2JJWA

Structure of human signal regulatory protein (sirp) gamma
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
111
Chain Sequence
LQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKNVEFKSGPGTEMALGAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL REGULATORY PROTEIN GAMMA
publication title Paired Receptor Specificity Explained by Structures of Signal Regulatory Proteins Alone and Complexed with Cd47.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 21
structure length 111
sequence length 115
ec nomenclature
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jjwA01
1J8HB 4BH7B 4GOSA 1IGYB 3MCKB 5IHBA 2F53A 4OQTA 4F2MB 4ZXBD 1S3KL 4BELD 1YC8A 2X9XA 2NYYC 4FQHB 2YEZA 4NQXB 4Y8AA 4P2OA 5D7KE 5IMMA 3H9SD 3ZT6A 2XTJC 3G6DL 3E0GA 4PJAF 2XY2A 4G6ML 4MA3B 4K7FB 2FECI 1NC2D 4ODSH 2KUTA 3OG4B 2F5AL 3VDAA 4OKVA 2DQUL 3S4SB 4YHNA 3WFHA 2GSGB 25C8H 2V5YA 3BXNA 1CFSA 5F9WB 4LHUA 5I1KH 2IG2H 4OGZA 1PGRB 4F15B 3MXWH 3MREA 2AK1H 3QCUL 3QZWG 4KKNA 3BP4A 2DLIA 4HS3A 5BXFA 4OF0A 5HVHB 4WU5B 1WT5A 1V7ML 4ELME 3LS4L 1E4KC 2P5EB 3C6LB 4NQCD 1AY1H 4R7DB 1T22B 4J6RL 3TN0B 3L3OA 4QXUL 2R0WL 3HUJE 4J8RB 3ZYZA 4ZFOB 2YRPA 1MHEB 3CMGA 5GJTH 5E94B 2AI0H 3MV8B 1RZKC 4FQ1H 2ESVA 4WFED 3ISWA 1G7PA 1KT2B 4AEHL 4NZUL 5H37H 5DR5L 2I25N 4HWBA 3SDCB 2Y5TA 2RGSA 5F3BA 4Y89A 2QHRH 2QEJA 3I02B 3BPNB 4NN7B 4LVHB 4DEPC 3PGFH 4KZEL 4KUCD 1IAIL 3TP4A 3MRKA 1JGVH 2PXYC 3DXAB 1T0NB 1HXYA 4HZLA 2HT4C 4NDMA 1M05B 1YEHH 5GRYA 5TF0A 4NOBA 3LPWA 3VFTA 2D31B 3L3IA 2WSKA 4PJ7F 4MWFB 3UJTH 4KUCF 4QYOB 4JO4H 2JJTA 1N2RB 4GRLD 1S7RA 1ZVYA 3PWJB 5KOMC 2ZNWA 1KJ2A 1SMOA 3DI2B 1LEKA 1QP1A 4KI1A 4XMPL 5EZJA 1YY9D 1JYWA 3Q3GB 4LCUA 2F54A 4PTUB 2ENYA 4YFDB 3TZVA 4CAGA 4AG4L 3RPIA 1CFQA 3PWPD 2OR7A 4WU7A 1LO2H 4WW1B 2O5YH 4OSUH 4MS8D 1L7TH 5JMOC 1A7OL 1F3DH 4WEUD 4M6OH 3QBTB 4GFTB 3GSWA 1LO0H 1WBZA 1P7QD 2I9TA 4KK5C 4JM2D 4C56E 4LLQA 1KEMH 1AP2B 4R8WL 3VI3E 3EOBB 4FQLH 1EO8H 1QUNA 1OWRM 4CN6A 1OSPL 5CAYB 5JQ6H 3ULUH 5JUEH 3QIBB 3WUWG 3MV01 4NKOA 3VH8G 3WFZA 5EFIB 1INEL 3SKUD 1IQWH 5EUOB 2DYPB 1G9NH 5FUZL 3BVNA 3OXRB 4O9HL 5HHOA 3RDTD 4HWEH 1S7VA 1V3JA 4Y88A 3L5WB 3BD4A 1ZS8A 3OAUH 4JM2F 2OR9L 1A3RH 3CSYB 2AXGA 1A6ZB 4M7JL 3ARBD 2BNUB 2AJXL 2CKBL 1CDYA 3IFPB 4PBVC 1KPVA 1OAUL 3HI5L 2OI9C 1RUKH 3TPKA 3M17B 4OLWH 3DX9A 5HDBE 4NRZB 4PREB 1V8HA 3VFRB 3RZCA 1B2WH 3FOMA 3BO8B 3HZMA 3IDGB 3NFSL 4WUUE 5E8NA 3TA3D 2H32B 1FE8L 4JEGB 1U8OB 3VXOB 2ICES 3OHXA 4WY7L 3CFDA 2A1WL 3RL1A 5LXGH 4WFHE 4M5ZH 5FA3B 4L3AA 1CF8H 4MXQC 2YWZA 4IS6A 1RZGB 5LGHL 3MNZA 4JRXE 3U46A 1OW0A 4GRWB 5HDQH 2UY7A 5FB8A 3LQZB 3PWVB 1QA9B 4L9LB 4TUOA 4LL9A 3VGGA 3K2UL 3VG9C 1QFWM 35C8H 3DVIA 4ZQKA 2R1XA 3S34H 4M62L 1F2XK 2F19H 1H8SA 5D7IB 5KS9A 4DVRL 5DRXA 2R1YA 1YEGH 3QFJB 4IDJH 4PJXF 4DKEL 2CLZB 3LEVH 1R24B 3QUZC 2P5WE 4Q6IC 5ADOH 8FABA 1AGCA 2FATL 3SDXF 5D7JD 1RK0A 3U4AA 4X8JA 3WKMH 5I1DB 1FCCA 1PBYA 1TETL 5K9QG 2B0SH 4JHWH 2OL3B 4KXZH 3OMZA 2JB6B 2AERT 4Z0XB 5GGSY 5HGBA 2YXFA 5I17B 3O9WA 5GS0H 5FGCE 3PDGA 4JHAL 3TESA 3S88L 3FB8B 4LU5H 4RMTA 4HG4K 5C9JB 1MCFA 1CL7I 1E4JA 4U3CA 4YHIB 1SY6H 3BQUA 4C58B 4Z7UA 1GGCH 1J0HA 2A6DB 5DMIH 4TQEH 3IDNB 2XZZA 4CNIA 4G9FB 1IC5L 1HH9B 4K94C 2V5RA 3RWJA 3SE9L 1JPFB 3DGGB 2Y36H 5D9SA 4KQ3H 5EULV 1CU4L 5I8EA 2FR4B 3BZ4B 5IB4A 2MJWA 1FVCA 4XTRD 5J7CC 4G8FB 3MODL 5DGRA 4RZCB 4P0DA 3D48R 1YA5A 3O8XD 3G9AB 5DLML 3MUGB 1F4AA 2XA3A 4C83A 4UTBL 4Y2DB 1A22B 5KJRH 2CGRH 2AW2A 2O5XH 1B88A 3ZZ1A 2FSEB 5K9KB 5E9DA 3JTTB 2ICWJ 4IRJD 4CVUA 3ARRA 3CXDH 4N8PA 3O3UN 4WI8A 1EBPA 1DANT 4XBEH 3QXUA 4P4KB 3TJEH 1B2WL 3FQXA 2XZQH 3IETB 5FKAA 1HKFA 3WN5C 1PKQA 3RVTD 1PYWB 4HUXA 5I1JH 4BSWA 4HBCH 5IEKA 4OCXH 3MMEA 5DA0B 3X14A 1EZVX 4MNQB 2BJML 5F1NA 5F9OH 3U6RB 3OKEB 1DL7L 1QBLH 1JIBA 1QD0A 3FT4B 4XI5D 1EEYA 3D39A 1KCVH 2B5IB 3KYNA 2VXSH 4QRPE 5DMYA 4KFZC 4MD4A 5JDSB 1YPZF 4GW5B 4CU7A 2VKXA 3MLZH 4RFOH 4HJJL 1IM3A 1EBAA 2AXFB 4KVNH 3JXAA 3VD5A 3BAEH 3HI6H 4TUJA 4X4YB 4R4BB 1RJLB 1AO7A 1F58L 1ZHLA 3KNBB 1W8NA 5FKPA 1A7NL 4OZHB 4PJFF 4QHMA 1TZIA 4LEXH 3BZEA 2P44B 5JDJA 4Y1AD 2NY2B 4PJ9C 4BUHA 3LEVL 3SQOH 3SKJH 5J3HD 1VFBB 3L3DA 3U79A 1KNOA 1G7MA 1GZPB 1M71A 4XH2B 3V52H 1KEGL 1MCQA 3N85H 1GZQB 2VLKD 3DUHA 3BN9D 3HHRB 1K85A 3RWFB 5IUSA 1GIGL 3F12A 3U0WL 2AK4A 1ONQB 3HFML 3ARFC 4GUPA 3QDGB 4A6YH 5GZOD 5SWQB 3FHQA 5ID1A 3U36B 3GRWL 2IADB 2H2SD 5GXBB 1EHLH 2K9UA 2ZPKH 3WJJA 3SDDA 5TE7H 1UT9A 4BQ6A 1G0YR 4JFEE 5DJ0A 2VXQH 2FBJH 3AS0A 2IH3A 3HC0A 3DURA 4S1DD 4NBZB 5IFHL 1FFQA 3QEQD 1BZ9B 3MRLB 3QPXH 4PRBA 4GXVL 3H0TA 4OTXH 3NZHL 1S5IH 4FXKA 4EVNA 2DBJA 3IF1A 4FZ8H 1T7ZA 3QO1B 2LQRA 1OGAB 4MXVE 2BVQB 4FQXD 1CK0L 4YGVB 2PETA 4FG6D 2AJ3B 2EH8H 1AD9B 3NBNA 3V7AE 3VG0H 2Z91B 4P48A 5IFJA 5DK3A 1NGQL 4Z7QE 4NRYA 43CAA 3TO2B 5KSBB 1N7MH 2FO4A 2XN9B 3SDAC 4OFKA 3EBAA 3V0WH 1I7UB 4EI5A 3KPRD 2CH8A 3BDYL 3MX0A 4POZC 1JMXA 3C8DA 2BVPB 5D1QD 2G75A 4ORGB 4HKJB 1H0DA 1KLFA 5C0RH 1WCBA 4O02H 4WGVB 5B38A 4JREC 3TT3H 4P23A 3VXNA 4EDWH 2CDEA 5D4QA 2FIKA 2F53E 5ISZA 4OCXL 1N5YL 4DKAA 3O41A 3E6FB 5IVXB 3VXUD 5FYJH 2HJLB 3P9LB 