2JJWA

Structure of human signal regulatory protein (sirp) gamma
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
111
Chain Sequence
LQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKNVEFKSGPGTEMALGAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Paired Receptor Specificity Explained by Structures of Signal Regulatory Proteins Alone and Complexed with Cd47.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords SIGNAL REGULATORY PROTEIN GAMMA
total genus 21
structure length 111
sequence length 115
ec nomenclature
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jjwA01
5F7EH 1J8HE 3ARFA 3CZFB 4Z76A 1J9CT 3NABH 3SBWC 3PDGA 2XPGA 1U8JB 5F7HA 4XPHH 3U7WL 3LEXA 3SY0A 2L7JA 2X4SB 2ORBL 3G6JB 4I0PA 2X4NA 4UB0H 4MJIA 3FO0L 3B2VH 4YHZH 2FDBP 4LFHD 5E8DH 4HIIA 2NTSP 2V7NA 1IL1B 3O9WC 2Q6WB 3FHAA 1UQSB 4NQCB 2ATKB 4P9HH 3QH3A 2BRQA 3FO9A 5EOTB 3R8BB 1FDLH 5EUOA 3L7EA 3RUGF 1G6RB 4F9LC 2F5BH 1RZJH 2NXYD 3TH3T 1HINL 4TSBH 3KYMB 1BBDH 3BDBA 4FZ8L 2H3NB 3HR5A 4D9QE 3RWHB 2X10A 4EVNB 3GSUB 1NCBL 5TE7L 3C6LA 5IB4A 3HNSL 3I6GA 1I7RA 3VH8A 3MJ8A 2EYTB 3DMMD 4K7PX 4OD3L 2W9DL 4N8PA 5DJYA 4M6AA 3IYLW 5D9SB 3L3JB 5F6HJ 2ZSWA 1Z3GH 1B2WL 1L4IA 2ITDB 2IBZY 1JPFA 2IPKB 5LG1A 5CS7A 2A83B 3TGXA 2A0LD 1EEZA 5DD3L 3WSQL 4MCYA 5JXED 4LBEA 3DXAE 2VR9A 5IWLC 3V52L 1TQCC 5K9QG 1IAII 1IAIM 4HSQA 4Y1AE 4PS4L 4JZNB 4PG9B 4X9HA 3INUH 2DLTA 5DWUL 4XMLL 1WFUA 2AW2A 4AEIL 1UJTA 2BMKA 1MJJB 4M5ZL 1T1ZB 1A6UL 4R0LA 3SE8L 4OJFL 4YQXL 1LO0L 4GSDL 3U0WL 3ZKMD 4NQSA 4GLRH 1RUPH 1HDMA 1F2QA 1AXTL 1LK3L 1HEZB 2VABA 3T3MF 1H3XA 4JFYA 1HYSD 1F5WA 3IS0X 5C0DB 3TH2T 4RGMB 1F4WH 3VXUE 1PSKL 4BJLA 1AR1C 3QXVA 3OR6B 1B0WA 5IW6A 2ESVE 4KQ4L 5FFLA 3N85H 4HCRA 3VFWB 2BX5A 4NIKB 5ITBL 3BSZL 3TEUA 1IGYA 1J0IA 2WWMD 4LASH 3BP4A 1JPSL 1A7BA 4BUGA 3SDCC 5I15L 5C8JA 3ARUA 4GW5B 2DQDH 1R3JB 1FJ1B 5H94A 4FQLL 5C07D 4N9GA 5DEGB 3ZLQC 3BJ91 1CS6A 4D94A 5IIEB 4PLKC 3WDJA 4FNLL 3TVMA 2ADGA 4KDTA 5FXCH 5C07E 4OCXL 2YD1A 4K3JH 1H5BC 1A14L 2YPLE 5GZOC 1YEIL 4FQIH 3FRPG 5IVZB 1QPPA 5GRUL 4U0RC 3QUYC 1BZQK 3WO4C 3ZT6A 3C6LB 1FO0A 5C70A 2LQRA 3WUZA 5L8JB 1OY3B 1LK2B 3VI3E 5CJXA 1G7IA 4FTVE 1A5FH 2YKLL 4L29A 3FRUA 4ZFOA 2ZJSH 3OGOE 3HG1E 4HXAL 4AJ0A 1RIHH 1A6AB 4WUKH 5JIKA 3B5HA 2P1YA 4LVOC 3PDDA 3DIFA 1XF3B 1KN2H 4OJFH 3LKQA 1I4FB 5HHXL 3VGFA 1NEZB 2BVOA 5AEAA 5IB3B 5L2KB 2WLYA 4K7FA 2ZUYA 2FO4A 3QG6B 2BRRL 1F00I 2RFXA 4OLEA 4OCSH 3QBTB 4I0PB 5A2IH 2OR8A 2YC1A 4XP6H 4X8JA 4JG1H 2QSCL 4Y5YB 3FN3A 3OKKA 1R3KA 3IDMA 3VDCA 1KLUB 3F7VB 2JJSA 3QUKA 3C5SA 4JRXE 4PJFB 3O2WH 3IKCA 5FA3B 4B50A 4X6CF 3TT3L 3RWCB 2Y06H 1CBVH 5DJZB 5IEHA 1GRWA 2XY2A 1ZK9A 3Q5OA 1NKOA 5D2NE 4I0CC 2FX9L 3BPLB 4JRXD 3MRRA 3SE4C 4JHWH 3VXSA 4JDTH 3VRJB 3QIWC 2QTEA 1BGXH 1F4YH 5A2JH 2DLGA 3LN5B 3LN4B 3KYKL 3TNNB 5CLWA 2ED9A 1DUZA 3B2VL 4YHZL 3HE7D 3O8XD 3ARGB 1JGUL 3QUML 4CVZA 1R5VB 1QRKA 4G6AD 5D7JB 1E4JA 3QO0B 1T83A 4F58H 4TNVF 4Y16D 2ENYA 5CWSA 3AM8C 3P9MA 3KPQA 4OFPA 3MRNB 5B8CC 4HEME 1FE8H 4X4YA 3QFJD 1AGCB 5B39A 1ZA6B 2Q8BL 1GJIA 3B8SA 4DGIH 4UV4H 3EIFA 2BVPA 4HGWB 1OTUD 2VLKB 2V2TA 1I75A 2WUCH 4FQ2L 4HIEA 4O4YH 5L88L 2CUHA 4G80B 5FYJE 2RB8A 2FEEI 1EFXA 3RWGA 4XPAH 1HH9B 4MQ7B 4XCCL 3WXWH 3ZMRA 3T2PA 1RHFA 4NNPH 1U0QA 1RUQL 1I7TB 4C56B 3L1OL 1F11A 4KHTL 5LCVL 4CVUA 2Y9RT 3EYSH 1F45A 4YIQA 5JW3H 3VFTA 5FYJH 3MV7A 2Q86B 3GSRA 4P0DA 5DVMA 2BNRA 3PP3H 1L6XA 4QRSB 5C09E 2Q76B 3C60D 4JM4L 2VISA 3MGAA 3K4ZA 4OSUH 3F7PC 5D1ZA 1DANT 4N1CA 4OI7A 4GXVL 4EN3D 1F58H 3TBVA 3DSFL 3IAGC 5C09D 1TITA 2HMID 4HLZH 1A9BA 1YZZA 1GHFH 2X4OB 2YUZA 4HF5H 1T7XA 1IQDA 2UYLB 2APVA 4XNQB 1R3IL 1ZLUK 1X9QA 3B2UC 5ISZE 3S8WA 4R4ND 5GRJH 3STZA 3PWVA 1LO3L 2NY2C 1LD9A 4K71B 3MRPA 3VXMA 2F15A 4C56D 1KCVH 1VFBB 4LHUA 2VDRL 2DB8A 1LE5B 1ODAA 4NJ9L 5CJQH 1K5NA 4WGWB 5J1TC 3GDBA 1HHKB 4GXUM 4JFDB 5FHAL 1HDMB 5DK3A 3WFEL 1T83C 3OAUH 1XGYL 4X9FA 4W4OC 4BFGA 1C5CH 2XICA 4KVNL 3CSYB 1ZT1B 3SGEI 1MJ8H 3MMEA 5INDB 4R0LB 3RA7H 2YMXL 5C08E 3MJ9A 3QUXC 1NAML 2CUMA 1QO3B 1QSFB 4Z0BL 3WN5A 2B4CL 4PJHF 2ZUTA 1C16B 1DUYA 5KVFH 4MD0B 5F9OL 4I48A 2IANE 4YHML 4UIMA 2FWOA 4OM0H 3DUHA 3K2MC 1JWMA 4P2CG 5IQ9B 5FYKH 1V5JA 1QVOA 1AC0A 2XG5A 4OZFA 2MFNA 2QSVA 4MWFA 2H26B 3ZL4L 4PJIB 2VWEE 5ACMA 4UI2A 4UOW1 3QUZA 1YEJH 5E24E 5EBWA 4L4VB 3T04D 4KKCD 1MVUA 3FZUD 2A6KA 2J6EH 2OMNA 4PRPD 5CEXA 1LP9F 3QWQB 2BFVL 4U6XB 2DM2A 2A9NL 3OKDB 4EVNA 3KLHC 4Z7OE 5IVXE 3ULSB 2F5BL 5F89A 2OZ4A 2EXWC 5DUBA 2YK1L 3QFDB 5HPMA 1OW0A 3T77B 3TBYB 3T4AB 3V79C 1NBYB 2ZCHH 4HG4K 1F8TL 4UQ3A 3I50L 3LS5L 5HHNB 2FECL 5A2LH 5I1KL 4HIIB 2XZAH 5IVNA 3RGHA 5FO9B 5DMGC 4XZUA 5HHXH 4PBWD 5LQBL 3KPRE 2DJSA 5GISL 3T1FA 3WLBA 3QNYA 5KJRH 5K59E 3SDDD 4G7YH 4ODWB 2F8VA 4XT1C 5KN5A 1BWMA 1KIPA 4RMVA 4LNVA 3GB7B 1WWWX 1NUDA 4HUXB 5ANMB 3GKZA 5JW4M 4JLRA 4JFQA 4QTHB 1YQVL 4OQTL 3X12B 4ONHB 3T0EB 5D72L 3VXUA 3V4VH 5MENA 3RVTD 3DTXB 5DZOA 2NY4D 2BY3A 4FMKA 2CKBL 4GOSA 5GS2D 5JQ6H 4EI5B 3GNMH 1C1EH 4QHLB 3QUMB 1UJ3C 4N0YL 3LB6C 3TO4A 2EH8L 3L5WB 5DJ0A 5DDHA 1QYGH 1JGUH 5A16B 4ZS7L 3MRKA 1OTTD 1LDPH 3MLYL 3EYVB 4RA3A 