3MYZA

Protein induced photophysical changes to the amyloid indicator dye, thioflavin t
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
97
Chain Sequence
MIQRTPKIQVYSRFPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
publication title Protein-induced photophysical changes to the amyloid indicator dye thioflavin T.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 14
structure length 97
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3myzA00
3CFDB 1EHNA 2N7AA 3D25A 1HQ4B 3U7WL 3G08B 4ZTPH 5HGDB 1QSFB 3NABL 5DR5L 4FQIH 4YDIL 1YC8A 3GMRB 3HR6A 4PJAF 1I7ZA 3CDGA 3UYOD 2H3NA 2EH7L 1U58A 4KUZL 4NUGH 2C9AA 2F54B 3NCBB 3LKRB 3BDBA 3ULUL 3GHBL 1MWAL 2D2OA 3PV7A 3FRUB 2FX7H 2FIKB 3UTSA 4YWGH 3PWLB 3LQAL 5I8OL 1XGYL 3VWKD 4DGVH 5L2KB 2W91A 4QRQA 3RIAF 1BZ7A 1MHCB 4P2QB 1FORH 1CDJA 1U8LA 3MRLB 5CFHA 2KZ1B 5FM4A 1PKQA 1C08B 3D85B 4QHMA 5AD0A 1G6RB 1N0XL 4OIIL 5GS0C 4NC2B 2EXYC 5I18L 1KN4H 5C0AB 1ZHNB 1Q9LA 3KYKL 1INDH 4KJYB 4L5FL 3N85L 4P4KD 4WEUD 3VI3E 3RKPA 1B2WH 5HD8C 2GTZB 3LD8C 4OCWH 3UPRA 2HRLA 5DUPH 3GMQB 5IM7B 5D1ZD 3FO9B 3TN0B 1IGTB 1NGQH 4I48A 1I3UA 2PO6D 3LS4L 5KSBE 2CLVB 2WAHA 1OB1B 3K8MA 3MLSL 3DBXB 1SVZA 4Y4FC 4R90H 2X4NA 4Z7UA 3QIWC 3C6SB 5CILH 1ETZB 1LMKA 3HZMB 3DMMC 5C7XH 3OXRB 5T1MA 5GGVY 2GIYA 3HC4L 3DNKA 2V2TB 4YX2L 3BPOB 2F53D 2KQMA 5DJDB 4NC1C 4TSAL 2AVGA 4X98B 5MEND 4U7MA 4Z0BH 2JJSA 3D3VD 2O61A 1NCCH 5FF6B 4J1UA 4GKSA 4XNYH 4JGJA 2DYPD 5HDLA 1WVZA 5C0CD 3MRQB 4N0UB 3KLAB 1FZOB 1AD9B 5C9KA 3UROR 1DQDL 2XG5A 3QUYC 4NNPL 1I8LA 1TFHA 2X4PB 4PGJA 5HSFA 3QFJB 3QUML 1A6ZB 4HLZH 5GGSY 1Q72L 1JIBA 3K3QA 1MREH 2R39A 4KKCC 3RGVD 1T80A 3CSYA 2I5YH 4Z78B 1XGUA 4WRLA 3VXQA 4W6XB 4ZO7A 2R0ZL 4N8VB 4OV5B 2GJZB 3MUGB 4K3EL 4E41D 1T7WA 3EYVB 5I1IL 5CBEB 1DFBH 2AJ3A 3JV5A 3T2QA 4NO0B 5DK0A 5EBWA 3HNSH 4HJ0D 1VERA 1YY8B 4PV8A 5T1LB 4M8QB 5C09E 4WJ5A 3FMGH 2AJXH 4NN5C 4QXGL 4PJXE 4M43H 1OAXL 5CZXD 3AC0A 5BZDB 2XQBL 2EYTB 4JHAH 4PJ9A 1N64H 3O6FD 3CD4A 1T5WA 5D2NC 5JHDD 4C55A 3VGDA 5BVJB 1FBIL 4DEPC 5E7FA 2DTSA 5C0DB 5LQBH 2XACC 4PGCA 1GHFH 5DVMA 3LRHA 3HMXL 1JPTL 4U7KA 4X9BA 3MLVH 5E2WL 3MLWL 4Z76B 3ZDZF 4LPXA 2NY2B 1LEIB 1QSFE 5IMMA 2AJSL 2P5EB 4M48L 4YDIH 5DR5H 1KIRA 4LEOB 4C56B 4ZFOL 5LWYL 2Y4SA 3HC0A 2EH7H 5C0GB 2F54E 5I1HH 4KUZH 4JFQB 1CGXA 2DDQL 3EOYG 3LY6A 3ULUH 1MWAH 3BDYL 1CFVL 2XTJD 4LKCB 3CZFB 1ROWA 3V5HA 4O00A 5I8OH 5T3XD 4OLXH 3BEWA 3NFNB 5L2KE 4MD4B 3VG9B 5FYJD 4G9FB 4JLRA 4P2QE 2JJTC 5TPWL 1I8IA 4OCSH 2AJZB 3AXLB 1Q9KA 1T2JA 4JZJB 5AZ2L 1BJMA 3IKKA 1Q0XL 3QEQD 4WDIA 1J88A 5C07B 4S2SA 2GITA 5JW5A 5D5MF 4UDUB 5DFVD 2YD3A 1MCOH 5DVNA 2K3TA 1N0XH 4H1LG 4OIIH 4OLZH 4Y2OA 5C0AE 1H5BA 3T2PA 5I18H 3S36L 3GMPA 3T1FB 3KYKH 4YE4L 4L5FH 3VXUA 3GUTA 1OCWL 4KJQC 1G6VK 4L9LA 5HYFA 5D1XA 3RWIA 1T7YA 1TJIL 5F9OL 4B0MM 2G60L 4OD2B 1X4ZA 2V7HA 4K3HA 4YHIB 4UIMB 3BP7B 3IDUA 2Y9RT 4W4NA 3MLSH 4KDWA 5DZOA 1A8JH 3W9EB 4QKXB 3DO3A 1MAKA 4LF3A 3BAEL 5EFIB 1VADB 2NQCA 1R3JB 1FAIL 2NY1B 1G7PA 3GGWA 4HUWA 4PJ5D 2P49B 2R4SL 3HC4H 3N1MC 3BFOA 4S1RL 5DYOA 1ZS8B 3EYSL 4MAYC 3PGCA 5CWSB 1QFPA 3DI2B 4FFZH 1JGVL 4LBEA 4TSAH 5ICXA 2R23B 4F7MA 3HPJA 5JZ7C 1AE6L 3D0VA 5JHLL 2C3HA 4PJGF 1C5BL 4JFXB 2X5PA 4N0UE 5KSVB 3CCHB 4NZDA 3GSNB 3ILQD 4W4OA 5LBSH 3TWCL 2XN9A 4NNPH 4PREA 3FOLA 2BX5A 2AK4D 4O2EB 4HPYL 3PE9A 5KVFL 4JFDD 1Q72H 4OZFG 1OT1A 4NFDA 3TA3A 3HNVL 2E6PA 3RVVC 1VB9A 3E1F1 4TVPD 2AXFB 3FONA 4PG2C 3QUXD 5ANMB 1KCLA 3DPBA 5IJVA 2G9HA 3PDOA 3GJEB 2R0ZH 4YPJA 2P47B 5FECA 4K3EH 1U91A 2NNAB 4PJHF 1T1ZA 5B4MC 5I1IH 1QBML 4WI5A 3B9KC 5CJ8A 3NPSC 2PCPB 3ZKXC 3I6KB 3SKUD 3BZ4A 3NIFE 3K4DA 5J11C 5CHNA 1OWRM 4M4RA 4WUKH 1A7BA 2A73B 1C12A 3OJMB 4QXGH 3DI3B 1OAXH 4JG0H 5KSUA 2XQBH 1A02N 4BH8B 1X7QB 4M93C 4KK8C 3BPCA 1DUYB 5AWNH 3BGMA 3O11B 2VZSA 5HI4C 4MQ7B 2NXZD 2GUOA 1RZ8A 3SDYL 2VQ1A 3HLAA 1JYXA 3HMXH 5ENWB 3UPAA 5E2WH 3MLWH 4RZCA 5D7IF 5DK2B 4F3FB 2ZUXA 2BVYA 2P5EE 4PJBA 1XGPA 2AJSH 2H9GA 4ODXB 1E6OL 3KJ6L 4WHYG 1F3JA 3H9HA 4DGYH 4ZUWA 1U6AL 2P8LB 3KLHD 4AQOA 4QRTA 3RTQC 3BDYH 1P4BL 2EDWA 2YR3A 3QWRA 4IJ3B 1T04B 4ZO6A 5J3HD 1B4JH 2LU7A 4MDIA 3KDMB 5JR1L 5K9QG 4L8SA 3ZTJG 4J2XA 1S9WA 3A6BH 5EZJB 5DXWA 1UJTA 4G9FE 5TPWH 1JTTA 1LILA 1CDYA 1AKJB 1KJ3H 1OGAB 2CXGA 3C8KB 5GGRY 5AZ2H 5IBTL 1AHWC 1HSBA 1Q0XH 3BKCH 4N68A 3BH9B 3LEXA 3NVQA 4X6DE 4WU5B 5J6GA 3O4OC 5I0DA 4LVOB 3TFKD 3IDGB 3P3YA 3RZCD 3MRHA 4Y4KC 2BFVL 5EIIB 4P5KA 2A83B 1KPVA 5GZOC 2OJEA 3S36H 4YE4H 2VABA 2VWEE 4OQTL 4RFEA 4L3EE 1FSKB 3RIFK 1EXUB 5B38A 1IZKA 1JWMB 3QDHA 4YBHA 1TJIH 1HHHB 1J0KA 4KZEL 1YUHA 2G60H 3VXNB 3ECBB 1K2DB 5J8OA 4P2OD 1H8NA 5LKNA 3P9WB 4KC3B 2X7LA 2EYRA 3MMEB 1INQA 4POZC 3ARED 3BAEH 4KU1A 2E7MA 4G8GD 4NHUB 5FYLE 1FAIH 1EO7A 3H6JA 3CDCA 5IVXA 1K3IA 1GC1H 2DM2A 4HKBA 2C3GA 4S1RH 4UIKL 2O5XL 1A3QA 1A6VL 3EYSH 5DJZA 4Y5YA 4R7NB 4PG9B 1F4XH 5HVFB 1CR9H 1I1CA 1AE6H 5JHLH 3TEUA 2PETA 2ZUUA 4O4YH 1ZVHA 3TWCH 4P59L 5SX4H 4HPYH 5KVFH 3QI9C 2IGFH 2QSQA 3HNVH 1ITBB 2H1PH 5ANME 4M61A 2YBRA 4DGIL 1U8NA 2G2RB 4P3DB 4ZXBC 1N59B 5AUMB 4QRSA 3CSGA 4NQVB 4Y5XC 4MAUH 1WBZA 