4ZFZA 1QKZH 5KSUA 3VFPB 5F9DC 5LJYH 1FGNL 2D4DA 1BD2B 5H37G 5H94B 5AD0A 3FTGA 3QUML 3TNMA 4HZAA 5I66B 3MLPA 4K3EH 3OQ3B 4WJ5A 1ZEAL 4OLZL 1ZE3C 3MACH 5DK2A 4UT7H 2CK0H 3GMLA 3A67L 3PWNB 3QG6B 5DD1H 3BH9A 2FEEL 1RUAL 2FH6A 1WSST 1FNEB 2E7HA 1Q9WB 3G04B 2HKHH 2VTFA 3OJVC 2R0ZH 2V9RA 5CD5D 3OZ9H 1IZKA 4J3SA 5CHNA 5D71H 4Y4KA 2QKIA 1NFKA 4O2FB 2AJSL 3AS1A 5J1AB 3OAYK 2C3VB 4JFPA 1BF2A 1L0QA 3AFLA 2VLJD 1IAII 2IF7A 5C0BD 2YD2A 1Z0MA 1BLNA 1FLRL 1MFBH 1Z6JT 2ESVE 1A4JB 4G42A 1HHKB 5T3XH 3UC0H 2F8OA 2BNQD 2VSCA 1NAMB 4X98A 4XXDA 1QPPA 3LS5L 3OR6B 4LSPL 5DDHA 4BH7A 2P1YA 3JWDC 2BXYA 1QBML 4JM4H 3P30L 4OLXL 1RZJH 3C5ZC 3L6FA 1F90L 2OZ4A 4F2MA 2F15A 4XGZB 1QPXA 2Y25A 3SCMC 2QQKH 5KSAB 3VRIA 4ZUUA 2FD6H 4DUWA 2OR8A 1HHHA 4HMEA 5EC1A 3DRTA 4M6NH 2L4OA 3BKMH 1P6AB 2FGWH 3GI8L 2VKWA 4FQHA 1G6RH 3KPPA 4KY1L 4NQXA 2PTVA 1IEBA 1MAMH 3CFCL 3MROA 3Q6GL 1HEZB 4MSWB 2X4UA 1KTDB 5C0AD 4MA3A 1TXKA 4K7FA 3QA3B 3VWKD 2VIRB 3IKCB 3O81A 5FK9B 3S4SA 3MRIB 3LKNB 4ZUTB 4DOHB 5J1TC 2GSGA 1W72L 1IEAB 1SEBA 5C2UB 5IIEB 5ENWB 2NX5E 4QHUB 1K5NB 1C5DB 1MAKA 1D9KB 1Z9LA 4Q9QL 3QYCA 1MJUL 4K9EH 4X9HA 2OJZL 4JPKL 4P49A 4XP6H 2P5EA 3GBML 3B8YA 4C54A 3TN0A 4D9RE 1QZ1A 1CS6A 5KTEL 4I48B 4J8RA 4MQSB 4ZFOA 5BJTB 5C0RL 1K8IA 2KPNA 1CICC 3AXLB 5E94A 3DVGB 4NM8L 4HHAA 4NO2B 5DS8B 5T3ZH 1KT2A 2B7DT 5J89A 3KPQB 2EIEA 1KULA 4Y0GA 3MLVL 2OMNA 4W4OC 3UXFA 4PLJC 1DEEA 5D5MF 4UTAH 3C09C 1B0GB 1BFTA 4MCZB 1CD0A 5F3HA 1EJ6A 1P2CB 1LHZA 5HHOE 3DXAA 1T0NA 5DTFB 3WS3A 3DIFB 3GEWB 1M05A 3GSVB 4PJAA 5AUMA 1FNGB 2VDOH 2XRAL 4JY5H 3CFJB 1MCKA 1XGPB 2D31A 5IBTH 1J1OL 2IPUG 4L8SC 1FVDB 1MRCL 2GITB 4QYOA 4LIQL 1N2RA 1I1CA 2CUIA 3LAFA 5FM5O 3PWJA 3H9SA 2X4NB 1QRND 1U92B 2HJFB 4XPGL 4NZJA 5SV3A 3P11L 3BSZL 2G5BB 3GMOA 4P99A 1LO3H 3Q3GA 4W6WB 3MRRA 4MNGA 3ULUD 1R3IH 5EB9A 3KHQA 4K71C 5GRVK 5I16B 5ANMB 3K3QA 4HUNB 4YQXL 2QTEA 1UWEL 4NZDA 2CPCA 4XVSH 2PKDA 4AEIL 3RGVD 2ATKB 1X5AA 2V7HB 1MCOH 5F93C 3ULUF 3CVHH 4M43H 4NZTH 4RDQG 5I2IA 1FDLL 5I1HL 2YZ8A 3QIBA 5ELIA 4TPRL 4ZPTB 2RAMA 1E28A 5KS9E 3W0WB 1FYTB 2YD4A 5EUOA 2KL6A 4DWHA 5INDB 1U8JA 1ZSDA 3ZYJA 4OCRH 3OXRA 2W1NA 3QWOB 3U9PH 2XG5A 4Z95L 2CRMA 4ZTPH 1MCIA 3EUUA 3FJTA 5DO2C 1A6ZA 5MENB 3MZTA 2BNUA 4FQ2H 3VU2A 1LD9B 4HF5L 2DQTH 4OF5A 3QUYB 4HS6A 5AZ2L 4HXBL 3BKYL 3RVXC 3C9NB 4HLZH 1NEZA 1NSNL 2R4RL 1KELH 1U8KB 1XCTB 3QUXD 1ACZA 3UJIL 3HB3C 3IDGA 1JGLL 2C3HA 4K9EL 3FZUC 3KHOA 5GRUL 3MLUH 1WFOA 4NYLB 1FL5A 2HRPH 3I84A 1U8OA 4Z7UE 2PYEB 5IWLC 1SBSH 1QRKA 3HE7D 1KCSL 1QSEB 4LSRH 3JSSA 4NBXB 1Q1JH 3AC0A 2YBRB 4XBGA 4KH2A 1RD6A 2NY3B 2EIDA 4Z78A 3I50H 5F96L 1RZGA 1MWAL 1H3VA 2C4FT 1H5BC 4LGPB 3GIVB 3VI4E 4JG1L 1YQVL 3H7LA 2DLFL 3LQZA 4L9LA 1RU9H 4G6AD 4KGLA 4I2XB 3CLEL 4LLWB 2EECA 3A6BH 5DJZB 3GFUA 2E8ZA 5GS0D 3DYPA 1BJMA 1A6VL 3MNVA 2AJZB 5J6GA 1RZ7H 3K4DA 3QFJA 3ZL4H 4NWUH 2E5EA 1IGJB 2CLZA 5E9DE 5HHXL 3VFGL 1NPUA 3P4OB 3QZWA 4OZFB 1OTUD 2WBJC 1JZ5A 4QTIL 3NIDF 3QQ9D 1TTUA 3V4PL 3HZYA 5HHMB 3MGOB 1DBAL 5I75B 1HIML 1A6AB 1L6XA 5H2BB 4M03A 3HMXL 3QSKB 1EEZB 4JPVL 3FFCD 4PGEB 4NHCL 2JB6A 3CSBA 1PKQE 3DI3B 4R0LB 4Z0XA 4M6AA 3PGCB 2BVEA 2PCPB 3ZKQD 3FB8A 3NGBC 3RWIA 3WSQL 4S1RH 2RQ8A 5C9JA 1JGUL 3V6OC 3PV7A 4P5KB 2ADFH 4NRXB 2VZ3A 4RDQF 4YHIA 2ADGB 5IW6B 3D39E 3GJFH 1NFDB 3ZDXE 5K93A 1T1ZB 4BA8A 4P5MB 4ALAL 3VWJC 4XWGL 4V2CB 5HGHA 3IDNA 4IMLA 4P5TC 1QLEL 4G9FA 3HKFA 2ITDB 4H8WC 1LO5B 4M43L 2GJ6B 5D6DC 4OZGB 4D9QD 3DGGA 1NBVH 4XCYA 1AO7E 3BPOC 3BZ4A 4NQDD 2J6EH 4K8RH 1PX4A 1OB1B 4RWYL 3GMQA 1H15B 2W0KA 4HJ0D 4I18A 1I8KA 5TH2B 2BVTA 1JFQH 2XG4A 3HC4H 1EUTA 5C0IB 4XMKH 5AYQA 3MUGA 1OAZH 5C0FB 3MCG1 4QRQA 3K80A 4XXCC 4IRSC 4NM4H 5SWSB 3SDXA 5K9KA 2AK4E 5MERA 1X4ZA 1P5UA 3JTTA 5IOPA 2YPKA 4OT1L 4RGNB 4HV8B 3T0ED 1QLRA 2VLRB 1T83C 2YD8A 2Q8BH 1ZA6A 3IETA 4LOUC 1QFUH 4L4VD 5IMLB 4MXWH 1BAFL 3UAJC 4F3FB 4J2XA 1PYWA 4HGMA 4F58H 1ZOXA 5FCUH 3CAFA 2FH8A 1IRAY 1WBXB 5CINL 3CD4A 3B2UC 3TCLB 5T5FH 3MLYH 4X7FC 3U6RA 1S7TB 3WUWA 3VH8A 3IS0X 3FT4A 5CCKH 3DRQA 4KRPB 3VD9A 2XNAB 1ED3B 43C9A 2NZIA 3RWHA 3CU1A 2V2XB 1F11A 1OT2A 5HI3D 3SE3A 3I2CH 1QFHA 2DMKA 1U8LA 1MIMH 4U6XB 3WL9B 4X4YA 4NSKB 4X6FB 1DQDH 3MRFA 1IKNA 1X3DA 3T8XB 2YSSA 5F7MC 3FQTB 4LKCA 5DZNA 4WW2B 1TNMA 2R29H 3BRDA 2D0GA 2DKMA 4GKNB 3U7YH 4M4RA 1HINL 4NT6A 1EFXB 3NACH 4R2GD 1Z9OA 5HYSG 3GKWL 3ARQA 4WWKB 5B21A 1GZQA 1WICA 3HAEB 1A7RL 4JQIL 1UWGL 4YXHL 1CDIA 2XPGB 4FFWC 1UENA 2K3TA 4E42B 4OLYH 5SWQA 3U36A 2MQ3A 2D2OA 3KYAA 2E7LA 4PRPD 5ISZE 1X5JA 4PJGF 4IRJA 1RIUL 2W9EL 4P2QE 1OM3H 5I9QC 5C0JA 5BV7H 2JCCE 2FEEI 1BJ1J 2P8LB 3VE0A 4OFPA 2K1MA 3MRLA 3P4MA 4U6YB 3KGRA 3VXSB 1CR9L 3FQWB 1YPZA 4FXLA 2A0LC 1T66D 3MR9B 3NAAH 4FP8L 3T4AB 3LN5A 2A2QT 1KN2H 4TULH 4P9HL 1E27B 2AEPH 2AXHA 3E8UH 2FLBT 2ED8A 3AUVA 2YA0A 4AQ1B 3V2AR 1T1YB 1FJ1B 4ZG1A 3O4LB 3EYVB 1BECA 4GBXD 4YGVA 3I6LD 3M1BB 3GSOA 3RI5F 3N0PB 2AJ3A 4TOYH 1JFQL 1FPTL 3MLWH 1N64H 5IV2B 3TV3L 2Z91A 4QCIA 4XB7A 4PP1D 2I9LB 3WIHL 3HS0A 4XNQA 2QL1A 1I1AD 1G7QA 1YEFH 2NY6B 2JJSA 5EPMB 5EUKB 3TO2A 2CJUH 4H8WL 5KSBA 3ALXA 3VXQB 3BP5A 2C3WA 2X2YA 1UYWL 5FYJD 5L2KB 2XN9A 4B0MM 