2D7OA 3O3EA 3KR3H 4XVJL 1GC1L 4U6VH 1LE9B 2MQ3A 4QXGH 4K3EL 1JPGA 3TNMA 1Q0XH 1RV6X 3LH2H 2OL3L 3P77B 4JN1L 1A9EA 1OAKL 2PTUA 3K4AA 4OBSA 1CIDA 3SO3B 3CVIH 1ORQB 3GBLA 4M1GH 1EJ6A 2C1PA 3FOLA 2WBKA 1SBBA 1FZJB 4JAMB 4CMMA 3G04B 4WFHD 3BP5A 1QLRA 1J11A 4LFHG 1QFWH 3TBYA 1NSNL 2VWEC 5IBTH 3MBXL 3WUWB 1XZ0A 4ZTPL 3MRQB 3VWJA 1T5XA 4XWOC 3OTTA 1AFVL 1B0RA 4UAOB 4JN2B 5GS0L 1YEDB 3DETC 5FB8A 4XVTL 4KDTC 5LBSL 2R2CA 3UBXB 1DLHA 2ERJC 3OF6A 3D39B 1HHHB 2AAVA 1ND0A 1O7VA 3GBNL 3RZWA 1NJ9A 4M6OL 2P47B 2XWBA 4OZIF 1DQLL 4NM8H 4UDUA 5DK2A 3BDYH 2IH3A 4P23B 1OCWH 5KAQF 1S7WB 1PLGL 1YMMB 3HZVB 1FIGH 1T3FB 4I5BA 3QFJE 2OZ4H 4LARL 1A7OL 4P2QA 3C5ZA 4UU9B 1MJ7H 3NCBB 4CVXB 4N5UA 2VXVL 2W38A 4YR6A 1I9RL 4E0RA 3DV4A 3L3GB 1K4DA 3ILPA 3IDGB 2D03H 4PJ5A 4A6YB 3GKWL 1CGVA 3AM8A 1PDKA 3FT4A 3DPBA 1PJ9A 3FL7A 3TN0A 2DM7A 1GPOL 4JJHA 3BD3A 2A2QT 4I8DA 4KQ3L 4BA8A 2EDLA 3IU4H 1NFDE 4JGJA 1Q1JH 4HWNA 1YEFL 3QQ9D 4X80H 4NO3B 4FZEH 5DJXA 4HPYL 4LVOB 2X41A 4NHCL 5D7LD 4N90E 1XH3A 3MLZL 4YBLC 1HXMB 3QXWA 5E0QA 4PGZA 3EYFB 4K23L 2Q3ZA 4PRIA 5DRXB 4I4WB 4YAQA 4OT1H 4F37F 2VZ1A 2W9EL 1RUKL 3EGSA 3VXRA 1MNUH 1SMAA 2JCCE 3O41B 5EU7E 5IFJB 4IIQA 1X5JA 4PD4K 5BS0E 3ZSSA 2VH5L 1EJOL 3IT8D 5CEZH 4DK6A 4UIKL 4BH7A 1GGIL 5I2IA 1YA5A 5ISZD 1HHJA 2LV4A 2NY3C 3L5XL 3OKOB 5LBSH 4TUOA 3WL9B 2YRZA 2J8OA 3FTGB 4Z7VA 3GSWA 3MCKB 5C86A 2VLJD 3O3AB 4HX1B 4K8RC 4XNZB 4Y5VB 5F7KC 3VGEA 3HZMB 3V5DA 1D3CA 4OD1H 5ERWB 1B6UA 3N1MC 5CEZE 1RZKL 1CFSA 5CP7A 1FCCA 1R5WA 2KPNA 3PIQB 3ARRA 1DLHB 4U6HA 5I1DA 5I1AA 2Z35B 1F8TH 1HH9A 2IBGA 4OKDA 4XTRD 1OWWA 4HK0B 5DMJB 1ZVSA 1D9KB 3WUWA 2V2TB 1NGWB 1RULH 2HJLA 1A7PL 4HJ0D 1D9KC 1HILB 2P8PB 1RPQA 3RZCD 1C7TA 3UROR 1S7RA 4ZFFA 2XOTA 4MNQE 1D5BB 1EXUB 3QJFA 5I75C 3DRTA 4Q9BA 3S7GA 4L9DA 3W9EA 1Z9OA 2AJXH 4H25A 5LWYL 4LLMA 2GT9B 3JWOC 3HS0A 3LKSA 3U83A 2EH8H 4B7IA 4HKJB 2IG2H 1KCRL 4IJ3B 4LSQH 5D71H 1RU9L 1FNAA 3MRGB 4KKLC 5J57B 4WGVB 1A3LH 3OG4B 3LN4A 3ECBB 3LN5A 4K23H 4KXZI 3MREA 3W39A 3SE9L 2LTQC 4GAJL 4MX7A 1NAKH 5KZCB 25C8H 3QDGE 4KUZL 4MSWA 4DN3L 5GJTH 3V4PH 1XGQA 3UZVB 5C3LD 4I2XE 2DI7A 5KSBF 5E6ZA 4X7SH 2A6DA 2ZUQC 3O9WB 1ES0A 4UBDD 3WHE0 1KTDA 3CFEB 4W6XB 3BUYB 5D8JH 5IFHH 3QEQB 5GGRY 3O45B 4LPWA 3MLTB 5F97E 4J4PC 3TCLB 1J1PH 3TZVC 2VQ1A 3O9WD 3WIHA 4OM0L 4ZUWA 1JI2A 3RZCB 3L9RB 1I4FA 3JTSA 1H5BA 4LQFH 3FB7B 1YYLH 1AXIB 3HG1A 3UDWC 4R2GD 5GS0H 4KRMB 2J88L 2DQTH 4YDLC 4L29B 1RZIA 4PLNC 3RVVC 2Y23A 4NNXA 3FKUS 3UYRL 2DQDL 4PJ7A 4XBEH 3SKUD 4MAYB 1KCUH 2IPTL 4NZJA 4RFOL 4J6RL 3NCYP 1UENA 5ESQA 1A7RH 4OGYL 4YHPB 1OF2A 3BWAA 4NJAL 1OAZH 2H6PB 1TPXB 3RKDD 2IBBA 2X4UA 3KJ6L 3RX8A 3MPCA 1ZGLM 4P4KA 4ODVH 2MHAA 4H0HB 3I6LE 3UTSE 1FC2D 2R2BB 4IOFC 5TDNA 3B5GA 5CD3B 2O5ZL 3MLVL 4X0KB 4JZJB 4QXUH 1S7QA 3LS5H 5CBAB 4PJDF 3RIFK 1B6DA 4Q0XL 1FN4A 1IC4L 1OPGL 4JVWA 4MJ2A 4N1HB 3T0DA 4JM2A 1JNNH 4JQVC 4YHYB 1UH4A 4ZODA 5CZVL 1ACYH 3EBAA 4XC3L 4HWUA 3V6FA 1FNFA 4KI5D 4ZUVA 1XEDA 1DBMH 5CJXC 5DT1H 5DMIH 4PRHD 5JXAL 4PJXB 5DQJA 4XBGB 5IM7B 2V5MA 3PV6B 1H3VA 4FZEL 4YUEL 4NRYB 1BBDL 4S1DC 4D9LH 3S88H 3RAJH 4PRHE 1BVLA 4Y16A 2XQYK 1SBSH 5JW4N 1D5XA 2IAMC 2IQ9L 2W9EH 4QRPD 1S7SB 3FCTB 4ZOCA 1CZ8L 1JUFA 4X99B 1P7KB 5KVEH 4Z77B 4XP4L 4M7KL 2B4CC 3FMGH 1G9ML 1M05A 3RNKA 4F7PA 1XGUB 1AD0B 1FYTB 3V5HB 3KR3L 4PGCB 1BHGA 1P4BH 3GSQB 4JHZA 5I1GH 4DEPB 1TZGL 4P46B 5GPRA 2A9ML 5D5MA 1P6AB 5CIPA 4GKSB 4IEFB 3EFFB 3ZTJH 4ELKB 1QLFB 4FP8H 2OX5A 1VSCA 1KCUL 2ZPKH 2ZUUA 3QZWB 2YMXH 5EBMA 3HFML 5IB5B 5LKNA 5C0CE 4KRLB 4PJHA 1Q0XL 3OHXA 5CSZA 5F7MC 4XBGA 1QFUH 2QQLH 3IDNB 4FN0A 1S7TB 1A1NA 3ZDXE 5HHOA 1L9NA 4S0SD 5D6DC 2AGJL 5IF0A 3V6FB 3QNXB 4WHDA 4MAYC 2VR5A 4PRID 5F7WC 1FZKA 1RUPL 3PHQB 4AG4H 3PWUB 5HYJD 3WS6A 3TO2A 4Y4FB 1DDHB 1I8IB 2BVEA 2V5TA 1F42A 2EIBA 2M26A 4I0PC 4H0GA 3MC0A 3P0YH 1CXKA 4O5LL 4QY8B 4CRPA 2CR6A 3GSVB 3CH1B 1FN4B 2GK0A 1J0JA 4NBYB 4OLWH 3HE7A 1JNNL 1N3NA 3H3BC 3D3VB 3VFOB 2ZCKH 1NFKA 4JFPB 2Z93A 1A2YA 2YZ8A 3MNWB 5TDNB 3ZHKA 3M1BB 5GGTH 4YLQT 3H9ZA 2VDMH 4U1SB 4CN6A 3FT3A 1A4KA 1FFPA 3REWB 3QJHB 4NN5C 4PRNB 3STBA 1DBKL 1OF2B 3BWAB 3GJFB 2SEBA 4C56A 2OTPA 3KXFA 4OLXL 3GJFH 4J3OC 4IHOB 5D2LB 5KG9A 1JF6A 2MQ0A 1DQQB 4JRYB 4LCWB 5CUSL 1EFXB 3IDJA 3NIDE 1SVCP 2E7MA 5L9DH 2C3VA 2MCPH 3HC0A 1XFPA 4XCFH 1BOYA 2ED7A 1W0WA 4NHUA 2AJXL 2LTQB 5D1XC 4YWGL 1H5BB 1S9WB 3L3KB 3IDYB 1OLZA 3MOBL 1I1RA 3MV8D 2C4FU 4HS6A 4J12A 3ZKQD 4R2GC 5GRYA 5HTSA 3QIWD 4LSPH 1MH5B 4Z78A 5IHLB 3DXAB 3Q6FB 1FPTL 1TJGH 1X4YA 2VLJE 5FYKU 1Q9OA 3QYCA 4LF3B 4QXTA 4J3TA 2GTWB 2XA8H 4F7MB 4X6BA 4QWWD 5L6YL 2APWA 3O3DB 4LF3A 2ZP0T 5IBLD 3OXSA 5DD6B 4HK3N 5CINL 4A2MA 3RVWC 3U7WH 3CCHB 3B2UD 2IAND 1U93A 4HS6B 4RGMC 2KQMA 4ERSH 5B8CA 3RWEB 3HNTH 5I76A 1A7RL 4OGYH 1I9EA 1U9KA 4ESKA 3BZFA 5FUOL 4RGND 2NY6D 3RWIB 2IMNA 3DWTA 3VDBA 1WGOA 4O02L 1U3ZA 1K2DA 1CDYA 2AK1H 3QG6A 4M61B 2H8PA 4PRPE 3ARBA 4XMPH 2L7UA 2XWTA 3BGFC 3AS3A 4G8GA 1GOFA 43CAA 1Q0YL 1FYTD 4NJAH 3BGFB 4OCSL 3SPVB 1J8HB 2ITCA 3HE6C 1HWHB 1ZLSH 1JWUA 1EEYA 5T3ZL 3S5LG 4O58H 2FD6H 3ULVH 1A3RL 3MRMA 1X5HA 3D3VA 4RWYH 5IMMA 1VFMA 2NY6B 4PJIE 3MRDB 