5EUOE 2XI9A 3HMWL 7FABL 3FQXA 4U2ZA 3MBEB 1A3RL 3QXAB 3VWJB 1L6XA 4LCCA 4OZGA 3PP3K 4X4XB 1KCSL 1HHJA 3I85A 4MVBD 1G7IA 2P24B 4C57C 5HGBA 2XZAL 5DURB 4ZAKC 2XPGA 2X2YA 3DVFA 3MOBL 3C60D 3BPNC 4NN6C 3ROOA 3LOWA 3P4MA 1BFVL 5IW1A 1JZ2A 3EUUA 2C26A 4QTHA 1U8IB 5KBNC 3IFPB 1ZWIA 2IC2A 3L5HA 2XFXB 5D71L 5BS0B 3I6LE 1X5XA 1JGLH 1NBZB 3GDBA 4FTVD 4W68A 3SDYH 1OLZA 3QEUB 2VLLA 1GGIL 3MPCA 3DXAB 3OGOE 2VLMD 3EJYC 3D18A 4PS4L 4OBRA 3TNNB 4XGZB 4LNRA 1EPFA 4Q6YA 3GMLB 1IEHA 4GUPB 1J8KA 5J1AA 4HG4K 1J8HB 1FPTL 1FL6A 3ARFC 4MB3A 4G43A 1KJMB 5FB8B 4PJ8D 2VDKH 3KNBB 3HUJF 1U6AH 3QXVA 1KCVH 1MELA 4JFHE 1P4BH 3ZDXF 4NJ9L 4GRMA 1UWEH 2EZ0C 1UG9A 2VDQL 4XVUC 5FO9B 1AGFA 1H0DA 4MZ3A 5JR1H 5FYJU 1UM4L 4NSKA 5EU4B 1MH5A 1BBDH 3TNMA 1OD9A 2IBGA 4D0BB 4K7PX 3REVA 4JAMA 5E1HB 43CAA 5IBTH 1M6OA 4WU7B 4TNWF 5DHVH 2NX5D 2VH5L 4GW1A 3QEHA 5CGYD 3NCYS 4O9HL 4P46A 1WLHA 2BFVH 4QRRD 5C0FB 3QPQC 3ZYJA 2R0WL 5HHXL 4HS3B 5IR1B 4X80L 2E7HA 2X4TB 3LD8B 1OP9A 1X4YA 1YEHL 1YY9C 4I5BB 3FB5A 3H7LA 1I1AD 4OAWA 4LRIA 4PGBA 4HWEL 4OFKA 3Q0HA 1GCFA 3G6JE 3WS3A 1I9RL 5F1IA 1CICD 5TE4H 5EZIL 3HS0A 2ZSWB 1YC7A 2WINA 3DTXA 4JPWL 1KIQB 2A6KB 1OL0A 3C5JA 4TQEL 5JXAL 4GBXB 5DJ6A 3I75A 4UIKH 2O5XH 3RPIA 2X4QB 2IQAB 2APFA 5ESVB 1IGIL 2BZDA 4G6ML 3H9SA 4JZOB 5DJ2A 1I7RA 5E5MB 3BIBX 1B9ZA 2WP3O 3BSZL 4XMPL 5D7KE 2SEBA 4J3WA 2R0KL 4KKBD 3RY6C 3QUZD 5CEYB 3UBXI 2YPLD 3VFUA 2VAAA 5FGBA 4P4KC 4P59H 1XF4B 3M1BB 1ADQL 3VXTB 1S7SB 2A2QT 3AVEA 1U8HB 2OYPA 4XRCB 1I4FA 5HHMD 1FNGA 1H3WM 4JO1H 2MQ3A 3EOBA 4DGIH 5D1ZC 1T66D 5EO0B 2PO6C 1OGTA 3PWUB 4WUUD 3NGBC 4FXLA 1U8JA 3SE4C 3CH1A 3LSOA 3TZVD 2EDOA 1D6EA 1UENA 4LPUA 4Y88A 1WWWX 3QNZB 5D70L 3HMWH 7FABH 1R3HB 5A2IH 3OL2A 4QRPB 1P7QD 4ISVB 1PG7X 5KJRL 1A3RH 3MJGX 1FJ1B 1LWRA 5CIPA 4HBQA 3PIQB 5ESQB 5J1TC 4NN5B 3TCLB 4UI2A 2XZAH 3MOBH 4H5SB 5E9DA 4D8PA 2EDXA 3C87A 2E9JA 1BFVH 1H3XA 5D2NB 3ZE1F 5DI8A 5IF0B 5AYQA 4UQ3A 4RGNB 2H32H 4JJ5B 5BS0E 5D71H 4Z9KB 5EORH 1UQSB 4BQCA 4NT6A 2ZZUT 3IDNB 4U0RB 3RY5A 4NO3A 1GGIH 3DXAE 4GFTB 2MNUA 3ULVD 1H3GA 5I1CL 4PS4H 3RGVC 2B7DT 1NGXB 3AS0A 4MA3A 4XCNA 3IU4H 1J8HE 3WBDA 1QSED 4LDLB 5LJYH 2R8SH 5F3BB 3MJ8B 4P4RB 3QQ4B 3OR6B 4KDTC 3CLEL 5M94B 4NJ9H 4PJIA 1LO2L 3LDBC 1NMBL 4YDLB 2ENSA 2VDQH 3S96A 2IAMD 4NRYB 4U1IB 1UM4H 1PGRB 3K80A 3SJVB 5E6ZA 3D39B 1PSKL 1OT2A 4WHTB 5E7BA 5CZXC 5EH1A 4EUPG 4NGHL 1DDHB 3HI1B 5BRZE 3O6FC 2XWBB 2X9YA 4F9LC 1J5OL 1CD8A 1FYTD 1RZIB 1U92B 5HYJD 5FKAA 5I0ZA 5CLWA 4GAJL 1JZ5A 4O9HH 5HXMA 4A6YA 4Q6IB 3L3OA 1MY5A 1ACZA 1NUNB 2WZPD 1HXYA 5ETUB 3L3DB 2R0WH 1UJ3B 2NYYD 4MS8D 5BXFA 5HHXH 1DUZB 1CD0A 4RAUB 4DUVA 1CE1L 1BQHA 4X80H 3VI4E 1RIVL 1TCRA 3BP5A 5DJAA 3ULVF 5JPMB 4ZPTA 5MERA 4FXGA 1FIEA 3GBMH 3QNXB 5K9JL 5L7XL 5IROC 2OXGA 3T3PE 4N8VG 2VN4A 2X4UB 2XTJC 3B2UD 4QCIB 4HWEH 2YD5A 3KPRB 1BD2D 3VXSB 3UO1L 2ZJSH 1EEUA 4KMQA 4PJFF 4OZIA 1D5XB 4JPWH 4UNTA 3B43A 5C2BH 4U49A 1G84A 2BVOB 4TQEH 4UBDD 3S4SA 5IMLB 4NC1E 3CIQA 4XPFL 4LPTA 3T0ED 4BZYA 4JQXA 5D8JL 5DFVC 3BSZH 4Y5VB 4YHLL 4YHNB 4I8DA 4XMPH 2R0KH 1OD7A 2KUTA 3HZVA 1FL3A 1K4CA 4J4PD 4QXTB 2A38A 1R5WB 2YRPA 3QULB 4Z0XA 1XF1A 4S1DC 2HH0H 5FYKL 1VGKA 2Z0BA 4ZO9A 3GJFK 3LKPA 1DE4B 1ONQA 2JK5A 5JIKA 3RZWA 5HY9A 2K7QA 4Z95L 4CU8A 1DVFD 5BW7C 1IM9B 2YKLL 5D70H 4QRPE 3MRJB 2AQ2A 2Z93B 1CCZA 3PP3H 5GS1A 5KJRH 3KPQB 1QFHA 4I4WA 2BHUA 5FUOL 3KLSA 2GJ6D 3T2OA 3QEGH 4ELKB 3QJFA 2ZNWA 4POYA 5D2NE 4RQQA 4KI5D 4JREB 4RGNE 3MUZ1 2YA0A 3PHSA 2W0PA 1T03L 2F58H 3P0VL 4JANA 3FTGB 4D94A 3HE6A 5MEQB 2R1WA 4JY4B 5I1CH 3BUYB 3QQ3B 3Q5YA 3QUXC 3WUZA 3SKNB 3I3DA 1GGBL 5FDWB 5SV3A 4MNGE 4XNMA 4YFLF 1KYOJ 2NY4D 3RTQB 4NCDA 4LASL 2ZUSA 3ARGD 1RFDL 4KQ4L 1LO2H 1NMBH 2HFEB 1VFMA 4Z7WF 3SJVE 3D39E 5I16B 5F7MC 2OR9L 5TQ2L 1PSKH 3MUJA 3RDTB 3V0WL 4P99A 4WEMB 5CEZL 4HIIA 2W60A 4CMMA 1J5OH 3LS5L 1WICA 3FQRB 2ZSVB 5KN5B 2NXZC 2YEZA 2FZ3B 4KI5F 5GGVH 2BNRB 2CKNA 4X9IA 3NZHL 1JPSL 3P11L 2NY6B 2VLKB 4F37F 5LAXB 2IWGA 4H8WC 2D7QA 1D5IL 4PTTA 1T3FA 2KZWA 5K9JH 1LK3L 5L7XH 1CDIA 2NTFB 3H7BB 3KLHC 2PW1B 3R06B 2BRRH 1IAOB 3SGKA 4ESKA 2VDRL 3DX9B 1EEYB 3KPRE 2HTLC 3L7EA 3MV9D 3QDGA 5J3HC 5EG6C 3VXSE 4JM2D 3FOMB 3E6FA 43C9A 5GS2H 4XHJD 2YSSB 2QTEA 4N5EC 4LSTL 1VA9A 1XT5A 1FLRL 1KENL 1RUQL 1MLBB 3SOBH 5D8JH 3TFKC 4YHLH 1CXEA 3W0WA 4HEPG 3RZCC 4KK5D 2BNQD 4WFFE 2DM7A 3RVUD 3RI5F 2B0SL 32C2A 4GKZB 1CE6B 1WWAX 1W0YT 3QI9B 4ORGB 4XP6L 1L0XA 4YO0A 3MFFA 3OGCB 1KLUB 1D5ZB 4RNRA 3D69A 3KPLB 2HMID 4M7LT 1RSFA 5FYKH 4PD4J 3OQ3B 2Q87A 1WF5A 4GW5A 3UJIH 3MLTB 4R2GD 3ARPA 3O2DH 4IOIB 4LEXL 4LK4A 1DL7L 2VE6A 5J13B 2EDRA 3STZA 3MO1B 5J7CC 3AREC 2F8OA 3D9AL 1F3DJ 4JM2F 1EA9C 1P4LA 2QQNL 4KVNH 5FFLA 2YUXA 3WNOA 1PY9A 1R24B 2VKWA 3LPGA 1I1FB 5HDBF 5D7LD 3TO4A 3CSPA 3WN5C 2EYSA 3E6HB 1QSZA 3BPNB 3WE6A 5FUOH 1ORQA 2DM4A 3X12A 3A6CH 3K2UL 4ONOA 4EN3D 1ZA6B 4WI8A 3P9LB 1YEDB 5C1MB 2G5BB 3EGSA 4IDJL 5K59E 3VFMB 4X9HA 5DRXA 4DN4L 1VENA 2V5SA 3BH8A 2NW3B 1MCHA 1UEMA 3RVWC 2WBJA 3VGFA 1T03H 5AG8A 2ADJA 1JJUA 3PL6A 3KPTA 2EE9A 4JRYB 4PJAB 3MCLL 3N1FC 4EI6A 2C5DC 5I1LA 5IOPB 2HJLB 2HVJA 1A3LH 4K2UL 