL 3L3OA 1KPUA 2APVA 1UXWB 2DWEB 3JWNC 3ARWA 5IKCA 4GS7C 5TH2A 4NZTL 3G6JF 4KXZI 3C2SA 4G6MH 5EOQH 1BVKA 2WP3T 3ARTA 4YIQA 4MDIA 5JR1H 5E00A 4FQ1L 5IJKC 2DWDB 1A6AB 2JTDA 3ARBD 3ARUA 4QRSB 1MJJA 1QQDA 1OD9A 5TDPA 1IBGL 1HXYB 4J12A 1QR4A 1X5JA 3DARA 3V6FB 1EBAA 2AEWA 3U30B 1QFUL 4NPYA 1I7RB 1L0QA 1SY6A 1ZVSB 5GRXG 5FA4B 1AQDB 1H5BB 5T3XE 2ZWLT 4BK4A 1Z0MA 2WMPA 1IEAA 2CRYA 5FYLD 4WI5A 5DEZA 5F7EL 3VI3F 3OXSA 1EFXD 1JYNA 1AGEA 4P4RA 4NKDB 2EH8L 5EO1A 4PJBF 3QIWC 3STLA 1ZLUH 1BREA 2E9WA 3TO2B 1ODAA 4CAGA 5J4MA 4HK3N 1JBJA 3O2DA 2I60H 3KPNA 4X6FA 1N6QH 1QEWA 3VFNA 5CS7A 1Y6KR 5DYOB 3MLZL 1QLFA 3ARRA 2WAHA 4X80H 2Z93A 3T1FB 4HDIA 1K4CB 1X5KA 3AM8A 3L3DB 5J3HD 3MSPA 3AY4C 3O6ML 4Y16C 1A1MB 5I2IB 4MNHB 1AY1L 2WBJD 4QT5A 5DT1H 4PJHA 5IJVA 2FO1A 4J23A 3LKOB 4HK0B 1XGQB 2H3NB 3A67L 2R15A 1DLFL 3GSOA 2NY7H 4B7IA 1VACB 4IMKC 2GY5A 4TYUA 3MFGB 1MJ8L 2XWBB 4GRMA 4U31A 5MI0C 1JFQH 1G6RL 3VU2A 2CLZA 3WIIH 3L3HA 3RBGA 2VUYA 3H9ZA 5CAYB 1NLDH 4YHLL 3S98A 1OT1A 1JWSB 4RMRA 1CICA 3FB6B 3DRTA 4U1JB 2GT9A 1YPZF 2QL1A 4JHBA 3BDYH 4TRPH 4Z9KB 3SGKC 3F7VA 3MA9L 5CD5D 3QFJE 5IMKA 5SX5H 4OLVH 4ZO9A 2AP2A 4JDZB 3RI5K 2C3GA 4FQHA 1U95B 4MYWB 2MQ3A 3CUPA 1F3JB 1BWMA 4E41A 3LN5B 3KG5A 3S88L 4WW2A 1SJHB 3O6LH 4M5YH 4E0RA 2MJWA 4CMMA 1VEOA 3MV7B 2NNAB 2B1HH 3ARBC 3UYPA 4N5EC 4R0LA 4YHZH 2Z92B 2MNUA 3QUMA 2BNRA 1MHPL 3H3KA 3VD7A 3BH9B 4U1NB 4XVSH 2MTPA 2DMCA 2XZQL 5SWZA 1PYWB 4PIRF 2DICA 3ZKNC 4H0GA 4PJAE 3GMMA 4KRNA 3ZYOA 4Z7WB 4G43A 5FM8A 4E41D 4WHCA 2DQGL 4M8QB 4DGVH 3JVGA 2FH8A 4I8DA 1AO7B 2OJEB 2UWEF 5CWSA 4P4KB 4KRLB 4RSVA 1UA6H 2DLIA 1RZFH 1RHHB 2DF3A 2XKUA 3P0GB 1EGJH 1DR9A 1DUZB 4FOMA 1PZUB 3F5WB 5CJQH 4PY8I 1AXSA 4HW6A 2BNRD 1DBBH 3BWAB 1YEKH 2YPLA 5HY9B 2B1AH 4YDIH 3HN3A 5E8DH 3QUYB 1VFBA 3BWUC 4XNQB 3PWNA 3VXOA 3QWOA 3MGOA 5J56B 2HJLB 3PABA 5JNYA 3OX8B 4XZUB 4YK4C 5LQBH 1EV2E 1ZGLA 4GAGH 3ROLB 5GRJH 2OK0H 1I75A 1FRGH 3D69A 1I8MB 5ID1B 5E8OB 1C16B 5IVZA 3QZWG 4PJFB 5BW7A 5I1KL 1FHGA 3VFUA 4EI5A 3T3ME 1XFPA 5IB3B 4Z7UA 1BZ9A 4WI7A 5GGTL 3REVB 1BFVH 4KJWC 5LWYH 1JGLL 2H6PA 1KB5B 2PTTB 1Q72H 4BH7A 1HNFA 4PJFF 2O26U 3ZSTA 3A0OA 3IFOB 1A6VH 2AQ1A 5GRUH 4Z78A 1IGFL 5EWIH 2GJ6D 4YHNA 3S3PA 4Z0XA 3RX5A 3AM8C 4X5XA 4Y4KB 1OCWH 1IL1A 5CD5C 1N5AA 1AC0A 1H3VA 5ICZA 1UZ8A 1EDQA 1JV5B 3HS0B 2FZ3A 4EI5D 3FQTA 4DGYL 3BT2H 3CX5J 1HINH 4ZSOB 1TDQA 2GAZA 1FYHB 1UC6A 5F1KC 3WUWA 3BKCL 2R29H 4U3CA 5D4QA 3OQ3B 1TPXC 2NW2A 2XXCB 5E6ID 4LRIA 2NYYC 2F54D 4P3CL 2CLVB 2FX8L 4R3SB 3A6CL 4KQ4H 4XI5D 1JPFA 4YXKH 3QFDB 1VFAB 4P2QB 1P4IL 4N1CA 4PJEB 2QADD 5J7CC 1M1SA 2GQHA 1ITBB 4MCZB 2GTWB 1AKJD 3MGTB 3LPFA 4L8DA 4WW2C 2CIKB 5K33A 2V2WA 2BFVH 4PJEF 5F8RC 4ETQA 5CEZL 4CDHA 5H37H 2FX7L 1VESA 2C26A 2DLHA 3OAUL 4WHTA 2R8SL 4R0LC 1G9NC 2VE6B 4FP8L 2CR3A 1S5HA 4IOIA 1JTOA 4G8GD 4G8EB 1TZIB 5EOCJ 1G0XA 2F5BL 2NXZB 3X12A 4PBXA 3C5SA 5GRVK 5C0DA 4YGVA 1U8KB 4YBLB 1LHZA 1LP9F 3WKML 2EICA 4NNYA 4R90L 3IAPA 2EE6A 4GKZB 4M93B 1AP2A 3UTQB 1E4WL 2J8OA 3JVGC 4Y1AB 3HMWH 4WEBH 4RMUA 1CLYL 1MWAB 4FFVD 1KLFA 3BIAX 4GUPB 1LK2A 3FB5B 4U6XB 1NEZG 3EO1A 3TNNB 3SDAA 4WW1A 3DBXA 5D1XA 1OGAB 1G7HA 3NFSH 5IBTH 4OLYH 4UT9L 1NFDA 2PYFB 4Q6YA 5T1DL 1JTPA 2F53A 1JZ5A 4PJIE 1EUTA 4LCCC 4PJ7A 2DQCL 1KEMH 2GW5A 4DK3A 4GQ9L 3DIFA 1GZQA 3DRQA 5GRYA 1KT2B 5C0JB 1RZGA 3WDJA 1MIMH 2XWJB 2HKFL 3INUH 5I1GL 3H7BA 1YEGL 1IEBB 3PJSA 4MAUH 1MCIA 4QRQB 3IFNH 5B21A 5BW7C 4YR6A 4DKEH 1BX2B 1A6WL 4S2SB 4EI5C 5B3JF 4NQCE 2H9GB 3D3VE 4OKVB 3VGAC 1KTDB 3ZDYF 3M1BB 5I1CL 3T77A 4O2FB 5BRZE 2EIZA 3SOBH 4H1LA 1OM3L 4M6AA 1YMMB 3V7AE 2J8UA 3RZCA 1CFSB 43C9B 4DKFH 4U1KA 3MV9A 3KS0J 1YY8A 2EYSB 4JG0L 2QADC 1XF2B 5T33H 3KPMA 5IB1A 1ZHNB 1RJZA 1N64H 3EYQD 3I3BA 1KN4H 3ULSA 2YC1B 5ALCL 3GBLA 1A6UH 1QHOA 2CK0L 3C5JA 3QPQD 4G3YH 4G6JL 4F57L 2X4PB 1F90L 4A6YH 4WI2A 4DQOH 3P73B 3IXTA 2B4CH 3OKEB 4YLQT 5T1LB 3MV9D 1UWEL 4O4YH 5DC4B 5MEND 4L4TD 3I85A 5C8JA 2DM7A 2E6JA 3VRIA 3H9SE 2BCKB 2BVYA 4XPTH 4FFWC 4FQJL 4QHLB 5FO8B 4LFHG 1K8DB 4PLJD 3O81A 5HBBA 3LRHA 3VDAA 3GB7B 3NIDF 5FAAA 4G80B 5L88H 2X4QA 1FNLA 1FVEB 3CDYA 4QNPF 1JNLH 4Z7NE 3WJJA 4WCYL 2DLFL 5SX4H 4NZJA 2IADA 4YDVB 1P7KB 4HKJA 3L3KA 4J3VA 2BNQE 2HLAB 5HHOA 2OL3L 1SYVB 3VFSA 4NQVB 4NSKB 1CGTA 2FO4A 1UADC 5GGRB 3HRPA 2IANB 1NGPL 5DMJB 1DDHA 5IBLC 2J4WH 3BP7B 5CBAB 5ERWB 4TVSa 1LO4L 1ZHBB 3MJ9A 5C09D 4HUXB 1WBYA 4M43H 3PWJB 4J4PA 1DQML 4JJ5A 5LBSL 3DVGB 3SDAC 3O3BB 4K3JH 2VLRD 3D39B 1SYSA 4N0CC 4QXUL 5HYJB 3R1GH 4KI5D 4JFEA 4LCIH 5HHOD 4Y88A 1I1AA 3MOBL 1YMHA 5I8EA 3O9WA 4WDIA 4G9FA 3SE4A 1LO5A 3L6FB 4X0KB 3T0EB 5FKPB 3TT1L 4PS4H 5F7YC 1KCVH 3NFPB 4GW4B 3MQIA 3AC0A 4XVUD 2I26N 5C71A 3CDCA 1JYWA 1QLRB 4J3SA 4G7VL 4TVPL 2M26A 3QO0B 3CVHL 