5FDYA 4ZNEA 1G7QB 4LLUA 4XPBH 5ALBH 1ZLWK 4HJGB 4AIOA 2MWCA 3P4OB 5I74C 4LOUC 1DR9A 1IGIH 2W0PA 4GMTL 3TA3B 3QWRA 5E08L 4HUUB 1G7PB 2IANB 1CDHA 3EZJB 3QXDB 3V4UL 3PQYD 4TSAH 1VACA 4LHUG 1MH5A 3SKMB 1P7QA 5EPMA 4OZGA 4KRPB 2BDNH 1NC4B 4UT6L 3T4YB 1K4CA 2GCYB 4HKBA 4G43B 1U8NA 3BW9A 4FXLA 5B38G 4L3CB 4GAYB 1FZMB 4ZUUA 2NYYD 4FFZH 5HJ3B 3BP4B 1FG2B 4IIQC 2X89D 1T5WB 5MEPB 3RWJA 3TBWB 3HNTL 2JIXB 4OLZH 1W72B 4TTDD 2GTZB 4FA8A 4KGJA 4X98B 5CCKH 2WUCL 4KJYA 4G9FD 1SYVA 1MLBA 1WCQA 4XP5H 4TUJB 5AG8A 4GFTB 3QDHA 3B3IA 4OB5H 1A2YB 4LGPB 3DO3A 2EDWA 2AJUH 4OZIE 5HI4D 3HI1B 5EZLB 4NRYA 4P46D 1Z5LB 3KLAA 1Q1JL 4MS8C 4X5LA 4QRRB 3CDGA 1CDUA 1J1XL 4LQFL 5E5MA 4WI8A 3QIBA 1QSED 1A0QL 4DZ8A 5CBEA 5GGSB 5IQ7H 3GGWB 1ZLUH 2ADIA 2BJMH 1P53A 3ULVL 3NFNB 3AREB 4JJ5B 3AMKA 1NDMA 1MWAL 4NSKA 1B4RA 5EN2A 5EG6C 2P44B 1T03H 1DSFH 4NRXB 5I8EA 1S7VA 1A1NB 2E7LA 3HHRB 5F9AC 1WC7B 5DK2B 2VN7A 3UTSA 4X0KA 1CGYA 4UIKH 5CZXD 4HF5L 2GFBB 1KJ3L 1KIQA 3PF2A 3TPUB 4KROD 4PGJA 4OV5B 3QCUL 4P3CH 4IMKC 3KPNB 4X9GA 4PTTB 4JPIA 5JPNA 1CFVH 2AKRB 2B4CH 3I6KA 3DUUB 3ALWA 1RZ8B 5GZOD 4TPRL 1YDPB 1JK8A 3LDBB 3KDMB 3ARGC 3OPZL 4KZDL 5J1AA 2EIZA 1G7LB 1B2WH 4FRWA 4P3DB 1U92A 2IGFL 3JXAA 3CXHK 4LRIC 5CGYC 1NANI 1W0VB 4Z0XA 3U1SH 5FEBA 5AAMA 1Y18A 1BOGB 1S5IH 1AQDA 3HC4H 1PQZA 5CUSH 2E9BA 2G75B 1YC8A 1S78D 4U1LB 4CMMB 1MHHB 3N9GH 1FZJA 3F58H 4JAMA 2NXZD 3D3VE 3LDBC 3TP4A 4MCZA 3PV6A 4MXVF 2FBJH 4KKAD 2OLDA 1IILE 3HAEA 1QNZL 4XP5L 4OTXH 3WBDA 4MD4B 2IMMA 5HYSA 3VXOB 1KELH 3EDFA 4G8GE 5C7XL 2XTJD 1DQQA 4LCWA 3LIZH 4JM2B 1TFHA 4P9HC 2R1YB 4ZFOL 1G9MH 3FMGL 5KG9B 4ACPA 2R15A 1ZGLB 5GZNC 4POYA 1LEIA 4MNHA 1U95A 3RTQA 1JYNA 1WF5A 3V95A 4XAWL 1LEIB 1FRGH 1YPZB 5C6TL 1FO0L 5JHDD 1WUNT 1G6VK 5ITBH 5H2BA 2W60B 4YNYA 3ORJA 5I73B 5EU3A 2BNQE 3KYOB 4V1DE 32C2B 1A6PA 3DROB 1JGVL 1WT5A 3QDJD 3O4OB 4H26B 3D69A 1WSST 2QQLL 3G9VA 4KKBD 4JFFA 3VFMB 4BSWA 5DS8B 2A6IB 3HFMH 3MLUL 2Q7YB 4NN7C 2EYRB 3MFGB 2AV7A 4NO5B 5HDBF 3RTQC 3TO2B 2WWMC 1ORSB 5BZWB 3L5JA 3MCG1 3PHQA 4WV1C 4GRWF 2GJ6E 4JDZB 4TYUA 4WWKC 5HGGS 2JB6A 1KLFA 4NN6C 3NCCB 4UTAH 4NKMA 3T3PE 1UZ6E 3GBML 4ODWA 3P0YL 5T1LD 1NGWA 4NOFA 5GSVA 2X42A 1JRHH 1EV2E 5JOFB 1T6WA 3H42L 1EEUA 4Q6IB 4C4KO 1I7ZA 1Q0YH 2PW2B 3IVKA 5D7KE 5I0ZA 5IB2B 1RK1A 2RHEA 5DMYA 3UJJH 1XAUA 1IAOA 2Z92B 3MO1B 5CIPB 1RZ8A 3EOBA 1OGTA 1QG3A 1QRNB 4ZXBA 4XBEL 4XXDB 1YEEH 3O6MH 2ENSA 1MCDA 1R0AL 1T21A 2OTUA 4OLXH 4P5MA 5HDOA 3UTOA 3RNQA 3NIGE 3RZCC 4KMTL 3SOBL 5JXEA 3W9DA 1JNHA 7FABH 1OAKH 4R96B 4WW2A 4KPHH 1D5XB 3KJ4B 5IJVA 3BGAA 4Y16B 3ECBA 1JGDA 4MNQD 1MFCH 1YMMD 4L4TA 1I1AC 5DURD 4Y19E 2DLFH 2HKHL 1WWBX 3GUTB 1MCPL 4GRLC 2BVQA 1CWVA 2W91A 3DVNA 3CDCA 5F7FA 1IM9B 4X7TB 1R5IA 4U05A 1P7QD 2A1WL 1S9YB 3I9GH 2CIKA 4PRDB 4R8WL 2NY1B 2A6JA 3MBED 2AJ3A 1DBML 4OZHA 1UXSA 5DT1L 3RWDB 1JGLL 3B9VA 2XKNA 5LVEA 3LSOB 5FF6A 1KLGB 2AK4A 5F7DA 2EZ0D 2JIXA 1T21B 4P5MB 1A3LL 3IAQA 4APQD 5H35B 4JFHD 1T5WA 3RWJB 5MEPA 1JK8B 1NSNH 3ZKMC 5BZDA 2H1PH 3QI9D 4FQCH 1YYML 3DX6B 3WD5H 4PTTA 5J6HB 1EO8L 1GAFH 2GI7A 3LEVH 1N26A 1NFIB 2VLRB 3M17A 3BRFA 5FDWA 1F4AA 4BSVB 5ERWA 2XN9B 1IEHA 5CJ5A 5F1OB 2OL3B 3QI9C 4PYGA 5D7IB 3MCKA 4MXWH 2C4FT 5CFHA 1EGJL 4QF1B 4IRSC 5L88H 5F71A 4NKMB 3QG7H 5EN2B 5D6CA 1MFEL 4M8QB 4WFED 3GBNH 3MUJA 2VZ3A 3JWDC 2HT3D 1KPRB 3LD8B 3GMLA 4TULL 2ADFH 3QISA 3PWNB 1ORSA 4AM0A 3VD7A 1QFWM 1QFWI 2EYRA 3L3OB 1DTUA 3BPNB 2Z8WC 5BZDB 2AGJH 4OCRL 4PJ9B 4UQ2B 5FGSA 3GEWB 3WLWC 1MELA 3CU1A 5FUZH 1WBXA 4OCWH 1JHLH 1WVZA 1GZQA 3TIDB 3HB3D 4JQIL 1HXYB 4AEFA 2AI0H 4FQ1L 1A7QH 4D8PA 3KPLB 1XZ0B 5L2JA 2HFTA 1E6JH 3CFIC 4FQJH 1JBJA 3HNSH 5D7JC 5DA4A 2VZTA 2EDEA 3ARBB 3B6SA 4HFUL 3TBWA 1KFAH 2NX5E 1DBAL 1U8KA 1H3PL 2BVQB 5HJ3A 2I5YH 5HHOE 3FQNA 4GAYA 5FM5O 4X7FC 2HH0L 3HR6A 4YEFA 2NX5D 2NW2A 4KVCH 1FAIH 1MCNA 5KVDH 3SEPA 5C2UB 4HC1H 1NDGB 3H8NA 4DN4H 3VWKA 2R56L 5C3TA 1GAFL 3U4EB 2WQ8A 3UZQA 3AB0B 3V7AG 1XGYH 3QXDA 2LU4A 5D2NC 3HPLB 5DD6A 4ZYKB 5F8QC 2R0WH 1AJ7L 5I1EH 3DYMA 2J5LB 3BIAX 4HHAA 4R4NC 2NX5B 2ICES 4Y1AA 1TENA 3SDAD 7CGTA 3E2HC 2IH1A 3SCMC 3MO1A 4ALAL 4PJAB 3RAJL 5I1AB 1NCDH 1RK1B 2YBRB 2OI9B 3E6FB 3ILQD 4P2OD 1R3LA 3OAYK 3CSGA 1F6AB 2EC9T 4U6HB 1U42A 3QCVH 1JPTL 3OKMA 1MCLA 1NMAL 1NC2A 3GK8H 5D7LA 3RWCA 3EO9L 4I1NB 2EH7L 4NOBA 5DC9B 1T0PB 3PP4H 2QV2A 4PGDB 4UTBH 3GSWB 3MNVA 3K8LA 4QF1A 3WS3A 5I1IH 4L5FL 1KJVA 3C08L 1PEZA 5SX4I 2OK0H 1QKZL 2NCMA 4HD9A 1YNTB 2A6IA 4QXWA 5EZIH 3K8MA 4K7FB 1GL4B 5IR1B 3V5KB 1KACB 3FJTA 4FFWD 4BKLB 1LQSR 2OXHA 1FVCA 2DBLL 3NZHL 3J7HA 1VADA 5GS3A 5KS9F 1A7NL 2WUBL 3DLQR 4X4MA 4P3CL 3WFHA 2Y4SA 1AKJB 5DUBB 5T1LA 5BMFL 2PYEE 1HQ4B 4XCCH 4N8VG 3VFNA 2E5EA 3P11L 3DX9A 5FKAA 3RUGA 3ZSTA 3O2DH 1J1PL 4C58B 1MIML 4OZHB 2E8YA 1MAJA 2PR4L 3ARQA 3KPPA 1FFNB 4XRCA 2ATPA 1ZHNA 1X44A 5EO9A 3FN9A 3TIDA 2W65B 3SJVB 5TH2A 1FIGL 2WBJD 3IFOA 5BV7L 5HHMD 4MD4A 3PL6C 3Q48A 1J1OH 1W72H 2FJGB 5C9KA 3DNKA 1OSZA 5I1EL 1Y6KR 1RHHA 5EU5A 1NEUA 2ADGB 3B5TA 4LDLB 4UDTB 1OP5H 1QACA 1WICA 3U48A 2XY1A 5GRVK 5BVJB 4EI6B 1KIPB 4MDIA 2UVFA 2F54B 4Y8AA 3N0PB 3WFDH 1B90A 3WN5B 2PCPA 1TTUA 