3MYZA

Protein induced photophysical changes to the amyloid indicator dye, thioflavin t
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
97
Chain Sequence
b'MIQRTPKIQVYSRFPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
publication title Protein-induced photophysical changes to the amyloid indicator dye thioflavin T.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 14
structure length 97
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3myzA00
2CQVA 1P53A 2O61A 4LHUG 5F89B 5KW9H 3NZHL 1KIPB 4OGXL 4X7TB 4BSVB 2F53E 2A9ML 2R1XB 3HMXL 1ETZA 3QH3A 4RMSA 3SN6N 3I02B 5JDSA 4ZPTB 5IESH 1N6UA 5E6YA 4M6NH 3BH9A 2BNRB 1RUAH 1J12A 3IKKA 2VE6A 3RTQD 2VL5A 4JFPB 3MV8E 4D3CL 1D5XB 4HUVB 5HY9B 2HLFC 2FHFA 2JELL 3BEVA 2VWEC 5C71A 4KJWC 2GK2A 1T80A 3CDCA 2R23B 4QRRA 4UTAH 4L8CA 5B8CB 3WFEL 4LMQE 1BZ7A 2IF7A 3MX0A 3H7BB 2DQJL 4ETYA 3WNLA 2ZSVA 1BOGB 4I18B 2Z93A 3NH7L 4RIRB 4U2ZA 1K5NA 1X5KA 4JVWA 2HTLD 1KB5B 2BHUA 4Y16D 1MRFL 4KTEL 4J1UB 3U82B 1MCNA 3O41A 2R2HA 5EB9A 2Z8VC 1CFTA 3BYYA 5EOQH 2C3WA 1RK1A 1BWWA 4LIQH 3SKJL 1FNFA 2GAZA 3TBSB 1DQMH 3H9SB 4N0FB 3SPVA 1UJTA 2CH8A 3RHWF 1KXVC 1MF2L 5IVXF 4QHMB 4RGMC 4S1QL 3RY6C 2VH5L 1B2WH 5CZXC 2VDOH 1MAMH 3SQOH 4NOFA 3VA2C 3TVMB 4AG4H 1JYVA 4M5ZH 3ARFA 1RUPL 1M05A 1C16A 1DBBL 2WK2A 2VXUL 2X4SA 3DECA 4QRQB 4X9BA 5CP3A 2L0DA 2NY5L 4PJ7B 3U0PB 4XNZC 4JKLA 5JR1H 1NAMH 2W07A 4PJXA 3U7WL 4CBPA 4AENB 5C0DA 4WCYL 4NNXA 4LP4A 4DGYL 4RGNE 1U3HB 1ZT7B 3STLA 4QHUB 4RMWA 2EDNA 5ICXB 4U1LA 4TOYL 2GSIB 1A14L 2DBJA 3QHZL 4P5MA 3PV6B 5IKCB 3VXQA 1XGTA 5F1NB 5LXGH 5CJ5A 3QXWA 5IM7B 5EZJA 3HC0B 3QXTA 1H3PL 3HTLX 4G43A 4U7KA 1MFAH 2GITA 4XCFH 4H8WL 1S9WA 5GZOC 2AXJA 1D5BA 1G7MA 3TA3B 1LEKA 1J8HB 3O2VL 3RWDB 5T5NG 3RWJA 5IBTL 4OLXL 5JW4R 3IFOA 2R0ZH 3MNWB 4ZUVB 4GS7C 4JHBA 2R0KL 4LSTL 4BZ2L 4M48H 3L5WA 1KEGH 4XB7A 2AQ1A 3IDXH 4R7NA 4IDLA 3OAZH 4LASH 4LQFH 3VXPA 1BVLA 4H0GA 2AK4B 5I9QC 3NCMA 2X41A 1I7TB 1RHHA 3ZYIA 3P73B 5GS1C 5E8EA 1KXQE 3GRWH 3LS5H 4OIIH 3S37L 3SDYL 2O5ZL 4Q9CA 2PCPA 5CMAB 1WFTA 1WIUA 4QRRE 1P9MA 1HCVA 5HYJD 1DBML 2JJTA 4HBCH 1Q38A 5BV7H 3ZO0A 1Q9KA 1DQTA 4XVJH 5ETUA 2X89D 5BZDA 1CLZL 1LO4L 4EVNB 3ULVC 5HGAB 1RZ7L 3WCYA 2NXYC 4PJ8B 2J8UA 5EPMB 5ICZB 1V05A 4XPAH 1HINL 3SGDI 2VN7A 4U05A 3FFCE 3T2NL 1A6AA 5M94B 4F7TB 3V6OC 4P2QA 1CICC 1UT9A 3GM0A 4AMKH 1NCDH 3GSRA 3HE6B 2ZPKH 5I1AB 3T09A 3PIQB 4XAWL 3RY6A 1QTYT 5EWIH 4G9FB 4V2BA 4OFKA 3UZEA 3DX9A 4UQ3A 1NL0H 1OSPL 3K0WA 4FTVB 2C7UB 4FABL 2FWOA 3IU4H 4NHUA 4RFEA 4U1IB 5I66A 3BRFA 4PJHB 4ZD3H 4PLJD 1MELA 3ILPB 1OY3B 3QSKB 3QWRA 4KDTC 3MOAH 2I9TB 5M95B 3LIZL 5J06A 5IJVB 2EKSA 3OKLB 1ED3B 2XZQL 1MI5B 4LMQI 4YDLC 4DCQB 3QIUA 5C0BD 1YECH 4LLDB 2FYYA 4OIBA 5DMKB 5DEGA 4FP8H 1HHKA 3ESUF 5F6HJ 1CL7I 2YK1H 4PJ9B 3O9WB 5SWSD 3ZDYF 1F6LL 2DOCA 1ZVSB 1A6TB 5D72L 4XRCA 3X12B 2X4TA 2YXMA 1URLA 3CMOL 3ECBB 4OGXH 2BVOA 2A9MH 3HMXH 3RIFK 2J7LA 3P40A 2V2XA 3QUMA 4TVPD 3DRTA 2X10A 1JPST 5DWUH 3QI9A 1RJLB 2GIYA 4G80B 4Y5VA 2VLRA 1FO0B 4YIQB 4XHJC 3A67L 5CEXB 3QEHA 2XQYK 1YEDB 3ZKXC 3PNWA 2JELH 4Y4FA 5DRZA 1YC8A 3NFSL 2FJHB 1QSFB 1X44A 4N9GA 2J3SA 2FEDC 3NAAL 4P2OD 5AD0A 3KPLA 1RZJL 3Q6GL 4V2CB 4QY8A 3WFEH 4CVZB 1U0QA 1F42A 5JHDD 1NGWB 2JJSC 3ARDC 1HWHB 2DKUA 1XH3B 1JHTA 4Y1AD 1X4ZA 2DQJH 3DV4B 5E95B 4OCLC 1YYLL 1MIEL 4XPTL 1NFKA 3NH7H 4M7JL 5F6IC 3QFJD 1EAPB 1O7SA 4NUGL 4J4PD 4NQXB 1M1SA 1LD9B 1MRFH 3HCVA 4KTEH 4HIEA 4MB5A 5E70A 4LLYA 4PGCB 4HMCA 5AEAA 4JB9L 4N90D 2BXZA 2JK5B 3ALPA 3OF6A 1KCUL 5IVZB 3SKJH 1MCRA 4LBEB 2NY7H 2J8UE 3QUML 3FFDA 4EUPG 4RMUA 2VDRL 2WP3T 3V52L 1MF2H 3PWPA 2ZUTA 1B4RA 4OLEA 1HILB 4S1QH 2VH5H 3KXFB 4P4KA 3H9HB 1BMGA 1KIRB 2A6DA 3WXWL 1CFSB 2HG5B 1J88A 1DBBH 2VXUH 4NRZB 3PDDA 2NY5H 5E6IA 3GSWA 3EO1A 3DYOA 5KTEH 1G7LA 4P2RB 1H5BA 3U1SL 3AUVA 4WCYH 2CJUL 4DGYH 5DZNA 4U31A 4OD1H 1HHJB 3UAJC 5KSBA 3DI2B 2VC2H 3QHZH 3BP6A 3IS1X 3MGOA 1N0XL 3JUYA 4XC1L 3U4AA 5AUMA 5IHZA 1DJSA 1UM6L 4DKFL 5IFJB 1H3PH 1CBVL 4R4ND 4OV5A 3FQXB 3FONB 5TE6L 4X8XA 1L9NA 4H8WH 4JPKL 3BFOA 4OF7A 1F90L 4P2YA 4ZXBA 2D0GA 5DQ9B 4UAOC 5H37H 2AXFA 1WIPA 5IBTH 4OLXH 1KJVA 4L4JA 2BFVL 1R5WB 2PXYA 3LQAC 3SDDD 5F7WC 1A3LL 4EXPX 2R0KH 2ZWLT 4LSTH 4BZ2H 2WNGA 3D2UA 4HK0B 3MRJB 1DVFC 2QSQA 4G6AC 3ZLQC 4ODSL 5ECJE 3RL2A 1T1WB 1L0YA 5CEZL 2P5WB 4KWUA 1LE9A 5FYJD 4UIKL 5CP3H 5ITBL 4MNGA 1TETL 5C0EB 4TTDC 2HH0H 4JFOB 4YDJB 5FO8A 2C1OA 3S37H 4KI5D 3SDYH 3CIQA 2O5ZH 5IK3A 1PD6A 3E3QC 1LILA 4JRYB 3F7QA 1A7PH 1JRHL 4L8BB 2G5BA 1DBMH 1HSBA 3VFWB 5DK3A 3KNBA 3VXMD 3GMMB 2VISA 4PRNA 5I2IA 1CLZH 5I75B 1LO4H 3MOBL 3BWAA 2WZPD 1RZ7H 4GJTB 1KTLA 1I1AA 5FFLA 5DRWB 1UYWL 1HINH 3TPUA 2OTWB 3DGCR 4EN3A 3T2NH 2BRRL 2NX5B 1WAAE 4G8GA 4LLUA 3QNXB 3ULVE 2DI7A 3ILQD 1MLCA 4ZTPL 4UOW1 3MLXH 4TUOA 5DLML 3FB6A 1ZA3B 2A6IA 2ZG1A 4PJBB 4XAWH 4X4MA 5GSVA 1YPZA 3V6OE 2Y07L 2R9HC 1EEYA 3PWPE 1P5UA 1OSPH 1PY9A 4LPVA 1FGVL 4HEPG 4FABH 4MD0A 3REWA 3NCYP 2VLLB 4OLYL 3G5ZB 3MRIB 4KK9C 1K2DB 3B5TA 3TZVB 3KLHC 4Z76B 5DQJB 3HZKB 3LIZH 3VWKC 2EDXA 1DN0B 2X4RB 2XZQH 2HJFB 5BJTB 2KZWA 4JFDB 3C6SA 3DPBA 2QKIB 