2JJWA

Structure of human signal regulatory protein (sirp) gamma
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
115
structure length
111
Chain Sequence
LQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKNVEFKSGPGTEMALGAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords SIGNAL REGULATORY PROTEIN GAMMA
publication title Paired Receptor Specificity Explained by Structures of Signal Regulatory Proteins Alone and Complexed with Cd47.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 111
sequence length 115
ec nomenclature
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jjwA01
3VI4E 5CILL 1BIIA 1WZKA 3O2DH 5IW1B 1JRHH 2MHAA 3RJDA 1UKQA 1U3YA 5J7CC 4FQLL 3VWKA 3VE0A 2D7TL 2DQJH 1J0HA 3JV6B 3SGKC 1YEIL 4K9EC 3QXUA 5I1KL 5D4QA 1TIUA 3OR7B 2AJZB 3ARDC 4DK3A 3O6ML 3HG1B 2XPGB 1M7XA 1ZHNB 5DQDL 3I75A 5FYKH 3ZSSA 5I74B 1BVKA 3W39B 5D1ZD 5GZOC 2NY1B 2UVFA 1X5HA 2YPKB 2EDNA 2X6MA 5KTEL 2CKBA 2ICES 2LU4A 2P7TB 3RGHA 4TTGA 1VB9A 3BN3B 3SDAB 2YXFA 1R5VB 3TA3A 1N0LA 2OTWB 4OM0H 3WFZA 4Y4HB 5F7KC 3WXWL 3AVEA 4E5XB 2AI0L 1A9EA 3RL2A 4ODXB 4KZEL 2JJVA 3DX6A 3NCBB 4LLYA 4KQ3H 5TDNA 3ZE1E 4UT9L 1E4WH 3T0EA 3S98A 2EEDA 5B21A 1MCRA 3KGRA 4XNQB 3BVNB 1FFOB 4HWZB 5CZKA 1HIML 3BX7C 4P9ML 1KIQB 1EJ6A 1HXYB 1C5BL 1A7RL 1UJ3A 2Z8VC 5HHMD 4Z77A 5J89A 2CR6A 1QBBA 2CJUH 1FN4B 3ARBC 4ZNCD 1I9IL 3HRPA 3N1QC 5FO9A 5I1DA 4JY5L 1T04B 1MOEA 4XI5D 3GMMA 4FZ8L 1A8JH 1YEGL 1Z3GH 5D1QD 4CMHB 2WK2A 3HFMH 1SYSB 2RJMA 4JFEB 1CICC 1QLEL 1IM9B 4I18C 3QDAA 2ZUUA 3QIUB 1PYWB 3GNML 4HUNB 1DQQB 2P43B 3QPXH 3W0WB 5AD0B 4MDIA 1OT2A 4RCAA 4GJTB 4QRRE 1OCWH 4EI5D 4WWKC 3RVTC 1U8NA 5IVXE 2MSPA 1PSKH 2A77L 5BVJA 3SCMC 1WC7B 1WFOA 3C9NA 4LVEA 5I1IL 1UVQA 2BVUA 4PJXF 4DQOH 3CDYA 1EH9A 3QUXA 3WNMA 3KPSB 1VDGA 3WKML 5LG1A 2HT2C 3RU8H 2C3GA 2Q8BL 4R26H 3HZMB 5T3ZH 1HSBB 4JPIA 1FIEA 2VDQL 3TIDB 4P2QE 5HJ3A 4YHZL 2ZCLH 3OKOB 4UTAH 3MV01 1U0QA 2VLKE 2M8XA 4H25B 1I8IA 1P2CB 2BMKA 3QUZD 3HI6H 3ZDYE 1AY1H 1N64H 2HKFH 3MNZA 3PV6B 2AK1L 1CDYA 4MQTB 1F4XH 4PJIF 1HHHA 3ARFB 3EYVA 3G5YA 3MRGA 1KV3A 1ZEAL 5F9AC 3SGDH 43C9B 2CRZA 4PJEE 5CSZA 3WHE1 1L7IL 2DQIL 5IOPA 4GRWF 1D5ZA 3IJSA 4HGMA 5JA8B 4S1SH 4U0RC 5GIRB 1T5XB 1GPOL 1DDHA 1DTUA 4G7YL 3NFSH 5J11C 5DJ6A 2NYYD 1GYAA 3BD4A 3NCEB 4JVUA 4UB0L 1F3JA 1T1YA 1DBJH 2DRUA 2PTTB 1IAOA 4RNRA 3JZ7A 2BNRD 5A16B 1ZT7A 1O5DT 2HLFD 5E99L 3RPIA 1S7RB 1HOCA 1T80A 3PWJA 1CD8A 1IE5A 4O2EA 1BVZA 1BVLB 4OZFA 4FABH 1AGDA 4WUUB 5E7BA 2B8OT 4WI8A 3DMMC 3QXAB 5CIPH 5E94A 1XGUA 3F58H 1P7QA 5CMAA 4HK3N 5IW1A 3HN3A 1T1XB 4ZSOA 5EZOL 4TSCH 1EERB 1NMAL 2W65B 4RISH 1JWUA 4POZD 3JV6A 5I1HH 1CK0L 4JRXD 4Z76B 1NBVH 4NZUH 2Z31C 3KR3L 5DS8A 3ZHKA 5KSAC 4N90E 5C07D 5SX4I 2VXTL 4ZTPH 3OHXB 5ICYA 1TITA 1OF2B 1HCVA 3OR7A 1FLTX 2AJZA 5L0QB 1TETL 4ZDHA 5JW4Q 4OZGB 3HG1A 4NUJB 3SE4A 5IQ9A 3BW9A 3WYRA 4QHUA 3SDYH 1EEZA 3QFDB 2PW2B 5DVMA 4PJ8A 3MGOA 3RWEB 3BPLC 4HW6A 4JZJA 4AT6A 3W39A 4CW1A 1X4YA 3DOSA 2LTQC 1K6QH 3PHOA 1TCRB 3LN4A 2IGFH 4I0PD 2HT4D 5DFVD 3VFWA 1KB5H 3K46A 3WFCL 5DUMH 4JDZB 4Y4HA 1KTDB 4GAGH 3UP1A 1NGXB 1RK1B 3V7MA 3ULUE 4LCIH 2CDFA 5DD0H 1NC4D 2FZ3B 2WUBH 4APQA 1D5MB 2OJZH 4WHTB 3T0EE 5GRYA 4XNQA 1N6UA 4HWZA 2AV1A 5D8JL 1HXYA 3ELAT 3UEZA 2WQ8A 3G5XB 2LV4A 2NY3C 4PLJD 1N6VA 1T4KB 5I8CB 3L5WB 4FQHB 5AZ2H 5FV2A 8CGTA 5D2LB 4OQTL 4QXTA 4I3RH 4L1DA 1YEHH 3MBXL 1GGTA 3BO8A 1T04A 1KJ2A 3TN0B 4TOYH 2FEDC 3MRHB 1CL7L 1X3DA 1FVCB 2EIZA 3PP4H 4MCZA 1IFHH 1JZ4A 4U4BA 4ERSL 4TRPL 5I66A 1QRND 1XZ0A 3QIUA 3CGTA 1FPTH 3FHQA 5BCAA 5B22A 3F6LA 3W0WA 5BW7C 4KHTH 2H3NB 4GS7B 4G3YH 5T3ZE 1NUNB 4UUJB 5J13B 4Y5XB 4XC3L 1NAMH 2AJXL 1JIBA 1YA5A 1EGJL 2XZAL 5C0DA 2ZUQC 1AR1D 3RAJL 3GI8H 4R97B 4NFCA 1FZJB 2XKNB 5FUOH 1XF1A 3MLZH 3IT8D 5KN5B 1QSED 3VXQA 4ODWB 4PIRF 1ZSDB 1S8DB 1JBJA 1WCQA 3QNYB 5E6ZA 4NDMB 5IROC 2YD2A 2XN9E 3A6OA 4YDJB 5C2UB 3MRDB 4RGNE 4X6FB 1A1OA 4N8VA 4R4FL 