3MYZA

Protein induced photophysical changes to the amyloid indicator dye, thioflavin t
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
97
Chain Sequence
MIQRTPKIQVYSRFPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
publication title Protein-induced photophysical changes to the amyloid indicator dye thioflavin T.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 14
structure length 97
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3myzA00
1ZHBB 2J8UE 4P9HC 4XP4L 5D2LF 1S7TB 5F9OH 1FL5A 3CX5K 4OLZH 1Z3GH 2AW2A 2WQ8A 2EZ0C 2A9NL 4H1LG 1CR9L 1VESA 2IALB 4XWOC 5BRZE 3D3VA 3SE9L 1S7UB 2YSSB 1U6AH 4QXTB 4DAGH 2XZQH 4FQ2L 4J8RB 4RMVA 4G9FE 1J1PL 5JXEA 5C0JA 1P6FA 1OP9A 3MGOB 4U1JA 5DJDB 1J1OL 4FNLL 3TEUA 2IF7A 3EO9H 2BOCA 1DVFB 4BK5A 4IJ3B 4JRYD 2X4RA 5C0GA 1G6RH 4X9HA 1CIUA 3NOIA 1LEGB 1S9VA 3AUVA 5FOBB 5H37H 4NRXA 4WTWA 5I1LB 4ZG1A 4UT7H 3RNQB 3BJ91 5I8KH 4QLRA 4Q6YA 3L5WB 2DB8A 2PCPB 2XI9A 4TTDD 5D71L 4EUPB 4JRXA 3GMOA 4D0BA 1BM3H 1OVZA 1QSFB 3MJ7B 4Z7VE 2BNRB 4G6FB 4OF7A 2Q1EA 4PJFE 4L3AA 4DN3H 5MENE 4PBXA 4GG8B 5FOJA 4J3WA 4N0UB 4V2BA 4PRNA 1EH9A 4F57H 4P2RE 3WJLC 3AMLA 2AJUH 1AI1L 2EDKA 1M71A 1NBYB 4J3SA 5JUEH 4S1SH 4AZ8A 4WJ5B 2BVYA 1N5AB 3A67L 2NY5C 4DGIL 3GSNH 4NNXA 3EIFA 3W2DH 1P84K 3BGFC 3GMMB 3UZQA 3UTQB 5MP6L 1U8OB 2BNQE 3TBWA 5DJYA 3VRLF 1R3KB 2VR5A 5BO1H 3W11C 3B9VA 3EYVB 3KDMB 4Y88A 2V9QA 2WIIA 3K2UL 3B2VL 1G1YA 5TE4L 1SEQH 5C6WH 2Q76B 3AB0B 2J6EL 3ESUF 4EI5B 3EYFB 3GMNB 4OLUH 4DCQB 1F6FB 1WFNA 3IXAA 5FIEA 1I3RA 4CNIA 5KTEH 3EFFB 1RUKL 3T04D 2Y9RT 2PYED 4FN0A 1PAMA 4K3EL 4K94H 3QUXA 4PY8I 2X7LB 4JFOA 3UTSB 2IH1B 2DWEB 3PWPB 3PGCA 2BSRB 3BYTA 2VRAA 2B1HL 1MCPH 4KQ3L 2DJSA 1X5ZA 3VFOB 3G9AB 3P4LA 2HH0L 4ZS6C 5TFSL 2R23B 2VR4A 2CDEB 3GO1H 5I0ZA 2CKBA 4Q58C 4PJ5D 2PTTA 1IKFL 3L5XH 3GUTB 3KAAA 2YD7A 3A6BH 1NDGB 2BSTB 2NPLX 3KWWA 4OZGB 2HJLA 2P8MB 1NCDL 1TJGH 2EXWC 4JO1L 4X7SL 5BS0A 3QUML 1UT9A 2DIBA 1KIUA 5GGTH 5D1QC 1YYLH 4AT6A 4RGND 5K9KB 1VGKA 2P5WB 2MMXA 5D8JL 3CX5J 2YMXL 4UQ2B 3QG6A 1Z5LA 5HVGB 5J89A 3FJTA 5TGBA 5ID1B 2F58L 4OZIA 4NFDA 4OLVH 4E0RA 2JIXA 5E8PA 5E0QA 3CZFA 1YMME 43C9B 1J9CT 4RSVA 4Z7NE 1TMCB 4P5MB 2PW2B 5E95B 4A6YA 1ZA3B 1J11A 3BH9B 4P23B 1NGQL 3ARYA 1FFOB 3ME0A 4JKPL 3RWIB 4YGAB 1S7VA 3U7WH 3FOMA 3GBML 4V1DD 4E5XB 1UM5L 1NLBL 3DTXB 1U9KA 2K9UA 4CN6A 3VGFA 1LP9F 4WFFE 1F6LL 1R5VA 4HJJL 1U8QA 5HGDA 5GRJH 3AS0A 1M05B 4FQLH 1NGWA 5ALCH 3HAEB 3PV6A 2H3NB 4YR6B 4LDOB 1H9VA 4XVUC 5L9DL 2ZG3A 3BHBA 2IPTL 3MRIB 3NZHH 2DM7A 4EDWL 1A9EB 4TUOB 1MH5B 2NCMA 1FVEB 5EZIH 3BZEB 1H5BB 4PJEA 3BIAX 3KXFB 2VLRD 3MV9B 3P9MA 1X44A 4WNQA 1XGUA 4PJIF 1HNFA 4TULL 1WISA 3GK8L 2VAAA 1EZVY 4X6FA 5E5MA 5GQBA 3BVNB 3HE7C 3MV11 4KMQA 4ORZC 1WZMA 3KYAA 1MCLA 5I8OL 5DFVC 5TDOA 2DMKA 2CXKA 4AIZB 3O8XC 4JO2L 1AXTH 4XGZA 1YPZE 2DLEA 5C0CB 3C9NB 1L0QA 3P0VH 2E7HA 3E6FA 1JI2A 3LEXB 4GMSH 1U0QA 5HHOA 3A0OA 3V5HB 4ZFGH 1LO0H 3O6FA 4KRPB 4KK8C 5EB9A 3JSSA 1FDLL 2IH3A 1UWGL 2AJZA 7CGTA 4QRPD 1PQZA 5E2TL 3C6LB 4BH7B 2EDQA 5AYUL 4XPBL 2H26B 2VXSL 3FT4B 3DBXB 4Z0XB 5SWZE 1BOGA 3RY5A 4UUJA 3MOAH 1JNLL 6FABL 3KYOA 1OAYH 4RFNB 3NCBB 2A1WH 2XA8L 3TIDB 4QTIH 4XI5C 4U1KA 1EBPA 4K9EC 5AG9A 1CICC 5KS9B 3CK0L 4RBPH 4F7EA 2VDQL 3SDAB 5TE7H 1M6OB 1RURH 3KR3H 3RFZC 1NQBA 3O41B 1HYSC 4RWYL 2LQRA 5DD0H 3TA3C 4GLRH 2FGWH 2VAJA 5IR1B 5CP7A 3BUTA 2C4FU 4D9RE 3PGDB 3HB3D 4JFHE 43CAB 4PJ7F 4LCCB 5KVDL 5A16A 1AD0A 2YN3A 3HLAA 4LKXA 3V0VA 3IAGC 1V3JA 1CDCA 1S7WA 5IVZB 1IC4H 1XIWC 4JB9H 1RVFL 1IL1A 1X5LA 5AWNH 1FG9C 1PEWA 1CWVA 3ZT7A 5D6DC 4PRIE 5E9DD 4KJPC 2CIKA 4JM2A 4XPTH 4ELME 5GRXG 1B2WL 2VDKL 3MUGB 4MGXA 4G6AD 5BZDA 1QO3A 1BF2A 1T83A 4HFUL 1IAII 2PXYA 1MCIA 3BH8B 4TSAL 1IC7H 1OQXA 5KVMC 4LP4A 3Q2CA 1YUHB 3QXDA 3RP1A 1CLYL 4XBPB 2BVQA 5F1KC 3QO0A 4JFQA 5K9JH 2UY7A 2PW1B 4QRQA 3PIQB 4Q6IA 4M8QB 4UBDD 1DR9A 3MV8D 1T3FB 3BYYA 2C3HA 4ODBD 4NBZB 3DX8A 1WEJL 5DJAB 2VQ1B 3MRHA 3O4LB 3T0VA 4O4YL 3NAAL 2GQHA 4WW2C 5D7SH 1SJHB 1J05A 5GRUL 1IEBB 1WAAF 2VXQH 1BOYA 2YXFA 3ZDZF 4G9DB 2ZCLH 1TTUA 3MLSL 3QI9A 5HJ3B 3PGFL 4PGBA 3E2HC 5FGCB 5FYKU 4L3EB 3G5VB 4PG9B 4Z8FH 1E4KC 3JZ7A 3RX7A 2DQCH 4UZGA 2ICWI 4GKZB 1NUDA 4PJGF 5IFJA 3LY6A 3LDBB 4PR5B 5IIEA 3VE0B 3C5JB 3NH7H 2HTLC 4DGYH 5HYFA 1SQ2N 2R2CA 5H94B 2IC2A 2R4SL 2XTJE 5IW1B 4P3CH 1RJYB 3CPLA 4HS6B 4AM0B 4S1QH 1LO3L 1Q94B 1REIA 3GHEL 4FS0A 4I2XB 3ZE1F 2BVEA 4KKAC 4U3CA 3T09A 4K8RH 4RRPG 5DR5L 3TT3H 2V2TB 1FVCB 1LK3H 2X9YA 3S37H 3KLAA 4LDLB 3MTRA 4TUJB 1BWWA 2X4OA 4WFGD 3SDDB 2ZSVB 4PS4H 1FCCA 1MEXL 1F3JB 1L6ZA 1QRND 1TZHA 4DAGL 4O00A 3WFHA 3U9UA 1HILA 4YDIL 2GYSA 3BEVB 4YGVA 1H3XA 5D7JB 2DQGL 1LE9A 1NBVH 1XF2A 3WXWH 1YC8A 5IB3A 3WXVL 1MCQA 3RAJL 1MVFA 4K3GA 3ZKXB 4NUJA 5CSGA 4PJHB 3QH3A 4F7CA 3ALWA 3B2UD 3VDBA 1TCRA 2F19H 1NLDL 3IU4L 3WNPA 2H1PL 4JN1L 4MHHG 1NJ9A 4JFFB 4B0MM 4EZMA 2WV3A 1NSNL 3LV3A 1VHPA 1M7DA 1N8ZA 3KPRD 3TZVA 3RIAF 4LIQL 4RCAA 2X4TB 2F74A 4Z7WE 5C0RH 4KRLB 3BPNB 3VDCA 3MV7B 4WY7H 5EU5B 2AV7A 2IAMD 2P5EB 3OJDB 3VGGA 3D0VA 1BF8A 5FAAA 4ZUTA 2LE9A 3FN3A 4LSTH 2H45A 4S1SL 5A2FA 