1IM9D 3Q3GA 5L9DL 4L4TD 3TF7C 2IALB 5IKCB 4OLVL 1G7PA 2IANA 4HUUA 4OFVA 1ZEAL 4QRQB 4XNYH 3RNKB 1S7UA 1MUJA 2FZ3B 4HS8H 4F7PB 3RWFA 3QPXH 3UO1L 1P7KA 3I75B 2R8SL 4NUGH 2NLJB 2VXSH 4RX4A 1JFQH 2M2DA 5I1CH 3HB3C 4Q58C 4FFYH 4Z7UA 3S3PA 3V8OA 2Y7QB 3CUPA 3T2NL 3MXVH 5IB2A 4XP6L 2BSSB 5H8DA 5IV2A 1ZANH 2Z8RA 1JJUA 1FNGA 4GS7B 4HIXL 5IEKA 2VH5H 4F57H 4RMTA 3GSOB 1CD9B 4MJ6B 4LDEB 2AJ3B 1T1YB 4ZPVB 4APQA 1FGNH 4YHOH 1GGCH 1DLFH 3QUZD 4JFOA 5E2TH 2VOTA 5DXWA 3UC0H 1P1ZA 3SKOB 1FZKB 4QHUA 4DGVL 1HHGA 5DSCB 4Y19D 1XF4B 4O51B 5IGXL 1Z9LA 1OP5K 1EGJA 1CI5A 2XNAB 4FQJL 2FHCA 3C2AH 5IQ9A 3T0BA 5I8CA 2PN5A 4ZXBC 1RJCA 1JMXA 2NY0B 4LU5H 1FYTE 4IJ3C 1QBBA 4I48B 4QTIL 4YBQC 1JHLL 5DQDH 2OP4H 4F9PA 1X7QA 2MMXA 3KPSA 1A64A 2FB4H 4UBDC 3CCHA 4XPFH 3ALXA 4LCYA 3ME0A 2YUWA 4WU7B 2HH0H 3PGDA 4MQXD 1CGXA 4PJ8A 5HI5C 5IB4B 3IXTA 2IC2A 4M6NH 1NGZA 5BW7C 4OGAC 3DMMC 4JANB 5LGJA 5B38A 4BQ6A 4BZ1H 4HV8A 2AJSH 1MI5E 2DMBA 4NM4L 2F54A 2AQ3A 5EZJB 4G43A 4I13B 3KYNB 4F3FA 5DFVC 3TO4D 4AL8L 5LQBH 4IMLA 3T4YA 5JHDB 4XNYL 3HI6L 5JZ7C 2KUTA 3LQAH 1ZA6A 4ZSOE 3GMMA 1N64H 2WIIA 1RZ7H 1S9WA 3L3KA 3GRWH 3HNVL 4PLJD 4QCIA 3FQUB 3PJSA 3BD5A 5DVKA 4PJEF 1VKXB 1S5HA 4NQEE 5FECA 5GGVH 5FUCC 3H3PH 4XVUD 3IDYC 4U49A 3N06B 3DI3B 5GS1B 1BVKB 3AMLA 4NQTA 4BSWB 4U2ZA 5D1ZB 4ZUSA 4G9FB 3AXLB 3HMWH 1NFDA 4V1DA 3NABL 4WFFE 5CJQL 4UTBL 4LCYB 1YQVH 4FFVD 4M62L 4ORGB 4J4PA 3WFHB 4O2FA 5FAAA 2R1WA 3GSRB 4WCYH 4M1DL 2IFGA 35C8H 1V3JA 5EIIA 4O2FB 2AJVH 1Q72H 1B4JL 1I3RA 3O6KH 1G1CA 3EJYC 3QCTH 3QCVL 4M4RA 3WHE1 2YD5A 5C0RH 3OZ9L 3HUJA 5DJCA 3C5ZC 1QSFE 2D0FA 3L3DA 1NUGA 4YPJA 3EAKA 1FO0H 3PP4L 4GG6E 3S34L 4MXQC 2X70A 2X4TA 1UCBH 4FG6D 2DI8A 5DSCA 5CD5C 3NZ8A 1N4XL 1H3GA 1MVUB 5INCB 4PBVC 1P1ZB 1ZAGA 4LMQI 5C0BB 4FQXC 2B5IB 4ZPVA 5IF0B 4Z7WB 4OCRH 4NQDB 4Y4FC 1KGCD 5D7LB 3ZDZF 5DO2C 3NPZB 4LSRL 1ITBB 3OHXB 3V6BR 2CLVA 3OV6A 5BO1H 4JY5H 1E28A 1RFDH 4WY7H 5JW5A 3KPQB 1I1AA 2DI9A 1QFWL 3DYPA 4TUJA 4NNYB 3ZTNL 2CQVA 1J1OL 1Y6NR 3IRZA 5MENE 2YEZA 1K8DA 1KXQE 4LSPL 4F7MA 1NCNA 3C8KB 4F8QA 2XIDA 4P23C 1AQKH 5SWQA 3ARXA 5CKGA 4NC1E 3V5DB 3VRJA 4NUJA 2BVYA 1T7WA 2E7LC 3SDYL 4CU8A 4ZUUB 2BERA 3I3EA 1YEHH 1X7QB 3LPWA 3NCJH 4TNWK 1LE5A 4OIAA 2ERJB 3MLXH 4RFNC 4RIRA 1K4CB 4P2QD 5F88A 1QQDB 3BO8A 5ADPL 1AE6H 1ZT4B 2B0SL 3A6CH 5IFAH 4WW2F 3UYOD 2R2HA 3MGOB 4OZGB 2P7TB 1CT8A 1RHHB 2UWEA 5EU5B 3MR9B 4M6OH 1VACB 1OSZB 3S88L 1T66D 2K3TA 2N1KA 4J1UA 2BHYA 3V8CA 2YRPA 4DKEH 1PEWA 4WW1A 4RMRA 1GOGA 4XH2B 5I1HH 2Y6SD 3QJFB 1A3RH 1ZLVH 2W65A 1RZJC 2QQKH 1MPAH 1ZT7B 3MLSH 2AV1B 3CDGB 4KTDL 5T5FH 3ZDZE 3CC5B 1IBGL 1T2QL 3O2VH 2RQ8A 3EOTL 4CDGC 3FB8A 1E4KC 3ULUF 3MUGB 5FHBH 2YD4A 1WFNA 1JWUB 3FT4B 4TNWF 4NWUL 4EDWL 3HE7B 1YY9C 2MHAB 3IDGA 1SYVB 4FQQB 3U30B 1PKQE 3L3OA 5E6ID 3QDJE 1I8IA 4GRLA 3T09A 1MQ8A 3WKMH 3W5MA 2VDLH 2X4RA 5IB1B 4Y4KD 3NA9L 1BVZA 1IGCL 4PJ7B 2BOBB 4DVRH 2CKBH 4MQ7A 4G8EB 1U2CA 3CXDL 3SCMB 3IETA 3G6DL 4JQXA 1HOCB 4OGAD 5KSUA 1RZIB 1CT8B 5L0QB 4HIEB 1MWAA 4YFDB 4JEGB 2OL3A 1T7ZA 1X4ZA 3C8DA 4HGWA 3DSNA 5IB5A 1JPFB 3WDIA 3C5ZD 5EZIL 5H94B 4N0UE 1BWWA 3NIDF 3RZCA 3BZEA 4NPYB 5T33L 4P5TA 4LLVA 4U1MB 3T0EC 4KK8D 1VB9A 2B5IC 2RCSL 2C5DC 3IDIB 1R3LB 1IC5L 5JOPE 2YN3A 3EZ8A 1HYRC 1VFAA 3IFOB 1T2XA 2NY7H 3MGTB 1B0RB 3BRDA 1ZGLP 3SJVA 3GMRA 5T3XD 4D9RE 1RZJL 2H32A 1CICB 5SX5H 3ARGD 4KI5C 4OGXL 3LQZB 2HLFD 5I0DA 1NCWL 2YEZB 1JUFB 3S5LA 2VRAA 5F1SA 5JTWA 1CFNB 3DHJA 2D7TH 2OQJA 1RMFL 2IPUK 4KH2A 4FQ1H 4NQSB 1CL7I 4TOYH 1HHIA 4WWID 3TFKC 2I9LB 3IU3A 3RI5F 1GGBH 2DM4A 4U0QB 1MJUH 4RGNE 3ILPB 3MJ9H 3HI6H 5C9JA 2BY0A 1SJVA 3WFDL 2F58H 2GK2A 3VXRE 1NLBL 1KFAL 3HAEG 2CPCA 3NZ8B 4RISL 5CJOH 5DFTA 1DL7L 4JRYA 5E9DB 1RK0A 3I2CL 2X4TB 1JWSB 4UUJB 5C07B 1F4WL 4TPRH 2A73A 1FAIL 3LKNB 5IQ7L 5EC1B 5IHZB 1TPXC 3L5WA 1KSRA 4X4XB 1BQHG 1FL6A 2MKLC 5GISH 3W0WB 1KT2A 3MNWA 3OKMB 1V7ML 2VXUH 1DZBA 1F6AA 4DAGH 4YGAB 3TBTA 2XKSA 5JDSB 5F7NC 1U8HA 4TQEH 5FB8B 4G9FA 1L7TL 1DFBH 2GK0B 4ZUSB 3G08B 1VERA 4FXKA 5JA9A 4G6KL 5FYKE 1S3KL 2EO1A 3FHQA 2VLRD 4Z95H 5FYLL 4WNQA 4BUHA 3HPJB 2IBZX 5E6IB 5EUOB 2NZIA 2OYPA 4RFEA 1G0XA 1DLFL 5E2TL 4F7EA 1A1MB 1CD0A 1GOHA 1BJMA 4KHTH 4ZO6A 4JHBA 1HHJB 2A77H 1OARL 4QRUB 3IFLH 4WTWA 4WFEE 5EU4B 3UTTA 1D6EA 3BE1L 4N9GB 4HAGA 3KYNA 4JB9L 4XNZC 1SJEB 3MXWH 1K85A 1QFHA 1L0YA 1NFIA 2D7TL 4NFDA 4UOJA 3HC0B 1QRNE 4YX2L 4GW5A 3UAJD 3GJEB 3QEQA 5HYJB 5B38B 2Q3AA 3H9HA 4N68A 3QA3B 1QBLH 3VGAB 1JV5A 1CXFA 4JANA 2IF7A 2V9TA 1BREA 1NAMA 4WUKL 1NGZB 2X05A 1HXMA 3MJ9L 4I77H 4GKNA 3LRHA 4PREA 2MCG1 1KELL 2V2WA 3V7AE 4WFFD 4NO0D 3KPSE 4GQ9H 4MA3A 4M4PA 4K8RL 2XZZA 3NZHH 1ZGLA 2ZUSA 1GC1C 1Z9MA 3IAPA 4LAJH 1OAXL 1BVLB 3BKYL 2UY7A 4UOW0 2UV3A 2DWEB 1MCHA 4JFPA 2YKLH 5FV2A 3SDAB 1QSEE 2DAVA 2G5RA 3BVNA 5J06A 2V9RA 3QAZC 3LKRB 2RBLA 1QSFD 1TXKA 4PJIA 4XCFL 5IM7A 3LKSB 5JDJA 3JSSA 1KN2L 1KN4L 2CIIA 1CDIA 4ZTOH 5LGKA 1FVEA 4NJ9H 8FABA 5JUEH 3X3FH 5K9OA 3GB7A 3RDTD 3TBSB 4MJIE 2F19H 5ACZB 4Z5RB 5BV7H 3BKCH 1H8SA 2ICWJ 1BFSA 2VITA 4PP2A 3BRGC 1JF1B 2IFFL 1S8DB 4KKCC 4JDTL 1UM4H 3LRSB 4FG6C 3EO1A 5E6YA 2CD0A 2Z4QB 5DJ6B 1U58B 1WFTA 