4ZUTB 4NQDB 2ITCB 4J4PD 2KPNA 5E1HB 1HHGA 3AU1A 1I1YB 2JCCA 1WEJH 3EYSH 4RFEA 3UEZA 4X7SL 1G7MB 1NAMA 1P7QD 2R2HB 1UH2A 3ILQD 5TPWH 4RWYL 2P8LB 4HQQL 2HRPL 4WNQB 3C60B 4FQPA 3LMJL 1UB6A 2FEEL 3BPNB 3RZCC 3D5OF 1RUAH 1JGVL 1MLBB 1QO3B 3DYPA 4HPYH 2YR3A 3MNVA 4F8QA 1PZ5A 5JOEA 1BFSA 3MRQB 4TNVK 1MRDL 3G9VA 3FT3A 5IK3A 3NPSC 5JHLL 3ILPB 3IXAB 3QDAA 2VISB 4QRPE 3MUGB 3MBEA 4WHDA 4RNRB 4G7YL 4PLJC 1Y6NR 5EZJB 2AJUH 3FCTA 4U49A 2AJ3A 3I50H 5J6HB 1FO0H 1T83C 2X1QA 1S7VA 2AJXL 4HMEA 3WJLA 4I0PD 3ZE2F 4DZBB 5ICXB 4E9LA 3O45B 4UV7L 2ZUVA 1QP1A 3PGDB 4N90D 4HWUA 2DLEA 3GBNL 1V3KA 1HIMH 2FJFB 4NO2B 5FOBA 5I1HH 3Q1SH 5L9DH 2JJWA 4XXCA 1KPVB 1YDPB 4LARH 3OJDA 3B5HA 3ZLQC 2Y5TA 1RZ8A 2YSSA 1HHJA 3O2VL 3VCLB 1DSFH 4LDOB 3CLFH 3HI5L 4HCRL 3MMEB 4QHKJ 1ZANL 1YYLH 3MO1B 3V8CA 1AIFB 4TUJB 1VGEH 1S9KC 1QVOB 4I2XA 4NC0B 2PN5A 3D0VA 1HNGA 1RZIB 2EDTA 3DSFL 3MX0A 1FFNA 1RIVH 4PJGB 1CGSH 3BE1H 4ZFFB 4OZGA 3NA9H 1U8MB 1WTLA 1RUML 3K1DA 3EJZD 5D7JA 5F72S 5CBEB 1NAKL 5ICYB 5DJCA 2QEJA 4M6OH 2VNCA 4F9PA 4LSVL 5DHVH 2OI9C 4PJGF 5D9SA 2Z8WC 3O2WL 4CU7A 1CE1H 3MJ7A 2G9HA 4PRPB 1KJMB 1KGCE 4J4PC 1YEFL 3CSGA 2ESVB 3LZFL 4GG6E 35C8H 5BZDA 4R7NB 3U4EA 1DBMH 1CFVL 1FZKB 4FZ8H 2V5RA 1A3RL 1EXUB 4NO5A 3VXMB 1I1AC 5I30L 2DIBA 2DD8H 3OMZA 1PKQB 1SJXA 3MACL 1GH7A 4WO4D 5D7JD 4LF3A 3O9WC 3LS4H 3MLTA 4KTEL 5GJSL 3SE4C 4UT7H 4UU9B 3DURB 4TPRH 1Q9WB 4EZMA 3QQNA 1FCGA 5IVXF 4X4YA 2NY2B 1AXIB 2EE2A 1ZLUK 4AJ0A 1OP5H 1ZHKA 4BZYA 2YZ8A 4OIIL 4PP1C 1T0NB 2EDLA 5E7BA 1JUFA 3C5ZB 2IQ9L 3X14B 1S9YB 5J1AA 5DC9B 1UACH 3RU8L 1SM3L 2OTUA 4HJJH 1H15A 2VDOL 1NGXB 2UYLA 3MREA 2BMKB 1IC4H 5HHMD 2IBGA 4GSDH 4X99A 5BMFH 1PDKA 4XAKE 3QHTC 5HHPA 5L2JB 1HHKB 1BECA 3RNKB 4HSQA 5TF1H 2HN7B 4K23H 4S1SL 5FIEA 2JF1A 5IQ7H 2ENYA 1P84K 3WD5L 4XVJL 5B39A 2GSGA 4CW1B 3MBEC 3IFPB 4I13B 1IGCH 4MJ2A 2V2XB 3ARFB 4WWKB 5ESVB 1VFOA 4Q9QL 5SX5K 4FZEH 5DVKA 4KDTA 3N1GC 4DW2L 2DQDH 2NY4C 3WJLC 3BHBA 2F8VA 3IDGB 3PP4H 3WIHL 3S5LB 2EDOA 2R56H 3HAEH 3SN6N 3OF6D 2FWOA 5F7DA 5A2KH 2DJUA 1NCTA 5C0BD 1FN4B 3DX8A 2DDQL 3JWDL 1WZ1L 4ALAH 5IMMB 1MF2H 3EJZC 4XXCC 1NSNH 5DJ2B 5EUOE 3KJ4C 5C07E 1HHIA 2ZZUT 5I1IH 1EZVX 3ZHDA 5CJ8A 4LCUA 1KV3A 2XICA 5E5MA 5I18L 3QFJA 2YA0A 2CK2A 4ODXA 4FQLL 4HH8A 4AIZA 3ZE1E 1GYAA 1MPAL 4XNXH 1L0XA 1K85A 8FABB 5GS1B 5D2LB 2DQFB 4HWZB 1JNHA 1FGNL 1RURL 1CLZL 2VDPH 3WSQL 4IRJA 5DZNA 2X4TA 3LIZH 2FIRT 5D7JC 3MV8E 1G9EA 5DFWH 1J86A 4F9PC 4JFOB 4AEIL 2YWYA 4ZFZA 4X83A 5DURD 3QUKB 1WV7T 3FKUS 1ED3B 4Z7VE 4OM1H 1F4XH 1MJ7H 2XQBH 3L3OB 4CL7A 4PJAA 2OSLA 1D5IH 1B4JL 5IKCB 2AGJL 1T0PB 1FNGA 4PTUB 4X7EC 4X5WA 5FO9A 3TZVB 3ZE0E 3BPOB 3OAZH 1BVKB 4MDIB 5FF6B 4OTXL 1N4XL 1W72A 1R5WB 7FABL 2FSEA 2BVOA 4IRJD 5GGSB 4Z8FH 4JN2A 1J5OL 1BWWA 5SWQA 2DM2A 4WEMB 3KYKL 2V9RA 4OCWL 1KCUL 2HYMA 4DFHA 2GITA 3QI9A 1HDMB 2R1XB 3TYFA 3FQUA 4F7PA 1UM5H 5GIRB 2YUXA 3OXSB 4BKLB 1CK0H 2VLLA 3MNZB 4PB0L 1OAXL 2NPLX 4HKXA 3MRJB 4PYHA 3MLYH 3F7YA 4O5LH 3MA7B 1RZKL 1AGDB 2VQ1A 4ONFL 5J1SC 2UZXB 1BIIB 4AEHL 3DJ9A 4UDUB 4OCSL 1S5IL 4X7FC 5D71L 2Z93B 2XWTB 2HT2C 4HDIB 3L5HA 2ZUYA 5DFVC 3GGWA 2WIIA 4TUOA 2FBOJ 5KS9F 5FO7B 4MCYB 2MOVA 3MV11 5IJVB 3H3BC 4BFGA 4D9LH 1AGFB 5E2VH 2AXGB 4L3CA 4KDTC 5IW3A 2CKBB 5HYFA 2YD5A 4KU1A 1KXVC 3GSOB 1EZVY 3PDDA 1TJGL 4RMSA 3ULUH 2EYRB 3U0WL 1ROWA 1TJIL 2X4SB 4FMKA 2R0WH 3NOIA 3MPCA 1I7ZB 1JPSL 4O2EA 1CICB 3HZKB 4W6WB 1VPOL 2GT9B 4DTGH 2R1YA 4MSWA 4P5TD 4QTIL 5EU4B 3ZDZE 3SEPA 1HWHB 4HEME 3CUPB 5BV7L 1XF1A 3ULVF 5GSRA 1NGZA 1Z6JT 3IETA 1OQOA 5CINH 2KZWA 3IJHB 5E8EB 1FAIL 1EHNA 2UZIL 2JIXB 4OLZH 1LEKA 4AIOA 3G9AB 3I3DA 1I7UB 1X7QA 4XT1C 1A22B 3HI6H 4IRJC 3RVUD 3AS3A 3U79A 3MRRA 3CGTA 3CFJB 2VQTA 4IHOA 4K8RC 2CDFB 2X09A 5SWZB 1GZPA 3Q5YA 5HGAA 4P2RE 5CCKL 1KLUA 3GMMB 2VZ3A 5C9JB 5I1JL 4G43B 1V7ML 3B6SB 4Y8AA 1ZKAA 4MNQD 1CXFA 3TBWB 3UO1H 5GS0C 3LHPH 1WBXA 3ARDA 3NACL 5LVEA 1ND0B 3O8XD 3FN0H 1ORSA 3D0LB 2Q8AL 4YQXL 4ZPTA 5AWNL 3B9EA 4TULL 5DJ6B 1AXSB 2VXTL 5F7EH 2XQYG 4AQ1B 4GAYA 4XB8A 4EDXB 4H88L 1Q94A 2EH8H 1I3RA 2YPLB 1RU9L 1BBDL 2ZSWA 1YYML 1CE6A 4OZFB 4PJIA 1F3RB 3VH8B 1FDLL 3O0RL 3CSBA 2VL5A 2LAAA 1J10A 2YRLA 3L5IA 1CVSC 1U41A 1EPFA 3QI9C 2LU7A 3WS3A 1X5ZA 2NZ9C 3MLZH 3D69B 5FECB 3ARDD 4I4WB 1OP3H 1N5YH 4HHAA 2YPKA 5JDSB 4F15C 4M03A 1NDMA 1JHTA 4Z76A 4Y19B 3O6MH 3GIVB 1EH9A 4NQCA 1FFPA 3D3VA 5HHNA 4YHYB 3LQZA 3AS0A 3C6LA 4BH7B 1JHKL 3QAZC 3A67H 3HMXA 5BRZA 1R3LB 3HRZA 2PETA 1MJ8H 4JFZL 3GMNB 1U92A 3BAEH 1QRKA 5ESAA 4YHNB 4C55A 4Z0XB 3TT3H 4UDTA 4X5XB 3LDBB 3RJDA 1JI1A 2WZPD 3AVEA 5JDJA 2A9ML 4KRPD 5ICZB 1UZ8B 4HUUB 2AJZA 3BZDA 2FZ3B 1EHLH 4F9LA 1TIUA 2CKNA 2Y72A 3KPRE 5AYUL 3HE6A 2DQEL 1MHEB 1NUNB 2XZAH 1ZV5A 4NNXA 3WUWB 1AFVH 3O3DA 3WYRA 