3JTTB 2HFEB 2KQMA 4U49A 2YUWA 2F5BL 3DETD 1P7HL 5BRZD 4DN4H 4HHAA 1A7OH 5JPMA 4WUKL 2CLVB 5D72L 2NTSP 4LRNL 1SJEB 3HI1A 4KRNA 4JLRB 3D39E 1N6QL 1DN0B 3CSPA 3K4DA 4Q74A 1FPTL 2IPUG 4G9FD 5IROC 2B5IB 5FM8A 1F4XL 3OXRA 1AGFA 2XKNB 3K1DA 1I1AA 2FHFA 1JL8A 1XGRA 2VXUH 2YPLB 3F7VB 5IM7B 1A22B 3PHQB 1S78C 3WHXB 5GS0C 3KPQB 1SY6H 5FGBC 2HRPL 2B4CC 2EKSB 4KJYA 4YIQB 4QWWC 4KJWD 4X8JA 3QWOB 2PYFB 5KTEL 1NCCL 2HKFL 2HFTA 1GPOL 1S5HB 1GGCL 4LSRH 5EU4A 1A14L 5LGJB 4PJFF 4HEME 3O3EA 5TQ0H 4ZFFB 3RTQA 4WU7A 2OJZL 3ULVC 4WUUA 5ICZB 5MEND 4X7TA 3TPUB 1BZ9A 1T2JA 3O0RH 3VD7A 3PQYE 4FQXA 4P2RD 3SN6N 4JZJA 3CFDB 2HKHH 4YX2L 2VZOA 3BZFA 1A6ZA 4FFYH 5JOPE 3VFWA 3B9DA 4P57A 3MRFB 1UQSA 3S96B 4PJ8B 2DYPA 1XF4A 3C5ZD 2BNQD 2EDNA 2X9WA 4PRAA 2ORBL 4NQXB 3VFVB 4P46B 4AENA 4HZLA 1BVKB 4JFDA 4RAUB 4JPIA 2HVKB 1K8DB 2YC1B 2BMKA 4X4ME 3THMH 3FQUB 3LD8B 4UIKH 3JWOH 3N06B 1AGCA 3RNKA 4XBGA 1BX2A 2R0LL 3PHOB 3QNYB 4JPWL 4KRPC 4X5WA 3P77A 1UGNA 5E1AB 2AJVL 2P48B 2OI9B 4NCC2 4L8CA 2V2WA 3H9SE 5GGUB 4Z77B 1ZLSL 4UMGA 5DHYA 3C6LC 3BDXA 4BQ9A 3FZUD 4GG6F 1N6VA 1PKQA 4I3GA 3TYGL 3V4VH 1R5WA 1JIBA 2ICEA 3O3DB 4I9WE 1KEGL 1KLUB 4NN6C 3KLHD 4OQTA 4RFNC 3QNZB 3L3JB 3PF2A 2Y7QA 1RFDL 2DI8A 3FHQA 1B4JL 2L0DA 3WUWA 2EDLA 4LU5L 5HYJA 3MACH 1QHPA 1A3LL 1I1FA 3PNWA 4UDTA 1HSAB 4NHUB 1MJJB 3B9KD 3P11H 3RDTA 3ZDXF 4IOSD 2JB6A 2ZOKA 1MJUH 4QTHA 5EZIL 5E6ZA 2BOBB 3ARGA 1KJ3H 1JCKA 4HS8H 2CXGA 3EZ8A 5LGKA 1I1CA 2R56H 4JKLA 4LCWB 3P9LA 4M61B 3MXVH 4MQSB 1OTUC 4ONOA 3TP4A 1G0XA 1HHKB 3D87B 3HI5H 3SDCA 4R4FL 3JV5A 1YMMD 3O45B 4Z0BL 2VLKA 1P7KA 2JJVA 5ANME 4GFTB 1KT2A 1OGAE 5DUML 5T3ZE 5CEXB 4JFXB 3FQXA 3C60A 5I1IH 4ZUVA 4IHOB 3K4ZA 1F11A 4DUVA 5DZLA 3T8XB 5CIPA 4NC2B 5LAXB 3QFJB 3BKYL 5I8EA 5HPMA 2UUDH 4Y16B 3BO8A 1TETL 1J1XL 4WFFD 5HHVH 4M1DH 4PREB 1F4AA 1F02I 3HC3H 2MQ3A 5SX5K 3MNZB 4XAWL 1KNOB 2GY7B 4YBQD 1HQ4A 1D5IH 5CWSA 1WIUA 2ZCKL 4F7PB 2H2SD 4XPGH 2XY1A 4MXWL 2APXA 2UV3A 1A1OB 3QRGH 2R0ZH 5D7IB 3ZE2E 1MWAL 2EC9U 3D85D 1CT8A 1I3UA 1N0XH 4HPYL 4KI5E 1DE4A 4FOMA 5FO8A 1FAKT 3NIDE 4PLJC 3FRUA 1FORL 3CVHA 4JHAL 4F37F 4PP1D 3FB6B 2R1XA 3OKNB 1Q9OA 4ZAKB 4WEBH 1RUAH 4I3RH 2K7PA 4MA3B 2UWEA 1U93B 1Y18B 1JGUH 1UXSA 1ZT7A 5EO0B 3RUGF 4FZEH 3U0PA 2NXYD 3WNMA 3ZKND 4NFCA 3ZKMD 1MQ8A 3VFUB 5HHXH 3ZYJA 1H0DA 2V9TA 3QDJB 3CSYA 1OD9A 1S7XA 4XP5H 3MYJA 4H0HB 1IC4L 2X9XA 4NM8H 2WM0A 1UCBL 4JZNA 4F9LA 5JHDA 3TJHD 5B38A 3EOBA 2YRPA 3O6LH 3W0WB 5EOCJ 1BFOA 2CJUH 5JR1L 1C5BH 3MA9L 4QHLA 5IVXA 4OT1L 1H8NA 4NPYA 3NFSL 4ODUB 4ODXB 2YA2A 3MCG1 5SWZD 4HCRH 1JF1B 4MA8H 4OIIL 4FXKA 2YBRA 4NQEB 4RMWA 3MJ9A 1IC7L 1RJLA 2HFFA 5FGSA 3LB6C 3CFIC 4O2EA 3OGOE 1CFQB 5L8KB 1F90H 3AM8A 4X6BB 2WINA 3WS3B 5T1KA 3SKMA 1GSMA 1H3VA 1A2YA 2D0FA 5E2WL 5J0BA 2GSIA 4X7CC 2AEQL 4UQ3A 3ZKXC 2BXYA 4A2LA 5EO9B 2QSCH 4FTVB 4F8TA 3OJ2C 4D9RD 1UC6A 2V5YA 1O5DT 3VXRE 2BHYA 1NAKH 2WLZA 1IJ9A 4F58L 2ZJSH 4P4RA 5E2VH 4ZOEA 1OL0A 3QDGE 2ARJB 1S8DB 4ELMF 3RVUD 5FUZL 5F7DB 1FFPA 4JM2C 4PRID 5HVHC 5FYJU 5C3TA 4NWUL 5DYOA 4IRSA 2FJFB 4B53A 4PRPA 4LGPB 1X5FA 2NX5B 4MD5A 5C8JA 1HI6B 1FRGH 3NH7L 3QIBA 5KAQG 3OV6A 4KJQC 5CUSL 4OV5B 1T2QH 4MLIA 4YDVB 1E0OB 2C1OB 3K81A 1YDPB 4PUBH 3TT1L 1E4JA 1MVUB 4G42B 2P8PB 8FABA 3VXME 1WICA 1KPRA 4FFZH 4N8VA 1KPVA 1YYML 3ETBF 3GKWL 3NIFF 2FZ3A 3NGBB 3UTTA 3MLPA 4JAMB 4U1NB 3X13B 3S37L 1QOKA 3Q5TA 3JBG7 5HDBE 1IQDA 5IBTH 1DQJB 2HRLA 2IFGA 1IM9B 3FT2B 5KZCD 4YLQT 1M7IA 4LHJB 4KH2A 3MROB 1V3MA 5L2JB 2V7NA 5DI8A 3HR5B 3O2VH 4P4KA 3WEXB 2B1AL 4Y5VA 4MD4B 4EBQH 1DDHA 3LN9A 3X3FH 2ZCHL 4G8EB 4BSWA 3K46A 1ZEAL 2XPGB 5C6TL 2Z8SA 5E8DH 4ZSOB 1LEIB 1P1ZA 5F6HJ 3B8YA 5EZOL 2VISB 1FFNB 5GS0L 2B0SH 5C0EA 1FCGA 2Z31A 3O2DA 5CINH 3T1FB 1NAMB 2JK5B 3L3IB 4N0RA 5FEBA 5I1AA 3PWJB 3TGXA 4KGLA 4H0GA 1N7MH 3UZEA 4PJ8C 3TWCH 5D5ME 2VLME 1AJ7L 1OTSD 3HMXL 4ISVB 4WY7L 5ETUB 4C83B 3T4AB 5L6YH 4QNPF 4QHMA 3HE6D 3MRGA 4WI9A 4OD2A 4P46C 2K3TA 3OBAA 4NOFA 4XXDA 2NY2B 1D9KA 2D31B 3A6CL 4JQVA 3F5WB 1DBKL 2G75A 4LSPH 5B4MD 5J13C 4H20L 5HGHB 1WBYA 4G80B 4RDQG 5I76A 5IQ9A 4PJDA 2EEDA 1U3HD 4CBPA 3G08B 3JWDC 3PXHA 4ODSL 4ESKA 2OI9C 4LCUA 2MCPL 5B38G 2X42A 2NR6C 3PWVA 2AQ1A 4D8PA 1YEDA 1AP2B 4R96A 1CGSH 3S35X 4RGMC 1QPXA 4YHYB 1D5MA 4PJCA 4HS3A 5TF1H 1GZQA 1CXIA 1DLFL 5C08A 3ZHLA 5I73B 5IJKA 1BD2A 5DJZB 1EJOH 5DK2B 1R5IA 4YXKL 4MXVE 5ESAB 5D1ZA 3CFEB 2NNAB 4ZXBB 4K55A 1MCDA 4KMTL 4OD3L 4EOWH 1LDPL 3IKCB 4ODHH 3RJDA 3WN5B 1KYOJ 3BQUA 1NKOA 4PJBB 5A3ID 4WCYH 4HULB 1TITA 5LKNA 5D9SA 4PD4K 3TO4B 1EGJH 3O0RL 2EE6A 1PVHA 4KFZC 2OP4L 1CLZH 2VSDA 4W4OA 1JNHB 4IDLA 3ARSA 4G5ZH 3SKNA 1NGZB 5FUCC 5BV7H 2BHUA 3CC5A 1TVBA 2CH8A 1I3GH 4NQDE 4Y4HA 1T1XA 1YNKH 2HT2D 3E8UL 4U6XA 3B5TA 5IHUH 3D39D 2Q6WB 4ZPVA 4L4VE 3U0TB 3SDXE 2AK4B 3KS0H 1AQKL 4Z95H 4D3CL 1RZIB 2NZ9D 3OX8B 3INUL 2VDOH 3L95A 5DD6A 1KEMH 4NJ9L 5ADPL 4YXLH 2MQCA 4QOKB 1FSKC 2OTWB 4LLMA 3SBWC 5D2LA 1RUMH 4UDUA 4P2OA 1FAIL 3GI9L 3X14A 4OF8A 5MI0C 1WITA 3H9ZA 5DFTA 3V52H 5IF0A 1KTLB 4POZC 3IKKA 5IHLB 5TJWK 2UZIL 1PG7X 5IMLB 1DBML 3FO1B 2P24A 1SYVA 4P9HH 4MJIB 4MJ2A 5T3XH 2BVOB 3MLTB 