1F3JA 1RJZB 5DWUH 5CBAA 1I1FA 4X4ME 4GT7A 4PBXA 4LPYA 1RUAH 4LCWD 4B5EA 5INDA 2DQGL 3M17B 4AQOA 1I1CA 1IAIL 3LQMA 4Y5VC 4XCEA 5D1XB 1HHKA 4JFDA 4RWHA 4HULB 1I7RB 1MUJB 2X1QA 2Y72A 4ZAKD 4TNVK 2HLFC 4ODBD 3GSUA 2VC2H 3P4MB 5EOCL 3BSZH 1G9NL 1H3WM 3MRBB 1WTLA 3KYMA 1M05B 2OJEB 5I1GL 1GZPA 2PXYA 3UTSB 2IALA 1CFQA 4G5ZH 4Q7DA 3MRQA 5F9JB 5IKCA 4RZCA 2H9GA 3QIUA 3Q1SH 1I9JL 5HGBA 5ICXB 5MI0B 4ZQKA 1IEBB 3LEYL 4ZS6C 3FAWA 4FQLH 4PP2B 1QLRB 3QEUA 3BIKA 2Z31A 4ZO7A 2OR9H 1PW3A 3L95A 1QOKA 4K7PH 3JV0A 4N8VA 4CN4A 5FIEA 3CX5K 2AV7B 1NMAH 3TBVB 1KB5H 5ELIA 4AK1A 2BHZA 2Q7NA 4KC3B 4KXZH 5D8JL 1L6ZA 5TH2B 3MACH 5GHWL 5DRWB 5C08B 1KV3A 1TZHA 2FD6L 3CU7A 2P48B 4U3CA 1ZHNB 2WBJA 1PVHA 4G3YH 2VLLB 4LSUH 2CKNA 1G7JA 1HKLH 4YO0B 2BC4B 5JUEL 4ZOEA 4OZGE 2W0KA 4BZ2L 3DO7A 1OT2A 1XMWA 3D9AL 5CGTA 5H37H 3QQ3B 5C0IA 4QHLA 2ZJSL 1RIVH 4ONOA 4D3CL 2QQQA 4N1EA 1FVCB 4LLQA 2HFGH 5CMAB 2BXZA 1TVHB 3EOBB 4S1SL 4PG2A 4NO2B 4M1CD 2QQNH 1EZVX 3DX8A 2G2RA 2E7CA 4GUPA 2VERN 2E6PA 5ADPH 3TN0C 3C6SB 4NNXB 3STLA 5BOPA 4WTXA 3BH8A 3MV9E 5FHAH 3FOMB 4N0RA 4P57A 4FFZL 3CAFA 4KTEL 4FHBD 2JB6B 2R1XB 4AMKL 4XWOD 3LAFA 4U1NA 3R06B 3LHPH 3KLHD 4Y4HA 3HPJA 3O4LB 4GRWE 5F1NA 2F8XC 1VEMA 1KUMA 2X9WA 4WEBH 1RZGA 5HYQA 3UBXA 2VQ1B 4Z7WE 2J8HA 1M71B 3W0WE 4ODXA 1A4JA 5HDLA 3PGFL 4JN2A 1WCBB 1SBSL 1YDPA 3OXRA 4X6CA 1HSBB 2DQFA 4CKVX 1JGVH 3BUYA 9CGTA 5FHBL 2XV6B 1NBYA 1IARB 3KYOA 1WTGT 4OV5A 1CTNA 1FL6B 2KQNA 4N0CD 3VFTB 2AP2A 5T1MA 4PRBB 4UV7L 4GG6B 4D0DB 4PJGE 4M1GL 2P5ED 4RFNB 3CDYA 2VLKE 3GMPB 3QIWA 4Z7VB 4ODUA 3ROOA 1U91A 1UACL 2YC1B 4ZSOA 2C1PB 4IM8A 1CG9B 2O61A 3AREA 2YXMA 4CJ0A 1OTSD 4XNXL 4EUPG 4OF0A 2J4WH 4JFEA 3H7BA 4S1RH 4U1NB 5DQ9A 2W0FA 1P4BL 4YX2H 1M7IA 2H2PD 5BCAA 4ZNEE 4O02H 1MCWM 3WIHL 5JR1H 3VRIA 3GHEL 3PWPD 3VFSB 4QHKJ 4KI1A 1FL5A 2F54D 3B43A 5JPMA 4NO3A 1KB9J 2JCCB 1W0VA 5D2NB 1YNKL 4D8PB 5L2JB 1RIUH 4M7JL 1HH6A 3DECA 3QHZH 3TVMD 2Y5TA 5HYEA 1W72A 4NFBA 3EJZC 3LZFH 4GBXD 4LVNC 1CGWA 5I66B 5KSAD 4N0UB 5DI8A 1JTOA 1WWAX 2J88H 4XPBL 3PQYA 4L3CA 4G7VL 1P4LA 4HT1L 4LGRB 1A02N 3MV8B 2BC4A 5HD8D 3U9PH 4Z8FH 2YD8A 1Z9SA 4FZ8H 3W82A 4PRAA 3C5ZB 3IKCB 3LMJH 2O5YL 4UMGA 5ICZA 3TYFA 3IFNH 5BQ7B 5EWIH 3VGHA 4ZS6D 4LIQL 3KJ6H 5GGTA 1JYVA 2IH3B 2X1PA 2W1NA 2AJSL 5T1DH 5IW1A 3CK0L 2X7LB 2X89A 3MLXL 1IGYB 2O5ZH 3O6LL 4OI8A 2XN9A 1BFTA 2NY4C 3C87A 5M95B 2ADIB 5IB1A 1L7IH 3DX7A 3MOBH 5E8NA 3GI9H 1WLHA 4GRLB 3BP6A 1ZHBA 4MQSB 4NQXA 5E5MB 2Z31B 4DAGL 1LNUB 2HAZA 4ETYA 2VLJB 1Z5LA 15C8H 3K0WA 4O2CA 5DD0H 4QRSA 4OCYL 3DURB 3CFDA 2Z93B 3QEHA 2OR9L 4GRMA 2C4XA 3H3PL 4BFIA 2MQCA 1U41A 5EU6B 3D39E 2VC2L 1F3DH 5TPWL 4G6KH 3DVGA 2XACC 3L5XH 4BQBA 3RJDA 3E0GA 1NBZA 3EYOB 2EDRA 2CLRA 1T20B 1MCKA 1NC2D 4JKMA 4M1DH 2DF3A 5D2LE 1U8OB 4YHNA 1FL3A 2CUIA 2P43B 3OL2A 4HEPG 5DJAB 2FIKB 5B3JE 3WE6A 4YJZL 5BV7C 1YN7B 4XPTL 2BVPB 4P2QB 1VEOA 1G84A 4WJ5A 4GS7C 5A1AA 3B9DA 3DJ9A 3RJQB 1F3DJ 5SWZA 2D2OA 2WWKO 2XZQL 4Z9KB 3VH8B 4UDUB 4NUJB 5BJTA 3D0VA 4G6ML 3RWHA 1FHGA 5IW6B 5DMKA 5I1JH 3OJDA 2WBWB 4EI5A 3DRQB 4Z7QF 2QKIA 3FQTB 4NQDE 4MA1C 1XIWA 3MRRB 4AMKH 5JW5B 3RBGA 2APTA 3MA7B 3QPQD 1NCWH 4KZDH 4PJXA 3CLEL 4YFLF 5DQJB 1P9MA 4H1LH 2YPVL 2UVEA 3RL1A 3F7VA 3QUKB 1BZ9A 1RURH 1OD9A 5KN5B 3QA3A 3OKKB 4JVUA 4OIIL 3UPRB 4OCYH 5KJRL 2H8PB 1IQDB 2UYLA 1GCFA 3LV3B 2D31B 3U1SL 1IAKB 3CZFA 2BP3A 2QBWA 4ONFH 4YC2B 3P4NA 4Z76B 2NZ9D 4M1CC 5ANME 5K93A 4JFFD 4TSCH 5ESVB 3RVVD 5KANG 3MOQA 3CVHL 3VMNA 2VDML 4DUVA 3TPKA 4B53A 3D5OF 2PXYC 5E5RB 1JGEB 4H26A 2XKUA 2F58L 2FJFB 3LKOA 2AJZA 4JKWA 4I9WE 3LKQB 4JFFE 4Q9RL 3VMPA 3QXUA 4X6FA 3I2CH 1BEYL 1KPUA 1GVIA 2Z8SA 4ONGL 1F4HA 3U0TA 2FGWL 3GSVA 1YY8A 4UILH 1KCSH 3TVMC 1MRDL 1AGFA 1QYGL 1U8HB 1IJ9A 1UFUA 1INEH 5CEXB 4U2YA 5CSGA 1KG0A 1W8OA 1JNLL 5I1IL 1MLCA 5E4EB 3FB7A 1MNUL 3ARDD 1NCCH 4HUVA 5AYUL 1P69B 5TE6L 1G9NC 4U3XA 1OAZL 4JFQB 4HG4J 4MMXC 3H0TA 4QRTA 1QUNA 1YNKH 1L0XA 4F7CB 5ADOH 3S4SG 1ADQH 5JHDA 4QHNA 5JIIA 4W6YB 5ENWA 1A6UH 3PDOB 2F53D 5ESVA 1H8OA 1N5AB 1O5DT 4HK3J 4GRWH 3QUXA 3SKNB 3QDJB 4GAGL 5SX5K 1EHLH 3GHEH 1FNSH 3QO0A 1HQRA 2D4DA 1R5VA 3IDJB 1JHKL 5JO5B 1JPST 4WCYL 1A7QL 2WWKT 4C59B 5AD0A 5E2UL 3GRWL 3HNVH 4MA7H 2WV3A 5I1LB 4MLSA 1N59A 1RIUL 3G5YA 4G8FB 3SBWA 3U7AA 4MSWB 3RVTC 1GYAA 1J05B 3FT3B 3VFRB 5MI0C 4HFUH 1V8HA 5KANI 4MX7B 4HPOH 1K5NB 1A22B 3MBEA 3PGCB 3KLSA 4NNPL 3REVA 1HEZA 1RJLB 1WIPA 2CKBA 5JXAH 1T1XA 5DHYB 5MERA 3KHOA 2BNQA 4K8RH 5IOPA 1BX2A 1UWGH 1IM3A 3WNNA 4POZC 4PV9B 1I85C 1BD2D 5EWIL 2NXZB 2X4PA 2R69L 1KIRA 1UJ3B 3M07A 4KKBC 5LXGL 5I1KH 4XCNA 3WEXB 3G9AB 1IQWL 4WEBL 2YD7A 3HCVA 4JHAL 3N1FC 2GJ6A 1CVSC 1Y0LB 3QUYB 1EA9C 2P8MB 2ESVA 5DYOB 4OQ1A 4FFYL 2YD3A 2ZPKL 3OJVC 4NP4L 1G7MB 2ILLA 4GKSA 4TSAL 4LNRB 1FO0B 1JGLH 4L8BB 3LS4L 1URLA 3PL6A 4FMFA 4ZOBA 4OQTH 4FQQA 5ESQB 4OTXL 2XN9E 3VCLA 1MHPL 5HHQA 2VLRE 3NMEA 3O3AA 4HX1A 3ULVC 3RWGB 2BRRH 2E8ZA 3BQUA 3VXNA 5KW9H 4LRNL 4HW6A 4O2CB 2AEQH 4TUOB 3WL9A 1RJYA 2WP3T 1IC1A 4NWTH 4R9HA 5CZKA 4HBCL 2I25N 1TZIB 1FNEA 2ATKA 4N0YH 1AQKL 5I19H 4LLDA 2VZOA 3MRPB 1DVFB 3L9RA 1IL1A 2YOCA 2APBA 1UH3A 1RVFH 2CDEA 