5HGHB 1T22B 5FHBL 3D87B 1HXYA 5DEFB 5GS0C 3K80A 3RX5A 2OQJB 3HB3C 5I19L 3UTTA 4P5TA 3PGDB 4APQC 1IGTA 3KPRB 1F58L 3BIKA 2OX5A 4JREC 1DDHB 4U1SA 1EV2E 1FNEB 2UVFA 3PF2A 3PDOA 5DFTA 5C3LD 3A67H 3VGEA 3MCLL 4I2XA 1IGJA 5FO7B 5F7KC 1GH7A 3OXRB 4OT1L 1A2YA 4DKDC 1UZ6E 5IMKB 3NFSH 4I9WE 1T0NA 4J7RA 5T1KA 1J05A 4ODBD 4RMTA 2V7HB 3NAAH 5DJ2B 3Q6GH 1RZJH 3T4YB 1HHIA 2B1AH 2H9GA 1GC1C 3AM8C 5IGXL 4XPTH 1YYLH 1MIEH 4MNGE 4ELMA 5L8JB 3CFKA 4M7JH 3EDDA 3FL7A 4WRLA 3TBTB 4M4RA 2X40A 1XF4B 4NUGH 1GSMA 4G8FA 3TIEA 3VRLE 3AB0C 1W2KT 1QBML 4WHYH 1FFPB 1E6JL 1OTTC 2DYPD 1DQDL 4JB9H 3F12A 3QJHB 4JDVB 4LOUC 1QPXA 3MLRL 3P0VL 2XTJC 1Q8MA 1KCUH 3RVVD 3T3PE 1MCHA 4RWYL 2VYRE 1AGBA 1R5VB 2JIXB 3L3JA 2KQNA 4LLVB 5I8OH 2AJXL 3QUMH 3MV9D 4K94C 5D6DA 3GKWL 1R3IL 5IB3B 2XNAB 4QHLA 3GGWB 4MA3B 2DWDA 1UWXH 4DKEL 4X98B 1ZLWH 4JFFA 4X4ME 2YA2A 1YPZE 3VXUD 4JKWA 2MHAB 5KVEL 4XNYH 4O02L 2Z9TA 3O6LH 3GMLB 1P4LB 1N8ZA 1WZKA 1MCJA 1S9YB 3U1SH 1FG2A 1ZTXH 4RCAA 4O9HL 2FCBA 2EZ0D 3FZUC 4HCRL 5B3NA 1RK0A 4JHWL 4MJ5B 4U6YB 3BRGC 4OF3A 4N8VB 4OZ4B 3Q5OA 1N0XH 4XC1H 3DBXB 1UM6H 3MFFA 4WFED 4QRPA 5TE6H 3S96A 1T20B 4GG6A 1U58B 1X5HA 1F90H 5CD5C 3WE6B 3F7RA 2XWBB 4MHHG 2HJKB 4Z78A 3S3SA 1S8DA 2BFVH 1JJUA 1NCAL 1KCVH 3BQUD 3HZMB 5ENWA 3MV7E 1A3LH 3TC9A 1U91A 1EEZB 4OFDA 4PJDF 1WWBX 5DTFA 3L95B 2OL3A 1XGPA 4GRMA 4ODSH 4U49A 5F8QC 5CEZH 2GY5A 3Q3GA 2UV3A 4ENEC 2KUTA 4H1LG 4UIKH 4O2EB 4I2XE 4KKLD 1RZGB 5ITBH 3H3PL 1KN4L 2GTWA 3QO0B 5GS1B 3OWEA 4XCEB 1VACA 1B6UA 3WS6C 1JVKA 2C1PB 3L5IA 2EIZB 1HNGA 2IWGA 1I3UA 1UGNA 5ACZB 1FN4B 4JFEA 1S7WA 3FQUB 2BHYA 3GUTB 1JRHH 4AIXA 4UQ2B 2IQ9L 3ELAT 4ELME 3T0BA 4KROB 3MOBH 3OR7B 3V2AR 3E3QE 4KK8D 1CFNA 3C6LB 2NXYB 3DI3B 4JVUA 1Z5LB 3CU7A 5F7MC 1UYWH 1PLGL 2XIDA 3HR5A 1N4XL 3MJ7B 4P23B 4OBSA 2AP2A 4UDTA 1WBXA 5EC1B 2K3TA 3SJVB 3I6LE 4UV7L 4P3CL 4HKZB 4ZTPH 5D6CB 4P57A 5C09E 1KT2A 1A4KB 5IMMB 3TO2B 1GGTA 5D5MF 2OL3L 3WLBA 2Y07H 1ZXQA 4LARL 4MD5B 3MRGA 4P46C 5KSVA 1GIGL 4WV1C 4YFEA 1FGVH 3LKNB 1LMKA 1IGML 4GAFB 3V0VB 5I1JL 1MNUL 5EUOF 5L8LB 1Q9OB 4L9LC 4OLYH 4PLKC 5EOCJ 1JIBA 3BRDA 4CVXB 4L4VB 4JO2L 1CD8A 4R4BB 1WBZB 4KMQA 3EYFB 4RFOL 4XTRC 3NN8B 2G9HB 3L3KB 2NNAA 1XGYL 3VFTA 4YDLB 2ZG2A 1YMMD 4WUUA 4F80A 5D96C 5BW7A 4YGAB 2EDOA 5JUEL 5F7YC 8CGTA 1KIPA 4X7TA 1OP3H 1A9BA 2R2EB 2EIEA 3K1KC 5FHBH 1KPRA 5D1ZC 3FOLA 2NY1B 4DGVL 1EO7A 1FL6B 1DQLH 4KRLB 1QBBA 1J0IA 1TVBB 1D5XA 4HUVA 3U7AA 3RZCB 1NPUA 1F58H 4QRPE 4PBXA 2A73B 4OGYL 2VLJB 3L7EA 4OZFB 3AY4A 4JKKA 4GG6E 3IFLL 2YRPA 3GJEA 1MFDL 2WINA 1RMFL 3SCMA 1OVZA 2N4IA 4LCWB 3MCLH 4M62L 1KCSL 3VXRE 4TUKH 1S7TA 3H7BA 3M1BB 3ZKXB 4OZIB 4OT1H 2IANA 4GKOA 1BOGA 2X70A 3CDFA 4I18A 4NKDB 3BE1H 3HUJF 4RIRA 2BNQB 2IADA 5LGKA 5EZLA 1IILE 5GGRY 1A7OL 2F8VA 5HJ3B 1JYWA 4LLWB 1HK6A 3ARDB 4OFYA 1WLHA 1R3HB 1RZFL 1ZHBB 5IGXH 2DIJA 3SGJC 3WUWA 4F7CB 5F6IB 3NCYS 1EK3A 4CU8A 3KYAA 4BJLA 3MYJB 4KKBD 4OI7A 4C58B 5ICYA 2V9RA 3MZGB 2PYEE 3TBSA 4JFEE 4C83A 3DSNA 1QBMH 3H9SA 5ANMB 1M7DB 1T0MB 1N7MH 3QUZD 3ESVF 4DFHA 1E6JH 2ZUQC 3OAYK 1DQDH 4QHMA 3KG5A 3RGHA 3PXJA 3MLRH 4F2MA 3P0VH 2GJ6B 1HSAB 1U6AL 2AJXH 4X6BB 3X17A 1XIWB 3W5NA 3GKWH 5HHVL 3RJQB 2HRPL 4QRQA 4HDIB 1LO5B 3L9RA 4XGZB 5F7FA 3CAFA 2FEEI 1YN7A 2EDLA 4JVPA 4RMQA 4WFFE 5IBLD 2H2SD 3U0PA 5B39G 5SWQA 2JKXA 4ODHL 4AENA 1U8OB 2ESVA 5FAAA 5GGTH 2HTKC 3VD4A 1ZT7A 2VOTA 3S4SB 1KB5L 3O2WL 4O02H 5ICXA 4DK6A 1NFIB 5F7UA 3QEQB 5IKCA 1GHFL 1PZ5A 5F1NA 3KYKL 4XP9L 1HEZA 5I8KL 1F4XL 1EVTC 1T5WB 4O9HH 2P8LB 4HCRH 3CH1A 5L0QB 3OKOA 3TA3A 3LN5B 1DEEB 1J8HA 2YXFA 3B9EA 2VAAB 4UB0L 4HC1A 5F72S 3MNWA 4ZUVA 3QRGL 1JPGA 4FQCH 4XNQA 2WP3O 4WUUE 3CVHB 3V7MA 4ODVH 3VA6A 1XFPA 1C8PA 1MRCL 4G8IA 2RGSA 2NY6D 2YKLL 4XZUB 4QCIA 1HOCA 4UAOB 4Y7MA 2H26A 1MLBA 4KTYA 2BCKA 1NCAH 4MCZB 1AO7B 1H0DA 1I7TA 1XCQB 1F4YL 1PG7L 3B5HA 3P73A 3KPSB 4WENB 4Y4KB 5F9OH 3HNSL 2DM3A 4HIIB 4MAYA 5JPMB 4K8RH 2I26N 3EBAA 4KZEH 2DD8L 1BEYL 2N7AA 5CMAA 5EN2B 3O3EB 3O3BB 1MY7A 1J87A 1DQJB 1OLZA 4FZ8L 3H3PH 1CIDA 5MHSE 4JZOA 4MQXD 2IANE 2Z4QB 4DGIH 4HQQL 4D9QE 5HGAA 4KHXH 2BVQA 1U8MA 2ED7A 3BO8A 3HPLB 4Y4HA 4NN6C 2Y36L 2O5XL 4MLSA 2F54E 1JBJA 4GG8B 4F7PB 4GMTL 1YN6B 5I1AA 4KPHL 4J8RA 3PIQA 4K8RD 3QWQB 5MEND 3FRUA 1PW3A 4FTVA 2C7UA 3P9LB 4P3CH 5JHLL 1IGFH 3ROLB 1P7QA 3KYMA 3ILPA 5JTWA 2VLKA 3EAKA 4Y2DB 3W0WB 1GIGH 3VFGL 4QKXB 2MKWA 5IJVA 5I1JH 1IGMH 3OKLA 1GZPB 1LVEA 1MNUH 3MLUL 4LPWA 4QXGL 1FPTL 5K33A 3D0VB 3B8YA 3O4LB 4X99A 1UXWA 4LLDA 4XMLL 5DMKA 4JO2H 4JHAL 3U79A 2VXVL 2ESVE 3VFSB 3GFUA 1TZHB 4RFOH 1EH9A 3MXVL 2RR3A 5D7IF 3O9WA 4U3XA 1EFQA 3JSSA 2G75B 1XGYH 3S3PA 35C8H 5DF0A 5J12C 2I27N 1DQQB 3S6CA 1OM3L 4JM2D 5JUEH 5K9OA 3ECBA 4XVTL 1TIUA 2E6QA 2CKBA 3SGEI 1RJLA 3GHBL 3PGCB 2J6EH 2AKRA 4YIQA 1FO0A 3VE0B 1QACA 1DUYA 4APQB 2CDGB 3DVNA 1RIHL 3PHOA 4JREB 4ZUUB 4OGYH 2NXZD 3D3VE 2O5YL 5IIEA 3GSOA 1CK0L 1KTDB 5CWSB 3QIWA 5C6PB 5TQ0L 1RMFH 5IR1B 3CC5B 4NM4H 4CVZA 1NGWA 1KCSH 4M62H 1LO0L 1AHWA 2PTVA 4NFDA 1XH3A 2W0KA 4HXBL 1P69B 4NQDE 1G7QB 3JWOL 3RKDC 5KAQG 1EAPA 4KVCL 1QFOA 3V4VL 3L3DA 4NQXA 4UUJB 1LD9A 3BN9D 