1U8LB 1KUMA 4IDJL 4N8VG 5MEPB 3PWLA 1GZPA 3CIQA 5D2NC 1FZOB 2YK1L 4JY5H 4TSCL 4XNYL 4UOJA 3SKJH 1WTGT 3O11B 2JTDA 3PQYD 5DJ0A 3GHBL 1I8MA 2AGJL 4K7PX 2IADB 2FEDC 4LSSL 1QLFB 2AKRB 5JOPD 2GJZB 3I75A 2D03H 4RQQA 3WUZA 3UJJH 4L5FL 3BDBA 3MBEB 4LKCA 1BQLL 4JQXA 5KOMC 3O9WA 1JN6A 4K23H 4J4PC 2Q86B 1UKQA 2Y07L 1LGVA 5L0QB 5C0AE 1UJ3C 3L6FA 4ZMAT 1HXMB 3QZWB 2FR4A 1MJ8H 3GSWA 4OM1H 1IAIM 3K3QA 1Z2KA 2R56L 1KCKA 4AG4H 5J11B 3DUSA 1CE1H 4AEHH 1VFMA 2NY0C 4HK0B 4ZUSA 5E99H 3H3PH 3RJQB 1NC2B 2AXHA 1B3JA 1MHHB 4JHWH 4X5XA 4LCYB 1JGDA 3IDJB 1OM3H 1FFQA 2GKIA 2XOTA 5AEAA 4LLYA 3BKJH 3E1F1 3M07A 1FGNL 1WZLA 2WBJB 4UV7H 5GGVL 1DANU 4I9WD 4XMKH 1NFDE 2NY5H 5L2KA 5F7FA 3BAEL 1QSZA 3QHTC 1RZFL 3OPZL 5D1XD 1FL3B 5DMKA 3FAWA 5JW5B 4XH2A 2C3GA 1HXYB 1TVDA 4M5YL 4U6VL 1T1YB 3CXDL 3PP4L 4IMKA 1JYNA 3MLRL 1GGYA 1X5AA 1AY1L 3QZWG 3UYOD 1RZ7H 5EOTA 1NBZB 4AEIL 4I3SH 1S7QB 4N9OB 3PABB 3ARDB 2WUCH 5C0BB 1P2CA 4NO0B 2XA3A 4G8GE 3ARGC 4WI2A 1VKXB 1Q9KA 4IRZL 3UJTL 3QWQB 4K3HA 3D18A 4JM4H 4Q2ZB 3IU3A 3MFFA 1QZ1A 2KKQA 5EA0L 1T20B 3CD4A 4DKDC 1EUTA 3AS1A 3MLUL 1INEL 1I8LA 3W9EA 1EAPA 2YKLL 2CUHA 1AQDA 3BESR 4L9LA 1SJXA 3C60C 2A2QT 3LN5A 1OGAD 1ZT1A 1QSVA 2LAAA 4XTRD 4QT5B 3PDOB 2BNRE 3IDMA 2D7TH 4YZFE 2R4RL 3U7AA 5GSRA 1KELL 1PSKL 3G04A 4I4WA 4MWFA 3S98A 4HUWB 1CFNB 1NPUA 1J7VR 3UPCA 4L29B 1JP5A 5CJOL 3UBXI 4DW2L 4JRYB 2ARWA 2WMPA 2BCKA 2NY3D 4GT7A 4X0KA 3MLVH 5JW4R 2VO5A 4X6EA 1P4LA 5CJBA 4RX4D 3PV7A 1MCBA 2EDRA 1UA6H 2WWMC 1FE8H 4G6JH 5I30L 4RWHA 4S0SD 5DD5H 3NN8B 3VRJA 4HUMB 3HZKA 7FABH 5EZJB 2G5BB 4H5SA 1W0VA 3VWJB 4AH2A 5FM5O 2OL3H 4WW1A 2QQLH 4KC3B 1SVCP 4OF6A 1YN6A 1T0MB 3B6SB 1LP9A 2KQNA 3IDNB 4ZUWA 1PZUB 3NA9L 3GM0A 5DO2C 3ROLA 5KJRH 3I6GA 4MNGB 4Q9QH 4LLQA 3L3GB 4IRJD 3LKRB 1T21B 4OKVB 3T77B 2Z8VC 3LOWA 3WNNA 2KZ1B 3M17A 4YK4C 3V8CA 4HKZA 2VLRA 4OZFB 4ZS7L 3RVTC 4JFPA 5FYKL 4Z18A 1FL5B 2LVCA 4GAJL 4GKNA 5CEZH 1MY5A 3RKDD 3VXPA 5IGXH 4HJGB 3AREA 4HXAL 2QQNL 1WT5A 4PJIA 4JY4B 5FYJH 1Q38A 2ATPA 5CD5D 4EQ3A 2P46B 1WCBB 4WU5B 2B39A 1BJ1H 4ZTOH 3LRSB 4QXWA 3SCMC 4I0PA 3WLBB 2H32A 2XKSA 1G7JA 5AZ2H 4PUBL 1JNNH 3I6KA 4TVSa 2PYEB 1QNZL 3DMMA 4OZGE 3N85L 4QCIA 3SO3B 1FBIH 4H8WC 1NCWL 1VEMA 1CD1A 3P4OA 5J6HA 5EBLA 4OUOA 4GBXD 4HC1H 4PRHD 1F8TH 3DGGB 5EIQA 3RWDB 1OWRM 4DZBA 3MYZA 4AK1A 1EXUA 1C1EH 5JHLH 3GMOB 2J88H 4X80H 3WFZA 1ZLUH 5CMAB 2NY4B 5GJSL 4RMQA 4OB5H 3RVXC 3VXRD 1CZ8H 1XF1A 3MBXL 3ESVF 5I17B 3H6JA 1JPTH 2VC2H 3QJHA 3HI6H 4HWZA 3WFCH 5K9QI 4U1IB 4NUGL 1IGIH 4P3DB 3L9RB 4YWGL 4P9MH 4PP2A 3QUYD 1NKRA 3WDIA 2VZVA 4OF0A 2BDNH 1E6JH 3I85A 1QYGL 3QIBC 3TBWB 1FNSL 2DQDH 1WWCA 3LEVH 3IVKB 2OZ4H 4K9EH 4GAYA 3V4PL 2NY1B 5CILL 2W0KA 5EDXA 5DGQA 4ODTH 4PJ7A 4KK5C 1A3RL 4YE4H 5E9DA 1N6UA 4H1LH 3WHE1 3HNSH 1ZAGA 5KSAD 1E28B 4NO5A 2JJTC 4AEFA 2MKWA 3EZJB 4TRPL 5F1IA 3FRPA 4M7ZC 4XX1E 1JZ5A 4K3DH 3QEGL 3G6JE 4JFOB 1N64H 2DKMA 1FZMA 1ACYH 2P7TA 1FHGA 2CRYA 3I9GH 1IGCL 5GIRA 2VH5H 5T1MB 5IT2H 2Y5EA 4M6NL 5EU3A 3VXUE 4NJAH 4NO3A 1WIPA 5CBAB 5E6YA 3FO2B 1A8JH 4GW1B 4NNPH 3IFNL 1NDMB 3ULUC 5IV2A 4H26A 3HRZA 3WL9B 4OGXL 4D2NA 2DD8L 3RWCA 1WV7T 4QF1B 1U8HA 3LQZB 3SKUD 1ITCA 1JZ2A 5HI4C 1P9MA 1WAAA 3T4YA 4PB0H 3K1KC 1JRHL 1IFHH 4EIGB 4NHCL 5IK3B 3DIFA 1LEKA 4FP8L 3D48R 4U6HB 4KKLC 5IHZA 2VLMD 2XICA 2ID5A 4RNRB 1OF2B 2NZIA 3MBEC 3AS3A 3DVGB 1ZA6B 4XC3H 3U36A 1DFBH 1SEBB 2ZKHL 2E3VA 2Y1VA 4PJGA 4ZFOB 4MJ5B 2JIXB 5E8PB 1CLCA 3STZA 1D9KC 1OTTC 2HTKC 5K9OB 4OLXH 1NL0L 2MHAA 3LKOA 2NW3B 2IMMA 3UO1L 1U8KB 3M45A 3HC0B 3K2MC 4NQTA 4NZTL 1YEFL 4WTXA 4S2SA 3QEQA 4QRPB 3GBNL 3FQNA 5J11C 5HHNA 4Q9BA 3O2WH 4YHIA 5KSBB 3HC4H 4M6ML 4YNYA 3RWJA 2F54E 1GOFA 3VFPB 4HUUA 2VDOL 5E08H 3RI5F 2DJUA 3V0WL 4JO4L 4EDXB 5DEFB 4MXVF 1EZVX 1NGWB 5IB5B 2A0LC 1QRNA 1NMAL 4QRSB 4CMMA 1I9JH 2XWBA 3U0WH 3BHBB 5KVFH 1EJ6A 4MQ7A 3DXAE 3ROOA 3VMNA 4CAGA 5IWLA 3QPQD 2Z93A 1INDH 2QADD 1U92A 4PJXF 1LE5A 5GGRA 3TNMB 3WFDL 4X6FB 5E5MB 3VD4A 4WO4A 4I13B 1NH6A 4DZ8B 3EW3B 1ZHKA 1EERB 3ARDC 4U0QB 5AZEL 2ITCB 3AU1A 5CZVL 2J4WL 2CDFB 5TDOB 2FLBT 5HY9B 4M7KL 1S3KH 1BFTA 2WBWB 4R0LA 1B0GB 3MUJA 5IMKA 4NQDD 4JVPA 3KPRA 3VI3E 1UG9A 5I8CB 3OG6B 3IDYB 4PTTA 1XR9A 5HHOB 2DS4A 4K3JL 4OI8A 3MSPA 3ARUA 4XAKE 4XHJD 3IB4A 2IAMA 3TN0B 2DBJA 2GJ6A 3MRQA 5F8RC 1K4CA 1IT9H 1K8IA 3GJEA 4L3EE 4U7SA 4Y19B 4ZD3H 2A77L 4C56A 2RBLA 2VOTA 1TJIH 1CU4L 3KPOB 3QIWB 5DFVD 2DQEL 4U1LB 4UUJB 3ARFA 4QXGH 3MV8B 3T2QA 5JOFA 1A6UL 4YHOH 1R3IH 1T6WA 2W07A 4ZO8A 3RL1A 4JFYB 1S9YA 1OM3L 4J6RH 3F58L 1Q0XH 2BRQA 4ZUUB 5MHSE 4F7EB 1SMAA 1OAQH 5D70H 1NGXA 3ZKSD 3NBNA 3IFPA 4KDTA 5IB2B 2EECA 1WFOA 3VFGH 1G9MH 1VPOL 4I2XE 3FRPG 5F9WB 4TTDC 1WZ1H 4GXVH 5E2UL 5HDOA 4PLKD 1Y0LB 3MMEA 2BNUB 2VTFA 1PJ9A 4ALAL 1H3PL 1FNGA 5A16B 1AR1D 1VGEH 2HT3C 4ODVH 2AP2A 3LS5H 2WQRA 1N4XH 3V6OA 4RA0C 5B39B 4LEXH 4IEFB 3QWRD 4OM0H 4XI5D 1MHPL 3HPLA 2ZOLA 2X70B 1LNUA 2B4CH 4YDJB 2A6DA 3ZSTA 1JPSH 2RB8A 2FX9H 4KMLB 2I27N 5LBSH 3EYSL 4G3YH 5C0AD 2X41A 1TNMA 1JHLH 3V0AC 1H8SA 4Y8AA 1NEZA 4PJHE 3HG1B 1BP3B 1QO3B 4Y1AE 1Z9OA 2NLJB 2YD8A 2PXYB 4JFEA 2BJMH 4DEPB 3C5ZA 4NRYA 1UXWA 