3BE1L 3LV3A 2ESVA 1GGBH 4LLWA 5DS8B 4DZBA 1LE9A 3VFSB 4LASH 5EOTB 4YH6A 5HHPB 1YMMA 3ETBF 1RFDH 2AKRA 3BN3B 2R2BA 4I2XE 4KQ4H 1CLCA 1E0OB 1ND0B 3HG1B 3LEVL 4FQ2L 3IKCB 4PLKD 2BCKB 4M8VA 4J3TA 1RZJC 4ZUSA 5D96B 5I1AA 2DQCL 2AERT 2R2HA 2J12B 3LMJH 3RBSA 1GSMA 4PRDB 3GSUA 3C60C 1NDMA 3EYQC 1H15B 3V0WH 5CEZH 4ALAL 3EOAB 3B3IB 4ZYKB 4UOW0 4YXKL 1RK0A 2BVQB 5DHYB 2BNRE 5IT2L 3GMOB 3ZKND 1FYHB 3NZHH 3L9RB 1BECA 1IGYA 1JPSH 5IJKC 1OARL 2VLKE 4DVBB 1U9KA 2N4IA 5IBLD 3DETD 4P5MB 4ZQKA 1U3HB 3U0PB 1UACL 2ZUTA 1KACB 3U36B 1EJOL 1D5IH 5IVZA 5C8JB 2VO5A 3UAJD 3U1SL 3N9GL 2O93L 4PJ8C 3MRIB 2DTML 5MHSD 3QNYB 5I76A 1WFUA 2ICWA 4LSSL 1FH5H 3X14B 2E6JA 2FECL 3ZKMC 5SWZA 4LFHD 4RX4A 2C4FT 3VWKB 5GS0L 2XOTA 2DQJH 3X3GL 2PXYD 2BSRB 1MFCL 2JCCA 2CMRH 4JEGB 5IFJA 4LSTH 3QZWA 4HIJB 4U6HA 1MF2L 1FLRH 1KENH 1RUQH 3F7PC 1CU4L 1QVOA 2WUBH 4GT7A 4ZPVA 4C83A 5EUKA 5CGYC 4M7ZC 2OK0L 3QFDA 2A74B 4B41A 2B0SH 2XZCH 1NBYB 5E8PB 3LN5A 3O0RH 2NY5C 1ZT7A 1A4KA 2VDLL 1I1AC 5TDPB 1NAML 5ISZD 2M1KA 3IFOA 3QUMA 3P9MB 4C4KT 1DL7H 4OF8A 3J8F7 4NCC2 1CICC 1NGPH 1QRNB 1X5YA 3D9AH 2ENYA 2I07B 3K81A 5HJ3A 1FRGL 4XWGL 1IGJA 2QQNH 2HYMA 3WHXB 2XKNA 1MHPL 3CFEA 4NPYB 2LAAA 1F11B 4AG4H 3TYFB 5MENB 2X4OB 5T5NG 5E95B 3GMMA 1R3IL 2GK2A 4KKBC 4OFYD 4OCYL 5C0CB 1WWBX 3IFLH 2IG2L 4IDJH 4HHAA 4TVSa 5F1KC 3V5KA 2MTPA 3BQUD 5KAQF 3LPWA 3LKQB 4JRYE 2HJFB 3VFVB 3AAZA 3ULUD 4TTDD 1CVRA 4JG1L 3OHXA 3O3BB 4K3DH 1YNKH 1FNSH 3A6OA 1SJEB 1T66C 4X6EA 3G04A 4YNYA 4JN1L 3MRDB 4E41B 1YN6B 1KEGH 3DRTB 3P4NA 3TLRA 4FQCL 3MNWA 3KYNB 1WUNT 3RL2A 3LDBB 3HG1E 4N0YL 1JYNA 4C54A 3LEVH 4FQ2H 1K3ZA 1N2RA 4L9DA 3GSVB 5D7SL 3CDGB 1UKSA 2YD4A 4MYWB 5EBLA 3WIFA 2NXYB 3MGOA 1GL4B 1YDPA 2DQCH 5I6XB 5D5MB 4HFWB 2ADGB 3O6FB 5IP4A 1ERNA 1IEAB 1A9BB 5JHDB 5DJXA 1A2YA 3LQZA 2P42B 4QRQB 1J0ZA 3IGAB 3WJLA 1U95B 3U46A 1GZQA 4NZUL 5IT2H 3SDCC 3E8UL 3ULVC 1PX3A 4IRZL 3KR3H 2O5ZL 1OARH 1ZHLB 3BP6A 3T09A 1FDLH 1MCQA 3ULUF 4I3GA 1FO0B 3UTSD 3MV11 1UACH 1C1EL 4MXWL 3QIUD 1EJOH 1OAYH 3N9GH 2WSKA 5C0JA 1HI6B 4LSSH 1NEZB 3VFWA 3UTPD 3UPRB 3IETB 1LK2A 5GS0H 4EI5A 2IAMC 1EBPA 3WKML 5D2LA 4I18C 3X3GH 4RMRA 1C16A 1MFCH 5CEXA 3JUZA 1T6WA 1BIIA 2P1YA 1FFOA 1A6TB 2O5YH 1FVEA 4Y8DC 4PJGB 5D7JA 1CU4H 2HN7A 3WL9A 2AXGB 2GTWB 5B39B 2ZOKA 2OK0H 2YZ8A 5CJOL 3V5DA 4P23D 3VGEA 2VMFA 4MS8C 2NYYC 1S7RA 5IIEA 1X5IA 3T0XA 4F7CB 4MNHA 3P4OA 3QYCA 4LKXB 3TBWB 3CUPA 1NBVL 5ALCH 4MJIA 2VDLH 4PJHB 1NAMH 1BQSA 3BGFC 3WFCL 1XMWA 1HWHB 3CFBB 2DD8H 3B2UC 1XGRA 1Z6JT 2FO4B 4KJPD 4V1DA 1VHPA 1A4JB 3EO1B 3LRSA 4DAGL 5KVDH 1F4YL 3U4EA 3ESUF 4JDTL 1OAQL 4F33B 3QDJA 5A3ID 5JOFA 1FRGH 4UBDC 4XWGH 2JIXA 1N4XL 1F6AB 1KB9J 1R0AL 1MHPH 4U1GC 3S98A 5MENE 3D3VE 2AJ3B 2PUQT 3T0EC 1V3KA 3CLFH 1A1MA 1DR9A 4IMKC 3HA0A 3W5NA 5C0CE 1R3IH 1CGVA 4OCYH 4AM0A 2IG2H 4Z7VA 3NFPA 4J4PC 1HKLL 3ZDZE 4UMGA 4WTXA 5D7IB 1QEWB 4JFDB 1G1YA 3TT1H 4CNIB 2RQ8A 2Z31B 2D0FA 1OWWA 3VRIB 3QUXB 3UMTA 1TIUA 3QJHA 1OF2B 3I3EA 4H88L 4E41E 4JN1H 1WCBA 4OUUB 5DGQA 3QIBA 3UYPA 5IQ7H 3SY0A 4XXCC 1HH9A 4FQCH 2NCMA 5EC1B 4W6YB 4UILH 5BQ7B 1MRDL 3WEXA 4N0YH 4DUWA 3NZ8B 4PJ9D 4GG6E 5D7SH 4KKLD 5EA0L 1YMHA 5IQ9B 2Z8WC 3NOIA 5IK3B 4QHNB 5D5ME 5D6DC 5TDNB 1RZGA 3MRPA 3W39B 3ET9F 3E2HC 2DQEH 4UU9A 4WWKB 5JHDE 4H1LH 2Q20A 4KI5C 3LHPH 1LO0L 4FOMA 4UNVA 4W81A 5CBAA 2X1PA 3WUWG 3QG6A 3E8UH 2QADB 4IRZH 1DJSA 2O5ZH 3T77A 1NGYB 4WW2A 3SO5A 3QO1A 1NJ9A 2Y06L 3SGEH 3JV4A 5TGBA 2ATPA 1T1WA 4MD5A 5IKCA 2NY4C 2XTJE 4G80A 4TRPL 3G5XA 5CP7A 5EZOH 3ARGC 1MHEB 4JDZA 5EWIL 3S5LA 4I9WD 1F4WL 5E6ID 5T3XE 3Q3GA 1T0PB 1IKFH 2NY7L 4NZRL 4HUNB 2BMKB 5FYJE 2YHGA 3PHOB 1A6PA 1WAAF 4PJDF 1T20B 3R1GH 3QEQE 3MRNA 4PJGE 1NUFA 4GRLA 4O51A 3VXUD 4Y7MA 2GSGA 5EU3A 4JY5L 4ODWA 2B1AL 2IADA 5C0NC 2IH3B 1YNTA 5D1XD 5CJOH 4WFGD 1VEMA 5IHZA 4JM4L 3DECA 4OZFH 3NN8A 3ROLB 1IVLA 4JQVA 3F62A 4F7MB 2FX8L 3RWDA 4FQHB 4YEFA 1AC6A 4PJHE 1ZT4A 2XWTA 4QGYA 4UINH 2EDBA 4XPTL 4P2OB 1U8KB 4TN9A 5KSBA 1ZVYA 1K5NA 2MPAL 3STLA 1IC7L 2ZOLB 4HGWB 1NCAL 3VE0A 1LO4L 4NZJA 3P2TA 3PWJB 1V8HA 4ZNEE 4DAGH 5DD6A 1F4YH 3AREB 3IU3A 3FONB 4I3RL 2F74A 1OAQH 2GCYB 2R1XA 2XXMB 3OAYK 4I77L 1G0YR 2KKQA 1NCNA 4ZFZA 3WN5B 5DQ9A 5C08D 1ACYH 2XN9D 1D5BB 1ZLUK 4X6FB 4QF1A 4MXVF 1YNLL 4TUKL 3WYRA 4KK5C 3TA3D 3IDXL 3RVUC 1MFDL 1SY6L 1UM5L 2YXFA 4JFOB 5D7IE 4XCFL 5DD5L 5EOQL 2PN5A 1C12B 4JFDE 3SE3C 4GXVL 3VXPB 4AT6B 1JZ4A 5F7NC 3R0NA 1P6AB 4TVPE 2HMIC 1RIUH 5CSZA 3IAQA 1U41A 2EEBA 3VMOA 1I3RB 1MVFA 3HUJB 4R2GC 4WHYH 3ARDA 4H88H 3UBXB 1BFSA 4J7RA 2W07A 3M17A 3QR2A 3W9DA 6FABH 1KPUA 2APVA 3SGDH 3F58H 1A14L 1MRDH 3ZTJH 1HHIB 5DJ8B 5EA0H 1IAKA 1KF9B 2WK2A 4ZUUA 4Q9RL 1MCPL 3QWQB 4PJXA 3ARBB 2VQTA 4LCIL 1XF2A 4EN3C 1AQDA 2HJKB 1DP0A 5B3JE 3QDMB 1S9VA 3TO2A 1WK0A 2AEIT 2IEPA 4IMLB 3ME0A 3VXOB 4PY7B 1LO0H 1QPXA 1G7MB 1BM3L 1KULA 3MC0A 1W72B 4X6BB 1UXSA 1QRKA 4ZS7L 3LEXB 4JRXB 1HQ4A 3G08A 4OF5A 5HGDA 1QSFA 5J6GB 4DQOL 2BVTA 5F8QC 3WIIH 4F8TA 2Y06H 5I1KL 2OJEB 2F54A 3LKRA 2VABB 4PJ8B 4EEEA 2IF7A 4K3JL 1WV7T 1C5DB 4OKVB 2V9RA 3FRUA 2FIKA 5EWIH 3PWLA 1FNHA 4YUEL 1F4WH 4U6YB 2NY7H 3EFDL 4PLKC 