4N68A

Crystal structure of an internal fn3 domain from human contactin-5 [psi-nysgrc-005804]
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
EPSAAPTDVKATSVSVSEILVAWKHIKESLGRPQGFEVGYWKDMEQEDTAETVKTRGNESFVILTGLEGNTLYHFTVRAYNGAGYGPPSSEVSATTKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of an internal FN3 domain from human Contactin-5 [PSI-NYSGRC-005804]
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Contactin-5
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n68A00
1JN6A 1WVZA 1MJJB 3UTSA 3W9EA 5JHDD 1IT9H 1BZ9A 3WJJA 2Y36L 1AXTH 4GAFB 3BZFB 1YEJL 4JRYA 1UACH 3MXVL 3DVIA 4Q9RH 3UYOD 5TFSH 1EVTC 3PQYB 4X9BA 3MV8E 5LVEA 3ET9F 4BSJA 2NYYD 5FM5M 1A6ZA 2J5LC 2R1XA 3RHWF 5KG9A 1RV6X 4ZUSB 4N8VA 1K8DB 1JGEA 1YEDA 3NCJH 1KPRB 3EDKA 3C8HA 1H15B 1VERA 1X4YA 35C8H 3E6FA 4XMPL 5B39A 3DYOA 4MX7A 4OZIF 3RL2B 1KTLA 4V2CB 2VZUA 3HZVB 4M4RA 1Q1JL 4TULL 1VGKB 3MJ7B 3BKYL 3ILQD 3U82B 4ZNEA 1XCQA 4PGZA 4LMQI 3ARED 4I0PD 5DQJA 5I8KL 5IFAL 3K7UA 4WW1B 2AJ3A 3O11B 3D25B 1MIML 2ZOKB 2E27L 2APBA 3OWEA 3DO3A 5GS1C 4JFFA 2XWBB 3VFSB 3MODH 4X6DE 2EXYC 1DDHB 2ED8A 3D9AL 4R96A 5JO5B 4R97B 4LASL 3LSOB 4KJPD 3W5NA 4BZYA 5D1XC 1CGVA 1QFOA 2QHRL 4ONGL 1KCVL 3VFNA 2IFFH 1RULL 1PKQA 5D7IA 4HX1A 3S97C 1KB5H 3NZ8B 4OCRL 4R90L 4FQCL 3ARPA 1NL0H 4K2UH 5JW4N 1PBYA 3VG9C 1BZ7B 3KS0J 1WBYA 2AAVA 4HKZA 3WO4C 3LRSA 2XKNB 3MYZA 4F2MA 5GGRA 4Z76B 4OIAA 5CINH 2EH8H 1S7QB 2BVQB 4XPTL 5JIPA 1BLNA 3UPRB 4ODSH 3QNXB 1KIRA 4CVWA 3OKOA 5AYUL 5DD6A 1I8MB 3PDOB 2H6PB 2RCSL 1QPPA 2OTPA 1A3QA 4YDIL 1XF4A 1XGTB 3EDFA 3GI8L 3QDMB 1TJIH 4WUUB 5B3NA 3KJ4C 2EIEA 1MIEH 4HKZB 1NCCH 4G9FB 5GZNC 1BQLL 3O6FD 1X5ZA 4P46B 4CW1B 2A74B 1MNUL 3UTSD 4X6CE 1MCFA 3HE7B 25C8H 3S34L 4EI5B 2VNCA 4PJFF 1KN4L 2IMMA 2XACC 4W68A 2HRPL 2WAHA 1QTYT 1BJ1J 1NBQA 1N2RA 4QHUB 1IC5L 5I30L 1HDMA 3MYJB 4P57B 1H8OA 4LAJH 3TNNB 4HWBH 3O9WA 4RRPG 3GBMH 4TYUA 1N5AA 3ARGA 4CMMA 3OKMA 4KTEL 3UBXG 2KQNA 4KK9C 4UMGA 3MRCB 5IB2A 5BZDA 4JRXD 4M6OH 2XZQH 3ARBD 4LCCC 2B1HH 1BJMA 5E2JA 1GZQB 5DD5L 1TTFA 5IHZB 2DL9A 5E56A 5IEHB 1KNOB 2GTZB 1I8IB 1O0VA 4KV5F 4ODXA 1B0GA 4MAYD 2ADGB 2OTWA 2R9HC 2IG2L 3PJSA 1D6VH 2X6MA 1F45A 2XOTA 1J0KA 1OLZA 1UVQB 1UACL 1ZHLA 4IRZH 4JZOA 4PB9H 3L5HA 1JE6A 4IDLA 3QEGH 5DRWB 2PXYC 3TJHD 2BVPA 5JOPD 4FFYH 4GG8A 1G7IB 5D7IF 3QNYB 4GAJH 1WBXA 4QRRE 2QQKH 1HYSD 2X4TA 5J1AB 4MSWA 2YPVH 4AMKH 1NANH 5CILL 1QA9A 4LF3A 5FB8B 3IGAA 4NC0B 1KPVB 2NZIA 2WIIB 3C8DA 3QQ3B 3EYFA 4M6NH 2HTKD 4GUPB 1ES0A 1QLRB 2ADFL 1MJ8L 2PXYD 3GMRA 4K3JL 2P7TB 2VDLL 5C0BA 1UA6L 3LOWA 4K3EH 3WIFB 1B2WH 5HYJE 4K9EL 4NDMA 1AGEB 3R1GH 5C9JA 3F58L 4NQUA 3MRGB 4XCEA 5E8OA 2NY1C 3VMNA 1BZQK 4UAOB 4XWGH 2P5WA 4KUCF 3VWJC 2G9HA 1JZ2A 2DQUL 4IRJB 5D2NA 3QWRA 4FFVD 2VYRE 3FZUC 1YEIL 5C0AA 2P7TA 2WUCL 2VLLB 4KK9D 3LKSA 1IKNA 3WKML 5IROA 4NDMB 3VD4A 5C9JB 5IFJA 4MXQD 1KJ2L 4X9GA 4JZJA 2ARJQ 1MLBA 3QIBB 4LSVH 1DLHA 1MQ8A 5DA4A 2GYSA 2AV7A 1P84K 2ICES 4KKNA 1DTUA 3FQRB 3ROOA 5J13C 1T5WB 1TENA 5DDHA 1S9VB 5GGTH 1IM3B 1S78D 4ISVA 1FN4A 4JANA 4NBYB 4Z6AT 3RWDA 1EO7A 2DQIL 4OM0L 1U8NA 4BKLB 5JIIA 3BO8A 4TNWK 5FO8B 4LCWE 4JZJB 1MSPA 5I74C 5IJVA 5D2LA 5EORL 4R0LA 1A21A 3HE6B 4D2NA 4MNHA 2C1OB 3NMEA 4X99B 2NTFB 4FG6C 3ZKND 3LHPH 4XXCA 3TF7C 1NCDL 3H9HA 3NIFE 4UINL 5TE4L 3VD3A 1SYSA 1JNLL 3P0YL 4Y4FA 2V2WA 3IJYB 5L0QB 3HFMH 1EHAA 5LWYL 4EXKA 3VFVB 1PVHA 2XKSA 4XC3L 1IBGH 5KSBB 5D5MF 4R4ND 1RJLB 32C2A 4AJ0A 1OM3H 2J88L 2NTFA 2VERN 3BQUC 4S1SL 1FL6B 1CLZL 1J12A 3WS3A 5I73B 3MLZH 3ARDD 5C0EA 2KZ1B 3U6RA 3DMMB 5EIVA 3M1BA 1MF2L 4PRPB 3WYRA 1NFDE 3IU3B 3MLSH 1IEHA 2YRZA 1XR8B 2D7TH 2I27N 3MRPA 3HCVB 2X1QA 5ILTH 3A6CL 4G6FB 4IHOA 1LQSR 3R06A 3T04D 4C54A 3U6RB 1RZ7L 3MNVB 4QYOB 1KEGL 4I5BB 5IB3B 5TPWH 3O2VL 3JTTB 3O6FC 3QWOB 3B3IB 3BIAX 3SCMA 1G0YR 1L7TL 2LTQC 5FXCH 2GJZB 3VXPA 3PGFL 4J4PD 1Z6JT 3RZCD 1KIQA 1CCZA 2HFEB 5HDBE 3EKCA 4Z5RB 4MQ7B 1U36A 5DT1H 3L3OA 3L3HA 3T0VA 2VSDA 3GMMB 1MPAL 1BZ7A 5DVLA 4NHCL 2Y1VA 5ILTL 3MRNA 2DQCH 4MA7L 1SM3H 4LLUA 1MJUL 2YA0A 5HHMB 1B2WL 2DICA 5ABDE 3RWCB 3LEYH 4HQQL 1X4ZA 3EJYD 1FG9C 4JO1L 5KS9E 1CDUA 1N64H 4M7LT 1FO0B 1R5WB 2YSSB 1GC1H 4LLWB 1VSCA 3BZFA 5E4IA 1T66D 3OKEA 4PJ7A 3BPCB 4TUKH 4HKJB 1MOEA 4NO2B 4PTTB 5JW4M 4FQJH 3PXJA 2H2SC 5I66A 5K9OB 3PL6C 1OPGH 2X40A 3FT4B 3TWCH 3V4VL 1F58H 5ICXB 1YC7A 1D9KC 3QQ9D 4KQ3H 3MV11 3RPIB 2UY7A 3L5JA 1FNLA 4U1KA 2K1MA 3ARFC 3OKKA 5I1DB 1U2HA 1YEHL 4OM0H 5BZDB 4Y4KC 3U7YL 1UENA 3K8KA 4WFEE 5IHZA 3O41B 1MFDL 2W1NA 3O2DL 3SE9H 2R4SL 3W39B 4KUCD 4M62L 4P2CG 4YHIA 3U4EA 1FPTL 2NY3D 4KAQH 3TV3H 4DW2H 9CGTA 4QRRA 3K81A 2E9BA 4JZOB 4D3CL 4BUGA 4WUUD 1D6EB 3TFKD 5CFHA 4KRMB 4WI4A 3GB7A 4DTGH 1YDPB 3RTQB 4AL8L 3W81A 4G8IA 4HFUL 3GFUA 1A6VL 3NN8B 4HUUA 5DK0B 1AR2A 5GS0D 2DM7A 2IQ9L 3H2WA 1PKQB 4PRIE 1N0XL 3QUZC 4XMPH 3D1MC 1LEIB 4IM8A 1GOHA 5C09E 5ADPL 4IIQC 4MDJB 3IAQA 4PJXB 1MLCB 2SEBB 3AM8C 4KK5D 1WBYB 4X80H 2XKNA 4R3SA 2G60L 4MJIE 3RDTC 1MCOL 5DWUH 2WQRA 4JCMA 4LCIL 3BP6A 5KVDH 1T1YA 1F11A 1A64A 4XAKE 4P9HC 5E8DH 3RY4A 1RHHA 2CRZA 5F9WC 4QOKD 5I1JH 1MIEL 1G9ML 3OKOB 3KPLA 