2VWEE 1PDKA 1E27A 3OHXB 5ESVA 3ULVH 4M3JA 5I9QB 4KPHL 3CFBB 3N50A 4N0YH 5EZLB 2OSLB 1R24B 4D9LH 5HYSA 2OK0H 3MREA 4MZ2A 4U05A 3KPNB 4O2CB 2YPKA 4GJTB 5DLMH 5TF0A 1CE6B 4R97C 5AYQA 1PY9A 1EEZA 4MNQB 3VJ6A 1EHXA 4PJAB 4BQ8A 2JCCB 5DRWB 1RJZA 4W81A 4G8IA 3FB7A 3T3PF 4WHTA 5F9AC 2XZCL 1HEZA 1IARB 5DQJB 3OR7A 3QI9B 3S88H 4PGBB 5ID0B 3EO1A 3N1QC 4YH6A 4OZHF 3BD3A 3QUZB 1BLNA 2IQ9H 4WW2F 1YEJL 3Q3GB 4GG6A 4PLOB 2BC4B 2OTUB 4L1HA 1DVFD 2I07B 3C6SB 3OTTA 4WFEE 3S35H 4NYLB 2QHLA 2JB5L 5FYKE 5DD3H 5EWIH 2O5XH 3QEUB 3UYRL 1MUJA 1I8LC 5GS1A 3B9KA 4WEUD 1CGWA 4PB9L 2R0KL 4KROB 4RGNC 3TJEL 1QFPA 4YZFF 3EYOA 4FQIH 4OLYL 2CKBH 5BW7A 4LHQB 2YWYA 2CPCA 3FQRB 1QSFD 2C7UB 4NQVB 2J8HA 4BFBD 2BNRD 4G6FD 1JFQH 2NY1C 3OKDA 4G9FB 4EIZC 4U0RC 1MAMH 3P3YA 5HHPA 2SEBB 3T2NL 4OFIA 5F3HB 1I7RA 5TDPA 4HWBH 2A38A 4X6CE 3VRIA 3I2CH 3FFCE 1IAKA 3OZ9H 1XH3B 4I5BA 1EAJA 2OJEA 2AQ3A 1OSPH 1LE9B 1LHZA 1YEKH 2E9BA 5IFAH 2VXTL 4NUJB 1G7IA 3MR9A 5ISZE 1GGBH 1C5DA 1T89A 3MRKA 1A1NB 5MEOB 5DK0A 2EO1A 4Z7VB 3ILPB 3FCTA 1U8NB 3DUUA 1XEDA 5FHBH 4A6YH 1DSFH 1QUNA 4EI5D 2FLRT 2WP3T 2YUZA 5ESQA 5ECJE 1KJMA 3UCRA 4TQEL 5A2IH 4HT1L 4XRCB 5C6PB 2D4DA 4HIHB 1I1YA 2VE6B 1HK6A 3LKSA 2CRMA 1KIPB 2FCBA 3UTSD 2AV7B 3PWPD 1UYWL 3D0VB 3HUJE 1MFAH 5JIKA 4ZUTB 2CIIB 1CL7H 2DI9A 2P8LA 2VITA 3KJ6L 1WT5C 3DSFH 5T1LB 5FO9A 2O61A 1J87A 5JW4M 4KZDH 5DRZA 2JE8A 1OSZA 3NZ8A 3ARZA 4K7PH 4L4JA 4R90H 4AIXA 3TESA 1SM3H 4KTDH 4RAVA 1L7IH 4TUKH 1HKLH 4OZGF 3ULUL 4PY7B 2BK8A 5DT1L 1YMHA 5FM4A 3ORJA 1AGFB 4XP9H 3RUGA 5ACZA 1XGRB 1X9QA 1BVLB 4J1UB 3EOAB 5F7YC 4KKBD 4YHLL 1JWUA 1P7QA 1T4KB 4U33A 1YJDC 1YN7A 3RL2B 1A47A 4X99A 3LS4H 3DV4B 3C2AH 3HNSL 3R06A 3WDHA 4M62L 2D9CA 2V5TA 3SQOL 3QSKB 4MAYD 5EU4B 3BOVA 4LSVL 3JVGC 4HIXL 5EIVA 4UIMA 5ABDE 4FQCL 4LCWE 4R26H 3VWKA 3RTQB 1FH5L 2DQIL 4UV4H 3PL6A 3S3JA 4QHKJ 5EOCH 1U8IA 3N1PC 4X7DC 5C7XL 2C4FT 4ZYKA 5GS0D 3WIIL 3WFEL 2ICWA 4FQXB 5I6XC 4JZJB 4P23D 2H6PB 2WUBL 5EUOA 2JELL 4KAQH 1R3LB 1JK8A 4J2XA 3BUYA 2D7PA 1DL7H 1HZHH 3CDGB 4NKOB 3WFBL 4DWHA 2CLZA 3HB3C 3QFJE 3VFWB 4P57B 4YFEA 4GRWB 3FTGB 4CGTA 5DJ8B 3W81A 4PGEB 2JJWA 3QULA 4Y5YC 1MCFA 1MREL 1T1WA 4HWUA 5E5RB 1KCUL 3ZDYF 1FN4B 3GMRA 1X5GA 1QVOA 3ARRA 3C09B 2H9GB 4HLZG 1G84A 2ZSWA 2DLHA 5E8EA 2Z92A 5DHXB 3ARWA 2BMKB 1YMMB 1MI5E 2Y06L 1X5HA 1RZGA 3M1BA 1AKJB 5D7LA 1AGEA 4G6AC 3RNKB 3MV9D 4PG2A 1ZGLB 1BX2B 4RISH 4X5WB 1HH6A 2FH6A 4L8CB 2HT4D 1UZ8B 2AK1L 4RIRA 1R5WB 3QIWC 4PYHA 4UBDC 3VXUD 25C8L 5C0CD 3MGTB 2N1KA 3O6KH 1HSBB 1A21A 2XWTA 3WUWB 1KB5A 4RBPK 5HDQL 5GISH 3DRQB 4J3TA 3MC0A 1HDMB 1V7NL 3EOTL 1EUUA 3HFML 3IDIA 3U0WL 3ZMRA 3WNKA 1KCSH 1YECH 5C0DA 3R8BB 4UTAL 2OLDA 5F9WC 2X4NB 2O5ZH 1P5UA 3RGHA 1KFAH 3IETB 3T65A 4OSUH 1HHIB 3TV3L 3VGDA 1QEWB 3VD5A 5KS9F 2FX7H 5KSVA 1SBSL 2XT1B 3PUCA 3VDAA 1BGXH 3D5OF 5I15L 1TDQA 1H15A 1XZ0B 3H42L 5LWYH 1YPZB 5F3BB 3B3IA 3F7YB 3FB8A 1JRHI 3SDCB 3SDAD 3QDME 4XVTH 5I19H 1AGDA 4F9PC 1YNLL 4XMPH 2VLKB 4I48A 4WV1B 1MRFL 5JW3L 3FQXB 4Q9RH 3G5YA 3OL2A 3JWNC 3MJ6A 3A6OA 1TPXC 1CXKA 2BSSB 3TBYB 2HLAA 4DEPC 3BW9A 3OF6D 3SPVA 4U31A 3KYNA 1CLOL 4GXUM 2RQ8A 3VFMA 3ES6B 5I9QC 3FQWB 3BO8B 3MCKB 4LLVA 3HE6A 4LNRB 2UVEA 5DC0A 4CRPA 4BZ1H 4Y7MA 12E8L 4ODWA 1HHHB 1CDJA 2Y6SD 1GAFL 2DQUH 1FYHB 4UILL 3STBA 4NIKB 4QRUB 5CWSB 1VA9A 4UINL 1LO4L 5GRWA 2X44D 3W39A 3IFOA 1S7SB 2NX5E 2Y4SA 1URLA 3DXAD 1U3HA 2VDMH 1CT8B 1TZGL 4LVOC 5CSBA 4EKXA 5EOQH 4AMKH 3B2UC 4XWGL 1VFAB 1FL6A 1OAXL 1T7ZA 1XGYL 3MRNA 3VFGL 4LASL 5MEQA 1Q9OB 4GMTL 4L4TE 4HUNB 5L88H 4DTGL 4HKJB 2XQBL 3SGKA 2Z91A 4EJ1C 5E94B 3L1OH 1P4BH 4X4ZA 2HG5A 3T2PA 4AQOA 4PRIB 4QRRA 1UEMA 5DMIH 1CXFA 4CDHA 2IQAA 3JWDH 3OMZA 4JREB 4LPWA 1U36A 3CSYB 3O4LD 1S7XB 3WE6B 1VACB 2ENYA 3MYJB 3NCJH 2OBGA 2IAMC 1MFDH 3LEYL 4U3XA 5C09B 1MJ7H 4JZNB 3UTOA 1IKNA 2Q7NA 3EOBB 3MRRA 4BKLA 4YC2C 2R0WH 4KI1A 4EEEA 4L3ED 3KPPA 1MRDL 3DETC 2KPNA 3BKMH 4LOUD 2J6EA 3KYKH 4PY8J 5JDJA 4Y4FD 1QBAA 5C07A 1RJLB 4HCRA 2HFFB 3REVA 1T04A 2C1PA 5TPWH 3BJLA 5GRVK 1V05A 3VFSA 4CU8A 4UT6L 1T03H 3OB0H 4D9LL 5T1KB 5I1CL 5F6IC 2FIKB 3LPWA 5MHSD 4QO1A 4KJWC 1WCQA 3LN4A 4ETQA 3GMQB 1BZQK 3P40A 4QGTA 1KJVB 4HXBH 1HIML 1JUFA 2ESVA 3P0YL 3HZVA 4MB4A 4XZUA 5ITFA 4YUEL 3SE8L 4N8PA 1CD8A 3V6OC 1G9NC 4MDJA 3STLA 3SDDD 5I1KL 2ADFL 1LK2A 5DJXA 1OQOA 4NM4L 1FFPB 4MA1B 4PJHF 4OJFH 5JMRA 1JJUA 1D5BB 5D7JD 4DKEH 2XTJB 4L3CA 3VH8A 3G5XB 3QAZC 1VDGA 2I5YL 4MD5B 1N2RB 4Y1AD 3S5LG 3QCTL 5IW6A 1Q9LA 2GUOA 3C5ZC 2ZZUT 5FXCH 4M9PA 2G9HA 3VG0H 3MCLL 2XKUA 1XGQB 4JFFD 32C2A 2VLJA 3P4NB 4F37K 1BQHG 4MDIA 1KN4H 4XPFL 1KPRB 4F2MB 4MD0B 2IPKA 4G6KL 4O5LH 3VXNA 4MAUH 3LIZL 3CXHJ 4FQHA 3MNWB 1DQDL 2I60H 5KANI 4PJBE 4YDLB 3R0NA 3C08H 3QCVH 4H88L 4Y4KA 3LKNB 3HNTH 4IIQC 2P5ED 3FN0H 4HIEA 6CGTA 4ZTPL 5T1DH 1M7IB 3IGAA 1F42A 2H2PD 1RULH 4Z78B 4NWTH 2H8PA 2AJ3B 2V7NB 3FZUC 5DQDL 4A2MA 4PGJA 2ADIA 5FK9A 1UM4L 4GAGL 1UB6A 5FCUH 3NFPB 1DDHB 1G0DA 3QUKB 1UVQB 4LARL 4CVXA 1HN1A 2DQTH 3KLHC 4NQUA 1U8PB 2HWZH 3IJSB 4NNYB 2WLYA 3G6DH 2AK4E 2Q7YA 5DJ2A 3DRTB 4ZFOL 1AFVH 2YPLD 4HUXA 4WFED 3T0BA 5J3HD 3V5DB 2VJXA 