3BKJL 1CN4A 2IPUK 5F9WC 1KLGB 2PO6D 2XKNB 2VZOA 1I7UA 4X6DB 5HGGS 4LDEB 2IFGA 3HNVH 4NN6B 4QOKB 5JXED 3DVNB 1MFNA 5J1SC 2V17L 5AAWA 4ORGA 1CDHA 4TVPE 1Q9LB 1A4KB 4NNXB 1EERB 1J8HE 3LEYH 3TFKD 1YNKL 3C6LC 1X5GA 3F7VB 2B4CC 2ZSVB 3E6FA 2D4FA 5IVXA 3WFCL 1PQZB 3BZDA 2EDKA 3O2VH 2HJLA 3P9LA 1VPOL 1WBYB 3FRPA 4HS8L 1I8IB 3VFPA 2DM3A 3MRMB 3L1OH 2VE6B 4YE4L 1TVBB 1BD2A 4KKCD 4M6ML 2KQMA 5E8DH 5H94A 3WIIH 2VISB 3SDCC 2P48B 3HPJB 5K9JL 4NN7C 3BPNC 4LARL 4L29B 4YUEL 3QDMB 1P9MC 3ECBB 2UV3A 4HFUL 1XIWA 3EJYD 3RTQD 1FNEA 4GG6B 1Q9WA 2NXZC 3G04A 1VFMA 1S5HA 2DWDB 2GTWB 2R8SH 2F74A 4PGDB 2HYMA 2DIBA 4FQXA 3NOIA 5A43C 3DMMD 3OKDB 2VB5A 4PRDB 1ZTXL 3MRJB 3CU7A 5B22A 5J1AA 1IVLA 2P5EE 3QNYB 2FRGP 2ITCA 4ETQB 3AB0B 4BM7A 4XVJH 3LKSB 4LCYB 3CFKA 4QF1A 3BW9B 3MV8E 1I1YB 5ACMA 5JA8B 2DM7A 1HHKA 1AGEB 4NN5C 1DLFH 4U6HA 3WFDL 5T1LD 1NAMA 4YLQT 1KB5H 4OZIB 15C8L 3IFNH 4RMWA 5D1QA 4AK1A 4XGZA 3QP3A 4P46C 5KSAA 4MCYB 4HIHB 3AMKA 3DXAE 4ODVH 3RNKA 3C8HA 1TITA 4HUUB 3IRPX 4KUZL 3CFBB 4JJ5B 4AM0A 3LHPL 1PX3A 1YYML 3U1SH 1HEZA 3QIBC 4MSWA 4D0CB 4RAVA 3SBWA 1SMAA 2DD8L 1S7QB 2HVKA 1MI5B 5FK9A 1F3DJ 1U2HA 3KJ6L 1Q72H 4I0PD 5CJQL 4ZUTA 1IEAA 2Z8WC 5T3ZD 1RZKH 3FB7B 4HKZA 2A9NL 2YUVA 5ENWA 3H3KA 1QR1A 1C5DA 2R9HC 1D9KA 1ZLVH 4QRRB 1AQKH 1T5WA 3T1WA 4HLZG 2VYRE 3K8KA 1A14H 1DVFD 2P24A 4M3JA 4I48A 2AEQL 1D5XB 1UM6H 5FHAH 3RVVC 4P9ML 3FO2A 4ERSL 3P4NA 1JK8B 1T80A 4KK9C 4PJIF 5HGDB 2VLJA 1T2QL 3KPQA 2XKSA 4U1NB 3GUTB 3VFMB 2VOTA 2DAVA 3ELAT 5DI8B 4Q6YA 1EHXA 1MY5A 1B0GA 4MCZA 4JFHD 1Q0XL 4APQB 2J5LB 1A9EA 5EUOE 1P2CA 3UJJH 1NCCL 3HRZA 4PUBL 4JANB 5DVKA 3FB5B 2MCG1 4HQQH 4OBRA 3DIFA 5EOCH 3GSVA 1FNGA 4P4RA 4HPOH 1LEGA 1AC0A 3CFJA 1XGPA 4N0CD 1WGOA 3LB6D 4OD2B 2DLEA 4WTZG 5DJ6B 3WNNA 4BQBA 3CCHB 1FVDA 2GITA 3RWGA 2LVEA 3WFBL 1P4IH 4OBSA 3C5JB 4RMVA 3O2DH 1HCFX 1MVFA 1T21B 4ZYKB 3T77B 1U92A 3PE9A 4GS7B 3TYGL 3N50A 1BIIB 2J8OA 1IBGH 3WUZA 2G5BA 1HKLH 1CZ8L 1WIOA 1E6OL 4GAJH 1EMTL 3U4EB 3DHJA 1GGBL 3RUGF 3QIUC 1KOAA 2DQEL 3SOBH 3RI5K 5ANMA 1AIFB 1UB6B 3MV9D 3SE8H 4DN4L 4YFLF 5J11C 1YYLH 3ROLB 3LDBB 4CUCA 5CEYA 4HH8A 3BUYB 3VGHA 5C0NC 2A6JA 4AJ0A 1JUFA 1I9IL 3DLQR 5D5MA 2ZZUT 1U3HB 3R0MA 4EEEA 1OWWA 4EKXA 1SVCP 1U3YA 4PYHA 4ZAKD 4C4KT 4E41B 3EDDA 1T5XA 5MI0C 5D7IE 3TVMC 1FYTA 4PJEF 3PWPB 1E4XL 4OIIH 3FMGL 3HTLX 3QFJE 5FO8B 5GZNC 3QWOA 1U58B 3S36H 3DO7A 5C2BL 4NZRL 1QO3B 5IHZB 5MENA 1G7HB 3BP7B 4PS4L 1I1RA 5F7HA 5HSFA 2XY1A 2ZCKL 1LD9A 3W39B 1OAQL 1Q94B 3I85A 1HYRC 3QUYA 1ZGLM 3EO0B 4JM2B 5DURB 3C9NA 3ARWA 4NQUA 4Y2DC 3X3GL 3HN3A 4PJDB 4JFQB 1D5MA 1U8KA 3MTRA 3VXMD 2RCSL 3TF7C 1VGEH 4JO2H 3UTTD 2ID5A 3HPLA 4RFNB 2MPAL 2R2HA 4I5BB 4P4KC 3GI9L 1OF2A 1JMZA 4KVCL 2IBGA 4PYGA 3ROOB 2F8VA 3LN4B 3F7PC 4GAGL 3FFDB 5I1LB 3N1QC 4G9FE 1GRWA 1L7IL 4WFFE 4WTXA 2ZUXA 4PRHD 2MQCA 3PL6A 4EN3C 3QI9B 4YX2L 5JNYB 4PB0L 4FN0A 4XZUB 3GIVA 5FHBH 3LKPB 1R3KB 4UI2A 4EUPH 4FQQB 1NCWL 4QXTA 1CFNA 2Z35B 3KWWB 4I2XA 5CSZB 3RGVA 1EVTC 4PJCF 1U8PB 3B6SB 4MD5B 2X4QA 5IB5A 1NKOA 3UTOA 2R2BB 1RZ8B 2AJZA 3QULB 2XIDA 3MA9L 3MLSL 3KDMB 1TZGH 1T2JA 3SDXE 1IGJA 2VQUA 3WIFA 2MOVA 4N0YL 1AHWA 2FX8L 3P4OA 4E0RA 4XNUL 2WWKT 3F7YB 4WI3A 5LGKA 4S2SB 5BS0D 1AGBB 3PHOB 4S1SH 2Q76A 2NY2C 4LGRB 4PB9L 1IM9B 3IFLH 4AT6B 4PJXB 3T0DA 4LLAA 5CP3A 1NGZA 5AWNL 1T04B 4R0LA 3OGCA 3P77A 5DQJB 1T0PB 4K94H 3PGCA 3D5OF 3EYSH 1OP9A 4ELKA 5CJXA 3MRCA 1Q9KB 4JFFA 5C3TA 4K8RD 5JORA 1QNZL 5GPRA 4P5KA 1G7LB 4Q9BA 3ARYA 3NPSB 4NRXA 2ADGA 5IW6A 1NFDA 4PJ5D 3RFZC 3BPCB 3QUXA 2IPTH 1ZHNB 1JWMA 4ZNCD 2HLFD 1UH3A 2YD7A 3FO0L 4YHOH 5FYLH 2KDGA 5H35B 3QNZB 5D7LD 5C07D 2GJ6A 4OZGA 3HE7A 3MLTA 4F33B 2R0KH 3OKKB 4DQOH 1MPAH 4NWTH 5KVGL 1OB1A 5C8JB 4QRTA 1SYVA 1FYHB 2C5DC 4WHCA 1F4YH 1VA9A 3JWOC 3ALPA 3H42H 1UCBH 2IPKB 5D93B 5TH2A 5KVDL 1I3UA 3HZVB 4XP5H 2Z9TA 5D70H 5C0IA 5IT2L 4XPBH 2CDFB 2WIIB 4MNHA 1SYSB 5C0FA 1FO0B 5GHWH 3VFWA 4GKZB 3PG2A 1FH5H 5SWSA 2XQBL 1S7UA 2MMXA 3HZKB 1AI1H 5FM4A 4HV8A 4Y4FC 4BSJA 2X4SB 3QQ3B 3ZKMC 4XAKD 5D7SH 4XNZB 2BX5A 1DZBA 1J0ZA 4V2BA 3WXWH 4JDTL 5BQ7A 1FG2B 2KQNA 1MFCL 1UACL 2OTPA 1OLZA 3MXVH 4Z9KB 1SY6A 3CVIL 5IMLA 2GK2A 4OD1L 4F3FA 3O8XB 5T5NG 1PG7W 3MFFB 1WBXA 3TCLA 4CU8A 3TT1L 1YPZE 1S7TA 4P57A 4HK0B 5DK0B 5HI4C 2VNCA 3VCLB 1OCWL 2QQLH 1BWMA 1ED3A 1NQBA 3SGDH 2HFGL 5TDPB 1T1XB 6FABH 3B5GA 1CD1B 3SHSA 1H3WM 5DRZB 1JCKA 2MWCA 4PJBF 4U6XA 3WL9A 3BI9X 3MJ9L 4NSKA 5ICYB 3T8XA 3O6KH 2DTMH 2R69H 1AQDB 1ES0B 4GKNA 1YMMD 4FABH 4XMLL 2VQ1B 3O6FB 4JVWA 1MCWW 5JZ7D 4LMQI 4OUUB 5KSBE 5SX4I 2XN9E 1DQTA 4R90H 1JZ3A 4NOFA 3HAEA 4OI7A 3KPSB 2VDMH 1I4FB 1BQHG 2IAMC 3O3DB 3DSFL 2DQCH 3ARGB 5EOTA 4OCSL 1KIQB 1MSPA 4OQTH 5C09B 3KPMB 4YDIL 5EU4A 4O51B 2VDKH 3EDJA 4MMZC 3STLB 4V1DD 5IVXE 3TM6A 1CBVL 5E08H 3ZLQC 2VITA 4KROB 2GAZA 4WHDA 1PG7H 2HMIC 1BD2E 4F9LC 2HA1A 3FQWA 4XCNA 5GS2H 1T89A 4LRNH 3LMJH 3MR9A 3T4AA 1FNSL 2NY1B 2JELH 2OX5A 1FZJA 3R4DA 5D6CB 1ZVHA 3GSQA 5EU7E 4LCWB 4Y5VB 4JKPH 4HT1H 5E2VH 1FJ1A 4J4PD 1CGSH 3ZKXB 3O4LA 1IC7L 3EYVA 5DRWB 4EI6A 3M1BA 5L0QB 3BT2H 3CC5A 4LSQH 4FMFA 3G5VA 1D6VL 3QEQB 4N90D 4NNYB 4ZS6D 2EE2A 3LKOB 