2JJWA

Structure of human signal regulatory protein (sirp) gamma
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
111
Chain Sequence
LQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKNVEFKSGPGTEMALGAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL REGULATORY PROTEIN GAMMA
publication title Paired Receptor Specificity Explained by Structures of Signal Regulatory Proteins Alone and Complexed with Cd47.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 21
structure length 111
sequence length 115
ec nomenclature
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jjwA01
5TDPA 3QFJB 5D7JD 1XH3A 2IBBA 4HKJB 3F7PC 5D71H 5HHVH 3T77B 4X6BB 4PGCA 4HG4J 5E99L 4JEGB 3VJ6A 1EERB 3STZB 1DBML 1U8MA 4Z78B 3BKML 1CN4A 1HHJB 5HYJB 2HVJA 2AXGA 3AREA 3RUGE 5C71A 2CGRL 1V7ML 4Y2DA 4NKDB 1GZQB 3MYZA 4CMHB 2VE6B 4F37F 1J0JA 2R0ZL 1HKLL 1Q9WA 2WINB 3WFHA 5FUZH 4PJGE 1FZMA 5EZJA 4F58L 3FRPG 4ELME 4DJMA 4J23A 3FQTA 2PO6B 1F5WA 5EUKB 4JANA 4Z0BH 1TIUA 4CNIA 2YOCA 4M6OH 5CBAA 5IB5B 1UKTA 3Q2CA 4XNXH 4PJBA 3QUMB 5I18L 2MHAA 3RU8H 3PJSB 1F58L 1MJ7H 1JRHI 4XXDB 2R29L 4WI5A 3HAEB 4N0FA 2GTZA 3VXNA 3RDTC 5A3ID 1MHCB 2OCFD 1AH1A 3O4LA 2G5BB 3TLRA 5IKCB 4LVEA 4M1CD 3PIQB 4EI6A 3RZWA 3FQNA 3VWJD 1CBVH 4I2XB 2AJ3B 1YEKL 2BY1A 3MA9L 1FL6B 5J57B 2O93L 2R0LL 4ZFOB 3VXUE 3IDMA 4Y4FC 2X4OA 5C2UB 4JM2B 1UXSB 5J06A 1QNZL 2EKSA 2ICES 3NCBB 1GZPA 4OJFH 2YRLA 2R2EA 1L7TH 4GBXB 1BJ1J 5IG7A 2WWMC 1ZT4B 1S3KL 4PRPD 5FKAB 4XZUA 2M1KA 4QHUB 3RVXC 4E0RA 1GYAA 5IHBA 3CIQA 1IAIL 5I1AA 2NY0D 4M7LT 3MUZ1 5L8LB 1CE6A 2BOBB 5I73B 3BVNA 3JWOH 1JK8A 4X8JB 2IF7A 3LH2H 2H45A 5LQBH 4RQQA 4M61A 4ZSOA 3BAEL 1YEJL 2YWZA 5I8KH 5HGGS 1P7KB 4CU8A 4D94A 4G3YH 2GTWA 5ABDE 2X1WL 4LLAA 1BBDL 3MBXH 1VSCA 1BZ7A 4LRNH 5D7IB 2VIRB 2DWDA 3N9GH 1LWRA 1TJGL 4HKXA 3EYFB 4HBQA 1CLYH 4DVRL 1OGTA 2EDFA 1UH4A 3B4NA 5MHSD 1KCVH 3OAYH 3MRPB 4YBQC 1T22B 5C7XL 2XN9D 1OAUH 2ZUQB 5JO5A 3B9KC 4GXVH 2VLMD 4LSQH 5TDPB 2DJ4A 4S1QH 1XH3B 4G5ZL 3MC0A 5HPOA 3VI4F 5IT2H 3U4BL 2I60H 4KMLB 3WXVL 4PGCB 1MLBA 4OAWA 3VJ6B 4LPVA 2C26A 1U8MB 2KDGA 1SM3H 5BV7L 1LEKA 2WW8A 3HS0A 5F70A 1AD9A 3BSZL 3DHMA 4LSSH 3RKPA 2XZCH 5GS0H 2PTTA 2HVJB 4X9GA 1QOKA 2AXGB 1RUPH 3AREB 5AYQA 3EBAA 3SGJC 4Y2DB 4ZS7L 1ZANH 3QUXA 3W0WD 5BV7C 3MCKA 1RMFL 3OKEA 1Q9WB 3BN3B 2AJVH 4ZOBA 5F7EH 3WFHB 1JP5A 3QUYC 4UTAH 3ULUE 4LL9A 1FZMB 5EZJB 1DLHA 1INDH 3C87A 3NGBB 3LQAH 1CFVH 5TF1H 1JZ2A 1UVQA 4JM2F 3FQTB 1DP0A 4XAWH 4JANB 4CNIB 5CBAB 3P9MA 4AQOA 1KCUH 4PJBB 2MHAB 5E2WH 1MCCA 1N3NA 4GKNA 3R06A 4OZFG 3GMPA 3DXAD 2VLRD 3P40A 4N0FB 4XAKE 4I3RL 2GTZB 3VXNB 3BKCL 4PJCE 4XCEA 1BM3H 3O0RH 3SQBA 4F7CA 3CMOH 3GSVA 3O4LB 4M7JL 3G9AB 5FXCH 3IDGA 3DX9A 1OAKL 3A6CL 4EI6B 3FQNB 3O9WA 2R2CA 4HUVA 3T0AA 1SMAA 3UTPE 3O6ML 2FDBP 1LILA 1SQ2N 2WLZA 3HA0A 3IDMB 2IPUK 2X4OB 5I1LA 3X14A 3IFOA 1FPTH 2EKSB 2X7LA 4OV6F 1GZPB 4PJ8A 1QZ1A 4TNVK 2R2EB 5EUOE 3NA9H 5IG7B 4PJHE 5JXEC 3HHRB 3GK8L 3BKYH 4HIHA 4KGJA 3CZFA 4XZUB 5DD1L 4PJ7A 4E0RB 4X0KA 4U3XA 4KRPC 1L7IL 3T8XA 3UJTH 2VABA 4LHUD 4AL8L 5JMRA 1MLCA 3MQIA 3O6FC 5ETUA 3ZKSD 5I1AB 2J8HA 1N64H 4S1RH 4ZTPH 3P73A 5D7LA 1CE6B 2YR3A 3BN9D 4NP4H 3BVNB 3ARDD 4RMRA 3OJDA 1ZMYA 1JK8B 2X44D 4XPFH 1SBBA 5IUSA 4P9HC 1QQDB 4RQQB 3D85A 4M61B 4ZSOB 2CDFA 2EO9A 3MLPA 1U3HD 4I5BA 4MNQE 2GTWB 3L3KA 1RD6A 4EKXA 5MHSE 3LPFA 3LB6C 1A6WH 1AXIB 1BZ7B 1F6FB 2Y4SA 3TA3A 2XICA 4KVNL 2CR6A 4H1LH 2DWDB 5CBEA 5C0RH 2IBGA 3GMLA 4HKXB 3UZVB 5KSVA 5E94A 5DO2C 3F7QA 1OGTB 4NN5B 4P23A 4I0PA 3QO0A 3J7HA 5JO5B 4MGXA 1BLNA 4YH6A 4PUBH 1J8HD 1N8ZA 3WDIA 1FGNL 1S8DA 2VLLA 3EO1A 4LFHG 1OTUD 5HYEA 3DMMC 2NY1D 3X13A 1MLBB 4PJBF 4TPRH 3RRQA 3ARSA 4OAWB 3U0WH 3V52H 1GGCH 3DGGA 1LEKB 3HS0B 1AD9B 4DTGH 2PTTB 5F1OB 1T1XA 1C5BH 2ZPKL 2QSQA 2WANA 3QUXB 2EECA 3MCKB 4KMTL 3OKEB 4KU1A 4I3SL 2QHRL 4A6YA 5SX4H 2ED8A 3SDDC 4A6YL 1HKFA 3GSNA 3D0VA 1DLHB 3GSNL 2BY3A 5DUML 2IPTL 2QSCL 4K3DL 5EC2A 1UVQB 3DI2B 1MCWM 2MPAL 3S5LA 3AU1A 2DTSA 3DXAE 2VLRE 5K9JL 2B39A 4HXBL 4MJIE 3P9MB 4YHPA 1KGCE 5IEHA 1MHHA 5D1ZC 1N3NB 2DQTL 4TUJA 1HOCA 2YMXL 2Z31C 4YIQA 4GKNB 3R06B 3GMPB 4U7SA 5B22A 5JW3H 3VH8A 4XCEB 3P0VH 4TNVF 4F7CB 3D5OF 3GSVB 5I8OH 1M6OA 3IDGB 3DX9B 4KTDL 2VJXA 4Y5XA 5DFTA 1IGCH 1I9RL 3O9WB 4HUVB 3FZUD 2RHEA 2F5AL 3V0WH 4KKAD 3V6ZA 2H1PH 3MV7A 2GJJA 3RTQD 4XP5H 5I1LB 3X14B 2DBLL 3IFOB 5GS2H 1CGTA 4NN6B 2X7LB 3M1BA 4ONHA 4PJ8B 1UG9A 1BIHA 3MOAL 2JIXD 2AJXL 4UILH 4HIHB 5CJ8A 5EU5A 4LSTH 3AAZA 3CZFB 1I9JL 3MJ7A 1M1SA 4PJ7B 4EZMA 4X0KB 4LMQE 1MY7A 5CSBA 2VABB 3T8XB 3VFNA 1MLCB 1HSAA 5ETUB 5TE7H 3HE6A 3P73B 1VGKA 5D7LB 3G5VA 4I8DA 3OJDB 4FQ1H 5KSBA 4KROB 1UJTA 5C07E 1BREA 2IH3A 3ZYIA 3D85B 4EOWL 2CDFB 2CD0A 3GB7A 3T65A 3QDAA 2NY4D 4I5BB 1B4JL 3L3KB 4H25A 3DJ9A 3TA3B 1HQRA 3CX5K 2FATH 4JREC 4JKLA 5E4EC 4JFFA 3LIZL 5CBEB 3GMLB 4KI5F 4URTB 5KSVB 5E94B 1LO3L 4P23B 4I0PB 1J8HE 2K9UA 3QO0B 2FX7L 4QKXB 1DBKH 3TCLA 3NVQA 3HI5L 4ZO8A 3SCMC 1L4IA 1M7IA 3G6DH 2D7OA 2X4RA 4BA8A 5FDWA 1IL1A 1BLNB 2J5LB 1CGUA 2MFNA 4FQXC 5GS3A 1CZ8H 1MFAL 1N8ZB 3RKDD 1S8DB 2VLLB 3EO1B 3V4PH 3U7YL 3X13B 1NMAH 