4NZRH 1YUHB 3F7VB 5L2KA 5IMOB 4YIQB 3BX7C 3QG7L 1MHCA 3OAUL 4P2QA 5HHVL 3UYRL 1HHKB 5F70A 3RBGA 3N50A 3MRLA 2PW2B 1R6VA 1DBML 1C08A 3D85A 2NX5B 3MJ9L 2YA2A 1BLNB 1G6RA 3SCMB 4QRRB 3OKKB 1CFQB 2HT4D 5C0AA 1ZHNA 1ZT1B 4H0IA 3WJJA 4KJYA 2DQGL 3ZKNC 3LKSB 2VAJA 3SDXE 1DLFH 2GTZA 5IBLC 1B6DA 5FEBA 3DETC 4I0PD 2L4OA 2EC9T 4NNYB 4XNZB 2VXQL 3GMQA 5IM7A 2DL2A 4S1SL 3FO9A 3RA7L 4Y4HB 1IGTA 3WD5L 4XPTH 3UAJC 2CLVA 1KT2B 5I75B 1OB1A 2MPAH 3DBXA 5F7DA 1IC7H 1JN6A 1LO4H 1ADQA 1EZVX 2PYED 1AQKL 4J23A 1ETZA 5IGXL 2MHAB 3HZMA 5DLML 4O02L 4G8GE 3GI8L 3VI3F 1BP3B 3OXRA 4I3RH 1MIMH 2PXYC 2DBJA 3WS6C 2V2TA 4I77H 4CVUA 5DJDA 4EOWL 1FV1B 4NQED 5DJ0B 1JZ8A 1FNAA 4X98A 3HNTL 2GW5A 3DX6B 1YEFH 3O9WC 3NTCH 1YNLH 4TUKH 3U9UB 3MRQA 3QUZB 5GRWA 1E4WL 3OG6B 4N0UA 3IDXH 4OZGB 3KLAA 1FZOA 1AD9A 3RNKB 3PF2A 1XGTB 1MFDH 1ZGLM 1UM5H 1NGZB 2KH2B 2X4PA 5EOQH 3QFJA 1ED3B 5FCUL 4CDGC 1A6ZA 5TQ0L 4GXVH 4FS0A 4DN3L 3V79C 3P4MB 4M6OL 1NFIB 4Z78A 2HFFB 3RWGA 3ABZA 3HUJE 2EO9A 4WUUB 5I1EL 4N8VA 3TZVB 5F8RC 2GJZA 4OV5A 1XGQB 3EYVA 4NRXB 5CBEA 2CK2A 3KPOB 4X83A 3HB3D 3D18B 4ETQB 2P5WB 3GSXA 4NO0A 4OBSA 2CKBB 1KGCD 1A14H 3I6GA 3MBXH 1YY8A 1Z9LA 4OFPA 5T1LA 3WXWL 4RWYH 4Q9RH 1MCPH 1KEML 2Y6SD 3VH8G 3BD3A 5BZDA 4AL8L 2EYTA 1OAZH 4LCIH 2R29L 3ZMRA 4UT6L 3KXFD 2OSLA 5E1AB 3QDME 4N0FB 4ZOCA 4XVJL 4MB4A 1E27B 1RZFH 1EHAA 5F7UA 5GZND 3A0OA 4FTVE 1EHLH 1HQRB 2VXVH 1J1OL 5C0DA 3PGDB 4AY0A 1IC5L 3P30L 3BQUC 5JW4Q 4ZS7H 3D5OF 4OFIA 3ULUC 2FDBP 4Z76A 4TTDC 1LEIA 5FHBL 4U6VL 2P5EA 1KCUH 2Q6WB 2AEPL 4LEOA 4C56A 4DQOH 2W9EH 5E8DL 4LVEA 5C0GA 3WFEH 5I1KH 5A16B 4JFQA 4M62H 3C9NB 2DM3A 2DLTA 4PJFB 4LKCA 3B2VL 2MCPH 3CZFA 2COQA 5HVHC 2UVFA 2IAMB 3FB5B 3NFNA 1HYRC 3RAJL 4MD4A 1F58L 3IAPA 4G9FA 3QG7H 1OVZA 1KXQE 3OAUH 3OF6D 4NQSB 2AJZA 4ODVL 3AXLA 4JZJA 4U0QB 3TJEL 4P46D 2NX5E 1DBMH 2GT9B 4UDUA 3MJ9H 3RIFF 3VG0H 3PGFL 1FO0L 5HYJB 3R0MA 2VDML 4QRRE 3WXVL 1EEZB 3C5JB 1P1ZB 4NKQB 3T1FA 4MA8L 5FM5O 3HI6H 4X5XB 4L3EA 1JK8B 4LHUB 1PLGL 2I60L 3SQOL 4MCZB 3PWNB 3L3JB 2VLRD 4O5LL 3OKEB 2IH1B 2XXCB 4HAGA 4XB8A 3T0VA 3DROB 2VXQH 3NIGE 3G5VB 4OD2A 4S1SH 3QIUC 2ADFH 1X4XA 3BGFB 4YAQB 3WD5H 4Y19D 2B2XL 4YHIA 4UIMA 3BP7A 1I8KB 1Z9SA 2OXHA 4HXBL 1NAKL 3W9EA 1KB5B 2A9NL 1GOGA 2BXYA 5IGXH 1CD1B 5DLMH 3ZDYE 4O02H 5EFIA 3GI8H 1VADA 3OAYH 1R3JA 3H9SD 3UTOA 1MRFH 3ULSB 2QSTA 5H37G 2Y23A 1ZS8A 4X6CF 5CWSA 4EOWH 4QGTA 3ZE1E 3SO3C 3U7YL 3T0EB 2R23A 3HNTH 2VUOA 3MYJB 3EZ8A 5I2IB 1F45A 3HFML 1E4WH 4P23C 2YPLE 3T0WA 1E4JA 3CCHA 5KSVA 3GSNA 4DUXA 5FCUH 4O2EA 5TQ0H 5JQ6H 3RWHB 4DN3H 5E9DB 1BZQK 1QHOA 2P8PB 2DQFB 3WCYA 1NLDL 4M6OH 2AXFA 4PD4K 5ANMA 4WUUE 2BY3A 3GJEA 4HJGA 1OP5H 2AJUL 3C2AL 1GZPB 2NNAA 2YN3A 3IFNL 1DVFB 5E03A 4H20H 4KJPC 1MCDA 4PJEF 4UTBL 1MI5B 1XF3B 4Z7WB 3CVHL 2PCPA 2VDPL 3GRWA 3I6KA 5DZNA 2JJSC 1KFAH 4OLYL 5A3IC 3OKNB 3WXWH 1UWGL 4DW2L 4I3SH 4EUPH 3NAAL 2A73A 1KEMH 3GK8L 3JVGC 4PRPD 2NY3D 1S5HB 5HDOA 4AL8H 4GQ9L 2HP4A 4UT6H 3U0TA 4TVPL 4BH8A 1X7QA 2Z8SA 5IB4B 1DUYA 4XVJH 4DFHA 1QNZH 3O11A 3FN3A 1Z3GL 4HUKB 4JHBA 1O7SA 4MQ7A 1J1OH 5CJQH 1IC5H 3P30H 3MSPA 4LLYB 3ULVE 3NIFF 5ENWA 3HE7D 5DK2A 4F3FA 4B53A 4U6VH 4GJTB 2BVUA 3CDFA 2FB4L 4ODXA 2DI7A 1HH6B 1ZAGA 3UC0L 1PZ5B 4XC3L 5ALBL 5GS2D 2NY4B 4YGVB 2D7OA 5FCSH 2P8LA 3KS0H 2Z92B 3F7RA 5F9DC 2XZZA 5GISL 3B2VH 2LVEA 1T04A 3SBWA 1GGCL 5H94B 4PJ9C 4FQXD 3KDMA 4KKLC 1F8TL 2FJFB 3RAJH 5EZJA 1CFNB 3U4BL 4L3CB 1BWWA 1AJ7H 1AKJA 1OGAA 3C8KA 4HAFA 4ODVH 3TJEH 5IW3A 3ESVF 3CZJA 3P0YL 1QBLL 2YPVL 3SN6N 3N06B 1FYTE 1DQQB 4H8WL 3OB0K 4WU5A 2GEEA 5HYJE 3OPZH 3IDGA 1P84K 2VDMH 5FYKD 5I74B 4LSQH 5EIIA 2A83A 1DBJH 4R3SB 2XY1A 1I3GL 3PXHA 4MDJB 3ZO0A 3WIHH 1EXUA 2B39A 2I60H 3SQOH 1FE8L 1JWMA 3VXRD 1FIGL 4O5LH 3CFIC 1HHHA 3VFTA 4X6DF 2DAVA 3ECBA 3HZVB 1K2DA 4MMXC 3VXNA 5KANI 1GC1C 2B2XH 1B0RB 3PDDA 4GAGL 3L5WA 3MMEA 5E4EC 3LZFH 3MV9B 3C6LD 4HXBH 1BD2E 3EJZD 4QO1A 4Z0XB 4JM2B 1VFAB 1TZGL 4QTIH 1UXWB 3GJFA 4OLEA 4NHUA 3O45B 3O2VL 4JN2B 5A1AA 3CMOH 1EH9A 3A67H 1GAFL 1A47A 1MPAL 1IJ9A 2QV2A 5HY9B 2QEJA 4L4TB 3T0EE 3U7YH 4R7NA 4PG9A 2AP2A 1EERB 1YQ2A 4LRNL 3KVQA 2ED7A 5D1XC 3HFMH 4GRWH 4LHQB 2FHBA 3CH8A 5EZLB 3G6DL 5CINH 4XAKD 1X44A 1XIWD 2OMNA 1EUTA 5D1QA 4PB9L 3AB0C 3OZ9H 5IWLA 1S5IH 3BPLB 1M7DB 4KGJA 3BRFA 2P44B 2G2RA 3LKNB 3EYFB 2EXWD 2Z91B 1NCBH 3OJ2C 4P3DA 1FFRA 5C9JB 2AJUH 1N59A 4MLSA 1TNNA 3C2AH 4PRHD 2GQHA 3F6IA 4XB7A 3IFNH 4NQVA 1MI5E 4UTBH 4Z7WE 1TQBB 4EXKA 3EDDA 5EULV 1G7JB 3MBEA 3QXAA 4OLYH 4WI2A 3VWJA 4QLRA 5I1GL 1JTOA 3IVKB 4X4XA 1D9KD 1G7QB 1YQVL 5HHOD 1UWGH 4DW2H 2P24A 5D7LB 3NAAH 3JUYA 3GK8H 4W4OC 4M3KB 2GJ6E 4GQ9H 3FB8B 3MZGB 4TVPH 5JA8B 5IB3A 1BEYL 1QPPA 4KI5E 2CRIA 1K85A 1U8IA 3TA3C 4LIQL 5EUOF 1L7TL 1V3MA 3IFPA 2OL3L 2XFXA 1AFVL 2FH6A 5BS0A 1NBZA 3FN0L 4HC1L 2WNGA 3T2NH 3QEUA 3SDDB 1UH2A 3CGTA 3DXAA 5EBGA 3KPSB 5IUSA 1JCKA 4FQLH 5DC0A 3TNNA 1KN2L 4XGZA 4J3VA 5I1JL 3VD4A 4TULL 1S9XB 2ERJB 4KPHL 2FB4H 4GUPA 5BMFL 3NCCB 4JRWA 3UC0H 1DBAL 1J8HA 4XC3H 5ALBH 2UWEE 1KJMA 4U1HB 5FB8A 3KNBA 3EZJB 4WCYL 2EE6A 4M1CD 3JSSA 4ZOEA 5KW9L 5GISH 4PLNC 4HUXB 3MRBB 