3K7UA 4WO4D 4K2UH 3ZYOA 4EBQL 5T1MB 4X8XA 2VJXA 2BCKA 1DN0B 5IBUB 3DYOA 5EPMA 2VUYA 5EUKA 2XA8H 1ZLUH 4Z77B 1VFAB 1PD6A 5HVFB 5T5NF 5IM7B 4C4KO 2YD6A 1A3QA 1KLGA 2AGJH 3F6IA 1B0RA 4X6DA 5D7KD 3MBXH 3BE1L 3TWCH 2JE8A 4HWBH 3WDIA 4NNXA 3EZJB 5I8CB 3RIAF 1IC4L 1M4KA 2FGZA 1C1EL 4X4XB 4I3RL 1FFRA 1PQZA 5E5RB 1GYAA 3RVUC 1ORQB 1FNFA 1HQRA 1P7KA 1BOYA 1WBYA 1J7VR 2VDPL 1JPTL 2VE6A 1TVBA 2IH1B 5E2UL 5B8CC 2IWGA 4G3YL 5BRZB 2X4RB 1CFTB 4WI6A 2APXA 2VR5A 4LSTH 2VISA 1MCJA 1CXFA 2V5TA 3HPJA 4Y16B 3I6GB 5FGSA 3H3PH 3GJFK 1AXSB 1ZXQA 2D9CA 5CGMA 4L29A 1QG3A 3W9EB 2C3XA 1LEIB 3QDMA 5JR1H 4FTVB 1FHGA 3ECBA 3O2WL 2HWZH 5ETUA 1ND0B 4DOHE 1NCDL 4NHUB 2BOCB 2NYYD 5F9JB 2JJVA 2Z4QB 4M5YH 2GTWA 2H26B 4ELMF 3MBED 1FL6A 4LVEA 1TVHB 1J10A 3NCFB 4GBXA 3HUJF 3OKDA 4JO1L 3MRJA 4O58H 3JWDH 4BSVB 5DVMA 4ETQA 3CFEB 1A1NB 2YD1A 3L7FB 3GMNB 2R56L 4LCYA 4F9PA 4NUJA 4X7SL 1OAYL 1XF3B 3G5XA 4GAYA 5BVPH 3INUL 1P1ZA 2NZ9C 3NCJL 2DQHL 2PO6A 4LLYA 3ARDA 2ZJSH 4ISVA 1U8NA 2JIXB 4PLOB 4ZFGL 5JXEA 2FJHA 2HT2C 4IRZL 3OV6A 1AXIB 1YQ2A 5FUCE 4Y4HC 4HIHA 4FQCH 1F42A 3AREB 4U0RC 2DQIH 3S37H 5F44A 1UXSB 3LZFH 4R3SA 4KDTC 1B4RA 4JJ5A 2KZWA 3VFSB 5HYSA 5E2VL 3D2UA 5ESQB 4BZ2H 1CGSL 4Z7WB 4N8VG 3SGKA 1RUML 1TIUA 2JB5H 1MRFL 2BNQB 1S7QA 4JLRB 4WCYH 3GIZH 3B3IB 1WFUA 2PXYD 4PG2C 1PSKH 2CKBB 4L8CB 1S9YB 4K2UL 5DUBB 1G1YA 4JPWH 3RU8L 4C56D 4CRPA 1JZ7A 1NDGA 4I1NB 4Y5XC 4GMSH 2VDNH 3VDBA 2EYSA 3F5WB 3KYKL 5GGTH 3WS6A 5FO7B 3QUYC 3TGXA 4QRRA 4RMQA 4XPTH 3CSPA 2C9AA 3MLXH 5JTWA 5ANME 1XT5A 3MRBB 2NY7L 3MOAL 3UTPE 1N4XH 2EDLA 2XTJB 2P43B 1CYGA 3REWB 1KB5B 5C6TL 1E4XI 3DMMA 3VI3F 1UJ3B 1VGKA 4LSSL 2Q8AL 1I85C 4KRNA 3LKRB 5CLTA 4BUGA 2DF3A 1A6WL 5DUMH 2FL5A 5HGDA 3RY6A 4Z7OE 1P84K 2VN7A 3PV6B 4RGOL 2B1HL 2CO6B 3GUTA 5DI8A 5ALBH 3RWCB 4E5XB 4KHXH 4APQA 2FIRT 5FO9A 3REVB 1FYTE 3PGDA 2YA2A 5D2NC 3LVEA 1BFSA 4WUUD 3FB5A 4F57H 4MJIA 4EUPG 4LLDB 4RISH 1C8PA 5MENE 3B43A 3T3PE 4LSUL 4K7PY 1A21A 4N9GB 3V4VL 1F00I 4O2EA 4R26L 5HDBF 4ODHH 1KJ2L 5E6IC 1ZT7A 4IHOB 1NBZA 1HE7A 1ERNA 3CCHA 3TBSB 4WRLA 4WFHD 1IGFL 1UB5B 2LTQC 1Z9SA 1A5FH 1RV6X 5IBLD 3C5JA 4JRXD 3S36X 1HK6A 4Z0BH 3T77A 3DYMA 3PXHA 1BIIA 1BOGB 3IU3B 1HHIB 3CIQA 1JF6A 3KPLB 3ZSTA 5ITFA 1OGTA 3OKNB 5TF1L 5DUPL 2OP4H 3U4EA 2H9GB 1OAKL 1FNHA 4CDHA 5I75C 2FEDC 3EGSA 3AM8C 1UQSB 1F45A 4UT6L 1PY9A 3TO4A 2O61B 3RJQB 3FN0L 2IFFH 1AIFA 1UB6A 1B6UA 3G5YB 4YDJB 2E6JA 5DHVH 2PW1B 5EC2B 5D1ZB 4D8PB 5CJXC 5J6HA 3ULUE 2WUBL 5IFAH 5F7DA 2BY3A 2P5WD 4YDVB 1OTTC 3Q5OA 1VB9A 1AXTL 2VC2H 4I8DA 5JW4M 5I19H 3P4LA 5INCB 4I2XE 5D1XD 4KKBD 1CGXA 1JHLH 2R4SL 1LO4H 2BY1A 5JOPE 2YMXL 1YEKH 2EXYD 4LCIL 1A7PL 5FO8A 1MQ8A 3RIAK 1A1OB 4FXGB 2ZP0T 2GJZB 4X5WB 4IJ3C 5IVZB 1JGDA 1VADA 1FZOB 3LEXB 1QO3A 2ZUSA 5IHZA 2V2WB 1G7HA 5IHLB 4KHTL 3P0GB 1INDL 4AEFA 4K7PH 5HHME 2Y07H 5IHUL 1NC4B 2MCPH 3EO0A 3WHXA 4ZUVB 2VDLL 1GGIH 4GMSL 4ODTL 4XHJC 4U49A 4JFQA 1JN6A 3D9AL 1TTFA 1WCQA 4JFFE 3RUGA 3QUZD 4RGNC 1S7WB 1F4XH 5F7FA 2E7CA 4YEEA 4MB4A 2D03H 1NFDE 2AJVH 2AAVA 4LQFH 5CBEB 5I8KH 1ACYL 4UT9L 3ROOA 3CVHA 3FFDA 1DBKH 4G5ZH 4D2NA 4NPYA 1A64A 2OI9B 1ZGLA 4EXKA 4GG8A 2GJ6E 4OZGE 3QI9A 4KRPC 3LKPA 1R3KA 3MOBH 3WO4B 4KHXL 1AKJB 2A77H 4U4BA 2M2DA 2Z35A 5CSZA 4ZNEA 3UYOD 1H3PH 4DFHA 2VDRL 3UROR 2WINA 4XB8A 2X5PA 5JW3L 4M1DL 2R2BA 4P59L 2EDBA 5DJXA 4ONFH 3UYPA 5SWSE 3KDMA 1FFOB 1CLOH 4DN3H 4GQ9H 2IMNA 4NP4H 4WW2C 4R4NC 1NL0L 4O2CB 3F7YA 4QRPD 3RA7L 5ACZB 1R5VB 3CX5J 4M61B 2VLRE 4GSDH 1AGBA 3PHOA 4LNRA 5DMGC 1IM9A 3SPVB 2PR4L 1AE6L 5CILH 1U95B 3UP1A 1N6UA 1C12B 2RHEA 4WWKC 5IK3B 1TQBB 4KQ4L 4MX7B 2GSIB 3TEUA 4S1QH 5JHLL 4KMLB 5DXWA 5DQJA 3IGAB 1Q0YL 2H1PH 3VG9B 5CD3B 2W65B 1A0QH 3G9VA 4XC1H 3G5ZB 1GPOL 4LPXA 5C71A 1BQLH 1YMHB 4CVXA 2W07A 1G7IB 1ZHNA 1ZLVK 5IFAL 1KG0B 2CO7B 3U2SA 1FIGL 4GKSA 2A83A 1JRHL 4LAQL 1T3FB 3GGWB 2EYRB 3FFCB 4F33A 5EU3B 3OKKA 3LOWA 4WTZA 1OP3H 1JHLL 1NLBL 5J9PA 4U7KA 3P0YL 1PEZA 3QXDB 2APVA 1P4LB 4JFED 2IPKA 4QT5B 4ONHB 1SEQH 2BC4B 2XYCA 5E70A 2WIIA 3X3FL 5LBSH 3O4OC 5BVJB 1QEWB 5IKCB 1Y0LB 1I7TB 2WV3A 5KG9B 1FO0A 4KKAC 3P40A 1UKQA 3C60B 4OLUL 4MVBC 4PGBB 4XWOD 5FXCH 1U93B 1ORSB 3ZKNC 3GK8H 4NUGH 2NY5L 2X4SA 1EDQA 4JN2A 1GGIL 2NY6C 4YHPB 4PJ9D 1HILB 3RAJL 2UVFA 3U48A 4AENB 3C2AH 1ZVSA 3GJFA 4BH8B 3BX7C 3NFNB 3CDGA 1F97A 2WBWB 4S11A 4L1HA 4NN6C 3MFFA 4PGJA 3ARFD 3DV6B 1E6JH 1D5BB 3UYRL 3LQAC 3VXSE 1FFPB 2D7OA 2W60A 4ZO8A 4F7EA 5HJ3B 5TQ0L 1FBIL 1BVLB 4MXVF 1TQCC 3VCLA 3ILPB 4URTB 4BQ8A 1S7XB 4DKFL 4RQQA 5J12B 2B20A 2J6EA 3WNKA 4AMKL 5I76B 4MAYD 1NMBH 5C0GB 1RJZA 5TDPA 1T1XA 2KH2B 4J23A 5TE6L 3O4LE 5BZWB 2K7PA 1CD1A 4Z7VF 1PG7X 3SKOA 3QUMB 1B9ZA 4S0TD 4YK4C 2C7UB 4L4VB 3B2VH 3WN5B 4JRYA 4Z7QF 2Q7YB 4K3JL 2W0PA 4M7KL 4YWGH 5E5MA 3EIFA 1XF1A 1N5AA 3HNTL 4J3UA 1R5WB 4ZOEA 5J06A 1AQDA 5D7LA 4DK6A 3V5DB 2F53D 5I1GL 2VQ1A 4NJAL 1AGFB 5DD5L 2VXTH 4OUUA 2WWMC 1JF1B 3WDHA 3HG1B 1RZFH 1M6OB 1JPST 1PFCA 1KBGH 2X6MA 1DBJH 4X6DE 4P2OD 1YNLL 4UMGA 1XZ0A 2X41A 1H8OA 5GS2D 2NW2B 3O3DA 1DSFH 1EPFA 3NABL 1Y6KR 3CZFB 3WXVL 4ZD3H 4TVPH 2X89A 2H3NB 1HHJA 2BDNL 3ARGA 4YHKH 4POUB 2MHAB 3EYUH 2OZ4H 