5MENA 1RHFA 3I9GH 3DGGB 4P2RD 3U7WL 2HN7B 2ZCLH 1RZ7H 1T1XB 4QRSA 4KPHH 1ZS8A 4LSVH 3T4AA 4LSUH 3OAUH 3CNKA 3QQ9C 2XY2A 3HUJF 3QEQA 1JTOA 2N7AA 2BVUA 5EFIA 4A6YB 4Y16D 4YX2L 4PRID 3R1GH 1A6AA 3GJFK 4MNGE 1Q8MA 1A64A 3GSNB 3D0VB 2W07A 2NW3A 4L1DA 5I15L 3PQYD 5IHLB 1DQQA 2DD8L 5EC2B 4TTGA 3S5LB 4HWBL 3AU1B 3ZE0F 3ARFC 4V1DE 4WDIA 3V6OC 4RMVA 1WAAE 5C8JA 5I0DA 4YHPB 2I27N 5IEHB 1MHHB 4TUJB 4N0UE 1HOCB 2IC2A 4K7PY 2IQAB 4YIQB 4JQVA 5ALCL 5DHVA 2VDOL 1RZFH 4J4PC 3CX2A 4PJ7F 4EUPH 3K1DA 1O7VA 3VH8B 1A7QL 3T2PA 4A2LA 4H1LG 1NGXA 4YHZH 1M6OB 5BRZA 5DMGD 2J88L 3EO0A 3MZTA 4Y5XB 4JQVC 2QQKL 5J7CC 3IKCA 2HT3C 5E5UB 1FCGA 1UCBL 5E8DH 3TBWA 4PB9H 1W72A 5CZVL 1W72L 1QP1A 1EO8H 1MREH 1MY5A 3V6ZB 3MV7B 5L2KA 4XPTH 5MI0C 1PKOA 2Y5EA 3MOBH 5F96L 3V6FA 5LBSL 5KG9A 2D7NA 3CK0L 3M1BB 4ONHB 3BD5A 3SBWA 3T2NH 1YC7A 3TH4T 5C08A 3CD4A 1Z3GL 2PW1A 5EU5B 2VC2L 3AAZB 3H9ZA 3MJ7B 4PD4K 1JI1A 3VFNB 3PWPA 3EYSL 3CLEL 1HSAB 4GMSH 5J6GA 3HE6B 1VFOA 3FT3A 1FJ1A 1VGKB 3CSYA 1JZ4A 2P24A 3G5VB 5L6YL 2HFGL 4HKZA 5KSBB 1KJMA 4ZS6C 2ZG1A 1AQDA 3VGDA 2IH3B 5DRXA 4OF8A 2OS7A 1A9EA 3GB7B 3T65B 5FB8A 2VYRE 5FGSA 4DKFL 1NCNA 4LCIH 2ICCA 4H25B 3IAQA 1JFQL 1HQRB 4GXUN 5E8PA 4HMEA 4JFFB 5C0EA 2ESVA 5HYSG 4DGVL 4P2YA 4PJ9A 1ZVYA 3TCLB 2HTLD 1JPSH 2RCSL 1A6PA 1M7IB 5KOVC 5DJXA 2X4RB 5FDWB 1IL1B 4TSAH 2P45B 1XAUA 3KWWA 3MODL 4HK3N 1KN2L 4LVNC 4GKZA 3MXWH 1BZ9A 4F57H 1PKQE 5MENB 5GRJL 1ZLVH 4PS4L 3ARGC 4OFVA 15C8L 3BT2H 5DR5H 3MBED 4KC3B 3LS4H 4QRSB 2HLFC 1ZS8B 1XMWA 1LDPL 3QEHA 4PRIE 3T4AB 4MVBC 2GEEA 2EH7L 4LPUA 3QEQB 4P2QD 3Q48A 5DI8B 2X4PA 1LO4H 5EFIB 2GK0A 3WLWD 3VA2C 3TBVA 1NGPL 5DJDA 1A6AB 3O2DA 4U3CA 2NW3B 3EZ8A 3O2DL 3O6LH 1DQQB 1AGFA 2R56L 4L9LA 4QT5A 3KPRE 4WDIB 3ZT6A 5C8JB 3TFKC 2XNAA 4FQLL 4JPWL 3DIFA 3PUCA 2AXFA 1D7FA 5I30H 5T1LA 1U95A 3N50A 4DAGL 5E2UL 1RUKL 3QHTC 5DHVB 3DV6A 1J86A 4PBVC 4L4JA 1D9KD 1NGXB 5BRZB 1YNKL 2XPGA 3D3VE 4WFHE 5KSBF 3EO0B 5JOEA 4LCCC 1E4KA 1WIUA 3IKCB 2NR6C 3SE3C 1QBLH 5D2LE 1W72B 3SHSA 5L0QB 3CXHK 4UTBL 2NY3C 1CD1A 1TLKA 3HNTH 5L2KB 4OCLC 1VA9A 3KVQA 4JJ5A 1B9ZA 4B5EA 4OF6A 5T5FH 3V6FB 4RAHA 3GSXA 4KHTH 5KG9B 3Q5OA 3QUMH 1BJ8A 4IDLA 1MFDH 3V4VH 5C08B 4X80H 3EFDL 2PW1B 1NLBH 3O2WL 1KIQA 5DLMH 2XTLA 1J1PH 4HDIA 1A6ZA 5FGBC 3MRDA 3PWPB 4XP4L 2PKDA 4AG4L 1H3UA 1RULL 4PJ5D 5JLZA 2YK1H 5J6GB 3FFCE 3FT3B 1FJ1B 3F58L 3CSYB 3VG9C 4GSDL 2P24B 2IBZY 4YDVA 2EYRA 4HKZB 4TVPL 1KJMB 2DLTA 2LV4A 1MNUL 3OX8A 3FMGH 5EO0A 1AQDB 5FFLA 4I0CC 1EEUA 5C1MB 5DRXB 5EA0L 5C0CE 3MRGA 5T1MA 1A9EB 5FB8B 1QA9A 4ERSL 3DX8A 4OLXH 4XPHL 4Y5VA 5E8PB 3EIFA 3SY0A 1G0DA 3NTCH 4L4TE 4ZOCA 4KJPC 3QWRA 5INDA 1A4KA 5C0EB 4NZUL 4MYWB 4R90L 1ZOXA 1FO0H 2ESVB 3OR7A 2XKUA 1QSED 3HR6A 5KW9H 1E4WH 4PJDA 3U0TA 2ZWLT 3NIDF 4BFEA 4PJ9B 4RSVA 4EUPG 2YSSA 1P4LA 5DJXB 3DARA 3G08A 2IFFL 3L1OH 1ORQA 3KWWB 5CHNA 1NL0L 3QI9C 2XTJD 1CGVA 3OKNA 1A5FL 4GKZB 3I6LD 2F15A 1BZ9B 1MEXL 3RNQA 4WY7H 1B0RA 3PGFH 1V5JA 4Z7UA 2A6KA 3SE4A 3QIBA 5FYLH 4GS7C 1FC1A 1G7HA 1S78C 1ZHLA 3QEHB 5T1KD 5HHMB 8CGTA 2VDRL 5IHZA 2RJMA 3DX7A 4NQDE 5J89A 3QNYA 3QCUH 1MI5A 5KJRL 1QSFD 3T3PF 1T1YA 3QPQD 2X4PB 5ANME 2DQJL 2GK0B 1OP3H 2EDRA 3TBVB 3BPNC 4MJ4A 5DJDB 3ZTNL 4L5FH 3L3OA 4XCFL 2Y06L 3RGVD 3FB7A 2R1YA 3LEYL 1OTSD 1T83A 1MCOL 5GPRA 1AGFB 4L9LB 4QT5B 3IJYA 3QSKB 2XNAB 4NRZA 3VRLF 2E3VA 2WZPD 3DIFB 5CJOL 4F8QA 4NBXB 4XNMA 1QHOA 2AXFB 2BRRH 5T1LB 1U95B 3OB8A 5I1HH 3DV6B 3F7VA 1XEDA 4RX4A 1HKLH 3RBSA 3RVUD 1CXKA 2NXYD 3QDGA 2XPGB 1KPVA 2BNRA 3C2AH 5FV1L 1P5VA 3CCHA 5GRWA 1JGDA 4OB5L 4LHJB 1EFQA 2YBRA 4YC2B 1CD1B 4KXZI 4HS3A 2M26A 1C1EL 2VXVL 2YA1A 4JJ5B 2CO6B 3GSXB 5ELIA 3T1FA 3X3FL 4CVZA 2R29H 3O8XA 1OAYH 2DQUH 3WXWL 4HMCA 4LGRB 1KIQB 3B9DA 3TJEL 4JO3L 3OKOA 4HDIB 1MRDL 1A6ZB 2IADA 5TQ0L 3MRDB 4NO0D 1QRNE 5JLZB 4YUEL 1K4CA 3B2VH 5EG6C 4YDVB 1LHZA 5TJWK 1G9ML 1OT1A 3CLFH 1FIGL 3S35L 1RUAL 3KYAA 3OX8B 4NPYA 5EO0B 1PW3A 2R2BA 5F7KC 2ITCA 5F9JA 3GKWL 1CFQA 2VZ1A 5D2NC 3ZYZA 2CXKA 4M43H 2B1HL 2DQGL 1NCCH 3MRGB 2WM0A 5T1MB 1QA9B 3DX8B 1NPUA 12E8L 1QSEE 4Y5VB 3SE9L 3SY0B 5I1IL 4HUUA 2H8PA 1S3KH 3M45A 4Q9QL 2XZQL 4RAUA 3LDBC 3E3QC 4IOSD 3MRCA 1A4KB 5INDB 4WTZG 3OR7B 5JW4M 4PJDB 3U0TB 4Y7MA 2HWZL 4QRPD 3BDYL 5FGCE 3I6LE 5KVDL 2PF6A 2YSSB 5CEZD 1P4LB 3JTSA 4LKXA 3WDHA 2E7BA 3G08B 5B21A 1ORQB 2YN5A 5CHNB 1F3JA 1N6UA 4MS8C 4HBCH 3GDBA 3OKNB 4D0CA 1YEJH 4HQQL 5IV2A 2WSKA 1BD2E 1J18A 1LEGA 4JPKH 4DOHB 3RNQB 1B0RB 4Z7UB 3UCRA 1QTYT 2A6KB 1QSFE 2A74A 4WEBH 3QIBB 5HDBE 3EDKA 4L4VE 4FFZL 1G7HB 1ZHLB 1KENL 1I9IH 1NCUA 4AENA 1LDSA 5HBBA 1P4BH 1UT9A 5IHZB 4DVRH 3DX7B 4G9FA 5C0ND 1XF1A 3QNYB 5JMOC 1MI5B 1T1YB 4N5UA 3VXMA 5C7XH 4OZGA 3QCTH 3WBDA 3L3OB 3FB7B 2R1YB 5KSUA 4RCAA 4AIXA 4BQBA 1IM3A 5IGXL 3U0PA 1J12A 3G04A 1WV7T 3IJYB 4JO2H 5J8OA 4OLVH 4P57A 1ZHNA 4NRZB 2VDMH 5BV7H 4L3EE 1PJ9A 4XNMB 5CJ5A 1IC5H 3P4NA 3U2SA 3F7VB 4XNYL 5C0JA 1AKJD 5FYKU 4O02L 4K55A 1N0XL 1IQWL 4AQ1B 1RMFH 1Z6JT 3MRRA 3KYKL 4TULH 2DIJA 3QDGB 2ZOLA 1KPVB 3HPLA 5E1HB 4ZFZA 4JN1L 1PX3A 2BNRB 3CCHB 1JGDB 3STLA 4NZJA 2BFVL 1JHLL 2YBRB 1MRFL 5I71B 43CAA 4YHYB 4HS3B 4QHMA 4KTEL 1T89C 