1UT9A 4HUMB 4NRYA 5B8CC 3DXAB 1EHLH 3OR6A 1T7WA 3NH7H 4JFHD 1E27B 3QDGD 3AS1A 4OUOA 5J11B 2OL3H 1A2YB 1M71A 5FKPB 1UWGH 5DJDA 3QUZD 5C0AB 1V8HA 4Z7VF 1WWCA 2ZCHH 3UPAA 4PGCA 2VXSH 4UU9A 1G7HA 2FATH 4JLRB 2A6DA 1FVEA 4CAGA 4Z0BH 1KC5H 1U91A 1Z9LA 2EXWC 1JRHH 4GXUN 4K94H 4NQEA 4CJ0A 4J8RB 2W60B 1ETZB 3A67H 3DO7A 4ZUUB 2WBJA 3P4LA 2QL1A 2EDTA 1IL1B 3O4OB 3UBXI 2RCSH 5E6ID 3G5VB 2FIKA 3KYMB 3LPFA 1KNOA 4NQEB 2WZPD 5JOPE 4J8RA 3O6LH 4TOYL 4HUVB 3ARGD 5EU5A 3GSNL 1A9BA 1MFEL 3RGVD 3RU8L 1U8OA 3U46A 3BW9A 1IGIH 2F53A 4FQQA 1OCWH 3MOBL 4M4PA 4L8CA 3H7BA 4N0UE 4TSAH 1GGUA 3SDCD 4KK6C 4M61B 5I0DA 4MAYA 2BRRL 2JJTC 1A7OL 4UNTA 4QTHB 4S10A 3SO5A 3KPNA 1YMHA 4CMHC 3MLUH 1NGWA 3MRHA 4DGYH 4UTBH 1A9BB 4BFBD 4C57C 1VEOA 1U8OB 1MCHA 4KJYA 4YQXL 5HD8D 2QADD 1J5OH 5E1AA 3S8WA 5GIRB 1JWSA 4KROD 2OS7A 3QUMA 5D9SA 3FAWA 2FD6H 2D0HA 3GSWA 2UVEA 3M1BB 3UROR 2FLBT 5E4EB 2FEEL 4RISL 4N9OB 3TZVC 3IXTB 1AGEA 5DJAB 1GOFA 1X6LA 2J2ZA 5CD3A 3DVNA 4KI5E 5CBEB 4MLIA 4HZLA 4XVUC 3TV3L 4DW2L 5F3HA 1AO7B 1FFOB 2Q7NA 3V5KA 3BZEA 1A6TA 4OJFL 5FOJA 3RIFF 2N7BA 5I16A 1UXSB 2OK0H 4PRHA 2CLZA 5FV2A 1WWBX 4HD9A 1M1SA 1MJJA 4E5XB 1KB9K 4XI5D 1TTUA 4U2ZA 1A7QH 4JHWH 3BGAA 3QAZC 1Q72L 3CCHA 1MI5E 5J6HA 1MUJA 1KB9J 3L1OH 3S96B 3WXWH 1FAIH 4HZLB 4ZO8A 5HGGS 2X89A 1NSNH 2VDRH 3ARYA 4NKIL 5T1DL 5GGSA 3L5IA 2Q6WB 2DQIH 3CFJB 2CLVB 3MRKB 4Z8FH 2XZCL 5B4MD 3QUXC 2ZSWA 2KZWA 3QDJB 2NY2C 5DJ0A 5DQDH 1Z3GH 3CSBA 1CFNB 4K23H 4BH8A 5EFIB 4NHUB 2R0LH 2WSKA 5L9DH 5IW6B 1T1WB 2VLME 2NX5E 4MGXA 4P2OC 3HLAB 4UIKL 3GO1L 3JWDL 3O4LE 3UZVB 1AY1H 1IGIL 3L7FA 1HCFX 5DRNA 1Z5LA 4X99A 4KV5E 3CFJA 1X44A 3OXSA 3GEWB 1TVBA 2NY6B 5EG6C 1I8KB 3VWJD 4DAGH 1JTPA 3SO3C 1CF8H 4PJ7B 4R4NC 5HHVL 2BNQB 4PY7B 5F9DC 4H25A 1YEFL 1IQWH 3GBLA 2PO6D 1ZAGA 1E28B 5CMAB 1U93A 1MJUH 4NJAH 1OGAB 4AH2B 2HJFB 3WNOA 2R2CA 2C3HA 2NMSA 3RDTB 1BIIB 5A2KH 1FL6A 3EYQC 2OI9C 3BPOB 4YHMH 2R56H 4PJIB 1I1YB 1RFDL 5EA0H 4E41D 4HV8A 4U6TA 5C6TL 5EO0A 1JZ4A 1FFRA 3GDBA 5CJXA 2Z8RA 3SDAD 5T33L 4U49A 1MVFA 3VG0L 1QSEA 2VC2H 1T3FA 4F7CA 5GRJH 1YMMA 3KYOA 1C1EL 3N0PB 5CLWA 3QIUC 4HUNB 3D5OF 5LCVL 3QYCA 5I8CA 1OLLA 5IVZA 4UNUA 4GG6E 4PJIA 4PD4J 5KAQG 4UTAH 3MLPA 2P5EB 4QRSB 2ICEB 4YR6B 2P5WD 2AJVH 2YRPA 3O3DB 2AI0H 4NKOB 1YQVH 1NKOA 2VTFA 4LIQE 5HYIA 4U0RB 2YOCA 1QSEB 4NWTH 5T1DH 5I1AB 4X6FA 1KIQB 1P9MC 4RBPK 2GITB 1P4IH 3KYNA 1DE4A 4FFVC 2DJSA 4Q2ZB 1CE1H 4IRSA 3L3DA 4Z95H 4MDJA 4YPJA 4WW2B 3RY6A 5T1KB 1SMOA 3UTTB 1D5ZB 4S1DD 4Y19D 5IV2A 3CFCH 4N0FB 4F7TB 5F96L 5ISZA 2NY1B 5IWLC 2QSVA 3OKMB 2NTSP 3UC0L 5T3XL 4OCSL 4P57A 2EYTA 3TBVA 1P6AB 2DYPA 2I5YH 3QPQC 1VHPA 4X83A 3JV4A 4PJCB 4CMMB 2Z92A 1G9EA 3EFDH 2HLAA 1RAMA 5ALBL 2VQ1A 2NZ9D 2FIRT 2HT2C 3F5WA 1CTOA 1WK0A 3ZKSD 1PZ5B 1FRGH 4N0UA 4YGAB 2OM5A 1AFVH 5IEHA 2CIKB 1S9XA 2GAZB 4ONHA 1U6AH 3QO0B 4LVEA 4X80L 4PFEA 2Z8VC 3CDGB 2HKHL 4DK3A 3JV4B 4PJCA 3CFEA 4CDHA 5EU4B 3IETA 3LEVL 3HNVL 4BSWB 1A14L 1T80A 3F7QA 3MUY1 3PL6D 1N8ZA 5KSAD 3GSUA 4X6EB 1NUFA 4KKBD 4HG4J 2PTVA 2DQCL 4MA7H 3IKCB 2ERJC 4TSBH 1YEJH 1EZVY 1LO4L 2AXGB 4JZJC 4QNPF 4FNLH 5C0FA 4HXAH 1V3JA 5C07E 4I3RL 4GW5B 1FP5A 2W07A 4Y4HA 5C0ND 1CXHA 4WU7A 3V0WH 4Z0XA 1KCKA 4ORGA 2FJFA 5FHBL 2EKJA 3RU8H 1FE8H 3ARUA 5EU4A 2WLZA 3U0TB 2BVOA 4UI2A 2PW1B 5FUZH 4H1LH 2VLJB 3EHBD 1GGCL 3MFGB 3N85L 3EYVB 2VDPL 3LV3A 4PRHE 4GRLB 3JWOC 1YEGL 4G6KL 5JZ7C 4YHZL 1LP9F 3VXMA 4P23A 2NY3C 1RZJH 4KRLB 4UQ2A 1PYWB 4C59B 3DRQA 3MRIB 4O4YL 1QRNE 4NO0A 5I15H 2VLRD 4OCXL 3DMMC 1HWHB 3RVTD 3VDAA 1F4XH 3FN9A 3VXRE 2CDEB 3F65A 4F33A 3D85B 4KJYB 5F7EH 4YHYC 3WLBB 1P6FA 1RPQA 4I2XE 1QOKA 5GIRA 4P2OB 3FN0H 2VABB 4R4FL 2KKQA 4YBQD 3KLHC 4JEGB 1OF2A 4YAQA 4LPCA 3X14B 1H0DA 2R1WB 1IC5H 4H8WL 5DEGB 4MZ3A 2OZ4H 4B0MM 3QIBD 3IKKA 3LKQB 4PB0L 5DDHB 4I0CC 5BO1H 3GBML 2QR0B 3X3GL 4F33B 2WBJD 1T6WA 2P47B 4AG4L 4Y4HC 5DJ6B 2CIIB 4MNHB 1E27A 3GMNB 4JM2B 2W0FA 4WFGD 4YHPB 4O02L 5GISH 2MSPA 1MFBL 1UM4L 5DVNA 5C0CA 3X11A 1HILA 2YWZA 1E4WL 3G5ZA 2JLLA 1FVEB 4P0DA 5D7JC 3VI3E 3HI5H 4CJ1A 3I9GH 4F37F 3MRFA 1JP5A 1Q9KB 3DX7A 3SDXF 4HIHA 1M05B 1TJIL 4GMTH 4LGRB 3GHEL 3R4DA 4F7EB 2CLVA 2OJZL 3MRKA 4X7EC 5KZCD 4JRXA 3QH3A 4EDWL 1JBJA 1CU4H 3W0WA 3DMMA 2PW2A 1CDBA 4JRWA 1EAPB 5A2JH 1MRFL 4NM4H 5IW6A 4NQCD 2KPNA 3LAFA 4LMQE 1BD2A 3HZKA 3VGEA 1CLCA 2IFFL 4YHOL 4LPYA 1JF5A 2FL5B 1DANT 5JIHA 5DI8A 4IHOB 3IDXH 1KENL 1NSNL 2VDRL 4NKIH 5EZIH 5EZLA 5AYUH 4P2QD 2EO9A 5CKAA 1W72A 3QEUB 4I9WE 1INEH 3BIKA 2N4IA 5KVEL 4Z78B 3BGFB 3T0AA 2X4OB 5DYOA 2WNGA 4MJ6B 2EDEA 3LB6D 5D7LB 3ARFB 4Q9QL 2LVEA 4OF6A 2YXMA 4Z7QF 1UQSB 4UIKH 1OGAE 4OZFG 4EVNA 5A40E 1ZGLA 4PS4H 4NQDB 5D9SB 1BREA 3BKCH 4NQVB 4AEIL 2F74B 1W72B 3V0WL 2ZOLB 1KJ2H 4XMLH 4PJGE 1OPGL 2XICA 3F7VB 3WDHA 1CFBA 1KCVH 4PJDE 3PWJB 3T8XA 3L3JB 3BYTA 4HBCL 5I1IH 1XGPA 2DYPD 5GSRA 4P9HH 5KSVA 2OR7A 4HBQA 4UILL 2V17H 3S37X 3EYOB 2F54A 3UPCA 3MLWH 1ADQA 3JXAA 2ARJB 1ONQA 3MRRB 4NJ9L 1CF8L 4XP5L 1FFOA 5ID0B 2J3SA 1EAJA 4UQ3A 3EUUA 2P5EA 4PLKD 4O00A 2ZOLA 4L3CA 3WKNA 4XAKD 1AI1H 1LP9E 3BP5B 4NP4H 4M6MH 4OLVH 4L4VE 4Q6YA 4K3GA 1F97A 1MRDH 2Z4QB 4HK3N 4UOJA 5C8JB 