1N8ZA 2COQA 3KPMA 4M48L 4PV9B 5CEXB 1BX2B 4O51A 2CMRL 3TJHD 3MRQA 5CUSL 5E2JA 4F9PC 2FX9L 5JLZB 4R2GB 2VH5L 1A1MA 5BZDA 5E1AB 4UIMB 5JW5B 1T0MB 4OCYL 1V7NL 3L7EB 2DIJA 3UBXI 1KC5H 5IEHA 3QDME 4LCWA 4Y5VA 4HLJA 4EDXA 2VLLB 2HG5B 5DRWA 2ESVD 5E95B 4XPHL 4L4JA 3MYJB 1ZHBB 4XVTL 5TDNB 1RURL 4NNYA 5E2WH 12E8H 2NLJB 4MA7H 1XF4B 3WEXA 4I77H 4CMMA 1DN0A 2B4CH 1DQML 1W72B 4YXKH 4G9DB 5AZEL 3HR5B 5JPNB 4Z77A 1UVQB 3PQYB 4ZXBC 5FA4A 3V4UH 1GC1L 3EDFA 3NCEB 1NAKH 1UH4A 2IQ9L 1QSFB 4U1HA 3EFFA 1G84A 2QSCH 4LRIA 4OZIE 3EO9H 1U6AL 3DV4B 1WQVT 2VMFA 2J1KA 2YC1B 2DMBA 3QEUA 1ADQL 1NUGA 4UILH 2DJUA 3S6CA 4UINL 4CJ0A 1PW3A 2CR3A 2NX5D 4X7CC 3MGAA 3TZVD 4DCQB 2IALB 1BM3H 2X4RA 1CFTA 4YAQB 1DUZB 4Y16A 1GJIA 3VXRB 1T2XA 3OB0K 3OPZH 4D9RD 3C5ZD 4PGCB 4APQC 5K9OB 5L7XH 2J5LC 1RHHB 1LEIA 3HLAB 1MI5E 3SCMD 3IDJB 2XWBB 2Y7QA 1JPSL 1MRDH 2A9MH 3T2OA 2AKRB 4JREB 4M8QA 3S37X 1NGXB 1ND0A 3GMPB 1HZHH 2BOCA 4ESKA 2WP3T 5F9JA 5F89A 3WJLA 2Z4QA 1P4BH 1WEJH 2H26A 4TSAL 5FYKL 2OK0H 1TVHA 5FCSH 4WEBL 4QRRE 5A1AA 1IILE 2APTA 5AYUH 3GSNH 4LAJH 2F58H 5T3XE 1OHQA 3IJSB 2X09A 5HHOD 2MQ0A 4NJ9H 3ULSA 5TPWL 5FYJU 3GMNA 3ZT7A 3DVFA 4NQVB 4IM8A 3L3HB 3ARPA 1XF3A 2VUOA 2BRQA 1JTOA 3UDWC 2Y72A 4BFEA 4R4FL 4Y19B 2ADJB 3ARXA 1NGWB 2DQGH 5JMRA 2JIXA 3RZCD 2IGFH 5I30L 3LDBC 4GRLC 3FKUS 2VWEE 1CICD 4MJIE 1LK3L 1OARH 3OF6D 3GBNL 3NH7L 1UXSA 4X6EB 1U3HC 5L9DL 3VFSA 1XGYL 2ARJB 1YY9C 2Z93A 5I8OL 4U1JA 3C08H 4JLRA 1BQHA 1A6UH 4JFXB 3VFVB 4QXGL 4YHLL 4Y5YC 2E7BA 4ELMA 1ZANL 5DUBA 5LWYH 4KK8D 4JDVA 1NGPH 2DN7A 4MS8C 4X5XA 5AG9A 1F8TL 2H32H 3DROB 4UUJB 1FC2D 1WITA 3V9FA 5FO7A 4ZS7H 3FOLB 1S7SB 5IG7B 3QRFM 3B8SA 3C6SA 5KN5B 4JM2C 1GOHA 2ZNXA 2VDQH 5T3ZE 1BEYL 1BFVH 1KB5A 5HTSA 5E1HB 1IAOB 3W2DL 1FGVH 32C2B 4LP4A 2E27H 4KMTL 4PTTA 5DSCB 4J3XA 4GRWH 3RDTC 4HCRH 2CLVB 2F5BH 4KTEH 5KS9F 2FWOB 2VR9A 4LASL 3PV6A 4MJ6B 5JA9A 3ARBC 3T3ME 1VFUA 4JR9H 3T0VA 4E41E 4NNPH 3IT8D 4OF6A 4M93C 4JFZL 5DHYB 1CLYH 1MWAB 3BGMB 3QB7C 4JFDB 1SJHB 4ODUA 7FABL 5IJVA 4I3SH 1RIHH 1OAXL 1RULL 3DX8B 1TJHL 1E4KA 3IU4L 5DD3H 3BQUD 4LLDA 1BZ7B 3LCYA 4ZFFB 5GRZA 3T09A 4IHOA 5EU5B 4N8CH 3TA3C 4DAGL 3MRNB 1MUJB 2OL3H 3TBSA 4JDZA 4C59B 4RAHA 3Q2CA 1RMFH 4JGMA 5EO0B 1C5CH 4PJDE 3QG7H 2OK0L 3OSKA 4GMTH 2ZKHL 5DO2D 2YUZA 4Z7UF 4AIXA 3IU3A 1HHIA 3KPLA 3W9DB 4U1IB 4XP4L 4MDIB 5KW9L 2B1AL 4K7PX 1NCAL 5JPMB 2RR3A 2PXYA 2J88H 3N06B 1YEJL 1CWVA 4O00A 4Z8FL 2BSRB 3G5YA 4YDJA 2YPVH 5ALCH 3VI4F 5EC2A 1ZLUK 3HC3H 5E9DD 5EBWA 4D8PA 1EK3A 1HWGB 1S9WB 1PLGH 1UA6L 3DTXB 3NPSC 3LIZH 1CI5A 2DDQH 3MRGB 3F58H 1D5IL 1M1SA 4ZUWB 3GO1L 1YJDL 2RB8A 5DJYB 5A2KH 4M9OA 2BVUA 3MRPB 1T4KA 5D7JC 1GAFL 3HMWL 4ZNEE 5I73B 4WNQA 5ID0B 3KPNB 3K81A 1SHMA 4G7YL 1ZHKB 1A7QH 3OKYA 5C6WH 4CL7A 3CJJA 1MJ8L 4DTGL 5GIRB 1D6EB 1A1OA 4FXGA 3TBTB 5IVZA 4KJQD 3BMVA 3D39D 3LEXA 5GJSL 1X44A 5EO9B 5CIPB 2BVOB 1C08B 3O2DA 4QTHB 1UADC 2HTLD 3EOAB 3BHBB 2ORBL 2X1OA 3NA9H 3BIBX 5T33L 1NC4A 2M8XA 3CLFL 4F7PB 3NIFE 4X9GA 4WUKL 4LF3B 1JRHI 5DRNB 4M1GH 1HWHB 1AO7D 2FZ3A 4H5SB 3ZDXF 5E00B 3MCLL 2P46B 5B38G 1NBYB 3CMOH 3FAWA 3JTSB 5E8PB 4I4WB 4EOWL 5CEZE 5IVNA 4XAWH 5CJOH 5DFVD 1CLZL 4JRXA 1FCGA 3PABA 3P9WB 4HUMB 4MQXD 4WV1B 5CBEA 5LCVL 4JVUA 1ZT4B 3IJHB 3AAZA 2DWEB 1J0IA 1RVFL 4GRMB 3LH2H 3O8XC 3ULVC 1F4HA 1JJUA 1MNUH 1RUQL 2DOCA 1VKXB 5IQ7L 5KZCB 2IJ0C 2XZCH 1JP5A 5SV4A 1J5OL 5JIKA 3SDYH 3VFNB 4OF7A 3T04D 1DE4B 4GW4B 3UEZA 5EIIA 2NNAA 5ITBL 2A74B 3SDDD 1AKJA 2OSLB 1I3GL 4H1LB 4TUKL 4G8IB 1RIHL 1H3XA 4GO6B 3VMNA 1WF5A 4NO0B 1GGYA 3FCTB 4M7ZC 4KGJA 4KJYA 2VXUL 4N8CL 3RVTC 1A8JH 2ICCA 4PJCB 4M7LH 3QXAB 5D8JH 1QFWL 4HMDA 4BK5A 3EFDH 4M61A 3S5LB 3O6FC 4C55A 1UCTA 3M07A 4XI5C 1YN6A 1H5BB 1U95A 3S7GA 1AFVH 1C12A 5IK3A 4MX7A 2GSIA 4M7LT 1J1XL 3ULVE 4IRSD 5CD3A 1UM5H 2W65A 2BY0A 2NTFB 3SE4C 3G5ZA 5DD0H 1D5ZB 2FJFA 5I1CH 3X12B 4XPAH 2BERA 3BWAB 2V9TA 3WNLA 4G8EA 2WP3O 3JWOH 3L3GA 4LEOB 5FGBC 5GISH 4LOUD 1G7IA 3QUZA 4Q6IA 1KG0A 3RGHA 3V7MA 1I8LC 1CFVL 2WBJB 4EUPA 3LV3B 4MJ4A 5SWZA 5BS0B 5C0CD 5IGXH 2D0HA 4YPGB 4L3EB 4EI5D 3LD8C 1YEDB 3NMEA 1T3FA 4B7LA 5HHNB 1BREA 2EYRA 1CXEA 4OFVA 4JRYE 5EU3A 3MV7B 3IXAA 3GMMB 4O5LL 3IAQA 4ONGH 3EO1A 1MFAH 4P23D 1CE6A 5F7EL 5ILTL 1T20B 5GSVA 5ISZD 4W68A 3NGBB 3T4YB 3W11C 5J0BA 4A2LA 2Y06L 3JWNC 1MLBB 4ONHA 5LKNA 4P2QD 3S4SG 2H2SC 3LRSB 1MVUB 3ZKXC 5HYJB 4PJ5B 5IKCA 5E99L 1FRGL 2PF6A 2YK1L 3KPSE 3VWJB 5IROC 4S1DC 3IDMB 3NA9L 4P5TB 4PG9B 4KZDH 2X70B 2BP3A 5MHSE 5I15H 5C07B 3L3JB 3O0RL 1IEHA 2JCCF 3U4BH 5C09E 3BPOB 3O6MH 3GHEH 3ZE0E 1I9JH 1MFDH 5CSBA 1DLHA 4AENA 5TDOB 3S98A 4TN9A 1D7FA 1HSBA 4BH8A 1IGIH 2EXWD 5KANG 3BDXA 1JI2A 3DV6A 1D5BA 2EDXA 5CBAA 4Y4KD 1FN4B 3D3VD 3MGTB 5E7BA 3THMH 5GGQH 4CDGC 3LH2L 4U6VH 1KYOJ 1BVLA 3T08A 2BFVL 1C5BH 3ILPA 1MNUL 4XP1H 3KPOB 2OCFD 2VZTA 5I76A 3FQUB 4M1CC 4KTDH 3EW3B 4LCWE 3EYOB 1CGUA 5GS1B 1GSMA 1UZ6E 5BZWA 1IARB 5D2LB 2UWEB 1BBJB 1TCRB 2AJUH 3CXHJ 3WN5A 2HVJA 4W6YB 4BZYA 4TVPD 1R5WA 1J8HD 3QDJB 3QHFH 3BDBA 3V5DA 4Y8DC 1MQKH 5CSGA 5F7LB 4H20L 5DQDH 3KLHC 4U2ZA 3LKQB 1TJGL 2B39A 1M6OA 1Z3GL 4UV7H 5EZOL 1KFAL 5D8JL 4JFEA 1LE5B 