3HZMA 4W68A 2VN7A 4LCCA 4R0LC 3TIDA 1A14L 1A6WL 4E41B 1DLHB 1J5OL 2C4FU 1MRDH 3QRGL 5J6GB 4P9HL 4BH8B 3FFDB 4KK9C 4NZTL 1MJJB 3TT1H 1CGXA 1LO4H 3ILQD 4GQ9H 4X6BB 3PV6A 5FO8B 4YJZL 4XWOC 3ARFA 3KXFE 3P4MA 1CG9A 2GY7B 4WU7B 1FYHB 4OB5L 3ULUH 1YMMB 3IB4A 3WNOA 2I9TB 1MCBA 3FT3B 3IGAB 3S5LB 2QADD 4U0QB 3MLVL 1QHOA 3QQ3B 4G5ZH 3RWGA 1N59A 2ZNWA 5CD3A 4OLWL 1AHWC 1MPAL 5EU5A 5D7LE 3H9HB 2HTLC 5LGKA 5J3HC 4Q0XH 1CQKA 4OZFG 3O9WD 1JMXA 4LVHB 1K8DB 2VC2L 2MTPA 3MJ7A 3QDGA 3VFGL 1LDPH 3WS6C 4K7PX 4LL9A 1MCJA 5HHNA 2NY2C 5JIIA 5ETUA 2C7UB 3A67H 4WI6A 2PTTA 4IMLB 3RWCB 4ZOEA 4LVNB 5L8LB 4LPWA 1EAPB 1FFPB 1FG2B 1G7QB 2Q7YA 2BVPB 1MUJB 4N8CL 5KS9E 4PR5A 1X4ZA 3RUGF 3ARGA 1JZ6A 3OJ2C 1FYTA 2VQ1B 3SGEI 3U0PB 4WUUA 3FRPA 1TVBB 2VAJA 3U36B 1WBXB 1RJLB 3IF1A 4DKDC 5EPMA 4GKNB 3X13B 4ZFFB 1QLFA 3BGFB 3BDYH 5DEFA 3RNQB 4OI9A 2NZ9D 4JGMA 3INUH 1T1WB 4HUVA 1T1XA 3D69A 4YBLC 1RZFL 4XC1L 25C8L 3Q48A 4PY7B 3BGMA 1DUYB 4L9DA 4LPXA 3EO9H 3OGCA 1JPFB 3GSWB 3F7YA 4KK8D 2OI9C 5ALBH 5IB2A 3OX8B 3DHJA 1TZIB 3OHXA 3U7YH 2VXUH 3DO3A 2Z93B 4PRPD 3OJMB 5FAAA 1CIUA 4HC1A 3I50L 5DK0B 5HDBF 4ZUWB 2RHEA 5ESAB 5AG9A 1DUZA 1VFAA 5H8DA 4F15C 4OF7A 1NUDA 5AG8A 3QFDA 3U83A 5I1LA 1TJHH 4LGSB 3RWEA 4XRCA 3H3KA 2YPLE 4ZUVA 4KWUA 2E7CA 5TF1H 2ZSVA 3FQUB 2Q3AA 3VGBA 4X7TB 3NA9H 1XT5A 3T0XA 4TSBL 3MV8B 4JDZA 5BQ7A 1ETZA 2BVTA 5AZEL 3TWCL 2X1OA 5DGQA 4CN1A 4ONFL 3P0YL 5KSVB 3EO0A 2W0FA 5T1MB 1UB5B 2V5TA 1YN7A 1MFEH 1W8NA 3WO4C 2J5LB 2DQHH 2E7LA 1DR9A 3O4OB 4JN1L 4IRJC 2A0LC 1VESA 2CLZA 3PE9A 2W92A 4QXGH 4YHYC 5INDB 4JM2C 3NA4A 3C87A 2YPVH 5F97E 1Z9LA 1TCMA 5L9DL 3FJTA 4PLOB 4WFED 5TQ2L 3EOBB 2XXCB 4V1DE 2P8MB 3TN0A 2Z9TA 3MRHA 3WNKA 4L8BA 4P5MB 3QUYC 2EDLA 5E5MA 5JHDD 4HIHB 5B3JF 4PB0H 4GBXC 3V5KA 4JFDA 1F02I 5IFAL 1CBVL 2GUOA 1OP9A 1KBGH 2FB4H 2NY5L 2AEWA 5T1KD 2J7LA 4JM2F 2CDGB 1IQWL 5TH2B 4BSVA 1AQDB 2IANA 2H3NA 1MFAL 2LU7A 4FQ1L 4AENA 2X09A 5FKAB 3UTTD 4UUJA 4OI8A 4OM1L 2DQGL 4Y5XA 4N8VG 5JW3L 3GSXA 4S2SB 2P8PA 3MCLL 5TDPB 1FZJA 5DK2A 2AXHA 1YEDB 2B1HH 4JAMA 1IC4L 4EJ1C 5KN5A 3HPJA 1JGEB 5C86A 1ZSDA 1S8DA 3CJJA 1HEZB 3AREB 1LE5B 2APWA 1IGCH 3P30L 1F45A 3UDWC 3T3MF 1CU4L 3TZVD 3VMPA 4E41A 2YZ1A 3U0WL 1V8HA 3FQRB 5LBSL 2WBJB 4R90L 4BH8A 3RL1B 3FFDA 1PD6A 4WGWB 3MBEB 2F8VA 5I17B 2AJUH 3PXHA 1U93B 4F8TA 4XHQA 1GSMA 3CPLB 3T09A 3P77A 4X0KB 3DRQB 4PGCB 5FO8A 3CSBA 4XH2B 1CXFA 4I5BB 1TTGA 3PNWA 4GAJH 1GGYA 3QCUL 3MGTB 4YZFE 2ESVD 3ZYOA 3RHWF 1YMMA 3O3DA 4KKCD 3K2UL 4DZ8A 1A5FH 3S5LA 1CGUA 3V4PH 3L3HA 1FGNL 3HI1B 4P4KB 4IOFC 5I75B 4QXUL 1LK2A 1R5WB 4A2MA 5IBUB 3V95A 3SQBA 5GPRA 3BN9D 1RZKH 5EC2B 3H9YA 4H1LA 4TSAH 5I1CH 1K8DA 2FHBA 5J9PA 4F37K 4EN3D 3E8UH 3QDGE 4HUMB 3FMGL 3CVIH 5FB8B 3CAFA 1YJDH 2FATL 3D2UB 2C7UA 3OKKA 4PJXA 1F42A 4NRXB 1ZE3C 3B5HA 5DJYB 1DFBL 5DD5L 1MCOH 2R23A 3RWCA 2B2XL 4Z0BL 3U2SA 2XYCA 1EAPA 1NAKH 4WWKA 2FBJH 1JYNA 4PS4L 3SCMA 1CT8B 2DQCL 2VQ1A 4W4OA 1CR9L 1TVBA 2GTZB 1LO0L 2VZTA 4GKNA 1J8KA 1L6ZA 1HWHB 4ZFFA 4LMQI 4NQCD 5EORH 4WGVB 1KJVA 4L4VD 4XAKD 1T1WA 5DA4A 2VDOL 2DYPD 5GS0C 4UNTA 1VKXA 4HHAB 5E56A 2YWYA 1MNUL 1Y6KR 1DUYA 1JK8B 1U42A 5ACMA 1K2DA 5CLWA 3RI5K 1JPFA 4PUBL 2P4AB 1OP5H 3MLYH 4WTXA 3OX8A 1A1MB 2UUDK 5GJSL 2EDWA 2GW5A 3DSFH 4ZUWA 1EXUB 5C0AD 3P73B 4Y4KA 3U1SL 2DF3A 3HE6B 4RZCA 1K3ZA 4L8SC 2R69H 3HMXL 1YMHB 2FJHB 1WICA 5MERB 1MIEH 1A7NH 4LCWB 2ITCB 3U9UB 4O51B 3RY5A 1T22A 1QSFB 1A6UL 2X4PB 5GRJL 4X7TA 3QAZB 3F7PC 3SDXB 3LV3B 1MREL 4OUUB 3LS5H 1I1AA 5LGHL 1XMWA 4NKQB 1PQZB 2C3WA 2GQHA 3P11H 4MMZC 1OM3H 2A9MH 4PJBE 1LK3H 4OTXL 1XIWC 2VKXA 5KSVA 1I1FB 4FS0A 3EYUL 3DX7B 5SWZA 3ARXA 5JXEA 3JTTB 3DBXA 4NYLB 1S7UB 4FG6D 5IBTL 3BZ4B 4UV4H 2PW1A 1J8HE 1HILB 2OLDA 2OP4L 2IG2H 1GIGH 1DVFC 3QULA 3FAWA 1MAKA 5IR1A 4J3OC 1NGWA 4JFZL 2J88L 4KMLB 5CJBA 5D5MF 4QRPE 3LQAL 1LD9B 5K9OB 2F5AL 4LSPL 4GRLA 2VNCA 1P7KA 1FNEA 2ATKB 3DMMA 1MCHA 5HGHB 2FRGP 5KSUA 2VDKL 4DTGH 