4QTHA 5JTWA 2L0DA 2P24A 4Z0BL 1NKOA 1KLGB 4L3EB 1YQVL 5H8DA 2E5EA 2VLJE 3TH4T 1JPFB 4MLIA 3I02A 2RBLA 1KSRA 1P4LB 2NY5C 1F2QA 3CXHJ 4KAQL 1RUPL 1T1XA 1MCFA 2XZQH 1X5YA 3UTOA 4LVEA 1YJDC 4Z6AT 1JPTL 3H9SA 4LCYB 5DJZA 4K94C 4L8DB 1Z5LB 3KPLA 4Q6IB 1DQTA 4ODWA 2OQJA 4GAFB 3LD8B 3OJVC 1BJMA 1TTUA 1H9VA 3EW3B 2DQIH 1X5HA 3MRMB 1FE8H 2ZCLH 4NM4L 4PRAA 4Q7DA 5EU6D 1HCFX 2VH5L 4HKZA 5D7LB 2LU3A 3GJFH 5IFHL 2BNQA 5SX4I 3QDMD 3RDTD 3IU4L 2W91A 2BOCA 4HK3J 1OLLA 1MCSA 1PY9A 1TMCB 3EDEA 2P4AB 4RZCA 4PJXE 3UTPD 1KELL 1D5ZA 3GI8L 3H9SD 4NZDA 1UH3A 4DGIL 3FN9A 2A6DB 4S0TD 2VDKH 5I9QC 3ARDC 5HHQB 2XTLA 1T7XA 3NFNA 3V2AR 1LK2B 5JA8B 2C4FT 5IUSA 1P4BL 3DBXB 5E2UH 2VJXA 1FVCA 5D1XB 4JKMA 5F7HA 1NFDB 4P99A 4IJ3C 4B50A 4NUGH 2BNQD 1JCKA 5JHDA 4MQSB 3NTCL 4F33B 4BFBD 1FNSL 3BP5A 1BAFL 1GGIH 5HYIA 4LAJH 2FHBA 3I3EA 1HOCA 1T03L 4A6YA 4KRPC 3U9PL 1F4HA 1XGPA 4KFZC 2K3TA 5J06A 3AREA 3MNWB 3VG9C 4HF5L 3T77B 5DK2A 4DGYH 3C6LC 1UZ6E 3G5XB 4LEXH 5J6GB 3V4UL 3QDGB 5F96L 3BKCH 4HPOH 1B6UA 2J8UB 3MRCA 5JHDD 5CJOL 3BRDA 4X6DE 4G9DB 3KDMB 5JQ6H 1VFMA 2B7DT 4U1KB 5DJYB 2DI8A 5HI4C 4GW1B 4P3CH 4UINL 2LU4A 5C2UB 3G5VB 2JK5A 3U0TA 1EO8L 5DEFB 3KPMB 5IB1B 1RUKH 5JA9A 2Q86B 3BP6B 1O7VA 4OQTL 1D5MA 1P4IH 4YE4L 5E8PA 4F9LC 4YC2B 1WFOA 4UNTA 4QRPA 3CH8A 4MXWH 1SQ2N 4PV9B 15C8H 4HC1L 3O6FA 4XTRD 2X2YA 3HPLB 3QG6A 4ZAKD 5F7FA 1AHWB 2WLYA 5CEZH 1M4KA 2FECI 3UTTE 2FX7H 4LMQI 2FD6L 5IEKA 3OAUH 4XXDB 2R8SH 4FXKB 1E6JH 2AK4D 2NY6D 4GMSL 3RDTC 4K9EC 5HSFA 4YPGA 5DRXA 4PGBB 5KN5B 1KN2H 1TNMA 4JQIH 5L2KE 4WTXA 3BQUD 4NFCA 2R1WB 2F5BH 4OI7A 1S9VA 5I75C 4Q2ZB 4NHUA 1QNZL 3VD5A 1T5WB 2V5TA 4QRPD 5L0QC 1JGUH 3NZHH 3SKJL 1BZQK 4GKOA 4R90H 5CEYB 3QUXD 3VA6A 3FQWB 5IMLA 1E4WH 2MHAB 5T5FH 1R3IH 4XHJC 5FYLL 4PGEA 3HZVA 3NIGE 5FKAA 4Q0XH 1KIQA 2P5WB 5T1KD 4C54A 1FAKT 3L3KB 4HKJB 4LSUL 4AIXA 5C08E 3DHMA 2AKRB 4JZJB 2MFNA 3FQRB 2X89D 1I8KB 4NBYB 1N2RB 5DDHB 4YEFA 4AY0A 2DQCH 3O4OC 3KYMA 4U7KA 1DDHB 1BFOA 3RNQA 1A0QH 3SKMB 4OAWA 1SY6L 3V6ZA 2DTSA 1RSFA 1D5BA 5FYJH 3DUUA 2BJMH 3PQYE 1S7WA 3UC0H 5D70L 5I1GH 1K3ZA 4JJ5B 1KUMA 1CBVL 4D0DB 3N9GH 1OP5K 4RISH 1IZKA 1XCTB 2AJSL 1A6WH 4GG6A 4ZS7L 4JFEB 3LKQA 3C09B 2IH1A 2VR5A 5I1CH 3QXWA 4FXLA 4NJ9H 4DCQA 3O9WB 3HB3D 2Z4QA 2X40A 4FTVE 1LO5B 3FMGL 3O2DL 5TQ0L 1OM3H 3TJEL 2EO1A 4XPAH 3SDXB 1OAZH 1FO0A 4HXAH 3CFDB 4NQTA 2OX5A 2BSRA 2E9BA 1KJVA 1YN6B 1FH5H 2Z91A 1NC4D 1CF8H 2B4CC 1EAPB 1HHHA 5DD3H 4OIAA 3AREC 1PX3A 4RFEB 5EU5B 3SDXF 1WITA 1KEGL 4ODVH 1NAMB 4R8WL 5INCB 5ALCH 1FVDB 3LKRA 2J2ZA 1ZA6A 1KBGL 3Q0HA 4HGMA 4ZAKC 1BQLL 2ZJSH 1B9ZA 2A6IB 2CK0H 4QCIB 4WUKL 4F57H 3SDYL 2NY0D 3LN4B 2FL5A 4HS6B 1EHAA 3VGDA 1DQDL 1OGTA 1PZ5B 5BO1L 2HH0L 2NY6C 3JV6A 3THML 5IK3B 1KIPB 4ZFGH 1CVRA 4LKCB 3G5YA 4PBWD 5DS8B 4ZUSA 1JPST 2D4DA 3HUJE 3MBEB 2GI7A 1KTLB 1XZ0A 2B0SH 3GMQA 4GBXA 1I3GL 4MJIB 1MY7A 3GSNH 2XNAA 3G04A 4RGMC 1S7VB 3O6FC 2D7OA 5JPNA 1A6ZA 1KG0A 1ETZA 3MUHL 1CTNA 5LAXA 2EKSA 4WCYH 2DLFH 2DOCA 5FOBB 1CT8B 1G9NL 3QUML 4XAKD 2A6JA 3ZT5A 5KSUB 4JZOA 3UJTL 1INDH 1G7JB 5F6IC 4RAHA 3KJ4B 2Y06L 3MJGX 4JGMA 2KBGA 4K3GA 2EYTA 2Y5TB 1REIA 6CGTA 2K7PA 5EUOA 2X9YA 5C07A 4KMTL 3OKYA 4PJCE 1KCSH 1O0VA 2EO9A 4HIIA 1F42A 3GMOA 1DBKH 1FFOA 4EVNA 5MP6L 4E5XB 1LO4H 3D0VB 1KYOJ 1T4KB 4OCNC 1HH9B 4ZTPH 4ZTOL 3X11B 1A7BA 4OZGB 3OAZK 4FQQA 3ZKXB 1OPGH 5E1AB 5DJCB 4EDWL 4NUJA 4B7LA 3S6CA 5F9JA 3RGVB 4WI3A 3MV8A 5C07D 3TBSA 1J1OL 2XYCA 3HPJA 2UV3A 4H25A 2G9HB 3WS6A 3Q5OA 4HT1H 4Z7VA 4PTTA 2OP4L 4WUUE 5KANI 4G7VH 4TVPH 1GSMA 4X9IA 4LRNL 3JV4B 1JWMA 4X7SH 1P1ZA 3G6JE 5GSVA 3L95A 1P2CB 4YHMH 4HQQH 2HRPH 3Q6GL 2NY0C 3PV6A 4X4YB 3LMJH 4P9ML 2PCPA 5H35B 4ZNEE 1A4KB 4LLWA 5C0GB 5H2BB 4FABH 3P11L 2HJFB 2VABB 1JUFB 3HAEA 4NWUH 4FFZL 3UJJL 4IRSB 2IALB 3GEWB 2BY0A 4P2OA 3VRLF 1M7DB 2Y9RT 1KF9B 4N0UE 4QF1A 3E6FB 1NJ9A 1RJLB 5TE6L 4X6BA 4LPYA 1RK1A 3M45A 3BYYA 3WL9B 1R3HA 5IT2L 1VERA 4JM2A 4X9GA 3W81A 4ZUVA 4X99B 2D31A 3VI3E 3DNKA 5FGRA 4QOKA 2I9TB 4XCCH 1CI5A 4QO1A 2O5YL 2WINB 5FCUL 1DANT 4PJBE 1ZMYA 3LKPA 3SE8L 4UV7H 5IW6B 1IGJA 2IH3A 2V5MA 3GBNH 1QTYT 2F58H 4XBPB 5EOTA 1PW3A 3C8KA 1MRFL 2A73B 1JIBA 3CVIH 3IJYB 3SKOA 4KTDL 1UKQA 4D9QE 5F7MC 4HIEA 1BVLB 1BFTA 5FB8A 3O2VH 1RK0A 4JN1L 3HI5H 1U93A 1XF3A 1MCBA 5EN2A 3BHBB 5KSBB 2P48B 4N9GB 1FJ1A 5GRZA 1K5NB 1INQB 1T2XA 4OZ4A 5KTEL 2IJ0C 4QOKD 3W0WD 1Q0XL 1KCRH 1SMAA 4BQ6A 3DSFH 3DX8B 3RY5A 5DJXA 2W9DL 3RVWC 3QDHA 5C9KA 4KRMB 1N8ZB 3SDCA 2WP3O 5KSBF 2XY1A 3FRUA 4ONOA 3V95A 2PO6B 1RUMH 1P6AB 4DN4L 1LO0L 3FRPA 5JOFA 5E5MB 4OCYH 1OTUC 4ORZC 3S35X 3QFJB 1JF1A 1U8PB 4AIZB 4R4BB 5GXBB 3FT4A 3FHAA 2CLRB 1YPZE 3O2WH 2YEZA 5JZ7C 4OV5B 4U1HB 3GK8L 1TJHL 2C7UA 3O6KL 4BUGA 2Y07H 3ESUF 1YEFH 2AI0L 2VLKB 