4JB9L 1GGCH 4FP8H 5FO9A 4HV8B 1F8TH 5EU4A 4PTTB 1A1NB 4P5TD 1BBJB 4D0BA 1N7ML 1I3VA 1R5IA 4HJJL 4X7CC 3HI5L 4MWFB 5BRZA 5DQDH 4WU7A 1EGJA 4AMKL 3P0YH 4G7YL 1QBLH 2YPVH 3O6ML 4H8WH 3D87B 3PG2A 2XY2A 3V4UH 5CZKA 3VFOB 4NQXB 2VSCA 4Z7NF 4OTXL 3CC5B 5C0FA 3M8OL 2ITCB 4OJFL 1I3GH 4HS3A 5IR1A 1EFQA 4XP5L 2X4TA 4JZNB 4XP9L 4YHPA 4ELMF 1DQMH 5C86A 3IDYC 4I5BA 1EO5A 1CLYL 1FE8H 4GMSH 5JLZB 4RMUA 4L8SC 4OQ1A 4QHKI 3GIZL 3B9EA 4GAGH 3MV9E 1HDMB 5EU5B 3TP4A 3C09B 2ZSWA 5HDQL 4NJAL 1KIQA 2A6KA 4DKEH 2CD0A 3O2VH 3FT2B 5DF0A 4YXLH 4X7SH 1GAFH 1MPAH 2X4QA 4QNPF 2IQAA 3REWB 2FJHB 4GLRI 2X6MA 5ESVA 2NY5L 4G8EB 5E5MA 1JHKL 1MCJA 2J1KA 4D0DB 4LRNH 4H26B 2HT4C 4PRIB 3G6JF 5CEYA 3QUYA 1TXKA 2IAND 5E0QA 1XF4A 3G6DH 3M1BA 5DC4B 3VXTA 2DICA 4XNXH 1U8HA 4I0PC 4TNVK 1I7TB 2XZQL 5MI0C 1TTGA 1F97A 5A2FA 3OKOA 5ISZB 3ORJA 4F58L 1TTFA 2H8PB 3O8XB 3PWUA 5EO0A 5I15L 2FATL 4CUCA 4TPRL 1I8MB 2EDNA 1IAIH 5DVKA 3QNZA 1R3HA 3KPMB 4LCYB 4QRPA 4RMWA 4ISVA 2BJMH 1FJ1A 4XP4L 5HPOA 5I1GH 5IHUH 3PIQA 5ESQA 4D9QD 3L95B 5D7LE 4EBQL 4WY7L 2R2EB 5HGAB 3TCLA 1LE9B 4L29B 3L7FB 4H5SA 3W81A 1AXIB 3MODL 2WBJD 1SJHB 4BUHA 1J9CT 5D2NA 3VA2C 4MZ2A 5MEPA 4F2MA 5IF0A 2UUDK 4LIQH 1AGCB 4ZUSB 3EIFA 2OL3H 1AFVH 4OZHE 1UQSA 3FN0H 4HC1H 2R2HB 3PJSB 4XBEL 3IDNA 2ESVD 3GSUB 3G5YB 1MWAB 4N8CL 1N26A 1GJIA 2CKBL 2Y36L 3MXVL 1W8OA 3FFCD 1KN2H 1NGXA 1AGEB 3BT2L 4YPGB 5GS0D 2B1HL 1UC6A 4AIZB 2OMBA 1C8PA 1YPZF 2EIZA 1CWVA 3ALPA 5F3BA 3MJ8A 2D03H 4P4RA 4WCYH 3QQ4A 1AR2A 3HB3C 3B8SA 5KW9H 2WQRA 4LOUD 1MUJB 1G9NH 2ZUYA 4U1IA 1A5FL 3SJVA 2JB5L 4FABL 4LSRL 3KYOA 3D39A 3B9AA 5DA0B 1N7MH 4WHTA 5IB5B 5K9OB 3ULVL 1DDHA 3NMEA 2IPTH 3HI1A 4Y4FD 5FIEA 1FZMB 1RMFL 2XWBA 4G7YH 3O6MH 4BSWB 5FYKU 3DMMD 2IFFL 2X1WL 4YK4C 1I9IH 1U92A 4OTXH 5GZNC 4Q6IA 5DMJB 2E27H 5ETUA 3L3DA 1UJ3A 4OJFH 1DUZA 4RAUA 4L3AA 3NCJL 1SBSL 5DD3L 4ZPVB 1QR1B 1DN2A 5JPMA 5SWZD 1ZTXL 4HWBL 3QIUB 4RX4D 3QNXA 4X5WB 3UX9B 1TVDA 4RA0C 5B8CB 5MHSE 3LN5B 2X4UA 2R9HD 4QCIA 5CAYB 4ZFGL 5HHQB 4WIQA 3KPRA 3VXSA 1ZT7B 2GFBA 3M07A 3QQNA 4JCLA 1KC5H 1D5XA 3KWWB 3C5ZB 1RURL 3DUUB 3ARUA 2BVOA 3DHJA 5IMLA 4P46C 2G75B 3ZLQC 3QUMB 3J7HA 2Q7YB 3AGVA 4PFEA 5D93C 1QKZL 1RJLB 2PYFB 4PY8J 4K7PL 4Y5VA 4YHNA 1T5XB 4P23B 2AQ3A 1DANT 5HJ3B 3BMWA 5DFTA 4QXTA 3CFEB 1R5WA 5EDXA 1RUAL 3LB6D 3QULA 4HK0B 1KB5L 1N6QL 3ZTNH 3S3PA 2EIDA 3ARTA 2XZQH 4JFYB 5ISZE 3D48R 3DLQR 2FEEL 4F58H 1UYWL 3VGBA 2B4CC 1DE4A 5I15H 1KJ2L 1QZ1A 2FATH 3L3GB 2V5RA 4TPRH 3QCTL 4OGXH 5CP3A 2ZCLH 4E42A 1IM9A 2DMKA 2EH8L 2IPUK 4PJCF 1U2HA 1KTKE 3IT8D 3MRJA 4KRPB 4RAHA 1I85A 2Z93A 3TESA 1HOCB 4ZS6D 3KPQA 4KHXL 4UAOC 4CAGA 3JXAA 4WY7H 5L0QC 4OF7A 5EOCJ 5T1KB 2FECI 5FGBC 3MODH 4ELKA 4HF5L 5JORB 2X9XA 3D6GA 5JA9A 4NNXB 2DS4A 2FH8A 5TF1L 4POUB 4ZFOB 3IDIB 4WEBL 2E8YA 2P48B 4LL9A 4KUCD 4XBEH 1H3UA 3ULUE 3FTGA 5DSCB 1H8OA 4N8CH 5MEQA 2X1OA 4JY4A 3V8CA 4RGMC 3BUYA 2Y36H 3MXVH 3QQ3A 3H3KA 5J9PA 4ZTOL 1M7IB 3SKNA 4I0KA 3BT2H 1QBBA 3CDYA 2B1HH 2DQHL 5FDWA 1YJDH 1JWUB 3V4VL 5DD1L 3RTQA 5I71B 4PP1D 3ISWA 4OLUL 3BD5A 3MTRA 2HFEA 3O3DB 4R97C 4PJDB 2ICES 3PABB 1A5FH 1TVHB 2JB5H 4FABH 4LSRH 5F7KC 3RDTA 2APTA 2NY3C 3EHBD 3RUGE 1PG7L 4U3HA 1TENA 1LK2B 1V05A 2IFFH 1OY3B 4KXZH 3FQRA 2ZSVA 2XRAL 2FZ3A 4OCRL 3NFSL 2BNRA 4YDVB 1J86A 3Q2CA 1FFOB 3O41B 2VERN 5F21B 3HE7C 4Y2DD 2XQYG 3ZE0F 2VLKA 12E8H 3WL9B 5DD3H 1WFTA 1N5AB 1EAJA 1S3KH 1W8NA 5LAXA 3UTSE 1FN4A 3V7MA 2QQQA 4PP2B 1ZTXH 1V5JA 1AY1L 4NUJB 5DFWH 2NTFA 3BOVA 1OTTC 3H7BA 5IIEB 1DLHB 2PW1A 3R06A 1IAOA 3DX9A 1EEYA 3UTPE 3GM8A 1VEOA 4ZFGH 4IOFD 1RV6X 5E6IB 3RVVD 3FOMA 4FQXC 3FCTB 4MJIB 4YFDB 2XTLA 1RURH 4NHCL 2YSSA 5SWQB 1IBGH 2LVCA 4IRSD 2IJ0C 4NWUL 3UP1A 1MLBA 1FHGA 1JI1A 5IB2B 3I50L 4YFEA 2N7BA 4K7PH 4LARL 4WV1B 5FUCC 5IW6A 5ICYB 2HRPL 4XCYB 4GKZA 1CE6A 3H8NA 3QI9A 4ORGA 3OGCA 1KLUA 1D5ZA 2XNAB 3KPLA 2V5TA 4Z7UE 4V1DD 2W0FB 3IJSB 3MLTA 5HI4D 4KROD 1UYWH 2ZUQB 5FKPB 1KJ2H 1SY6A 4IOIA 5JXEA 2W0KA 3QCTH 2JIXD 3C6LC 3EJZC 4PGEB 3MO1A 1BQHG 4JQXC 1SMOA 1JUFA 3SGEI 3DV4B 4FMKA 4KHXH 4JO4H 3GBNH 3H2WA 1I1FA 2V2XB 3QISA 1S9YB 5C08B 3E6HA 2YWYA 4NQDB 1UT9A 1MFAL 4PB0L 5FGSA 2UUDH 1ZA6A 3IDJA 4JGUA 4KAQL 3P9LA 1YEDA 5IHBA 3M45A 2G5BA 3ARWA 3VFMA 4HQQL 4FNLL 1BJ1J 2VC2L 5TH2A 1UB5B 3DSNA 4Y1AD 2F9BT 1B4RA 1A7OL 2NW3A 4K7FB 4M7LL 1RZGB 3MRPB 1A7QH 2V9TA 4X7TB 4JRYA 3S4SG 1P4IL 4PJAA 4KZDH 5IOPA 2HJLA 4ZTOH 4YHZH 3FO2B 4JKKA 2EXWC 4U1SB 2DQHH 5GZOD 5GS1C 3V4VH 5DS8A 2QL1A 5E8NB 3VFSA 5EOTA 5HHPA 4NYLB 5FA3B 2J5LC 5A2LH 4ZTPL 4Y89A 3T77B 4M6AA 4B7IA 5JW4M 3HG1A 1WAAE 5DHVB 4PJDE 4WWID 3L3IB 4DZ8B 3IKCA 2BCKA 9CGTA 2WWMD 3VGGA 1NJ9B 1D9KC 3FFDB 5IKCB 3TBTB 4PRDA 1PG7H 4ZUVB 2FX7L 3EDKA 4QOKD 4YWGL 2DB8A 3S5LB 3Q3GB 3GSRB 3EOAA 3HE6C 2WWKT 3B3IA 3LN4B 4CMHC 4ZYKA 3CXHJ 1V3LA 2BVQA 5DHYA 2XRAH 3GMOA 4OCRH 3NFSH 3V6FB 1PJ9A 5KS9F 3L9RA 2R69H 4F15C 1MVUB 3D1MC 4ZUTB 4DVBA 2VJXA 3IDYB 5IVNA 3BKML 4P5MA 2CXKA 4R0LC 1U3HA 3U0PA 1KN4L 3U36A 1AY1H 5C8JA 1NSNL 1URLA 5CKAA 4U3CA 3K4AA 3MRIA 4CDHA 2EDEA 4M1CC 1S78C 3DGCR 4I9WE 3X14A 4HS8L 3RWDB 2DJSA 4JFFD 3VWKA 4GRLD 1RZ7L 4PV9B 1LNUB 