5F93C 3CFJA 3N9GH 5FYKD 1MFBH 3B9KC 3CVIH 2VZ3A 5GGQH 1PG7L 1I75A 1EDQA 3X3GH 1RHFA 1DP0A 5AAWA 4OQTH 2CK0H 1D5XA 2BSED 2Q20A 2XN9A 4QYOA 4C55A 4UTBH 4JO3H 1L7TH 2DBLL 3H9HB 5CZXD 4YHPA 3AGVA 3D39B 1A6TB 2DLTA 3QIUA 1BFVH 2QQKL 4HGWB 2A83A 2DJ4A 3FB5A 4XXDB 4GSDH 2XXCB 2GT9B 1AXIB 1EO5A 2CRIA 4BFIA 5I76B 5IQ9B 1ES0A 3CH1B 4L8DB 4PJDB 1KIQA 3ZHKA 3O3AB 1QFHA 1ND0B 35C8L 4HIIB 4M5ZH 3SHSA 5C9KA 1DQLL 2PTVA 4OCRH 5KOVC 2VL5B 1T89C 3PWVB 4HGMA 2WANA 4O9HL 1FYTA 1RHHB 2Z0BA 4PJCB 1PYWA 4YBQC 2AERT 1RIVL 1T5WA 2EC9T 2H2SC 1KLGB 1AIFB 1CDHA 1TTGA 2GK0A 5C08B 4FQPA 3VFRA 3IYLW 3BSZH 3WJJC 1I9IH 2NYYD 3Q6GL 4P2QE 5CIPH 4GKSA 5JDSB 5F89B 4M7JL 4BH8B 5IJVA 1NANI 2FIRT 5FA4A 1R0AH 5DD1H 5M95B 4RA3A 2CGRL 4OGYH 5J1SC 2Q8AH 1CGTA 1I4FB 2VDPL 4PP1C 2AXFA 5BQ7B 1U58B 1EGJA 3SKNB 2NMSA 1KGCE 2A9ML 3CC5B 1TVBB 4CDGC 3ZKNC 3RZCA 3ZKMC 1RUPH 2EXYD 5FB8A 3U9PH 3EUUA 3GIZH 1YC7A 2ZUWA 3T0EA 3KPSE 1U8MA 1WQVT 3OKOB 3V4UL 1DEEA 3OG4B 3QO1A 3RX8A 2AJSH 3TJHC 3MNVB 5D6CB 5GS2H 3L95B 1X4XA 5DD6B 4WV1C 2I25N 5KVEH 1X4ZA 5C0BE 3H9SB 4P2OB 4DGVL 1CS6A 3X14B 2W9DL 1X5YA 3ULSB 3VCLA 5IF0B 1MF2H 4NZRL 3GM8A 1D3CA 2UUDK 4NZUH 3LKQB 3HMWL 4L8SA 3WKML 1ETZA 1SYVB 4LCWD 5CHNA 2APWA 5D1XB 1JMXA 3RX5A 4BSVA 3ZE0F 1DBAH 1NAMH 1IGYB 4KVCL 5B22A 4GS7B 4HPOH 5JORB 1N3NA 5D4QA 5FKAA 2C3XA 1HHGB 1G7QB 3GSVB 5D93B 2MFNA 2RFXA 2HA1A 4GW4B 4PRHA 5EFIA 2ICWJ 4JG0L 1R3HA 1CK0L 2HVJB 5JXAL 2V17L 2AABL 4O2FA 3SJVE 3DO7B 2X10A 1IGMH 4IS6B 3MJ9H 3QFJD 4KHTL 4Y16D 2NQCA 4JZOB 2ARJQ 4RQQB 2AEIT 3KGRA 3OKEA 4H8WH 2BHZA 1PBYA 1Q9WA 4TVPL 4NKIH 3GSRA 5D7IF 2DQJH 2ITDA 4M43H 3RVUC 1JWMA 2J5LC 2QTEA 4OSUL 1K5NB 5IBUG 3L6FB 5GZOC 1J5OL 1G7MA 1IEHA 4U4BA 3GSWB 4DKFL 1NMBH 5SWSA 5ANMB 3BT2H 3CMOH 5K59E 5I16B 4HV8A 1E6OH 2CD0A 2D7MA 3CLEH 1DBJL 1TFHA 4HKBB 5F96L 1ED3A 4JQIH 4F7MA 1MFCL 3CLFL 3B8SA 3AAZA 4LAJH 1AO7A 3GI8H 4HH9A 4JY6A 4E41E 1OD7A 4ZAKD 4APQD 5J6GB 2FB4H 2F53E 2NY3B 1C16A 3C8KA 4DVRL 1NCAH 3U7YH 5L2KB 3QDJD 2IBGA 4HGKC 3NTCH 4YPGA 5DMKB 4YEEA 1I7ZA 1IM3B 2VQUA 1I9RL 5ALBH 5IB4A 1AD9A 4RZCA 1ERNA 3W0WD 3OAYH 4TSBL 3D3VE 5DZNA 1EHLH 4XNZB 4B50A 1C12B 4ONHA 15C8L 1QP1A 3N1FC 2DQFA 2PNDA 3UC0L 1P2CB 1C7TA 5T5FL 3MLXH 4LMQE 4NQED 2IG2L 4QEGA 5F1NB 3VD3A 1LILA 3CUPA 3CU1A 3FO0L 4IRJB 1FIGH 1UACL 3D18B 4QXUH 3HZYA 4P48A 3BP4A 3MFFB 2FD6H 2OR9L 4TNWF 4LQFL 3GMPB 1Z0NA 2FWOB 3L3HA 1A6AB 3S4SB 2A6IB 5DHVB 5FECB 2Y36H 2A6JA 5D96B 1ZVHA 4JRXE 3UTZA 3REWA 1BBJA 3U2SB 3GRWH 2IANA 1SYSB 1A7BA 5IEHA 4FTVD 4LVEA 1VCAA 1TVHA 1OTSC 3S7GA 2JKXA 5FKPA 1W72B 4TN9A 3NCJL 3I02A 5FO7A 3TVMD 4O58H 5JZ7D 4NN7C 5GSRB 2ED9A 4JFZL 3HE6C 1NFIA 3ULVE 2DQHH 1MIML 2R0WL 1KJ2B 3BE1H 2E6PA 3NIGE 3OKKA 2YHGA 1VFOA 2KUTA 4XPHH 4QY8A 5B4MC 3GJFA 4Z5RA 4YDLC 4GBXB 3PE9A 3DYPA 2IFFH 5EPMB 3QXAA 3HS0A 1U3HC 5HGAA 1FO0A 3LMJH 5CGYD 4ERSL 2NX5D 1F3DJ 2C3VB 4LCIL 4OTXH 3S4SG 1CF8L 3LPGA 3EDFA 1TNNA 2IBZY 1T0NA 1K4DB 4U1MA 3VXRB 4O02H 3BPLB 3D2UA 5TH2A 3VD9A 4M48H 5IBLC 3ARTA 4OCYH 1QFWH 1U8JB 4I18B 3QDGB 3BZ4A 3SGDI 4JANB 4L4TD 5J06A 4HBCL 2IJ0C 4XB8A 2OL3A 1J0HA 3H0TA 4ZUWB 1A1MA 1XCQA 3I6GB 1DTUA 3L7FB 3QUYB 2VZTA 4ONGH 3NFNA 2WWMD 4Q0XL 3SDYH 4NT6B 3M17B 1KTRL 1OAZH 2KBGA 2GFBA 3G6AA 5A3IC 1IM9D 4UT9L 1YEIL 1OT2A 4JFPB 1EMTL 4LMQI 4GOSA 3Q6FA 3PHSA 4PJXA 1FFRA 2FJGA 1T7VA 2PO6D 1OPGH 4P5KA 3BWAB 4PV8A 4OFDA 3DURB 3U1SH 3VXMB 2CLRB 4UOW1 2HT2C 3K8KA 5I1DB 2GEEA 1WJ3A 3R8QA 4WDIB 3QJFB 1N5YH 5BS0E 5LCVH 2NZ9C 3P4OB 1CFSA 1G6RB 4YBLB 1ZGLP 5C9JA 1SVZA 4Y2DD 5IB1A 2CSPA 1M1SA 3SE4A 5E4EB 1G7PB 1BFSA 2DTML 1FZJA 3O8XA 1OW0C 4FQQA 4OZIE 1C08B 4J23A 1LVEA 5J1AA 1MPAL 3KPMA 2QKIA 2NY2D 4OD1H 5JQ6L 2Y72A 2X40A 2BX5A 1DBBL 1YEEL 5GPRA 5I1EL 2X89D 3RWEB 1W0WA 2CK2A 4O51A 1INQA 4BJLA 4XCFH 3IJYB 2VXVH 3CFKA 3GSNB 4DVBA 1TQCB 4YHZL 2GAZA 2F5AH 5H37G 2J7LA 4M4PA 5ENWB 1T7WA 5D5MB 3CX2A 2YPVL 1EFXA 2FJHB 3MLWL 1GGIH 4GAYB 2DLFL 3X3GL 1XF5A 3RGVB 3MO1B 4D0DA 1CICA 1ZTXH 1TLKA 5FDWA 1EO8H 4PJBF 4M6OL 5E5UB 4OLWL 3DX9A 1K6QH 3GNML 2Y25A 4ZXBD 3TA3A 4PJEE 2XZAL 1SMOA 3LRHA 4GRLB 1P5VA 4H1LA 5ILTL 3RU8H 2ICCA 3UBXA 4PJ9D 4TOYH 3FOLB 1V5JA 3FFDA 2UZYB 2CUMA 3TO4D 5L7XH 2HN7B 3WD5L 4MCZB 3OXSB 4JDZB 5GIRB 4KDWA 2Q87A 3U6RA 1A9BA 1CBVL 4RGOL 3EDDA 4K7PY 1HHJA 1WBZB 3BP6A 5INDB 1RV6X 5LG1A 2Y23A 2R1YB 4LSQL 4XPAH 3BIKB 1MLCB 2HP4A 5D1XC 1HOCB 5HHOE 2ERJB 2AK4D 2LVEA 4XNMB 4HKXB 1F58H 2EIDA 3JUZA 4NKMB 4Q9CA 4PYGA 4Y19E 5D93C 4QOKD 5J9PB 2IALA 2AI0H 1S7UA 2YSSA 3IFLL 4MXQC 3ULUF 1QLEL 5EN2B 1OCWH 3M8OL 4XNXL 2GCYB 1TZIA 5GZNC 3NVQA 2R2HB 3MGOA 5IHZB 5DJDA 1S9XB 2XRAH 4MJID 4OZHA 1LEGA 4EN3D 5FOBA 3T0XA 4WW2A 4PJGB 1GIGH 2EYRB 4L4VB 5DSCB 2B7DT 5I1LA 4KXZH 5J12B 1RZJC 4M4RA 4FQ1L 4YHML 3RHWF 2W65A 2R8SH 2FBJL 3L5WA 1RUPL 2QHRH 1Q72H 2PCPA 3FQNB 1BAFH 1EBAA 4F3FA 4EUPA 1PLGH 1C5CH 5F70A 4XTRC 4QHNB 3QXUA 4HF5H 1E4KA 3BKCL 4FABL 3IRPX 4YNYB 4ZOCA 1QSFA 3MJ7A 4AL8H 3SY0B 3CVHL 3HPJB 5B3JE 4K2UH 4L8BB 4GG8A 5KVEL 4N0UA 4IOIA 2NY3C 5KN5B 2VLLB 5DDHB 2HTKD 4XBEH 5F1SA 4WJ5A 1WBXA 2XG5A 3ROOB 3GMMA 4WENB 1MNUH 3UTQA 1LDSA 1OY3B 2Z93B 1U8OA 