4KKLD 4ALAL 2E9JA 3T1FB 4CVZB 5KVMC 1YEIL 1QFUL 1I4FA 3FO0L 2C1PA 2HH0H 35C8L 1K8IA 5BO1L 3O8XB 1P7HL 4PJDF 4POUB 3ILQC 4MXQD 4YZFE 3OKOB 4LRIA 1Q0YL 3T0DA 2IADB 3WL9A 1FP5A 1K4CB 3A6CH 3O41A 5HI4C 3LKPA 3HB3C 2B0SH 4NPYB 3QUKA 4O51A 4QNPE 2CR3A 5CCKL 2R2BB 1S9WA 2ITCB 4MJ6A 4BH8A 1CFQB 5F9JB 5E08L 5E1AA 1C8PA 4PP1C 2HKFL 5E2TL 5JZ7C 1YDPA 3BZFA 4G8GA 3EO9H 2ZUXA 4QRPE 4HUUB 2H8PB 2UY6A 2FZ3A 4RAUB 3RVVC 3IFPA 4OGYL 1Z9SA 3MRCB 2GJZA 4NBZB 1SVZA 2O61A 2WWKT 4R3SA 4P9HH 3KJ6L 1RIUH 4KRMB 2J4WL 3KPSA 4P2OD 3JTSB 2YD3A 4LKXB 5AUMA 3TZVC 1V3KA 2LVCA 1MRCL 1YMHA 2YPLB 4B0MM 1F3JB 3FO9A 4D0CB 5IV2B 1HHHA 1LEGB 4OGAD 1T21A 1NC2D 1FL5A 2A74B 3H3PL 5ITBH 4P9MH 1SMOA 2MSPA 4KVNH 1DBBL 1X44A 4KFZC 4AENB 2XWTA 2ZZUT 5DZOA 4FFVD 4ODSL 2BK8A 4G9FB 2Y25A 4XMLH 3EDFA 4GRLA 1IQDA 4OD3H 4EDXA 3MX0A 3VXMB 3OF6A 4OZGB 1HXYA 2EEAA 1QSVA 2VLKD 3VW3L 3SKNA 1PLGL 4W68A 5KSUB 1IM3B 2VITA 3U0PB 5C3LD 2QL1A 1WSST 3HFMH 3G04B 4NWUH 4RISL 3RWEA 4P5TA 1EMTH 2J1KA 4P57B 2FX9L 1ZHNB 3TYGH 4G6KH 4NWTL 4Z7WA 3P4NB 1BGXL 2OM5A 3U2SB 1NFKA 4NJAL 5C0JB 3SJVE 3GSUA 4X4YA 1RURL 1XIWC 2YPKA 4FQPA 1I8MA 3T0EC 3MRRB 4KUZH 4XI5D 2ZOLB 3HPLB 4TVSa 4ZFZB 4XMPL 5DA0B 2DQEL 1GL4B 2V5SA 3R0MA 1YEGL 5IVOA 3STLB 1O7SA 4NZDA 5IFHL 1OAZL 4OBSA 2QSCH 1OARH 3ZE2F 1U91A 4POZD 1D5IH 5CKGA 3PL6A 43CAB 5FCSH 4QHMB 2B2XL 4O58H 1HIMH 2AEQH 4IRJA 4QF1A 4MAYA 5E5RB 5I76A 3EOTL 1T7ZA 3IRPX 4FG6C 3GJFH 3V5DA 2E9WA 4NYLA 5I8EA 1WTLA 4MA7L 4XC1L 1I4FB 2C1PB 2J8UE 3FJTA 1K8IB 4NM8L 5GS1A 2IAMA 3NZ8A 1CXLA 1X6LA 1WCQA 4RGND 4U7MA 5IFJA 3WL9B 1WT5A 1VFUA 4JKWA 2Y07H 3K4AA 1U9KA 3O41B 3GI9H 3LKPB 3U79A 2YA0A 3O3BA 3QUKB 4O51B 2Q8AL 1EAPA 2YEZA 1S9WB 4MJ6B 3ECBA 4BH8B 1RSFA 1T3FA 5E1AB 5CSZA 2DBLH 2I25N 3N06B 4WI3A 1YDPB 3BZFB 3U6RA 2NXZC 3WMSA 4G8GB 2W59A 4PP2A 4FTVE 1X5LA 4DUXA 2FZ3B 4LCYA 3IFPB 1PZUB 2GJZB 4K94L 4KMQA 3AS0A 2O61B 3OB0K 1PG7H 4MXVF 1PZ5A 4R3SB 4K2UH 3CUPA 4R4BA 1KNOA 3KPSB 5AUMB 4W4NA 3BUYA 3S6CA 2WQRA 1YMHB 3MJGX 3RY4A 5F7HA 3IVKA 3FO9B 4EOWH 1NCAL 1HHHB 1H8NA 4AZ8A 3QIUA 5SWSD 3TVMA 3OKDA 4EN3C 1P53A 4PGEA 5DJ0A 1T21B 1FL5B 2IGFH 5DJ6A 3PV6A 5HD8C 3LIZH 2O5XH 3TO4C 2XWTB 5B3JE 1LO3H 1NMBL 1MHEA 4ZXBA 4XHQA 4GRLB 5M7QA 4HIIA 1IQDB 1ZTXL 4EDXB 3VXSA 1HXYB 1CYGA 4J3UA 4YNYA 3SKNB 2H2PC 5EZOH 4XP6L 4UIKL 1JHKH 1DLFL 2H2SD 3VWKD 2VITB 3MRJA 3U7YH 4CJ0A 4LQ1A 3RWEB 4LGPB 4P5TB 4P0DA 1D5XA 2AGJH 3VFGH 5JQHC 3HKFA 1R3LA 5D7JC 4NCC2 5D93C 4X4ME 4Z7WB 3BFOA 5I9QC 4KK5D 3GSUB 4YE4L 1QBBA 4FQIL 4X4YB 1HHGA 5E9DD 2YPKB 5EBGA 4H5SA 2D4DA 1I8MB 1RZ8A 5JORA 3KHOA 4UV4L 5LAXA 3V2AR 3MV01 2DDQH 1IBGL 1OSPL 5KZCD 4HF5L 1U91B 4HWBH 3PL6B 1PVHA 4PJXA 3NZHL 4IRJB 1AY1L 2N56A 4QF1B 4MAYB 5I76B 1F2QA 5T5NG 1FNLA 4EIZC 4X7SH 3V5DB 4RGNE 3D6GA 4NYLB 5I8EB 2XV6B 1OB1A 1FHGA 4APQD 5JIIA 5GS1B 2IAMB 3GMQA 3NZ8B 4P4KA 2YHGA 4OLWL 2K7QA 3SPVA 4U05A 3QFJD 5AWNH 5IFJB 1DQDL 2VAJA 5IROA 1NCDH 4M3KB 3FN9A 1RIHL 5HVHC 1TCMA 2QQKH 4MAUH 4R0LA 1U8HA 3O3BB 1EXUA 1W0YT 4OIAA 5ADOL 1EAPB 4LLWA 4MA8H 1H3GA 1WWCA 2YEZB 3ECBB 1BX2A 5A3IC 4YFDB 1T3FB 3RPKA 5HYJD 5CSZB 3IFNL 5J12C 2QQQA 5HVWA 3TH3T 4U6VL 1ZLWK 3U36A 4M1CC 3U6RB 3VWJC 3MACL 4PP2B 2OL3H 1JGVL 4X6CF 3MSPA 5I1JL 4LCYB 2VC2H 2VWEE 3RWCA 1IKNC 5IBTL 1RI8A 1PZ5B 4Z76A 1KYOK 3CUPB 4R4BB 3QQ3A 1KNOB 1UM5L 3MROA 1NAKL 1ED3A 1X5JA 4NKOA 4XTRD 2PO6D 3GO1L 5F7MC 3SO3C 2VH5L 4HXAL 3BUYB 5D7KD 4P3WA 5IB2A 3HNVL 3IVKB 4OZHA 4Q7DA 4Y1AA 1RJYA 2DKMA 2MCG1 1FVEA 4YXHH 3PDGA 3QIUB 3TVMB 4DKFH 3OKDB 2XRAL 1QACA 2NY0C 3K2UL 4PGEB 5DJ0B 4Z7WF 5A2IH 2ILLA 1JFQH 5DJ6B 4RA3A 3PV6B 3HMXA 4BZ2L 2QV2A 2A77H 3IDYC 4OLYH 4LDOB 3HMXL 2DYPA 1J10A 1MCEA 3CFIC 4MA1C 1EHXA 3G6JE 4ODTL 1MHEB 4ZXBB 3V79C 4PGZA 4HIIB 5I19L 4IHOA 3VXSB 2YUXA 3IAPA 4YNYB 5H35A 4JM2D 1NGZA 1P7QA 3MRJB 4QGYA 3RWIA 3G5YA 4GBXD 3C60A 2QQLL 2NY2B 4G9DA 4QXUH 4LIQH 3OKKA 1D5XB 1KG0A 1DSFL 2XG4A 4U0RB 3CMGA 15C8H 3EDDA 1R3LB 2QQNH 4JFHD 1GHFL 3ME0A 1CD0A 3S8WA 1FNSH 2OI9B 1EHLH 1HHGB 5C86A 4UI2A 4H5SB 2R4RL 2Q3AA 1RZ8B 3IF1A 1D5MA 4JDTL 4FFWD 1G9NC 5JORB 2ENYA 1IGIL 5LAXB 1RZGA 2IANA 3H7BA 1NCTA 4OKDA 1MQKH 4HJJL 4JKKA 1T2QL 1OP5K 3S36X 3X11A 5AYUL 3VCLA 3L3IA 1H3TA 2YKLH 4KHXH 4PJXB 5KTEL 2AJSL 3GGWA 1LP9F 2R69H 3DUSA 3EUUA 3UC0L 4JPWH 1CDHA 3JVGA 3QYCA 1OB1B 1MCPL 2EC9U 1F42A 3GMQB 1QPXA 4P4KB 1LO2L 5EIVA 3SPVB 3TT3H 1AGCA 3F5WA 3C6LA 1YNKH 3MRKA 2FJGA 5HYJE 3F8UB 3VMPA 4OT1L 1H0DA 4ZODA 4R0LB 2XWBA 4J7RA 1U8HB 3BHBA 1AFVL 1EXUB 1SJEA 3AUVA 4LLWB 4UTBH 4JKMA 1BX2B 1JJUA 1IC7H 4NUGH 3ARED 1PSKL 4BQCA 4Y2DD 3U36B 3MJ6A 3TGXA 4JB9H 3Q5YA 4YDIH 4YJZL 4KAQL 5D1XA 3EFDH 3ARUA 5LJYH 3VI4E 3RWCB 4D9LL 3CC5A 4HUNB 1VADA 4Z76B 5L88L 1JWUA 3QQ3B 5HYFA 4AG4H 3MROB 1B0WA 4FZ8H 1ED3B 4NKOB 4RGMC 1LK2A 1OAXH 4GSDH 3RP1A 1FC2D 1FBIH 4IM8A 1GGYA 5IB2B 4OZHB 2W9EH 4Y1AB 1RJYB 1FVEB 4K8RL 5ACMA 4PPTA 3HNSL 4H8WC 4NC1E 3BN9C 1I8LC 3ARDC 2V2TA 3TIEA 3S36H 4FFYH 3O4LD 1JGUL 2DYPB 2VUOA 4M7KL 4M02A 3EOAA 3LS5L 4TSCL 2PTVA 4GMTL 5CJBA 3QCVH 1U3HC 1I75A 4IHOB 1KB5H 1NBVH 4KVCH 5EIIA 2V9TA 3HZYA 4FQHA 5H35B 1MCFA 4N0YL 1YUHA 1NGZB 1P7QB 2ICWA 