3ZZ1A 1J18A 1JNHB 1RZFH 1UH2A 3RWEB 5C0RL 2JK5A 4PYGA 3UBXA 2X1QA 3I75A 1NH6A 2JJVA 5IVZA 3IS0X 2Q86B 3BN3B 5IF0A 3AB0B 4ZUSB 4LBEA 2LE9A 4LPTA 3G5XB 3U0TA 5J89A 2XPGB 1AD0B 2CKBL 2AJSH 1CXKA 3WJJC 5C0FA 4L4TE 1FO0L 5T1DL 4BA8A 1RQ5A 2EIBA 2XTJB 3S5LB 1WFNA 2V2WA 5BQ7B 5HYQA 1ZWIA 3FMGH 1MIMH 1U6AH 2DB8A 4RMVA 5HHVH 4NRZA 2BSSA 3CXDL 2C9AA 5FM5O 2H1PL 1QZ1A 3B2UD 3T0DA 4DTGL 4ODHH 1JGEA 3ZL4L 4JKPL 1P5VA 5DVMA 3IU3B 1OGAB 3MREB 1KB5H 1HHJA 3O2WH 2VLKE 4E5XA 1T1YB 4HGWB 4IJ3C 1NCWL 2EYSB 1NDMB 4FQHB 1YJDC 4MWFA 3UYPA 1GHFH 1KUMA 1S78C 3B6SB 4NKQB 3VDAA 2DQTL 4BH8A 2BNRD 1Z3GH 3KYKH 1VFAA 2XG5A 3IAQA 5IFJA 5EO0B 2WBWB 4XP9H 3VD5A 3FQXA 3FONA 5I8KH 1JYXA 1F4XH 4MX7A 4GBXC 3CH8A 4WHTB 3GBLA 4OCWL 5IVXE 1ACZA 5DQ9A 1RPQA 4NPYB 4UB0H 1YY9C 1WFOA 1CDUA 4GH7B 4QRSA 4LVEA 1A7RH 1R5WA 3QRGH 3ZDZF 1BIHA 2XRAL 2FO4A 2YD6A 4LSRL 3H6JA 3WDIA 2A2QT 4HK0A 5EU3B 3C60C 1MRCH 3CLFL 4AYFA 5A3ID 2YKLH 4TNVK 1T1WA 2NY3D 2Y23A 3DETD 1MJJB 5KSAC 3EOAB 2P5WA 4TNWF 3ET9F 3MJ8A 3O3UN 2UWEB 5SWZD 5EO9A 5HTSA 1NC4B 4HIXL 2XACC 2FZ3B 4N0CD 4XNUL 1F4YH 3BD3A 5BRZB 1PG7H 4HIHB 3G5VB 5CD3B 1K8DA 1RJZB 3HNSH 3FQRA 3RWFB 2DD8H 3MCKA 3KWWB 4JRYA 3QDGB 5EOCL 1ERNA 4FZ8H 4XVUC 3VI4F 4HWZB 1G7HA 4HQQH 5L88H 5DVNA 1QBLL 4A6YA 3VFVB 2VABB 2IH1A 4NHCL 4WO4D 1IQDB 5DRWA 3TVMD 3N1FC 4LCCB 4ERSL 2Y36H 2NX5A 4PJEF 4AEHL 4FQIL 1C5DA 1OW0C 1JMZA 3KJ4C 2YD5A 1FGNL 4PJBA 2ZCKH 3LKOB 5F71A 4Z77A 2X4PA 4D0BA 1UZ8A 3EJYC 2VKXA 1PG7W 1T89C 1NGPL 1R5IB 3EOBB 3L3IB 4EXKA 4YXHH 1FIEA 3GI8H 3BGMB 2XICA 5H37G 4P46B 5I8EB 3HZKA 2A6JA 2Q8BL 3OBAA 1B88A 3EHBC 2MFNA 3MLUH 2X4RA 4QXGH 2HJFA 1I3RA 2A0LC 3V6BR 1V7NH 1G0YR 4QF1B 1S7VA 4XMLH 4JHAH 3IF1B 2VXVH 4JFDA 4UILH 5HGHA 2AJZA 5J57B 3RNKB 1N6QH 5DEFA 3HG1B 3GSQB 1FZOA 4IRZL 2P46B 2OQJA 1JF6A 1W72B 4D0CB 5AG9A 5D96B 4NCC1 3KPRA 1OM3H 3RTQC 4YNYB 3PWLA 4JO1L 4XVTH 3FOMB 4P49A 3PABB 3GHBH 4F7EB 1FJ1B 4R7DA 3TJHD 3INUL 1RZIB 2R1WB 2AXHA 4XCNB 4DAGL 3P4MB 4JZJA 3OXRA 5FOBB 3SE3C 3PJSA 1L7IL 1BD2D 1CT8B 4J6RL 4EI5B 2V7HA 3STZB 1CK0H 2EDEA 1PKOA 5DJ2A 5TQ0H 5CJQL 1LO0H 3NTCL 1FYTD 2COQA 5HGGS 3TN0B 3G9VA 5HYIA 4PJ8D 1MJ8L 3W11D 2IMMA 1TFHA 4HXBH 4HS3B 4HGKC 5D1QB 3QZWG 3V4VH 3PWUB 3T2QA 2E27L 4LCIH 4IOFD 5LG1A 4JRXB 4W4NA 1JZ8A 4H88H 1JGLL 3ZT7A 3HE6D 4RZCA 1FFPA 4PBVC 1PG7X 4PRHE 5ERWB 1OP5K 1CZ8L 3QJHA 2H2PC 4G9FD 4JDVA 1CDIA 2ICWI 2W0PA 4Q2ZB 1AXSA 1NC2A 1HDMB 5EU7C 5TQ2L 4LLVA 3TP4A 2CKBH 4K55A 1UCBH 2ZUQB 2B4CL 2FBJL 5IB3A 1FO0H 2XNAA 4HUUB 4ODUB 5T1DH 4MA3A 3HHRB 4YC2B 4AEIL 3QPXL 3RUGF 2YZ8A 5D8JL 2DLFL 4S1RH 4XBEL 1XR9A 3JWDL 3C5ZB 4RX4D 4X98A 4ZFOB 2PO6B 1MI5D 4GT7A 1C1EL 1NLBH 2DQIL 5GGQL 1PYWA 1IAIM 3CXDH 1NCNA 4FXGA 2VL4A 3AREA 5J13B 4LNVA 3K1DA 2CRMA 4LSUL 3BZFB 4WWKC 2Q20A 4PJ9D 1JWSB 1FVCA 1ZA6B 1S9YA 3PWVB 3ZL4H 1P6FA 3RL1B 4LGPB 1TZIA 5D1XA 2Z92B 3MV8D 2ZKHL 3HE7C 3VRJB 4U6YA 1DLHB 4NOBA 4OZ4A 5FGCE 3EO9L 4WY7L 3X3FL 3O6FB 4UU9B 1IC4L 4LLQB 3OG4B 2VZVA 3EW3B 1U58A 5DDHB 3K4DA 4TRPH 3DYPA 4OCWH 3DXAA 4HPOL 4RBPH 2XWBA 1QSFD 3MRFB 1MHHB 4RA3A 2HJKA 3RGVA 3QULB 1JWUA 1I9RH 3CXHJ 3QQ3B 3HZMA 2Q7YB 4G6JL 3X14B 2FNBA 5DFVD 2XRAH 4ZDHB 1VFUA 4NNYB 4LSRH 1KLUB 3L95A 3TBVB 1FV1A 1OAZH 3T08A 3Q1SL 4CN6A 3P4LA 4KUCF 1MHEA 1CYGA 3QEGL 3UBXI 3RWGB 5HPMB 4WHYG 5HHOA 5DR5L 4FQXA 4HIXH 4IOIB 4JFYB 5D7JD 2HT4C 5DEZA 4Q9BA 4KKCC 1JFQL 1QHOA 5C0IA 2ADIA 1XGRB 4JDZA 5F9WC 5DZOA 5KVGL 4RRPG 2QQLL 5ACZA 5E8DL 3KAAA 4GW5A 5EOCH 3SE9L 3KPNB 1ZEAL 4I48B 1YMHB 2YD7A 4PY8J 1U8QB 3MUZ1 1I1RA 3B2VH 4K71B 2FBOJ 3TO4B 1IAKB 2DL2A 2K1MA 4GW4A 1ZV5A 1U8PA 1QBLH 3C6LA 3KXFD 1BM3L 1Z5LA 3F6LA 5DHVB 1VGKB 4NHCH 2NR6C 3MLVL 1IAMA 3RVWC 5I15L 3M8OL 3MJ7A 4P23A 4NN6B 3UMTA 4ERSH 5D4QA 1U8KA 4HKBB 3SJVA 1WJ3A 1UM4L 4LSDA 1KJMB 4AEHH 4FQIH 3WYRA 4O5LL 5D6CA 1K6QL 1RJYA 3B9KB 2P1YA 3OKDB 5IMMA 3TO2A 1FGNH 4P2RD 1I8LA 1QP1A 1OSZB 1Z9LA 1G6RA 1FC1A 3IXAB 1U92B 3V0VA 4FRWA 1OQOA 5I74C 1Q9OA 4M7LL 5J9PA 4CVXA 4BFEA 4L4VA 4BFBD 1WBZA 3EYFA 5KSUA 5E9DE 3V5KB 2ZCHL 4J3VA 2Q8BH 3NN8A 2G60L 2G9HA 3D85B 4POYA 1IE5A 4RDQF 4XP6H 3H7LA 2WIMA 3ARTA 1VADA 2V5RA 3OB8A 1IM9B 3LPWA 1T7VA 1MQKL 3RHWK 4Q6IC 2BY3A 1SBSH 2FRGP 3VXOA 1JNNL 4MS8C 4MXQC 3IDYB 3GJFB 1JGDB 1T03L 3PP4L 1DUZB 2OXHA 5J12B 4GUPA 2IPKB 2WM0A 5E5UB 5EBLB 4PLNC 3RZCA 4ZFZB 4IIQA 1CXHA 4QHKJ 3JV0A 2VLJA 4JO1H 4UMGA 3TNMB 2X05A 4BK4A 3OGCB 4MMXC 3MODL 4FHBD 3DXAE 1K85A 2OXGA 2YBRB 3INUH 4LCWA 5J1AB 5GRVL 2X42A 2W9DL 4DAGH 3T1FB 4FMFA 1G6RL 4OZIA 1E4KA 4NNPL 3W82A 1D6VL 3QDAA 4NO5B 4KZDH 4NKDA 4NKIL 5J1TC 5EH1A 5CJOL 4OFVA 5ITFA 3FFCD 4N5EC 5HJ3A 1T6WA 1TVHA 4X5XB 5CJQH 5HHOE 3NTCH 4J3TA 4YGVB 5D93C 4JPWH 1MJ8H 2ADJB 5IG7B 1ONQA 2ENYA 4F7CA 1UEMA 5D2LF 2DLTA 2IBZX 4HXAL 4UDUA 4KJYA 5A1AA 1KENL 2E27H 2FIRT 5DI8B 5T33L 3L5XL 3SE4A 1T66D 4Z95L 3A6OA 1M7DA 5C2UB 4EDXA 1WT5C 1TCRA 1EBAA 1CZ8H 4DFIA 1HH6A 1KTRL 1JWMB 1C5CL 1XF5B 1D5ZA 3MRDA 4LEXL 1XIWA 5C70A 5ISZA 4CDGC 2B4CH 4XGZA 4HDIA 3CFJB 3TZVD 4IRJD 1FVEB 5D8JH 2DLFH 1AE6L 4XBEH 5EU7E 5TE7L 2VZ1A 5LGJA 2XY1A 4HH9A 5CLWA 4WUKH 5C0CA 3O6KL 1C1EH 2DQIH 5GGQH 5L7XL 