5KVGL 1NGQL 3MOQA 2ED9A 2A6IA 2BSRA 5F1SA 5F3HB 4HIJA 4MXVE 3MX0A 4NWUH 1EBAA 3VXUE 1J0JA 1C7SA 2PF6A 3I50H 3DURB 1Q8MA 5K9QI 3OTTA 3RHWK 5IEHB 4RIRB 2OJZL 4HZLB 1U3JA 1X5FA 3DV6B 1MCIA 1MCFA 5JUEH 5J89A 1N0LA 4ZODA 1CXLA 4XWOD 3GHEL 2DL9A 1NBYA 3KGRA 2VDNL 5E8PA 4DKFL 2QLVB 4G6FD 3VU2A 2CLZA 2OZ4A 4I0PB 3SGKC 1X6LA 5MI0B 3U6RB 1TVBB 5TDPA 2PO6A 5DUBB 3NPZB 4HXAH 1NLBH 3THMH 4XNUH 3GSQB 5HGHB 3N1GC 3P9MA 1S7VB 4Y0GA 1MREL 1QLRB 4E9LA 1JV5A 3G9VA 5LGKA 1JGUL 2F8VA 2W9LA 2I5YL 2V6HA 1QLFB 3S37X 1QP1A 3UZEA 2I07A 2W9DH 2H32B 4R8WL 3WHXA 3NIDE 4Y8AA 4NPYA 1F11A 5C08E 4NQEB 4NQDE 5MENA 2XN9E 1DFBL 2DKSA 3G5ZB 3DSFL 2X4OA 4PB0H 1LP9F 2DYPA 3SGJC 4KAQH 4Q58C 5C0CA 2N56A 2J6EL 4HQQH 4FNLH 2VC2H 2JELH 3QA3B 3FMGL 4LLQB 5C09B 1DBKL 2AJXL 4KVCH 1A7OH 1FG9C 4M7LH 2J8HA 1Q9WB 3CFCL 4JHAL 3ARDD 3LKQA 2HJFA 3VFVA 1P4IH 1JPFB 5GHWH 2GJJA 3O3BA 2X1XR 1SJEA 1K6QH 1R3KA 5F1NB 2IQ9L 2BY2A 3MRDA 4E41A 1YN6A 1GHFL 3DRTA 1IGML 3MLVL 3KYNA 2DBLL 2DLFL 3T04D 1YY9D 2RIKA 3GSVA 2EC8A 5GGTH 5I1HL 3Q5OA 2X41A 5D5MA 2EO1A 5H35B 4HFWA 2ADGA 2HKFH 1XAUA 3O6FA 4GS7B 3KXFB 3U7AA 5ACZB 3K4ZA 2WBJC 4ZFFB 1IEAA 1A9BA 3K2MC 4NFCA 5JHDA 4OLXL 5BOPA 4CVXB 1BOGB 1S7TB 5B22A 2ICCA 3HC3L 3IGAA 5SV4A 4ONHB 4W6WB 1U95A 4OCSL 1YECL 5KAQG 1JP5A 5CD3B 1H9VA 1LEKA 3TBSB 2F54D 4MMZC 4U1MB 2Z8VC 1ZHLA 1MCOL 3BKMH 1NANH 4OLZL 1FO0A 1EZVY 3TGXA 5IROA 5HTSA 1NSNH 3MR9A 1P7HL 2Y07L 4A2LA 1E28B 1HI6A 1NEZA 1BHGA 3MREB 4LOUC 4HS8H 3IETA 4WO4D 2AXHA 1CGYA 1RZ7H 5KVGH 1T89C 3D85D 3NCMA 4U1NA 4X6CB 4EIZC 2J8UF 2UZIL 4DJMA 2R56L 2MWCA 3TF7C 5F7DB 3QEQA 3U2SB 2ARJB 1A6TA 1JN6B 4PJGA 5DTFB 3DYOA 3PXJA 2FR4B 4JJHA 4FMFA 1T7XA 5D4QA 1UCBL 1E6JL 1M05B 1OSZA 4J6RH 2APXA 2AXGA 2E5EA 2GTWA 2OJZH 4OLVL 5B39A 1FFQA 2ICWJ 1ZHKB 3LH2L 5GXBB 1K8DB 3GHEH 4UV7H 3TN0D 2VDNH 4FFZL 3QBTB 4DKFH 1B6UA 4F7CA 2FSEB 3TBWA 4LKXA 2HLFD 5CD5D 2VLRB 5E94B 5HVGB 3VMPA 3H42L 1HIML 5JOEA 1TQCC 2X40A 2ZNXA 4PJHA 2X70A 4GSDL 4PJEB 4Y19B 4YZFF 5LBSL 4NRZB 4IIQC 4K55A 3OJDB 3CFBA 2PYEE 4K9EL 2R9HC 1F3RB 1KIUA 2FO4A 1A4JA 3EO1A 4Z7QF 4KRMB 1ZLVK 3ZL4L 1X5JA 1JGUH 5DEGB 5JMRA 3RWGB 4F33A 1KSRA 4R8WH 2LABA 1F6AA 3U79A 3VD3A 4XNQB 4NQEE 5L0QB 2OP4L 2CIIB 4TYUA 2W38A 3DSFH 3GSXB 3QFJD 2X89D 2ZUVA 3CVHA 4K71C 4RMQA 4U6TA 2VQUA 3I6GB 2J6EH 2GAZB 1DBKH 4WUKL 1T0NB 4RCAA 5D7IA 4JG0L 1QEWA 1CL7I 2YA1A 4JFDA 3LB6C 1R5VB 3CFCH 2EE3A 2FWOB 4M1GL 4CNIA 4MA1C 5CJXC 3QZWG 2OSLB 2Z31A 5F9AC 1PY4A 4GAFB 3VRIA 3WHE0 3QUXA 2YK1H 5AWNL 2OR8A 5GS3A 4LP5A 4NO0D 1OF2A 1T1YB 1AIFB 1T22B 3AS1A 2IQ9H 4OUUA 1P69B 4GQPH 4K94C 3DIFB 1IGMH 3P73B 5EC2B 5EC1A 2DBLH 2H41A 5BQ7A 1MRCH 2DLFH 1KGCE 1VCAA 3MQIA 1HCVA 3NZ8A 3QAZC 4R97B 4C59B 4ZS6C 3FKUS 5IQ9A 1NC2D 3BVNB 5IK3A 4NKMB 4QHNA 5I66B 4DGYL 5TDNA 4PRPB 4F9PC 3W39A 4BZ1H 3KXFE 3INUH 1B4JL 4WWKA 3V7AE 4RFNC 2WM0A 1LEGB 4ENEC 3A6BL 4AIXA 2NY2D 3JWNC 3O3AA 4HMCA 5EO9B 4NFBA 2BSTB 3HC3H 15C8L 4C56D 1KJ3L 1YECH 4GG6F 3GSWB 2QSVA 3MLUH 3BKCL 4NM8H 5GGSB 4X6DB 4YDKL 1NGYA 3GSOB 3TH4T 1WT5C 1N5YH 1BIHA 2MKLC 5DMGD 3MUY1 2Y07H 4K23L 5EU6D 1LDPL 4L3EB 4PP1C 5EBMB 3RKDD 1MHEA 1WTLA 4MX7B 1SYSB 1G0XA 4FQ1L 4S1DD 4FQXB 5C07D 4KKAD 2BMKA 4X6CE 2VTFA 5H37H 3PHOA 2UZIH 4PLJD 1T20A 2R56H 3EHBC 1J1PH 4PJ7F 3WJLC 3FQUB 1UCBH 1E6JH 2LTQC 4KJWD 1QO3B 1JF5A 1KJVB 4OLVH 1GGTA 2IH3A 3LH2H 4RGOL 1OSPH 1GC1L 4WI3A 4X4ZA 4HGKC 5J1SC 2NW2B 4CGTA 3ROLA 4Y2DC 1F4XL 2XICA 4XAWH 1CR9L 4NKOB 2VLRE 3LCYA 3VXRB 4FQHA 3H42H 1HIMH 1XCTB 5DEFB 5F6HJ 4O4YL 4PJEE 4Y19E 4GSDH 4P2OA 1U8KA 1BF2A 5J4MA 1NQBA 2AV7B 4PBVC 3Q1SH 2ZOLA 4HGWA 3WMSA 1LD9B 4K9EH 2IGFL 3C6LB 4IOFC 4CJ1A 3PWJA 4NO2B 1T21B 5T3ZL 2H1PL 3ZL4H 3AREA 2G5RA 5D7JC 2BRQA 3H9SE 2WIIB 5E2TL 2GCYA 4YR6B 3U83A 2VLJD 1JF1A 3KAAA 1GVIA 4HJGB 4IRSC 3OR7B 1UKQA 3WN5A 2OP4H 3JZ7A 4GRWF 4MAUL 1L9MA 3VD7A 5EUOB 1D5BA 3WLBB 2EEDA 2B5IB 4X6FA 4LGPB 3SKJH 4LDEB 4GKOA 5GRYA 2YC1B 5DJYB 4OM1H 5I8KH 1IGCL 1AO7D 1U0QA 4JFOA 4OGZA 4AT6A 4OI7A 1XIWB 3VXPA 3GFUA 5DJCB 2QKIB 4M1GH 3V4PH 3U0TB 2FO1A 4XI5D 4XP1L 4MHHI 4P2RB 1Q1JL 4FG6D 4QWWD 5F7EH 2CK0L 5JQHC 3MLYL 3IJYB 1I3RA 3HUJA 4KROC 3OKDB 1CFSB 1JGLL 3EBAA 3UBXA 1QACA 1Q9OB 1BAFL 1CLOH 2AABL 1NKRA 2NR6D 4M9PA 2HG5B 1KCRH 3OBAA 1F90L 3HAEB 1HHIA 2AXJA 4U1JB 4ODHH 1FC2D 5DJ8A 4XBGB 4QYOB 5A40E 3B4NA 3PV6B 4G8FA 5HHOB 4Q2ZB 1HYSC 4PRPE 3ARBA 5JDSB 2VDKL 4MCYB 1KCVL 4RDQF 4PPTA 1FVCB 5IBUG 2HTLD 1XCQA 1UWEL 2HJKA 5BV7L 3QDMA 1AP2B 4JPVH 5A43C 1W2KT 3VXOA 4IMLA 4PY7A 1BBDL 1WCQA 1G7MA 2E8ZA 4OFVA 15C8H 5IEKB 1W72A 3MV01 4X6BA 1L0QA 3ES6A 4N5ED 4BQ6A 1FNEB 4ELMB 1JPST 5C6PB 4NN7C 5DDHB 5MEOA 4LLAA 2H2SD 4G42B 4M3JA 4APQD 5IJKA 4JRXA 2YRZA 3MACH 4YDKH 4R0LB 1EFXD 1MCWM 4GMTH 1HWGB 3BKJH 5B3JF 3VCLB 1TJGH 4PJ8A 4K23H 4OKVA 1C5DA 1LDPH 3JWDH 2C3WA 3JTTA 3CU1A 1OGAD 4FQ1H 4EDWH 3MJ7B 3TVMD 4U6YA 3BESR 3G9AB 2BNUB 1JNHB 3L5JA 5DRZB 1CGUA 2WWMC 4X4ME 3F7VA 4JPKH 4M6NL 3E0GA 4LCUB 4P5TB 4YIQA 5IMOA 3VFTB 3LAFA 1JPGB 4HPOL 2LQRA 3VGAC 1HHKA 3L5WB 5I73C 2PW2A 1LHZA 1MQ8A 4R26H 3G6JB 5TE4L 2NX5A 2WLYA 1BLNA 2OTWA 3GJFB 5FYKE 3SCMA 3I9GH 1E4XL 