2QKIB 3BKCL 3CFDB 1OP5K 4D0DA 5DD5H 3UAJC 2K7PA 3BPCA 4U1GB 1CLYH 5ICXA 5D2LE 1DQQA 1LK3L 3O4LB 3VFOA 3TN0C 4M1GL 4JO3H 3O81A 3DETC 4NIKB 4JJ5A 2AQ1A 5K9OA 3BVNB 5AD0A 4AQOA 5ICYB 4PBVC 4C56A 2C3VB 3DGGA 2QQKL 2HMID 3V4PH 3E0GA 2MKLC 4BH8B 1MWAL 5EO9B 4JG0L 1HZHL 5EULV 4MXQC 2HRPH 2DBLL 3MACH 1QKZL 3IDXL 3V6FB 1CVRA 5TGBB 4EBQH 5I73C 3QIWB 4YUEL 5KSAA 2UZYB 4I48A 3X12A 1PG7X 5I9QB 1FZKA 2IPTH 3KLSA 1BMGA 4M7JL 4AIZB 1I3UA 3L5XH 1KCUL 3TLRA 4WW2F 4OLXL 3TZVA 3M07A 1HSBB 2B1HL 2BSTA 5FF6B 3GB7B 5JLZA 4QF1A 1I7ZB 2Y06H 1KTLB 2XRAH 1V3LA 1PKOA 5T3ZH 4NM8H 1IILE 3IETB 1J87A 3SE4A 1C8PA 2R2BA 3SDCA 5DUML 1HINL 2LAAA 2AQ2A 3EOYG 1LEIA 1C12A 1GSMA 2OZ4A 4ZUWB 2A77L 4X4YA 1ZVSA 3TNMB 3ULVH 4PJXA 2R69L 4QWWD 4GG6F 4AYFA 4ZSOA 1PSKH 3VFGL 4GLRH 1ZLWK 3T2NH 1KXTB 4OI8A 4Y8AA 1U92A 4K8RC 1JNHB 3BYYA 1YJDC 5IQ9B 3F7YB 4G8GE 4XNZC 4XNUH 4FXKA 5D4QA 5FO9A 3HUJB 5GRZA 3QI9A 2PYEA 2A6IB 4P5TC 4U1HB 1NBVH 5T1MA 1NDMB 2I9LB 4OD1L 3NFSL 1QRNA 1E0OB 3OX8A 1D5MB 4YR6A 1AGFA 1YPZA 4HIJA 4Q9QH 3SCMC 3G04B 1CD8A 1D7FA 5EO1A 1YUHA 3BD4A 5DHVB 5DZLA 1B4RA 5IQ9A 4QCIB 4YWGH 1G0DA 1DBBL 4Y19B 5BRZA 1OT2A 1VADB 2UWEA 4X9FA 4Y5YB 3OJVC 3OKNB 3FT2A 2HWZL 5DR5L 4FZEL 5JDSB 4M48H 1T2JA 3QO1A 3C5SA 3K1DA 4JHZA 1OP5H 3UTTA 1FL3A 1PJ9A 4PR5A 4FN0A 1AXSB 4OFVA 2IADB 2YEZA 2NY2D 1RZJL 4LVNB 4RWHA 3BGMB 1XGUB 5JDSA 5D1XA 1TJGH 1W72H 2FYYA 2LAGB 5TQ0L 5J06A 5FK9A 3QO1B 3FO0H 4S1RL 4HUVA 3MV9A 1MF2H 1RZJC 5IVXF 4OKVB 1NGPH 5JW5A 2VZ3A 4L29A 2W0FB 4YHPA 1S7XB 5CINL 5J3HC 1N2RB 3ISWA 5C0CB 1RK0A 4HHAA 1MVUA 4FXGB 1EMTL 2OMBA 4QNPE 1IFHH 2QBWA 2C4FT 3PL6A 5F72S 2B4CH 1OTUC 3I50L 5GQBA 3RL1B 4HXAL 2VLKD 1T0MA 2VL5B 1TCRA 3CMOL 4XAWH 3P0GB 4HXBL 2XWTB 3D39B 4I1NB 4WEUD 5H37G 1H3UA 2AEPL 1A6UL 1D5XB 2IQAA 4U6HB 2OYPA 3S5LA 5IR1B 1W72L 5E1AB 1XIWA 5E6IB 4DQOH 4NQCE 5ANME 1WAAE 2WINA 3EHBC 3VCLB 1JFQH 3LEXA 2E7LC 4PJ5B 2C7UB 1D3CA 3IF1A 1LD9B 1TZGL 2F58H 1CL7L 1ZHLB 4XCCL 4AG4H 4Z7WF 3MX0A 2Y07L 2NNAA 5C6WH 4Z7UF 4NNYA 1FZMB 3MSPA 1FZJA 2X7LB 5EU6B 1A5FL 4TVPL 3VXNB 1N4XH 3BSZL 3RVVD 3O9WC 4LLAA 4QXUH 3SDCC 4CKVX 1IKFL 3DRQB 1I75A 4OAWB 5EZOL 4EQ2A 5IF0B 2VR5A 4CVXA 3OR7B 2CKBA 4P2RA 5D7KD 2NNAB 2DL2A 4YBQC 2UVFA 4YXKL 2AERT 4GKSB 4HCRL 3QXDB 5ACZA 4KTDH 4P23D 4XMKL 4KDWA 3WIHH 3U0PA 5CJXC 3C09C 5GRVL 5L9DL 2IANA 2F19L 4S1QH 5C1MB 2A2QT 1CXFA 1ZHNA 3KDMA 2FEDD 1RIUH 1MWAB 1EGJL 1MFAL 5CGYC 2IJ0C 4XNXH 3PABB 4YHOH 2DI9A 3R0MA 2MKWA 4WHYG 5D71H 5H94A 3A67L 4BK5A 1P2CA 4GKSA 4MB5A 4JRYB 1NGZA 5E6YA 3VI3F 3MBXH 3C2SA 1CFNA 2D7MA 4Y5VC 1WBZA 2X4RA 5FUCC 3WHXA 1ZS8B 2IBGA 1DEEB 4K9EC 2DLFL 3I9GL 1JPGB 1CICC 1V3MA 1EHLL 4G5ZL 3L7FB 3AFLA 2KDGA 2YXFA 3BDYL 1CDJA 3RX5A 1TVBB 3H6JA 3RNKA 1NGZB 1BJ1H 3MJ8A 4JANB 2N1KA 2HJFA 6CGTA 1FLRL 3SKMA 1UCBL 4O9HH 1PG7L 4H1LB 4OZIB 3QCTL 4HLJA 3DGGB 1FZOA 1SBSH 3OAZH 1JGDA 4FFWC 3TIEB 2PYEE 3X3GH 1HKLL 4KY1H 1LEKB 4N8CH 1FNEA 2P4AB 5IFHH 1IKNC 1J7VR 2Y5TA 3MXWL 1SYSB 3AC0A 5DC4B 1TQCB 4L4VB 1K2DB 1MAML 5I1HH 4F7CB 5GJTL 4GO6B 1U8QA 4OZ4B 2O5ZH 5FHAH 1YNLL 5HDLA 5DHXB 4OLUH 4WCYL 2ICEA 1JYWA 5DFVD 2C26A 5I8CB 1XF2A 3SKOB 4PUBL 4LHUA 3TZVB 4ETQA 2ZOKA 5HVHC 5IB4A 2GJJA 2O5YL 3F7PC 3LDBB 3WIHL 5GPRA 4IIQA 4S2SB 5DMKA 4I3GA 3DIFB 3JV0A 5I1AA 1G7LA 1UADC 4R96B 3F12B 3TBSA 4BH7A 5D1ZC 4NKOA 4TTDC 4RMTA 4P2QA 3DTXB 1S7QA 2BVQA 3PWNB 1IGCL 1X3DA 3OJ2C 4NZUH 4CN1A 5DD6B 4ODHL 1I8MA 4JFOB 1TLKA 2AJVL 3UMTA 2VDNL 5L88L 1N4XL 4JAMB 5T5NG 1YPZE 2COQA 2FR4A 4PRBA 3NIGE 3TBVB 4WCYH 3ZE2F 4PJHB 2CXKA 2OR9H 4Y16D 1E4XL 2Q1EA 3T0BA 5CWSA 2BX5A 3EO9H 1D9KD 4YWGL 3VFUA 5IESH 4JY4B 5CS7A 1BM3L 5SWSD 1FFPA 2A73B 1QHOA 2FD6L 5F89B 3UPRA 5L2JB 3WSQL 2HWZH 1EEYA 4L3CB 1N59B 2DKUA 2VB5A 5L2KA 4K7PL 1C7TA 3SHSA 4QHUA 3VJ6B 1T5XA 2FSEA 3BUYA 2RGSA 2VH5L 5KN5A 2C9AA 4H88H 1J0YA 1KCRL 1QNZH 4JPVL 4I18A 4YK4C 5DVOA 3NIFF 4WWKB 4N0YH 1MHEA 2G5BA 4LLUB 5CLTA 2QLVB 3O4LA 1AR1C 3P4OA 2BSRB 5EUKA 3SO3B 5JXAL 3V52H 4WJ5A 3MGOB 5C0FB 4XVSL 4M5YL 5DUBB 2RBLA 4PYGA 1X5XA 2D31A 1T0PB 3L95B 5F9AC 2VLJD 1IAKB 4LHUG 2YD1A 4HCRA 5DRWA 1HQ4B 1CQKA 4WU7B 4KVCH 3MNWA 4Z0XB 1KF9B 1T89A 1AR1D 5T5FL 3RP1A 1KSRA 4HDIB 4LSQH 4HIEA 1YEIH 43CAA 1R3HA 2VO5A 4NWUH 1R3JB 4NM8L 3TP4A 2QADC 2ZG1A 3ZDYF 2P45B 4O5LH 5EB9A 5F9JA 5I76A 4JFEA 4DGIH 3SGKA 4HH8A 3ZSTA 1JMXA 2APFA 3VWKB 3GGWA 3FO2B 4L1HA 2VQUA 1JZ3A 1QSFB 3QIWC 1C7SA 2VAAB 5GSVB 4XT1C 2VN4A 1LVEA 1XFPA 4HIEB 4KKCC 4HEPG 4XNMB 5KJRL 3IDGB 4YO0B 3SDAA 2X4TB 5J1AA 2ZUXA 3PGDB 1NLDL 2CLRB 1T0NB 3GGWB 1CGXA 3Q48A 4B53A 3MXWH 3KAAA 3ULUC 4DVRL 2A6KA 3ARDC 3I50H 1E6JL 5FEBA 1FZMA 1F2QA 1FZJB 3PQYE 2CO7B 5DO2D 3DV6A 1CD0A 1G7MB 1RD6A 4ELMA 5ELIA 2B39A 1UB6A 4G80B 1WAAF 1KLGA 4MD0B 4TQEH 5DJ6A 4ZTPL 5GRUL 2VDQL 5TF1H 1Q9LB 4P5TB 3DX8B 3D0VB 3OAYH 2DLHA 1JMZA 4LAQH 4IRSD 1F6AB 1AP2B 3IFOB 1EO5A 5CSZA 1KTKE 3INUL 4FG6D 1S9VA 4U3HA 2VLLA 2AGJH 4M1CC 4W4OA 3U2SB 2APTA 1CT8B 5FYKE 1F6FB 2YD4A 3PHSA 3RVUD 2X1OA 2E7MA 1KLGB 1MLBB 4L4TD 4W4NA 5GGTL 2EEDA 5L8LB 3WXVH 2VDOH 2JTDA 4ZUSA 1YEDB 2W0LA 3D0VA 2YMXL 4GRWB 5JQ6H 4IMKC 7FABL 3OGOE 3BMWA 4PGCB 2APVA 2V2WB 4OB5H 