5HVWA 2ITDB 2C4XA 1P7HL 5TH2A 3NN8A 5EUOF 1ZLSL 2IANE 3NAAH 4G8IA 2Z31A 4OBSA 3FO2A 5KSAA 1GOGA 3VXUE 3QUMH 5SWSD 3QEQB 4KKLD 2F74A 5TDPA 3UZEA 3B2UC 4XBGB 4MJIB 2YD3A 4JRYD 4LAQL 5MI0B 4MAUL 3C6SA 4QYOA 1UM4L 1NUGA 1WZMA 3LRHA 5IHUH 3LEVH 1AKJA 1FFRA 1X5GA 2J4WL 5DI8A 1MRFH 1HEZA 1KUMA 2F54B 4YXKH 1P4LB 4BH7A 3BKYL 4HC1H 1NGZA 4KKAD 3SPVA 3VDAA 1RUAL 1KFAH 1BOGA 4PV8B 2BY2A 3KPPB 1WTLA 1X9QA 2X10A 2HVKA 4LQFH 5DSCB 1FNSH 3WHXB 5TGBA 5KSBF 3TNMB 3SDCC 3S5LG 2ADGA 5IGXL 2WBJA 2G60L 1S9XB 4NM8H 5D70H 3RPKA 2YZ8A 2GFBB 1U93A 5IV2A 2CDEA 4CGTA 2HMID 1EIBA 4I77H 4H1LG 3QXDA 2LE9A 3QHZL 1F90L 1VERA 3MV7D 5DUPL 4P5TC 3V52L 2QQNH 1KB5B 4WDIB 5DHVH 1P4BL 3RZCC 3FB6B 4M3KB 5F7NC 5CHNB 3QCVH 3NABL 4S1RL 1H5BC 4PJEB 5EWIH 3S3SA 2AJYL 4P46C 4P4KA 4QHMB 4L5FH 4OGYL 4AEFA 2VZOA 1S3KH 4JCMA 5DJ8B 5BV7H 4XP9L 1MSPA 3H42H 4F7CA 5CD5D 4UOW1 3FB7A 4YC2B 2M26A 3SKMA 3EFDL 4HXBL 3I6GA 3I02B 3NPSC 3NFPB 3DUUB 4KUZL 4Y5YB 4OF6A 3C6LB 5DJYA 4Z0XA 3SN6N 3UTPD 4UINL 3O2DL 3HZKA 1S7QB 5FM4A 3B9KD 1XR8B 3B8SA 3CZJA 4N5ED 5IW6A 2KKQA 2FIKA 2CPCA 3MRMB 3AU1A 2DQJL 4JO1L 2EC9U 2Y06H 2VAAB 3Q3GB 3ROOB 1OSZB 5J8OA 4YFDB 3HRZB 3OSKA 5A3IC 4K9EH 1F4WL 1OAQH 3MOBH 4HT1L 3SE3A 3STZB 3VWJD 1A6TA 4U7SA 3L3JA 1NAMB 3T3PF 3T2OA 4HHAA 4ZUTA 1KPVB 5E4EC 5FYKL 1MVUA 1EHAA 3OB0K 4PJIE 5IQ7H 3IDUA 1FVEB 4NO5A 5GGRB 5JPNA 2HN7B 4GRWE 4EQ3A 4UI2A 1HK6A 4XPGH 1RHHA 1J1PL 1WSST 4NQVB 2NPLX 2FJHA 1XEDA 3H9SB 1NDGB 1TPXC 1QSFA 3VG0L 3ALXA 1MHPH 4K7PH 4IJ3C 4G6MH 3LV3A 2C26A 3GGWB 4HGWA 1PQZA 4LASH 5I16A 3BKJL 3MO1B 1G6VK 2YRPA 4M61B 3NPZB 1I1FA 2OM5A 1J1OH 4G8EB 2APXA 4FHBD 1ZLVK 3RUGA 2VTFA 5SWZE 3IXTB 4KKBC 5GJTH 4NYLA 2E5EA 4MMXC 3WLWC 3D39B 1UH3A 4XMLH 3CC5B 4Y89A 5D7IB 43CAA 4XPFL 5L6YL 2EE6A 3CFBA 3OAYK 4MS8D 3VXRA 4XNXH 5IHBA 1JUFA 2JIXA 4P3CL 2XZQH 4J3UA 1ZKAA 5JW4M 1CFQB 1PSKL 2ATKA 5MHSE 2GSIA 3JV5A 4JFFD 3MREB 3BESR 4PJFB 1A6VH 4DQOL 3ZE0F 1OTTC 3RVWC 3HLAB 3ORJA 5EBLA 4X7SL 3WE6A 5HD8C 2DD8L 3O6FD 1E4XH 4FFYL 3DYMA 5CP3A 3HCVB 1LEKB 3IU4L 2Z8RA 2DQUH 1LP9F 5F7EH 1UADC 3QEQA 4HIIB 4YHIA 4R26L 3DXAB 3RDTD 4AY0A 3ARUA 4YHKL 3PWUA 4KRNA 5EOQL 4P49A 2Q1EA 4FQCH 1AI1H 4YR6A 4WNQB 4GRWH 4M3JA 2AAVA 1AY1L 5H94B 4Q9RH 3VD4A 1TDQA 4L4TB 4PG9B 4WI2A 4ODHH 1OTSC 4P3DB 1JV5B 3MUGB 4GQPH 5DSCA 3WN5C 2DI7A 5BRZB 1OQOA 2G75B 5C3TA 3S35H 3K1KC 5EN2B 3MCKA 2MPAH 5MENA 4YE4H 2OJEA 4S1SL 4TYUA 3MA7B 4M62L 2GFBA 1FRGL 5IBUG 3BH9B 2O61B 5FF6A 1MVFA 4AEHH 2BNQD 4MXWH 4HPOH 3NCJL 4K3DL 2XRAH 1JYXA 1K8IB 5L8JB 3CUPA 5EIQA 5FA3B 1EEQA 1UWGH 1RUKL 3ULSA 5HYJB 4HXAH 2VERN 1DANT 2ZKHL 2I60H 1EUTA 1WBYA 5DJ8A 3LEXB 2P42B 2FGWH 5IM7A 4KKNA 4GMTL 3TVMB 3BXNB 1I75A 5DC9B 2WUCL 4FABL 3KYKL 5GS1C 3DUUA 4P3WA 4GFTB 3Q0HA 2BDNH 5E5RB 3UJTH 5F3HB 4HJJH 2IAMB 5DJZA 1QP1A 1MY7A 3GFUA 1Z0MA 1S7QA 3F65A 3QG7H 3FOMA 2DIBA 3MYJB 2JELL 3MRMA 2IQ9H 1WWWX 4S1DD 4OCYH 4OT1L 4LK4A 4F57L 5KS9B 1QA9B 2YA1A 3T77B 3HRZA 3GSNH 1YDPA 2O5YL 1FE8H 1ZHBB 5F88A 4KXZH 1IC7H 3KYAA 3STZA 1AGEA 3BAEL 2ZNXA 2CIKB 1S7VA 3SDYL 1UM6H 1VACB 1KPVA 5D1ZC 4IIQC 2IFFH 5C2BH 1MLCA 5EU7C 4U6YB 2QSVA 2X4UA 1QFWL 3JWOL 4LSQL 1F11B 4TN9A 2JCCB 3BMVA 2FLBT 4LSSL 2VH5H 3T0WA 1ED3B 3IJHA 4BFIB 1NFDE 3GRWL 5DJCA 2NY0C 4QF1A 4LSVL 1NANI 3JVGA 4Y4FB 3BDXA 2VE6A 4GAGL 5JR1L 2ZUTA 1SMAA 5EOCJ 5CP7A 1H3VA 1MLBB 4LCIL 5DD0L 2BRQA 1KLGA 1Q1JL 3OF6D 2OJZL 2RCSL 3CCHB 3EO1B 4OD3L 2NX5B 5DJDA 5D7JC 2LQRA 1E6JL 1HN1A 4M93C 3GGWA 4KUCD 3Q6FB 3PQYA 2AXGB 3QDJE 1P6FA 1X5ZA 3IFPB 3RGVD 1SM3H 2ARJQ 3FOLB 4LGRB 2ED7A 4M61A 3UTSD 3QCTH 5FO7B 5DK3A 1P84K 5B39A 3GKWL 5EH1A 4XI5C 4M1GL 4I3RL 3QR2A 4G8EA 1HHGA 4UIMA 5D1QC 4LLAA 3WFBH 3UPCA 4TOYL 3RUGE 2BJML 3L95A 2DL9A 4O9HH 2X4SB 1OD7A 1MHCA 2J12B 1T0MB 5I8KL 4ZG1A 3D39A 1ZLUK 2EC8A 2HJKB 1FO0H 4MNGA 1CDJA 4QTHB 3L5HA 1CVRA 4ZFZB 1FIGL 2HVJB 3REVB 4EI5C 1NC2B 1IGIH 1MI5E 5B38A 3IXAB 3SY0B 5HTSA 4ZD3H 4MX7B 4UNVA 4V1DB 