5ICXB 4UB0L 4WFHE 2AQ2A 1R3KA 1NC2D 3EYVA 3V7AE 4LAQH 3KDMA 1Q0YL 4XNZC 3SE3A 1J0YA 1BEYH 4G7VL 2R69H 1IILE 2EH8H 3BP7B 1CFTA 2Q76A 2WBJD 4EI5A 4JHBA 4YQXL 3AU1B 3GMNA 3UYPA 5F44A 4DCQA 4IMLB 4JRWA 4R0LB 3NABH 3EFFA 4XC1H 4IRJC 2X7LA 2XQYK 4HK3J 4P3WA 4PTTB 3F8UB 3UTSA 2IH1A 3KPSD 4NKIL 4JKKA 2DWEA 3HRPA 4GQ9H 3PWPA 4BA8A 2GJ6B 2IGFL 2BSRA 4BQ6A 5INCB 3RKDC 3GEWB 4P5TB 5B3NA 3GJEB 2V2XB 3KS0J 3MJ8A 3E6HB 1RSFA 4GW5A 5CD5C 1RK0A 2O5YH 5C0BD 3VFOA 2B2XL 4NO0D 2R23A 3CMOL 2GIYA 3VXOB 1E6OL 3GUTA 5JOFB 1F2QA 3S6CA 4L8SC 1NFDB 4JQIL 4WWKB 4EXPX 3X11B 5F8QC 1NDGA 2BSTA 3I3BA 4LLDB 1B0RB 1MWAB 5BMFH 2P8MA 3IDGB 1ZHLB 1OARH 3FONB 3S34L 4GBXC 1QQDB 3BDYH 4OCSL 3JTSB 3UBXG 5K9KA 2P5WA 2AEPH 3V2AR 2H32H 2W38A 1UENA 4DQOL 3MMEB 2EDEA 5C2BL 2K1MA 2PTUA 4G8GB 3BPLC 3R1GL 1IGTA 4JCMA 4GUPB 5KW9L 4MA7L 5IROA 2N7BA 3NPSC 1X5IA 2ZPKL 4I18C 1MQKH 1LNUB 5E6ID 1YJDH 4P5MA 2PW2A 5FGBA 1ZA3A 3OJMB 2DF3A 1HWGB 3BH9A 3QUYC 5IQ7H 1JGVH 5DWUL 3RWIA 3FMGH 4XCCL 3O3UN 4U6YB 1A7RH 2AJXL 5CEYA 4CADB 4P59H 5TE6L 5CGMA 4KKCD 4E5XA 4G6MH 4JFEB 2FD6L 2V5SA 2ZUSA 1E27B 5I18L 3TPKA 1CFVL 1RIHL 2HT3D 1OWWA 3VWJD 4XP1H 1HINH 5F9JB 4BZ2H 1MHEB 1QBLH 2H3NA 4Z7UB 4YR6A 5IMOB 1T66D 3MRIA 5HPOA 2FNBA 2YPKB 2F53D 1A9EA 1ZLVH 5KSAC 4M7LL 3MA7B 1MH5A 2EDFA 2BY1A 3BZEA 3EDJA 1IZJA 1MCCA 1H5BA 1Q1JH 1KXVC 3KXFA 3MV9A 2HFGH 2FX8H 2AAVA 3O2DL 1RJZB 1FLRL 4YBLC 3D9AL 1GHFL 3BVNA 1HEZB 1NGYB 3Q1SH 3OR7B 2RHEA 2P47B 1S5IL 5IEKB 1BIHA 4EUPG 5E4EC 2IFFL 9CGTA 5J4MA 2YWZA 1ZLUK 1KCRH 4AIZA 4OAWB 3QHZL 2DMBA 2W92A 2C3WA 5JXED 2Z35B 4NQCA 4U1GC 5C0CA 2G2RB 3ZL4L 1NEUA 2EH7H 3LEXA 1JGLH 3W9DB 3VMOA 5CKGA 2HLFD 1QFWL 2XNAB 1WTLA 3LKPB 1MUJB 4ZOAA 2ZUQB 5E8OB 1NGPL 5GS1B 3S36L 1I7UA 3C6LA 4BH7A 2PR4L 3QNXB 4XP6H 3ZTNH 2H26A 3FT4A 3DBXA 1A6PA 3IXTB 3EYOB 1TQCC 5K9QG 5I1GL 4PBWD 1F4HA 2NY4D 5EUKB 4JE4B 2DKSA 4J3VA 4WUUE 3P30H 4Y5XC 2O93L 4OCXL 3RGVC 5HHPB 3MLZL 5KS9A 2NW2B 2QSVA 3QCUL 3RZWA 3SDAA 4N8CH 1M6OA 4YHKL 4JR9L 3O41A 2P45B 2XY2A 4HWBA 4GRLC 1RZ8B 5IR1A 2P44B 5FYLH 1K3ZA 1AE6H 3OKLB 5CJQL 1ZANL 4GRWE 1A6VH 2XFXB 3PGDA 3RVWD 1OOAA 3BP5B 5E00A 4PRDB 43CAA 4MAYB 4LCCA 5E7BA 3DECA 1C5DB 2G60L 3RY4A 1OP5H 5IVZA 3ELAT 2NY1D 3LHPL 3GB7A 5DK0B 4JFDE 2C5DC 2MWCA 1RZKL 2X1OA 3AY4C 2EYTB 3PP3H 1IAOA 4IBLT 2FL5B 1XGTA 5GHWH 4ONFH 4NC1E 4KDVA 2CMRH 2ERJC 3ZKQD 3WV0A 4D0CB 4KY1L 3QPQC 2UYLB 3QUXD 2QADC 5F7EH 1V7ML 1CDUA 3BH8A 5C1MB 4WTZG 5GJTH 4M03A 1P6AB 3TC9A 1AHWB 1YUHA 1EVTC 2AJYH 1A4KB 1PKQE 1MRCL 4XBPA 4NC0B 2O61B 1KF9B 5JQHC 4EVNA 1F5WA 3NZ8B 3PIQA 3FHAA 2MKLC 4M8QA 2MPAH 3U4BL 3N1MC 4RAVB 2R29H 2EO9A 4PGCB 5HYJE 1A7PL 1T5XB 5E7FA 5DJAA 3O4LA 1BJ1J 1ZV5A 1SJHA 1T2XA 4L1DA 1WSST 3S8WA 1IEBA 3RUGB 4XHJC 4LVHC 4JN2A 3L3DB 1NCBL 4G9DA 1GC1L 3G6JB 1G1CA 3QG7L 1JWUB 1P7QB 2AEWA 4RRPA 5HJ3A 4CW1B 1KENL 1YN7B 1A5FL 3R06B 3QHFH 2EC8A 3SE4C 1ADQH 3MLYH 1GOHA 1S7RB 4GKZA 4XMLL 1UH3A 3VXUB 2C9AA 1A7NH 4HK3N 4UIMB 3HNVH 1AGBB 2NXZB 2N56A 4PR5A 3VE0A 3C5JA 3BPCA 2BVPB 2JIXD 1U8IB 3HAEG 5H94A 3T0AA 1RZJL 4KV5F 2HJFB 3MFGB 2VLKE 5HYQB 4M93B 4OGAD 5I1JH 2EIBA 5TQ2H 5KSBF 1RJYA 4HS6A 4AM0A 3TBVB 1Q94A 3IS1X 3E3QC 1CQKA 5EUOB 5T3ZL 1JK8B 4R8WH 2W60B 1CIDA 1MCOL 2W9EH 5HD8D 1LO2H 4XX1G 4PLKC 3UPAA 2CLZB 4XVJL 3GDBA 5CFHA 1QR1A 4MSWB 1AR1C 2V2TA 1FVCA 1KBGH 1OAUH 4OCWH 1ZT4B 2E7LC 5LQBH 2OS7A 1BBDL 2E8ZA 1QBML 2ZSVA 3GMRB 1BQSA 1IC5L 1X6NA 1A0QH 2OXHA 2CKNA 4CU6A 4ZDHB 2E27H 3BEVA 4LF3B 4XCYA 1A7QL 4Z7QE 2VUOA 3H7LA 2WZPD 4YDKH 3UDWC 3VU2A 1UM6L 2VDLL 1RAMA 5ADOL 2DDQL 4BZYA 1HH6B 1RUQL 4X7FC 4JDTH 4KVNL 3EJZD 1UWEL 2F54B 5ERWB 2QR0A 4JFFA 3QA3B 2UWEE 1CVRA 2EYSB 3F7PC 3VGAB 4RIRB 5EO1A 1DJSA 4HH8A 1C5CL 2Z4QB 5CZKA 2QL1A 4JPVL 3O6ML 1X5KA 4MVBD 1YQVL 4WWKC 1KCVL 2APFA 4PTUB 2X4TA 5F72S 2GHWB 5IFHH 5C09E 4KUZL 2FYYA 5HHOD 3DXAB 3MV7A 4ZQKB 5EU5A 4XVSH 5JHDE 5EBMB 2P5EA 3TN0D 3OJDA 3O6FD 4NOBA 1TJHL 3LH2H 4WVRA 3LQAL 1QSEA 4Y19D 3JTTA 5IVXE 2HFEA 1JZ7A 3VW3L 3U46B 2NTFB 1IQWH 4X98B 3QIWD 3MJGX 3ARXA 1W72L 2CLVA 1GCFA 1SJEA 4JLRA 3KNBB 1FVDB 2A74B 5JOEA 4HQQH 5HI5D 1E4XL 3GSQB 1B0WA 1DVFC 2BRRL 3I3DA 4IJ3C 2XKNA 3V5KB 1KJ2L 2YPLA 3WHXA 3F7VA 5IM7A 3PHQA 3FB8B 4MNHB 3KPQA 1VEOA 3JV4B 5CD3A 2EKSA 3QWOA 1A6WL 2PYFA 2RAMA 2GTWB 3WIHH 1QKZH 4GQPH 3VXSA 4HLZH 3QQ4B 1FGVH 5LGJA 4NO2B 5DVOA 5FFLA 3KLSA 3D1MC 2X4UB 3SPVB 4ZFFA 3UJIL 3KYNB 1MFEH 2A6KB 4NP4H 4I77H 4Y4FB 1PGRB 2HJKB 3QPXL 4LLVB 1ORSA 5ICZA 1RIUH 5BVPH 4KHXL 5JW4N 3TPUA 4FQJH 4HD9A 5IVOA 4ZFZB 1RU9L 3DYMA 3W39B 5KVGL 2MTPA 4PRPE 3HG1D 1MHCB 1S9WB 3QQ3B 4ZO9A 3WSQL 4M1GH 2PXYD 3MRFA 1X7QB 3S96A 4PJ8A 3SGEI 3SOBH 4WFHD 5F9OL 3KPTA 1DQTA 3SE3C 4NQSB 4R3SB 4OLZL 1Z3GL 4KTEH 2CO6B 2VDRH 5JNYB 4NQXA 3VFVA 3AB0C 4P46A 4TVPD 1BVKA 4RAUA 4EI5C 1U6AL 4PJAF 2HVKA 1K8DA 2YC1A 2Z91B 5E8NA 2JCCF 3UTTE 2XZQL 1I8IB 2HG5B 3FQUA 1T6VN 5DMYA 4MNQD 5J57B 4M3KB 3VI4E 3EO9L 3PHOA 3QNYA 2NY7H 4R4ND 1FV1B 2ZNWA 1G6RL 3T3MF 4Y1AB 2ZUQC 3MRPB 4HG4J 4Z77A 5GGUA 3QI9D 4UT7L 3MRRB 2FATH 1IMHC 5I8KL 3DO3A 4XNUH 3O3DA 1KLUA 4YXHH 2OYPA 5CP3A 1ZSDB 3QUZD 3TBTB 3ZTJG 3L3JA 