2NYYD 2ADJA 2I9LA 4PJXF 3RWIB 1CD9B 3G5YB 4N8VG 5L7XL 3C60B 4ONFH 4G9DB 2ZP0T 3OKKB 1KG0B 1Z9LA 2ZOKA 3D69A 3IB4A 1KV3A 2BVOA 1OTUC 2NY1C 1KULA 1GXEA 4WW1A 3S35X 3X3GL 5KJRH 4N9OB 5FYLE 1CLZL 4JY5L 2G60L 3IF1B 1D5MB 1IGTA 1NC4A 1WZMA 4XCFH 2ERJC 1RZGB 2IANB 3P9WB 2GFBA 3RIAK 3OKLA 3UYPA 3H7BB 4X4XA 2H6PA 3SKJL 3G6AA 1XR9A 3X11B 4OF0A 3VCLB 3L3IB 2VLJA 3GGWB 3DUSB 5AG8A 1T03L 2CKBH 4NUJA 5CJOH 4QHNA 4NKIH 3ZT5A 5FOBA 1D5BA 4EJ1C 2AJUL 4LLMA 4BZ1H 2YD9A 3Q0HA 1XF2A 1LO0H 1TVHA 4JQIH 3HC3L 1VEMA 4H26A 4O5LH 5AEAA 1BFOA 1HXMA 5ICXA 5GRUL 5ESAA 1AGCB 2H3NA 1IT9L 3F5WB 3C6LB 3ARTA 3MRKB 2FJGB 2DI7A 2Q87A 3FB5A 1H0DB 4JO1L 4PTUA 3X12A 4DW2H 3H9YA 4MMZC 3ES6A 2XWBB 5D6CA 4OZHF 1UM4H 3BHBB 2FR4A 1SJEB 2NY6B 3L5XH 2F58L 2VNCA 4XVSL 1JRHL 3LRGA 2EKJA 4P2CG 5SV4A 2BX5A 1T66D 3QUXD 4KI5D 1YQ2A 3NCEB 3FZUC 1S7UA 1UWXH 3VI3F 1NQBA 5J11C 1S9KC 3OKYA 5D1XB 5FECA 1I3GH 4KKAC 3CC5B 3S88L 3RTQC 1VADB 1JWUB 4NQEA 5GGSY 4KZEH 2YN3A 1TETH 1LK2B 2EDWA 3I6KA 1JYWA 1IEHA 1FIGH 3S35H 4MDJA 1LD9A 3OJMB 1INEL 5B8CA 3O4LE 4Y89A 4KTYA 5CMAA 4WU7A 12E8H 2EICA 3TIDA 4MD4A 4XC3L 4NHCL 1NDGA 1P84K 2IFGA 2V2TB 3TIEB 1WWBX 4JR9H 2APXA 2VTFA 1YEDA 1E6OH 3EOAB 3O9WD 3TT1H 2NY4C 4H88L 1F11A 1S7TA 2HRLA 3BDYH 7FABH 3E6FA 5EIIB 2R2HA 3HZYB 4FQHB 3U4AA 5GHWL 5B39A 3U7AA 1YUHB 3EYVA 3WJLC 2J12B 2VZSA 3UMTA 3EYUL 4OM0H 1RY7B 1X5AA 4PJ8D 2ICWB 2ADJB 2I9LB 2D7MA 3LQZA 5KVFL 1YEHH 5C6PB 3Q5TA 2NZIA 4IOFD 3HE7A 1RZKL 3RIAF 2FYYA 1BF8A 2ZOKB 3D69B 1JYXA 5F6HJ 2X4UA 1KENH 3RKDC 4ZSOE 1AR2A 1IM9A 5CJQH 2BVOB 3QFDA 4LEXL 3S3PA 5D7LD 3D25A 5E00A 3PP4H 1RZKC 2JJSC 4WW1B 4HFWA 1J1OL 2VR5A 1ZHKA 4KROD 2DM3A 4JZJA 3REVA 4RMWA 4Z95H 3D85D 3K3QA 1IGTB 1NC4B 4UBDD 3PE9A 2GFBB 5FYKL 3OKLB 5SX4I 4X4XB 2H6PB 3H9HA 4NC0B 5JR1H 3FAWA 3TA3D 2FIKA 3G6AB 1XR9B 2VSDA 2VLJB 4Y16C 1OQXA 4BJLA 4TQEL 4NUJB 4QHNB 1II4E 4P23D 5FOBB 1D5BB 4I0PD 4OTXL 4LLMB 1XF2B 1TVHB 1Q0XL 4NJ9L 4YBHA 4LU5L 4H26B 3GM8A 4ONOA 4QEGA 4JGMA 4E9LA 1UACL 1BFOB 1HXMB 4M8QA 2WIMA 5ICXB 5ESAB 2XI9A 2H3NB 1R5IA 4O2EA 2EDTA 3FB5B 1TJIL 2HKHH 3CVHA 1HH9A 4PTUB 2JLLA 4Q2ZA 3QRGL 3X12B 1F4AA 3CVHL 3ES6B 5D6CB 2Z92A 5FYJU 3NCYS 2FR4B 4KI5E 1JGLL 4DWHA 2GY7B 3MLXH 1ADQA 3ZE1F 2YZ8A 4G6AD 1WWAX 1KEGL 2BVQA 4LPCA 5DMGC 3ROOA 2A2QT 1A7OH 4HIXL 3ZDYF 1S7UB 2LU4A 3EJJX 4TSBH 35C8H 5E8OA 3QEUA 5FECB 3MV9E 1C12A 4K7FA 1H5BA 2YD1A 1P4IH 1L9MA 5C2BH 3CAFA 4NQEB 1A14L 4GRWB 4M6ML 3TBYA 2V2XA 4IJ3B 5CUSL 4J3XA 3I6KB 3WUZA 5EOQL 4IIQA 4MDJB 4NNYA 1HNGA 4O9HL 1LD9B 3SGDH 1RFDL 3A0OA 3EJZD 5B8CB 3HUJE 4X5LA 4WU7B 5CMAB 1I7RA 2XG5A 2HKFH 1UA6L 5E2TH 4LVHB 3R0NA 2D9QB 4LDEB 3TIDB 1NDGB 3IFLH 2MCPH 3BPCA 5E2VL 1HI6A 3BWUC 3SKOA 3H8NA 4X7TA 1MVFA 1YEDB 3IJHA 3QDHA 4M6NL 2VN4A 3ZE0E 5ESVA 1KJ2A 4WWID 4PJAA 3LKSA 2KL6A 1KJ2L 1F11B 2FCBA 5CGMA 1S7TB 1A6VL 1SEQL 1MCJA 3E6FB 3K8KA 4JFDA 4UUJA 3ALWA 2JJUA 2R2HB 2Q8BL 4YHNA 2OZ4A 3BPOC 1WFTA 3MV7D 5B39B 4JG1H 4Z7VE 1R3KA 3EYVB 4PJ7E 1A7BA 2H41A 5LVEA 1JN6A 4WEUD 4J3TA 3LQZB 5BVJA 1KCRH 3IS1X 4RFOH 2PXYA 3MJ9A 5F7DA 1QLEH 1UGNA 4UV7H 5D7LE 1TPXC 2HTLC 1F13A 5BW7C 3HE7B 2FYYB 1RAMA 3QRFM 2CQVA 1QHPA 3HI6L 4H0HB 4LCWE 2X4UB 2VR4A 4IDJL 1IM9B 3HE6D 3QEGL 1ZVSA 3QFDB 3D25B 5E00B 2D0HA 1KOAA 4HFWB 1ZHKB 3ARRA 3O3AA 1OGAA 2CIIA 1IGML 4JZJB 3REVB 5EPMA 3ZO0A 4UQ3A 5DK2A 3MBEC 3C09C 3ARPA 4PJEE 1FSKC 3H9HB 1KF9B 3EHBD 2FIKB 5IM7A 1OY3B 1UWEL 4J3OC 4JFFD 4JY6A 1OW0A 3WLWC 4B41A 3MXVH 1GOHA 1AJ7L 4WV1C 3KJ4C 1GOFA 2HTKD 3TWCL 2O5YL 5GISH 1KTKE 4HGMA 5CSGA 3MLSL 1UZ6F 3ELAT 2CLRA 4M8QB 3LN9A 5BCAA 4PFEA 1R5IB 4O2EB 2AJYL 2Y7QA 1T7WA 1MPAL 3CVHB 5IVZA 4PRNA 1HH9B 1YEGH 4Q2ZB 2AQ2A 2Z92B 1IGJA 5A2KH 5MEND 1MCLA 5JA9A 2B2XH 1D9KC 3RY6C 4BKLA 2H32A 5HI3D 1FLRL 4N9GA 2BVQB 2I26N 3ROOB 2VR9A 3EOTH 4G8EA 1TQCC 1GC1C 4JM4L 2D3VA 3DECA 2DI9A 2OJZH 3OZ9L 3QEQD 2F53E 5E8OB 3I50H 4ZNEE 1CVRA 3QEUB 1WFOA 4NM8H 3DO7A 3I3DA 1C12B 4K7FB 1H5BB 4Z8FH 4M5ZL 2OK0L 2FD6L 1R0AH 4WUUB 2ZUVA 2VL5A 4FZEH 3TBYB 3TC9A 1A1MA 1MAMH 4KKNA 4Q97A 2V2XB 1INQA 1B6UA 2VQUA 1CVSC 3AM8A 1RUQH 1ES0A 4IIQB 4NNYB 1TENA 1XGPA 3LPWA 2DTML 1F02I 3LEVH 1T0NA 2YD5A 1I7RB 1XCTA 4QOKA 3BWAA 2HT3D 4MA3A 2PETA 5J1SC 2JB5L 3BPCB 1SJXA 4YHMH 1EGJA 1HI6B 2VZOA 5BRZD 1EGJL 5AAMA 3VGEA 5AZEH 3SKOB 4X7TB 5M95B 3ARQA 3IJHB 2X4SA 2OJEA 5ESVB 1KJ2B 4PJAB 4KUCD 3LKSB 1ZLWH 1BFVL 1F4XH 4JFDB 2EDNA 4UUJB 2MOVA 2ZCKH 3UTOA 2FIRT 5F7FA 3RA7H 1TPXB 2IQ9L 4YHNB 5L2KD 4YDKH 1KJVA 4CJ1A 1R3KB 3VMOA 4Z77A 4JFEA 1JN6B 9CGTA 5BVJB 2PXYB 5F7DB 5D6DC 5C08D 4XB8A 3GIZH 3V8OA 5SX5K 1Q72H 4N8CH 2APFA 2JTDA 1WEJH 2ARJA 2C3HA 3PWPD 3VFSA 2XTJC 3OPZH 1ZVSB 3O3DA 1JBJA 1LNUA 1MWAH 4DKDC 1XF5A 3MRNA 1ZTXH 3WIIH 3O3AB 1OGAB 2CIIB 5DQDH 5EPMB 4UQ3B 5DK2B 1X7QA 4JFFE 1BMGA 5LG1A 1NUNB 2P7TA 3HR5A 4KZDL 5DC0A 5EZIL 5K9QI 5CGTA 3F6LA 5IM7B 3QPQC 1I1YA 1MAJA 1U8JA 4RMTA 4JY6B 3BJ91 3GBLA 3GM0A 2XKNA 2PYFA 5KS9E 4NM4H 3GI8H 2ESVD 3RGVC 3JUYA 3MREA 1X5XA 3KYMA 5IESL 1OTSC 4YQXH 3RI5K 1U8LA 4PJ9D 4IMKC 3VG0L 4A2MA 4KQ3L 1TZGH 4JRXA 2EH8H 4KJWD 4FQIH 4LNVA 2CLRB 5C3TA 3GSWA 1A1OA 2WAHA 2FLRT 4WFGE 4OFDA 2FB4L 2Y7QB 