4LU5L 4RQQB 4MDJA 4KDWA 2FJGA 4ZUVB 3LEYH 1FG9C 4DQOL 1X5FA 1QRND 4J23A 2CDGA 4AT6B 3P30H 5TQ2H 4FQPA 2UWEB 2FX9H 1KTLA 2HYMA 4WU5B 5SX4H 3QUYD 5ICZB 3QHZL 1E4KA 3K74B 1WV7T 4OF8A 4Z7NF 2ZSVA 3MRDA 2JELL 3SDCA 3G5ZB 2Q76A 5IMMB 5DUMH 4FXGA 1O0VA 1EEQA 2J6EL 3FT2A 4NKDA 2JE8A 2FX7H 2QSTA 4IRSB 4P5TC 3UXFA 5IG7A 3VCLB 5HHQB 3MREB 5J0BA 4FQHA 5TF1L 5AD0B 2HJKB 3DV4B 3L3GA 3QQ9C 4LHJB 3MUHL 1KLUA 4HT1H 2JTDA 2VJXA 2GYSA 5BS0B 5AWNH 2X40A 3LPGA 5IVOA 1MOEA 2CMRH 4UV4L 4DFIA 2C26A 4H5SB 3MA9L 1H3PH 3ARZA 4R97C 2VDPL 2DIBA 4HJJL 4P9MH 3SDXB 1FBIL 1UVQB 1KGCE 4JRXB 2ED8A 4R0LC 1UXWB 1MI5A 4U1KB 4M5YH 2VLKA 2R29L 2CDFA 4Z7WA 1C5BH 3R0NA 1CICC 1NJ9B 1TDQA 1CGSL 1EX0A 2G60L 5CKAA 3HE6B 1OGAD 3P73A 1G6RL 1CG9A 4GW1B 4NYLB 4Q6YA 4JO2L 5CWSB 5JMRA 4P59L 1MAML 2YWYA 3GMQB 4ODTL 4TTDC 2H3NA 2R56H 1A6VH 3K2UL 4HKZA 1JYWA 4OGZA 1MCOL 1T5XB 4K07A 4X6BB 2DKSA 4NKOA 4H1LG 4PJCF 4X5WB 2P45B 4FTVB 2QADB 1J0YA 1EUTA 2VKWA 3ZE2E 4L9LC 1J05A 3FTGA 1TETH 4FQCL 1R3IH 4NN6B 4ALAH 4J3SA 3FOLB 5E9DD 3VW3L 4G6JL 1BMGA 5B22A 1YPZE 3BEVA 5I8OH 1OTUC 1OM3L 4K3DL 4MMZC 4Y5YA 1MAKA 4HWEH 3EOYG 1UC6A 4LLMB 3Q1SL 4JM4H 3QULB 2XZQH 2CDGB 3EJJX 3M45A 3UJIH 3F6IA 4AT6A 2HRLA 4YHLL 5IESL 1VKXA 2BZDA 1NCTA 4QHNB 5TF1H 3WJLC 3FO1B 2B2XH 4ENED 2PO6C 4F7CA 1H0DB 1ADQA 5EUOF 4MVBC 2IJ0C 2O5XL 1V3LA 3QUMA 3DX8B 5C0DA 2PXYD 1EGJH 2BNUA 5E8PB 2AQ1A 3QUXD 4JO3L 4KRPD 5J3HC 1A3QA 3RY6A 4OKVA 3U4BL 1N3NB 1RIHL 4YHMH 3U2SB 4NT6A 1GIGL 3VXUB 2VL5B 4PJ9D 1LGVA 3QDAA 2E6QA 4RBPK 2Z31D 1IC7L 4DCQA 1MFAL 4FQXA 1AP2B 1AIFA 3H42H 3BP7B 4BZ2H 1JZ6A 3PWNA 1WAAE 4XPGH 4LNRA 3THML 3UBXI 5CZVH 1GXEA 4MJ5A 4RMQA 2AXFB 4M8QA 3MRIB 1RIVL 2ID5A 1FZOA 4ODTH 2ZNWA 4MYWB 5TGBB 1K3IA 2APFA 2MCPL 3IDNA 1KB5B 4LBEB 1F90H 1CQKA 3Q6GH 1AGBB 5DEGA 2IADA 1KIUA 2FSEB 4L9LA 2F53E 1BEYH 3O6FB 2UZXB 1VCAA 1FSKC 4XP9H 2MJWA 5IFJA 1JZ2A 7FABL 2X4PB 2GUOB 5E00A 1OQXA 1PLGH 3CX5J 4JHWL 3VXRB 2HFFB 5KVEL 1BD2B 2Z91B 5H35A 2CLZA 1U3HB 3V5HA 4OF6A 3I85A 1CFQB 5F9JA 1LEGA 1YEJL 3QUMH 2PXYB 4OD2A 3MRBA 3L7EB 1BFVL 3K81A 1VGKB 4KHXH 3RWDA 1U3HA 5CGMA 2VL4A 4DKAA 5I1CL 4R26L 2P5WE 4LVHC 3OX8B 4OM1H 5EC2A 1NCDL 5E8OA 2R8SH 5I71C 4WO4D 1PZ5B 1QR1A 3JUZA 5IWLA 5F3BA 4G8FA 4OI9A 4ZD3H 5D5MF 1A6WH 3WNKA 2R23B 4ODHL 5IMOB 3V6OC 1CLYH 1A1OA 2QADC 5BOZG 1N5YH 3RRQA 3WUWG 1KB5A 4RDQF 2LU3A 2FEDD 5E8EB 2UZIL 4MA1B 2JK5B 1IT9H 2XQBH 5K9JL 1QKZH 2FLBT 2AK1L 1R3HB 3OKEA 2C9AA 3AB0C 4WW2B 5IVXF 4MHHG 1S9XB 5ALBL 1UM6H 2Y07H 4QOKE 2IWGA 3OB0K 2YD6A 2YRLA 5SWSE 4S1RL 2O26U 1A21A 3PQYB 1ED3A 3CMGA 4LSVH 4EIZC 5D70H 3HAEH 3TJEL 3IFPA 3PABB 3IGAB 3UYRH 2B39A 4TOYL 2DQIH 2H6PA 1W0YT 4ZFGL 3E1F1 5TDPB 1QNZH 4ONHA 4LPVA 3T0EA 4Y2DA 4MA3B 4PYHA 5BV7B 4XP9L 2AJYL 4K7PL 1UZ8B 3QO1B 1YEGL 2G60H 1RD6A 3CFDB 4OUOA 4YPGA 2PYEA 1DL7H 3L6FB 2VDPH 1J8HD 4DKEL 4KRPC 5J3HD 1KJMA 1M7IB 5FUZL 4XTRC 3JWDH 4M7LT 4AEHH 2DYPA 2EKJA 4PJXF 2GUOA 2FJFA 3LKOB 3DMMB 4NM4H 1KPVB 3SGDH 3ZZ1A 4ZMAT 1Y6MR 1KCVL 3GIVB 4PY7B 3WS6C 4KWUA 4BH8A 2X4NB 2MPAH 3HI5L 5EU6D 3OMZA 3T0WA 4OM1L 5BS0D 2D9CA 1IKFH 3DROA 1EBAA 1NPUA 4X9BA 3NTCH 3FONB 4NWUH 3FO2A 3MX0A 3ZDXF 3S37H 3T77A 3OR7A 1NFDF 4PJDB 3RIAK 4GG6A 5DK0A 3ABZA 1NC2B 3UMTA 5HVHC 4K3DH 5FM8A 1P4LB 3CFBB 5GIRA 3D39D 4AEIH 1U95B 4L1HA 2ARJB 1N2RB 5C0EB 4JCMA 2D7MA 3VXSD 5C71A 1WZLA 4U6YA 5T5NF 3HUJF 3O0RL 2QR0A 3FQTA 4GW1A 4NYLA 1D5ZA 4UNUA 4P2YA 5C08D 2ZNXA 3X14A 4NQVA 4L4VA 1EAPB 1PZUB 4IS6A 1I8MA 4S1QL 2ZUVA 1EMTH 3V0WL 2E7BA 2GT9A 1J1XH 2BCKA 5GQBA 5BJTB 4OFYD 1QVOB 4XWGL 3MV7D 4IMKA 5F7EL 5ANMA 4K9EL 5C09B 5I18L 4J4PD 4U1LA 4Z7NE 4G42B 4GAFB 2A0LC 4YE4H 5JXEC 1ZANL 1ZVYA 2V5YA 2UWEE 4LVNB 3LQAC 1ZHLA 3FO0H 2WZPD 2NW2B 4Y5XA 4FNLH 2K9UA 1K9TA 4Q2ZB 4WRLA 5HVHB 1EFXD 1WZ1H 4YHIB 1YN6A 1YEIH 4IRSA 5DD1L 2CLRB 4JO3H 5BRZE 2NNAB 1CFVL 4TN9A 5BXFB 5C0IB 2OBGA 4UQ3B 3WMSA 3FN0H 3NPSC 4HUWA 3CX2A 2B1HH 5IMLA 1CFTA 2NXYC 3C09C 4PRBA 4C55A 4R3SB 3KJ4C 5E8DL 3QIBD 5I75B 2IGFH 4NRZB 4WWKB 1T4KB 1KTLB 1AGDB 1U8MA 3OB0H 1RSFA 4Z18A 2GY5A 4QYOA 1DBJH 2QJDA 3QHFH 4UT7L 4XGZA 3WFCH 3P73B 2A6KB 1Z3GL 4PY7A 4XNQA 4P9ML 3GIZH 1AE6L 1A5FL 1O7SA 1ZHBB 1UKTA 3L95B 3DX7B 4GMSH 4CUCA 4IRJC 5MEQB 1OPGH 1D5MA 4MZ2A 4ZQKB 4MAUH 3KLAB 1U2HA 5EULV 2HTLD 5F9WC 4I9WD 3SCMA 1X5XA 4XNXH 5FKPB 1FZOB 3N50A 3MUY1 4WI2A 5I16B 2BOBA 4WWKA 5GGRB 1BAFH 1JTPA 5IJKA 4YWGH 3N1PC 1MY5A 2FATH 1UH2A 3EOTH 3U46A 3UPCA 4G7VH 5IMLB 4MXWL 5A40E 1CLZL 3ZTJG 4GQPH 5DRNA 4RMSA 2V7HB 2NY3B 3O2WL 1TETL 2C1OB 2KDGA 4R26H 1G1YA 1FNLA 4WW2C 5JNYB 3PHSA 3PNWA 3ARFD 4FTVD 2C1OA 4PGEB 5HY9B 2RIKA 1RY7B 3QQ3A 4GBXB 4TULH 3O81A 2VE6B 1CFBA 3OAZH 4S11A 4XC1H 1IFHH 2OM5A 4HWEL 3F7YA 4RAVA 3CNKA 5F93C 4X83A 5HI4C 4UZGA 2ICWI 1OM3H 3BGMA 4CBPA 1A0QH 1BQLL 1H0DA 1HSAB 4NZDA 2JJSC 2X1WL 5DEFB 5FGBC 4NWTL 1C7SA 5IMOA 1D5MB 4XBPA 1MRFL 5C0RL 3U7YH 1UM6L 1LP9A 2Y07L 2P7TA 3MROB 4QHMB 2BNQB 3ARGA 1BIIA 2FECI 1N0XH 5EO1A 4LLWB 1RJLA 3EJZD 2DLHA 1M1SA 4M9PA 1HIMH 2Y25A 5I15H 5E2VH 5E99H 1I85A 2FGZA 3ZTNH 3UC0L 3JWDL 1LWRA 4JDVA 3MRFB 4RAHA 4XPHL 1KJ2B 3FQXA 4K94H 3BESR 3CFKA 2PF6A 1MCCA 3C2SA 1TVBA 