2HH0H 2NY0B 1F4WH 4IOSD 1RIVL 1OPGH 4OGYH 3WD5H 2L0DA 4S10A 5DA4A 2NW2A 1FZMB 1NAMH 1CDUA 5HYIA 1J1PH 2H3NA 6CGTA 1T03L 4OV6F 3HE6B 4FZEH 2MHAA 4B53A 5FF6A 3QHZH 1I9EA 2XZAL 4YDLC 3JVGC 4RAUB 4OKDA 4PJ9A 5I6XC 1OSZB 1YEIL 4NQSB 5BRZE 2XOTA 4UIMA 2NW3B 1CXIA 2UZIL 4R7NB 3HCVB 2P5ED 2GHWB 3C6LD 1MLCA 3L7EA 3TN0D 5CD5C 2XKUA 3ARFA 4Z7VA 5DJDA 3OR7B 3F8UB 1ZLSL 3B5TA 1A3LL 4FTVE 3QJHB 4LCCB 2V2TA 1TTGA 4XVUD 4N68A 3AREC 4UNTA 4FQJL 2HG5A 3MV8D 5JW4N 2GJJA 3MYJA 4G6JL 2Z0BA 4K3DL 3UTZB 5TDNA 4NBYB 5FUOL 2OBGA 4HX1A 2NLJA 5GRJH 4YHMH 4NC1E 2JK5A 5HHPB 1R0AH 4OM0H 1XF4A 2QR0B 1ZKAA 4BZ1H 2I60H 2DQJL 1W72A 5EORH 3U9UB 4G9DA 4H88H 1I7RB 1PY4A 3N9GH 3DXAD 5JPNA 3ZMRA 4EQ2A 1EVUA 2AXJA 1UVQA 4PLKD 1NUNB 4U3XA 1BVKB 4HPYH 1GXEA 4DGYL 5F1OB 1QSFA 3S9DB 2FX7L 4HDIB 2FLRT 1N0XL 5CJ5A 5CZVH 1CD9B 3GKZA 4JCMA 5GS3A 3VXTA 3BD5A 2IC2A 4FFYH 4ZDHB 3BD3A 3T1FA 1UJ3C 2YC1A 1N3NB 4MA8H 2FJGB 4DW2L 3P3YA 2Q3AA 4NKIH 4FHBD 1WZ1L 5EH1A 4TNVF 1YZZA 4OGXL 3SDAA 1JNLH 2EE3A 2IALA 5GRVL 4YAQA 1DUZA 1YEEL 4Z7WE 5F71A 1IKFH 2AQ3A 1DFBH 4AL8L 4YDKL 2CIIB 3IDJA 2XWBA 4OI8A 2AKRA 4P3DB 5MP6H 1NGXA 1LILA 3H7BB 5B39B 2ZUWA 4F7CB 3QIBD 1BP3B 1CG9A 2ENSA 1L9MA 2LAGB 5HPMB 2VR4A 5IB1B 1Q8MA 2DYPD 4JPIB 3IJSA 1J0JA 2XTJE 4W70A 3WD5L 2EH7L 4LLUB 4QHNA 4RRPG 3QCTL 3QISA 5D72H 4NGHH 1JWSB 3L3HA 1CVSC 3QWRA 4QRUB 3T0XA 1EGJH 4XP9H 2M26A 1KJ3H 2R9HD 4RCAA 3B9KB 5EUOF 4JO3H 4G43B 3QJFA 4O4YL 2NXZB 1MREH 2V9QA 2GKIA 1NGWA 2NXYB 5D1ZC 4NKMB 2FYYA 4D3CL 2LU4A 3DETC 2HFEB 3RVVD 5EZIL 1SM3L 1J87A 5F8QC 5DWUH 3GM0A 3DWTA 5F70A 4H0GA 4KK9D 3BFOA 3F62A 2CLRB 3O3AB 3E6HA 2ARJQ 3A6CL 5L88L 4XNYL 5GRWA 2NX5A 2R15A 2GK0B 2EZ0D 4NN5B 4XCCH 1B4JL 4H26B 4JFXA 4WWID 4DGIH 4ODBD 1HI6A 3GSNB 3VFOA 4GW1A 2HLAA 4HC1H 4HJGB 3C5ZA 4XNXH 2ADIA 2MKWA 4FFZH 1Z5LA 2I07B 4P46B 1CD8A 3MFGB 3SCMA 1JHKH 3Q1SH 3DX6B 1EAPB 5DJ2A 3FOLA 2C3GA 4HKBB 1KPUB 3CUPB 3Q0HA 2PN5A 4EIGB 2K7QA 4FQIH 4HGWB 3QFJD 3OKOB 2FNBA 2PTTB 3WLBA 1IAOA 5C3LD 32C2A 1U8IA 4YBLC 2OLDA 5DSCA 5DVNA 2CLVA 1L0XA 5D7IF 4LLMA 4C56B 4MJ6A 4Q0XH 4U7MA 2X9YA 4ODSL 4UV4H 3RIFF 3D0LB 1MWAA 4HEPG 3D25B 4LVNB 1JNLL 25C8L 4JFDA 1SJHA 5B3JF 3OJDB 4OZFH 5I1KL 2IG2L 3D85B 4B5EA 3WO4C 1BZ7A 3QIWB 3MXWL 2AK1L 4JG0H 4PRNB 3J7HA 5I1IH 4OAWB 1I75A 5EU5A 2DQDH 1CICA 5MP6L 3EYFB 1MUJA 3OF6A 5CP3H 1AY1L 1CXLA 2EIBA 4G9FD 4ZPVB 4WFFD 5GGTA 3WKNA 2NTSP 2ZOKA 5T1KB 3MUHL 1ZGLP 4W4OA 4UQ3A 3VXPB 5GJTL 5I18H 3CDFA 2AI0L 3O3BA 3FQRB 4FQ1L 3O11A 4JN1H 3W9DA 4U1IA 3HMXA 3MA7A 1EJOH 1NCTA 3OKLB 4X6BB 2IMMA 4TSBH 3BRFA 1Z2KA 2QHRL 1JE6A 1UM4H 2BSRA 1TQBC 4L4TB 4G6KH 4G6AC 3PGFL 4GAFB 4KRMB 2Q6WB 1JGVL 1BIHA 2D9QB 3BEWB 4P2RB 4L8SA 1YEHL 5GS0C 1FAIH 1S9WA 4NCDA 1I8MB 1GHFH 3DTXA 1G9EA 4P4KD 3KYOB 1LWRA 3MRGA 1JWUB 5BMFH 1QFWI 5JHDB 1N59B 3ESUF 3UJTL 3BH8B 4JO4L 3G6JA 4KJWC 1EH9A 3TIDB 3A6OA 5DWUL 5L8LB 3OBAA 3W5MA 3KPNA 5F9AC 3GB7A 2Z31B 3QIUB 5EO1B 4XC3H 2KZ1B 3NPZB 1ZHKA 2QQNH 3ZDYF 4D9LH 3SO3C 3MNWB 1D6EA 3I9GH 1GCFA 1TJIH 5EO9A 5CIPA 5J11B 2BVOA 1C08A 3FRUA 1ZA3B 3BKCH 3IYLW 3BHBA 4OCMC 5DD6B 2YZ1A 1A02N 1LO2L 1QOKA 4FNLH 2BNRB 1DQJB 3CFIC 3PP3H 2O5YL 4TNVK 1IGMH 4MZ3A 4OSUL 4LF3A 3C60C 3L5XH 5D1XB 1L7TL 1GOGA 2H41A 4M6OL 3N1PC 5FGCB 1LO0L 5DHVA 1NBYA 4XRCB 5MI0B 3JTSA 2EDRA 1KEML 2AEWA 1KV3A 2W59A 5E8PA 3SJVA 3TVMB 4N0FB 4FQLL 1EO8L 2NY2D 5JQ6L 3ULUL 5JUEL 4ZO6A 4P3CH 4HJ0C 3IJHA 3S35H 2XWJA 3SN6N 3FRPG 3B4NA 5SWZE 2DWEA 1IQWL 4GRMA 1G9NL 4UU9B 5J56B 2AABH 4D0DA 2C1PB 4HWEL 4OZHF 1VKXA 3OAUL 1A3RL 4YJZL 4JB9H 4RMSA 5IB2A 3PIQB 4HIEB 2OSLA 2HN7B 3P9MB 3E2HB 4H1LA 1RUKL 1U8QB 5J12C 4OLWL 5F6HI 3KR3H 4G8IA 3T0EC 4JZOB 4NO0A 5JXAH 3FCTA 1QTYT 3IDIA 3HAEH 1KB9K 2ZG2A 4JQXC 4X6CB 5IWLA 4X9FA 4L5FH 3AS2A 2DQDL 2QADB 3BESR 1CQYA 5CMAB 1WTGT 1YECH 5HGAB 1NANI 4X7EC 1HXMB 3VD3A 5C08B 4EN3B 3P0VH 3H9YA 4PGZA 1H5BA 5LXGL 1A2YB 3M8OH 4MHHG 4M5ZL 1CF8L 1L6ZA 1BFOA 3NTCH 3QH3B 4D0BB 2WAHA 3PUCA 4BKLB 5J8OA 4X0KA 5FYLE 1D5ZA 1JV5B 5HDQL 3TBYB 4Y2OA 3RWDB 1FZKB 3WDJA 35C8L 1DDHB 1FIEA 1NUFA 3S34L 3WFEH 5TQ2H 3O6LH 1IGCH 2ZUVA 2XN9D 4QRPB 2F19L 4HFWB 2WBJA 4IMKC 1YEGL 4YPGA 3OKMA 4R2GC 4YHZH 4IDJL 3S8WA 2ILLA 5HHNA 2RBLA 2YD9A 3O3EB 5ADOL 1RK1B 3QUKB 2B2XH 5KSBF 1AH1A 5HI4D 2AQ2A 3CK0H 2BRRH 4JQVC 4RFEB 3WKML 3T4YA 2B0SL 4JHWL 1MLBA 2O5ZH 4MJ5B 5C7XH 3LRSA 2QHLA 3V6OA 5KSVA 3DARA 3HG1E 3I9GL 4JZJB 4UIKH 5HYJA 5GS0L 3MLRH 2R0LH 1WAAA 1WFNA 2GTZB 4HWZB 4LU5L 2RIKA 4UDTA 3WIHA 1BD2D 5DYOB 2CSPA 3VJ6B 3VWJA 4UNVA 3IDMA 4P5TA 4MB3A 3RIFK 4PG9A 1SY6L 1QHOA 2N7BA 3DECA 2Y4SA 3S97C 1H3UA 5IVXF 1AGDA 1GGCL 5D6DA 3BEVB 1TDQA 5DMIL 1T66C 4TQEL 1NGYB 1N26A 1IQDB 2D7TH 2P8MB 1XIWD 4QGTA 5K9QI 3V6ZA 5L2JA 2VQTA 1JZ8A 1YDPB 4KWUA 2Y36L 4KQ3L 3RNQB 1J12A 1CDCA 4MQ7B 2WQ8A 1ETZB 1R5IA 1FN4A 3WHE0 4GLRI 2PYFB 4UQ2B 4CVZB 3VFUA 4XXCA 1A9BB 2AABL 4IRSA 4XCFH 4ZTOH 5TE4H 5IW1A 4PP1C 1DQLH 5JQHC 4Z7VE 4XPFH 4KK6D 3FQUA 4OIBA 4Y4FB 3EDKA 1I1AC 1QYGH 1AD0A 1O0VA 2E6QA 3EYOA 1DJSA 5KJRL 1T83A 1J05B 2CGRL 2O5XL 3Q6FA 2YPLA 5D2LA 2HFTA 1BBJA 3QNXA 4IOFC 4I13B 5EBLA 1W0VB 3CXDL 1I9RH 4NFDA 2ZCHH 5FV1L 5C0CA 4XBEL 