4ZFFA 1NCWH 5IVZB 4PRNB 4NOBA 2E7LA 1IGJB 2I5YL 3QEQE 4HLJA 2YD4A 4OCWL 4BKLB 3RVUC 3V6OE 2H32B 4N9GB 2NXYC 1NJ9A 5DD0H 4P5MA 4HW6A 4MXWL 5E6YA 4G8EB 5HHMD 1NCBH 3AS1A 2WNGA 2W0LA 4B7LA 3FRUA 1FH5H 1KEML 3DO7B 2G75B 2Z8VC 4K3EH 4YWGL 4HPOH 3UO1L 5F9OL 1YN6A 1I1AA 2VL5B 3LKOA 5F7UA 2AJZA 4L8SA 2VMFA 1A1MB 1INQB 4FMKA 3PP3H 2CPCA 4PRHA 3ULSA 1WZKA 1ES0B 1FNAA 1XGPB 4KQ4L 4ESKA 3OBAA 5ADOH 4GQ9H 4YHLL 3NFSH 2A83A 4CRPA 1T0NB 1WK0A 3WN5A 2OQJA 4M93B 2WBJA 5T1LD 3T3PE 1XCTB 3SDAA 4QOKB 3TV3L 3BWAB 5KSAA 1EA9C 3PV7A 4MA3B 1ULVA 5IK3A 1Z5LB 25C8H 1VPOL 1CK0L 2B5IC 2X6MA 1OD9A 5D72H 1BEYL 2EYTA 2N4IA 4G6ML 2Z9TA 1A6UL 2X4SB 1FZJA 1BQLL 2OJEB 3HZKA 4XP9L 4UU9A 3BQUA 4HWEL 3WHXB 1UM5H 3OGOE 4DN3L 5DMIL 5C08E 3JXAA 1I8KA 4HXAH 1KJVB 2WWKO 5AAWA 5CEZL 1FRGL 2Q7NA 4Z77B 4JFEB 3HNVH 5EC1A 2KPNA 3PWPE 3GBNL 1JWSA 1ZHBA 1EJOL 4I48A 2XRAH 2RR3A 5D96C 2AK4A 1I7UA 5GGRA 3K2MC 2CJUH 2KQMA 4N90E 2ARJB 3VFSB 3VXTA 3ZKMD 3BIBX 4X99A 3O3DB 4NBYB 4I18C 4TVPD 1LNUB 1U36A 1DBJH 1XF5B 3MRNB 2HFFA 2PR4L 5GJSL 3RI5F 1DQLL 1YJDC 4HJGA 3QH3A 2DF3A 1X7QB 3QG7H 3MLVL 5ICZA 3Q3GA 2P7TB 3HR5B 1ACZA 5C0NC 3LKNA 5ACZA 3OXSA 1CFSA 4LQFL 3RX7A 3RUGA 1I1YB 1U8JB 4LSRL 1A8JH 1VFMA 2XKNB 3QWRD 2PYFB 3BIKA 1DSFH 4U2ZA 3MREB 3PHSA 1H15A 3KYMB 2Z93A 1U8LB 1EUUA 1G9NH 3LKQA 2GJ6A 4JRXB 5DVMA 1JPFA 1N7ML 1I85C 4LIQE 2EC8A 3LRHA 5HTSA 3GSWB 1A1OB 5IB3A 3WSQL 2BVYA 3AY4A 3IU3A 2W9DL 4KV5F 3UTTE 1IFHL 3NCCB 5DGRA 1QYGH 1FORH 4ZFFB 1DBAL 2NW2A 1JYVA 1JVKA 1P69B 3SKMA 4HJJH 3KLHD 1AO7A 1JF1A 1T2QH 3QIBD 3T3MF 4MB4A 2AK1L 4JG0L 1NJ9B 4E41E 3UC0H 1IILE 4P5MB 1CDBA 3UX9B 4TUKH 4F8TA 4NZRL 1MI5D 3FRUB 2V2WA 4FQJH 4QXWA 2DAVA 1MCKA 4NQVA 1LO2H 3MMEA 1P1ZA 1YN6B 4Y2OA 1I1AB 4WWKA 3WS3A 4ODWA 2XT1B 3LKOB 2AJZB 4KKLC 4L8SB 3RJDA 4M62L 4OT1H 4XP1L 3CFCL 4PRHB 1ACYL 5MERA 3ULSB 5TGBA 5KOMC 3WD5H 1MFBL 3NAAH 3Q1SL 3M8OH 4MXQC 2A83B 2AEPH 3WN5B 2OQJB 3DOSA 2WBJB 1GGUA 4HT1L 1U0QA 3QT2A 4GKOA 3SDAB 4HC1L 4K3JL 2VDKL 5KSAB 4YBLB 2N1KA 4DGYL 2PUQT 5IK3B 1A0QL 4RMUA 3PWJA 4RX4D 5TE4H 3WFEL 4IBLT 3QDGD 2EYTB 5GZOD 5MEQA 2BNRD 1FZJB 3HZKB 4RA0C 1UH3A 1XFPA 4UU9B 3BQUB 3VRJA 3H9SA 4WFEE 3P4MA 4P3CL 5C0BA 1BQSA 2FO4A 3UYOD 1I8KB 4YXLL 4H8WH 1RUMH 4L8DA 4NZTH 3GBML 2W0KA 5I75B 2GITA 5EC1B 5FUOH 1CGXA 3ARWA 1JWSB 1ZHBB 4I48B 4WHTA 1NBZA 1SJVA 4TVPE 3O8XD 4P2OC 2Q76A 3GNML 3HNSH 3L3GA 3K8LA 1FFOA 2AK4B 1I7UB 5GGRB 1NFDA 2BVTA 3HC4L 2UV3A 2Z4QA 4OFYA 1WITA 2VN7A 3O81A 3VXTB 2A9NH 4YFEA 4BSJA 4X99B 4WNQA 4G7YL 4M7KH 3EDJA 4Q6IA 5GZND 5IIEA 4OZIA 2DM4A 1B6DA 2X4QA 4TSCH 1FFNA 4OCYL 4QRTA 3AB0C 2GCYA 4OGAC 1T6VN 2HFFB 3UP1A 3NPZB 4HJGB 3QH3B 3MLTA 3V9FA 3VGGA 5EBLA 3Q3GB 5BS0E 5JNYA 1AQKL 1FVDA 2X41A 4FFVC 4YAQA 1B2WL 5F9WC 4PJDE 3LKNB 5ACZB 3B9AA 3OXSB 1CFSB 1HZHL 4M7LH 3RUGB 1WGOA 1CIUA 1L6XA 2VDPL 1E6JH 3A67L 3BIKB 1I3RA 4P48A 1H15B 4OFPA 2Z93B 3MR9A 3H6JA 1V8HA 1DE4A 3LKQB 2NNAA 4JFQA 3BMVA 4ODVL 1JPFB 3ULUL 4BSVA 3X3GH 5IB3B 4J2XA 2DQDH 4FABH 3IU3B 2VXSL 4QXGH 1UB6A 4QRRA 5TH2A 2DLIA 1RK1A 4RNRA 2NW2B 1H3PH 4HGWA 1CGSL 3I3BA 2FBOJ 3SKMB 3LMJL 3VD3A 3SKJH 1JF1B 1MCIA 3VFPA 4XI5C 2XXMB 2E27H 5EOTA 5F6IB 4PJCA 3DSFH 4K23L 2DBJA 4G9FD 3VFWA 4DN4L 4JKPL 1VCAA 3VXMD 1KN4H 4BH7A 2V2WB 4POZC 2D7TL 4NQVB 1UEYA 3E1F1 3MMEB 1SYVA 3QULA 5GRUH 1P1ZB 4FRWA 3WS6C 4WWKB 1IT9H 3WS3B 4ODWB 4KK6D 3O3EA 1E4XH 4M7ZC 1OM3L 3P0YH 4CUCA 2YXFA 5MERB 5TGBB 3GFUA 5IHUH 5D9SA 2XQBL 3AS3A 4OBRA 4UMGA 3P0GB 5JUEL 5IW3A 1OOAA 4PJHA 4U3HA 1AC6A 2A6DA 2BNRE 3MLRL 1U42A 5CGYD 3KYOA 5F21B 4LAQL 3PWJB 1KELH 1KTRL 1EJ6A 3N85H 5MEQB 1XGYL 4JN2A 4OM1L 4MWFA 5DVOA 2VXUL 3WJJA 3S88H 3TPUA 4LAJH 3D18A 3U30B 3VRJB 3H9SB 3W9EA 4HX1A 4XCCL 1Q1JH 3P4MB 4XPBH 4XXCC 5EZLA 5C0BB 4HS8L 2FO4B 2F5BH 4MNQA 2VDLL 3FAXA 1N4XH 4KY1L 2XWJA 4L8DB 3UTSE 2DIAA 1DFBL 1KLGA 2EDYA 2GITB 5D2NE 1DQJA 2NPLX 3K80A 3DTXA 4WHTB 1NBZB 2GIYA 2Q76B 5JHDA 4QTIL 3L3GB 5C9KA 4NHCH 1FFOB 1MF2H 6CGTA 1NFDB 4OQTA 4XNQA 3WNPA 4UAOB 1F4YH 2Z4QB 4OQTL 1A3LL 4TTDD 4F15B 5F3HA 5IFAL 3E3QE 4WNQB 4Q6IB 3BP4A 5JPMA 5IIEB 4OZIB 2X4QB 3WCYA 3S37L 1FFNB 3OSKA 4OCXL 4QRTB 2GCYB 2ZUSA 4H88H 4K71C 4U2YA 3BD4A 1IC4L 3BPLC 3MLTB 1NLDL 2ATPA 2HT2D 4XMKL 1T7YA 1I1RA 3PHOA 5EBLB 4RBPK 4X5WA 2AI0L 3RZCA 3DLQR 2GSIA 1QFWM 1FVDB 3EYUH 4YAQB 5JNYB 1A7RL 4ONGH 1BAFL 2ADFH 4G8GD 5LGKA 5HVGB 2GAZA 3T04D 3ZDZF 4PB0L 1SBSH 1RZKH 4W6YB 1I3RB 4GAGL 3DNKA 5DT1H 5C6TH 1UQSA 4NC2B 5K93A 3QDMA 1W8OA 3VWKC 3MR9B 1K9TA 3GRWL 1DE4B 5FIEA 3KPSD 4D9QD 2NNAB 4JFQB 3N1MC 2C4FU 2ATKA 2QKIA 2ZG2A 2X05A 1J1OH 4PG2C 3PNWA 3UJIH 1AXTL 2KZ1B 1RZJC 3INUH 4MZ3A 3IDNA 4FP8L 4GLRH 2F54A 1UB6B 4JFXA 2WMPA 3CFEA 4QRRB 4UOW1 5F8QC 5TH2B 4U1GC 3C08L 4F9LC 4MJIA 2R15A 3AMKA 1RK1B 4RNRB 4G9FE 4KK5C 4M9PA 2LTQC 4HGWB 4LHUG 5GGVL 4MXVE 1VGEL 3ZKQD 3CVIH 3V6BR 3VFPB 5BVPH 5EOTB 1JNJA 4PJCB 4Y5YC 3UBXG 3VFWB 3HZVA 4GRLD 5FYJL 2HVKA 4CU6A 5KVEH 4BH7B 3OF6D 4EDWH 1CLOL 4MHHI 3EJYD 2CIKB 3QULB 2HJKA 1SYVB 3P11L 1U2CA 4EI5A 1SVCP 3O3EB 3ZKND 1B3JA 1TJIH 2NY7L 4P5TD 1YY9D 5CIPA 5D9SB 4APQC 4K3HA 4QYOA 4ZD3H 2XA8H 4PJHB 2A6DB 2CMRH 1WWWX 1NFDF 