1VEMA 1MVUB 4CN1A 3DTXA 1EIBA 3EHBD 3U6RB 3GSUA 4W68A 1CFVH 4AH2A 1PSKL 1A3RH 1UXSA 4EI6B 5E56A 1MFBL 5I30H 4YXLH 5CUSL 3MACH 4NZUH 3M8OH 1KB5H 4KTEH 1JE6A 4S1RL 1FYTD 1NEZB 1T22A 4P2RA 3JZ7A 3PHOB 3WS6C 4G6FB 4PJAB 2OSLB 2FCBA 4RX4A 2OR8A 1FNGB 5FO9B 2C3XA 3MV7E 4OIIH 4W81A 1WSST 2X10A 1OSPH 2BVPA 4MAYA 1Y18A 4NWTH 3BUYA 1OAUL 4AM0B 2BVOB 3AXLA 1OP3K 4I3RH 3RWIB 2ID5A 3RU8H 2UWEE 3TBVA 3V0WL 3QJHB 4IIQB 5DUML 5C0RL 1KTKE 1ZT4A 3NPZB 3ET9F 5IFJA 3HNTL 2FBJL 5ANME 4H20L 3KLSA 4U6TA 3TYFB 3B3IB 5C2BH 3FQUB 4NRXA 3T65B 4F7PB 2YMXL 5I1EH 3VW3H 4P2OC 3WD5H 4XVJH 3U9UB 5SWSE 4YDJB 4EIGB 2VERN 1Z9OA 1MIEH 4GT7A 4J1UA 1I9JH 4NJAL 4JM2C 3BRGC 1UJ3A 4MZ2A 5IVOA 5ITBL 3WIHH 5AAWA 4P23A 1JGEA 3SGJA 4NHCH 2VQ1B 3KYOA 1BD2D 4NQSA 3L5XL 4UT6L 4MWFA 4OIBA 3ULUD 2DDQH 4F7TB 1WZ1H 5LKNA 3GGWB 4PJFE 4JY4A 4H8WC 4JANB 4DFIA 3JUZA 4CMHB 3QUZA 2WIIB 5FUOL 1MCPL 4R96A 5GRVL 4TTDD 4CN6A 4XP1L 3QEHA 1A7NH 1YQ2A 3KPRA 5C3LD 1K8IA 5D7IB 1MWAH 3NCYP 1Z9MA 3P77B 3V5KB 3I6KA 3VXQA 1KTRL 2JB5L 4JVPA 4FG6D 5EC2A 3SDCC 5AUMB 2FH6A 5D7IF 2HVKB 1RURH 2AV1A 2VLJA 3RKPA 25C8L 4PR5A 2O61B 3QUZD 2OXGA 2CPCA 3MRBB 4MSWB 3FO2B 1MJUL 1CDUA 4RWHA 2D0FA 4AEIH 3GJFK 1J0IA 1NGZB 2CXGA 4JO3H 2ERJB 2EXYD 1QFWH 1FNAA 4U2ZA 1BQSA 2ADJB 3KPRD 3I6LD 3MJ9L 2B39A 1U8IB 3U83A 1NCBL 2AGJH 4GW5A 1LEKB 2K1MA 1X7QB 2E7LA 4QRRD 3ZSSA 2CIIA 1Y0LA 2VOTA 1N4XH 2YWZA 3LN9A 4P2QE 4LP4A 4PJEE 3CFCH 3MRRB 7FABH 2EDNA 4GKNB 2VMFA 5J9PA 2VLJD 1DN0A 1GZPB 5HGAB 1KLUB 2WUCL 3QULA 5LJYH 1OF2A 3MRKA 4PFEA 4JO4L 2R69L 4P46A 3MUZ1 3KYKH 1RV6X 2DBLH 4K71C 3TVMA 1GXEA 1KCUH 3FZUC 4YWGL 3L7EB 2DMKA 2EC9T 4PJXA 1XEDA 1UWGH 4LQFL 1WBXB 1DLHA 3UYRH 5D6CA 1U9KA 4PGJA 2Q8BH 2EXWD 1JK8B 2XFXB 4AL8H 1LP9E 2AXJA 2ZG2A 3L3JA 2NXYD 4MAYC 2UY6A 3MCG1 1DTUA 4CVUA 5F1OB 4JR9H 5B3NA 1S9WA 3FFCE 4N8VA 3RHWK 1IEHA 5F6HJ 1PAMA 4IJ3B 1I3RB 4OFDA 5KBNC 5DUBA 4PJIB 1U3JA 5CLWA 2VL5B 1SVCP 5AZEL 3K2UL 1S3KH 2XN9D 4QXGL 3TVMD 1TXKA 1LO2L 3RKDD 4EN3A 1QR1A 3VWKB 1RZKH 5HI3C 3BZEA 4LLYB 3C2AH 1CXIA 3RVVC 3TIDB 4OCSH 4XP5L 1RZ7H 2HVJA 3QIBB 3L9RA 5BS0D 3QG7L 5DWUL 3WHXA 4TTDC 4UIKL 5DTFA 4OB5H 4C57C 3WFDL 4Z95L 5HGBA 3VMOA 1FFPB 3D3VB 3LQZB 3C6LB 3NBNA 4LNRB 5B3JE 5BRZB 3F62A 4P23C 3SGJC 4NN6C 4FG6C 3ZDYE 4Z77B 1U92B 1I9RL 4HWBL 3NIFF 5GISL 1WUNT 3HE7B 3VD4A 4EN3D 5EIVA 1SJEA 3GSWA 1NUFA 4X6DA 3IDIA 1T6VN 4NO3B 4X6EB 5DK3A 3QUZC 4N0YH 1EMTH 1JPSH 1CGXA 1PG7W 4C56B 3OB0H 3O4LE 3BVNA 1HSAB 2FX9H 4JAMA 1ZEAH 4ORGA 4LOUC 5IIEB 3HE6B 3GSVB 3HG1B 5L6YL 1GGBL 4B5EA 1YMME 1IAKA 3GIZH 4PJ5D 3RQ3A 3UDWC 2P24B 1Q0YL 1BIHA 3UCRA 2ADGA 2EDDA 5EZLA 3HA0A 4JO1L 5HPMA 2ZUQB 3R06B 3TWCL 3VDBA 2VDML 2VTFA 1MAJA 1SJVA 1F8TL 4R4FL 3UTTA 4KZDL 1TVBA 4YAQB 3CXDH 2Z8RA 4R2GC 3QXTA 5EBWA 2NY1B 1OP9A 3I9GH 3PUCA 5CCKH 4F37F 5L2KA 1DQQA 5I1JH 4ODWB 4PJ8B 2OQJB 5FYKE 1AGCA 3BW9A 3KLDA 3QEQD 4OFVA 1JF6A 2EXWC 1CR9L 1EUUA 2HLFC 3RIFF 5I1LB 3NACH 2E7LC 2VB5A 5HHVL 1H3XA 3NIDE 4YQXH 4YNYA 5EO0A 1ORQA 1P69B 5AWNH 1MFAL 4TULH 4QNPE 2VXTH 4PJDF 5C08A 3MLPA 4HZLB 4ODHH 3C8DA 4P46C 4RZCB 4E42A 1RU9H 3P9LB 4JFPB 1QSZA 1YYMH 2IG2H 4OCMC 3TVMC 3RKDC 3FB8A 4WV1B 1FDLH 3O0RH 2HT3D 4ZQKA 4X98A 3T0DA 3OKDA 4YX2L 3NFNB 2IGFL 3EDDA 4ZXBA 4XNMA 3QHZH 3TA3D 1MNUL 4ENED 5T3XL 3PQYA 4LLUB 3U7WH 4OF3A 2DLGA 4PRIE 2QQNL 4P5MB 3V4PH 2UVEA 4U6HA 1I8IA 3MRHB 1EK3A 2IANE 5JQHC 1FLTX 1JHKH 2VAAA 3MBXH 4WFGE 4M61A 1LD9B 1LNUA 1T21A 3NABH 4D0CB 4EN3C 4FTVA 1KJ3H 1Q9OB 3F65A 1T1WB 1TQBB 5HGDA 3N1PC 4JDTL 5LXGH 4UOJA 4KKAD 4JFZH 5BVJA 3AS2A 2GJZB 3DROA 1BM3H 4OF5A 4ZXBD 3D39E 4MS8D 2A9MH 3PQYD 4V2BA 2JKXA 3AREB 1LEGA 1U8QA 3WFZA 2MPAL 1TQCB 3S8WA 3GSQB 4P48A 4PB9L 4RGOL 3DVNA 5DK2B 4R9HA 3KJ6H 3E2HB 5JOPE 2CUHA 4MZ3A 1ZSDA 3T0EE 5IGXH 3MRCB 3TN0A 2DQTL 2CJUL 1CFQB 1YQVH 4DEPC 3WHE0 3NCJL 3U0TB 3G08A 2WBJB 4G6ML 5EOQL 2NY3B 3EO0A 5CEZD 3RA7H 3S36H 3C9NA 3QQ4A 5E8PB 5JR1L 1FC2D 4KAQH 4EUPH 3VMPA 3JSSA 1DUYA 3DX9B 3HUJA 3WO3B 2N56A 2V2TB 4G8IB 3L3GA 2X4OB 4YDLC 1NL0L 4ESKA 4S1DD 4XNZC 1MI5D 4HJ0D 4NM4H 1INEL 3PWPD 1N0XL 4NOBA 5BVPH 1YNKL 3TNMB 2HTLD 1KIUA 1MELA 4KY1H 4UAOB 1A2YB 4NN7C 5JW4Q 3MJ6A 4WIQA 4K8RL 3ZE2E 1CLCA 4N0FA 1A7RL 5AG9A 4QEGA 1R5VB 1K4DA 1TVDA 4IDLA 3IU4H 5D93C 2Z9TA 3OXRA 1HKLL 3DMMA 2HT3C 4HUVB 4XMKL 4DKDC 4HLZH 3GI8H 5IMLB 2WQ8A 4PJCA 2I60L 5C7XL 4ENEC 3JTSA 1K3IA 1U8LB 2YD2A 4JDVB 1W72L 4HFWB 5FYJD 2FGWH 2HTKD 1HYSC 4LHUD 1CXHA 3OZ9L 1WCBA 4UUJA 1VADB 4LIQE 3O3UN 4JJHA 2ZOKB 5SV3A 5DT1L 4PG2A 3RNQB 5JXEA 3D85D 2ORBH 2NX5D 3V6ZB 4FN0A 3HR5A 4DKAA 2FHFA 1FNSH 4KKAC 2D0GA 1I3VA 3DUUB 3QNZB 2NY7L 4ZXBC 3DXAB 3R8BB 1T03H 1JFQL 2HFTA 4PJGE 5GZNC 2I24N 3WIIL 3STBA 3U9PH 1ONQA 1NLDL 4WUUA 5KSAA 1HWGB 5C6PB 1OSZB 3LKQB 