3VXQB 1BM3L 2J8UF 3ARPA 3V7MA 5DEGB 1T04B 4DN3L 1WGOA 1YEHH 3DVFA 3ARBB 3VA2C 5HGBB 4NHUA 4KKBC 4F57L 1MJJA 1AXSB 2AJUL 5I74B 1H8OA 2MQ0A 5GGSB 5JUEL 3LN4B 1ONQB 4KROD 1IAIH 4ETQB 2NY6B 3GSNL 2BOBA 3W2DL 4MAYC 2FHCA 2ESVB 4MQXD 3I84A 3D0LB 4Z7OE 5BO1L 4M61A 1FNFA 3LRGA 5HHMB 2EIEA 3AC0A 2IWGA 1SEQL 1VADB 4MB5A 4GKOA 1JHTB 3O45A 3FQTA 4P23C 1RMFH 4U1SB 4OLUL 3KPLB 4PJDE 1JPFB 2R2EB 5CEXA 3SBWA 4IHOA 5EORH 2RGSA 3NACH 5SV3A 4L3CB 4XHQA 3T8XA 4Z7VF 4K94L 5IW6B 2GUOB 1AHWC 5JPNB 5F88B 3MV01 4NBYB 3BISA 4KQ4H 2G9HB 3NCYP 5DF0A 4PJCE 1RK1B 4PREA 2WWKT 4HX1B 32C2B 5C08E 3MNZA 1KNOA 4MYWB 4XP6L 1BD2E 4F7PA 1MCPL 5D2NA 1V3LA 5CCKH 3EFDH 1A1OA 1O7SA 3UXFA 3GO1L 3TZVD 3BGMA 4X6CB 1U42A 3FFCB 5D7IA 1D6EB 4ZOBA 1H5BC 1UH4A 3RWFA 3L5XL 4C4KT 5I1HH 3EO0A 4FXLA 4FZ8H 3J8F7 3A6BL 4HIEB 5BXFB 1JV5B 3DX7B 2VKXA 3D25B 1LMKA 4YHNB 1TJGL 3KYMB 2ZG1A 2HT4C 2RCSH 5ISZB 5T1LD 5GGTL 4N0FB 5FYLL 1ULVA 1UB6B 1U93A 1Y18A 1YYLL 3QYCA 4J4PA 5HHQA 1IGJA 1DCLA 4S1DD 3VFUA 1IGFH 5K33A 3RIFK 1UJ3A 1L0YA 3QDJA 1YZZA 4HDIB 5ITBH 1EEQA 1I1AD 5FCSH 2DI7A 2OQJB 4G7YH 4OLVL 4M93C 1I8KB 4W6XB 3CFJB 4DUWA 5D2LE 3W0WA 2I9LB 5GHWL 3HUJB 3IDXH 3GSXB 5DUPH 3EBAA 3K80A 2D0HA 1J8KA 1LO5A 5C86A 4ODUA 1CXEA 4ODXA 5F7EL 4BQCA 1UCTA 2C26A 1QFWI 2XN9B 2EIZB 3U7WL 4LSUH 1J8HA 3I50H 4NQEA 1R3JB 2FHBA 4RFOH 3RTQD 1KB5H 3GMLB 2AJYL 5T5NG 4WUUD 1KC5H 2VL4A 5EU6B 1R6VA 1CFQA 4LLWB 3WS3A 1DZBA 3SDAC 5GRJL 1UWXH 4FQLL 4FQXD 1QFUH 4GRWF 5ALCL 5H35A 3NZHL 4OFYA 1VFUA 1D6VH 4ZPTB 4L9DA 3CNKA 1KIQB 4JPKH 4FTVA 2H41A 2N7AA 4JEGB 4LCCC 2IPUK 4HWEH 2DYPD 3TYFA 5BCAA 1EK3A 2I9TA 5FA3B 4XP4H 2ARJA 1S8DA 5DRNB 4Q97A 1ORQB 3L3KB 3VGAC 4Z7NF 1OB1B 1FYTB 1ZWIB 4X6DB 4QHUA 2Y6SC 3TO2B 3OB8A 3DYOA 1T5WB 1Z9SA 3EGSB 2GK0B 3SEPA 1EEYB 2A9NH 2EDOA 5IMMB 1CR9H 3DVNB 4LHUB 5AUMA 3SE9H 1AXTL 2PUQT 1O7VA 1AKJD 4CKVX 4GKSB 3P0VL 3AVEA 4CVZA 4FQ2H 1F6AA 1J1PH 5IJVB 4GMSL 3BGAA 4OV5A 4ZFGL 1J1OH 4FNLH 1WVZA 2BZDA 1LO0L 5L8JB 5DTFB 1MVUA 3V6ZB 5I71B 3VRLE 4G42A 2P8PA 3KJ4B 2DIAA 1D5ZB 2ZNXA 5L2KE 3CDFA 4M7LT 1F3DH 5F71A 5BV7B 3MOAL 5FB8B 4JAMA 4U1NA 3X13A 3F6IA 1OAYL 2A1WL 1MI5B 1DQJA 1JWSB 4QTIL 1IM9A 3FT2A 4P2CG 3TBSB 3MROA 3WDJA 5TE7L 1RURL 5L2JA 3KR3L 3RDTD 3HR5A 5DD0L 3WEXA 5SWQB 2FGWL 4JVWA 1FIEA 1VEPA 4LOUC 4APQB 1YPZF 1AI1H 2VERN 4G8EA 3WKNA 3A67H 4NN5B 4DGIH 4Y4FC 3CCHB 2XPGA 3LDBC 1BIIB 2AV1B 4F15B 1ZOXA 4ZSOA 1LEIA 5MP6H 1ROWA 2LAGB 4JB9L 5SX4I 3SDCD 5AWNL 3ALXA 5IG7B 3MRDB 3ZZ1A 1IVLA 3K2UH 3HCVB 4NDMB 1NAMA 2WAHA 3B2VH 2VLKD 1V3KA 3T1FA 3L3IA 5TE4H 1AH1A 4RGNE 2X4QB 3MQIA 2APTA 4XPTL 3PWJA 2BY3A 2J6EH 1J18A 5A43C 5GSVA 3AXLB 4NRZA 4ISVA 5ETUA 4C83A 1KXQE 3N1GC 1YY8B 1RUKH 3SCMA 5C3LD 3T4AA 3H9YA 4F8QA 4K3EH 2DIJA 1Q9WB 3C5SB 4S1RH 2E7CA 1U3JA 3KG5A 3SDDC 1IQWL 2D31A 3BI9X 3OGCB 3RWGA 3F5WA 5K9JL 5CBEB 1BVZA 1IBGH 3QDMB 4G80A 5D7JC 2X89A 1G7MB 2B1HH 4KQ3H 4LSDA 3G08A 5TFSH 1K85A 2YR3A 1KLFA 5D7SL 1KTKE 1IKFH 4JFHD 4F7TB 3TVMB 2VXQL 1T1ZA 2VWEC 4BFGA 2ZCLL 3AAZB 1AO7B 3LSOB 1U2HA 2FGZA 1LP9E 1NCDH 4JO1H 4X7SH 3QUMH 1CD9B 1KYOK 2AVGA 5DJZA 3IF1B 4Z8FL 2DQCL 1KB9J 3F7QA 3CFEA 2NNAA 3L5IA 5GZOD 4FG6D 2VLRE 5D8JH 3VFTB 3BPNC 2DLIA 3ARBC 2YMXH 1I7ZB 4I0KA 5C09D 3ZT6A 3OB0K 1BZ7B 5JHDD 4DGYL 3TO4A 2H2PC 1G7LB 2F58H 4PJIE 5JTWA 5EC2B 5IOPB 5TDNB 2W0FB 1JNHA 4P3CL 2J1KA 1NGZA 2CR3A 4S1QL 3B4NA 3J7HA 1UB5B 2DQFB 4I8DA 3AMKA 3GGWB 4L4TB 1NGQH 5KSUA 3CGTA 3BPOB 3G5ZA 4K8RL 4JKPH 2B5IC 2Q6WA 3ZT5A 2DN7A 3TT3L 2JJTA 3CUPB 1LK3L 3U0TA 3QDHA 1P4IH 2X4SB 3GBMH 1I3VA 4X4YB 2VABB 5J3HC 1UM5H 1NLBH 1RZIA 3ISWA 5T1KD 5E24E 5GRVL 4FHBD 3HN3A 4ELKA 4HJJH 4HAFA 4PS4L 1E4XI 4QOKA 4QRTB 3U79A 2OTWA 5IUSA 4R4BB 5EBWB 5E4IA 5F7NC 2PO6B 2IANB 1QLRB 1NBVL 5C0ND 5L9DH 3WXWL 1KTLA 1JZ8A 2DM4A 2IPTH 4EDWH 1JF5A 3GRWA 2JF1A 5IMLA 2XXMB 5FO7B 3FO1A 4E42A 1CG9B 5CZXC 4MJIA 2BVOA 1NFIB 3MLTA 2F19L 1U8LA 3H7BA 4TULH 3GK8H 5MEPA 4R7NB 1FZOA 2IBZX 1XGPB 3O11A 4Z5RB 3ALPA 5CLWA 2XTJD 4IRSD 5I8OH 3PWUB 4Y2DB 5D1QB 1JYWA 4JO2H 1QLFA 1MLBB 3GIVB 5C0RL 3L5HA 4PGZA 4MMZC 4U1MB 1FNLA 3MBEA 4PJ7E 5KANG 1HCFX 4LSTL 3L3OA 5E9DE 3BEWB 1FDLH 1UWGH 3P9WB 3BXNA 4DN4L 2OL3B 1A7OL 3H0TB 5E2TH 5AAMA 1FG2B 1HXMA 3QZWA 3LD8C 4HAGA 3RPIB 4XPBH 2VXSH 4XCEB 2NYYC 2DICA 2XTLA 4NKDB 1L6XA 1BREA 1JNLH 5FGRA 4YO0B 6FABH 1ZHNB 4HK0A 5C0IB 1KPUB 3P73B 2VXUL 2XA8H 1MHHA 1MAKA 1SY6L 3IDJA 1KG0B 2OXGA 1RMFL 5DS8B 2FJGB 3CK0H 5IBLD 2D7NA 2VDQH 3EYQD 3QQ9D 4PV8B 4RWYH 5GRYA 2YUXA 1XR8B 4LSRL 4Z7WF 2EXYC 4KRMB 2I26N 2GTZB 5TQ0L 1FL3A 5JW5A 1HXYA 1I7TA 4PJ9B 1T1YA 3OKMB 5KVDH 5DVLA 2A73B 2Z31D 2OR7A 5CCKL 1RVFH 1WAAE 4QHKI 4W4NA 1NBZA 3HE7B 3ZDZE 3DROB 1VB9A 1S7QA 2HKHL 4LPCA 3IS0X 3PABA 5FYLE 3ARDA 5IB1B 1QFOA 3VFNB 4NO0A 4AJ0A 1VKXA 4FFYL 3MUY1 3O8XB 1B2WH 2VDKH 4POUB 4BQBA 3GKZA 4HFUH 3ECBB 1LWRA 4PJGE 4Q2ZA 5J1AB 1T20A 5A1AA 1IEAA 5DUBB 4TSAH 4PJDF 4WI8A 4HFWA 3X12A 3QEQE 4HBQA 1J0JA 1NC4B 4NSKB 4KUCD 2XG4A 4WI7A 3THML 3QISA 4UIKL 3JWOL 4QT5A 1KTDB 3PDOA 3CFKB 5FF6B 4G7YL 2GAZB 4Y16C 4HUWA 1ZGLM 1CFNA 1WEJH 3Q48A 1EFXB 4O4YH 3NAAH 5GRUH 4JRYA 1LD9A 4EN3B 