1QPXA 5FA3A 2AJYH 1YJDL 1CK0L 3KS0H 3EYSL 4OLUL 2YHGA 1AH1A 2XFXB 2NNAA 4G7YL 5D96C 4HPOL 3SKNA 3TIEA 4CVWA 4MA8H 1ZV5A 3FB6A 5D1QB 5IUSA 1X4XA 1WZKA 2DJ4A 3PWPE 2AXGA 1GGBL 4XVUC 2ITDA 4WFGE 1XF1A 1S8DA 1XR8A 2VKXA 1KJMB 4JZJC 3GO1H 4ELMF 4Y2DC 1GHFL 1KYOK 3BYYA 5A2FA 1T0NB 4ZUTB 4XCYB 1AIFB 4R4FL 2EYTA 4PUBH 1LK2A 5LXGH 2FHBA 1YEFH 1C5BL 4KTDH 5T5FL 1EPFA 3DGGA 3L3DB 4AIZA 5DTFB 1CTOA 3HUJB 4CJ1A 5F3HA 4L8DB 1K8IA 3NACH 32C2A 4PJGA 4RNRB 2HWZL 3WNLA 5EOTA 4LKXB 2OK0L 2F53B 4P59H 4YHYC 1G9EA 2EDTA 1UWXH 2H1PL 1UB5B 3Q6FA 2ARJA 4NQCA 3QDMD 1JCKA 3ZKXB 5DR5H 5KS9B 4MNGB 1QFOA 1IEAA 4PB9H 1S9XA 3MV01 2P8LB 3ARDB 1QTYT 1SMOA 4XNUL 3G5XA 2ICWA 3RY6C 1UB6B 3HZYB 5D93C 1LO0H 3U0WH 3BT2H 3OJ2C 1U8LB 3OKLB 2IAMA 4NDMA 4BQCA 5IJKC 2HJFB 4QRRE 4X8JB 2V2XB 4X6DE 3JBG7 1DBBL 4C54A 4W70A 4WI4A 1FFRA 3UYPA 4DW2L 3A67L 1M7DA 5F6HI 5B21A 2AJVL 2EYSA 3NPSB 4JB9H 1R24A 4GLRI 2A74A 1JRHL 2LVEA 4EOWH 4PRNA 1OARH 1OB1B 2J8UA 3MLPA 2WQRA 1A4KB 1FFPB 4UILL 5IESH 1HN1A 5LAXB 2G75A 2VNCA 1TTGA 4J7RA 5AYQA 1BOGA 3BYTA 4LSVL 3CXDH 2A9NH 3G6DH 2APXA 1TQCB 4K2UL 3PWJB 4PB0H 5ETUB 2NY7L 5KVMC 4CDHA 3JV4B 3GIZL 4HFWB 4POZD 4YUEH 4GKZA 4M7ZB 4HGMA 5KSVB 4M93B 3N1GC 4DGYL 3UTZA 5T33H 3ZE0E 5D1XA 2L0DA 2X1XR 5DUML 4NC0B 4U1MA 1MQKL 4OLYH 1YMHB 2YD9A 3C60C 4IOIB 5AUMA 5FA4A 2XA3A 3H3KA 4QGTA 2E7HA 5DLML 4X4XA 5DHVA 2EIEA 5B4MC 4Y88A 2BVTA 5CSZB 1RU9H 2J8UE 4WEMB 4Y1AD 1JWMB 1D5IL 3DVIA 5C07A 5E1AB 4S1DD 1YECH 1PG7H 2DIJA 2FO1A 1WISA 1C8PA 1QLFA 2CRYA 4JKPH 1YEKH 1IAKA 1UT9A 5D9SA 5I8KH 1RI8A 2J7LA 4MLIA 4URTB 3DXAD 1OGAE 5HDBE 3T0AA 1YNLL 2X4RB 1QSFA 4QO1A 4IDJH 3V0AC 2RR3A 1VFUA 3HR5B 2B0SH 5IFAL 5FM5M 3CPLA 4JQVA 1AD9B 3D25A 1FNGB 5IEKB 5HGDA 1FNHA 1NMBH 4JDVB 4JRWA 3LIZL 1RUAL 2VQTA 5SWSB 2VLME 5E8PA 1IZJA 3NFSL 3JV6B 4JO2H 2NY1D 3MBEB 4S1QH 4OAWB 4PRPB 2CRMA 3MOAL 3LKPA 3VFRA 3ARDC 4Y4KB 4CMHB 4EOWL 4WU5A 1LEGB 2VLMD 3QFJA 1WIOA 3BWUC 3UJTH 1XGRB 2DOCA 2A74B 3D85B 3S35L 1TJIH 3QG7L 1FG2A 3H9SB 5F9OH 1ZA3B 2WUBH 3QULA 4YHKH 4MDJB 1N6QH 5DMGD 5KBNC 3QUXB 4JVPA 1DBKH 4MDIB 3ETBF 3BO8B 2ICWB 1AHWA 3C5JB 2AEPH 4WHCA 2XG4A 3VA6A 3F7YB 4RAVB 4NC2B 1MWAB 3RUGE 4Z0BH 1P7QB 2F74A 1MVFA 3D2UA 4IRJD 1F6FB 2NZ9C 4G8IA 2WINB 3SKJL 4M48H 4DTGH 4WI9A 4DVRL 2EDQA 4M3JA 4K71C 4Y4HD 3MSPA 3T0XA 4E5XB 3WSQH 2YPLD 1IC4H 3DGGB 1FAKT 2FIRT 5MP6H 3FZUC 5EORL 3BQUC 1MCQA 2CK2A 3I6LD 5E4EC 5J56B 2GSIB 4AENB 1OOAA 1HQ4A 1UYWL 4H20H 4RCAA 4MQTB 4Z7OF 3WLWD 1EZVY 4MXQD 3ES6A 1DQTA 5H37G 5DJ8A 1KT2B 4DQOH 4KVCL 3RL2B 4JO1L 2LAAA 5F9DC 1VESA 3CC5A 5E03A 1LNUA 3BPOB 1GIGH 1ZT7A 4ZTOL 4XMPL 3UTPE 3EYQD 4LMQE 3JUYA 3QEQE 1UXWA 5EH1A 2HLAA 3BUTA 4WI3A 4XH2A 2VUYA 3O4LE 4GRWB 3I02A 1KJVB 4LARH 4RAUA 2N4IA 1KC5H 4I2XB 3QCTL 4H1LA 1PSKH 4EUPA 2VR4A 2XPGB 5D7SH 5BQ7A 4U1HA 1Z0MA 3LVEA 4YXKH 2FX7L 3ARFB 4DWHA 3QDGB 4NRZA 1E4WH 2AXJA 3HZYA 1RVFL 1OAUH 2DN7A 4OZFH 1AXSA 5F70A 3ZHDA 5HGHB 2I9LA 3IU3B 4OCMC 3FQWA 3KG5A 3PWPA 1E6OH 4HH9B 3F7RA 1RUMH 5CEYA 3G5ZA 5JIPA 4R8WH 3T2OA 3ARPA 4LCCC 2J2ZA 1PAMA 2AK4E 3FB5B 4I18B 5I66A 5F3HB 4Q2ZA 2YA0A 1WBZB 3D6GA 5ADOL 1CICA 4F8TA 3WV0A 3IJYB 3MROA 4K3GA 4QHMA 4UT6H 4I2XA 4GBXC 5GS2H 5ILTH 1WIUA 4G42A 3PJSB 5TE4H 3WNPA 3U4EA 2OP4L 4L8SB 3MLZH 1D5BA 1EXUA 3QDMA 2B20A 5C0JA 4LSDA 1T0MA 4LDOB 2D4FA 2WW8A 4NQDA 4IMLB 1N6UA 2CDFB 2EDNA 5HGAA 2DBLH 4F3FB 5SWZE 1PGRB 3C2AL 1CD1A 3H7BB 5GRVL 4ZO9A 4PJCE 4JM2D 1I8LA 5DJAA 5CJBA 4ISVA 4HIJB 2ICCA 5I17B 5HY9A 2GJJA 4QXGL 3TM6A 2ZZUT 5EUKA 2PO6B 3KXFB 4PJEE 2XN9D 5AAWA 3A0OA 1F6LL 2XFXA 4PRHA 5KOVC 1T2JA 4P4KD 1JMZA 5IG7B 3HZMA 3FO2B 1J0HA 3FT2B 3MRLA 3ARWA 4PJXE 4ORGA 5FKPA 3L5HA 4FXGB 3DURA 3QDME 1AHWC 3OXRB 4JM2F 4X6CB 4OQTA 1X3DA 3AXLA 2PNDA 5FUCE 5IBTL 3SDAC 1QEWB 4LEOB 4Q9CA 1KNOB 3CZJA 1J86A 4LLWA 2UWEF 3RDTB 4XCNB 1BIIB 3MRCB 1JTTA 1R3JA 1HHGB 4IIQB 5EIVA 2D31A 3O41A 5FOBA 2UZYB 3JZ7A 1FPTH 2O5XH 4XVTH 2GSGA 1BGXL 1F4YL 4QYOB 1OP9A 3NFSH 4LQ1A 3FQUA 5LWYH 4RQQA 3L6FA 2H9GB 3GMMB 4LCIH 3GI9L 4ZG1A 3FFCE 5D7IA 2WLZA 1UGNA 5ALCL 1BIHA 4AY0A 3O6LH 1DE4A 1ITCA 5IV2B 4CL7A 5FDWB 2FR4A 4GAJH 3PGFH 2QHRH 4PJ9C 4PV8A 1PBYA 4GBXA 5KW9L 1I8KA 4KKNA 4NKIL 4DZBA 5L8LB 4F57L 1T6VN 2OZ4L 1P84J 2IFFH 2JJVA 4FP8L 15C8L 3DV6B 3S37L 1HE7A 3IXAA 2V7HA 2VXVH 3MQIA 1K8DB 5GJTL 4WDIA 4X9IA 2NY6C 5SWZB 4Y5XB 3ZE1E 3WHXB 3SE4A 4UU9A 3KPSB 2E9JA 1UXSB 5IBUB 4M7ZC 1MHEA 5JPMB 3MV7E 4PRDA 4YXLL 1N5AA 2X9XA 2JK5A 3WKNA 5K33A 5JQ6L 3O8XA 4UDTA 4JY6A 3LEVL 3KHQA 5C0AE 2EH7H 3D87B 4R4BB 3L7FA 1FGVH 2WANA 1FL3B 4DKFH 4LLAA 2CIIB 5FA4B 2R2EA 3AS0A 4QTIH 1ND0B 1N7MH 5TQ0H 1BQUA 3GMOA 1AO7D 1HHHA 3D39A 4L4TB 5C0AD 5DJYB 3I3DA 4X6EA 1MCIA 4L5FH 5ISZB 43C9A 4EN3B 2WNGA 1F58L 3MV9B 1U8MB 4R96A 3MNZA 3GSOA 1ZLVK 3IS1X 3JWNC 3TZVA 5EUOE 2CKBB 1AKJA 2DKUA 1MQKH 2Y7QA 3CUPB 4PJHE 3LPFA 4X6FB 4MGXA 4P4KB 2HG5B 3ALPA 4WHYH 3BP6B 1JZ4A 1SJEA 1R24B 3H9YA 2R4SL 3KXFD 5D7JD 5GS1A 1BF2A 1UZ6F 3MBXH 4ZTPH 3O2VL 4HZAA 4F2MB 2X4SA 3G6JA 3VD5A 4YDVB 3WFEH 3MNVB 4XMKH 1JPGB 4R7NA 5IHUH 3KPRD 2EDFA 1DFBL 4R2GB 1KEGL 5CD5D 1AC6A 3RA7L 3RGVA 4Q74A 5I8KL 3EKCA 3O3EB 3TJEH 