5CJXC 3KYOB 4HIXH 5I74B 4KJQD 1NH6A 4MLSA 3P77A 1VB9A 1CLCA 3RVTD 4OZIF 2ARJQ 1A22B 2GSGA 1V3MA 4JN2B 4OLZL 1GSMA 3O6KL 3TPUB 5HI5D 3D18B 1KACB 5C07A 1A14H 1RJZA 4LBEA 3W9EB 4HX1B 4CMHC 5M94B 5EZLB 5CUSH 3PL6D 1HHKA 4MNQB 4R26H 3WIFA 4IRJD 2XWJB 4O9HH 4MAYD 1KLGB 4F3FA 4OCRL 3U9UA 5I1KL 1DQJB 4LLYA 1UA6H 4XNUH 3DTXB 3F7RA 5JHDB 4LARH 2IAMD 3PWUA 4XTRC 2PO6C 5FA4A 5DRZA 4P59L 3QPXH 4C83A 5F3HB 3BP4B 5JPMB 4JQXC 4M6NH 3V5KA 2VRAA 1T2XA 3RL2A 1LEIA 3SDCA 2YA2A 3KPLA 4JDVA 4G8GE 1A6VH 4OV5A 2ATPB 5FCUL 4U49A 3PHOB 2Q8BH 4XBEH 2ORBL 4OCSL 3WFBH 4X5WB 2D0FA 3RZCB 2GSIB 1DL7H 1CR9L 3FKUS 3MLUL 4QY8A 1MFEL 2UVFA 2R4SH 5F9DC 4NC1C 4WTWA 4D9QE 4UINH 4PJCF 2GAZB 1R24A 1BIIA 1X4YA 1UQSB 2GQHA 4JM2C 3QDMB 2E7MA 5GGQH 2P8LA 1F4WL 2ATKB 5DUPH 4WO4A 2QKIB 4GBXC 3S7GA 5LWYL 3T2OA 3PNWB 5SX5H 1IKFH 2MQ3A 3IDNB 1KB9J 2F54B 4JFXB 3CFEB 4V1DA 1WAAA 3BKJH 4MJIB 4JPVL 2COQA 2BSTA 3QIUD 3TVMD 3KXFE 3O4OB 4X6CE 1QEWA 4YHOL 4Z6AT 4PJHF 4Z18A 4N0UA 1HCVA 5C9JA 5I73C 1OLZA 4PLKD 5EB9A 1GIGL 2ICWI 4OI7A 3IDXL 8FABA 1UWEH 4RDQF 4X7EC 2OLDA 4FFWC 2CK0L 1JF5A 4ZXBD 4BFBD 3HZVB 2HVKB 4NGHL 4E42A 1DQML 3OJ2C 1OSZA 1CDUA 3MLSH 1U3ZA 3VXSD 4AMKH 2HJKB 1T0MA 1U8KA 3T0EE 4EI5B 2ZG3A 1YYLH 2E9BA 4JVWA 1PYWA 1QFOA 4TRPL 1TMCB 4Z7WE 2AABL 2R9HD 32C2A 2F19L 5IJKA 5CIPB 2NY2D 1NBQA 5KANG 1GC1H 3CDYA 2B1AL 4ZOAA 2ZUQC 4QYOB 2CK2A 1TTGA 3BGFB 2EZ0D 4CMMA 4DEPB 1IGYA 3LVEA 5F72S 3WKNA 3PWVA 3U9PH 5B4MD 2W0PA 4IOIA 1VDGA 1EK3A 1TJHL 1AR1D 3P77B 3OZ9H 3W81A 2FJFA 1NDMA 2GSGB 1JE6A 1RHHA 5HYQA 1R3IH 1GH7A 1RPQA 2M2DA 3AREC 5C07B 4Y19E 3D39E 4Y2DC 1NEZG 1RJZB 4LBEB 2JK5A 1C16A 1HHKB 3WIFB 4HULB 4GFTB 1YEFL 3C5ZA 4F3FB 1XF3A 3U9UB 5ISZE 3QZWG 4YFLI 4LLYB 3NGBC 4UT6L 4IRZL 2WK2A 5HSFA 3PWUB 4P4KD 3IDIA 2I07A 4Z7NF 5FA4B 5DRZB 1CWVA 1F90L 3GMNA 4C83B 2ZCHL 1OPGH 3IU4L 1NGYA 4LK4A 2Y23A 3WUWG 4RRPG 3V5KB 1FFQA 1ZK9A 1CU4L 3RL2B 1CQKA 3SDCB 3KPQA 4CBPA 5EOCH 1LEIB 2CUMA 1MHPH 3KPLB 1LP9E 4JDVB 4PJFF 1IZKA 3FRPA 4OV5B 1ZEAH 2IQ9H 4GOSA 2F8XC 1PKQA 3CXDH 4GJTB 3FT2B 3L9RA 3ARBA 3VXRA 5HVFB 4QY8B 1GJIA 4TOYH 4AJ0A 3TN0A 1FDLL 3LHPH 1R24B 1BIIB 2EE2A 4Q0XH 1T80A 5D7SL 3TNMA 4OLUH 4ZYKA 2P47B 1OCWH 1YY8A 4RGOL 4BUGA 4K9EL 2P8LB 2V5YA 2NYYC 5I1GH 4WO4B 4UT7H 3S97C 2R0WL 2O5ZH 2VQTA 4DGIL 4Y4KA 3I2CH 4Y1AD 1T7XA 3IGAA 3R4DA 4K9EC 1JCKA 3LD8B 4V1DB 3KPRA 1QQDA 5HGHA 2BSTB 3KR3L 1QEWB 5HDLA 2ZSVA 4N0UB 4QRQA 5C9JB 3QXAA 1AP2A 3GHEH 5T1DH 5TFSL 3EDEA 1ZKAA 8FABB 3LV3A 4J6RH 5TE6H 2DYPD 2B4CL 5AG9A 5EDXA 5IESH 4ELKA 5HPMA 3D3VA 4E42B 4XVUD 4KQ3H 2NY5L 1OSZB 4HUKB 3QIWA 1NAMA 3VGAB 3L5WA 3UTZA 1NAML 1T0MB 5D2LA 5DMJB 1GGIH 1U8KB 3ESUF 5JDSA 4ZAKA 1P7QD 5DYOA 1PYWB 1LK3L 4NN5C 3KPOA 1DANT 32C2B 3C60D 2G5RA 5IP4A 1NGQL 1MSPA 4CMMB 2NZ9D 4C58B 3HMWH 1IGYB 4ORGA 3T0VA 3AROA 5I1CL 2DMBA 4PV8A 4DFHA 3PWVB 4Y4HA 5JW4N 3JV4A 2VDNH 2VKWA 5CAYB 5JHLH 4IOIB 3GUTA 5GQBA 1F2XK 1WIOA 1BVZA 3UDWA 2FJFB 1NDMB 3FFCA 1BECA 2X1PA 5JPNA 1RHHB 3TM6A 2R23A 5HYQB 3L95A 4HG4K 5LXGH 3T2QA 4PJXE 2JKXA 4MCYA 2ZUWA 5F9OH 1U2HA 2IAND 1C7SA 2V17H 1T66C 2JK5B 3QUXC 5C0CA 3RVWD 1C16B 4KI5C 2BERA 1BQHG 2OP4H 4MSWA 2JE8A 1G6RA 3DUHA 3KS0H 4NOFA 4R97B 1G6RL 3C5ZB 5DFVD 1LMKA 1XF3B 1K6QH 1R6VA 1RU9H 1A47A 4L4TA 2IG2L 3S34H 5K59F 1KCKA 3IDIB 2I07B 2J6EH 4GW5A 5IBUG 3D9AH 1X4ZA 3C6LD 3W2DH 3GMNB 4X9BA 5C0DA 1NGYB 4MQXD 4BSWA 2P5EA 1ZLSH 3KPQB 1J0YA 1WAAF 4XPAL 4FNLH 5T3ZL 2NY6D 3UZQA 1PKQB 3S4SG 5CEZH 5IR1A 1YEEH 4PRPE 5DD6A 3L9RB 3ZL4L 3MCLL 3ARBB 4EBQL 3VXRB 1MIEH 4AK1A 4N8PA 3D0LA 3O9WC 2BXZA 2DQHL 3MJ8A 3MGTA 5D7IF 3GBNH 4TYUA 3TN0B 4DKAA 5D1XD 4ZQKA 3JTTA 4NQDA 4OZFA 4UNTA 4GG6A 1QKZL 3FTGA 3TNMB 4ZYKB 5ANMA 4U4BA 1MJ8H 1YJDH 1YY8B 4NN6C 4ODHH 4Y1AE 5DD5H 4O4YL 4PJ8C 5FM5O 5D5MA 4LGSB 4OD1L 4YXKL 1CXFA 4IOFC 4Y4KB 3C5JA 1DQLH 1ITBB 4ZFGL 5J3HD 2BY0A 3IGAB 5HGHB 3KPRB 4K8RD 1NMCB 4TN9A 3VI3E 2FGWL 4LSTL 4CDHA 2ZSVB 4QRQB 3SGKA 3QXAB 1AP2B 4YPGA 5D71L 1X5FA 4KROC 5HHVL 3LV3B 3SOBH 2XN9E 1YZZA 2VLME 1BQUA 4UBDC 4MZ2A 1SY6H 4KDVA 5F89A 2EDHA 4KDWA 4ELKB 1AE6H 5HPMB 3D3VB 4U1JA 1FAIH 4HWZA 3TA3C 3QIWB 1NAMB 3L5WB 3UTZB 1T7VA 5E6IA 5D2LB 3WSQH 1CDJA 4J3SA 5JDSB 1IFHH 4ZAKB 3F6IA 4OFKA 1IGFH 4GG8A 5DYOB 2FEEI 4P23C 1E27A 4I0PC 4HH9A 3KPOB 5FUZL 1DBAH 5EOCJ 5ACLA 2VSCA 3CDCA 1JWMA 2J3SA 3SDXE 1U93A 3W0WE 3C8HA 2J5LC 2EEDA 5EWIH 4ORGB 4JG0H 4JHAH 4PV8B 2Q7YA 4Y4HB 2HN7A 3JV4B 4FMFA 4XNXL 3GUTB 2ZKHH 5JXAL 3RU8L 1QRNA 4FXKA 5FO9A 1MJ7L 3CJJA 3FFCB 5JPNB 2R23B 3L95B 5GRYA 1NC4D 4G6AC 4MCYB 4FQQA 1JMZA 4WI6A 3RBGA 4QWWD 5C0CB 3CFCH 1QFWI 4MSWB 2GY5A 2CSPA 2VLJD 1G6RB 2FX8H 2W60A 3A6OA 4LSDA 4PY8I 3Q1SH 4HKBA 4OIIL 4XHJD 2A73A 4NO5A 2NLJA 2DL9A 4YEEA 3WIHH 5ADPL 4L4TB 4HT1H 4I1NB 4HC1H 2IQAA 4K3JH 2VDKH 5DEZA 4GW5B 3WNOA 4CAGA 4OJFL 1TNMA 4S11A 4LNRA 4KDTA 5C0DB 3EJZC 4BSWB 2P5EB 4I9WD 3MLYH 4ZUWA 4O2CA 4KWUA 1BD2A 4YXLH 5IR1B 2YD6A 5DD6B 2E5EA 1C5CH 3JWOL 3EGSA 2EEBA 4J12A 4Y5XC 4L4VA 3OL2A 3D0LB 3MJ8B 3MGTB 3LH2L 4JGUA 5LQBL 1CL7H 2XQYG 5MEPA 4L3AA 1T1ZA 5I8KL 4ZQKB 3JTTB 4NQDB 4OZFB 4GG6B 3ULVD 4G3YL 3FTGB 3SQOH 5GRZA 3MBXL 5ANMB 4M48H 4NQED 