1QRNE 5C08D 1CICB 3NCYS 3V4VL 3MLSH 1GOGA 5F9DC 5BV7C 3PGFH 5IKCB 3DX9B 3QEHB 5D1ZD 4H1LB 4G43B 4AQ1B 3BQUD 4LEOB 1X5JA 2N4IA 2X1WL 5CGTA 1U95B 4X5LA 2W59A 3MACL 3PJSB 3NN8A 5JA9A 5I2IB 5EZJA 4LLUA 3P11L 4ZAKC 3D6GA 1XIWB 5B8CB 4APQC 5E56A 4PRBB 1WC7B 2R4SH 3B6SA 3U6RB 1A9BB 1MJUL 3IDNA 2VN4A 2R39A 4NN5C 4Y4HD 1XFPA 4H0IA 4OIAA 5ICYB 1LO3H 1J10A 4MNGA 3GHEH 3L3GA 5CAYB 1J0ZA 1T21A 3LKRA 3T77A 2YS4A 1KJ3L 2YD1A 4HS8L 4OZFA 3F6LA 2GJ6E 3MXVL 3DV6A 3TH2T 4P2QB 5DR5H 5GGRY 3QFDA 4NGHH 3HI5L 4F80A 1JZ4A 1XF3A 4HJGA 2WP3O 4C56E 2P49B 4JJ5B 4M1CD 2MJWA 4JY4A 3RKPA 2X6MA 3H9SD 1QR4A 4P2OD 5CJXC 3HR6A 1WCBA 4OI9A 4WU5A 1MEXH 1GVIA 5I1IL 3LRSA 1TZIB 4YDIH 3WLBA 3DI2B 1KIRA 1YQ2A 2DQGH 3TIEB 1H3WM 4PGDA 4LPUA 2QEJA 4OZHB 2PYEA 3WXVH 4P0DA 3RAJH 1FZKB 4YAQB 4WW2B 5HHVL 4C59B 4M1DL 3HC3L 3KPSB 4JVUA 1NLDH 2BVUA 3IU4H 2H1PH 4JN1H 1D5IL 2W65B 3VXTB 1NMCB 1JHKH 4XPGL 3DGGA 3RWDA 1HYRC 4CJ1A 2EEBA 1NSNH 3E2HB 3QRGL 4MXQD 4F3FB 2R0ZL 4UNVA 1N0XL 5CMAA 5GZND 3TVMC 5JZ7C 4LIQH 3V6OE 3PWNB 4PJ5A 3O3BB 4W6YB 5I17A 1RQ5A 1GYAA 2WK2A 4FXGA 2RIKA 4HW6A 3RRQA 1JI1A 3O9WD 4IOIB 4U1IA 4WEBL 1RUAL 3VG9B 4I3RL 4P3DA 3L9RA 3TLRA 1WBXB 1JGUL 1GXEA 4FZEL 5JIPA 2F5BH 4J3OC 5HHXL 4WUKH 4JFEE 1DUYB 5CGYC 5D72H 2AXGB 4LRNH 3RWHB 5T3ZD 1N6QH 4XP5L 1ZK9A 3K74B 1FPTH 3Q0HA 5F7UA 4NM8L 2ED7A 3U83A 3SJVB 3OAYK 1VSCA 3IVKA 1F4XH 3JV6B 3O6LL 1CYGA 1CFTB 2CJUL 4MJ6B 4Z7UE 3V79C 2YRZA 2HRPH 1C5BL 3GJFH 2LU7A 3TNNB 5E6IB 1CXHA 5BJTB 3BPOC 3ZE2F 4TNVK 4JCLA 3NGBC 5L2KD 4KI5F 1E28A 1FO0H 1NCCH 4HCRL 2HKFH 4MA8L 1GPOH 3NIDF 5DFWH 4HLJA 5EG6C 1GGCH 1A14H 4LDEB 1EVUA 5JO5B 3O4OB 4OZ4B 4KI5D 4S1RL 4V1DA 4F33A 2R2BB 1F90L 4U2ZA 5ELIA 3CZJA 2OJZH 3L7EB 4RMUA 5T1MA 3SO5A 1IBGL 2PO6C 3MJ8B 4GW5B 1ZVSA 5BZWB 1RK0B 5CBAA 4E41B 4MZ3A 3FO2A 4GG6E 4GW1A 2QSCL 1NDMA 1N26A 2F53B 2CQVA 4YX2H 2J2ZA 4MCYB 3OR6B 1XCTB 1NAKL 1JGEB 2GITB 4GLRI 2ZJSL 5E2VL 3U30B 3WL9A 1QACA 4QF1A 4N1EA 3LQZA 2ORBH 4POYA 2B20A 3RHWK 2LV4A 5FV2A 4OBRA 4Y2DC 3D3VB 1OP3H 2DKUA 5IK3A 1EA9C 4XXCC 3ZDXE 1A4JA 4U6HA 3IDUA 1FRGL 4RNRA 5C0JB 1OF2A 3DVGA 1ZA6A 1IGTB 4U1JB 4UI2A 1T2QL 2BOCB 1SEBA 2R0LH 4JPWH 1JPGA 5C70A 5C0GB 2X4RB 4ZFOA 4MJ5A 2Q8BH 5L8LB 5DJCA 5JW4Q 2AJVH 2NY2C 1S9VB 5K9OA 4NRXB 1ZLSH 2NW3A 4FFZL 1U8KA 3HC0A 3TYGH 4QRPA 1HCVA 1KEGH 5I66A 3MRJA 4OZFG 5CEYB 5KSBA 4PIRF 1P4IL 4JRXB 2OTPA 5IBTL 4D0BB 1RFDH 3JVGA 2UZXB 1B4JH 3MODH 3VFPA 3H3KA 4LU5H 4YHYC 4EDXA 1A3LH 2V5MA 1PW3A 4PBVC 5DEFA 1TQBB 1ZVYA 3O2VL 3QDGD 5I73C 3BN9D 5IB5A 2JJSC 4PRNB 4ZNEA 4QRSA 4EBQL 3ILQD 1BHGA 3X3FL 1XAUA 2X4PA 1M71B 4ZXBC 2VR9A 3WN5C 4NNXB 4PJ9C 5E8DL 1YNTA 1UZ6E 5DK3A 3TNMA 3TO4C 5DJYB 3U4AA 5HI3D 2B0SL 4QKXB 2E7BA 1P84J 5CINL 5F7KC 5M7QA 3ARED 4Y5YA 4DZ8A 2WIIB 3U82B 4R4FH 2ITCA 1WIOA 2CDFA 5HY9A 3VXMD 2YA1A 4Z0BH 1B0GA 1N7ML 4I0PD 3TWCL 2EDTA 2VMFA 1BJMA 4NQCB 5DUMH 5HDBF 3IXAB 5I8CA 2KH2B 1I3RB 3DHJA 4X4XA 4CNIB 3RUGE 3DMMD 3V95A 5L6YL 1F13A 2O26U 1MCKA 3QUXB 1ZXQA 3TN0A 3BKYH 2ZUTA 1FC1A 1CDIA 1TETH 1J1XH 3PGCB 4Y19A 4LSPL 1I7UB 1EIBA 1FLTX 1YY9D 4XAWH 3BMVA 2ZCKH 1RY7B 1QFWM 3KPOA 4N9GA 3QIWA 4MXWH 4U1LA 1UADC 2FO4A 3WS6A 4NN6B 4FFWC 3MV8A 2CKBB 4UNUA 1MWAH 2PTTB 4JFYA 4HPYH 4Y2OA 4EN3C 1CCZA 4HEPG 1CGSL 1P53A 3BWUC 4ZUUA 4G8FA 3KWWB 5TF1L 5J7CC 2HJLB 1FORH 1ZKAA 4JHAH 5EUOE 5BS0B 5IB2A 1EJOL 5D5MF 4AT6B 1VGKB 4EOWL 1Y0LA 4ODHL 2BNUA 5E00B 1Q8MA 4WCYL 3QG6B 2OCFD 1Z5LB 3FKUS 1ZLWH 5B39A 1EGJL 5TGBB 5B8CC 3GB7B 4OZIB 3I3EA 2X70A 3RGVD 1UCBH 4YDJA 1CLZL 4E0RB 4G5ZL 5IW3A 3CZFB 5L0QC 5BV7L 1IAOB 4F9PA 4R2GD 1I3GL 5JR1H 1XGTB 4A6YB 1XMWA 5D7LE 4ENED 3MA9H 4GRLD 4EUPH 3WO4B 4OT1H 1YNKL 5IHUL 3HG1A 3NFSH 2NLJA 1S7VB 1MOEA 4OIIH 4OIBA 4B7IA 3FOMB 2E9IA 4Z95L 3OHXA 3CFBA 1KEML 5EZLA 1R5VB 1U8QB 2OSLA 4YXLL 1R24A 2WBJC 5HGDB 4EVNB 1RUML 2V7HA 3KPNA 4O2CA 4WGWB 3V52L 3PV6B 2FSEA 2PN5A 4LRIA 5E2WH 1CE6A 2FEEL 1Z6JT 2AEQH 2GI7A 2GJJA 4MNQA 3NIFE 4NCDA 4PJAA 1VFBA 4P9HL 2OX5A 4PJEB 5T3XL 1QA9A 2JCCA 5DRWA 3DARA 3P9MB 4WNQB 1XGUB 2QBWA 4F58H 4JN2B 5JLZA 2Q3AA 1NMCC 2VAAB 4HUKB 5DQJA 1YA5A 4JY5L 3SKJL 5ID0A 5FUZH 3H3BC 5FYLD 3QUZA 2YD3A 3HHRB 4NWUH 3Q3GA 1ADQA 2BC4A 4XGZB 2OTUA 3SDXF 5DJ6A 4R7DA 1BMGA 2I07A 3C6SA 4Y0GA 5DRXA 2D03L 3E6FB 2DL2A 3BPCB 3UJJL 4NYLA 1TTFA 4L4VD 5CUSH 4YBHA 3WNOA 3PDDA 3MPCA 4FMKA 3VG9C 2J8UA 3K8MA 3QEUA 3O6FB 3TT1H 1NFKA 1WWBX 3SKOA 4K23L 1OGTA 2IH3B 3QEQD 2AJZB 4N0CD 4K7FA 4LK4A 1PQZB 1YYMH 5ACLA 1MJ8L 4OM1L 5BRZA 3GKWH 1BOGB 3FQRA 4RFEA 4AG4L 2C7UA 4NQVA 1QR1B 1CE1L 4AEHL 2BERA 3KYOB 4NGHL 3DLQR 5E99L 3H3PL 4G9FA 4JHWL 2SEBA 3FL7A 4PV9A 4U1KB 5F3HA 4QNPE 5DXWA 5E6IC 3BKJL 3WHE0 4JG1H 4UV7L 1XH3A 4XMKL 4PPTA 2NY5L 2B1AH 4XCYB 3IAPA 5CP7B 2VB5A 3BMWA 1RD6A 5I0DA 2ADGA 2ZCHH 3O4OC 4KKCC 1ZEAH 1ZMYA 1EV2E 4NZDA 5C6TH 1AD0B 3HLAB 1AR2A 1A1NA 4WO4D 4LKXB 5MEOA 3V0VB 5EZOH 2QR0B 4Z7VA 3ILPA 1S7WB 3VWJC 2MOVA 1DUZA 1JHKL 1RZ7L 4GO6B 5GS0H 1U8NA 4PJFA 1IL1B 3IJHA 5MENA 5EO1B 4I3SL 1QTYT 1T66C 4QRRE 2WUCL 4P2RA 2CIKB 4JM2B 5HVHB 4XRCA 1JE6A 3U30C 4HIHA 2VE6A 5E1HB 2EDYA 2FYYB 5BZDB 1AJ7H 1KIPA 3HMXH 4JM4L 3QBTB