2EH8L 1F00I 2ZP0T 8FABA 4CGTA 1E4XI 1CI5A 2HRLA 2X7LB 5FGRA 3CSYB 2VZTA 2L4OA 3OB0K 1NFIA 1FZJA 2IAMC 4LSUH 3CCHA 3AS0A 1J5OL 1FNGA 5JZ7D 1ZT4B 5IB5B 4W6YB 4H1LB 4G8EA 2KQMA 2V7NB 2P8LA 1J0JA 2ZKHH 3LN5A 1DEEA 1DL7L 4IJ3B 3EO9H 4WY7H 3X3FH 2A83B 2RHEA 4BFIB 1IC4H 5IFAL 5F93C 3NZ8B 4QRTB 3LKQB 4NSKB 4XCCL 1D9KB 4TPRL 3VGHA 4HPOH 4IRSC 4KJWD 3FQTB 1F3DJ 5BVPL 1R3LB 5EUOA 5J3HC 2XWTB 4HGMA 1OCWL 4UV4L 4G6JH 1QNZL 2J4WH 4P5KA 1XCQA 1NANH 4GLRI 2NTSP 3C60B 3KPSA 4Y4KA 3MXWL 3Q1SH 3ZHLA 5JPMA 2B2XH 1FFNA 1U42A 5KSAB 2GUOB 5EN2A 3D18B 4MXVF 3O3EA 4KI5C 2YD3A 1DQJA 1UADC 4UZGA 1JFQH 1B4JH 2Z4QA 1I85C 1FZMA 1YA5A 4RAVA 1FZKB 4NGHL 4FFVC 5KVGH 3R06B 2QQLH 5K9JL 4YHIA 4Z7NF 3WHXB 1IGYA 5D7LB 5FV1L 2CK0L 1XGQB 1WEJL 3SE9H 3WS3B 1ZEAH 2HT2C 3HPLA 2JIXD 4X6CB 3MGTB 4XX1G 4HG4J 5ESVB 5GRUL 3JV6A 1S5HA 4FXLA 4RQQB 3SDAC 4D8PA 3MC0A 5CJ8A 2NW3A 5CZXD 1BM3H 1YN6A 2WUCL 3FT2A 4OD2A 3MLVH 3M8OH 1KN2H 4LHUA 4PJDE 3HUJA 3DV6A 3OKEA 1UM4H 2I5YL 4GO6B 3CZFA 4O5LH 3DO7A 1K6QH 1QR1A 5L2KB 5DURD 3T77B 1IGCL 4R26L 3KJ4B 4L8DB 3ROLA 1YUHB 3TT1H 4NZDA 1EO8L 1G9MC 4Y2DA 5ISZE 4KV5F 4QGTA 1X5XA 3W0WA 3MV11 5E9DB 3LN4A 1GZPA 4IDJL 2QQQA 5DRXB 4WVRA 1XF1A 3O4LA 4X5LA 4M7LH 4LPCA 4IMKC 4EDWH 4NQCB 5C0CE 4I0PA 1VGEL 3EO0B 3MPCA 4OCSL 1I8MA 1WV7T 3VFOB 4YAQB 1X5JA 5J4MA 2ZCHH 3V7AG 1R3KB 5M7QA 2G60H 5GZOD 3BUYB 2FIKA 3Q5TA 1M7IB 3S8WA 3KPTA 3WN5C 3C8KA 1DQQA 2L7UA 1MQKH 1IT9L 4WFHE 2OSLB 3S3JA 2NZ9C 4OGAC 1UACL 4WWID 2C3XA 2DM4A 2R0WL 5EU6A 3QB7C 1INQB 2Y25A 3MLSL 4ZPVA 4JANB 1ULVA 3PP4H 2CDGA 1VDGA 5IW6B 2XKNB 1UFUA 3RTQB 4BSWA 1NBYB 2CGRL 5D5ME 5INDA 1BJ1H 1KGCD 2MJWA 3HZYA 4XWOC 3IYLW 5HYSB 1FDLH 3MODH 5CWSA 4YR6B 5HXMA 3FAXA 2ZUUA 4HX1A 4Y5XB 5EUOE 3OGOE 2W9DH 1U2HA 3VFRA 3S34L 3N1QC 4RNRA 1G6RH 4NNPH 1D6VH 4NKIH 4BYHA 1CXLA 5I76B 1UCTA 3D9AL 3FO2A 1RUMH 4UT9L 4R97B 3ULVD 4R2GD 5B39B 5IB4B 4FS0A 2NXYD 3C87A 2BJML 1E27B 5TDNA 4DVBB 3RWEA 3C9NB 4Y19A 3SDXF 4ZFGL 1UVQA 2Y06L 2DN7A 3CNKA 1CQYA 4HXAH 3HAEB 1KENH 3VG0L 1FCCA 2Q86A 4NT6B 1CICD 1TMCB 3VWJC 3G5XA 5T33H 3L5XH 4Z95H 5IOPB 3WEXA 4PYHA 2NCMA 4M3KB 5E4EB 4DEPC 5FECA 3IDIA 3QXDA 4NN7C 2Q6WB 2NY2C 1IKNA 4LEXH 1GYAA 4AH2B 1M71B 1T21B 2VZ3A 5E6ID 4X7EC 3R8QA 4X9IA 1X5LA 2BVYA 3HUJE 4Z7WF 4GQPH 5D71L 2ADGB 3T0EA 1CDCA 4M7KL 5TE7H 4JFQA 3RPIB 4XXCC 1A7BA 1BZ9B 4L3EB 5I1IL 3O6KH 5L7XH 4X0KA 4LF3B 2EH8H 5DZLA 1OGAA 4NO3A 5SX4H 1T1YA 3GMNA 4HGWA 4AEFA 1GC1L 1NDMA 3C09C 4FQHA 5I1KL 1G9NL 2GTZB 4FFYL 1QG3A 5EO0A 4YDIL 4ZXBD 1AY1L 4MZ3A 4F37F 5AZEH 5HDBF 1UQSB 25C8L 4WHTA 3ZE1F 3HE7B 4MYWB 4F9LA 3REVA 4NPYA 2FGWL 1CXFA 4I9WD 1CFQA 2QLVB 4PJGF 5IFAH 3B5GA 4XHJD 1AIFA 2H8PA 1G1YA 3HI6L 4ZUWB 2XN9B 5EU6E 5BVPH 1MJJA 4MNQB 3EOAA 2BNQD 4QOKE 2FEDD 2UWEA 1OCWH 3SDCA 4PRIB 2CDFB 4N5UA 2ATPA 2ARWA 4UV4H 1QNZH 3O8XA 5FXCH 2FZ3A 5GGSB 3WO4B 2HJLA 5CJBA 3ARDD 2YHGA 4HIHA 3FQNB 1MH5A 1RJZA 3MXWH 3PQYA 1IAIL 1QFUL 4LL9A 1J0KA 1G1CA 1GOFA 5BOPA 3RWFA 1IM3B 3MRKB 1U9KA 2A1WL 1I4FB 2ITCB 4LPXA 3QDGA 3BAEL 1QBAA 3ARBA 3P30L 3LN9A 2VXTH 5HYJB 4NGHH 5F3BB 3DUUA 3EGSB 1XCTA 4MJ4A 3FAWA 1JUFA 2HLAA 1NCTA 4EN3D 5JXEA 3VFVA 2CK0H 2XY2A 2DAVA 1IQDA 1WEJH 3LQZB 1UB5B 3Q0HA 2YC1B 4LPYA 4LCCA 5FKPB 9CGTA 2HFFB 4KU1A 4QRUA 1JTTA 1E6OL 3BPNC 1OAQL 1QKZH 5GRUH 4Y19E 3D1MC 1U8JB 2FB4H 5F1IB 1RZ8B 2BY1A 4P59L 2WUCH 4MD4B 3O45B 2FH8A 3LKOA 5JQ6L 4LVNB 4GKSB 3VXSA 3EOYG 1NEUA 1WBYB 1KJ2B 2I5YH 4UINL 3LQAH 1N5YL 1F97A 3EOBA 1IGCH 3U4EB 3L3IA 4R26H 1A8JH 5BCAA 1TITA 2HVJB 5GRVK 1ZGLM 1GGYA 4ZOBA 1EO8H 5I8EA 1KB9J 4LKCB 1YEJL 3UAJD 4QT5A 3QCTL 4IDJH 3T0EE 2O93L 5I74B 1Y18B 2Z0BA 1A6ZB 3T0WA 3F7PC 3WNKA 3FTGB 4OCSH 2AEPL 4LQ1A 5JOPE 4FMKA 1WVZA 3MRLA 5FGBA 2I07A 2DQFA 2PW2B 3HG1A 4YHPA 1D5IL 3MV7D 2PUQT 1UENA 4JAMB 4D9RE 4ZMAT 2ZUXA 1NMCC 1YNLL 2BSTB 3VGDA 5SWSB 3T0VA 4D0CA 4D2NA 4U1KA 4L29B 3TT3L 1IT9H 4JJHA 3NOIA 1AO7D 1UACH 3WFDL 1KLGA 4JY6B 1VFBA 2R0WH 5IMLA 3BP5B 1DVFD 3PABA 4G6AD 1FJ1A 3HPJB 1KULA 1VFOA 1RZIA 3PL6C 1V3KA 3MO1A 2HMIC 3P4MA 2CGRH 1EIBA 2VITB 4GRWE 2YPLB 4EUPA 4YWGL 1CT8A 3V5HB 4TTDD 2GYSA 2IBZY 5JA8B 2F5AH 4XXDA 5EU5A 3MNVB 4GRLA 3S34H 3UDWC 3NIFE 3TN0A 3GBNL 2GHWB 4HS3A 2J8OA 2KBGA 3DX6B 5D1QA 4PJXF 1JPTL 4ELKB 1JNLH 3PQYE 5D7IE 4DQOL 5C0NC 2XQYG 3D9AH 4UT9H 4GAYB 5I17A 3I6LD 3L5JA 1NMAL 2AV7A 3K46A 5C09D 3RU8L 4POZC 1H15A 5DJAB 4MGXA 5E03A 4ZFGH 1UJ3C 5FYLL 2Y06H 2RFXB 4Q2ZA 1X7QB 3O4OC 3K4ZA 4WW2F 5C07B 3VG0H 5J11B 2MTPA 5I0DA 4PG9B 5A43C 1ODAA 2MPAL 2AGJL 1CLYL 4U6VH 4ODUA 2R9HD 1C08A 3KLAA 3AROA 1ZT1A 1G7PB 4WFGE 4WU5B 1W8NA 4Q9RL 4JE4B 1KPUA 3C5ZA 1P84K 3I85A 2PO6A 5CJXC 1FFQA 5FB8B 4JFHD 5E56A 4KK9D 3QDJB 5ID1B 1S7RB 3NA9H 3WFBL 1EUTA 4M7KH 4MA1C 3VWKD 4WI8A 2FJFA 3VMNA 5I1IH 2BHZA 3RL1A 3SKMB 5JNYB 4X8JA 3VRJA 3LVEA 1P7KB 4JQVC 3NMEA 1S5IL 1GC1H 2IAMB 5I1KH 5DJYA 1G9NH 5GS0D 4UU9A 4M02A 5J6GB 2ZUSA 3HB3D 1HQRA 4YDIH 1AY1H 4APQD 1ORQB 5DDHA 5EBWB 3CUPA 3VD3A 3VXRD 4M1CC 4S1SL 2NTFA 5C0JB 3LS4H 2FGWH 2IQAB 4M43L 2EKJA 1Q94A 4R96A 1J9CT 3TLRA 1DE4A 4Z5RA 2Q7YA 2Z91B 4ZDHA 1DEDA 4NNYA 3SDDB 1I9IL 1KLUA 3ORJA 3UTSE 