4DOHE 2P24B 5GGVL 4QNPE 3A6OA 3MRKB 3S4SA 4NZTL 4GMSL 4LP4A 5AZEL 1MEXH 3Q2CA 5KVDL 4C57C 4M5ZH 5KVFL 5ILTL 3MLTA 2BSTA 3O8XC 4LKXA 3LKRA 5T1KA 4LIQH 3V0VA 3BVNB 4HV8B 3TBTB 3T65B 4RGNB 3BIBX 3CXHJ 4PY8I 2DWEA 1INQB 2EDJA 3IJHB 2QR0B 4I0PD 4S10A 1Q94B 3UJTL 5J12C 4PJBA 1TCRA 1BLNA 4TVSa 2PYFA 3MOAH 3MODH 4J8RB 3D0VB 4PJ8B 4KAQL 4YBLB 3OZ9H 3RUGB 3U0TB 3HPLA 4LAQL 3X11B 2DLFL 4EDXB 5KZCD 4W4OA 5HHPA 1G7JB 3UPAA 2VLLA 3TA3D 3KPTA 3NA4A 4WTZG 2YR3A 4LSTH 3CMOH 4I77L 3K4DA 1REIA 2GKIA 3AC0A 4RMUA 2VDOL 5I30H 4M43L 3UTPD 3GSNA 4H88L 4OZ4B 4NQEA 1MFBH 5C9JB 4KI5E 3UTQA 3SDDA 3UTTB 4Z7UE 2VO5A 1IGFH 4YDKL 2BSRB 4PLOB 3ZKSD 1T22B 1RMFH 3GMPA 2E6JA 3QIWB 1HILA 2P8PA 3BPLC 4OT1L 1LEKA 3RL1B 1J5OH 4Z0XB 2J8UF 4P5KA 2P4AB 4F33A 2D7QA 4NKOB 3AREC 3DHMA 1IVLA 2J1KA 1IGMH 5IMKA 2H32B 5DHVH 1I3UA 4Y2DB 1RAMA 3OKYA 5FYJL 1VFAB 5J89A 3RI5K 1WCBA 5DZNA 1BD2A 2Z91A 1E27B 5JDSA 4MXVE 3UDWA 3DBXA 3HE6D 3FFDA 4TUKH 3PIQA 4NQXB 1R5WB 4AM0B 4Y4HB 3CFCL 2FL5A 1MY7A 3VDAA 4XI5C 5F96H 5C0CD 2X9YA 3JVGA 4E9LA 4WHTA 1RJZA 4I18C 4AH2B 5DJ2B 4Z7VE 2RJMA 3D3VD 5FYLE 2DMCA 5DD1H 5JHLL 1E4WL 4PRIE 1MHEB 4RSVA 5SWSD 1RQ5A 5EOCH 2NY2D 3EYQC 5HYJE 3TO4C 1P5VA 5J12B 1XF2B 3WHXA 4LAQH 2B1HL 3VFUA 2P5EB 1MCOH 1A1OB 3UEZA 4K9EH 4RGNC 3V52H 4ETQA 1BFVH 4KHXL 3O3BA 5J9PB 5JORB 2MSPA 5L8KB 1EUUA 2XTJE 4Y5YC 4GG8A 5DRXA 4EDWH 3AAZB 3VFVB 4WUUB 3EYFA 3VXPA 2ZUXA 3B6SB 4UINH 3G5VA 4LSSH 5DRNB 5K9KB 3DO7B 1JHTA 1GH7A 3CSBA 1CZ8H 4F7TA 3K46A 4PUBL 5D2NA 1JIBA 3AUVA 1RZFH 2I5YL 3QIUC 1A47A 4F58L 4KK9D 4HXBL 3KPLA 4OD2B 1IGFL 1LO2H 4YDKH 3ZL4H 5DGQA 2BNQD 5TFSH 3VFSA 1R5IB 5C08A 3FO1A 2H41A 3MGTA 3UJIL 2VIRA 4WUUD 5FGCE 1T03L 2BSED 3BJLA 2W0FB 5J4MA 3JTTA 4ETQB 5MEQA 4ZPTB 3WCYA 4E0RB 2HVJA 1FE8L 2X4OA 2ZUQB 4YR6B 2AEQL 4Y8DC 3BZEB 5EBGA 5IR1A 5HHME 1T89C 4WUUE 4HKXA 2R0WL 4RGOL 1KJ3H 5HI3C 1QEWA 1AGEA 4LEOA 1NL0L 2B8OT 5M7QA 3SDCD 5JZ7D 2KH2B 4O4YL 3LY6A 3ELAT 3BKJH 3SGJA 3L1OH 2VZSA 4X7EC 5C0AB 4HCRL 3MBEC 1M6OB 2ORBH 4NZRH 5C0CB 4C56E 2OTUB 1CLOL 3UAJC 1IGJB 2JKXA 2H2SD 5C0NC 1YEGH 5IK3A 4HZLA 4LKCA 3LD8C 4RBPH 4HKZB 3T0EE 4XPGL 3SKJH 3THMH 4G6AC 1I1AD 3AY4A 1NLDH 4HIJA 2IAMD 4HWBA 4WVRA 2VDQL 2COQA 4HHAB 3QUYA 4P4KC 1Y0LA 1HKFA 4QWWC 2C7UA 3HI5H 1EHXA 3MJ6A 5E08H 5EC1A 1Z0NA 1IKNC 4CN1A 5DVNA 3L3HB 5CIPH 3OF6D 1UWXK 3C6SA 5BZWA 5FO8A 3QRGL 3MA9H 4PG2C 4WW1B 5I74B 3GK8L 1FVEB 2X70B 4LEXL 4OFIA 1YQ2A 1SEQH 4PTUA 3UTQB 3K80A 2P42B 4NQEB 3VG0L 3MODL 5GZND 1EAPA 4ZO8A 2R2HB 4PR5A 1NGYB 1I8MB 3MUZ1 2Q8AL 5TFSL 1PYWB 1F02I 5DHYA 2VXUL 3EOAB 2R29H 1T1XB 3SCMD 1CVRA 4KK8C 3U6RB 1YECL 3V6ZB 2GJZB 3MFFA 2NY5C 4ZSOB 1HWGB 2W60A 4YNYB 5FCUH 5IHBA 4HWBL 3NCMA 4PJFE 2QHRL 2LAGB 3RGVD 2GAZB 4BQ8A 1T7YA 1JNHB 3TH4T 5KSBB 4DVBB 3IDXL 2VDOH 5I30L 1CFNA 5IEHB 1DVFD 3KPOA 4YO0A 1I8LC 5SWQB 3LOWA 4XX1G 1T1WA 1NAMB 4KV5E 5F1IB 3QDGD 4L4VE 1JYXA 1XF5B 2ZOLA 2YA1A 1HCFX 3C60B 4E42A 2OMBA 2R9HC 2BY2A 2NQCA 5L2KE 3BAEH 1S5HB 4NNYA 3OBAA 2DQEH 3CMOL 3BE1H 1DEEA 4PJ9A 4HIHA 2RFXB 3NCYS 2IQ9H 1QA9B 3KXFE 4PJEB 1UEMA 3CH8A 5L2KD 5GGSY 4N8VB 4M7JH 5HDQL 4MCZB 4QT5A 4PJBE 4MB5A 4HGKC 1MHHA 3QEUB 5CINH 4KFZC 3RL2A 1N7ML 1Y18B 2EDYA 4D3CH 1HOCA 4MNQA 5KSUB 3STLB 4YDVA 1JNLH 1FYHB 5D1ZD 4H5SA 1W2KT 3CFCH 1P4IL 3NGBC 2YPLB 1CE1H 5HHNA 4NGHH 3I3BA 2XWJA 2DQJH 1P5UA 1T04A 3KLDA 4WY7L 1A14H 2XZAL 5BRZA 3RGVC 1KIQB 1A7OH 4G8IB 2DL9A 2AK4B 5D93B 5F7DB 5IHZA 2IG2L 2LVCA 5DYOA 1WC7A 3RTQB 3BN9D 4NN7B 2BK8A 1JNJA 4LHUD 5I6XC 5IGXH 5JQHC 4OZFG 3S97C 5JW4Q 3HE7C 2ZG3A 1I9IL 4JE4B 5FCUL 5T3ZH 2H2PC 1NAKL 4CU6A 2JF1A 3NFNA 1H15A 2ZCKL 4H20L 5HHOD 3GGWA 1YEHL 2BOCB 4K94C 4N9OB 4ZXBD 3C9NA 4PB9L 1YUHB 4JO1H 3MV11 3OAZK 5A3ID 2HT2C 1HINH 3SGEH 1QR1B 4NHCH 5MERB 1LO4H 5EDXA 3HMXA 4M6NL 3O2DA 4O2EA 4RIRB 2BSSA 2AABL 1AQDB 4J3UA 3SE3A 2IQAB 1UCTA 3JV6A 4AZ8A 4ENEC 4LLYA 4JQXC 4W4NA 5SWSA 3DRQA 1KJ2H 2N7BA 4HC1A 5HGDB 4B41A 2D9QB 5HDQH 1VGEH 4JFED 5LGJB 3CPLB 3DVFA 3RNQB 3BPCB 3KAAA 2AK4D 3B9AA 1UA6L 1VA9A 3BPCA 4XXDA 2XYCA 1PY9A 4L8BA 3K1DA 5DD3H 3H9HB 3DUUA 2H32H 2CJUL 3V6OE 5FM4A 4PV8B 2PCPB 4NKIH 1G7MA 3LH2L 2YXFA 3WIIL 3AS2A 1U8NB 2LABA 1YEKL 4W68A 3MLWL 5F72S 3NIGF 3PDOA 2JJTC 3ET9F 1INDL 5E1AA 1FORL 3D1MC 4NGHL 2R0LH 1EEZB 4KV5F 1CL7H 3SKMA 2ZOKA 1NANH 2IPKA 1XR9B 4P46C 3RVUD 3NN8A 3NIFE 3R4DA 3P9LB 5DHXB 5IVXA 1ZHKA 5FYLD 3NCFB 4LRIA 3WIHH 5JR1L 1CE6A 2CGRL 4G6FD 5CHNA 5K9OB 3EHBD 1A9BB 5AZ2H 1UM5H 1N64L 4JKKA 2A38A 3HA0A 1TJHL 4TRPL 4N0FB 1CGTA 2VL5A 1YY8B 5IOPB 3JVGC 4G9DB 4KROC 2E9WA 4YC2C 4BFIB 4U1JB 4HFWA 5JHDE 3N85L 4YGVB 1QFPA 1I3RB 3TC9A 5HD8C 4X8XA 3REVB 1KEMH 1M7XA 3WYRA 4QNPF 3SPVA 4Z7UB 5H2BB 3TYGL 4IDJL 3ARED 3P30L 5TQ2L 2DTML 2Q6WA 2WSKA 1ETZA 1NFDB 1S7UB 2FZ3A 4LCCA 4M3KB 4N8CL 4ZOAA 4YBHA 1DJSA 1HNGA 4EI5C 3OKNA 4MJIB 1OAXH 2R1YA 4LPUA 3SE9H 3UX9B 2R4RL 4IDLA 5I6XB 3TFKD 4KPHL 4OLVH 1DANU 3HG1B 4OSUL 1PKQB 5IROC 1CXLA 2R4SH 4FFWC 3BX7C 1B88A 3VFGH 1I3VA 1F13A 4YDJA 2X2YA 4QRUA 1MJ7L 1HHIB 1RZKC 1U93B 3FFCD 2Q8AH 4PGBB 2D7NA 3X3FL 3K3QA 5AWNL 3DARA 1A1MA 3QEGL 1JFQL 4F7EB 3HRZA 1DEEB 1S5IL 4JFXA 2OQJB 4B0MM 1V05A