2JTDA 3OKNB 4L9LB 2QJDA 3MREA 2V17L 4TNWF 4PJFA 3GBLA 4U49A 3MFGB 3VFRA 3TO2A 2ZWLT 3VD9A 3IDYB 5FCSH 5FUZH 5HDBE 2XG4A 5D96B 4BQCA 2BXZA 5CJXC 4O02L 3SOBH 1T7WA 5JO5A 1S78D 3HCVA 4XTRC 3VWKD 4O58H 4WI4A 3RA7L 1KN4H 2B4CL 2XTJB 1T2QH 5KW9L 3ISWA 4RSVA 4N90D 1L0YA 2P5WE 4X9IA 3PWNA 4P2OC 2VISA 3FB8B 3GO1L 5KZCB 3QUZC 1AGCB 2X4NA 4WEUD 2CKBL 4M48H 4BA8A 3MLXH 4WNQA 3VH8B 4PGEA 1MQKL 1DP0A 4L4TA 4PG9A 2X4QB 1D3CA 3MUGA 5CCKH 1IT9L 1MWAA 5BRZA 2X89A 1IGMH 3VXTB 1UXSA 1INQA 1JFQH 4EZMA 5ESVA 5MENE 4D0DB 4MDJA 3G6AB 3TA3D 4GLRI 4YDVB 3NCMA 4MNQB 3FHAA 1KCKA 1NCDL 2ERJB 1CN4A 1HQRB 1ADQA 2OK0H 4WO4B 3TBYB 3CSGA 2IADA 3X12B 5B3JE 1CGSL 3D87B 3T0ED 1DVFA 1NGQH 1DEDA 2W9DH 4QXWA 2HLFC 2I24N 2NTFB 3B9EA 5DGRA 4KTEL 1RIVH 4HCRH 2J3SA 3CU7A 1L6XA 1RJZA 5EUOA 2BVOA 3L5XH 1G7PB 3KYOB 5I1JH 5I6XB 3KLAA 5HGAB 1X5FA 5IT2L 3B9AA 2D7NA 3T04D 5CJOL 1ZS8A 4L8CB 1ZAGA 1RZ7H 2KDGA 4XNYH 3EAKA 5F21B 1HH6A 2KZWA 1WEJH 3MRQA 5ALCL 1PAMA 5GXBB 5D71L 3G5VB 3FB5B 2D03H 4RQQB 1U8HB 4YAQA 3VW3L 4POZC 3BSZH 5DHXB 1KJMB 4ZNEA 3MYJA 1KXTB 3J7HA 4WW1A 2OL3H 4MA8H 4CADB 3GB7B 5C0BD 5KSBA 2VXUL 1ZHBA 2FNBA 4Q97A 1ZHKB 3VFMA 1R3LB 2CIIB 4JANB 5C6PB 2CIKA 4X98A 3QUXD 4HS8L 3QNZA 1VACA 3CVHB 2EH7H 5HSFA 1CLOL 4XNZC 4U6YA 5TF1L 4I0PC 1GJIA 2HT4C 5DFVC 3BPNB 3B9DA 2OX5A 4RGND 5LXGH 1FL3A 5GGQL 5CWSA 3UJIH 3RNKB 1KC5L 5I0ZA 2BVYA 4M7LT 4DVBB 4WHDA 2UWEF 1EBAA 5DRNA 1X44A 4TUKH 1ZTXH 4LP4A 5B39G 4C56A 3BP5B 3O2WH 3X3GL 1IAKB 4XHJC 1J87A 4Y2DB 3TNNB 1MLBA 1BQHA 4RMRA 2WIIB 1AO7B 4HWUA 1D9KA 1EK3A 2R4RH 3LHPH 5CBEA 2NX5A 4K71C 1MCEA 4L3EA 1H5BA 4PLJC 3TO4B 2CLRB 3V6BR 1IC5L 3Q6FA 3AB0B 3PQYE 4RA3A 4XMKH 2AXGA 4P46A 3IFPA 3WL9B 5JW4N 4HWBH 3FOLA 4MSWB 4QXGL 4Z7QF 1FFNB 3L9RA 3U0TB 2NY6B 3S6CA 1YY9D 4PGDB 1H3PL 1FORH 2X1QA 3CLFH 1U8LB 3T2QA 1OWWA 3RBGA 5SV4A 3HMWH 2X4SA 5EBMB 1WIUA 3PDDA 1HDMB 2DM2A 4GKSA 4PB0L 1KCRH 1Q0YL 2HJKA 2XQBH 1L9MA 1LO2H 1KBGL 2ZSWB 4M43H 4NOFA 1VEMA 2I9LA 4BFBD 4ZFZA 4CDHA 4IMKC 2HVJA 3FCTA 2X4TB 1JZ7A 1AR1C 4MX7A 3C2SA 3EDKA 3FO0L 4U1GC 4HKZB 4Z7NF 5T1DH 2R2EA 3C5JA 5D6CB 1EA9C 1P7QD 2B39A 3IDXL 4M03A 1GOHA 5DMJB 4M8VA 4KMQA 2YMXL 3M45A 3MA9H 1IGCL 5DJ2B 2Q3ZA 4KPHH 3WUZA 2RGSA 3RQ3A 4D9LH 1A02N 3ARDB 3MODL 2ICEB 1CIDA 5C0CA 4RWYL 5J1TC 3HG1D 3DURB 4UDUB 4PB9H 1CDBA 4OLUL 1RZIB 1M7IA 3BKMH 3PWPB 2JB5L 1F4YH 4M9PA 3Q6GL 3L7FB 4PJ8D 2DQFA 3LH2H 1EEUA 4P9HC 2X4QA 3C09C 4C83A 4GAJL 4NO3B 5ISZB 2QADC 4M6AA 1MH5B 2W38A 3VXTA 1KGCE 3WD5L 2G5BB 3SDAD 3U4EB 5F9DC 2VLRA 4WW2C 3VCLA 5D5ME 1PLGL 1MJUH 1R5IB 2ARWA 3PDOA 3QB7C 5C0ND 4F9PC 4MNQA 4Y4HD 2PYEB 3GJFH 3O9WC 5MEPB 2KL6A 1VEOA 2LAAA 5IWLA 1DQLH 3KS0J 4TSAL 1MCQA 3C8DA 4EI6B 3X12A 4UOJA 4APQD 5DVKA 1MFCL 5HI4D 1KJ2L 2EDOA 1I9RH 4WW2F 4Q6IC 4H0HB 2YA0A 3CMOH 1SHMA 4J3VA 2FBJL 3E3QC 4A6YB 4GT7A 3K8LA 1NBZB 1LP9A 5F96H 3EW3B 5GRUH 5C8JB 3V4VH 1CICB 5SX5H 1ZT4B 4OLVH 3AS0A 2NZ9C 4JKLA 4I3GA 3FB5A 1L7TH 2NXZB 3W9DA 4OLXH 1U8HA 5JDJA 3QIUD 5EORL 2GJ6B 5JPMA 1KJMA 4NWTH 1F6FB 4PJDF 1L4IA 1OSPH 3CZFB 4Y0GA 3W0WD 3T8XB 5HY9B 3N1MC 4KK8C 4UTBL 5ILTL 3D3VB 3K0WA 3VFSB 2Y5EA 1JYWA 2FX9H 3S36L 2A6DA 3MLYL 3RWDA 5IB4B 5KSBE 3EYOB 3RIAK 5C0EB 4FFZH 2IALA 4FXLA 1G0YR 1R3LA 3QWQB 5DWUH 3SO3C 2IQAA 3BD3A 5BZDB 1CXHA 5FKPB 3CVHA 1KG0A 3CH1B 2R69L 5CUSL 3V0VB 4GKOA 4X7CC 3ME0A 4JJ5B 2QQLH 3S3PA 2YXMA 3EJYD 3NACH 4PJIB 5FOBB 5DZOA 1UEYA 2VIRB 3R1GL 1QG3A 4XPBL 4NO0B 1PW3A 4NM4H 4LSRH 5L88H 4C56E 3O41B 1IAKA 1NMCC 4TVPE 4E9LA 2BHYA 1RSFA 1YN6A 4ODVH 2BCKA 1T1ZA 3FO1B 4PRAB 3BZEB 1YPZF 3VXMA 3V79C 4JPWL 1EZVY 1GGUA 4JQXC 4NSKA 1C5DB 3ARFD 4FP8H 4L3EE 35C8H 3TO4A 2CLRA 1VEPA 3N0PB 1GIGL 4GW1A 1F2QA 3LQZB 2PTUA 3G08B 4MD0B 4U6VL 4MSWA 5DXWA 2EDDA 5AYQA 2VKWA 3NGBC 4YUEH 3WDHA 5FIEA 4FXGB 3B6SB 5E08L 4Y16B 1U8LA 3PJSA 3N06B 1I9JL 5GS1A 3KYNA 4NT6A 2D2OA 5FK9B 5J11B 1VSCA 3B43A 2WW8A 2NNAB 2CGRH 2X4OB 2A1WH 3QDGD 5TQ0H 3VGEA 1G7LB 3ETBF 