4HH9A 5DJ8A 1RIHH 3IF1B 4LDEB 5DQ9B 4DCQB 5IROA 2Z4QB 3EAKA 4PREB 2D7PA 1N3NB 5MEPB 4OI8A 3G6JA 3TLRA 3GSNA 3LPWA 5F96H 5CJOH 2IPKB 2BSRB 1KJVB 3BKML 4ZNEA 2I9LB 1NBZB 1UXWA 1FGVL 1EO8H 2ZOLB 4LLDB 1D6VH 2B1HL 5IVXE 3T2OA 3A6OA 4RRPA 3BDXA 1PKQE 3EYOB 3LKRB 4N0UA 4WFFD 3WBDA 1A6AA 3MOQA 4OKDA 5IHZB 3TN0C 4HC1H 1T7WA 1MCWM 4J8RB 3WLWD 4PG9B 3V6FA 4PJ9D 5EBLA 1J8HD 2P8MB 2XTJD 2FL5B 3C8HA 1OGTB 4DGVL 5ILTH 2HTLC 4BUHA 2FD6H 4YFDB 1AQDA 1UA6L 2VZ1A 4PJBA 1RZFL 1H5BA 2F5AH 1RMFL 4GMSH 4ZUSB 5CJQL 1Q1JL 2QKIA 4UQ3A 4GBXB 1YJDL 4NKDA 2FEDD 1DBBL 4K94L 3TGXA 5E6IB 2MCG1 3LKSB 3BXNB 1SEBB 3SKJH 2H26B 3TO2A 1HQ4A 2A9NH 2HFGL 2W65B 5F70A 2X7LB 1PG7H 1CDHA 4X4XA 5DYOA 4GAGL 2OK0L 5DQJB 4LSUH 1FRGL 5GZOD 4JZOB 4PRNB 1A1NA 4MB4A 5JW4R 1WZLA 3T1FA 3L3DA 4LVHB 3HC0A 2EYTB 2P5EE 5EUOB 3DMMC 1A1MA 5I2IA 5AD0A 1UWXH 1BFVL 5J13B 5LWYL 1SY6H 3LKOA 4HK0A 1XGQA 5HTSA 2H3NA 3FTGB 4WEUD 1FFOB 4DZ8B 1VACA 1YPZA 1A6VL 1Q38A 5D70H 2XWBA 5A2JH 3BH8B 4G8GB 1U3HD 3QHFH 3FB7A 2HFEB 3GNML 3S35L 2AJSH 5KANG 2X1OA 5CD3A 5F44A 1PGRB 3CX2A 3FB6A 4U1JA 3VXTB 2CDGA 4UIMB 5JUEL 5F9JB 32C2B 4PG2C 5JXEC 3BT2L 1T2QL 4JDZA 3TBSB 4FQXA 2OR9H 3TJEH 1U95A 1AGBB 4NN5C 4ZPVB 4JY5L 1F3JA 2E7HA 1U8NB 1O7SA 3LN5A 4F7EB 2R29L 2OR7A 5IHLB 1SJHA 1G7PB 4W4NA 4KVCL 4GRLB 1QKZL 1CL7L 3HHRB 5KSAC 4K3EL 3MV7A 4KQ4L 1JWMB 2QQLH 2Z92A 1KEGH 4ZG1A 5F9DC 5IROC 4K7PH 5E99H 5F71A 1KBGH 3BH9A 5AYQA 1G0DA 2ZSVA 2PYEB 2CKBH 4U1NA 2UWEA 3PV6B 5DLMH 3JBG7 4WUKH 4MJ4A 2H1PH 2YXFA 2BFVL 3EDFA 1DQDH 3DI3B 4M8QA 4YGAB 5HVGB 2HH0H 2OJEA 5ANMA 3WO4C 4P2OB 4P4KA 4QY8B 2UVFA 4L29B 1RHHA 3ROOB 1DUZA 2NQCA 1NJ9B 3MV7D 1G9MC 2FEDC 4CVZB 3FOLA 4X6BB 3S97C 5KZCB 1I3GH 5SWSA 3P9MB 1NPUA 1VA9A 3BWAA 4JM2B 3WIFB 2JELH 4ZUVB 2D31B 3VG0H 2A83B 5HY9A 3QUYA 1WTGT 3U30C 5JPMB 4XNQA 5DD5L 1T5XB 2OCFD 5F3HB 4WEBL 3UBXA 5I6XB 3VWJB 3CZFB 3OX8A 4XZUA 1HYRC 5DD0H 2IH3B 5FK9B 3C8KB 1H5BC 4LBEA 5CIPB 1G9NH 3ROLA 3R0MA 4K9EL 1AO7D 4HG4K 1I8MA 5ID1A 5DA4A 4RQQA 4PJFA 3LQAH 4OLYL 1R24B 5FB8B 5IB3A 1RK0B 2D4FA 4OD3H 4KMTH 5EBMB 1T1ZB 4JKPL 1KEML 5EN2B 3REVA 1NBQA 1XGTA 2I07B 2PTTA 5F7WC 5KS9E 3V5DA 3MUY1 1CDCA 5I0ZA 1L7TH 3LVEA 3QUYD 5DJDB 5EO9A 1E28A 5MENB 2IAMD 5DSCB 4K2UH 5DJXB 3KVQA 4G42B 3SDCB 3IFNL 1U3ZA 4Y4KA 2PUQT 4DKEL 1KYOK 1OQXA 1HKFA 2EE3A 4TN9A 4XVTL 6FABL 1W2KT 3N0PB 3HS0A 4GXVL 1JF1B 5AG8A 2IMMA 3MYZA 1J87A 2VZSA 3SOBL 5A43C 5F3BB 4NBXB 2YEZB 1LO3L 4RAVB 1UYWH 1CLOH 4X5LA 3ULVE 4DKFL 1QFWI 2BRRH 4U3HA 1FIEA 5D2NB 1P9MA 2CLVA 2ADFH 1L7IH 4H5SA 4R3SA 4JGUA 1HCVA 3FFDB 3IS0X 1MFCL 4NRZB 1N64L 3GDBA 3AGVA 1VDGA 1VFAA 4P2QA 4PJEA 4NQUA 1JN6A 4FQXC 2QSCL 5KG9B 3VRJB 4AG4L 2J1KA 4MCZA 1A6UL 2G5BB 5C09B 4P2RB 2YOCA 2GTWA 5TGBB 1KXQE 4G3YL 1CDGA 3MGTA 3O3EB 3VGGA 1DE4B 4A6YL 2VLRB 1D6EB 3S4SG 4MVBD 3X3FL 1XR9A 2B4CL 3UJJH 4JLRB 3BD3A 4ISVB 2HP4A 5CZVH 1NLBH 4Q58C 3PHQB 3AXLB 1LP9A 1MCQA 1FNHA 3H7LA 3TBVB 3FFCA 4G8EA 5TE6H 1TZIA 4KI5F 4P2QD 4XPTL 5CJXA 5CMAB 4C4KT 5IFJB 4Y4FD 1U8KA 5L88L 2QSTA 4GKZA 3BJLA 3TH3T 3SE8H 1MWAA 1FZOA 4NRXB 1MFNA 4WFEE 4Q9CA 5M94B 1A6TB 4P4KC 1NC2D 1P7QB 1QZ1A 4GUPA 3FB5A 4U1SB 5E8NA 5C0EA 4U6XA 5KVDH 5ACZA 3TNNA 3QWQB 2GK2A 4JFDE 4J1UB 3ZTJG 1S9XB 4P3DA 2PYFA 3OB0K 5B38G 3QO1B 4JN1H 2YK1H 5IBUG 1UJ3B 3H9HB 4TQEL 5E24E 2NXZD 3QUYC 3WMSA 2IBBA 2J4WL 5C0JA 1QBAA 1KT2A 5HGHB 5ABDE 3T0AA 1BGXL 1RUQH 1X5GA 5KVEL 2XWJA 4MWFB 4M43L 4QHUB 5K93A 2HMID 2W9DH 4Y1AD 1IEBA 4JY4B 3HKFA 1WFNA 4KROB 4QRQA 4Y19E 2XA3A 1VGKA 3R1GL 1EERB 2H9GA 4OKVA 1FZJB 4LCIL 1LO0H 1KTDA 3KPSE 3QEHB 3O4LA 1OGAD 4I0PB 4XX1E 3VD3A 1HH6B 3M1BA 4L5FH 3Q48A 3HI1A 4O2FA 1K8IB 1JZ2A 3I2CH 5F8QC 4WWID 1YMMA 2Q1EA 4PS4L 2LFGA 3RVTD 1KCVL 3GK8H 3VXQB 3IJSB 5HI5C 3O6KH 1IKFL 1T7YA 1IARB 1ADQA 43C9A 2YA1A 4HGKC 1FIGL 4JFXB 5MEOB 4Y4KC 3RUGF 1JNNL 1PSKH 1XF2A 2HA1A 1ZHNA 1WEJL 3EYSL 4LVNB 4GG8B 1MFBH 1AR2A 1G7IA 4S1RH 4ZOEA 1G7QB 4L4VE 2DQHL 3LOWA 4L3EE 4MVBC 2X4PA 5DK0B 1RUAL 3VGBA 1Y6MR 5F7NC 3CFEB 4HPYL 3P73A 4L8CB 1N59B 1P9MC 2CIIB 3OKEA 5T1LA 4LCWB 4X8JA 5E4EB 5JW4M 1A9BB 3CLEL 1T3FB 4JKKA 1XF4B 3QULB 3MRKB 1ULVA 2BCKA 1BOYA 5DUMH 2FECL 1FO0L 1K8DA 2WLZA 3ZT6A 3L5WB 3HNTH 4PYGA 4BFEA 4G80A 1FVEA 2ZUSA 2GIYA 4GMTL 1HIML 4WO4B 4N8VB 1II4E 3Q1SL 5D7LE 3WXWL 1CXLA 1P7KA 3HC3H 3NCFB 5I1HL 3MR9B 1CQKA 3BZFB 1OAYH 2G60L 5KW9H 1PQZA 4LARL 5CJXC 2FJHB 2FNBA 4PRIA 4RMWA 5EU3B 5I8CB 1SYVA 2NXZC 4NJAH 4NQVA 2RFXB 1DSFL 3CLFL 1WLHA 5GGRA 1TENA 2R9HD 2IANA 4APQA 4WHYG 2FYYA 4M93C 3NA4A 4DJMA 1I85C 5ERWA 5C0CD 5CBAA 1QR1B 2HMIC 5K9OA 3L5XH 5D7KD 1ES0B 3J7HA 3DGGB 1ZHBA 2JLLA 2FATH 3L9RB 5CP3A 4W4OA 1RIVL 1CGSL 3BMWA 5FUOH 5D1QB 3BE1L 5CKGA 3DVGA 3O3BA 1MCPH 3D39A 3NA9L 5GHWL 3SCMD 3VXPB 4WGVB 