3U2SA 1GGBH 2G75B 2HVJA 2VUOA 3P4MB 4OBRA 5E5MA 4A6YH 1BWMA 2B20A 3TIDB 1I8LC 2NY5C 1MCLA 5C07A 4YDKL 2DQHH 5EZLB 3H42L 1P7HL 4LLYB 1ZVYA 5FYJD 4XRCA 5DJ2B 3N85H 2BOCB 1A6AA 2OLDA 1FNGA 2LV4A 3SDDA 5D7LA 2PO6B 1ZLSL 2VWEC 2AI0L 5HJ3B 4U6YA 4QRUA 1K8IB 2BNQD 4Z78A 5KVGL 5E70A 3VWJB 5ESAB 2E3VA 4NQVA 1L9NA 5I6XB 3RWFA 2ADFH 4M7KL 4ZNCD 1YNLH 5EBMA 5F1KC 3TIEA 4GKNA 3T8XB 3MBXL 3RX8A 3T4YA 3QPXL 5I1CH 1XZ0B 4OLZL 3AS2A 3FMGL 5KSVB 3QWOA 1WISA 3KJ4B 5HJ3A 4PJBE 2W0PA 3LRSB 4GBXD 1XF3B 4PLOB 1CDCA 3STLA 1CGYA 1XGRA 4YGVB 4NT6A 4FMKA 1NMBH 3QUMH 2ZWLT 4LP4A 1Q0YL 3F8UB 2EYSB 3I75A 3L3HB 4K3HA 5BV7B 1I1AB 3SE8L 1F4HA 3QUZB 4KJQD 5C0AD 4OLYL 5F7MC 3WNLA 4EUPB 2I25N 3MRNB 5ACZB 4FOMA 3TBSB 1GRWA 4FQ1L 3DXAD 3U0PB 1P1ZB 1T66C 3HG1A 5A1AA 5CD3B 2GFBB 2UYLA 5B21A 3MV8B 2EYSA 1LDPL 3N9GL 1OTTD 3L6FB 3CH8A 4QOKB 1V5JA 5DS8B 5F3BA 2C3WA 4WTZG 3U7YH 3NABL 4MB4A 1OAXL 3QUZA 1JYNA 3F6LA 5L0QC 1REIA 2AEWA 4KRPD 4MX7B 3DGCR 2L0DA 4KFZC 2YD2A 4K23L 2D03H 3V6FA 1BD2D 3HZVA 1JV5A 3O6KH 4NNPL 4NQED 3UJIL 2GY7B 4NC1C 5I19L 3T2NL 4PB0H 1A47A 4JY6A 2Y72A 2W91A 1UZ6E 4OGYL 3C2AH 3DYMA 1MWAH 3MOAL 5J7CC 2NXZC 3FQXA 3WXWL 4XMKH 3U48A 1DVFB 4I13B 5D72H 3WUWG 3GJEB 4LSDA 1DDHA 4LCWB 5B38G 4S1SH 4FTVE 1Y6KR 4MAUH 4WTWA 3CZJA 1FC1A 3O6ML 5C09A 5I2IB 4I3SL 3I84A 3IVKA 3AREA 1FH5L 4I0PA 2W9LA 4HX1B 3QXVA 2X4UA 1OSPH 3RGVB 1YEKL 4Y5XB 1HE7A 1FNEB 2WWKO 3J7HA 1N64L 2X5PA 3QP3A 2XT1B 4JG1H 3TJEL 5DJYA 2IAMC 4HJGB 3LRHA 4IRJC 5KSUA 3GMRB 5C09B 1OGAA 3WS6A 1INDL 3HA0A 4NN7C 3STBA 1DUYA 2JE8A 4HIIB 4L8BB 5HHVH 4XXDA 2H32H 1AD9B 3D0LA 5HI3D 3QDHA 3AMLA 1EJOL 1NMCC 4AL8H 5C0NC 2IEPA 4GS7C 3T2QA 4HIXL 2IBZY 4LEOB 4Y4HD 3ZZ1A 4PYHA 1TQBB 2Y5EA 3SCMD 1QHPA 4TUJA 1C08A 1HEZB 2VISB 4MVBC 3P73A 1QZ1A 5IMKA 3RTQA 2F54E 2RJMA 2Z8WC 5BRZB 3AMKA 2FX7H 3BT2H 3OJDA 1HXYA 4HJJL 5IMMA 2CRYA 4YBLB 3PGDA 4J4PC 3DXAA 2ZNXA 3C5SB 1E4JA 2M1KA 5GGTA 3P9MB 3FL7A 5C3TA 1G9MC 1INDH 3F58H 2DWEA 1CDGA 1ND0A 1U8PA 2B1AH 1S78C 1H3TA 5CZVH 3P73B 3MROB 1T7VA 5JXEC 4J1UB 1TVHA 4XNYH 1T1YB 5JA9A 3S4SA 3CSGA 4OCMC 2H8PA 4JDZA 3KPLB 4MNQA 4OQTH 1NCAH 1UZ6F 5FK9B 5E95B 3S36X 4RGNC 3OBAA 4G43A 2FWOA 3PP3H 2CRMA 2ZSVA 5CHNB 4WW2A 5LCVH 4HEME 3Q2CA 2E5EA 2JF1A 3BQUB 1R3KB 4X5XA 2X70A 4JM4L 3T3PF 4GRWH 3WMSA 2GY5A 3MLXL 2EYTB 4ODHH 1G7HB 1HIMH 4GG8B 3ELAT 3RL1A 4D0CB 1KT2B 3OF6A 1QFUL 1N6VA 1OGTA 2E6QA 3GBNL 3VGHA 5BS0D 3F5WB 3BP4A 1CG9B 5B22A 2H1PH 4PJ8A 5C0IB 4UDTA 5ACLA 4MA1C 5A16B 2W65A 1X5HA 4CN6A 3D39D 4FQQB 2CQVA 4X6DA 5E8DL 3DROA 5MEPA 3QIUD 1MQKL 4EIGB 4FXLA 4D0CA 4Q6IA 4X6CB 5ALCL 3DWTA 1RJYA 2HFGL 1S3KL 4F37K 5D1ZA 4JG0H 3MRGA 4XCEB 5E8OB 5IWLA 3TO2A 3D3VD 5IF0A 3AB0B 4G8GA 2BOCA 2AV1A 3C5ZC 4IRJA 4AT6B 1CIDA 3MUGB 4WRLA 4NNXA 5DZNA 2YMXH 4PRDA 2R2HA 2VXVH 1RZIA 2FH8A 4OLVL 1JGVL 1MCSA 1RIHL 3SCMB 4JKKA 3VH8B 5EU6D 5IB5B 4QTHA 1AGBB 4Y4FC 3L5XL 3BH8A 3KPRE 1I85A 4OTXL 4S1DC 4UV7L 5DD3L 3BJ91 4M6ML 1A14H 2X44D 2B5IB 4GKNB 1A1OA 3MLRL 1U8HB 1JWSB 1IAOA 3MRJA 3RJQB 4AT6A 4KMLB 5INCB 1XZ0A 4QHNB 4XC1H 1YYMH 2R2HB 3LQZB 3CZFB 3HMXA 4G5ZH 3QULB 4ZXBB 3FO9B 3P30H 2XY2A 2NY1D 2CUMA 2XG4A 1GL4B 3KPSD 3IDUA 1F02I 1RZ8A 4K3JH 3LKPA 4RGND 4LK4A 4HBCH 4TNVF 1NGYB 2YC1B 4LNVA 5IHUL 3WLBA 5GGSB 3ULUE 4ELKB 2BNRB 3QUXD 1GIGH 4ZFOB 3K1KC 5GGVL 3CZFA 4XCFH 5EFIA 4NHUA 1OAUL 4PJ8D 5J6HB 1HOCA 1RZ8B 4DUVA 4NQSA 4PV9B 1IGYA 3JV6A 1N7ML 2AABH 2IAMB 5F3BB 5KSBE 32C2B 4OFPA 1YEHH 3FN3A 3CVHA 2Q8BL 1CDIA 5JHLL 3EYUL 4M43H 1LEKA 1VKXA 3P77A 3T4AA 5ESVA 1J05B 1OW0C 2ZSWB 1RURL 5FCUH 3H42H 4PBXA 3ZE1E 2R0WH 4DN4H 2AP2A 1OB1A 5MENE 1TPXC 2CMRL 3O2WL 5JOEA 4UT7H 2UZXB 1GIGL 1SVZA 4OLEA 3OKLA 4AK1A 4M3KB 5DO2C 4CU7A 2EC8A 4NQCA 5C08A 3ARBC 1AKJB 2ADJA 4F7EA 5A43C 1H5BB 3ARDA 4DKAA 4YHIB 4WO4D 2XNAA 4N1CA 5C9KA 1J05A 3QEQB 4LOUC 1W8OA 5DJ8B 4NC2B 3RUGE 1MFNA 4LQ1A 2P42B 2DQJL 2MTPA 1U93B 3PWLB 2Y6SD 3LPWA 3I3DA 5ADOH 5LGJA 1RFDH 5EA0L 1RUPL 5EU7E 4ZFGL 5I1CL 4FQHA 4NUGH 4H88L 4ONFH 2DLIA 2Q7YA 4RWYH 1ACYH 1DQDL 3IFNH 3LS5L 1A7NL 4PP1D 2NR6C 4Y2DD 5D2NE 3S9DB 2DM3A 5H2BB 4R8WL 1S5IH 4QO1A 1NCWH 3BIBX 5KSUB 5GHWL 2VH5H 3G5YA 4XP4H 3VFNB 3ARFA 2ZUTA 3UTPD 5BQ7A 4KTYA 1P4LA 2X41A 3HE7D 4U1LB 5DZOA 2VDML 3FO0L 1U8LA 2PETA 1BBJB 1UKQA 3TCLA 2ZCHL 5FYKL 3D2UA 2V5TA 1KJMA 4OQ1A 5CEXA 1N59A 4F15B 1ACYL 1DQDH 1MCQA 1T5XB 3I6LE 4LSSH 4NO3B 1IGFL 4X7SH 4QRPA 1CN4A 4U1LA 3EYOA 1I1AC 2OP4L 4LPTA 4Y1AE 1WWWX 3L3IB 1Q38A 4CRPA 1U8MB 3PE9A 4OZHE 4UQ3B 3MMEB 1U0QA 4LL9A 1ZA3B 2X10A 3KLAA 2IBZX 5CEXB 3IXAA 5AAWA 2RFXA 3AGVA 5ITBL 2YD5A 3RI5K 3WJLC 3O6LL 3BH9B 5I8EB 1JV5B 1HHGA 3PNWA 4OZGA 3EOTL 5CJOH 4XHJC 4NQXA 3QIBC 4WWID 4NO5A 5FUOL 1MFEH 1YY8A 2OI9B 2R2EA 3FRPG 3QCVH 3HS0A 4A6YB 1BBDH 3MQIA 5BW7C 4GXUM 1X5IA 3ULVE 2BNRE 3ME0A 3ILQC 2IPTL 2PKDA 3IKCA 1UWEL 3KNBA 2RFXB 4PGEA 5AWNH 1VFMA 5IHBA 5MP6L 3FO2A 1A3LH 4G9FE 3S88H 5IB2B 1ZANH 3HUJE 2VSCA 2FJFB 1CD1B 3OB8A 1P69B 3U0TA 3Q6GL 1FYTD 4P5MA 1UCBH 3KR3H 4X6EA 5JDJA 3LV3B 4KKLC 5EN2B 1NAKL 4AIZA 4JO3L 4RAUA 4HXBH 5CJ8A 4GW5A 4PJGF 3T0EC 4WUKH 4FQCH 1CD1A 5DFVC 3WFEH 3Q1SL 1TXKA 1TFHA 3LIZL 4XXDB 