3DYOA 2ZSWA 4DTGL 3T0AA 1KEGH 5DD6A 2NCMA 2VLJA 3T3PE 2G5RA 1UWXH 3WCYA 1FBIL 3GK8H 4X6EA 1FZOA 2R0ZH 5DD1L 1BJMA 1P6AB 1ZHLB 1JGLH 4KDWA 1CE6B 4U6XA 1IEAA 5I1GL 1FYTD 1R3KA 4D8PB 4ODTH 4WUUD 3BE1H 4N0RA 3WKNA 3PL6B 5D1ZA 3IDIB 4OZIB 2F19H 4YXKL 3VH8G 4HIEB 3WV0A 4Z7WB 1RHFA 4HC1L 2E3VA 5CGTA 5DJ2A 1I3UA 3SDDB 3TZVC 3N9GL 1X5IA 4IOIB 3HZYA 4AL8L 1MCLA 4Q7DA 4X5XA 4PLKD 1VGEL 1BBJB 3OZ9H 2ICEA 3O3EB 5GGTA 1F3DH 4O00A 5D70L 4MJ5A 2OZ4A 1U8MA 2A73B 1A22B 1I9EA 1CDHA 1RZIA 3OL2A 4O2FB 4PBVC 2B0SH 4Y19A 3RIFK 3G6DL 2VL4A 4Z7VF 2ZCHL 3BPLB 1NLBH 5D7JA 3L5IA 5D6DC 3IS1X 1NBYA 4KKCC 2LTQB 3BI9X 1F8TH 1HYRC 4TVPH 1W72B 5I1AB 4HJGB 3QCVL 5IP4A 3VXSB 5FGBA 5J6HA 5EWIL 3NZHL 4HEPG 2VLRE 1OAXL 1C7SA 3BN9C 3BH8B 1R5IA 4L5FL 1V3KA 7FABH 1UZ8B 4WFHD 4AMKH 4EN3C 1QFOA 1KCLA 1TZGH 2AQ2A 3KDMA 4QTIH 2P48B 1A3LL 5EUKB 4LRIA 3OKDB 1FHGA 1S7TA 4WFFE 5DMYA 1IKFL 5HPMA 5DDHA 3LS4L 4HQQL 1TQBC 3P9WB 3ZE0E 4PD4K 5E00B 5ERWA 5C9KA 4NKOA 1I8LA 3QI9A 4XPHL 3SE8H 4OLYH 3WIFA 1T83C 3QPQD 4YEFA 5E8PA 1UYWH 2DKUA 2R1XB 4YDKL 1WZLA 1LP9E 4JO3H 1QRKA 3TN0D 1FO0B 1I7TB 2RFXA 1RUPL 1J86A 5C08A 3TT3H 5CGYD 3UMTA 1OAQL 5CJXA 4JFDD 4FZEH 3FZUD 2FO4A 1D6EA 8FABA 3WFDH 2GJ6A 3GUTB 5M94B 4JHZA 3MRCB 2IAND 3QT2A 3RY6C 4NNXB 5K9JH 3VDBA 4JZOB 4YHPB 5A2FA 1JJUA 4NQDE 5GGSY 2ZUQB 3PWLA 4PD4J 2VDRH 1T7YA 3BPCB 4P2OA 1MRCH 1YECL 2NLJB 5CGMA 2YS4A 3FN0L 4QLRA 2GK0A 5ICXB 2H6PA 3EYSL 3B5TA 2YRZA 3BMWA 5BZDA 1BX2A 5FKPA 4XP4L 4D0BA 1NCCL 4KRLB 1EBPA 1JZ8A 3LY6A 1UCBH 1BM3L 5ID1A 1IRAY 5C7XH 3HI5H 1MEXH 4R0LB 4UV7L 1MHPL 3VFPB 5FOBA 3V6ZB 1CD0A 4MZ3A 1QO3B 4Y2OA 4E41D 4NO0A 3RVXD 5C1MB 1NFDB 2NY4D 5DJAA 2R29H 1PX4A 4ZAKB 1CF8H 4CJ0A 5FXCH 1J1OL 4FG6C 1EO8L 4BZ2H 4PRAA 3FO1A 1Q9LB 2EEBA 1EV2E 3VXME 3DETD 1Q9OB 1DL7L 1C5DA 2FDBP 2OTUB 4XMLL 2NXYB 3RWHA 4F7MB 5EU6E 1YMMD 4ZXBA 5B3NA 1L9NA 3I3EA 2XZQL 1C5CL 1OGTB 1S7XA 5SV3A 1OLLA 4FXGA 2DQTH 1AHWB 2H26A 3VA6A 5FK9A 3EKCA 3A6CH 2J2ZA 3EDEA 3LQAC 1G7LA 4HGKC 4K3JL 2Y36H 5DT1L 3RBSA 3QNXB 3NZ8A 3D6GA 1V3JA 1QYGL 4JRXA 4KXZI 3LN5B 1AIFB 1PJ9A 2FWOA 5EC1B 2AK4A 2N7BA 2NZIA 1Q8MA 4KKLC 3SHSA 1CVSC 4WWKD 5D1XA 5KJRL 3MLRL 1QSVA 4ZS7L 2ZJSH 2W9EH 2DQUL 1CLZH 5HHXH 1ZHLA 5F7EL 3GMNB 3SCMD 4ELKB 4D8PA 4OJFH 3GMLB 3QDMB 2W9LA 3MNWA 3V7AE 5F89B 1HZHH 4EDWH 4AEIH 3GSUB 3PL6A 3LKNA 3AS3A 4OZIA 4KKAC 5HGBB 3TH3T 5EU7E 3NCCB 2OL3B 4Z7WA 4Q9RL 3LVEA 2VITA 2MWCA 4IOIA 4HFWB 3U46B 1IGFL 4UQ2B 1HE7A 3S35L 4QRSA 4LOUD 5F8QC 3O3EA 2HMIC 3C2AL 4MQSB 2P8LA 4GG6F 4Y4KD 5D93C 3WNPA 5IESH 3MXVH 4Y19E 4HUXB 1I8KA 1QBMH 4U3CA 4BUHA 3WFHB 1OP3K 4MXWL 5HHME 5IEKA 3EFFB 4KGLA 1OAUH 3KPOB 1W72A 5C71A 2VRAA 2BSSA 4XVSH 3UPRB 1TJGH 4N8PA 1I1AD 3IDMB 4HXAL 5HVHC 3MLUL 4OLZL 3ZKND 1VFBB 5CD5C 2EKSB 1UZ8A 4QGYA 3KPRA 3TFKC 1Q9WB 4LSTL 4EUPH 3FTGA 3WO4B 5SWZD 5JXED 1FL5B 5KBNC 4X6DF 1RU9L 1CFSA 5IMOB 2BDNL 2E8YA 4W4NA 4IRJB 3B9KC 4N5EC 5KOMC 2E9WA 2HFFB 4YHYB 3O6LH 1O0VA 2V9TA 4JQIL 2P5EB 4OCNC 4ZFOB 2VL5A 4HS6A 3C60B 2V7NB 2IQ9L 5FGCE 4KH2A 1QSEA 4OCYL 3L3GB 3QUYB 5CILH 4GRLD 3DVNA 1U8OA 5E9DA 3VWJC 5J1SC 2ZUSA 2WWMD 3BHBB 3DMMD 5C08E 3GSNL 2R2HB 4FQLH 1F4HA 4NKMB 3DI2B 2D7TH 1IGJA 3EDDA 5F8RC 1D7FA 3MRCA 1UM6L 1YEIH 4XCEB 4NNXA 5CZVL 2IFFL 2G2RA 2RIKA 1BOYA 1XGTB 1ONQA 4QKXB 4YHPA 1UCTA 1Z6JT 2HFEB 3IETA 5E0QA 3T0DA 5KSAD 4XXCC 2MQCA 2GITB 4CVZA 4P0DA 3O6MH 4CNIA 3HNSL 4ZOBA 1F58L 1MJ8H 2PUQT 4ISVA 4GXVL 5DQDH 1QUNA 4PG2C 1AKJD 1D5IL 2CK0L 2FX7H 5GGTH 4HZLA 4BKLB 1TNMA 3VFPA 3V6ZA 1HH9A 2DAVA 4YHOL 5IF0B 3WXWH 15C8L 2AI0H 4DOHE 4F9PA 5C3LD 4FQXA 1BWWA 1F5WA 4KZEH 2GHWB 2WBJD 2VMFA 1U8PB 3GIVB 4ZAKA 4UT9H 4WIQA 3QHFL 2X9XA 3DX9B 3IDNB 4CU7A 2BHZA 1G1CA 4WFGE 1Q9LA 4M7JL 3JWDL 3EJZD 1G6RA 4K7PY 2BNRE 3O2VL 1C5BH 4AH2B 1A7RH 2W1NA 3BT2L 2OTUA 1T89C 4JFOA 4MS8C 4ZQKB 2EE9A 3MRJB 4NN5C 4F7MA 3VRIA 5ACLA 1GAFL 3GJFB 4G6FB 1P1ZA 4JY5H 3GEWB 3TBTB 2Q8AH 3F62A 1CFNA 4PJDA 4FZ8H 