5EOCL 3CCHA 3RVTC 3QIUA 4NCC1 3L6FA 4V2CB 3T0EA 4HEPG 5FKPA 3RAJH 4WFGD 2W60B 4FFYH 3EDKA 3NFPA 4GW4A 1MHHA 2E9IA 3GFUA 1KB9J 2AEPL 1QLRA 1X3DA 2VDLL 3QO0A 1B0GA 4ZUTA 2ITCA 1DBML 5HHXL 25C8H 2I25N 1I1YA 3CK0H 2DKMA 3D39D 2Y23A 5HYJD 4OCRL 1G7MA 2R2HA 3ZO0A 2P8LA 3QDGE 4UT7L 4WNQA 2EDWA 4HJGB 2XA8H 4XPBL 2HJKA 2ADGB 3MJ9H 5EZLB 4ZYKB 1N7ML 4U1GB 1NCBH 2YUWA 5HDQH 4XCNB 4OZIF 3HLAB 1I1FA 3UTTB 1TVBB 4HAFA 2G5RA 2B5IB 1PX4A 2PR4L 5EBWB 1MLCB 1JTTA 2DM3A 3ILPA 1UACL 3EZJB 4NQDD 3IXAA 1DFBL 5MERA 2UZYB 4IMLB 4HJJL 3MUGA 4TTGA 4RNRA 5L2KB 5EZJA 3QCTH 5IOPB 1AGCB 2D03L 5J6HA 3BW9B 4UBDC 2EZ0D 1SMOA 1IC4L 4YWGH 4GSDL 5BMFL 2H32B 3C60D 2N1KA 5DEGB 4LQFH 4A2MA 1ZWIB 4DZBA 5TF1L 1QSEE 4HLJA 3O45A 3EOTL 5AZ2L 1KCLA 4YNYB 4K23L 4R97B 3BGFB 4NO2A 3TJHD 5J8OA 4MA1C 5DURB 3KXFB 2J5LC 5C08B 1NAMH 2HFFA 5I8OH 1IGCL 2C4XA 4HGWB 3F6IA 4LHUG 5D5MF 5HVHB 3MC0A 3W5NA 4WVRA 3FB8B 4FZEL 2GTZB 3MMEA 4ZQKB 3VFOB 1MFEH 3OKDB 3PP4L 3MO1A 4QXGH 1LO2H 1AIFA 2R56L 2P5WE 3QA3B 1BPVA 4ERSH 4XP5H 5DRZB 1RZIA 1HSBB 1DBAH 3QG7H 3W82A 4ALAL 1TZGH 2GYSA 3U4AA 1MF2L 4PJGA 1NSNL 2JJSA 1C1EL 4OJFH 3KHOA 1YY9D 1NGQH 2HAZA 4Z95H 5E94A 1U36A 1U8MA 1A21A 5CBEA 5ICYA 1DZBA 1LNUB 4PY7A 3S3SA 3T3PF 5EIIB 4U7MA 4APQC 5CILH 3K80A 5A2LH 5EBGA 1G7LA 5F6HI 1I9RH 3DROB 3MRFB 4M62H 1KJMA 4BK5A 4NRYB 3K0WA 3B2UD 4H8WL 1U2HA 2VZOA 4W4OC 5TE4H 3FT2B 2L7UA 4YDKH 3OJ2C 4HZAA 1LEGB 2VDPL 4MX7B 3LIZL 1FZKA 5IVXA 1T04A 2BSSB 1J1XL 3MLSL 5L6YH 1PKQA 1RD6A 2Y4SA 3TN0B 4UU9A 3SDXE 1EEZA 1Q0YH 3PGCA 1Q9WA 3T0EC 4OM1L 1MJ7L 2XQBL 1C08B 2BOBB 4NM8L 1CN4A 4LLAA 3BJ91 4KMLB 4PRPD 5IMOB 3G08B 4TSCH 1LILA 4XP6H 1T0NA 3EO0B 1F8TH 2ESVD 3QQ4B 4XP4H 4GJTB 1B0RB 1NCCL 1S9YA 3IKCA 1X6NA 1QRNE 4Z8FL 5ACMA 3FO0L 3VXMD 2R23A 2PW1B 5L8LB 3C60C 1OAKH 1UWXK 2BMKA 1D9KA 4ZO7A 3BPNC 4D8PA 1CYGA 4HWNA 1ZLVH 1HHKA 3RNKA 2NY2D 1IC7H 4XPFH 3L5JA 4YXHL 2HN7A 5ISZB 2X9XA 1MFAH 1WIOA 3C5ZD 3EGSB 1J0KA 1K4DB 4MJIE 4CW1A 4NKQB 4U1LB 3SE9H 3OXRB 2V2XA 3P9WB 5ESVA 1CK0L 3E3QE 1WICA 2P5EA 2QQKL 5ELIA 4LPVA 3SQOL 2C1OB 4KI1A 3DHJA 1HEZA 1GRWA 3MLYL 5BXFA 3IDGA 4O5LL 3JTSB 1J9CT 3QSKB 5IQ9A 5EUKB 1KIRB 2VZUA 5T3XH 2MQCA 2YRZA 1FN4A 2X1WL 3CDFA 4HV8A 4UUJB 1CFNB 3EFFA 2QQNH 1QYGH 2AJYL 4D9LL 4OT1L 2AV7B 3ARFD 3DVIA 4WWKD 3HR5B 2WANA 3F7PC 3IYLW 3PWLB 3O8XB 3ULUL 3B2UC 4DVRH 2H45A 4LU5H 4RIRB 1X5XA 2WUBL 8FABA 3VFRA 5GS1A 1WC7B 2DQFA 4HWZA 4IOFC 4WUUB 2JJSC 4M3JA 5C6TL 1RVFH 4DTGL 4Y2DA 4PB9H 4RGOH 3FJTA 4ACPA 2PTUA 4JFOA 3NH7H 3FO1A 3QUKA 3NZ8A 5BJTA 2DQTH 2G75B 1IT9H 1IM3B 1YEDB 5FV2A 3BUTA 2H8PB 4V1DD 3IDXL 1NCNA 2D0HA 3OG6B 4OLZL 1G6RA 3NCJH 4PTUA 3F58L 3TZVA 3WO4B 3TBTA 3B9AA 1ITCA 4OLWL 2BXZA 1ZVYA 3HI6L 2BERA 2PXYA 1CDYA 1R0AL 5FF6A 2M1KA 1R5WA 4N0UB 4RAUB 1XIWA 4N5ED 4PRHD 5GGSA 4K3DH 3LEYH 3VGFA 3FQNB 3P4LA 3VRLE 2A74A 3BEWA 4JFFE 2APBA 5EBLB 4OM0L 1UM6H 2A2QT 1NL0H 2EC8A 3ZKND 2NY2C 3EO9L 1JHLH 2BHUA 3UO1L 3LHPL 2XPGA 1INEH 1N0XH 1HDMA 2R1XA 1YNKH 4PJBB 3FN0L 2X42A 3QEUA 3QNYB 3C5ZC 2VSDA 3PWVA 2CDEA 3WLBB 2QKIB 4K8RH 4UQ3B 1Z9LA 1A7RH 5GIRA 1SHMA 2QJDA 4BKLA 2DQUL 1HKLH 1JZ3A 4XMKH 3MNZA 4XHQA 1D9KC 1HQ4B 5LGHL 4MD0B 5GS0H 3MRJA 2V9TA 5C7XH 3OKNA 3MA7A 3U7YH 5KS9A 1AGDA 3DYOA 3REWB 3WFEH 4X4XB 1KFAH 2C1PA 1BIIA 1W72H 4UDUA 5F1NB 1N5YL 4M6NL 1A1NB 5LCVH 2XWTA 3GJEB 1CZ8H 3OZ9H 3HC0B 2UUDH 2ARJB 1GAFH 2AABH 5F21B 3ARFC 1A5FH 4WWKC 5AD0B 1F5WA 5HYSG 5FO7A 3EOAB 4MCYA 1AGFA 5KSBE 2AXGA 4TNWK 3DVFA 1H8SA 2CKBA 3L7FB 1MHCA 2KKQA 2ZUWA 2X1XR 4KJWD 4PD4J 1YPZB 3UTZB 3AMLA 2EYRA 4Y5VB 2WSKA 1MSPA 3BAEL 3FB7B 3TT3L 4DVBA 2X4SA 3QDMB 2YPVL 2IFFL 1U91A 1IJ9A 4OGXH 5L8JB 1I7ZA 5CD3B 4HUWB 1AQKH 4ZNCD 2IBZY 3HZKA 2CDGB 4BQBA 4D9RD 1EHLL 4LL9A 4NKIH 4FQXB 4JFHE 5EU4A 4MA7L 2XZAL 3MXVH 1AFVL 3U0PB 1YEHL 1S8DB 2OMNA 4YPJA 2VLKE 4M4PA 3IJHA 3BKMH 4UOW0 5E8EA 5GS1C 1PKOA 1FGVH 3H0TB 2JIXA 2OXHA 3ZZ1A 1H0DA 5TFSH 1I7UA 5C70A 2NYYD 1TTFA 1SBSL 2IFGA 1VB9A 2CXKA 1WBZA 1A7PH 4NFBA 4LEOB 1CICD 3CFJA 3B9VA 3MRLB 2ZSVB 1YUHB 2CDFA 2UWEB 5HVWA 4WTZA 2HT4C 1KNOA 5C9JA 3BRFA 3B6SA 4AK1A 3TBWA 2DQIL 3K7UA 1FE8L 3VXRB 3R0NA 3TZVC 2ZCLL 5ANMB 2WM0A 3BPOC 2AS5M 3V6BR 4NBZB 1ND0A 4J3UA 3D0LA 1RMFH 5BOZG 4KK6D 1Q1JH 5DJ6A 2NY5H 2PW2B 3FOLB 9CGTA 1ZVHA 2GK0B 1YJDH 5SWSB 4EDXA 4WGWB 4JKLA 4K94H 5E4IA 2Y25A 4JFDA 4X4ME 3IT8D 5SWZD 4K3HA 4R7DA 1OARL 3MLXH 4OZFA 3VH8A 5D6DA 2HFGH 3UBXB 1NCWH 1NBVH 2V6HA 2VDKL 4OUUB 3ALWA 3MJ8B 1DCLA 4LBEB 4XNUH 5FECA 4I4WA 4RQQB 5E2UL 5JDSA 1X4YA 4Y19A 1ZXQA 3GIVA 4MDJA 4NUGL 2WWMC 1XGTB 5BZWB 5B4MD 3KPSA 4O2CB 4ODTH 3V5DB 2YPLD 2DIAA 2YD7A 3QDJE 1H3UA 5EO9B 1R3LA 4QKXB 1E28B 1GGIL 4CJ1A 5D7SL 3GMNA 1RAMA 2QSQA 3I6GB 5ITFB 3GNMH 3S35H 2ZG1A 1FZMA 3OHXA 1Z0NA 5DQDL 