4IRSB 5FK9B 3HI6H 1F5WA 5HPMA 3RWGA 4K94H 4PY8I 5LCVL 2IFFL 4X6DA 1NGYB 4IOIA 1F8TL 4LSPL 1VFMA 1A4JA 1YEIL 3U2SA 3O3DB 1XGRA 2CXGA 2PYED 1QFUH 4Y89A 4LVHC 2A1WH 4JY5H 5I16A 4I48A 3BAEH 4Z8FL 2M8XA 2SEBA 1OTTD 2CMRL 3GI9L 3TO4A 1IAKA 1NJ9B 4LOUD 3EFFB 2XTJD 5IFHL 4WFFD 1VGKA 2ICEA 1EX0A 4OF6A 2PYFA 3ZDZE 1I1YB 2X4QB 3BDXA 2R39A 3S35L 4HKBA 4E41A 1E6OH 4HZLB 1OAQH 2XTLA 4ESKA 4XMPH 2AQ3A 4GRWH 4J12A 3B9KA 5H8DA 3OKDA 5FM5M 5JOFB 3PP3K 5TH2B 2OR7A 1JCKA 5DYOB 3TESA 5JQ6H 3CFCL 4Z7VF 1FG9C 4BZYA 4UINH 3IXAA 1N5YH 5TFSH 4OIAA 3LPFA 3UPCA 2O26U 3HN3A 5CIPA 5IEKB 2VIRA 4KXZH 5BS0A 3SBWC 4QHNA 1M6OB 2ZOLA 4M8QB 2E3VA 3H2WA 4PTTB 3VI4E 2RBLA 4M93C 5FA3B 4PJAA 3FZUD 3RY4A 5EO1A 3D85A 4C56A 4NWUL 3GSXB 3QCTH 2QADC 1OHQA 4KTDL 4O2CB 1YNTB 1IM9A 1NAKL 4U1NA 3S7GA 1S7XB 4U7MA 5I71C 3DMMC 2AEPH 1U3YA 1HYRC 3TBWB 4OI9A 4PJEE 1D5IH 5DJCB 1YEHL 5CD5D 5I1EL 2AK1H 3QZWB 1JGDA 3WN5B 1A1NB 3QUXC 4OM0H 3GIVA 2XZZA 1NC4D 3SCMD 3WFDH 3LRSB 5E8OB 4ZYKB 3TNMA 4NKOB 2OI9B 4M03A 2EDFA 2P5EA 5TF1H 5BRZD 5CKAA 3BP7A 4F57H 4NC1C 3HI1A 1YEKL 3RNQB 3ZDXE 3U46A 3T1FA 5FO9A 2PW1B 4ENED 1LP9A 3CXHK 1DBAL 4G6KH 4NO5A 4YWGH 1HHGB 3WNOA 1AXIB 3V6FB 1EO5A 2MCPL 2F54D 4OUUA 2J1KA 3CK0L 4X6DE 3GBNH 4YBLB 4PJIB 3MA9L 3LB6C 4X6FA 4ZAKC 4V1DB 1JPTH 2UZIL 2VR5A 4HFUL 3NBNA 1YEEH 1I3VA 4DQOH 3F7VA 4PJFF 4H0HB 1PX4A 3D6GA 5MI0C 5LAXA 1GJIA 4HSQA 4NWTL 3WHE0 1NMAH 5KSBF 4DUVA 5T3XH 1V7ML 3ZKMC 4KY1H 3RU8H 5CLTA 1A7QL 2VQUA 5FYLH 2KPNA 1CE6B 1MWAB 4K3JL 4OLVL 5DK0B 5A16B 1T3FA 3M07A 4ZO9A 2PTTB 1D7FA 2MPAH 3MBEC 5D70H 3BGFB 2IC2A 4Y5YA 1CLYH 3MV9B 4DEPB 1ORSA 1FVEA 4E41E 5DC0A 1P4IL 4NO0B 4P46D 4Q9RH 2YR3A 4NN7B 1QSEA 3W9DB 3EYSL 4EUPH 1EGJA 1JV5B 3B2UC 1FNSL 4AZ8A 4PLKD 5LVEA 1NGQL 3ARGC 1OP9A 2AI0L 4CDHA 2VQ1A 4FQ1L 5H2BB 3CSYA 3WFBH 3GMPB 4K9EC 5T3XD 1EFXA 3UTPE 4HUWB 1MFEH 4M6OH 4ZOAA 3IDJB 4YH6A 3CSGA 3SKNA 1PQZB 4KRNA 4H1LA 5BS0E 1QVOB 3LZFL 3QNYB 4HJJH 3OPZL 2LAGB 1G84A 1MJ7L 3AFLA 3QA3B 4PJAE 4ZS7L 1S5IH 5DC9B 3DTXB 3ZKQD 2HN7B 4TVSa 5D1ZD 3ULSB 4X7CC 3D3VD 1G7IB 3RY5A 3VH8B 1YQVL 1NQBA 3DVIA 4QNPF 4JG0L 3ZYJA 3RDTC 3LKQA 4NSKA 1D9KA 1H8SA 5T1LA 2CD0A 5KG9B 3FQTA 3G6JA 3RVXC 3EYOB 3RUGE 4M43H 2XWTA 3IVKA 4K3HA 1F13A 4NQDD 5GHWL 1A6PA 4X7SL 3UROR 4LRIC 1BP3B 3DVFA 3BI9X 3QUYA 4RAUA 5D2NB 2QSCL 4HJGA 2P5EE 4NQEB 1EGJL 1YPZF 2D7NA 2GUOA 4HEME 5LCVH 3D18A 4K23L 4F33A 4YBQC 2EC8A 2WANA 5ALBL 3BXNB 4HHAB 1F8TH 4LSPH 3WDJA 2IMNA 3P4OB 3W9EB 1LP9E 4PG2A 4JQXA 1YEIH 1YEFH 1KG0A 2ZOKB 1FZKA 2FX9H 2FO1A 4NYLB 3WHXA 4L4TD 1AGFB 4XP1H 2HKHL 2F74B 4PJ5A 2OK0L 3GK8H 5AZ2L 4Z8FH 1U8HA 3G04A 5HHMB 5ESVA 1S9XB 4OKDA 4L1HA 4KK5C 4RQQA 2CMRH 3D0LA 3GI9H 1T4KB 2C3VA 3KPMB 3ARWA 5IFHH 4XNMB 1DFBL 5CFHA 1S9KC 4YJZL 3UYRL 3X11B 4P2CG 2X5PA 2X44D 4A2LA 2FR4B 3BPNB 3ZYZA 2VDPL 4PRDA 4P4RA 4LLMA 3T77A 1TJGL 3KPQA 1MSPA 3BESR 3QIBA 4U6XB 2W0FA 4WU7B 4C4KT 3KYNB 1QRNB 3CFCH 3TH4T 3DROB 3M45A 5I73B 3QP3A 1A0QL 2HTKD 1BQLL 1EVUA 5E0QA 5IWLC 5FCUL 2FL5B 3U6RB 1HIMH 2CDEB 1QSEE 5JO5B 5C08A 3EO0A 3DNKA 3ULUL 4QXWA 1XR8B 1R3KA 2IH3B 3BUYA 1CDGA 1IAOB 4NWUH 4XCYA 4PJEB 1M7IA 1MCOH 4KJPC 1JPSL 3GNMH 3WXVH 1NAKH 5INCB 1A1OB 1F4WL 2ILLA 1BPVA 4IS6B 3QBTB 4O4YH 3LKRB 1IKFL 2CK2A 2V6HA 5L2JB 3ZE2F 4HUNB 1YEHH 5DHVH 5I1EH 4JANA 4MSWB 1NMCB 4IEFB 5LWYL 5ILTL 1OOAA 2LV4A 1J1PL 3LRHA 3GZKA 1JP5A 3CDYA 1YY8B 3G6JE 4Y5XA 3NIDF 5DD3L 1YEKH 5JPNA 5L6YL 4M6AA 4N8VG 5FCSH 3MLWH 1A64A 3E6FA 4OTXH 2D7TL 3DRQA 1DBAH 5AYUL 4Q9QH 4KGJA 3OKKA 3KJ6L 4KRPC 5CIPH 4Z9KB 1PKQB 1E28B 2D4DA 1U93B 1EHXA 4R0LB 2MCPH 5B39A 4H20H 1OF2B 1NUFA 2OP4L 3CK0H 5GJTL 2RB8A 1FVDA 4DVBA 4Y16A 4MQTB 1LNUB 3NPZB 4FQJL 4I5BB 4P9HL 2UZIH 2NY4C 2BOBB 3QDME 4U1JB 3ULUE 4U1GC 4NT6A 3GBML 4NWTH 4ONFH 4PJ5E 5HYFA 2R0LL 1V7MH 2BY2A 3LKSB 1A7QH 4BFGA 1LK2B 3HMWL 2NLJB 3PGFL 3ZSSA 4JDTL 4LPUA 4YEFA 2GK0B 4HG4K 4TNWK 4DUXA 2VJXA 3O4OB 4K3JH 4OLVH 5HHXL 4GAJL 2B5IC 4GG6F 5FF6B 5CCKH 2ZNWA 3RPKA 1G7JB 4POUB 2M1KA 4HFWB 4G7VH 1PGRB 5DJ8B 4NJ9H 4NDMB 4K3GA 1A6VL 1IBGH 5JMRA 1GZQA 5BV7C 3IXTB 5DJ6B 1H9VA 4HKXB 5F9JB 1QO3A 3E8UH 3VXNA 3FB8A 5B4MD 1BZ9A 1GGUA 4XPFL 1JK8B 6FABL 1FNSH 4LF3A 4O58L 1NGQH 2Y5TB 4OFIA 2X1WL 2AI0H 3WFHA 4HIJA 4FQ1H 1IC1A 2Y7QB 4M9OA 4DVRL 2GTZA 3C5SB 2UUDK 3WFCL 4OZHB 1L9MA 2E5EA 1RUAL 1ZANL 1U8NA 2Z31C 3MA7A 3LZFH 3BISA 3OPZH 4NFCA 4ZS7H 2DICA 4NQSB 4LEOB 2CLVA 1VHPA 1YQVH 4JG0H 2X4OA 5DGRA 3OKNA 5F70A 3CU1A 4ORGB 4PJCA 5IEHB 1TQCC 1FQ9C 5JW5B 5GHWH 4X7SH 3E6HB 2CDFA 4LSQL 5GGSA 3UPAA 1C5BL 2MQ0A 5D7JC 5C0AE 2QSCH 5KOMC 3HZVB 1A47A 2OR9H 3F58L 4WJ5B 4D94A 3RKDD 2V9TA 1EGJH 1FP5A 2C4FT 1IM3A 3MRKA 4PRHD 4RMRA 5ALBH 2FDBP 2ENSA 3AS3A 5H35B 1A1MB 4OM1L 5E94A 3AXLA 2M2DA 3B83A 5F3BA 2DI8A 3LSOB 4NZUL 4OZFG 3H9YA 4NO2A 2X89A 3MLTA 2HKHH 4H1LH 5EU4A 1LE5B 3LQZA 1UB5A 1MAML 4QWWD 4AG4L 4FXKB 4M5ZL 1I1CA 3ES6B 1U8JA 1A6WH 1QYGL 2EDJA 1JGUH 2IPUG 1RZ8A 4PP2B 2E7LC 1AR1C 4RGNC 3O45A 4U33A 5EOTB 1GXEA 2Y6SC 1CD1A 3GRWA 3L3HB 2R2BB 4G42A 5GGRA 1WBYA 2D0HA 5E1AA 4L8SC 2VDPH 2YMXL 4OZGB 3U7YL 1TJGH 1QRKA 3U4EA 4EJ1C 4MXVE 1OD9A 2HVJA 