3RKPA 1C16B 3TYFA 1EIBA 4XBPB 3TJEL 3QDJA 5MEPB 2XZQL 1XGRB 3KYMA 3X11B 3SGEI 1CE1H 2VXVH 4GJTB 4HH9A 5KSAD 1BGXH 1MOEA 2ZUUA 3TFKC 2ERJC 3PQYE 5I1JL 1UZ8A 1XF2B 1EO7A 4HBCL 5E8OB 9CGTA 1S8DB 2ICWA 4MAYB 4OLVH 5F9OL 4P2QA 5FFLA 1QBLL 3R0NA 1NKRA 1QSFE 1W0WB 3UBXB 5C9KA 2JCCA 1DUYA 1KCVL 1FZMA 2VXSL 1MCEA 5KVFH 3ABZA 3MLZL 4RFOL 1Q9OB 1CTOA 4ZOBA 5CFHA 1S78C 2BMKB 4KVNL 1XR9A 3PDOB 3NA4A 4TRPH 4RAUA 3BAEL 4NCC2 3HI6L 5DEFB 5IJKC 3IAGC 1KCRH 2W9DH 4AYFA 1U42A 1JNNH 1VSCA 3EJYC 3RTQC 4KJPD 1D9KD 4LEXL 2G2RA 5GRXG 2YEZB 4P2OB 5TGBA 4R7NA 2F8XC 4WEMB 2IAMB 3SQOL 3SKJL 3RVWD 3V52L 1HH6A 3N85L 2WW8A 3GHBH 3D3VA 4X9IA 3GSUB 5D96C 4ORZC 1IL1A 4A6YL 1FVEB 3BXNB 3BZFB 3UTZA 4LHUB 1JI1A 5DJCB 3ZDZE 4LIQE 3AU1A 1EHLL 3L5JA 2ZPKL 3FAXA 5EA0H 5TE7L 3MREB 5HHPA 1NJ9B 2VXQL 3ORJA 3LSOA 1ZT1B 2QR0A 2GT9B 2DQFA 3BP4B 2FBJL 1KB9J 4Q9RH 4HS3B 4OB5H 1QACA 3U9UA 4YIQA 1XGQA 1J8HA 1IGYA 3L3OB 3MCKA 1VFOA 3QPXL 4LPUA 2GIYA 2Y9RT 3QCVH 3KXFB 4OTXL 4YR6B 4YXLH 4HDIA 4RGMB 4Y19E 3D1MC 1G7PB 1S5IL 1LVEA 4FZ8L 3BGFB 3NCCB 5DVOA 1KXVC 4K9EC 5DT1H 3T2NH 4YBQC 2VLME 3C2SA 4QXWA 1N3NA 4UAOC 4KV5E 5E8EB 2EH8L 3QRGH 2UUDH 4XCFL 1KN4H 3VG0L 2EC9U 4I0PC 1A7BA 4ACPA 2WUCH 3PXJA 2EE9A 1VENA 4PIRF 2QSVA 2NZ9D 2AEIT 3UTPD 5E03A 1N7ML 2HT2D 2H2PD 5I1EH 1LGVA 1V5JA 4U1KB 2CIIA 1E4WH 4N9OB 3V0WL 1S7RB 4OZFG 1DVFC 4RA3A 1AR1D 2P4AB 4WU5A 3C6LA 4R7DA 1KJ2B 1T22A 3IDXH 1LEKB 3H7BA 2YKLH 2AJYH 2DI7A 4R96B 1U41A 1BGXL 4N0UB 1MHEA 2VO5A 1RHFA 3AROA 4O02L 5EZJB 4F7CA 3TT3L 2E6PA 2HTKD 3MV8A 4EDWL 2F54B 3W0WD 5HPMA 1FYTD 1OD7A 5B8CB 5FYJL 4LLUA 3SDCA 2FECL 1QKZL 3I02A 4Z7OF 5CGYC 4RMUA 5MEND 2HKFH 2DLHA 1P9MA 1VDGA 5F8RC 2YR3A 4K3EL 3QUYD 3B9KA 2I9TB 1H3TA 4N1CA 5A16B 1AJ7H 2R1WB 3MACL 4N0CC 4UT7L 2CK0L 2N56A 4NKOB 5DD1L 3T3PF 3SGJC 4MWFA 4JFDE 4FFVD 4TNWF 1P69B 1U2CA 2HKHL 3BVNB 1S7VB 2R0ZL 1ZS8B 4DJMA 3OZ9L 1DBMH 5GGRB 5D71L 3AGVA 1QSED 1KENH 1E0OB 2BZDA 2G60H 5I73C 1KPVB 4UB0H 1R3HB 4PTUA 2GK0A 5T1DH 2NY3D 1F13A 4H26A 3DX9B 3PL6D 3GSNA 5EA0L 4WW1A 1MFBL 2Q1EA 1S9XB 4P2YA 1N6QH 1JL8A 5T3XL 1MIEH 1MEXH 3UC0L 5EOQH 1JHTB 1QSVA 2CKNA 2I07A 1NMAH 3HZMB 3PF2A 4KU1A 4P46A 3O45B 2DS4A 3DX6A 5E8NB 4Y4HB 3E3QC 4U0RB 4JM4L 5JOPD 1RZJL 3CUPA 2DIAA 1AP2A 4E9LA 5HVWA 3EOBA 2QQKL 1F02I 4HGWA 3RL1B 5MEOB 2FD6L 4GXUM 3QEGH 1G7JB 5EFIA 4NC0B 4M6NL 1K2DB 4X5LA 3BKML 2FGWL 3FONB 1G6RL 2DYPA 4JKKA 4IS6B 3MNZB 1MAML 5HHMD 1MH5B 2JLLA 4WV1C 2FEDD 3L5WA 5ADPH 2OM5A 4HIXH 3CSYA 3VGAC 3G6JE 4RIRB 4TUOB 2HT3C 4Y5XB 1YN7B 3QRGL 4PJ8B 3IFPA 4DVBB 3D87B 3VW3H 2R1XB 1MHPH 3D0LA 3LRGA 4LKXB 1CL7H 3D25A 4JFFD 3M17A 1OTTD 2R1YB 2F9BT 3OJDA 2RFXB 4NRZA 4PREA 5BO1H 2GFBB 3D85A 3VFRA 1EHNA 3BRGC 1KJVB 4OM1H 3BO8A 1AGCB 4ENED 4OAWA 3PHQB 5HHVH 3E3QE 4XP6L 1RK0B 3EYFA 3R8QA 1BBDH 2H32A 3HAEG 4X8JB 2Q86B 5FOJA 2D7MA 5I71C 4G8GB 2AJYL 5T1KA 2GJ6D 3VXOA 1KCUH 3VXPA 1NFDF 4G6FB 3O9WB 1MJ7H 1ODAA 5T3ZL 5FA3A 4G7VH 3SJVE 1NFIB 3HNSH 3VRLE 5CEZH 1CXKA 1ULVA 2VERN 5D2NB 5L6YH 4X6BA 4LSVH 4UTAL 1K4DB 5KVMC 1OQOA 4EQ3A 4OZGF 4HCRA 4L4TA 3PWVA 1QA9A 1FP5A 3WLWC 5E6IB 5SWSD 2Q6WA 4CNIB 3QPQD 4P2RA 1VEOA 3RWJB 5D7IA 3MOQA 1I8MA 2VDOL 2VLRD 4JY5L 2LTQB 5CZXD 4X80H 4OD3H 1JWUA 5IBTL 2Z8RA 2EKJA 2JKXA 3NCMA 5JHDA 1N59A 1R24A 3RP1A 1FVCB 5KVEH 3S35X 1K3ZA 3BH8A 3OAYH 3TIDA 2X7LB 2J8UB 3EHBD 1FO0H 1NMCC 1K8DB 3QIUA 5EO1A 5I1DA 4KI5C 3UMTA 2OL3A 4C83B 4P9HC 4RBPH 1KENL 1LO3L 5I17A 4KRPD 2AP2A 4LP5A 1R3IL 1ZA3A 4M9PA 1DBBH 4F80A 1LP9B 5DD6A 2C4XA 1X5FA 4RRPA 2BNRA 1MFEH 2V5MA 3GNMH 4WIQA 5EU6B 4XVSL 2NPLX 3ZTNH 2HLFC 3ULVH 5CP7B 1WFTA 1PKQB 2A6DA 1MCOL 4HUXB 4OI9A 1HH9A 1LDPH 3MMEB 4XRCA 3CVHL 3X14B 1OL0A 3TVMA 1OLLA 4NZTL 5F1NB 1JPFA 2VL4A 5DMGD 2FR4A 1HYSD 4JFYB 4IJ3B 4HXAH 4LLVB 4KXZI 3NCYS 4MD4B 3U7WH 1WJ3A 5LQBH 4G8FA 4RZCA 4UU9A 1BQUA 3EOYG 4OCRL 3B5HA 1IM3B 2OJEB 4QLRA 1G9MH 3U9PL 4ZTPL 4HAFA 5FM8A 4KI5E 1OD9A 3RKDD 3JUZA 4TUJB 4L8BB 4Y2DA 3V0VB 1AO7B 4FQ2L 1ZHLB 3PIQA 2FSEA 4HIEA 2DQTL 2HN7A 3P9MA 3C8KB 1U8QA 4CADB 2XICA 2LV4A 3BZEB 3V6OE 5GS1C 1REIA 3IB4A 1LMKA 3IXTB 1NCBH 4P4KA 5HYJE 2NY4D 2RJMA 4WVRA 1WAAE 1KELL 1G7MB 5A2LH 1IAKB 2J4WH 3VXSD 3PP4H 5EDXA 3MLUL 1BQSA 3F12B 5A3IC 1BBDL 2DBLH 2HRPL 3QXWA 2AK4B 5HGAA 2APWA 1HXMA 4OCWH 4TNWK 1S9KC 1SBSL 4MNQA 4LSRL 5ID1B 4EN3A 3OKEA 1Q1JL 4OJFH 3B83A 3K8LA 3O4LD 3R1GH 1MCLA 4A2MA 5SX5H 3H2WA 5DJ0B 3EOTH 5JDSA 1H3GA 1IT9H 2LU7A 2NY0C 4GW5A 2IH3B 4JFOB 3HC0B 3I50L 4RWHA 3DURB 3QH3A 1FFNB 1J0KA 4D0BA 2FB4H 2P8PB 2AXFA 1JV5A 3FQNB 3TBYA 1RZIB 3C87A 4LMQE 1S3KH 2D7QA 1RU9L 3DHMA 2NY6D 4R4BA 3HE6C 5JIIA 1RJLA 4LDLB 3QO0B 3A6BL 1B3JA 3RRQA 1DDHA 1OY3B 3KNBA 2DKSA 2UVEA 5L2KD 1XCQB 4OZHA 5FOBB 3SGEH 5I74C 1HOCB 5JZ7C 1RZ7L 2YPLE 3G6DH 5D2LE 4NWUL 1X5ZA 3ZL4L 2UWEE 4JJHA 1VFBA 4XH2A 1GZPA 4G6MH 3QUKA 1T6VN 5C0CE 3RWFA 3QDJE 2F5AH 2ATPB 1ONQA 3KLSA 2DQUH 4JAMB 5ESAB 3QDGA 4LCCC 4X6DF 2IADA 4JRWA 5ERWB 4NRYB 1F6AB 4M3KB 4HWZA 3QCUH 3V8CA 2YS4A 4S1RL 5DYOA 4PP2B 3VJ6A 1V7MH 1HNFA 2ADFL 3LS4H 4J6RH 1BZ9A 2CXKA 4QXUH 2R0WH 1H0DB 3QDMD 2APBA 1WCBB 4P23B 3VXNB 4L1DA 2CDEB 2FIKB 3V95A 5E7FA 1BWWA 