4QRRA 1CFQA 3OKKA 2FL5B 1B0WA 1ZT1A 2NZ9D 4RGOH 1MJJB 4WW2C 1G0DA 3LKSA 1HNFA 3CFKB 3FJTA 2DN7A 3VXRE 5TJWK 2NPLX 3AFLA 3X13B 2WBWB 4NNYA 3GMNB 3PWPD 4Y4HA 3GZKA 4K8RH 1KT2A 4H0HB 3RVWD 2HKHL 1LVEA 1ZLVH 5D1QB 1F2XK 4RBPH 2MHAA 5T3ZH 4GRLC 3O2WH 4JO1L 4H25B 3SDXF 5E2TH 3H9YA 4ODBD 3RY4A 5HYSB 1PBYA 2A6DB 4OFDA 5EN2B 2AW2A 4OF6A 3U9PH 1FV1A 1ORSB 5DJ0A 4C4KO 5GGRB 1IC1A 3DX6A 5LGJB 2CQVA 4XX1E 4JQVC 1VSCA 1RU9H 2AAVA 3U9UA 3S5LG 3QUZA 2YUWA 4CN1A 4XWOC 3RNKA 4X8JB 1XGTA 2IANB 4XAKE 1IGCH 1NGZA 1ED3A 3QDAA 4OM0L 3EYQD 2OTUB 1BVLB 4B7LA 5KTEL 4G8IB 3AM8A 5IB3B 1NFIA 4XP1H 5INCB 1SM3H 1YPZB 4P2RE 2HFFA 1Q1JH 2DOCA 2OI9B 2CK0H 3MLYH 4WUUA 4XZUB 5I1DB 4YJZL 3UTTD 3TZVA 5EORL 4PRHE 1J12A 3VWJD 1XGQA 5F97E 3SDAD 4MLIA 2LU4A 4NRXA 3LN9A 4PRBB 3KPOA 4HMEA 5F9JB 1BAFH 2JTDA 2AABH 4ETQA 5CEZE 2P5WA 2DMCA 2CKBA 1F90H 3BZEB 4LU5L 5SWSD 3MLPA 2KDGA 2VB5A 3IU4L 2C4XA 5HHOE 5AG9A 2R8SL 4GOSA 2R1YA 4Z7NE 2EECA 4NQCD 3UDWC 5E1AA 3ZKMD 4BQ8A 4N0FA 5BV7H 3V52L 3RWFB 3DXAD 3VMNA 1E27A 1HQRA 4AYFA 4ELME 3PGDA 1R5IB 5IG7B 3ARDC 1J8HD 5BRZB 3BRGC 4PRNB 1EUUA 5EPMB 3FFCB 2W65B 3IDMB 3NBNA 3HCVB 2XQYK 4PRAB 1XF5B 2IMNA 1NFDE 35C8H 4FHBD 2Q6WA 4LCWB 4PR5B 2A77L 4CU6A 4HULB 4JFEB 1W0WB 2JKXA 4F7EB 5A16A 3C9NA 2ZG1A 3IJHB 4PJFA 2CDFA 1IKNC 5DUML 4YHPB 2D9QB 1UFUA 5GSVB 2IAMA 2Z8RA 3HTLX 4QNPE 5KSAD 3GBML 4M6NH 4HWBA 2BP3A 3W11D 4HPOH 4NQSA 3UZQA 3WNPA 4Y4FB 3VDBA 2A6JB 2E9BA 3QIWB 3NH7L 2GT9A 3FAWA 2ZJSL 1FYTA 1FFNB 1MCEA 1AC0A 1AGDB 3DMMB 4LQFL 5HYJA 4OLWL 1IL1B 5C2BL 1E4XH 1BOYA 1EEZA 4HMDA 4NWTL 4RFOL 5C71A 1P1ZA 1NAMB 5DC9B 4IEFB 3CX5K 1W72H 4X5XA 1JK8A 4LHUA 4WFHE 1AR1D 3FRPA 3BYTA 4HUVB 4MCZA 1L6ZA 3PWNA 3L3JA 3OKEA 2B20A 2IH1A 5LVEA 3DROA 4ZO8A 3G5VA 3EDJA 4YAQA 3QUYB 4IIQB 5F88B 2R0LL 4PJCB 3D0LB 1I8KA 2HKHH 4ZD3L 4HH8A 4GBXD 2Y5EA 1KB5A 3VXMD 1CD1A 4UDTB 2HH0L 4WO4C 5F7WC 2MKWA 4HCRA 3OKOB 1CXKA 5GJSH 3WDIA 5T5NF 4HUUB 3ULSA 1AI1L 1SEBA 3ARQA 4AEEA 3UCRA 3WJJC 3NIGF 3T0EA 4IMKA 3MYJA 1S8DB 5E5UB 5I2IA 2ZG2A 2B4CL 4WTZA 2VR4A 4OCNC 2IANE 5DMKB 3MCG1 3ZDYF 4NC0B 3TN0C 5LCVL 3MV8D 3RWHA 1BVKB 4OM0H 2HLFC 2P8PA 3QEGL 2DQFA 5CD5C 5KTEH 2DIJA 1OTUD 1YPZE 1LO5A 2FHCA 5E2UL 5MEPB 4F2MB 4GG8B 4DEPB 3PUCA 2R4RL 2F58L 1NDGB 3KG5A 1GZPA 1DVFA 1L4IA 1QFWL 4XXCA 4LAJH 3SDCD 3BPOC 3BRDA 1MI5A 1XF3A 3DO7B 4Z7WA 1EAPB 2GY7B 4NOFA 4H1LB 4N90D 4LU5H 1S7QB 4XPGL 4FZEL 3OKNA 5EOCL 1B0GB 3LVEA 2EIZB 1RZKC 4MNGB 5JIPA 4YHYC 3V0VB 1S5HA 1GGUA 3DRQB 1OQXA 3ALWA 3DX8B 2CDEB 5I30L 4A2MA 5IB4A 1Y18B 3V52H 1S7UB 4MNQB 2B8OT 5IESL 3MRRB 3KYOB 4WI9A 1KELH 1GIGL 4LLYA 2RJMA 4HG4J 3SQBA 5FM8A 3FFCE 5KZCB 4E0RA 4LCWE 2J7LA 4JFEE 1HH6A 2A77H 4BJLA 4NZTL 1QR4A 1PZ5A 3LKOB 5GGVL 5I17B 1X5KA 4YGVA 1I9EA 3RNQB 3SJVD 4WI6A 2Z92A 3HZKA 4JO2L 3ZSSA 5DUMH 5H94A 5CMAB 1T83A 2FJFA 3OX8B 1CFNA 4L3CA 4N5UA 5JMOC 4X7EC 4ZG1A 2BRRL 2AEQH 3D2UD 1IRAY 4OZFB 3MA7B 5JNYB 3F6LA 3NH7H 4S0SD 1DQQA 5KOVC 2GFBB 4LQFH 4G6AD 4LSVL 4UNUA 2NY2C 4OLWH 3CXHK 4M1DL 4NWTH 4RFOH 1JL8A 4R3SA 4HSQA 4MAYB 5TE7L 4MDJA 3CVIL 3SOBL 4Y2DB 3QXDB 2OCFD 4QHUA 4R4BB 3B83A 4LLMB 1FG2B 3L1OL 1EV2E 5GSRB 3RWJB 4TSCL 2BSED 5F71A 2A0LD 3VXSD 3WDHA 4HT1L 5DMGC 3U30C 4PJCE 4HWZB 1B0RA 1H3PL 2R0LH 3VG9C 4L4VD 2AK1H 1IQDB 4IRJD 1IEBB 2JCCE 3RKDC 1KUMA 4LLDB 3MV9A 4ZD3H 2H26B 3NCFB 4JM2A 4JZJC 4M5ZH 1VFAA 3ZYIA 1KIPB 1UXWA 4Q0XL 1MHHB 3O45A 4KKAC 4JN2A 4XHQA 3UJIL 4N1HB 4YXHH 1MAML 4Q9QL 4WI4A 1AI1H 2CO6B 4PLJC 4IRSB 25C8L 3O2DL 2BDNH 2IMMA 4L4TA 4E42B 4JFPB 3B9KB 4KJWC 3NPSB 3ZKXB 2OR7A 4FFYH 2FX9H 1ZHBB 1NC4D 4TNVF 5J11B 2HLAB 2B4CH 4KVNL 2CSPA 3CK0H 3QO0B 4MD0A 5EB9A 5EZLA 3JV6B 3S3SA 3GI9L 5LCVH 3A6CL 4M93B 2PTVA 4DOHB 4KXZI 5E2UH 2IPKB 5IFHL 1IM9D 2VZUA 1M7DA 3HR5B 1A7PL 3LKNA 3EYFA 2Z91A 2R4RH 1Z0MA 5C9JA 1XR8B 1QFWH 5L8JB 4Y16D 3SE9H 5ELIA 5J9PB 4HIEB 2CRZA 1G7JA 1WC7B 1Y6NR 1BREA 1A3LL 5F96L 5GQBA 3X11B 2RR3A 4XPGH 3IVKA 4FZEH 1L7IH 5EOCH 1G7QA 5D7LA 1A64A 1P5UA 3FB8A 3CFJB 3BIAX 2RAMA 5A2KH 5I30H 4I2XB 2O26U 4MNQE 5BZWB 2GHWB 5IESH 5KS9B 4LPCA 3L5XL 1RJCA 1IT9L 5C0BD 3ZE0E 5CIPH 3MFGB 5C0RH 3LMJL 4WNQB 3SDDA 4NN7B 1AHWB 1GIGH 5INDB 2FJGB 3KPSA 4P9HC 2Q1EA 1WQVT 2D9CA 3H3PH 4XI5C 4CN6A 3O4OB 3K7UA 2AEWA 1S9XA 4FG6C 4QWWC 1X5GA 5IV2A 1A6UH 4Y4KB 5C0ND 1CTOA 4N1EA 2VXSH 4NZTH 3FQWA 1RHHB 3WLWD 4U1HA 5I8EB 2VL4A 2NR6C 4LMQE 4JO2H 4HUXA 3RDTD 3MRBA 3Q6GL 2DMBA 1FN4B 2FEEI 4HV8A 2QQKL 5ADOH 3G6AB 1A1NA 1BBJA 5E70A 2UYLB 5DD0H 4AENA 4MWFA 5I73B 1FH5L 3MV7D 4QOKB 2V7NA 3OG4B 1ZVSB 1HZHH 5C70A 2JE8A 5JW4N 2UWEF 3VFOA 4NQXA 2CUIA 4LSVH 1RVFL 2DQJL 2OQJB 1IAMA 2NY6D 3CC5A 3S34L 4M1DH 5I9QC 4LAQH 2CMRL 5AAWA 5CUSL 3RVTD 2ITCA 2XWJB 3AY4A 1HSAB 5TE7H 1BFTA 2CUHA 2H2SC 4APQC 3CVIH 4JZNA 2WUBL 1VGEL 4YFLI 2BK8A 3O4LB 2KQNA 3L1OH 4IJ3C 4TSCH 3SBWC 2D3VA 5JLZA 3IRZA 1QG3A 1BZ9B 4HT1H 5IW6B 4PGDB 1J1XL 2XZCL 5D2LE 4AH2B 4R9HA 4A6YH 1H3PH 1ZLWK 3KJ4C 1HDMA 3O0RL 5EU5A 5DEZA 4JFFB 4BFIB 3TVMC 1IMHC 2VZVA 1U8OB 4Q0XH 4EQ2A 2BC4A 5F9WC 2VIRB 1F4HA 1MAMH 4Q9QH 3FT2A 3HAEG 4ZXBB 1E4KA 25C8H 4WHDA 2VXUH 1LP9B 3HZYB 1SQ2N 2PR4L 4M7JL 