5TDPB 3BE1H 1YQ2A 3UYRH 1PAMA 3L3KA 2BMKA 5EU3B 1MCIA 1OQXA 2OR9L 4PJAB 4MDIB 1IGML 3QFDA 3MOQA 4ZFOL 5F7NC 5KS9B 2XTLA 3JBG7 3SDYL 4YXLL 1FCGA 2GTWB 1XCTA 4MA3B 3ZKMD 4YHKH 5D96C 1U3YA 4G80A 3QQ9C 1IC1A 1Z0MA 5IMKB 2X9WA 1N5YH 4OGXH 4IOIB 5BVJB 4M7LL 1FIGL 5DF0A 2YWYA 4EN3B 1AGBA 2IG2H 2H2SD 2XQYG 4BQ8A 2QR0A 4P4KD 3QDGB 4N0CC 5IHLB 1AE6H 1I3RB 3HRZB 4KK5C 4PRPE 4OUUA 2E7CA 1ETZA 1CFSA 2YKLH 3DECA 4P2OA 2LTQB 4E42B 1PW3A 4HCRH 5EO1B 5JXAH 1T7ZA 1VFUA 4P3DB 4CBPA 1YJDH 4XB7A 2LFGA 2VAJA 3FO9A 1UKTA 3OZ9H 1TZIA 3EOAA 1W0VA 5DEGA 4ZTOH 3G6AB 5DMYA 1HKLH 4N8CL 3FB7A 4YBLC 5IFHL 3QZWG 1WC7A 2HKFH 2YA1A 5IGXL 5FFLA 4DEPC 3RKDD 4LSUH 3UJTL 4XWGL 4KY1L 1OP3H 1I3GH 4NRXA 5A3IC 4NJAL 3X11B 4LDLB 2YEZB 2WK2A 4ISVB 3G6AA 2C1PB 4HWUA 2BOBB 5F88A 2P43B 3OAUL 3ZSSA 5MI0B 5ITFB 2CD0A 5TQ2L 4PY8I 5MENA 1CU4L 3EFFB 2V9RA 3C60A 3VXUA 4JGJA 4JZNA 5IMOB 2JCCB 1BFOA 1NGQH 4OZHF 4GAYB 2W65B 3H9HB 4XC3H 4JVPA 4QHKI 4KI5C 4WVRA 3PL6B 4Y4KA 1BQUA 4P5KA 3S3SA 4HK3J 1GH7A 1Y0LA 4AM0A 2H3NB 1I4FB 2BOBA 3PWUB 4MCZA 15C8L 3BKJL 5I0ZA 4U1MA 5DSCB 1KENH 4OLYH 1BWWA 3AUVA 2FDBP 2X4NA 3C60B 2KH2B 2NQCA 3MLSL 4BM7A 2BFVH 2VLRB 1R3LA 4E0RA 1LEGB 2DOCA 4ODUA 3VFTA 3KYAA 4OGZA 1ZT4B 2QQLL 4LLDB 5HHNB 3S35H 2WINB 1FAIL 4K8RL 2YA2A 4GQ9H 4QRSA 2I07A 3LHPL 5DK2B 3PG2A 2EDYA 5T5FH 4HWZA 3GSNA 3IU3A 4OKDA 2BXYA 3JSSA 4UUJA 5EORH 1ZHKB 3CCHB 3QHZH 4JR9L 3HMXH 2GFBA 2UYLB 4PJHE 2ATKB 3DI2B 2JK5B 5KVFL 3MZTA 1CLOL 1P9MA 2P8MA 1IARB 4OCYH 1FJ1B 3A6OA 5J8OA 5GHWH 2VC2L 1F42A 3WL9A 3MGTB 2CKBH 2NX5D 5CGMA 2ADIB 4HH9B 4ZS7L 4IMLB 5ALCH 2BHZA 5TE7H 3KJ6H 1W0YT 5HYSA 4JM2D 5I1EH 3QWQB 3PWPE 4U7SA 3UTSB 4QXWA 1XGPB 5FYLH 3BSZH 3UJTH 4NJ9H 3O6FB 4P46D 1V7NH 2D7NA 3MJ9A 3PHOB 1CL7H 4PJ8C 2JK5A 4PJHF 3VXOB 2JKXA 1HYRC 2BSSA 5SWZD 3WS6C 2NW2A 2QHLA 2WWMC 2DDQH 4XVTL 5E9DB 2ID5A 2D7PA 4HQQH 4KI5D 4QY8A 4JN1H 3UTPE 4K3EL 1P5VA 4Y16C 3VU2A 5B3JF 3AVEA 5DEFA 2X1PA 4RQQB 3W9DA 1EHXA 4NQSB 2VOTA 3KHOA 5F1NB 1LP9B 4KHTL 5JR1H 4KRPB 4BFEA 4V1DD 1DQQB 2CMRH 2O26U 4Y5YC 3FZUD 1ZLSH 2WUCH 2YSSA 1S9WB 5ESVB 1H9VA 3ULUL 1EUTA 1RULH 3PGCB 3QXUA 4M3JA 1LO0H 5JPNB 5MEQA 1GZPA 4YUEH 2X4UB 3RGVA 4HJGA 4NCC2 2XTJD 4Z8FL 5LQBH 1GXEA 4NO5B 3TH4T 5I6XC 1S7WA 1N3NA 4M7JH 3VRJA 3BN9D 3LEYL 3QIWA 4Y2OA 1F4WL 3DETD 1MIMH 3EDJA 3K74B 1NEZB 3IT8D 1X5YA 1SM3L 4YX2H 4LCUA 2D7TL 4MQXC 2VE6A 1EBAA 2GEEA 4DKFL 2IPUG 4P23B 5F8QC 2N56A 4FNLL 3ZHDA 1N3NB 3MRIA 2Z35A 4RMSA 4JFDE 4WDIB 2O5XH 4KK6D 3VRJB 3A6BL 4E41E 1G9NH 4APQA 1JGLH 2F5AL 3KYNB 4IJ3B 4ZPTA 3RBSA 1WFOA 4U1IB 4N8PA 43C9B 1GVIA 3G08A 1WV7T 5DGQA 4LBEB 4CNIB 5T1KA 3RHWK 1XF2B 1X4XA 4XCNA 2VABA 4OD1H 3CUPB 4ETQB 5DHVA 1IE5A 1ZT1A 3HE6C 5LAXA 2BCKB 3DUHA 1RZKC 3WHE0 3MV7B 5DMKB 2ATPB 3PWPD 5F6HJ 4Y5YA 1Z0NA 1ZANL 4ZOCA 3W82A 3ECBA 4P2QB 4YLQT 3LKQA 2P8PB 1NDMA 1YMMD 2I9LA 2Y25A 1ZLVK 1BBJA 3JVGC 1UJ3C 4F7PA 3QFDB 2ZSVB 2FBJL 1E6JH 4KI1A 1KJMB 2EKSA 2EDDA 1JGLL 2DQJH 5C0JA 2E6PA 3D6GA 1N6QH 2NY7L 1ZT1B 3VXSE 1AXSA 1WEJL 3RNQB 2IADA 5T3ZL 3ULVC 2W38A 3ALXA 1S3KH 3BGMA 2NX5A 3O8XA 3MA9L 3BQUA 1SEQH 5D7KE 1KT2A 3WDJA 3GSRA 5HHXH 4JM2F 4HFUH 5BRZD 3W9EB 1E6OL 5F9WB 4DWHA 5DLMH 4LNRA 1EXUA 2A9NL 3H0TA 4KZDH 3K4DA 5T5NF 1NBZA 1GZQA 1A2YA 1M71B 5FKPA 4Y5VB 1GAFH 3PDGA 5GZOC 1IRAY 2PTTB 3S37H 3U9UB 4EZMA 4I18B 3DUUB 4XCYA 5IW1B 3EDEA 3D48R 1A6ZB 3EOAB 4FTVA 1T6VN 4Z77B 4KK8D 5KVDL 4WEMB 1NUGA 3DOSA 5C0BE 4MVBD 4X98A 4UIMB 3QCUH 5A2LH 5EBWB 2ICWI 3QJHA 3MA9H 2AJUL 4WJ5B 1UZ8B 5DI8B 5DVMA 3Q6FB 3E2HB 4FQIL 5C86A 3G6JB 4OD2A 2GJ6B 5IMLA 3MLYL 3GHEH 4XTRD 3L95A 4G8FA 3C08H 4NN7B 4RZCA 4D9RD 4QHKJ 2XQBH 3MA7B 3DBXA 3F6IA 2CDFB 1A7RH 4EDXB 3AS3A 5KANG 4XXCC 3T0ED 1TZGH 2F58L 1SMAA 5CILH 3V4UL 1LE9B 3G6DH 4IS6A 1G84A 1I1FA 3VFPB 3Q5YA 5F8RC 4LSUL 1QEWB 1BF2A 5HYEA 2E27H 5CSGA 1LD9A 2Z9TA 4XP5H 5I8KH 3BP7A 4QRPD 4CN4A 2WIMA 1OTUD 4AZ8A 1MFBH 2ARWA 3CX2A 3LH2L 4J3SA 4LDOB 2A0LD 4TPRH 3R8BB 3S7GA 4PJ9C 5GJSL 1FV1B 2EC9T 3QULA 3NIDF 4UV7H 3WFCH 1LWRA 3VGAC 1NGYA 1GHFL 3KXFE 3U4BH 4KJWD 3MCG1 2VXQL 3MZGB 2VLRE 1TITA 3V6OA 3EZ8A 5JA8B 1CWVA 3MUZ1 5I75C 5ISZE 4WHTA 2O61A 1DLHB 1NC4D 1AHWB 4D9LH 2YBRA 3WKMH 3PABA 3UCRA 1BFVL 1QFHA 4RMQA 4HT1L 1NJ9A 2GSGA 1UCTA 3IRPX 3MRFB 4WTXA 3QDMD 3DV6B 2BC4B 2R4RH 4UZGA 4KI5F 5D71L 4QRQB 4RMUA 5EOTB 3FOMA 1T21A 1FO0H 1LO5B 5GGVH 2R1XB 5IFAH 1M7DA 4MD0A 4YZFF 3QXAB 4JKPL 4MNGA 5HYSB 2J6EL 5I8OH 5HHOD 1YEKH 1OAUH 2V7NA 2HT3C 5FA3B 3CFKA 3BD5A 3E6HA 4DUXA 1CGSH 3RL2A 4HG4K 1MRDL 2DM2A 1IC4H 5H37H 2Q6WA 5E9DA 5DRZA 2GSIA 3MV7E 1VPOL 1G7PA 5TQ2H 3SE4C 3QDJD 1RJLA 2PCPB 3QDJA 5DJ0B 3M8OL 5T1LA 3IJHA 3KG5A 1JGDB 4RMRA 3WS3B 3KVQA 4NYLB 3CVIH 3HMWL 3CFKB 2AXFA 3SJVB 3GIVB 4P2QE 3NCJL 1G7JA 2YR3A 4JKMA 1RVFL 3LMJH 1RK1B 4N8VG 3V9FA 4FQHB 4LAQL 4EEEA 1U8QB 5D5ME 1OARL 5JO5A 2VZVA 4QWWC 3HI5L 5B39G 1J8HA 2NY6D 5SV3A 3RA7L 2Q86B 5FYJH 3QQ4B 5HYJB 1IGTA 3ZYJA 1AC6A 2CGRH 3JUZA 3CPLB 1I9JL 1RI8A 2ZCLL 4ODTH 1RZGB 1EFXD 3RAJL 1JIBA 4K71B 1L6ZA 5IB4B 4U1MB 3RUGF 5IJKA 4LHJB 4LGPB 4QGTA 2MCG1 4FXKB 3QA3A 3GSOB 3WFBH 3PV6A 4YDJA 4OZ4A 2A6IA 3TM6A 3L9RB 3K4ZA 2P5ED 4LOUD 