3PHQB 4MJ6B 3G9AB 3WJLC 5ABDE 2JJWA 3QG6B 2QR0B 2N56A 1MFAL 4LKCA 5BVJB 1KSRA 5FCUH 1OQXA 3I6KB 3QQNA 1JGVL 3T8XB 4Z7NE 4QYOA 5JW3L 1WIOA 1S78D 3FTGA 5C0BA 3ULUH 5C6WH 4TSBL 4M93B 4GBXD 4DN3H 4JAMA 2V17L 3FHAA 4LIQE 4M48L 1U2CA 2QADB 2X4UB 5SWSA 1JPSH 2DMBA 1YY9D 4Z7UA 1F4WH 4JPVL 1I75A 1NUDA 1IKFH 4JM2B 1K4CB 2DWEB 1I7RB 3BGAA 1AKJA 5HDQH 3S4SG 3LDBC 2NY5C 4IMLB 1TQBC 5KSAD 3QHFL 3B43A 3QUXB 4MXWH 5LWYH 4YDKL 5ILTH 5JOEA 1J1PH 4KV5E 4P3DB 4PJCE 3TIDB 3KGRA 1SJHA 5L6YH 1H3VA 4P2OA 1CN4A 5D7LD 3D39B 2D7TH 4U7SA 4UOJA 5JHDA 5IB2B 4Y1AA 2OTUB 5AYUH 3DX6A 3DVGB 4U1MB 4XVUD 4H8WC 3IJYB 4NUJB 1YDPB 3KJ6H 4PV9A 4XPAL 1SYVA 4F15C 3QFJA 4FQPA 2GFBB 4GAYA 5EFIB 4PJGA 5CSZA 3H42L 4J4PA 2OP4H 4HWEL 5GJTH 4PREB 5F1OB 4ZAKB 3IKCA 1OGTB 1NC2D 4P9HH 2RFXA 2F58H 5EWIL 2VMFA 3QAZC 2YEZA 5BZWA 4JCMA 3ARFC 5L2KD 5KS9A 1JZ2A 2R0LH 3IU4L 4TVPL 3PGFH 1TXKA 5D7SL 1CGXA 4JDTH 2EDWA 4WU5A 4CVWA 4GAJH 3EJYD 4HZAA 5E9DD 2H32B 3LV3A 3MBEB 1AR2A 3ROOA 3CFBB 4KJQC 1A6VH 3BZ4A 4KMTH 1F4HA 1YC7A 4NQCD 5ID1A 1S7RA 4N0UB 1Q0XL 2RIKA 3V5DB 2KKQA 3QG7L 4LGRB 5D2LB 3CFDB 5D1XD 3GMOA 1IZJA 4LCUA 3JWNC 4K7PX 6FABH 2A0LD 2CR6A 3N1MC 4O58H 5JNYA 2ARJB 5JZ7C 2DMKA 2GCYA 2VTFA 1P7KA 2DBLL 4DOHE 3SDXE 3NCBB 4K07A 4DVRH 3TBYA 3WFCH 1KB9K 2X1XR 5T3ZD 4LK4A 1MUJA 4TSAL 3DXAD 5DWUL 1ZANH 3LRGA 1ORQA 2MQCA 4DW2H 4JY4A 1CD9B 5C0BE 2F19L 2VQTA 1ND0A 5FHAH 2IQAA 3TFKC 1U95B 3GSNB 2Z91A 3RDTB 3KYOA 4F3FA 3SDDA 3OQ3B 1EPFA 1KF9B 3CX5J 4FQQB 5FK9A 2FECL 4Z7WE 5C0AB 3VFUA 3LEXB 3LQMA 3BEWB 3WIIL 2NY3B 5HGDB 1P9MC 4LSQH 2JJTC 4UTBL 5SWZB 3RVTC 1W0WB 5J56B 1C5BH 3P4NB 4YK4C 4K3EL 4YXKL 1F6AB 4PJHF 3F58H 1AGCA 1F4AA 2W59A 5DS8A 1T5XB 5ESQB 4OM1H 5JHDE 5HDBE 4CMMB 3ZE1E 4Y1AE 2NY7L 2XZCL 3OTTA 4P0DA 4NZUH 1NJ9A 3KVQA 4OAWA 3VXMA 2H2PD 5J6HB 1PX3A 3QFJE 2P49B 2R2CA 4PJGE 4BKLA 4M6MH 2X4QA 4WO4B 4O2FB 3VFPB 4HZLA 3IDMB 4OKVB 1QYGH 1TTGA 4N90E 3QO1B 1RZJC 5TH2A 5DYOA 3OAUL 4L3ED 5KTEL 5KS9E 5FOJA 4X4YB 2CLRB 1A9EB 2YMXH 3U7YH 3QIUC 4OD1L 5FYJL 4WWKD 5CHNA 2VC2L 5FYJU 1M6OA 2EYTB 4M8QA 3IDGB 4PTTA 4WTZG 1FBIH 5ESAA 5FA3A 3BKML 3TPKA 2DIBA 1S3KL 3HE7D 2LU7A 2WBJA 1JGVH 3GSXA 1KACB 4WW2A 5HVFB 5JW3H 5JXAL 4CN1A 3S5LG 1S7XA 1S7SA 5EUKA 4TSBH 3QI9C 3FN0L 5DJCA 4Y5VC 43C9B 1ZLVH 3QZWA 2V17H 4U4BA 1RSFA 2XN9D 5CP7B 3VW3L 4MNQD 2G2RA 1S7UA 4JPVH 1A1NA 4LDOB 4Y4FC 3D48R 4PRID 3B3IB 3LRSA 1JPFA 5E8OA 3U4BL 4NKOA 4ZYKA 3VGGA 4C4KO 4EIZC 2A9NH 3RNQA 3UPRA 4M9PA 2HH0L 3BW9B 4MCYA 3QHFH 3TCXA 2UYLA 4YDKH 2HT4D 1B0RA 4FFWD 4KKCD 5IROA 1A7PL 4ZUTA 1BD2B 3BPCB 2Q76A 5H94B 1BF2A 1CGTA 5KANI 4PJIA 4U1HB 1GGBH 4R2GC 2J88L 1FYTB 4XPHH 4NRXB 5ACMA 5F1SA 3W39B 2YS4A 3QWOB 3DLQR 5JIKA 4WEBL 2OJZL 3H42H 4HWEH 3WFZA 3MLXL 1CGVA 2NR6D 1NLDL 3RVWD 5CUSL 2BNUB 2FD6L 4P4KC 4NQUA 1CLOL 1L6XA 2DYPA 2G5RA 2BMKB 4LVOC 4U1GB 5DSCA 3QNZA 4B53A 5A16A 2BVPB 1XMWA 3VXME 1NBZA 2PTTA 4G6FB 5E2UH 2Z35A 4H25B 3WIHA 4TVPH 5F7LB 5ACLA 5D7SH 1VB9A 4XNXL 5E6IC 2UY7A 3FO9B 4RISH 4ETQB 3QQ4A 1BBJA 1H5BC 5AWNL 4PRBB 4ZSOB 5IB1A 1R6VA 1QFWH 2P4AB 3G08A 4B0MM 1KTKE 1RUQH 4PJXE 4WFHD 3RRQA 1A3RL 3VXUA 1Q0XH 2WWMC 4DZ8A 3QG7H 3SKOB 4H5SA 5DA0B 3RBGA 2F53B 1PQZA 5EBMB 3BHBB 5MP6H 4Q6YA 1PJ9A 3WIFB 4ZXBC 3K8MA 2DBLH 3QA3A 3MV8B 2BP3A 2R69L 2ZCLH 2HFEA 2HN7A 4MS8D 4MXQD 3ULSA 4M61A 4RRPA 2PXYC 5JIPA 4PGBB 2JB5H 4TSAH 4WTXA 3RI5K 2OR8A 4Z7VA 2Y9RT 2IALB 1I1FB 2AAVA 5LGHH 2F19H 3LOWA 2YPLD 5DHXB 5MEQA 3EYOA 5J1SC 1RVFL 3C08L 1W0VA 2HA1A 1IQWL 3WIHL 3MNZB 3DJ9A 2D31A 3C2SA 1BIIA 1ZSDA 3BQUA 4N1CA 5IJKA 2B1AL 3F7YB 5D2NA 3WBDA 2FSEA 3IB4A 4PJBF 4YPGA 1U3JA 3GMQA 1E4WL 2EE2A 3WIIH 4N5ED 3O3AB 4F58L 1O0VA 4LSVL 4UTBH 1F3JB 3MJ9A 1BLNB 5IT2L 5D7JB 3FN3A 3RWHA 2ZOKA 4K3EH 4YXKH 4U0RB 3RAJL 4NYLA 1OD7A 4XH2A 4ISVB 5KOVC 7CGTA 4WDIB 1I1AC 2D7QA 3ZTJG 5C07D 1ZAGA 3LH2L 4EN3C 1T04B 2EIDA 3JTTB 2LTQB 4PB9L 1FL5B 3VGAC 2XZCH 5I8OL 3KPPB 1L6ZA 1INEL 3KPMA 3NCFB 4LHUD 4YHNA 3IT8D 4P2QE 5ADOL 2ITDB 5HHPB 1UB6A 1HI6B 3OAZK 5DVKA 1IEBB 2IBBA 4G5ZL 5C9JB 4G9DB 3QDJD 4HWNA 1FLRL 1ES0B 1KPVB 1HQ4B 4OSUH 4XNYL 4RGNB 3UTQA 3O6LL 2IEPA 3KYNA 3MRCB 3OXSB 3OAUH 3OX8A 4EI6A 3SGKA 5HVHC 3IRZA 4LKXB 4JKMA 4L8SB 3BPOB 1ZTXL 4PJFA 1NDGA 4I3RH 3FB5A 4HUXB 3DIFB 2IAMD 3MJ9L 5FYJH 5EULV 4ZQKB 2W91A 5GS3A 5B21A 4GKNA 4OCRL 3FQWB 1P7HL 3NCEB 4JPIB 3IGAB 1I7UB 5FGSA 3G5YB 5E99L 3BKMH 1JZ4A 4M7LT 1SJXA 2DQCL 1S3KH 4WEMB 4P5TC 3VXUE 4P9ML 4EKXA 2O61B 1K8IB 5JXAH 5BXFA 5INCA 1A1OA 1FHGA 4IS6A 3QH3B 1ETZB 2AJYH 4NCC2 4QOKD 5E8NA 2DMCA 1YMMA 1I8IA 3BH9B 1KCVL 3FN0H 2VE6B 4IRSD 5FKAA 3F5WB 5IBUB 4HUMB 3VW3H 5J3HD 1H3WM 4ODWA 4L5FH 32C2B 2PNDA 4Z7VE 3TYGH 2VLRE 3VXTA 3U4BH 2EDKA 4WFEE 1N5AA 3I3EA 3FO1B 2E6JA 4Q0XL 4QRRB 3LDBB 3BSZL 5DD5H 1MCSA 4MQSB 2ZSVB 2Z93B 2FATL 1CWVA 1PKQA 1E28A 3MOQA 4AQ1B 1LQSR 1U93A 4FFVD 4R0LA 4Y19D 5DJDA 3FFCB 3B9AA 3O41B 4KI1A 4F37K 4OBRA 2J88H 3FB7A 2HT2D 4HS6A 4I5BA 4BH7A 5MEOA 4NCDA 4F15B 4OD3L 5EIIA 3VRIB 2GAZB 1F11A 4NJAL 4WEBH 3SDAD 2JCCA 2OJZH 5DA4A 1VENA 3A6CL 5D6DC 4LCYA 3VJ6A 4MJIA 1EAJA 2X4NA 1NLDH 2R4SL 2F8OA 4TTGA 1LK2A 5CUSH 2NLJA 2B0SL 