5JUEH 4HUUA 2FLBT 1T2QH 5D7IE 5E03A 3IRZA 1MHEA 2IQAB 2IF7A 4LEXL 4JY5H 5T1KB 4HPOL 4XC1H 3G6DL 1QFOA 3WN5A 4L4VA 3W39B 1QG3A 2NZIA 4WI9A 5T5NG 1KLGA 4KVCH 4HS3B 4L3EA 5JQ6L 3N1MC 3VJ6B 5F93C 3R4DA 1QKZH 1CL7H 4UV4H 4H5SB 1U58B 3ULVC 2OJZL 4K3EH 3VMNA 4YBQC 1FV1B 2CR6A 1PY4A 1CICC 1RUKL 2DYPA 3JWOH 4OI9A 1IGTB 5MHSD 1WK0A 1JN6B 1P4LA 1JRHH 3HMXH 4QHNA 5IR1A 4MXWL 1OB1B 4LCYA 2E8YA 15C8L 1Z5LA 1CD1B 4Q6IA 3GZKA 2NCMA 1R3JA 1XR9B 43CAB 1QSFE 3MRMA 2VAJA 4L3ED 4KK9D 4KK6C 2E27L 3QH3A 1LP9B 1E6JL 1YZZA 4NFDA 4XAWH 4FA8A 3FFCB 5D7LA 1KN2L 2VXUL 4JQIL 1F6AA 1FL6B 3LQAC 1A9EB 5TJWK 3G6AB 1JGUL 4FFWD 1NC4B 3NZHL 5DD5H 3UTSB 5T5FL 3VI4F 1FZOB 2A6DA 1R3IL 3QP3A 3RX8A 5HHQA 1A14L 4Q0XL 4MQXC 3GUTB 2V17H 4K9EH 5E8NB 5EU7E 5C0EB 3ARGB 5ACZB 1EVTC 3V52H 1J12A 1TCMA 5L8KB 1H3WM 1CFTA 4P3DB 3DX7B 4OLUL 5B4MC 5D7LD 1Q9LB 4JKPH 1A0QL 4YEEA 4PY8J 1NGWA 3W9EA 5D6DC 1NBYB 4RMTA 4F33A 5FYJL 3B9KB 2BJML 5IBLD 3P2TA 3VFMB 3MCKA 3UC0L 3N9GL 3FQXA 4RISL 1NGYB 5ACLA 4N9OB 1VGKB 3MODH 3NIFE 2NTFA 4XVTH 6FABH 3SDAD 1CDJA 3MNWA 4JRYE 5D1XD 3O4LB 3IS1X 4GXVH 4N0CD 2X6MA 5DVOA 4QWWD 3HI1B 4NJ9L 3OR6B 4YHYC 2F53D 1BQHA 5CHNB 1LO3H 3G5XA 4XPAL 5J6GA 3QDGA 1OAZL 4HXAL 4NO0A 4O9HH 4G9DA 3KDMA 5ALBH 2IPUG 5DJYA 1SBBA 1FH5L 4GW1A 3LDBC 1CF8L 3G5VA 4C56E 5DD3L 2IPTL 5DEFA 4IBLT 1MFCH 2Q86A 3BP6A 1FG2B 4X7CC 2CO7B 3HG1E 2A6KB 3M17B 1QOKA 4ODVL 3UMTA 3F12B 1G7IB 2QSCH 4AG4H 3CMOH 3S36X 5DHVB 4JREB 2ZJSL 2Q7YB 4MB3A 2VUOA 4PV9A 3OKOB 3HPLA 4KK9C 4LRIC 1AHWA 1YN7A 3RZCD 1MCLA 3X3FH 3Q6FB 4X8JB 4ZFGL 3NVQA 1QSEA 3VFVB 4MA1B 4XXDA 1MCHA 4FXKA 3TO4B 2J5LB 5JO5B 4XWGH 1K2DB 3TIEB 1LDPH 4PGBA 2B0SL 5KN5A 5DJAA 3BPLC 2R1WA 2YN5A 3GSNL 4Q2ZA 3O41B 1MCOH 1T5WA 4Q6IC 4PJDE 2ADIB 4JQVA 3LD8C 3BO8B 3UPRB 5IB2B 4HXBL 1DQJB 3LCYA 3NGBB 5CEYA 3FQWA 2MHAA 3Q3GA 1M71B 1I4FB 1A7QH 3DETC 4IS6B 4WFHD 5JIKA 4OGAD 2AQ2A 2P5WA 4HBQA 3LEVL 2VXSH 3S96B 3OKKA 1G9ML 1BF2A 3W2DH 1INDL 1KPRB 1WCQA 2AKRA 4JZJA 1PQZB 2DI9A 3FQRA 1I8KA 4PRIB 1N2RA 5DDHA 3BPCB 3MFFB 1E4JA 4JE4B 3W5MA 2IMNA 4TQEH 1KCSL 5FGCE 4Y5YA 4APQB 4LVOC 2FYYB 3SKMA 1DBKL 3BOVA 5K9OB 1V05A 3GKZA 4ZD3L 1BGXH 3B8YA 5KVEH 5FXCH 5EZIL 1CCZA 1CGVA 4ZTPL 2FB4H 4D0DA 2P5WD 5IWLA 5D1XC 5K9JH 1XCTA 4QWWC 1OPGL 3CU1A 4RDQG 4Y5XB 1RZJH 4F7MB 3EYUH 5D1ZA 3CCHB 4Y7MA 1GC1H 3QIUB 2BSED 2IWGA 1AC6A 4M1GH 4HT1L 3SDXA 1XCQB 1MHHB 1IKFH 3CFDA 4EUPG 1FIGH 2DJ4A 3BKJH 1YN6A 1ZLVK 1B0GB 2APWA 4LASH 3U36B 1EAPA 1JNNH 4CDGC 1R5IA 2R4SL 1MRCL 5EU5A 1RULH 3WUZA 4LLMB 1OHQA 4ZFOB 3S9DB 1XH3A 4NKMA 4JFED 5INCA 1FVDA 1I1RA 3EYVA 4MA3B 1QRNA 3R8QA 4YHML 3W0WB 1I1AD 5I15L 2DQHH 2HJKB 2A6IA 3O9WD 4OGZA 4W6YB 4G9FD 4QCIA 4M7LH 2YN3A 5FGSA 4N8PA 3LN4A 4L8SB 4FABL 4HS6A 12E8H 1I1FB 4BH8B 4NWUL 2VN4A 3T1WA 2XI9A 3TCLB 1KIPA 4PP1D 4HLZG 4LKCA 3FHQA 4HFUL 2AEIT 2MKLC 1BJ1J 5DS8A 3CLEH 5MERB 5DRWB 3RWCB 3U1SL 4YC2C 1KTLA 4MJ5B 1S7UB 4MJIA 2Q6WA 3AB0B 3UAJC 4POZD 3W11D 2A77L 2R0KL 5L7XL 3WV0A 1ZS8A 2F9BT 5JXAH 4XCCL 4LLVB 1AHWC 1R3KB 4OGAC 1NCAH 2P1YA 4GMTH 2W0KA 2F58L 1GOGA 1CT8A 4JVUA 4HX1B 3WXWH 1G0YR 3CVIL 2HFFB 5KSUA 4QRTB 2EDJA 2G60H 1G7JA 4XNYH 3VFWB 1PG7X 2GCYB 4JHZA 3VXUB 3MBED 5DUPL 2HWZH 4J6RH 1MY5A 4I5BA 4JQVC 1IAIL 3GMPB 4YUEH 1X5FA 2NY4D 5CGMA 2ZKHL 3WJJC 4E5XA 2VXVH 1KCRL 5JW4N 3SJVB 1T4KA 5HXMA 4S1QH 1HH9A 4LGPB 3X11A 4JZJC 3S5LG 5E94B 3EDJA 2P8PA 5E1AA 2XOTA 3ZKMC 5GHWH 4OCYL 3SKUD 4PY7B 1ZA3A 5EOCH 4Y5YC 3RGVA 3AAZB 1G7LB 4XCFL 3DXAE 3QYCA 2Y07L 5DI8A 3SPVB 2AEPH 5ENWA 2VDLH 3DO3A 4XWOC 5IWLC 2X4UB 3N85H 3TM6A 5HHXH 5I76A 4D0BB 5IVXB 1UH4A 3JV4A 1T04B 4M9PA 3C09C 3QQ3B 4YXLL 4HAGA 5D1ZC 4NZUL 4OCRH 3M8OL 1KB5L 1BD2B 3WEXB 1P2CA 1EEZB 5IFAL 3PGCB 3RGVD 3QZWA 4XPBH 4BM7A 5I71B 4K7PX 4O02L 1N7MH 3D87B 4JFFA 3X3GH 5H35A 1A4KA 1QACA 2BC4A 5C0GA 3V79C 3GRWH 4L3AA 5H2BA 2HJFA 2VABA 1OSPL 3VA2C 2W07A 4IRSA 2IALA 5DHXB 4NWTL 2PR4H 3ULUF 4ZUUB 3IKCB 1M7DA 5J11B 4CNIB 1DFBH 4I3RL 1N6UA 3E6FA 1RJLA 4POZC 5F1IA 3W11C 2EIDA 2UUDK 2R23B 2ED8A 1DEDA 2ARWA 3WL9A 2GJ6E 3SO5A 1AE6H 2D03H 5DO2C 1D9KB 4D8PB 5EDXA 5C0FB 2I9TA 4U1MB 2WINA 4URTB 3D18B 1JGDB 1E27B 2EDEA 5C2BL 3EOTH 5AZ2H 3LAFA 4I77L 1WF5A 4JFYA 5ESQA 5I1EL 5IW6A 3VW3L 2AXHA 3VD9A 4XBPA 2GY7B 3KS0H 1TNNA 5I0DA 2A73A 5DMGD 3ARXA 1ZE3C 3IJYA 4XRCA 5T3XD 4ZO6A 1MIEL 1CS6A 4N1EA 1BVLA 2P5EB 1I9JL 3H42H 2F54E 3JUYA 3E3QC 1HEZB 2JJUA 4QRRB 5BXFB 3CNKA 5KSBA 4N9GA 2XG5A 4MD5B 4NHCL 1IGML 1K5NA 5IQ9B 3KPPA 1INQA 2YRPA 3L1OL 4U05A 4UILH 2AK1H 4XCYA 3TYGH 3QXAB 3EJJX 2VRAA 4HV8B 5FDWB 3RWHB 3EFFB 1N8ZA 3NMEA 3PNWA 1C1EH 2HT2D 4X7TB 1PLGH 4Y89A 3S4SB 5DFVD 2PO6A 2Z0BA 5FDYA 2RGSA 4ELMF 4L1DA 3BN9C 1A7NL 1U8PA 2VZTA 2X9WA 4R4BA 2NXYB 2CLRA 1MWAL 1WZMA 4OV5A 4U1HA 