1ZLUH 3VFTB 1IGTB 4NSKA 2GUOB 4H8WH 1BFSA 2X4PA 5EUOA 2C3XA 2HVKB 3I6GA 4M7ZB 5E2WL 1HCVA 1KIRB 4YE4H 4ZO6A 3L3OB 1K5NA 4DKEL 3OV6A 3CX5J 3G04A 3SE8H 1EEZA 1QR4A 1OAKH 3KGRA 3OMZA 4UUJB 2X05A 4F57L 4R7NA 5CCKL 1HI6B 4CU8A 2CJUL 2BJML 4DCQB 2V7HB 3FQTB 1DLFL 5IVZB 1FO0L 1KB5B 1DN0B 4JB9H 5D2NB 3DTXA 3PWNA 5I15L 2GUOA 3MGTA 1YEGH 2DBLH 2MHAB 2Q3ZA 1EEYB 3KLAB 4GXVH 5CEZL 1JPTL 1QFUH 1UH4A 4N9GA 4F58L 2FSEB 4R7NB 1XF5A 3SDAC 3UZQA 2GIYA 1VESA 4JAMA 3M17A 2Y36H 1T2QL 4DCQA 2Z93B 1WCBB 1HYSC 2HA1A 2HYMA 1BOGB 4YE4L 3S36H 1NUNB 5ECJE 4PLKC 4D9QE 4PRIB 4JFEE 5DMIL 1MCWW 1IM3A 4L4TB 4F7TA 5JR1L 4MJ2A 3VG0H 5DUBA 1EUUA 1NMBL 2X1WL 3QUML 1QO3A 1PEZA 1WCBA 5IW3A 4LCYB 4MJIB 3G6JF 4XPGH 3MO1B 3UO1L 4M8QB 1JPFA 1I7ZA 4GAJL 3GIZL 4U0QB 2LE9A 5IQ7L 3BESR 2CGRL 2BY2A 4BZ2L 1EFXB 4GW1A 1QR1A 3GMOA 2XWTA 1OAZL 3D39A 5CBAA 3ZT5A 3NVQA 4OBSA 3EO9L 4NPYB 5I1EL 3VXMD 3MXVH 5DURD 3BX7C 3RVWC 3HB3C 5I17B 4Y89A 2DQGH 1GZPB 3UYRL 4ONHB 2L4OA 4F9PC 4EOWH 8FABA 4MJIA 5FB8A 3TEUA 1S7WB 4PY8J 4CUCA 3U7AA 3S3JA 1S9KC 4MJ5B 5IT2L 1U2CA 3CXDL 1YN6B 4FFZL 4ELME 3B9KD 3ZHKA 4JFXA 4NPYA 1AO7D 3IDJA 4YBHA 5CAYB 3QJHB 3OHXA 3BN3B 2NPLX 2P8LB 1KJVB 3O3UN 4OCSH 4RX4D 5GZND 1CGUA 4HKXB 3MCLH 3SQOH 4ORGB 2DN7A 1YUHB 5HGHA 1AE6L 3RA7H 2NXYB 1WZMA 1SJHB 3P11H 4O2CA 3OR7A 2VAAA 2A6KB 1FH5H 5DLML 2EDFA 2VR9A 2DLGA 3H3PL 1FGNH 4J2XA 3I3EA 2X89D 2ICWA 1ZMYA 1U3HC 2C5DC 1K85A 5DUPH 2HH0H 3IDGA 3C9NB 3CAFA 3B3IA 4LRIC 4EN3A 4MAYC 2JB5H 2PO6C 4PRPD 1H3GA 1XT5A 1J0JA 1IC7H 4NKMA 5IIEA 2X1XR 5CZKA 4O2CB 1NC4A 1EVUA 3FQWB 3JUYA 5BV7C 4R8WH 2MQ3A 4D8PA 2BNRD 3QUXB 5JORA 1S7VA 5C6TH 3HFML 3GJFA 2QTEA 3NH7L 3C9NA 4D9QD 4ELMB 1WC7B 4I8DA 4G6JL 2XN9E 2BDNH 3PWVB 1MI5D 4NKMB 5D2LB 3VXRD 2DWEB 1EX0A 3MLUL 4NN5C 4O02H 2F8XC 1OAZH 1DBAL 1YNKL 4X6CF 4JDTL 2WWMD 4OQTA 4XHQA 4HK0A 3DRTB 3U0WH 3KLHD 3S4SB 1JFQL 4KUZH 2G75A 5FIEA 3QUKA 1EHNA 1BFOB 1I1CA 2IBBA 5BXFA 3FOMB 3DVGB 2XRAL 5E2UL 3GSXA 5C07B 3ESVF 3EFFA 2EE3A 5ANMB 3OF6D 1F5WA 5DMIH 3CJJA 4RDQG 3T0WA 1DBKL 3TBWA 1VPOH 1LNUB 5EC2B 3IU4L 5F7EL 3OB0K 3H7BB 3QUYA 3VWKD 1E4KC 2FHBA 1Y0LB 1BQLH 4NFBA 4YEEA 2XA8L 2Q8BH 4CDGC 2I60L 1TJGL 5BXFB 5J1SC 5ITBH 2OTUB 4N5ED 5I1DA 3N06B 1PZUB 3ZMRA 4KRPC 3QIUA 1PKQE 2X4NB 4G8EA 3OXRA 1DBML 4ODVL 4ZSOE 2I24N 5I1GH 1J8HE 2AKRB 4URTB 2PNDA 3EO1B 5IBUB 3VFRB 5MEPB 5JOFB 1K6QL 3B5HA 3NPZB 4YHKL 3LKOA 3DARA 3CK0H 3O45A 4RCAA 1V3KA 3QDGE 4LSSL 3STLB 1FYHB 2OTUA 4J3OC 3VFPA 5D7LD 5KOMC 3VXPB 3MUJA 3RWIB 3W2DH 3O3EA 4DN3H 1FNAA 3GRWA 1OSZB 3KXFD 3MRBA 3WFCL 4EDWH 3AREC 4I0PC 4KHTH 1NAKH 2CRIA 1WZ1H 2K9UA 5GS2H 3T3MF 2VXQH 4XVTH 3BP7B 3RTQD 3VRIA 5K59E 3CLFH 4GMTL 4QHMA 3Q6GH 4JHBA 3RGVC 5I1KL 1EFQA 1ZHBB 4UT6H 4XVJL 4MLSA 1CS6A 1P1ZA 4EVNB 3O3AA 1XGRB 4YGVA 4NSKB 1A1MA 3K3QA 3BP6B 2OX5A 1F11B 4QOKA 2HLFD 2NZ9C 1DZBA 1KACB 3E1F1 1GPOL 3SE3C 1OT1A 5E8EA 4PJ5D 4LKCB 2R23B 3MRMB 5D8JH 3NCEB 1VCAA 2NYYC 3QPQD 4DFIA 5KN5B 4FTVD 4DEPB 1A3LL 1QBLH 3SY0A 3IDYB 1OAXH 1KULA 1MPAH 3NABH 3EO0B 1AH1A 2B4CL 2EEBA 3P4OB 4H1LA 3V7AG 3FONB 4OZIA 2DQDH 1P7QA 1N5YL 4XPAL 4M62H 5EOCJ 4L9LC 2D31B 3VXRB 5JHLH 1KCSL 2XPGA 3HE6D 1J86A 3G5XB 3RY6C 1QSEE 4ZUUA 4QLRA 1FPTH 1MCKA 1E28A 1Q0YH 5CMAA 2R1YA 2GSIB 4MNQD 3OAZK 3QG7H 4LVNC 1R3JA 3TN0B 2VZ1A 5HBBA 1A0QL 3L3GA 4WUKL 5BO1L 1E4XI 3O9WD 3ZKMC 3D18B 2VLKE 4YHYB 4CVUA 3NOIA 3U79A 4I18C 3D85D 1QR1B 1IKFH 4AENB 1WIOA 2Z0BA 3DUSA 1YDPA 4JY5H 3T0DA 5HYJA 2BVTA 4BQBA 2WUBL 4OT1H 1JHLL 1AD9A 2V5YA 5BOPA 4LVOB 4OCLC 4APQD 4HS3A 2DD8L 2FO4B 1JRHI 3ROLA 2V6HA 1FNSH 1R3IH 4JFFB 4Q6IC 3G6JE 4GH7B 2EH7L 3QA3B 2DAVA 2R8SL 4S1QL 1LMKA 1C08B 3TT3L 4PJHA 3CUPA 4UINH 5TE4H 3SQOL 2FX8H 1C12B 1MCEA 3NIDE 3QSKB 1P4BL 4DOHB 2NY5L 4C83B 4F7MA 1CFVL 3OHXB 4Q9BA 1SEBA 4HIIA 1HXYB 5L2JA 2HLFC 4M6OL 4F8TA 4BA8A 3ECBB 3D0LB 5IGXH 4B41A 2DI8A 1V7ML 5LXGH 4RGNE 3CGTA 1WIUA 2IQ9H 2EE2A 4XPTH 2BY1A 4OLXH 4LFHG 4PJFA 4GQPH 4L4VD 5ADPH 1L9MA 4ZXBD 3HAEB 1TNNA 3CDYA 3WFHB 1AP2A 3IFOA 1PG7W 3AB0C 1NMAL 4CADB 3JWOL 4K7FA 5SWQA 4U4BA 4JQIH 1A1NA 2Z92B 4W4OC 1MQKH 3MV8D 3CVHL 4PJ9B 3NA9H 4N9GB 4QTIH 1K4DA 1RZFL 3GHBH 4UB0L 5B8CB 2X4QA 3A6CH 1FIGH 2HFGH 4P59L 2Z93A 5EBGA 3MCLL 1CR9H 1U8JA 3FQWA 4Z77A 1NLBH 4MXVE 5D2NC 5GGVY 1A7QL 4JHWL 2F8VA 3NCYP 4K7FB 3REVA 4RMVA 1S7VB 1FSKB 1I1AD 1NFIA 3VW3L 1V7NL 4YDLB 4DJMA 4HJ0D 5HDQL 1OGTB 4W81A 3AU1B 4G43B 1U3ZA 5SWSE 3IDNA 4P2YA 3TNNA 1A4KA 2VR4A 1UZ8A 2FYYB 4ALAH 3DROB 3BDYH 3QG6A 3WFDL 3U4BL 1HK6A 1PEWA 1BP3B 1HQRA 3IFPB 1FGVH 4OKVA 5GRVK 3KPRA 2B7DT 3ABZA 4NP4L 2VJXA 4YDVA 4GS7B 5F7LB 3DBXB 3P30L 1TPXB 4M1DH 4HKBA 4LCWD 1BVLA 5EC1A 5LGKA 1QEWA 3VE0A 5FDWB 3KPQB 2CLRA 4UAOC 1R6VA 1SY6L 3ARZA 4U1JB 5DURB 2ORBH 3LRGA 4X6DB 4UQ2B 3MFFB 2Z31D 4HF5L 3KPRB 3CXHJ 5FA4A 4U05A 3V4UH 1MAJA 3FT3A 4IMKA 1OCWL 2W59A 2VDKH 1JUFA 4LQFH 5IB5A 1KJVA 3IXTA 1GOGA 3B9EA 3QBTB 1KCLA 2F15A 2XV6B 5TE7L 5C0CE 5DMJB 4MMXC 4YFDB 4FQ1H 5CJ5A 1JGVH 1RIHH 1WFNA 2AV1B 4JFPB 1AO7A 2MFNA 4D9RE 1EK3A 4OGXL 4TSCH 5C0DA 3HI6L 1OHQA 3SGEH 2ZCKL 1KCUH 1R24B 4L9LB 4PRNA 4K8RH 1ORSB 2C4XA 3SKUD 1C5DA 5EOTA 1QBAA 5HSFA 