3WD5L 3QUZA 2FD6H 2BK8A 2AEWA 1AGDA 1CLOH 1XF3A 5AAWA 5K9QI 2NW2A 1G7JA 2BOCA 3LMJH 4ODXA 4K7PY 2X4SB 3R4DA 5DJ8A 4NDMA 1HHHB 1WQVT 3IXTA 5DJ6A 2H3NA 4HKXA 4XNXH 1IGIL 1SEBB 2FJGA 5F9JA 3U30C 5CEZE 1AQDA 4IRJB 5JOPD 2F9BT 2HVKB 4NNXB 5AWNH 2JF1A 2P45B 4D9RD 2DTSA 4XBGB 1E0OB 3STLB 2Y5TA 3UBXG 4P5MB 3NABL 4UT6L 1A3RH 3VXQB 1XGTB 2XKUA 2YD4A 3VMOA 3C5SA 1REIA 4PJFE 3CDGA 4HAGA 4YO0B 3D5OF 2GITB 1LEIB 5KSBE 4FQ2H 1G7MB 1DQLL 4OF5A 2NZ9D 4OGAD 3UXFA 3RWJB 2R69H 3ME0A 3O81A 4WI3A 2DQEL 1AQKH 4LEOA 1TPXC 2DLIA 1JZ3A 4KC3B 3IRPX 1KYOJ 3UP1A 2E7CA 5K9KA 4X4ZA 4R7NB 3DX7B 4HJ0C 4TUKL 5IEHA 4XWOD 2BX5A 4ZG1A 5JLZA 1IJ9A 3ARZA 1RVFH 1V3MA 3C08H 4LFHD 3VXPB 4DN4L 5JW5A 1J0ZA 1SVZA 3BE1L 1FE8L 1IQWH 3E6HA 3WIHH 5GGTA 3MZTA 1RHHB 3KPOA 3CMGA 5HHQA 1Y0LB 5E8EB 3RZWA 2X1OA 4WJ5A 1LWRA 2PCPB 4V1DD 1E4WH 3EIFA 3HNVH 2DLGA 4F58H 3K81A 2AV1B 1Q9KB 1X5AA 4LSVH 4HCRA 4CU7A 5H35A 5DT1H 5IT2H 4YK4B 5ETUB 5BZDB 3BP4B 5D9SB 1TLKA 1D6EA 2BZDA 2QJDA 3RAJH 1N7ML 1NGXA 2J8UB 1LE5A 4QNPE 3CVIL 3LH2H 3VWJD 1R0AH 4WFGD 2EXWC 3ARVA 4PB9H 4ZNCD 1INEH 3GSUA 2E9JA 4NO0D 1IVLA 1FL3A 4RGMB 4G8GE 2JCCE 4KGLA 5EOTA 3ZHKA 5ADOH 2NY2D 2HFGL 4MJIE 1Y6KR 3L3HA 3DX9B 4UQ3B 4G5ZH 5C8JA 1Q72L 2FWOB 5MENA 1FLRH 4HV8B 4KH2A 5GGTL 1RZKL 4F7MB 4MLIA 2ERJC 4NHUB 1I7ZA 4OZGA 5I66B 4KK6C 5JQHC 2YUWA 4LP5A 4R8WL 3PHQA 1MCDA 5DURB 4XNZB 1EJ6A 3N1GC 4MJ6A 4UIMB 1CR9H 5EIVA 3QG6A 3QPQC 4QXTA 2EKSB 3WNPA 3CPLA 4OZIF 1MVUA 3MJ9H 5BW7C 4NM8L 2FYYB 5E5MA 5DEGB 3QQ9C 1B0GA 4ONHA 1MCPL 4OCRH 1AFVL 3QEUA 4FQCL 5E99H 4UNUA 3CLEL 2DQCH 3HNTH 4XHQA 4DZBA 1VPOL 3UTSD 4P9MH 4XRCB 4ODVL 3WLWC 3PUCA 2YPVH 2PR4L 3DURB 4J3UA 2QTEA 3AY4C 1MHCB 2GI7A 4JM2A 5DD6B 3QI9B 3UTTE 1NFDA 2DWEA 4QTHB 4GS7B 3SCMC 5KVDH 3BPLC 3EZ8A 1WWAX 2DJUA 3QEHB 4IMLA 1IRAY 1U8LB 4NQED 4I3GA 5F9OL 3ARUA 3PNWB 4Y4FB 4K8RL 4I18C 3SY0B 4KZEL 4N9GB 5DUBB 2GJJA 4Q0XH 5I9QB 3NA4A 3KPLB 5AD0B 5IW1A 2MKLC 3BSZH 1NGZA 3IAPA 4DGIL 4PRPA 5DD0L 4ZTOL 1O7VA 4KHXL 5IB2A 2FATH 4U1MA 3QXAB 5HHMD 1YDPA 4TQEH 2PF6A 3HCVB 2GFBA 2AEQL 4HIEB 5B3JF 4JCLA 4AIZA 4OJFL 4E0RB 4LLYB 5FDWB 4F8QA 4R2GB 5EA0L 5IUSA 1N2RA 1OGTA 2J6EA 3ZE2E 3BD5A 5DMYA 5DXWA 1XZ0A 4OD3H 1YEGL 1CF8L 4LNRA 5L9DL 4NJAH 1HH9A 1JRHI 4PTUB 3A6CH 4YHML 1CICB 5CBEA 1CGSL 3PWPB 2R4SH 5DK2A 1QRND 1IGFL 3QUKA 2AJ3A 2B0SH 1QSVA 3WD5H 2A38A 4LAQL 4LVOB 43CAA 1KJ3L 3HC4L 3NIDE 1EBPA 3V79C 1FFRA 3BX7C 5B38A 3CFBA 3H3BC 4W81A 1X5ZA 5E6IB 3GSWB 4G6ML 1IGIH 1O5DT 3O11B 3V5DA 5MENE 5EORL 5GGSY 4JFFE 2R29L 2AJUL 5HD8C 4LLAA 2EICA 1MFNA 3AS1A 3QJFB 3RVUC 35C8L 4JGMA 3MRMA 1IL1A 2H6PB 3TA3C 2AERT 3BP6B 3NABH 5F89A 4UT6H 4BSVA 2R1XA 1VEMA 2VDQH 3I02A 4ZPTA 1DZBA 2XV6B 1BJMA 2BNRA 2J6EL 1CDYA 4ZXBB 4JFPA 2OZ4A 5HY9A 2Q1EA 2AXFB 1NBVL 1UXSB 1KJVB 2DQEH 2PN5A 2PXYB 4H0IA 3GSNA 2HT3C 3PL6D 2HMID 3D2UB 2R23A 1T2XA 4NM4L 5B8CA 2QSVA 1UWXK 4FQQA 4MAYC 3RL2B 4BQ8A 1N64L 1NFDE 3LEXA 1ZLWK 4DN4H 4CKVX 1FE8H 4MNGB 2VXSH 5SWZA 4J3WA 1KB5A 5FO8B 1OTUC 2C1OB 4J1UA 2P47B 5IK3B 4ZNEA 1QD0A 2VR4A 4UOW0 1ZS8B 5C0ND 3QR2A 4Y4HC 1T5XA 2BC4B 3OSKA 2JTDA 3ARQA 4PRPE 2VISB 4POZD 2AJSL 5A2LH 4MNHB 1KTLB 1VEOA 1R3JB 3P2TA 1HE7A 4I1NB 4N0FA 7FABL 5HYSG 3K3QA 1EUUA 4E41D 5B22A 2VZSA 1ACYH 2OZ4L 4M4PA 4W68A 3TPUB 3RX7A 3CVIH 4EN3B 4LLUB 1V3LA 4WO4A 3TVMA 4O2FA 4AY0A 3VGAB 3FMGL 1MIML 4TUOB 3GSNL 3FB6B 4ZO8A 4YHKH 5FYKH 1OT2A 3QO1A 4HWBA 1YPZB 3MFGB 4PJ7A 2AABL 3UTPD 4R90H 2HFGH 1EEYB 1RURL 4U6HB 1I9EA 1Q72H 4TULH 4MD0B 3JWOC 5JW4N 1FNHA 1U3HA 3REWB 1RZKH 4UI2A 3V0WH 2YRLA 4QHUA 4X4XB 5I1LB 2X9YA 3HAEG 3I3DA 4NC2B 4R8WH 2GSIA 3PV6A 2EYTA 1GGIL 4M00A 5KZCD 5GS2D 1Z3GL 4HH8A 5IM7A 1AI1L 1QR4A 3O9WC 3HC0A 3P0YH 5FUCC 5HVHB 3RWIB 4MDIB 3J8F7 4MVBC 3G6AB 4NM8H 1BREA 3RWDA 1OTSC 1MCPH 4RFNC 4Q58C 1AFVH 5FYKD 1A7RL 2E9BA 3CLEH 43C9A 4M1CD 5KJRL 4P5TB 1VPOH 4QXUL 4M1GL 1IGTB 3MV7B 2VKWA 1MCBA 1AJ7L 2PR4H 4G3YL 2FGZA 3BIKB 4U1SB 2A6KB 2BNRE 1MY5A 2ORBL 5CGTA 4B7IA 3QIWC 2AK4A 4HWBL 4I2XB 1AHWC 1DVFB 4NBXB 1MCWW 1A2YB 2JLLA 1EJOL 4YE4H 5T1KB 1OL0A 1J05B 5T5NF 3MJGX 3MSPA 1ADQA 3D25B 3CX5K 1HHIB 1BD2A 3MRQB 5H94A 3UTZB 3MRNB 4ELMB 1CGUA 5L88L 4EVNA 4U1HA 5DD0H 4ZTOH 3L5HA 4AT6B 4PJ8A 4NRXA 5EPMA 5ICZA 4GFTB 4HPYL 3RFZC 1FSKC 4G8FB 1U41A 3W39A 3JVGA 3TIEB 1R24B 4ZNEE 2AEQH 4F7TA 3LEYL 1OP3K 4KUCD 4OJFH 5IW3A 5EA0H 1B6DA 2V2TB 3HE6A 2ED9A 5C09B 5EDXA 2ZCKL 2BMKA 1VERA 5CZKA 1YEGH 1CF8H 2QBWA 3H9SE 1AGBB 4G9FA 3L3JB 5L9DH 1PSKH 1A7NL 3U36B 4YHMH 4KRMB 1CGSH 1C12B 5F6HI 1WZ1L 4U1IA 4YXHL 4PJHA 4LAQH 1EHLL 3GI8L 4GRWF 4ETQA 1KJ3H 1U8IB 2MSPA 3HC4H 1HXMB 2I9TA 1JTOA 1DBJL 2HYMA 4RX4A 5B4MC 4PJ7E 1ED3A 1ADQL 1MI5A 2VLMD 2WWKT 4DCQA 3NIFF 1V7NL 2UWEF 4G6MH 4UILL 3SKOA 5EORH 1FG2B 1N6QL 2R29H 2AJUH 3N85H 5GISH 4F9PA 2QADD 3I3BA 4PJ9A 4Z6AT 5EBMA 3VWKB 5CSBA 1RK0B 2H45A 1ZVSA 2C5DC 4NC0B 4NKMB 1A6TA 4CW1B 2CXKA 3X12A 3DMMD 2WQRA 3MV8A 3MFFB 4PGBA 1CTOA 4QRPB 5T1LD 2WIIB 3S96B 5GJSL 4K3DL 4GG6B 1J8HE 4G80A 2IALA 3QUXD 5CEXA 2OMBA 3PWNB 4Z0XB 1YEDA 4JLRB 1NBVH 4PLOB 3VXRB 4Z78B 1NCUA 4XPBL 1S8DB 1TPXB 2DQHL 2FJHA 1QSFA 5ENWB 1U91B 