3NTCL 4P4KD 1YEGH 4NHUB 5F3BA 4F37F 2EDFA 1QPXA 5IHZA 1QLEH 2Z35B 3GNMH 4NJAL 4KFZC 1A6ZB 3JV4B 2XZZA 1G7HB 1I1CA 2ZUXA 3G9VA 3QNXA 4WV1B 3O6FC 4JRXE 1AIFA 5EC1A 1G7MA 5DEZA 1PDKA 3RTQC 1WK0A 1AXSB 5HGDB 2VDNL 5C07E 2XWTB 4CAGA 3RDTC 2EDTA 4HSQA 4JVWA 4UAOB 2JE8A 5I1IH 3B3IA 5C0RL 1AD0B 4YK4C 3NIGF 4H8WL 3GMLA 4RAHA 2CUHA 3IU3A 4NUGL 1A3RL 3WKMH 2UWEE 4NC2B 4MJ4A 4AIZB 4ELMF 2Q8BH 2AXFB 5HGBA 2R9HC 2H32B 1MHHA 1NSNL 5DHYA 3O81A 3LKOA 2VDLL 1YPZA 4YHZH 1QSZA 2D0FA 4I4WB 4UQ2A 2OTPA 2W60A 3QJFB 3BDBA 4B5EA 5DFWH 2AK1H 4U1SB 1CI5A 3MV9A 2IF7A 2X5PA 3GM0A 4HJ0D 3ZHLA 1WT5A 1ZEAH 3DWTA 3WFHA 1L7IH 2DQIH 2OK0L 1OHQA 3DV4A 3QIBB 3T65A 3EFFA 1QSFD 4PRHA 1I8MA 1NGQL 2X40A 1GHFH 1MCDA 1I3RA 4OFYA 4RA0C 3L5XL 1QR4A 3N1FC 3CFCL 1CFVH 5I1JL 1VFBA 2EKSA 2QR0B 3KPRE 4NNYB 4LLQB 1HCFX 4UB0H 1QRNE 1WWBX 3LSOA 1OY3B 4PGBA 1FL5A 3OQ3B 4JJHA 3SGJA 3H9ZA 5BZWA 1QHPA 4Z7NE 2NY2D 1Z0NA 4NKDB 4WCYL 3UTTA 3HE7B 5JOEA 4S0SD 1J0YA 3VXRD 5IK3A 1S9WB 2P5EA 4L8DB 4S1DC 2JIXD 5GRWA 3NIFF 1N5AA 2V7NA 3B4NA 1SY6A 1QSEE 4G8GB 1JI1A 4LBEA 5GHWH 32C2B 3BHBA 2F15A 5FA4A 2ADIA 3AXLB 4X9HA 1YQ2A 5EZOH 1NMAH 3TBWB 1F6AA 2LFGA 4WI3A 3UO1L 4O2CA 1FC2D 2RAMA 2MJWA 5CS7A 4IS6A 4KRMB 4XCEA 3KR3H 5B8CB 4Z7VA 3V8CA 2ICCA 4YLQT 4RFEB 1YNKL 1Z9OA 4X99B 3KPNB 3OXSB 5BOPA 1TETH 2FJFB 1W0YT 3QEQD 5DO2D 1KLUA 1SYVA 3AGVA 4ZO9A 3V5HB 5FYJL 1ACYL 5I8EB 5H37G 2VYRE 3JWOC 3S96B 4XP5L 4P4RB 3V5DA 2DTML 4R4ND 4JHWL 4R96B 3D25B 3L7EB 3LHPL 2F53B 5FYJD 3F5WB 5AUMA 3RGVC 3O4LB 5C92A 3D0VB 5MEND 4OKVA 1U8PA 3GIVA 4ZYKB 4MCYA 2GTWB 4PY8I 1JZ2A 3DX9A 3IDNA 5CEYB 3R8QA 1X6LA 1FORL 3HC4L 4JKKA 5K9KB 1MFNA 2EIEA 4DGIL 4OZHA 4HH9A 5MP6L 5D8JH 4I2XB 4AH2A 2XIDA 3DRTA 2XV6B 4ZQKA 2XG5A 4HKBB 1KCRL 1JN6B 2AKRA 1HXMA 1YNTB 2A0LD 3E6FB 4OQTH 1JGVL 4LDEB 3MBXH 4IRSB 1IM3A 3E3QE 5C0IA 1YEKL 4PJDE 4ENED 2KZ1B 1J05A 2YC1A 3KPQA 3PIQA 1T0PB 4LF3B 1NEZA 3VG9C 3QQ4A 1T5WA 4ERSH 4TRPH 3EZ8A 4XNMB 4UT7L 2Z35A 3MJ6A 5MEQA 4L4VA 2DKMA 4JFQB 3JV4A 1N3NB 5SWQB 1TMCB 1EDQA 1G7HA 2NY7H 5TDOB 4KZDL 4YFLF 5FCUL 4XC3H 1S78C 2AJXH 5F7WC 1E4JA 1AXSA 1EGJH 5HGDA 2X70A 3VWKC 5GQBA 2XZAH 2XWTA 5JZ7D 3TYGL 4P2YA 4CRPA 3L6FB 4MA7L 4JY4B 4ZPVA 1AD0A 2B1AL 3H3BC 3TH4T 2BZDA 3FAXA 3TP4A 3D18B 1GGBL 2B4CC 1IKNA 1J0KA 2AXFA 2DLFH 3CXHK 1I3GL 4R4FH 4M6OH 1BD2B 1A4JB 5I9QB 5E4EB 4P59L 1A14H 4HK0B 1A6WH 4KY1L 4QOKB 4RFNC 2YWZA 1QR1B 2IPTH 1YPZE 1J5OH 3M17B 4WJ5A 1AD9B 2WV3A 4PRDA 4P9HH 4LPCA 4NZTH 3TA3C 3BEWA 4POUB 4Z95H 4DFIA 1RJYB 1CWVA 4HAFA 2UVEA 4M7ZC 5HYIA 4U1SA 1A1NB 4G42B 4QRUB 3MV9E 4KAQL 1R3HB 4OB5H 1DQLL 4XCCL 3T0EC 4CVWA 1CZ8L 3QIBA 4IJ3B 4PRHE 3MLVH 5IMLA 2W0LA 1S9YB 4GH7B 1UJ3C 3CXHJ 4NQEA 4OLWH 4WFEE 3PQYD 3MXWL 1MPAH 1WAAF 5JHDE 3IAQA 3FFCB 5BS0B 2PO6B 2QR0A 2VC2H 1HHIB 4GW5B 4HIJB 3IDGA 4HMEA 5F6IC 1KT2B 3PXJA 2SEBB 1JWSB 4PTTA 4LPUA 3HZVB 4PJCB 1SBSH 5F1NB 4KJPD 3IFOB 3BOVA 4NKDA 2HG5B 4Z7OF 3D39D 3HE7A 3MFFA 4OUOA 3AROA 3UTTE 4AK1A 5I2IA 4N8CH 4UU9A 5IVZB 4L8DA 3REWB 2BVQB 5GGVL 5T5NG 5GS0L 3UAJD 4G8GA 2BERA 3BJ91 5D72H 1AGBA 4UQ3A 3QFJB 3GSVA 3UYOD 5ITFA 5L2KB 3QUXC 4XC1H 25C8H 3ZT6A 3ZSTA 4M6NL 5GS0D 1EPFA 3KNBB 3MC0A 3TEUA 5B8CA 4Z7VE 3FT4A 4KJYB 4JDTL 4PRIA 4IHOA 1G9MC 2QQLL 3I50H 5EO9B 2ZUVA 3O8XA 3TIEB 4X4YA 1E28B 2OBGA 3RY4A 3F7VB 4R6UA 3S96A 2WNGA 4YQXH 1CD1B 4NRZB 3V9FA 2X7LB 1MWAL 4I9WD 1E27B 1M6OB 4KU1A 2DN7A 5E6YA 1Q0XL 4R96A 5CZXD 3SKNB 1FZKA 3L7EA 4TSBH 1JHKL 4L4TD 1M05A 3O3AA 1ZOXA 2DMBA 2JJWA 35C8L 5AZEH 3TWCH 3O4LA 1J12A 4KI5D 2X89D 5BRZD 3ZKMD 1ADQL 4ONFH 3E6HB 3P0YH 3DO7A 1KGCD 1YY9C 1V05A 1C7TA 4XNUL 4YUEL 3BRGC 5CEYA 2P44B 1FNFA 2AABL 5K9KA 3RWIB 4C58B 4JN1H 4JO4H 2DDQH 4HKBA 4FFWD 3D85A 1YNTA 1BZQK 1DVFD 4HPYL 4DFHA 5L9DH 5EU6B 2IH3B 2VZVA 5TQ2H 2IH1B 2CLVB 4EUPB 6FABL 3QUKB 2E27H 2HT3D 2KPNA 2GSGB 3GK8L 4GW4B 5E8EB 5IFAH 1CBVH 5I30L 4XNMA 2EEAA 5JOFB 5M7QA 1BWMA 4P2RA 4AM0B 2AEIT 4L4VE 4XAKE 