3QISA 5HYFA 1M7DB 2XG5A 5KS9A 3WO3B 3SGEI 2G9HB 4KZEL 2VIRA 1IAOB 3UP1A 4QOKE 5KTEH 3TVMC 4PGJA 3OPZH 5CGTA 4MXVF 5KW9H 4QHMB 5DD1L 4IRSB 3ULVL 1RMFH 4EKXA 3QXAA 3UAJD 5DFWH 4DQOL 5IV2B 4Z0BL 5C07D 4LIQL 5C08E 4MAUL 2JJVA 3OGCA 5DRZB 1DEDA 1ZHNB 3NPSB 4P4KC 2EECA 4QXTB 2EE9A 1JWMA 4FQXC 5EPMA 5C6PB 2VIRB 3OKDB 5SX4H 4H20H 1MRCH 4XBPA 3MBEB 3KWWA 3MLTB 3O6MH 5E9DD 1YY9C 3BRDA 1PY4A 1W0VB 3MCKB 1FBIH 4NCC1 3JWDC 2G60H 2XTJE 1ZS8A 1NCDH 5BCAA 1YEEH 3DVGA 2V2XA 5CEYB 5I2IA 1KELL 3P0YH 3CH1B 3VW3H 2PYFA 1F90H 2C1OA 4FFYL 1U58A 1CICB 3KLDA 5I1KH 1S7RB 2AK4A 3T4YB 5HY9B 1HNGA 4Y4FB 1J1OL 3TT1L 1IGJB 4X5LA 1I1RA 3SKMB 2BRRH 3DSFH 3WFDH 4LSTL 3TO4B 4ZTOL 2XKUA 1JTTA 4HJJH 1YMMB 1U58B 3I75B 5DQ9A 3L9RA 5GJSH 5AUMA 1RUAL 3PWPB 3UTSE 2M8XA 3LKNA 4L4VA 4LEOA 4KROB 2AEIT 5H2BA 3VD5A 3QCUL 3LKOB 1K5NB 4GRLA 2YZ8A 3O3DA 4XWOD 3KPTA 4Q0XL 1B0RA 4F58H 3QHZL 4FQXA 4X4MA 2DQUH 1KGCE 5FV1L 3UTQB 3DPBA 2E8ZA 3MV8A 4HT1H 4G6FD 1P7KB 1AHWC 3L6FA 2RHEA 2E9JA 2DRUA 2F54B 2N7AA 2VLRA 3G6DL 4YH6A 1KB5A 3V6OE 2FX8L 1O7SA 3QWRD 4J4PA 4X8JA 4WUUA 4OF7A 4Z7VE 4OZFA 1KGCD 4YHLL 4PJEA 5C71A 3ARVA 3HG1D 3TC9A 3MROA 3KPSA 3WEXA 3DX6B 1A9EB 4NUJA 4OLZH 5FCSH 4O2FB 5SWSA 2FX9H 1VGEL 2G2RA 4RGMB 4JY6B 4PREB 4DUWA 2R23A 3MRMA 3D69A 3SPVB 5GGUA 1HDMB 3MYJA 4PV8B 2FR4B 4G9DB 4P9ML 3HZMB 3GJEA 5CWSB 2DQHL 1BVZA 3GMNA 1S9XB 4HMCA 3QHFL 3NFPA 5GGSY 3LS4L 2KQMA 3LN5A 5J6GA 2DQEL 2YK1H 4X9IA 1UXWB 3NACL 5TGBA 1J8HD 3PHQB 4RGOL 4U6XA 3QEGL 4MA8L 2I5YL 2NW2B 1NANI 3U7WH 4GW1B 1EV2E 1XGYL 3BP4B 3GMOB 2X4QB 3EJZD 1B0GB 4NZTL 5T3ZE 1MELA 4LLWA 4A2MA 1WICA 2DMBA 4PG9A 5ALBH 2NY4B 4HUWB 3BXNB 2VZSA 3ULSA 3BH9A 5I8EA 1HSBA 2BSTB 5FF6A 3RVTC 3B9KB 3RI5F 5K9JH 1UXWA 4HS8H 3WE6A 3QNYA 2NY0B 3UYPA 1U95B 3HS0B 2NLJB 4TVPD 4A6YA 4LARH 1CQYA 1ZGLM 1AO7E 4JRYE 4LKXA 3D3VE 1KFAH 3QRGH 3EYVA 1EH9A 1A7PL 3RVVC 1GHFH 4H0HB 3C5JA 3PGCA 4M5ZL 4OFKA 4Z7WE 3VXTA 5H35A 1WSST 1OAYL 5FM8A 3VXMB 5J4MA 2EDJA 1ES0B 5D70L 4PJBA 2XFXB 5DC9B 2CK0L 1RIVH 5HGBA 3QRFM 1GGIL 1SJHA 2BZDA 3O41A 3GSQB 2UY6A 4R7DB 5EUOE 4U1HA 3SDDC 3U1SL 3VXUD 1TJHH 4LCCA 4PJAA 2OL3B 1MCRA 4MDIA 3ROLB 3ZDYE 3JWNC 5E94A 3BEVA 5HVFB 4ZD3L 2P5WB 3VA6A 2VE6B 1CTNA 4HS8L 3C60C 3MR9B 3BWAA 4WTZA 3HR5B 2GT9A 2GTWA 2R0ZL 5JUEH 2WV3A 1D6EA 4POYA 3GUTA 1OF2B 4NQDA 2R56L 4YAQB 4BQCA 5F70A 5HGBB 3QUXA 5JORB 2VXTL 1OAQH 3HG1E 1RUQL 4MD5B 3MV9E 1SBBA 4P5TD 3WN5C 2PXYA 3QFJB 4W70A 2YUWA 3SDAB 4P99A 4FHBD 4P3CL 3L3JA 2EIZA 1KIPA 1QSFD 3NCYS 2D03L 3O2DH 3SE9L 4ERSL 1ULVA 2J6EH 1UWXK 2GT9B 4W6YB 3LH2H 3GKWH 1N26A 2HT2D 2X70B 1X5LA 4BZ1H 5C70A 3DRTA 1ZE3C 4PUBH 3QFJA 4KU1A 1I7RA 4PLJD 3EOBB 4UILH 1NLBL 4FABL 1LE5A 1A6VH 4KXZI 1IM9B 1KOAA 1BZ9B 2AK4E 4LLMA 3OZ9L 5ANMA 3HHRB 5FUCE 1SYVA 4H5SA 4OFYA 5EZJA 1QVOA 3AXLB 5C08D 3BJLA 1MCBA 1J0IA 4S0SD 4OF8A 5IVXE 3EOBA 2H41A 3DX9B 3D39E 1JGEB 3HNVH 4NC1E 1AI1L 1WEJH 4WENB 3V5HB 1CDHA 5C2BH 4RX4A 5D1ZB 5HXMA 5KAQF 3ZTJH 1A4KB 1T2XA 4Y5VA 5AAMA 4K9EH 3MBEA 5TFSL 3QIUB 1NFDF 5C0BD 3VCLA 4OTXH 3P0VH 4X4ME 4ODWA 5DJ8A 4MCZB 4RFOL 3BIKB 5DQJB 4XP6H 2AVGA 3TIDA 4L3AA 4JM4H 3N1QC 2ZG3A 5JOFA 4GKZA 1KEMH 5DT1L 5HDOA 3FFCD 1UGNA 3TYGH 4M03A 1HIML 4PJIE 4UV4H 5DJ2A 1CICA 1Q0XH 4PJEE 1ZT4A 2VXTH 1U8HA 3MRJB 2F53B 3S5LG 3KPSE 2FATL 3O3EB 1NLDH 4XPBH 4AM0B 1ZVSB 5JW4Q 1I4FA 4YQXH 2B0SH 4XX1E 1G6RH 1WLHA 1JUFB 1ZHKA 4C4KT 3D9AH 2QQLH 2DTML 1LK2A 3TA3B 5K9KB 3L7EA 3O2DA 5D70H 2J6EA 5FYLE 2HP4A 1QYGH 1JHTB 1NPUA 2MWCA 4IDJL 1I1FB 5EBLA 8CGTA 5HTSA 5AUMB 4M5ZH 1QRND 1A1MB 4KVNL 5EU6E 5IM7A 3STZB 5IK3B 3V95A 5D7SH 4H26B 2JJWA 2NY2B 4WUUE 1WTLA 3K0WA 3HUJF 5DJZA 3SGJA 1KN2H 3RWCA 4HWBL 4QCIA 3T2OA 2DIJA 4PP2B 1AJ7H 1JNNH 4YJZL 5FUZL 3LVEA 3OKNA 1F6LL 3FCTB 4ENEC 1ZA3A 2OQJB 5I16B 4UT9L 2BXZA 1UJ3B 3BRFA 2YD8A 3DSFL 4MD4A 2EDWA 4PJEB 5FO7A 5MI0C 4RA0C 2GK0A 3CSYB 3ZE0F 1HHGB 3PNWB 4XX1G 3F7RA 5CEZD 3RNKB 2GSGB 2H26A 2XZCH 4G42A 2DD8H 3S35X 2EDXA 1IGFH 4YFLI 2BSSB 1XGUA 2AEPH 3EYQD 1VFOA 5DR5H 4G9DA 4IRSC 4KGJA 3GM8A 5FKAA 3MV9B 3GM0A 1G7QB 3HR6A 1T22B 4AENA 5CIPH 3T0EB 4EQ3A 3HLAA 5LGJB 1Q0XL 3TBTB 3FO1A 4FQJL 3SDDD 4LFHD 5HYQB 1M7IA 1U3JA 5DRNB 4ZAKA 2FX9L 4P3WA 4C58B 4P5MB 1LDSA 3CK0L 5FKAB 4TVPH 1S7RA 3QUYC 3RVXC 5EN2A 4QRRB 2V2TB 3TBYB 1GC1C 4UBDD 5T1LB 5TH2B 4LIQH 3D3VA 1A02N 4J6RL 3T0EA 5E6IA 4MSWB 1NKRA 3MODL 4RMWA 1AQKL 4F80A 4ETYA 2D2OA 1RK1A 5IG7B 2JELL 3RDTA 2DDQL 3FTGB 4JFYB 1AQDB 1CR9L 4Y5XA 3JTSA 3C6LA 4KDVA 1KBGL 1MCDA 3C5JB 5H35B 1MLCA 1RZGA 4LBEA 4CNIA 2F19H 3CXDH 3M45A 3W5MA 1AGFB 1YPZB 1QBBA 3OTTA 4HIJB 4PJAE 4TVPE 4AIOA 1FRGL 5IVXB 3H9SD 1FG2B 1B6UA 2BCKA 1YNTB 4JHAH 4LSVL 1X9QA 3DVFA 4XPHH 4KHXH 4CADA 2UZIL 3E2HC 2OBGA 4XNZB 1PLGL 2ENYA 3KYOB 4E9LA 3OQ3B 3FTGA 1JK8B 2DQFA 3HAEA 4MYWB 3ARXA 2UUDK 1P84J 2A9MH 1Y18A 2AEQH 4G7YH 3E8UL 2FB4H 5M94B 1U8MA 4JFZL 1K4DB 1HH9B 4MHHI 2ED7A 1JHKL 5L2KB 4NRZA 4TRPH 5EZIL 3WD5L 4LVHC 3Q3GB 5F7YC 2XWJB 4KQ3L 4U7MA 2GHWB 5L7XH 5TPWL 1TZIB 4HZAA 4MD5A 1AGDB 4O2EA 3FQTA 3V6OC 1QYGL 1MNUH 1U91B 4Y19E 5C7XL 3L3DB 3QFJE 1NAMH 5HD8C 1DP0A 1J9CT 2X4SA 1FLRH 2EKSB 4WFED 2WBJC 3W0WE 