1YDPA 4AEHH 3QO1A 4NZUH 5DMJB 1NBVL 3H8NA 1G0XA 5DR5H 4J4PC 3RNQA 3BJ91 2J6EL 4MQ7A 1OGAA 1ETZA 1P53A 1QLFB 2BVQA 4K8RL 3O4OB 3HRPA 5ACLA 2EKSB 4UQ2A 4KZEH 4CVZA 1IAIH 3ZHKA 3CX2A 3TNMB 3HC4L 1AD9A 2A6KB 4XMKL 4ZS6C 4WO4C 3AY4C 4WJ5B 4GG6F 4Y4FA 1OAZL 3D3VE 5DVLA 1IC1A 1G6VK 3UTSB 1J05A 4NM4L 3Q5TA 4PRIB 3CH1B 3BH9B 4F37F 1KTKE 1OVZA 5FDWB 3K4ZA 1C16A 5F88B 4XBPA 3ARDD 2E7MA 4ETYA 3IDYC 2Q8BL 5MEPA 1BVZA 4OGAC 2BVPA 2EEAA 1I1FB 3X11A 1QFUL 3KS0H 1X4YA 5M94B 4XMPH 4HKJA 4MXWL 5LVEA 1TQCB 4F58L 3D0VB 5FCUL 5AAMA 4JFPB 1XF2A 5E8OA 1S8DA 4AG4H 5T5FL 3MLYL 3K2MC 4OZIF 5ESVB 4AIZB 3Q5YA 4OIAA 3D2UD 5CCKL 3R1GL 3LPFA 4YK4B 2ZUQC 3GBLA 2GY5A 1A7OH 1MI5D 1Q9OA 4XXDB 5I66A 5DDHB 2BMKA 4LPWA 3PDOA 3L6FB 3I2CL 3PP3K 3RX5A 1MIML 4R8WH 5FEBA 5DEFA 1DQDL 3VRIB 4ZUUB 1OSPH 1R3JB 3PWNA 3QG6A 4MA1B 1HHHB 1HN1A 1INEH 5EC1B 4QRRD 2VRAA 3B9KC 3DRTB 3KAAA 2R29L 1WIPA 5T3XD 3U7YL 1FC1A 3KPPB 5FUZH 1PZ5B 3NACL 1IEBB 2D3VA 1MCHA 2NXYC 4O9HH 3MROB 2IAMA 3MBEC 2OR9H 4PJHB 4UDUB 2X4UB 4M7JH 4O2FA 2AJXH 2P49B 2CKBH 3GSUA 1OAUH 3HI5H 2X4OB 3ZO0A 4K23H 2C3VA 1MCBA 4JY4B 3ARUA 1FVEA 3BZFA 4U1GC 4OLYL 5M95B 4Z5RB 5DJCA 1A4JA 2XXCB 5HD8D 3RWEB 3UCRA 4APQD 1NJ9A 5DJ8B 1ZT1A 2GT9A 5HXMA 3NFSH 4F9LA 1OM3L 2HAZA 5BV7L 3OR6A 2R2CA 4MJID 1D3CA 1FE8H 4HIJB 2IANB 3PJSB 4WY7H 5K59E 1WIUA 2A1WH 3OJ2C 1K8IB 4LHQB 4NQEB 3A0OA 3KXFA 4MJ2A 3NAAL 4HHAB 2QLVB 4YR6A 1KN2L 4TULL 2AEPL 1VHPA 2IBZX 2OS7A 3OB8A 3E8UL 2H6PB 1JPGB 5LGHH 4OCNC 4HSQA 1DEEB 5F3HB 2N4IA 1KTDA 2XACC 5E8EA 3SEPA 2YOCA 2LABA 1B6DA 3K2UH 3MLWL 4TOYL 1N64L 3QA3A 2VIRA 3R8BB 3IKCA 3WS3B 3MRIA 4M62H 3LKNA 4PJAB 3TO4D 3IFOB 4X4ZA 5AUMB 3L3KB 4ZXBB 4DVRH 5IIEA 1YEFL 4DKEH 4QHUA 2CJUL 1K5NA 4TVSa 4LVNC 4U1KA 1CDJA 2FATH 4MGXA 3H9SB 3KJ4B 1OP5H 3HNVL 3QIWC 1TETH 1Y6MR 4DZ8B 1U3HD 1NH6A 3ZHLA 5HYFA 4PPTA 4R96A 2IQAB 3GMOB 4N0UA 5BJTA 1PEWA 1NC2B 3AXLA 4E41D 3DVGA 3LEYL 3V5KB 1SJEB 4JHAH 3MRRB 4NO2A 5DS8A 3S88H 4MNGB 5FECB 2ZG1A 3X13B 5B8CA 2YRLA 3O2VL 4B41A 2WK2A 3L1OL 4FOMA 3T3MF 5IMOB 5E8DL 4NCC1 3GMRB 3WIIL 2Y1VA 4NQCB 5DTFA 3CGTA 1IC5H 2NMSA 2MTPA 5A16A 2R1WA 5DURD 3SE9H 5I2IB 1CU4H 3BUTA 3RL2B 3CPLB 1E28B 2AQ1A 3MODH 1U8JB 1ZSDB 3PHSA 5IBLC 2R8SL 2X4NA 3N1FC 5DLMH 2HJFA 5GGRA 4PJ7B 4UTBH 4PJDF 3QWQB 1R3HA 3QAZB 4K23L 2Z31C 4HS6B 5BOZG 1GH7A 1LK2B 4XVJL 5I16A 1UJTA 3QI9D 1NEZB 1S9XA 1YC7A 1DLFL 1JHTA 3O45A 4GRLB 2ATKA 1KB5L 4Y4HA 2V7HA 1FL5B 5FDYA 1HSAB 3IFNL 3CDCA 4GRWE 4F37K 2YN5A 4L4TE 3QXTA 4KDTA 3LPGA 2BJMH 1EGJA 5D1XC 4KKBC 1DL7H 5JO5B 4M00A 5MEOA 4Q7DA 4DUXA 4ODVL 2E9JA 4P2RE 1G7JA 4ZPTA 4XBGB 1K2DA 2EXYC 3H6JA 3W0WA 4Z78B 2W91A 3FONA 5INDA 2V5SA 3EZ8A 2ZCLH 4HJJH 1IM9D 4Y5YB 2OMBA 1MH5A 4PG2A 5JHDE 3U1SL 3B9DA 3T2PA 4RIRA 4YC2B 4Y5XA 1YN7A 4HBQA 4PJ8A 4DVBA 1F58H 5B3JE 4PR5B 4LKXA 3TH4T 1A7NH 1P7QB 1Q72L 2X40A 4LPVA 5F6IC 4TSCH 3MNVB 5J6GB 4YFLI 1RZKL 2RFXA 5CEZD 3NN8B 2GFBA 3TBVB 3QZWB 3NIFF 3E2HC 1XCTA 1KEGH 1KJVA 4BFIB 1AQKL 2Z8SA 3QQNA 3FHAA 4HC1A 1EUUA 5F72S 1A14L 3PHQA 1I85A 1GIGH 4NYLA 2BNRE 1UKSA 3RDTB 3HZYB 2Q86A 3U0WH 3IRZA 3ARVA 5B4MD 3V79C 3HFMH 4G8GA 3UX9B 2PYEA 1QSEA 3ARBB 1UM6L 3GRWH 5FHAL 2QADC 4JGJA 3QFDB 3JV0A 4M93B 5DZOA 2YBRA 3RWIB 1NFIA 5D2NA 4BQ9A 5IFHH 1K4DA 4U3HA 3UJJL 3V8OA 4TTGA 5A2JH 4GXVH 5E6IA 5HGHB 4LLWA 4HWNA 4IMLB 4HQQL 3TA3B 5DJZA 2Y6SC 1PKOA 3NZHH 5EOCL 1OTSC 2IBBA 3OG6B 1X7QB 4HPOL 4F8QA 4XCYB 3EJZC 4Q97A 2UZYB 2XFXB 3GMQB 1CK0H 1H8NA 4OZFA 4I18B 1I8KB 3ZDYE 5E4IA 1VACB 2X7LA 1P4IL 2J8UA 5F7YC 3ULVD 4UBDD 1FSKC 1K8DA 3O2DL 3MGOA 5FV2A 1AR2A 2OYPA 8CGTA 4JVPA 3AM8A 1A6AA 4CN1A 4X6CE 5H2BA 1EEZA 5M7QA 1IBGL 3OTTA 4QRQB 4PGEA 1HKLL 1NGQH 2HFFB 3EYQD 4YNYB 4GAJL 3K1KC 3SDXB 2UUDK 5MERB 5IOPB 5IBUG 2PCPA 4UZGA 3SOBL 2YPKB 5HVGB 5C08E 4MNQE 1LP9A 3U30B 1QLRB 5E24E 3ULVF 4JE4B 3BDYH 4JZJC 3SE8L 5IR1B 1ZA6B 1DN2A 1T1ZA 1YYLL 4ZO9A 4P5MA 5EU6A 2E9BA 5CP7A 4EZMA 4JRYD 4IIQC 5BCAA 5D7JB 5DMKB 4Z76B 2ITDA 5GQBA 2D0FA 1N5YH 1LO5A 1OQXA 3O6FD 3WUWB 3RJDA 3VH8B 1RI8A 1CGYA 3DRQB 4JFYA 4LLVA 4OZHE 3JV5A 1H15A 43C9B 3RWHB 5ABDE 1FGNH 4U6TA 3KPSD 4OIIL 2ZCLL 3QUMH 2OJEA 3S36L 1F11B 3B9EA 3OL2A 5TFSH 4ZOCA 1ZEAH 4OLZH 1U8LB 5MHSD 4L8BA 2X89D 3ARGD 3MRFB 1WTLA 3V0VA 1JYVA 4XWOC 5MEQB 2YSSB 4POYA 5C09D 3A67H 4LKCB 3C8KA 1RUAH 4X99B 4RNRB 3QDGE 4CADA 3B9AA 4TSCL 2BSSB 1BMGA 5F1SA 4NT6B 2VLRA 3IXTA 2Y23A 4KROD 3GSXB 3EAKA 1IAKA 4PY8J 1VGEL 4JO2L 1MHHB 2AJSH 2CDGB 2NY1D 3ZE0F 4LBEB 5DEGB 3W11D 2BK8A 2OTWB 4LCWD 3U82B 2CUHA 1FLRH 5CKGA 2XNAA 5ECJE 4IRJB 4MAYC 4JFOA 3OAZH 4RX4A 1FFNA 5C0JB 3LS5H 2V2XA 4PBXA 2P8PA 1XR8B 1OGAE 4LSPH 3VE0B 5FHBL 3F7RA 3IJYB 1QBMH 3FQNA 3P30H 4OLXH 4M7ZB 1F90H 1RZIA 3P4MB 3EKCA 1WWCA 2X1PA 4X6FA 1UZ6F 1YPZB 5HI5C 3QO0A 1KSRA 3LN5B 3FQTA 4JY6B 4WW2A 1XCQA 5FOBA 1WZKA 4J1UB 1CTNA 1Q38A 3GI8H 2CK2A 4KY1H 1HOCA 1EFXA 3CFCH 1TZGL 4X7DC 3Q6GH 1JYXA 3GSOB 5CKAA 4WWKA 3SY0B 4PJFB 4P2OC 4S1SL 1H9VA 1GVIA 3IFLL 2ATPA 4QCIB 1HDMB 3HS0B 4JAMA 4XNQB 5ESAA 2XPGA 1W72H 4M1CD 4E42A 1RJYB 2FHBA 1I7ZB 1G7QB 1W0YT 4ZOAA 5ERWA 4K94L 3EYSL 1F6AA 3BP5B 5GSRB 3TJHC 4Q9QH 1MJUH 1M7XA 2A73B 1KLUB