2D03H 4U1SA 4LRNL 2GUOA 2XOTA 4FQ2H 4JJHA 3B9EA 1T2JA 4PGBA 3N9GL 3WKMH 5D5MB 1KUMA 1CLYL 3H3KA 3FO2A 4Q9RH 1BZQK 3C5JB 1KCVL 3ZDYE 1CE1H 1ZT7A 1OAUL 1YN7A 3HRPA 4M5YH 4LSQL 4L3EA 3HE6C 1QUNA 3KPMA 4S1QL 1EBPA 4YPGB 5IT2L 4NNPL 1J5OL 2I60L 3KS0J 4AT6A 1BP3B 3A67H 4N1HB 3V0AC 1SM3L 5CZKA 5F89B 3BUTA 3HTLX 1ODAA 4U1JB 4LSSL 3THMH 2XZCL 4ODVH 5GS0L 4HWZB 5IVNA 3EHBC 4GAJH 3BRGC 1HYSD 2HMID 2EYSA 5E6IB 5ALBL 1ZANL 2DLFL 5DWUL 1A7PH 1HYRC 4GG8B 5GGTH 2AJVL 1E27B 1H3WM 3U4EA 4HH9B 5E95B 2HTKC 3VFUA 4UTAL 1JWMB 3P30H 3HE7D 1INDL 3LMJH 1U93B 3LQAL 1CFVL 5TF1L 2Z91A 2Q7YB 2CXGA 4XAWL 1IM9D 4K23H 2MQ0A 1I3VA 1KCUL 4I3GA 4Q74A 1C7TA 1QRNB 4FXKB 5FO9B 3O45A 4WW2A 3PGDA 5DI8A 1ZSDA 3QAZB 1UADC 3ARXA 1CTNA 2D7TH 1H3XA 5HI3C 3MRHA 4FQQB 5FYKD 1BM3L 1DVFA 5MP6H 3CMOL 5J9PA 4UT9H 4KXZH 1FNHA 5JQ6H 2W60B 1YECL 5I17A 4HKBB 4RWYH 3P4OA 3NBNA 3U48A 3RX5A 4PRDA 1OTTD 2A73B 4NO5B 2NLJB 2UZIH 4RAVA 5FDYA 1GAFH 4WHCA 4GG6F 3MLRH 4I9WE 1KXTB 5LCVH 3SGDI 1FPTL 1A4JA 4LOUD 1YQVL 3FHQA 5E8EA 5FM4A 5D5MF 3NA9L 5DD3H 1CFBA 4LNRB 5FGCB 2BJMH 3FFDA 3VXPA 1DUZA 3BKYL 5DXWA 1L9NA 3KPTA 4ZUWB 4O2CB 1SHMA 4HEME 2P8MA 5C0GA 4XCCH 1BD2B 2DLHA 3O2VH 4S1RL 4W6XB 4ZTPL 5INCA 3NABH 2JELH 4HCRH 2AQ1A 5F3BA 1DFBH 3EGSB 4XPFL 1UZ6E 3SE8H 4L4VB 4WFFD 4NQEE 3F65A 4LKCA 5MEPB 3QA3A 5L0QC 43C9A 1T1ZB 4QTIH 1KPUA 4K3GA 3OAYK 1MIMH 2NMSA 5DQ9A 1JF6A 4OQTH 4U1SB 2GUOB 4H1LA 4PGBB 3SBWC 5C0RL 1V05A 3ZTJH 5F71A 2FH6A 3FO2B 5CLTA 1ZT7B 5HHXH 3MLZH 1UZ8A 1YN7B 5DURB 1F6AA 4L3EB 3HZMA 4MD5A 1JNHA 4WI9A 3KPMB 3I6GA 4AT6B 3SJVA 1MCNA 4TPRL 5ENWA 2HYMA 3DRTA 1RZJH 1GGCL 4RFNB 3GRWH 2LU3A 3ZDXE 5IB4A 4JFDD 4M3JA 5AZ2H 1C5BL 1AI1H 2EYSB 5D8JH 1KFAH 3PWLA 4FA8A 3RQ3A 3A6BH 3ARYA 4P2RE 4PIRF 3U4EB 4PLNC 2GW5A 2PXYD 3VFUB 4PJ9C 2VZ3A 1F00I 4HS6A 4KJWC 5EO1A 1S9XA 1TTFA 1XGRA 3FN3A 3QHFH 3WV0A 2J8UA 2Z91B 2VQ1A 3ZHLA 2CUIA 1AHWA 1JNNL 5IW6A 4IRSA 3E0GA 1A1NA 1PQZA 3O45B 3PQYE 4WW2B 1OGAD 3PGDB 1OAQH 3MV11 1ZSDB 3IXTA 5D4QA 1W0VA 4X98A 2FEDD 5GGSA 3QR2A 2GYSA 5EORL 5JW3L 3MRHB 3P0VL 1DVFB 1X4XA 3VA6A 5J9PB 5I8OL 4ZUUA 2HJLA 2AS5M 5E6ZA 1QSZA 1C08A 1IGCL 5HDBF 5TPWH 5I17B 3BD3A 3P4OB 4NHUA 4LDLB 1FNGB 4PRDB 5CP7A 4FTVA 3V0WL 5CP3H 4AYFA 1IC1A 2KBGA 4RAVB 2EDQA 3HC0A 4U1HA 3BDXA 3FN0L 4L9LC 1KCSH 1A4JB 3TEUA 4M03A 5E8EB 3D48R 4UNUA 4OLZH 3FFDB 3VXPB 1DUZB 4UILL 5CILH 1BPVA 4X83A 2P8MB 5C0GB 4R2GB 5DK0A 2FGZA 5TE7L 4M9OA 5JOFA 4ORZC 5INCB 3RGHA 2DMKA 2P44B 5F3BB 4FQ1L 1EUTA 1J11A 4F9PA 5I1KH 1E4KC 1UYWH 1KJ3H 4LKCB 3R8QA 1TNNA 3QA3B 43C9B 4YC2C 1KPUB 1J1XL 3FOLA 1DN2A 1CICA 1QBMH 5DQ9B 2GT9A 3HAEH 1A9BA 1JZ8A 2BSRA 4H1LB 5A2JH 1UH2A 4NO2A 1MUJA 6FABH 2BNUA 1Z9OA 3ZKXB 1PFCA 4L8CA 4OI9A 1UC6A 1DBKL 2D9CA 2FBJL 1WZ1L 3RPIA 3BZEA 1UZ8B 3G6DL 3ZKMC 4QOKD 1F6AB 1CR9H 2BNQA 3HZMB 1ROWA 4MD5B 1JNHB 1H8OA 2V6HA 1CZ8L 4X4MA 2OR8A 3I6GB 3V4PL 1CXHA 2YXMA 2VOTA 4YZFF 3SJVB 5BZDA 5ENWB 1N5YL 3AXLA 4JDZA 3DRTB 1NMAL 4WW2F 3I9GL 5I1EH 4P46A 1FL3A 2DB8A 4U6YA 4C56A 2X1QA 5IB4B 4X9HA 4Y5VC 4KPHL 4LSUL 3NCJH 4RDQG 4AY0A 3OAUL 1CF8H 3PWLB 1UWGH 3VGHA 1PGRB 1MFCH 4JFED 1N6QL 5FF6A 3MRBA 2ADGA 3MV8A 3R1GL 3O3UN 4HS6B 1T20A 5EO1B 1S9XB 1XGRB 3QUZA 1GIGH 4P2QE 1H9VA 1U8PA 2J8UB 2VQ1B 1AHWB 5IW6B 3NACH 4U1IB 4IRSB 5T3XD 1A1NB 1PQZB 1GOGA 2AV1A 1V7NL 2EC9T 4HD9A 2ITDA 4HGKC 5D1QA 5HDOA 5HYSB 2X9XA 1E0OB 3ARZA 3IXTB 1W0VB 4X98B 4EUPA 3KLHC 3SE4C 2MJWA 3QIBC 5GGSB 3NMEA 1RZFL 5J13B 4WU5A 4KUCF 3K46A 4ZUUB 3ZTJG 2HJLB 4HEPG 1C08B 5E99H 4XVTL 5E8DL 4HAGA 4NHUB 2E6JA 4PB9L 1DBMH 5CP7B 4FTVB 2MQCA 3BKMH 5DMKA 1FZKA 1T83C 3HC0B 4U1HB 2XXCB 4XPTL 4JRXD 4NCDA 4YDLB 2CGRH 1V7MH 3CFJA 4ZPTA 3T2NL 2R0ZH 4X5XA 1CG9A 1UFUA 3BE1L 1N5AA 5DK0B 4F58H 4M00A 4KH2A 1DANU 4CN6A 4GMSL 5JOFB 4NKQB 1DCLA 1JGEA 4NNXA 5GZOC 5ILTL 3AMLA 5I18H 2JCCE 3OWEA 5IWLA 1F58H 4TNWK 3DYOA 3H42L 4IRZH 4PJ5E 4KV5E 4P99A 3G6JA 5I71C 3FOLB 4YHYC 2IALA 4LCIL 1CICB 2GT9B 1A9BB 1UM6L 1I1AD 4JO4L 2BSRB 1X6NA 4NN7B 4NO2B 1MUJB 3PWNA 3N1QC 2BNUB 4DQOL 3T3ME 4MJ2A 4PRHD 1UJ3A 4OCMC 1P9MA 3O8XC 4L8CB 1YEKH 3QXTA 3MA9H 2QTEA 4Z9KB 2WIIA 4XVJL 2R0LH 3RPIB 3I84A 1JPGA 3K7UA 3BZEB 5B38G 2WBJD 3F62A 3SDAD 2IWGA 5KSAD 2BNQB 5GZNC 2VO5A 1G9MC 1QNZH 2J8UF 3V7AE 4ODBD 4R4FL 3B6SA 1HCFX 3LQMA 3WEXA 5BZDB 3AXLB 4HMDA 4JDZB 4JFPB 5JW4Q 2A1WL 3L7FA 4D0DA 3MGAA 3BT2L 3BQUD 4P46B 4K9EH 1FL3B 2XTJE 4U6YB 4C56B 1IAIH 3LS4L 1A21A 2ZUTA 4NDMA 5FF6B 1PY9A 3MRBB 2YPLA 1IAMA 4WVRA 2DOCA 2ADGB 3BAEH 4WEMB 5B3NA 3MV8B 3KR3H 2R0KL 1G9EA 1T20B 2AK4D 4Z7OE 4LLVA 4NQCA 3QUZB 2MTPA 1BBDH 1U8PB 4P4RA 1FIEA 5FHAL 2QLVB 2VDQL 1TJGH 5DJCA 3LRSA 2AV1B 4X6DE 2Y6SD 2ITDB 4WTZA 1MCWW 1CT8A 5D1QB 1FYTA 5I30L 3N1FC 3ALPA 4EUPB 3HAEG 1BFSA 1FV1A 4WU5B 3TESA 2P46B 2EDLA 1J7VR 4G5ZH 1Q38A 1LK3H 3IJSA 3U4BH 4JRXE 1NKOA 3WXVH 4LASL 1FCCA 4JRYA 4ACPA 5EBWA 5B3JF 5DMKB 1CI5A 3BSZH 1J0KA 1FZKB 2FECI 4D8PA 5BJTA 4KK6C 3HNTL 3WO4B 2GJ6D 1ZA3A 3CFJB 5T5FL 4ZS7H 4ZPTB 4KHTL 4TNWF 1BJMA 4X5XB 3HI1A 4JFZL 1MFDL 3V4VL 1CG9B 3GMMA 4X80L 4H20L 3NPSB 1NLBL 5DLML 2FRGP 1J1PL 1N5AB 4QLRA 5CGYC 1JI2A 1G7QA 2VZTA 1AO7D 2YK1L 3QDJA 