5DTFB 5HHNB 4GXVL 2E9WA 3D39D 2OL3B 1XGPB 3F7YA 1VEPA 4GRMB 4NQTA 1N64H 2H32H 3DV4A 2AK4E 3Q3GB 5LKNA 1X9QA 2KL6A 3WNMA 4W6XB 1BQSA 2GTWB 1ROWA 1F3JA 1J10A 3QDMD 4X5WB 1LO3L 1QOKA 4LCIL 5I75C 3LB6D 4H88L 3N1PC 1CTNA 2JE8A 4PJ5D 1ZMYA 4ZAKD 4BQ9A 4DKAA 1UC6A 2PYEB 4JFEB 4PGCA 1S7WB 1NUGA 3VGBA 1PEWA 2EC9T 1KBGH 1UA6L 2X1PA 3OKMB 4ZO6A 3JTTA 4K9EH 1JHKL 1D3CA 1ZHLB 3ZKMD 3TEUA 4QWWC 3KPPA 1UCBL 1SYSB 1WC7B 1BJ1J 7FABH 3MRBB 5GRYA 1HILA 4ZFFB 2OZ4H 4UDTB 1WBXB 3KXFA 4S1RL 3H9HA 4I13B 3ZTNL 5HHPA 3BDBA 1KIRA 2AW2A 2YRZA 1IEBA 3MBED 4QTIH 5C9JA 1CFSA 3BZDA 4N68A 3GSNH 1NLBL 2HG5A 4P57B 1ES0A 1KT2B 1KPVA 1ZHKB 1HQ4A 1CL7L 3NGBC 4G9FE 3WLBB 3OXSA 2AABH 3EZJB 4FTVE 2CRZA 2Z8WC 4P2RA 1RURH 3ARGD 4JO4L 4NZJA 5CILL 3B9DA 2Q3AA 4LKXA 5C1MB 4CRPA 2J2ZA 3OHXB 4PJHE 5TJWK 3P9MB 4HUXA 3DIFA 4ZQKA 2ZJSL 1GGIH 4YHYC 5CS7A 5HI5C 3IGAA 1MI5E 1AI1H 1G9EA 4WUUB 5DJ0B 4TRPL 1K8IA 5GQBA 2EEDA 4EZMA 1T2QL 1A9BB 4CU6A 5FUCE 2R8SL 2H41A 3ZT5A 1KPRB 4LDEB 3RDTD 3FOLB 1EXUB 1I9RL 4PB0L 2B4CC 3W5MA 5DD1L 5KJRH 1FRGL 6CGTA 3F5WA 1VCAA 4QXUH 3RVXD 4M1GH 3MRJA 5C0AD 1OAZL 1AJ7H 4G3YH 4JZJC 3JWDC 3L7EB 32C2A 1BAFH 3GJEB 2ORBH 2WINB 3FO1A 2EDBA 3SCMB 4HWBH 4FA8A 3BPLB 5C0EA 1S7TB 4JFOA 4YDJA 1QSFE 2IANB 4YBQD 2CSPA 2X70B 1EJOH 3EYQC 4OB5L 2V5MA 2IADB 3O2DH 5EZLB 4HKJB 4L8BA 3DGGB 1BBDH 4UT7L 4NZRH 3VFWA 1Z6JT 2P8MB 4KUZL 3FFCA 3GMMA 3B2VL 1FIGH 3WUWB 2F54B 1FH5L 2YWZA 4HPYH 5F7EH 4W4OA 4F8TA 2OTWA 4KK5D 5ICYB 3ZKSD 4PY7B 1QPPA 3VRIA 4C83B 3QNXA 3LEYH 1Y6NR 3KR3L 1KC5L 1ZA3A 4BUHA 3QDHA 4F2MB 4TYUA 2DKSA 3THML 2MWCA 1NEZG 4B7LA 4BQBA 2LFGA 1MFCL 1VSCA 1A7NH 3HKFA 1BQHG 2C26A 2E7HA 1Y6MR 3VI3F 3L9RB 3ZDXF 3KXFE 3N9GL 1HHHA 1KNOB 4EQ3A 1YN7B 1WZ1H 2VLLA 3AREC 4J3SA 3G5ZA 3MRIA 1EHLH 1SEBA 2EO1A 5SWQB 1K2DA 4KVNL 5C6TH 3HS0B 4IRJA 3TZVA 4U3HA 4Z76A 2HVKA 1X5GA 5DQJA 5I1GL 2ESVB 4WV1B 1DBJH 1QUNA 3BJLA 5D1XC 4LU5L 4XBGA 4XP6L 1DN0A 1ADQH 3L6FB 5DJXB 5BJTA 4L9LB 3NFNB 4P2RE 4X6DF 1PZ5B 5C92A 2QKIA 2XFXB 1T22A 1SBSL 4YO0A 2OBGA 1HEZB 2FLRT 1BFOB 1CGWA 4KJPD 1LEIA 1UH4A 2OYPA 3CH1B 3ARXA 3OKOB 2XQBL 3PGDA 1HNFA 1X5FA 1DDHA 3RGVC 2CLZB 1JPGB 4XNQB 3T4AB 1DBKL 1FNEA 5D1ZB 4XP4L 3D3VB 5GJSH 4K3DH 4G8IB 4MA8H 3DX7A 4QCIB 1HOCB 5FO7A 1UKTA 1LHZA 2H26B 1MLBB 1FAIL 5IMKA 4XPBH 1TTUA 2BCKB 2BRQA 4FQXC 2AJVL 2DQHH 4KZDL 3SHSA 2ZUYA 4XT1C 1H0DB 1MCQA 4NQDB 1Y0LA 1CIUA 4GXVH 3T4YA 2DDQL 2P5WE 4MAYB 4TSCH 3SGDH 4FFZH 4JN2B 4JPWL 5HVWA 1DLFL 5DMIL 4KRPD 3TBTA 3PE9A 3PV7A 4PGJA 4JZOB 1XF4A 2AV1A 3DHJA 1X6NA 1LO3H 4KROC 1S9VB 1G0DA 4L9DA 3BP4A 5D9SA 3MTRA 3C6LC 2BVQB 2V5YA 4JRYE 1U8MB 2QQKH 2NY4D 3BO8B 4PJAF 4L4TB 4Y4HB 4P23C 4S0SD 1UA6H 4G6FD 3ZE0F 1JHKH 1FLTX 1R5VA 2JIXA 1WWCA 1QSZA 4X9GA 4LFHG 2I60H 1NCCL 3UTOA 3GGWA 4J8RB 2NX5E 1I8LC 3S36H 3FRUB 3ZTNH 3ABZA 1EHAA 2CUIA 1WITA 2YD9A 4WUKL 1JYNA 3H0TB 4Z7OF 5CGYD 4HV8A 2MMXA 4PJBE 4F7MA 1MCEA 1P7QB 2MHAA 2YD1A 1CL7H 3KYMB 3GMLA 2VLKB 2F53D 1P4LA 4UIMA 2ICWB 4JO4H 5CILH 3VU2A 2M26A 5CZVL 1LP9F 5A2IH 4X99B 1A22B 2GQHA 1UXWB 4MJ5A 3X13B 4R3SB 3MUY1 4N8VA 2ZJSH 2HP4A 5IVXB 3OMZA 2CIKB 3BDYH 2IGFL 2NY1C 4HMEA 2Z31D 3DBXA 5LQBL 1EERB 3FKUS 1T20A 2ZUWA 3QCVL 4JFDE 2X09A 3RZCC 3WE6A 3DURA 3NZHH 4IIQC 5K9OB 1T2QH 1AKJD 5E2WL 1MHCA 2R8SH 2CKBB 4RFNB 5DD6A 4PB0H 1OAYL 4AM0B 2AKRB 3BWUC 3B9VA 4QTHA 2J4WL 5DD1H 4OV6F 3KPRE 1FRGH 1DUYB 1EEZA 1DANT 4U3CA 4D3CH 1U8LA 3DVNB 3K8LA 3PHOB 5FUOL 3T1WA 1E4KC 2B2XL 2LAAA 3SY0A 3V0AC 1KYOK 5DUBA 5IIEB 2EDYA 3GSOB 4JO3L 1Q9WB 3QIWB 4O2EA 1RZGA 3EDJA 3QO0A 4FFWC 5GS1A 1AHWB 2VWEE 1B4JL 4XCEA 1CCZA 3AGVA 2C1PA 2EIZA 3VH8G 4OB5H 1FN4A 4YHOL 3FQUA 3L3DB 3QXAA 3GUTA 1YQ2A 4UQ2A 4UT7H 2WSKA 2F8XC 3SE4C 3BZEB 3EJZC 4KUZH 2JJUA 1WAAA 4X6EB 4E0RA 3OR7A 5FDWA 1B3JA 1FH5H 3UBXB 3I75B 3R1GL 1FSKB 1DCLA 1KN2L 5IF0B 5EC1A 1PFCA 3U0TB 3V6OA 4PTUA 1XIWC 1AR1D 3KR3H 4HKZA 1CICA 4KDVA 4RGND 5C0FB 1KC5H 2Y6SD 1A4KA 1EDQA 3THMH 4W70A 2V2WB 3TT1L 1RAMA 1MFCH 4MD5A 1ZWIB 4N1EA 5HYQB 4NP4L 1RUPH 4RWHA 3G6JF 3LKNA 2BSSB 3N9GH 4XP5L 4HMDA 5GZNC 4EDWL 3O11A 4KVNH 3SO3C 4R4BA 1JGEB 3T2PA 3U7WH 5I1GH 4KDTA 3DSFL 5AYQA 3S36X 3BMWA 3L3KA 3QJFA 4LU5H 5L0QC 1CVRA 5SV4A 4E5XB 2H6PA 2YD8A 4TOYH 4MWFB 1A14H 3U9UB 2EXYC 2APTA 4I0KA 2JB6B 4BH8B 2R2EA 1VFAB 3ULVL 4RA0C 3ZYOA 3UCRA 2CR3A 4MX7B 4WHCA 4ZO7A 4JFXB 3ULUF 1CU4L 1FL6A 1Z9OA 2XQBH 1TVBA 3BH8B 3O2VH 1UXSA 4S0TD 1KCLA 2A73A 2EE3A 4QRSB 2VERN 4X6CF 4M8VA 4QRRD 4OZFA 1DBKH 4XP4H 1NBQA 2FO4B 1FDLL 2Q7NA 4YZFF 4Y4KC 3MYZA 3W2DL 3M1BA 3MJ8B 1Z0MA 1FAIH 5EO9B 3JTSB 2AJVH 2BNQA 2WWKO 3DX8B 2K9UA 4JM4L 1K8DB 1RUML 4H26B 2DDQH 4LLWA 2JJSA 3FQRB 3ARDA 1HZHL 1R3HA 1HYSC 1ZHBA 3GMRB 1KGCE 3W81A 1DLFH 5DMIH 1BHGA 3KHQA 3MCKB 1ZS8A 2YD2A 4PRHB 5SX5H 1T7XA 2NMSA 2BC4A 3MYJA 2DQGL 1G7HB 3CFEB 4MNHA 5ANMA 1R3JA 1T0MA 4A6YB 4XI5C 2V5SA 2IH1B 3ARYA 1FNLA 2ATKB 1FAKT 3ARFD 4RBPK 3VFMB 2GJ6A 4DJMA 2WV3A 1C5DB 1GCFA 1HSAA 4O00A 4X6BA 1NCCH 1LO5A 1CVSC 3CD4A 3KS0J 3ZKNC 3SJVE 4C57C 2W9LA 4FN0A 4Z77B 4GOSA 2X4PB 4Y2DC 4U6HA 1BX2B 4D0BB 1UZ8B 4KJQD 1U8OA 3S4SA 3NGBB 4X4XA 2P7TB 3WDHA 1J0HA 5I1LA 4I0PC