3ILPB 1IQWH 2OR9H 4KVNL 4LLDB 3BP6B 1EEYB 1CYGA 1SY6H 1MFAH 2C4FT 4FQ1H 3V0WH 1SEBA 1UEMA 2PCPB 4G9FA 1VENA 4OM1H 2DQGH 4U2ZA 5JW3H 4XWGL 5JHLL 4KTYA 3QA3B 3L6FA 4XXCA 4JY4A 2DQDL 2R1WB 4X6CB 2JB6A 1QKZL 2J8UE 1VFOA 5C0AE 3VRLF 4AQ1B 1IARB 1C16A 3QEHB 5GRXG 1UH4A 3SE4C 1X5XA 4AG4L 4G8FB 1NKOA 3P30H 3TJEH 3OTTA 5L2JA 1OGAB 4NPYB 4N9GB 2QKIB 1DQJB 4QOKA 4HK3J 1CU4H 5DC0A 1S9VB 3KPLB 1IL1B 1XCQB 3UBXI 3T1FA 3SDAC 4R90H 4HUKB 4F2MA 4Q9QL 4TVPL 5DYOA 4HAGA 5DUBA 2CUIA 3P9LB 5C0NC 1ZANH 5IMMB 4Y4HC 5DEGA 2HJFB 4DW2L 3OAZK 4ZFGL 4C56D 7FABL 4F33A 2Y7QA 3TCLA 3K2MC 3QCUH 3R4DA 1WZ1L 3GSOB 5E8DL 4APQC 4HWEH 4TVPD 2V2WB 3H0TA 1D9KD 4WHYH 4BJLA 3X11B 2NX5D 1S9YA 5ICZB 3B83A 1FGNH 5D2NB 4FXKB 1TNNA 4NQEE 4FTVA 4P46D 1UZ6F 4MNHB 3FFCA 4JFFA 3UBXA 3QEGL 4HX1B 2DBJA 4XZUA 1UYWL 3W2DL 2SEBA 1JWSA 2EDXA 2FATH 4CMHC 3RWFB 2AV7B 4F8QA 1DFBH 2B2XH 3IFOA 4Z0BH 4PJ7B 3GIZL 2HG5A 3QIUC 4XCYA 3RTQA 1X5LA 3HAEH 4RX4A 1U8QA 4WWID 5GRZA 2AERT 4ELMA 5ENWA 4EI5B 4J8RA 4PS4H 4LEXL 5SWSE 5IVZA 1KTLA 2DQCH 4JREB 1NFIB 1NC2D 4JRYE 1CR9H 1IAIH 4G43A 5FGCB 1LO0H 4QHKI 4M1DH 4I0KA 1MRCL 5A3ID 5CJQH 4XP6L 3VFUB 2VDOH 5T1LB 5L2KA 5ANMB 1S7WB 1MNUH 4JY6A 1ORQB 1RD6A 2ZOKA 4OD2B 3ZDZF 5JORB 4GG6E 1R3JA 1LGVA 1KENL 1SBBA 3DVGB 3EJYC 5IEHA 4HKXB 4Y1AB 3DGGA 3HI5L 4LCCC 5GJSH 2OXGA 3VI3F 3G6JB 5DR5L 3TIEA 2YD7A 4LFHG 2AJSL 5CBAA 1B2WL 4N0YH 3HMXH 3MV7E 2FGZA 2D7OA 3ZHDA 5C0CD 2WLZA 3LOWA 3NOIA 4N5UA 1E27A 1A6UH 4X8JB 2RB8A 1M6OA 1JHTB 3SKNA 3WDJA 3ARFC 1MREH 5CEXA 3V6FB 5LGHH 4N9OB 4ZO6A 4X6DE 1IVLA 1EFQA 2ZG2A 2YEZB 4P5KB 3UTQB 4PJ5A 5LGJB 4LRNH 3EYUH 3L3DB 4DOHB 2VLRD 1KIPA 3GHBL 2BFVL 2EICA 5IBTH 3KJ4B 1UKTA 2DQTL 4MNQD 2IMNA 3RWIA 1W0VB 5IB5B 4KKBD 2OP4H 3UTPE 1BZ7A 3ZLQC 4Z9KB 1R0AL 5AWNL 4NRYB 4JFZH 2J88H 1ZXQA 1GGIL 3NCYP 3LQAH 2FLRT 2CLVA 2QV2A 4PJHB 2F5AH 4LSPH 1XR9A 1AGFB 2HAZA 3QUKA 2F58L 5E2TL 2GSGA 1RZ8A 4N0UE 4GW4A 3U79A 5F9JA 5JOFA 3HPLB 2VDKH 3CFDA 4HH8A 5M95B 4P2RE 2D9QB 2BC4A 1MIML 3ILPA 3PGFL 1EEYA 1ZLSH 4F3FA 4OJFL 3QRFM 1VPOL 4NN6B 4EDWL 3HUJB 3BEVA 1SJHA 3EOAB 5J12C 4JDVA 1I7RB 2JJTC 3GHEL 4NJ9L 4LAQH 1LO3L 5FOJA 4MAUH 4PLKC 1UM4H 2Z0BA 4D9RD 4QRQB 2R8SL 2J4WH 4OSUL 3CK0L 3UTZB 5EBGA 3BKYH 4G8FA 1GGCL 4J3XA 1N7ML 1VFMA 4DGYL 1OGAA 1XGQA 4PGZA 1A6AB 4NPYA 4KMTH 3NIDF 4YFLI 4I0PB 2P24A 1S9VA 3KPLA 4JFXA 5E1AB 1XCQA 2R1YB 5IGXH 3CXDL 4ZUUA 1XF3B 1OAUL 1HKLL 4OZGF 1FSKC 3QIWB 4XVSL 3M1BA 5FYLL 1U3JA 1TJGL 2UV3A 3IVKB 3GMPB 1WJ3A 5C0FB 5IG7B 3QHZH 1F90H 1BLNB 2XNAB 3MROB 3UBXG 1NC4B 5H35A 1MCPL 3V52H 2BOCB 5IB3B 4G6JL 1P4BH 1EZVX 1U92B 5ADPH 4M5ZH 2V2WA 5EU4B 3NABH 4K71B 3O11A 5FYLD 2EYSA 4QGTA 4XVUD 2E7LC 1KOAA 2AJYH 4UDTB 5D2NA 3IDJB 3TO4D 5FUCE 3QPQC 3FQNB 4FTVE 4XP9H 5JW5B 4DUWA 3EFDH 1XF4A 4JFFE 3TN0C 2NY6D 2FECI 4KUZH 3RWFA 2AEPH 4DN3L 5CGYC 4N0FA 3O0RL 1QRNB 3NIGE 4JPKL 2DMCA 4UINH 4B53A 4E42B 3FZUC 4LNVA 1ZVHA 5D2LF 4HIXL 1IZJA 3HC0A 4X5WB 2X1WL 3F12B 4R3SB 4E0RB 3VJ6B 1YQVH 4ELME 4JO1H 1KTKE 5GSVB 3P4OA 2DM4A 2OSLB 3L3KA 4Y5XC 2VLJD 1M7DA 3QWRA 2Q76B 4U1NB 4PBXA 2ZP0T 3MRLA 1F4WH 4HT1H 4R97C 5DJXB 2YSSA 4M00A 4NP4L 3OR6B 4BQBA 5T1LA 1MJ8L 1DANU 3QG6B 1S7WA 4OD2A 3DSNA 3KLHD 2BOBA 3S7GA 3DVGA 1MCNA 5EA0L 3ARYA 2FX7L 3BQUA 5GGTL 5FGRA 4Y1AA 3BGAA 4R4BA 2OZ4L 3PUCA 4DKFH 3RVXC 5E2VL 2NY4C 2NY0D 3FQWB 2XWBB 3BIBX 1J88A 5T3XL 1J1PH 1ZGLM 4F7PA 3VMNA 1WAAA 4PRBB 1UM5L 3U30C 2BNQE 5I71B 1PG7W 3P9MB 3IAGC 4D9QD 3HKFA 3VG0H 4M7KL 5HHOB 2EIDA 4QRTB 4MJ6B 1G7IB 3DETC 5E6IA 5HDLA 2QEJA 5C09B 3QO1A 4Y19D 1Q94B 1SMOA 2WLYA 1ZA3B 5T3XD 5D7JD 5TE6L 1Z2KA 3BKJH 4JKMA 2QADB 1I7ZB 1O7SA 4K3EL 1B0RA 2YOCA 5HI5D 3UTQA 2BSED 2WBKA 2LABA 3L3DA 3RWJB 2Q8AL 3WEXA 1T3FB 3U82B 1V7ML 3NIFE 3BJLA 3O9WB 3PHQA 4MA3A 1CGWA 3MRKB 4LVHC 2VZSA 1JNHB 3THMH 4NQXB 1LQSR 4XPFH 5L6YH 5TFSL 5EULV 4K2UL 5L7XH 4EOWL 1MELA 4YPGB 4P3CH 1A7PL 4L3AA 4Q6IB 3BD5A 1U8IA 4LVNC 2CMRH 4RWHA 4G80B 