4Y5XB 3REWA 2HWZL 2CR6A 2FJHA 3T0DA 4G8EA 2PNDA 3VW3L 1FSKC 2M8XA 3I2CL 1NGPL 4D0DA 1QTYT 4H26A 1JUFB 2MJWA 2GK0B 4XPBL 4PRIA 2NZ9C 1F5WA 5ITFB 1D3CA 4AG4L 4ZAKB 3GI9H 3BWAB 1HINL 2Z4QB 4JR9L 4NN6B 1XZ0B 3PQYB 2DJUA 4DOHE 1R3LB 4XBPB 5JXED 1S7XA 3IDJB 1I7TA 5FV2A 3IFLL 5IFHH 3MRCB 1BJ8A 3UJJL 5ISZA 1UZ6E 5TH2B 1A7PH 2H8PA 3O8XA 4HKXB 4IDLA 1TMCB 2F8XC 1WBXA 4NKDB 1I8MA 4U1LB 4YDJB 4G9DB 5C3TA 4R96B 1VDGA 3KPMA 4LCYA 4K3DL 1YNKL 1FNSL 5F96H 1T2QL 3RVXD 2AV1B 3ARFB 1KEGL 3L95A 4EVNB 3FB6B 3H3BC 5HGAA 2R2EA 4L29A 3L7FA 4HS6B 3E3QC 1SJHA 1BJ1H 5LXGL 4JRYD 4Y1AE 4OIAA 1AGCA 3TBYB 5KS9E 3MRMB 1ZXQA 5IWLC 4URTB 3BKYL 3L5XH 1IT9H 3PJSA 1KLGA 5TDOA 3G5YA 1MWAA 2D7MA 4B50A 1UVQB 4LVNC 2WQ8A 5T5FL 1FGVL 1AGEA 4YPGA 1G9NC 4AIZA 1JFQH 2E7LA 3VWJC 3EFFB 3SDAC 4KV5F 3VRJA 1KXVC 3RGHA 3V6OA 2RB8A 1VPOL 3KR3L 4KHTL 4OZHF 2V5YA 2J8UB 3Q6GH 1FDLL 1MUJA 1WIOA 3FL7A 2LE9A 5T1DL 5JIIA 2QQKH 1N3NA 4J8RB 1OAYL 4YHKH 5IB5A 5HYSG 5K9OA 5C6WH 4Z8FH 1QUNA 4QOKE 5CSGA 3RUGA 1FZMA 3C5SB 5HHNA 4BSWA 3VA6A 1RVFH 2D7PA 3FHAA 3L3HB 1J10A 2BHYA 3S34H 4TUJB 2A6IB 4MJ5B 4XC1L 5CUSH 1U3HD 3FHQA 1F13A 2O5YL 4P57B 3HPLA 1VGEH 4BM7A 1QR1A 3O4LE 1BGXH 1SVCP 3O9WD 3PP4L 2YD8A 3QIUA 4X5WA 4D0CB 4UOJA 3QXWA 2D31B 3GB7B 5B8CA 1J1XH 4P4KB 5DWUH 4IBLT 4G6KL 5HHQA 4JFFE 2CLZB 2UZXB 2VSDA 4WO4B 2BVPB 5ALCL 1MIEL 5HGGS 2EDQA 3KWWA 5D1ZB 3C5ZA 5KSAC 4HKZA 1NGWB 3DUUA 1UCTA 4PLOB 2PO6B 3NGBB 3BD4A 3W11C 3KPPB 4Z5RB 2EDKA 4AEHL 4ZSOB 3FN9A 1LP9E 2G75A 2DD8L 2MFNA 3WO4C 1YN7B 1QBAA 1EVTC 2PR4H 2Q7YA 4M7JH 1ZGLB 2HWZH 3QXTA 1UH4A 1RJLA 1JV5B 2PYFA 5KVDL 3MROB 3C08L 3VW3H 1FGNH 2MQ0A 3I2CH 1T5XA 4KKNA 2J2ZA 4P23A 4XPBH 5DQJB 2F53B 4NBYB 3L5IA 2QHRH 1DZBA 1HINH 1AR1C 4GW4A 4JR9H 3D3VB 4HK0A 3CLFL 4TTGA 1MNUL 3BDXA 3PQYE 4OIBA 2DYPB 4JFYA 3UJJH 2CIKB 3EOTL 3S8WA 5E4IA 1A0QH 2Q76B 1QRND 2CPCA 3L3GA 4KH2A 1IGFL 1CGSH 3JBG7 4EUPB 3OWEA 5J06A 4U1KB 4ORZC 4CVZB 2DQTH 5FDYA 1KPRB 3TT1L 5E24E 2PTTB 4GBXC 3S35X 1ZANL 2P46B 3RGVB 1NANI 3JV0A 1PD6A 1TZHA 1HOCA 3BIKB 2XIDA 1R3KB 1T2QH 3TC9A 4YHYB 1ZOXA 3JVGA 2X4RA 5IQ7L 3GNML 1OPGH 5AEAA 5T1KA 3HMXA 3TYGL 4UILL 5ID0B 2EIEA 2UY6A 5JORA 1UM6H 4JKWA 1SEQH 5LXGH 3MOAH 2WUCH 4NNXA 3RWEB 4GG6B 5H2BB 5ILTL 2EICA 4ZFOA 5D9SB 4EKXA 3IDIA 1YJDC 3BKYH 4K94L 4RAVB 2LV4A 5J56B 5DSCA 2DQEL 4XPAL 2LAGB 1NBQA 2FGWL 2DF3A 1OTUC 1BF8A 1NCWH 5T5FH 1FGVH 3VRLE 1M7IA 4UT9L 1G7HB 1OAKL 3LHPL 1XR9B 4DK6A 1JWUA 1TDQA 2V5MA 3ARVA 5SX5K 3RX8A 3K0WA 1LEKB 4HX1B 2NXYD 5BO1H 2E7BA 1A1OB 1A7NL 1VPOH 4KHTH 2J8UE 4XCCL 1WAAA 3O3DA 4X4YA 4PJDA 1NC2B 4XH2B 4ZMAT 3PABA 5T1DH 1TVHA 4PJ7B 1CLZL 3L6FB 3MR9B 2P4AB 4RGNC 4L8BB 2XTJB 5EZOL 1WJ3A 4U0RC 2BERA 1IKFL 4RRPA 3U7WH 1WIUA 4U1NB 3NABH 4JHWL 3DJ9A 4XC1H 2ZCHL 3R1GL 4YDVA 5J12C 1K8IB 5KOMC 1FP5A 3O41A 3QEQB 4JPIB 3DUSB 5ESAB 3F12B 1F6FB 3VFPB 1OSZB 3GHBH 4YZFE 1N5AA 4XPHL 4WTWA 3RUGF 5K9KB 3TBVB 1JBJA 4PP2A 3PP4H 3AUVA 3LQAH 4NUJA 4YDLC 4NQUA 1ZLWH 3U30B 1XGYH 4JQIL 4Z7QE 5EU6B 1DLHA 4X99A 4G6KH 4O2FB 5E6IA 3EYOB 4GKNB 1J0YA 3R8QA 1U8MB 3FCTA 1MIEH 4UINL 2Q86B 3RHWF 4GRWB 1GXEA 2X70B 3TM6A 2EDFA 5SWQA 4ZSOE 4S11A 4AEHH 1RK1B 1MLCB 4Q6IC 2H2PD 5IB2A 1WIPA 3N85H 2C3VA 1FCGA 5FM5M 1UJ3C 2D4DA 1CZ8L 2FD6L 4MSWA 2ZWLT 4BKLB 5CS7A 5DZLA 3C08H 4G6AC 4WV1A 3SKMB 3QT2A 5B21A 4PJ5B 1VESA 1Y0LB 2ZKHL 5ICYA 4XCYA 2F53E 1RIHL 2HFGL 4M03A 3ZE2F 3LS4H 1ACYL 2VZ1A 3QH3B 5FOBB 1MNUH 2XNAA 3TH3T 3CVHB 3TPUA 2W0FA 3IJSA 2A9ML 2A0LC 5FKPA 3C8DA 3EOTH 2YXMA 1M1SA 2AK4B 2E6QA 2VZOA 4IRJC 1IGFH 4D9RD 1EDQA 4YX2H 4LSPL 4PGEA 1KCKA 1ZANH 1RIUL 5E2JA 4KMLB 2F5BL 1CDHA 2VLJB 4PYGA 3DV4A 4Y5VC 3T4AA 4N9GB 4WFED 4AEFA 4Z7UF 1HILB 1U3YA 3WFHB 2V2XA 5C08A 1S9YA 4HIHB 1W0VB 1DQDH 3GNMH 4NQDA 6FABL 3QFJE 3QUMH 3TYGH 5BVPL 3F58L 4P3WA 4FQJL 4YBQD 4X8XA 2VISB 2Z31D 5ILTH 1UB5A 3U82B 5JO5B 1AO7B 4OF0A 4K7FA 4Z77B 4K94H 1J7VR 3OKYA 2EKSB 4X7TA 1H3TA 2RBLA 4XPAH 2FGWH 3UTQB 2ZG3A 4UT9H 1OAKH 3FO2A 3VFRB 3O3AB 1ZGLP 4U1SA 1I85C 2NXZB 1CDGA 1CT8B 5E8NA 4Y16C 1A7NH 4NYLA 5FA3A 5MP6L 1Q94B 1TPXC 5DHVA 4XCCH 2C1PB 1JNLL 3L3IA 2BHZA 4DZ8A 1MFNA 3WIIL 5IHLB 4WWKD 4PJ7E 4UT7L 1CLZH 3MJ6A 3FFDA 4JREC 3WNLA 1FBIH 3H0TB 2FEDD 3TBTA 2NLJB 1ZLSL 5C2UB 2JJVA 5GIRB 4OQTA 4L8DB 3MGAA 3B6SB 4ZUVA 4KK9D 3GSRA 1JPTH 2QADD 1Z2KA 3LN4A 5I9QB 4JVWA 4JHWH 4M48H 4C56E 2C4FU 3CAFA 4K8RD 2ZCHH 3V6FA 5LWYH 4FRWA 4APQB 1DTUA 3T08A 1T6VN 2DDQH 1MVUA 4ZUTA 1NPUA 4XPHH 1CFVH 3RZCB 5T3ZD 1EFXB 4HD9A 1G7LB 1HXMB 1KTLB 5IMKB 3MRFB 1P9MA 1CF8L 1LO3L 5EU6E 4JQIH 3WLWC 3O3UN 3KJ4B 4LLUB 1DLFL 3SDXB 3RDTC 3ELAT 5C07E 3TVMB 2RCSL 3ZHLA 4PV9A 5F9WB 1LNUA 1UZ8B 4GRWE 2C7UB 5BOZG 3TIEA 4X0KB 5DRNB 5F3HA 4O58L 4J3UA 1OCWH 1CZ8H 2FD6H 3DURA 3N0PB 4FFVD 4N0CD 4RMTA 2Y7QB 5IEHA 4RIRA 4HZLA 2QQLL 1RJYB 4G8GB 4OCXL 1B3JA 4MQTB 1MIML 3DV6A 5FK9B 2NY6C 4PJ5E 4IHOB 2PKDA 1JF1B 5F9OH 3RVTC 2ZKHH 5CLTA 5L9DL 1RIHH 2HFGH 2Q3AA 3U48A 5F7YC 5ITBL 3TCXA 2I9TB 1KBGL 4PBWD 1M71B 5CKGA 3OSKA 2GKIA 4NBXB 4I0PA 1YEFL 1WSST 3NTCL 3U6RA 2YMXL 3PWPB 1TVBA 2A9MH 5ABDE 4HK3N 5DUBA 3EW3B 2P8MB 2VRAA 2AK4E 4HZAA 3S7GA 3GSQA