4G8GE 1RPQA 3VFRB 1KENL 2VLKA 4H8WH 3QXDB 4XC3L 5EG6C 1MVUA 3IU3A 1F97A 3U6RA 3D2UA 3BD4A 4NT6A 1F4AA 3ZKXC 4Y2DB 2EIEA 1EEYA 4OF0A 1J1XH 2XN9B 3MLSH 4EI6A 3RGVC 2D2OA 4OLXL 4JPKL 2NLJB 5IEHA 4JO3L 3FO1B 3NZ8B 3ZMRA 5BJTB 1QFWL 1NEZA 3QFJD 1EHXA 3WHE1 3PHOA 3VFGL 4EOWL 1ZT1B 2BVTA 1N26A 1DVFA 1BBJB 5I1DB 5B38B 4GXUM 1G6RB 4NM8H 5IBUB 3LS5L 3JWDC 3TBTB 3TBYA 1WJ3A 1QBMH 4K7PY 2F19L 1XF5B 2PXYB 2VLKD 4MMXC 4MD4A 4BSJA 1UQSB 5ETUB 3CFCL 1NCCH 4ODUA 1XIWB 4AM0A 3OG4B 3ZT7A 2PYEE 3RWIA 1LE9B 4PRDA 2ZG3A 4M02A 3FO0H 1D5XB 2ED9A 2A74B 3BEWB 4K8RD 3QJHA 4IIQA 4JO2H 2DBLL 1NMAH 1AH1A 4X4MA 2AVGA 5F88A 1ADQL 4POUB 2BP3A 1UWGL 2XPGB 1A8JH 3UYRL 4HIJA 2Q8BL 1BQUA 3B3IA 3QEUB 4AL8L 4YXHH 3PWVB 5GS0D 5DMGC 4IRSC 3T65A 2CDEB 5B8CA 4JR9L 5CSBA 1VEPA 3U9UA 4CADB 2VLME 4YDJA 1IE5A 4PBVC 2C4FU 2QQKH 2FLRT 3CFKB 3SQOH 5FYKL 4OZHB 1JWUA 1S3KL 3OKNB 5SV4A 5KS9B 2C1PB 3C2AL 1IRAY 3QDJA 4JEGB 1T7VA 1RZ7L 3QI9D 1A3LH 3MRGB 1X4ZA 4F7TA 2NZ9D 4JANA 4OB5L 4OZHF 3GJFB 1A3QA 1L9NA 4I3SL 1BJ1H 2X4NB 2AJYH 3GI9H 3QEQB 3V5HB 4JPVL 4OT1H 1QPXA 1MHCB 1QFPA 5A40E 1OT2A 2KDGA 5D7IA 2LAGB 3RTQB 5MENE 2X41A 4L4TE 4PP2B 1HXMB 3P77A 3V5KA 2LV4A 2WUBH 4DVBB 2X5PA 5AEAA 1U91B 1TZHA 2ZPKL 4UNUA 1QA9B 5IF0A 4N0YL 1EMTL 1BZ7B 1I9IH 5C6TH 3E0GA 5AUMA 4XPHH 2N4IA 2HVKA 2PO6C 2FX9L 1ZEAL 1CL7I 2O61A 4J3WA 1B0WA 2ZCHH 1TITA 3MRBA 4PRBB 5J57B 3FO2A 4DUXA 1AR1C 2HKHH 3GIZL 1P84J 3TA3B 3FOMB 1ZHLB 2ADJA 2RR3A 5CGYD 4UTAH 3IDXH 1U8IA 3BKYL 5TQ2H 5D2NE 2P7TB 4C59B 1H0DB 3F58H 3WUWG 4F37K 4L9LB 4OLWH 2ICCA 5E95B 1QSFA 3A6BH 1R0AH 3CXDL 2R2BA 1WBZB 4KPHH 3RRQA 1DN2A 1QSVA 4GKNA 1U3YA 4U6VL 5I16A 3RIFK 3I9GL 5C09E 4F3FA 3RHWF 4TOYH 1KNOB 2P43B 1NDGB 5F9OL 2ATKB 2D9CA 3H6JA 2Q7NA 5F89B 4OM0H 3QQ9D 1DVFC 1XAUA 1YECL 2CUIA 2VLRE 4F80A 3L7EA 3EO9H 1NCUA 4KI5E 2XIDA 3QRGH 2FR4A 3HZMB 1JK8A 2XFXA 4PLKD 4MA8H 2A0LD 2F8XC 1G84A 5T1MA 1YNLL 5CP7A 1GGCH 3MRPB 2DS4A 3VXSB 1JMXA 2DQUH 4ODHL 4JFDB 1H8OA 4IIQC 1U8JB 4R7DB 4U3XA 3RZWA 2IG2L 3IDJB 4LPTA 5LGHH 3NAAH 1F13A 2SEBB 4KGJA 5EC1B 3MZGB 4Y0GA 1QFHA 3VWKA 4LLYA 3TIDA 3QHZL 5KAQG 2QTEA 4KV5F 3UXFA 4M6NH 3QIBA 3U7WL 1LEIA 5IJKA 1J8KA 3LSOB 1MUJA 1AJ7L 3V4PL 4MDJB 3H3PH 2ZUXA 3HZYA 3KPSB 1GOHA 3LEXB 4JRYA 3MBXL 3PWPB 4LNRA 1I9EA 4WI4A 3NABL 1KJ3L 4J3TA 5LXGL 5AAMA 4Z77A 1UFUA 3HE7A 1BM3L 3VWKD 1D3CA 1DBJL 2YPVH 5HD8C 8CGTA 2IFFH 4X6EA 4NO3A 1FZMB 3OHXB 4CMHC 4ETYA 4J2XA 2CQVA 2EDKA 2AQ3A 4C56A 1HSAA 4P9HH 1JVKA 1O5DT 4KVNL 5IIEA 3MRIA 3HG1A 3GSVA 3KJ6L 4MA7H 4N90E 4C4KO 4NQCD 3RUGE 3D3VD 1PD6A 5CGYC 5IGXL 3C6LD 1YEHH 5KOVC 3QNXB 3WN5B 4L4VB 5BRZD 4LHUB 5HDBF 2FIKB 3P30H 1GPOH 3BZ4B 1HI6A 3R06A 2EEBA 4H1LG 3RL1A 1AI1H 4BQCA 1J18A 3WFHB 5HI4D 2DYPB 3RA7L 1SBSH 3LB6D 3S36L 3D85B 4Y16A 4YAQA 1JL8A 1J0JA 4QXWA 3MOAH 3BPLB 4QHNB 5IR1B 1CFBA 3CFIC 3WFCH 3QQ9C 2ERJC 3HE6D 3T4AB 2QHLA 4AENB 4PJ8A 1DL7L 1IFHH 2YD6A 1R3JB 3MLVL 4NCDA 1FNEA 5I73C 4PJDA 4PLKC 5CSZB 4BZ2L 5I1LA 4AMKH 2A0LC 4LCWE 5BVPL 2V7HB 3QH3B 4KY1L 4JY6B 5J12B 5JLZA 1LVEA 1M7IB 4OQTA 5A2FA 1GGUA 2J6EA 4BELD 1F6AB 2CSPA 2BHZA 4HZLA 4N1HB 4NCC2 1OTSC 4KKCC 5DVMA 3WDIA 3P9LA 4JFPA 4D94A 3B9DA 4LVOB 1OARH 4WV1A 3CU7A 2VIRA 2BY1A 3GM8A 4TUKH 3X13B 4HIXH 1S7RA 2DAVA 3OGCB 4XHJD 2FGWL 5K9QI 1Z9SA 4LLUA 1P5UA 5EU7C 1IQWH 1CFTB 1FL5A 4H26B 4P5MA 4PJ9B 2XTJB 1CG9B 3BN3B 2AXFB 3S37X 3MRHA 4I18B 3W9EB 1NGWB 2ORBL 2IC2A 4JPWH 2AJVH 1LD9A 1WFTA 2H32H 3D9AH 3RWJB 4D0CA 4CKVX 1Q9OA 3VWKC 3MCKB 5D7SH 1T1WA 1ZGLM 3K74B 2GJZA 1M05A 5E9DB 1FBIL 3FQXB 1EFXA 3QIBC 1H3TA 4RMVA 1S7TB 5HHME 2NTFB 2XKSA 4OFPA 1FL3A 5DQDH 3JWOC 2OL3B 1RIHL 3CSPA 3DPBA 3GSQA 4KWUA 1P6FA 4Y4HB 1BQHB 1I1CA 2B20A 1J0HA 1A1OB 3IDNB 3G6DH 3SO3B 4NO0B 3CX5K 1EEUA 3HE7C 3T04D 4MXQC 1CFQA 1IQDB 3LB6C 2OJZH 5DA0B 2ICWA 1D6VL 2E7CA 2WBJA 5LGJB 4OZIE 4ZUWB 2C5DC 5T3ZH 1I7TA 2QQQA 3ARED 3HE6C 4LPXA 3KLHC 1F58H 5C0BE 3DX9A 3TFKC 2V2TA 4O58L 1LGVA 1U3HB 5GS2H 5EORH 3FAWA 4G8IA 2X4OA 1BP3B 2ZUQC 1YN7B 5ILTL 1N6VA 3CVHB 1VKXB 2R4RH 3S34L 2E27H 1QSEB 4ZOBA 3TNMA 2F5AL 2RCSL 4KJPC 1A2YA 2NY3D 1DANU 3KYNB 3D1MC 1T6WA 2NY1C 5DJAB 2VXUH 1R5VA 2E7MA 4JFQB 1FFRA 1MCWW 1JZ6A 4HUVA 4PJ8C 3ZDXF 3V7MA 4J7RA 4X8XA 2A9NL 3P4MB 3Q3GB 2LTQB 3PDOA 1C5BH 3O6FD 5D5ME 3V4VH 2YUVA 4PGCB 1X5AA 4RGNB 1MCDA 1A14H 1U8LA 3OR7B 1PG7L 1CQYA 2CUMA 3OKKB 4JDVA 3KXFE 4HFWA 4YFLI 1D7FA 3ELAT 4PV8B 3FONB 1VADA 4ZOCA 4Z18A 4NP4L 4OLUH 3VGHA 2ZOKA 5GJTH 3KNBB 3P0YL 1NUGA 4Y5YB 3PL6B 4AT6B 3KPQB 4WV1C 5DHYB 3QNZA 3MRDB 2WWKO 1A6PA 1V7NL 2VITB 3DXAA 3BGMA 3T3PE 5IB5A 3QHFL 4DN3H 1NMBH 3RWEB 1OSZA 3GSRB 4GFTB 5T3ZE 3RWFB 3IF1A 5DQ9A 5D1ZB 4PREA 2OR9L 2DL9A 1N3NA 5MEPA 2NR6D 2XQYK 2Y7QB 2YBRB 1TQBC 5A1AA 5FHAH 4NQEB 2IPKA 2DI7A