4X0KA 2ENSA 5MHSD 4WY7L 3HZYA 3VI4E 5TE6L 4LSRL 4C56D 3VGGA 2EDLA 2FHCA 1HHHB 1IAKA 2EDQA 5DHYB 3HPLB 4KK8C 2HLAB 3DURB 1KPUA 2W9EH 3D25A 3TVMA 2J1KA 4HKBB 4PRIA 3VMOA 3NA4A 4KJWC 5D7JA 1J5OL 4PG9B 3BGFC 3H3BC 1D5XA 1YQVL 2IQAB 3RWJA 4JB9L 4GRLC 4BSVA 2DF3A 3NPSC 1ZLWH 5EZJB 3LCYA 4R26L 3KS0H 2GAZA 3IJSA 4X7FC 1NGPL 4ONFL 3EZJB 3IF1B 3IS0X 4NOFA 5E00A 4U1JA 1ZK9A 3MFFA 2PUQT 2WQ8A 5GRWA 2H45A 1CG9A 3MLYH 1YMHB 5IBTH 1HZHH 2XTJB 3K2UH 5FUOH 4IS6B 2NY4C 3BPNC 1G9NL 4OD3L 3G6JA 1C1EH 4OD2B 4QKXB 2Q76A 1JZ7A 1NGQL 2R0KH 2OJEB 2ZUSA 4IBLT 3GSNB 3ZTJG 3QNXA 2IGFH 3WXVL 4WI9A 5BVJA 2H6PA 3LZFH 3NFSH 3DVNB 4Y7MA 3B43A 5GRYA 4XH2B 3ARSA 4PGBB 1Y6MR 4Z7OF 4ONOA 3ARQA 1ZA6A 2P8MB 3JTTA 1FJ1A 4BZ2H 4XP1L 1Z9OA 4GT7A 5BV7H 3V5KB 4QRRD 4HKXA 3BZEB 4G7VL 4JKLA 1JRHL 1ZKAA 1KTRL 4TUOB 3BUTA 3GI8H 1MWAA 3GUTB 3K8LA 4NZRH 3C5ZB 4OCNC 2WUBH 1QNZL 4JPVH 1PGRB 1Q9WB 2FGWL 3O6FA 3PIQB 2BVEA 1NUDA 1NAMA 1YECL 4XP4L 3TPUA 1JWUB 5ISZD 1WBZB 3QFJD 3VDBA 3VFUB 4JY4A 3MRQA 4QXTA 3T65B 5T3XD 1DBJH 1S8DB 3EJYC 4R90H 1VDGA 1CVSC 4MMZC 5D5MA 4Y88A 2JIXB 5DJZB 2IPUK 4RQQA 2DM4A 3VJ6A 1FHGA 3E6HB 1NAMB 4ODXB 5E2TL 3MCKA 1DL7H 2WW8A 1A0QH 1NDGA 3OKEB 1F4YH 2YUVA 2FGWH 4ZFOA 2OQJA 3K4AA 2YPLD 2C3GA 3MRQB 4HPYH 5CUSH 4QTIL 3AXLA 5I66B 3CH1A 4EI5C 3G9AB 4XRCB 4H25B 3OAYK 1R5IA 3CFIC 1WBXB 4DKEH 1U3HA 5DSCA 2Y5TB 3WJJC 4AH2A 3TO4A 4DKFH 4FZEH 3MRDB 2JB6A 1U8KB 5FM4A 2E8YA 2NR6D 1UYWL 1YY9D 3VA2C 3QCVL 4RFNB 1DSFH 4JPWH 5HHNA 4GAGH 4HDIA 1F2XK 1DQJA 5DQ9B 5C0BB 2YUZA 3QCTH 4UV4L 3C6SA 4PJCF 1IZJA 2UWEF 4M5YH 3RVUC 3UTQA 1T3FB 5BV7L 1P4IL 5GGRY 4I0KA 1G7LB 4JDTH 3BI9X 1A4JA 1CFTB 3C8KA 3OKYA 4XCFL 4KXZH 3OXRB 4G8EB 5GS3A 4LPXA 4MHHG 43C9A 1VGEH 1NGXA 2YUXA 3K8MA 4HH9A 4QHLA 2XA8H 3T1FB 4JFOA 3CDFA 4MJID 4XVUD 1SY6H 2HTLC 4JO2H 1N6UA 1HI6A 3B5TA 3I02A 5BRZE 4EUPA 2X4OA 5D7IE 4FQLH 2BVUA 3MPCA 3DX6A 4NN6C 1T0NA 3PXHA 3N50A 3LKRA 5F96H 3AM8A 1OWWA 1DQML 1AQDA 1UB5A 2EDHA 4H0GA 5TJWK 1KG0A 3M8OH 5GS2D 3BEWA 2HVKA 2AJXH 4U6VL 4PREA 1DLFH 5ISZB 5HI4C 4OGYH 2EYRB 4WFFE 3VRIB 3MGAA 5GSRB 4NRYB 1XMWA 3LN5B 5J6GB 2DYPB 3W9DB 2V7HA 4R2GC 2EO1A 4WWKA 4HGMA 3UTTD 1E4WH 1PX3A 3HI6H 1GAFL 3GSRB 1QSVA 4FQ2H 1MCWM 3MBEC 1ONQB 4PJ5E 5B4MC 2WLYA 5LJYH 4FZ8H 2VXVL 5EUKB 4V1DB 4GFTB 3DHMA 4L3EA 4XPAH 1BGXL 4TSCL 5DC0A 3CMGA 4LKCA 5FYKU 2Q8AL 3BXNA 2EYRA 4EN3C 1NFKA 4DGIL 1S7TB 2FCBA 1J8KA 4LLQB 3BHBB 3GSVB 2YS4A 5K9QI 2OJZH 3CDGA 2H26B 1L7TH 3B6SB 4NWUL 5HI4D 2W60A 1BPVA 1AGDA 4O2EB 3SY0B 2ZUWA 4I9WD 2FECI 5LWYH 4UOW0 5F1OB 1H3VA 2Y4SA 4HWEL 5TDNA 5AD0B 4GOSA 5D7SL 3NAAH 1NEZA 4GMSH 5SX5H 4KPHH 1R5VB 4JCLA 5IQ7H 2VXUH 1JYXA 3EBAA 5IKCB 4HF5H 4M8VA 4NQXB 4LKXB 5FECB 3V52L 2HTLD 4JN1L 5D8JL 1JTOA 4LLYA 5F71A 3ZL4L 3U46B 4PJBB 1MHCA 4Q7DA 5FM5O 2EH8L 4LCCB 7CGTA 4KROC 3FB6A 5CJBA 5DFTA 1FNGB 2AJYL 2G5RA 4U1IA 2Y06L 3N1MC 3FHAA 4NQTA 4UDUB 3HR5A 4B5EA 1FGVL 4QRUB 3SJVE 2OL3A 4LPUA 1NC2D 2MNUA 4N0CD 3MRLA 1R3IL 2R39A 1NGWB 3MOBH 3MR9A 3CC5A 4GMSL 3Q5OA 5C7XH 1TDQA 4LHUD 4Z5RA 1U41A 2A1WL 3TWCL 4PRHD 1IJ9A 2R0KL 4XNQB 2GCYB 2XQBL 3I2CL 3L5WA 3JTSB 3GKZA 4YNYB 1QLEL 2XN9A 3T0XA 1FORH 4DN4L 3QEHB 2M26A 3P11L 2J4WL 4Z7VA 3DV4A 4LSPH 1PFCA 3MUHL 1G7MA 2FRGP 2FO4A 1EA9C 3I6KA 2F8OA 5KJRH 4YHZH 3FQUA 4BQ6A 2IF7A 3S88L 1H0DB 2R1WA 2Z31A 1FNHA 2DMCA 4UTBL 4G7VH 5JQ6L 1JF6A 4PJCE 2DIAA 4POZC 3OG6B 2P5WE 3RWGB 5AWNL 2ZUUA 4YNYA 3IYLW 2VDOL 4OB5L 3UDWA 1IM9A 4HULB 4H0IA 1NBZB 5FGBA 1C16A 3RKDC 3S36L 4NCDA 1MUJB 1GC1L 2XWJA 5CHNA 2CKBL 1F3RB 2APWA 3ARBB 3C5ZA 3DUUA 4XCYB 5EOCL 2UWEB 4AMKL 1JN6B 4TSBL 1UWGL 1MCPH 4Z7NE 1R3KA 3BAEL 3DX9A 4X5XB 5KVFH 3MJ6A 4OSUH 1V7MH 3UZEA 4OFYD 5SWQB 1OP9A 5I30H 3PDDA 4ZDHB 1J1OH 4M02A 5EDXA 1UH2A 4H1LG 1FL3B 3INUH 3KHQA 5C0GB 3IDYC 1IGMH 4YHLH 3Q6FA 1KJ3H 1I9JH 5IMLB 5ICZB 3VXME 4PJ8B 1EERB 1L6XA 2PCPA 3NCMA 1MCOH 5KG9B 2NY0C 2A83B 1MH5A 2I9TA 1ZSDA 2FZ3B 5EOQH 1PD6A 3HC4H 5A16A 4Q9RL 4HC1H 3VFWA 3W39A 3GNMH 1FVDB 1MHPL 2GW5A 1VFBB 2ITDB 3RDTD 2RQ8A 4XHJD 4R4BA 2H1PL 1JHKH 3SQBA 3TO4D 5D1QC 3C60D 2H9GA 1AY1L 1S7UA 1X7QA 2EDBA 2Q8AH 4U1SB 3QQ4A 4YFEA 3A6BH 4Z7UA 1HINH 3KPPA 2OL3L 1CE6B 2I26N 5IVOA 3RWFB 1MH5B 1ZSDB 2FZ3A 5DTFA 2VLKB 5D2LF 3JWDH 1TZHB 3SBWA 5ITFA 4IRJD 4M00A 5JPMB 1XGYH 4N1HB 1MEXL 1QSED 2JCCA 1EEQA 3OSKA 5EOQL 5F7FA 4D94A 2W9DH 1DVFD 3C09B 4BFIA 2CJUH 5F93C 1LK2B 3NTCH 3TA3A 4GXVL 4Y4KB 3VE0B 3LD8B 4LSQL 1KC5L 1OTSD 3ESUF 4YDIH 5EBLB 3RZWA 2DQDL 2QSCL 2R4RL 3QEQE 5D7IB 2V9QA 3U9PH 3NZ8A 3S98A 1IEAA 2PYED 4ZS6C 5INCA 1VFAA 3SGDH 2ZCKH 2NY7H 1NC2A 2DI7A 3MJGX 4L8DA 2V5RA 2W92A 4TUJB 2DKSA 4D0BA 2LU3A 1RU9H 4PJXF 3RTQC 1F8TH 4YC2B 4JRXE 2H2PD 2YC1A 4X6FB 4JLRA 1BQSA 2YKLL 5FO7B 4MS8C 4P2RB 1IEAB 1MFCH 1T04A 4JE4B 4RIRB 4Z7NF 3M17B 2AK1L 3NACH 3QDMA 1BD2E 2QEJA 1GPOH 5CEZE 3FB8A 1U8PB 1G6RA 3ILPA 2IANB 4UBDC 1C5DB 2J8UA 5AG8A 5D7JD 3MLWL 1QLFB 1YYLH 3LEVH 5AG9A 1A7OH 4ERSH 4RIRA 4M9OA 3IJHB 3VMPA 4OI9A 3RWHA 1M6OA 3PF2A 4R4FH 3GKWL 3FQXB 1WZLA 1FVCA 3GIVA 1WZ1L 4G6AD 2VL4A 4XP1H 1JPFB 1FBIL 4HS6B 4LVHB 1OD9A 1MFCL 1NDGB 4MQTB 3VD9A 1T22A 4XZUB 5KSAC 1ED3B 4RFOH 5FAAA