3E2HB 1JGEB 4NNXB 4PY7A 3SEPA 2X4NA 1Y6NR 2HLAA 3FMGL 1ZXQA 2IG2H 4YK4B 3G6JB 4PRHE 1HK6A 2IALB 1EHNA 4I3RH 4KK9D 3BKCH 3UBXI 4LMQI 3ZMRA 4WWKD 3STBA 4M7JH 4LVOB 1OQOA 3PWNB 3NTCL 1OAKH 1FO0A 1UJ3B 1FO0L 1E4WL 3O6MH 2WIIB 5DC9B 2AERT 5ECJE 1ZLVK 4LRIC 1JPGB 4MCZA 1RIVL 4TTDC 4JFOA 4Z7UF 5FA3A 3B43A 3MCLH 1RJLA 3L1OL 2KQNA 2JJTA 1TZHA 3B6SB 2OTPA 5IMLA 3LAFA 3WEXB 2HT2C 3GK8H 5CEZE 4WY7L 3PGFL 1QKZH 5ESQA 3EOBA 5DD1H 3L7FB 4D0DB 5FYLL 1TXKA 1L7IH 3H9SD 4AL8H 4O4YH 4ETQA 5C0BD 3QCUL 1GRWA 4NDMB 4S0SD 4YXKH 4ZTOL 1TQBB 5CZXD 5DUBA 4B7IA 3QNXA 1S7XA 5JTWA 4GAYA 5I6XB 2AKRA 4L5FL 1Q94A 2N7BA 4LLVB 4MNHA 4NQCB 1R5WA 4NKMA 4OFYD 4Y0GA 5EH1A 4P4RB 1NBYA 1KLFA 1U92A 4XNZB 2E7HA 5DJCB 4S10A 5IVXE 3LRSB 2EDXA 5C0IA 2JJVA 1CT8B 4XBGA 2BRRL 1FYTB 2HT4D 5I1HL 1FV1B 5FUCC 3CU1A 2BCKA 2XY1A 2NTSP 3IJSB 1FGNH 1JPTL 4GRLC 2X5PA 5IJVA 2GJ6E 3C2AL 4JGJA 1MJJA 1KSRA 1MCSA 3E6HA 4JRYB 3EJYC 1MVUA 1E4XI 5EBWB 2OMNA 3G6JF 3RWFA 2V5RA 4D8PB 5BJTB 1OP9A 1ZA3B 2HAZA 2ZPKH 3RDTA 3ZKNC 3ULUD 1SJHA 5DJZA 4X8XA 4P5TC 5JXAH 1YY9C 1ITCA 4KMTH 4P5KA 1AO7E 2DKUA 4I3SH 2QHRH 3HI1B 4L8BA 3EYOA 3GMMB 4QRRD 4A6YH 1OAYL 1AXSA 4MB5A 3ET9F 2IPUG 2DQUL 3ZDZE 3D2UA 1IAOA 4ZUSA 3GSNH 5DUMH 4KJQC 2IPTH 1G7QB 4Y4FA 4KKCD 4K3DH 2MPAH 3QDJB 4Q58C 3L5HA 3B2VL 3RVTC 2E8YA 5K9JH 2MWCA 5IEKA 4PY7B 2WBKA 2X4NB 2YUVA 4HXBH 4OIIH 4XAKD 3CLFL 4YPJA 2HLAB 1OF2A 5HI5C 4WI2A 2DQTH 5ADPH 3P4LA 5D70L 2DIBA 2UWEE 2YMXH 4M43L 1NCCL 3U83A 3PL6C 1EIBA 3OGCA 3S98A 3UTPD 4IRJC 3D87B 4MAYC 4G6FB 4Q9BA 2X42A 2VKXA 4I4WA 1HNFA 3B5TA 4KTDH 2QJDA 4EXKA 1FO0B 1I9RH 5FM5M 3CFBA 5GS1C 2IAMC 2F5AH 1NEUA 3X17A 2QADB 1CGWA 2YPVL 4MCZB 1DTUA 2MNUA 1BOGA 4JFOB 4S1DD 3N0PB 5FA3B 1WT5C 1RJLB 3L3DA 5KANI 4CADA 4PYGA 1TZHB 2IH1A 1EEYA 3H9SE 2NQCA 3BEWA 2G9HA 4HBCL 5IMLB 3MOAH 5C0BE 2E9IA 1EAJA 4JPKL 2AJXH 3K81A 3QWQB 5ESQB 3EOBB 3VXOA 1OP3K 1I9JH 4O2FA 1EPFA 2MKWA 2PTUA 4WEBL 4C57C 4EIGB 5L9DL 4IEFB 4OZGF 3OMZA 3B9KA 4ETQB 1I9IL 4CKVX 3UROR 1P4BL 1RVFL 4BM7A 5HY9A 4PBXA 4MNQD 4K94C 1NFDE 1EHAA 5DUBB 1BHGA 4P49A 3QNXB 1S7XB 4XGZA 1TDQA 4GAYB 2AKRB 2R8SL 3QCTL 4OZIE 1Q94B 5IOPA 5JHDD 4GLRI 5SWQA 1B4JH 4MNHB 1N59A 1R5WB 4NKMB 4NNPH 1J5OH 3SGJA 5E70A 1NBYB 2ADIA 2VLKE 4JO2L 1U92B 4OLVL 2AVGA 4P3DA 1J88A 2VDML 4F80A 3QIUC 5C0IB 4WI4A 3TVMC 3QUYA 2FX7H 1IC5L 4XBGB 3HI5H 4PLKC 3QP3A 5ALBH 2DLFH 2BCKB 3RZCD 5DWUH 4XWGL 5HGBA 4N0CD 3EZJB 1MFAH 4ZXBC 4TULL 3BH9A 5IJVB 3EAKA 1MJJB 3QBTB 5BZWA 2CKNA 3E6HB 3ZT7A 1MVUB 3K74B 3ABZA 3OTTA 3U7WH 3QDMD 3RWFB 5KBNC 4QRRE 3MV9A 4N68A 1U8OA 5DA4A 3RDTB 3QNZA 1SJHB 5DJZB 2R9HC 2NY2C 1Y18A 3UZEA 2DMCA 2C3XA 1JMXA 4P5KB 4L8BB 2F54D 3EYOB 2EZ0C 4U0RC 2HH0L 4YX2H 4N1EA 2X40A 1AXSB 4MJID 1KGCD 3D2UB 5B4MC 1IAOB 4U33A 2IPKA 4ZUSB 2OI9C 5I15H 3LSOA 4Y4FB 3HUJA 1AR1C 1IAKA 2DD8H 4FXLA 1RQ5A 1JZ3A 2APBA 1TFHA 1YECH 5IEKB 5T33L 3VFOA 4L29A 5E7BA 1OF2B 2NX5A 3MGOA 2B0SL 2V7NA 5FYJD 4U7KA 4OQ1A 5JXEA 1K85A 1WBXA 5ALCH 2VDOH 2OXGA 3TBSA 5DHVH 3OGCB 4U0QB 3ISWA 2FWOA 1YQVH 1A7QH 2OR9L 4EI5D 3O6FA 3EO9L 1EZVX 3CSBA 3U1SL 4I4WB 4RFEA 2J88H 4Z7VA 1VACA 4FHBD 1UCBH 4P9HL 3CFBB 4P4KC 1MJUL 1RIUL 5CZVH 1W72H 4BQ9A 3CX5J 2KZWA 1BOGB 5DQJA 2LABA 5IROC 3FB8A 2VERN 3L3DB 1XR8A 3L5JA 1RZIA 5F96H 4CADB 5FEBA 4LCWA 3LN5A 5LBSH 5E8NA 2IH1B 3CK0H 1EEYB 4R0LC 2EDKA 3WE6A 3BEWB 2G9HB 3DETD 3RAJL 5IMKA 5BMFL 1Z3GH 1ERNA 3VXOB 5E4IA 2DQCL 4O2FB 2VXQL 5C07D 5ITBL 4P9ML 5DJYA 5KN5A 3EYSH 2W65A 2DWEA 3B9KB 3CLEH 3QJFA 3HCVA 4PJEA 5HY9B 5SWSE 5JHDE 5L6YH 2HFGH 1S7WA 4XMLL 4GQPH 1U3YA 4KRNA 4OD3L 4QCIA 3DMMA 4AIOA 3AVEA 5CD5D 3Q6GL 4XGZB 2P5WA 3SKUD 2WUBL 1DQTA 5IOPB 1T4KA 5SWQB 1N59B 2X89A 3S5LG 3HFML 3HPJA 4NWUL 2ADIB 1EMTL 3JSSA 3QXUA 5BV7B 4P3DB 3TYGL 5HHOA 4G6KL 3SDDA 3SDCD 3QUYB 1JTPA 2B7DT 4DGVH 4HZLA 1J05A 5E0QA 2RCSH 3VH8G 3MUGA 3OXRA 5TDNA 3HG1A 5HGBB 1NUDA 3MODH 1KN2H 3BZDA 3QDME 4KUZL 3BH9B 5A43C 4Z7NE 4HAFA 4BFGA 1NUFA 4XVUC 5BZWB 5D1ZA 5GRJH 3BESR 4PS4H 2Z31A 5E9DE 2F53A 1OARL 3DVNA 4ZNEA 1D5IL 2F54E 1PEWA 3MV9B 1JNNH 4O58L 1HIML 1DR9A 4PJFE 1U8OB 1LDPH 2AEQL 3QNZB 4WO4D 3GJFA 4NT6A 3C60C 2EH7H 1Y18B 4WUKL 2NZ9C 1YC8A 1NGPH 3MA7A 3QHZL 4V1DD 5EORH 2RAMA 1R3HA 5FYJE 4EVNA 3O2DH 2IPKB 2KKQA 3LSOB 3HUJB 1IAKB 2Y07L 2R56H 1CQYA 3ZLQC 3GI9L 3S96A 2HP4A 3VFOB 4XWOC 4L29B 1L0QA 2NX5B 2V7NB 3MGOB 4FQLH 4OFIA 3QFJE 4PD4J 1CDYA 1Z2KA 2Y5TA 5E5MA 1ZT1A 3OQ3B 5HGDA 1WBXB 4DAGH 5E2UH 1RUKH 3RVWC 3FN0H 3TBSB 4KRPB 2FWOB 3O6FB 4CVXA 3C6SA 2J8OA 5DFVC 3JVGC 3FHAA 4RFEB 4PG9A 4Z7VB 3T0XA 3MFGB 4R4ND 1VACB 1PG7L 2OMBA 4K2UL 4Z5RA 1F8TL 3C6LC 5DQJB 3FB8B 4R6UA 1XR8B 4MQXC 4ZO9A 1RZIB 4LCWB 3LN5B 1YA5A 5E8NB 3WE6B 1E4JA 1X5KA 5IMKB 2NY6C 4LLUA 1J1XH 1CXIA 1S7VA 2ENSA 2OR7A 3O2WH 2IEPA 2YC1A 5D7KE 2IGFL 3SCMA 4M1GL 4BQ8A 1TCRA 3REWA 4XP4H 5DJYB 5KN5B 3IT8D 2W65B 2DWEB 1RULH 3QJFB 2BZDA 2O5XL 1IEBA 3HCVB 2LVEA 3F58H 4FQXA 4PJEB 5A2LH 5D1XC 4TVPH 1S7WB 5BOZG 3C5ZD 1MNUH 4QCIB 3DMMB 4ZPVA 5DJ8A 2FBJH 5J1TC 1WZ1H 2P5WB 4OLEA 1UXWA 3IDUA 1CS6A 5EA0H 5EZOL 3DSNA 5KS9A 4ERSH 1JHKL 1T4KB 3UAJD 3HN3A 4XPHH 4I2XE 3KAAA 3MRLA 3DO3A 2L4OA 4ISVA