4YBQD 3QI9D 3GMRB 2FR4B 5C0BA 3DECA 2V9QA 3FQTB 4W4OC 4X7FC 4OV5B 3SJVA 2Z92A 3STLB 3LZFH 1FVDA 1JPST 1CDGA 4J2XA 3NVQA 4MLIA 5CKGA 4X7SH 5C08D 2DD8H 3LKSB 3HUJA 4FFYH 4ZO7A 2NXZD 3IU4H 2GJ6D 2CD0A 3H6JA 3VU2A 1RZJL 5E8OB 4XTRD 4YHKH 1RURH 3D3VD 4PRPB 4HUUA 4Y8AA 3RIAF 4LOUC 4Q2ZA 5FGSA 5EOQH 5IW3A 4OCRL 4XGZB 4P2OD 3D0LB 3NCFB 4NHCL 2EXYD 3UTZA 4Y4KC 1U8JB 1OB1A 3VFNA 1QACA 3R0NA 2V7HB 3S36X 1H0DA 1GZPA 5BJTB 1V3LA 4TUJB 3UTSE 4LKXB 1I1AC 1B0WA 1BJ1H 2VO5A 4LEOB 2HWZL 1GHFL 4M62H 3OGOE 1FRGH 3ZKNC 3TYFB 4NO0D 3X14B 2XNAA 1CFVL 2BSRA 4JEGB 2BOCA 1NMCB 3NCJH 4K3DH 1CL7I 5DRWA 5JXEC 1PKQA 1T20B 1U92A 2UYLB 1KIRB 1U58B 1RUKH 2J5LC 4RMSA 4WFGD 5C70A 4S11A 3A6BH 5FYKU 2N1KA 3O4OC 2BK8A 3ES6B 2ZKHH 5DMIL 2F5BL 3DPBA 4LCYB 2ZPKL 4ZXBD 3O3BB 3VXNA 3DROB 3NGBB 4GMTH 4BSWB 5ABDE 1YNLL 2WUCH 4GRLC 4OFKA 1TJIH 3KYKH 3MJ9A 5KVMC 2WWMC 4Y16D 4J7RA 2WBWB 1F4AA 1RFDL 2VABB 4MXVF 5GHWL 1Q9KB 1HINH 5T1KB 4V2CB 4WVRA 2R0WH 3KWWB 3F12A 2JELH 4GKZB 3VJ6A 1EHLH 2IMMA 4ZUSB 4OT1H 2OSLA 2AK4D 4F57H 5F9WB 4ESKA 1B4RA 2Q76A 1TFHA 5D1XD 2O5YH 5ACZB 4U6TA 2WM0A 3BAEH 3UPAA 4KROB 2XA3A 3HA0A 1XGRB 2XPGA 1M71B 1ZHNA 4PV9B 3T4YB 3T2PA 3UC0L 1QFWH 3JWOH 3PL6D 1VADB 4LSQH 5FM5M 3ABZA 3ARRA 2YPKA 4LSSH 2P7TA 3SDAA 3I85A 3GRWH 1R5VA 3IRZA 3SDDD 3WMSA 4LSVH 3S8WA 2OTWA 4R2GD 5HGGS 2WBJC 4J3SA 4E5XA 5JR1H 1EVUA 1WAAE 4ODXA 3S34L 3RIFF 4LLUB 1Q1JH 1W72L 2I5YH 1F97A 4XHJD 2RCSH 4OD3H 3EJZC 4MJ6A 5HHOA 4OIBA 5C09A 3BVNA 1FFOA 1E6JH 2MQ3A 2ESVB 1TXKA 1Y6NR 2OYPA 1ZA3A 3WUWB 1KIQA 1I7ZA 1RVFL 1JNNH 4Z7OE 1FN4A 2Y6SD 3GKWH 3HNTL 4JZNB 4M1GH 3JWDC 4P4KC 2HFGL 5I75C 2Q87A 2XY2A 4PJ9B 2BJMH 3W9EB 1B6DA 4EN3B 1SYSA 4JFEA 1KIUA 5I8KH 3KPRD 2OMNA 2H2SC 5K33A 1IM9A 4LVOC 1PYWA 3Q1SL 1DQQA 4YPGA 1FIGH 1ZK9A 5AD0A 3GJFK 2NY7L 5GRVK 5HXMA 3PV7A 2C1OB 3D9AL 4G80A 3CFEB 1AR2A 1JPGB 3GMRA 4DZBB 2FR4A 1WC7A 2XWJB 5C0BE 2V17H 4OV5A 5CFHA 2CRYA 1RULL 3SJVE 3STLA 1F3RB 1ZT1B 3OB0H 3LEYL 4NQCB 3BWAB 4ONGL 5E9DD 3SE3C 3KPSA 4O02H 2J6EA 2C3XA 2DYPB 3S37H 2XKUA 3ZKQD 1QOKA 2DLFL 3RA7H 4H8WC 2B4CH 5KW9H 4M6OL 4IBLT 2CRIA 1HSBA 2AW2A 4HFUL 5E8OA 1UXWB 3DARA 3ZO0A 4C59B 4K23L 2IPTL 1VGKB 2ILLA 3OKOA 4ZS6D 3EIFA 5IFHH 4QY8B 3GO1H 1OAYH 2J8UB 4BK4A 4H25A 2CKBH 3D0LA 1XF5B 4PREB 1I7UB 1P2CA 1B90A 3DNKA 4PGJA 4Z95L 4HJ0C 1MQKH 1BFOB 1NGYB 5JUEL 5BOZG 2A6IB 1QQDB 3ARTA 2V7HA 4ONHB 1IT9H 1EHNA 1CS6A 43C9A 3CD4A 1TLKA 1B6UA 4F58L 1YYLL 1DJSA 1NJ9B 4PY8J 3QAZC 5F1OB 1ZLVH 4TUJA 5T5FL 1RUQL 4PJAB 4JFYB 1IQDB 4LEOA 5GIRA 1TVHB 2QQKL 1T5XA 1G6RL 5FHAL 1WCBB 1NCDH 3X14A 3OAYH 4GG8B 2VLMD 1YEFL 4FQXD 1K5NB 4ZAKD 1WIOA 1CGSH 2BX5A 4JE4B 3V6OC 1PKQE 3NFNB 3SDXF 1U58A 4WTZA 3LN9A 4KTEH 1SBSL 5A16A 3U7WH 1AC6A 3RVVD 1BBDL 1HSAB 2DL2A 4LCYA 5IT2H 2V2XB 1S7RA 2YRLA 3O3BA 3IKKA 5CJOH 3T1WA 4HLZH 1BVLA 4M6ML 5LCVL 3ARSA 5FEBA 5FECB 3QXAA 5I18H 5ALCH 4UBDD 5CJ8A 1OW0A 1Q9KA 5D71H 3EJJX 3W5MA 1UENA 1KN2H 2YD6A 5D72L 3VW3H 3KWWA 2D7MA 4P23B 1B3JA 2QHLA 4ZSOE 4CU6A 2W65A 4GKZA 3C5SB 2JJTA 3ZZ1A 2GAZB 4Z76A 4ZUSA 1FQ9C 3SQOL 5SWSB 5C6WH 1KF9B 2MCG1 5E03A 1G9NC 2GK2A 2PYFB 5DO2C 3T2NL 4C57C 4KQ4H 1OF2A 4IM8A 1AXIB 2P47B 4QCIB 1FDLL 5MI0C 1U95B 4OZGA 4NUJA 3HG1E 1G9MH 1YYML 4HS8H 1UWXK 1XGRA 4JQVA 2PW2A 1R3IL 3SO5A 4PV9A 4QEGA 3MRPB 4YQXL 1CLOH 4R4NC 4FQPA 1LVEA 4LQ1A 1TCRA 2AJVL 5GGQH 4KTDL 4O5LL 1KC5H 1P5VA 1FC1A 3CSYB 1KTDA 3K74B 1NGXA 3X3GH 1RK1A 4K7FB 1D6VL 2C1PB 4ODBD 1AE6L 1UZ6E 2FZ3A 4FRWA 2XOTA 1D5MA 4WHTA 4TULL 3MV9D 5CAYB 4UOW0 3MRIB 4DJMA 3AY4C 4Z78B 3WIHA 1IC5H 1N0XH 3S35X 2D31B 1WF5A 3G5XA 2CK2A 4JO4L 4A2LA 2DDQL 5EO1B 1T4KA 5I8CA 3L5WA 4FQHA 4PRHD 3CNKA 2YBRB 5D2LA 4KDVA 1ZVSB 4ENEC 1H3PH 5C0JB 2HH0L 4OFYD 1YUHB 4PJ9A 4NCC2 3MLTB 4H26B 2E27L 3W9EA 1FVCA 4WU5B 2R56H 4YC2C 1Q0YH 3MJ8B 1U2CA 1QEWB 3TPKA 3ZDXF 4PJEF 3C6LC 4OZFH 1OWRM 2OR9L 4P48A 3W0WE 3B9KB 1R24B 1SY6L 3BUTA 3V0WL 5JZ7C 5IB1B 2HRLA 4D0CB 4XVJL 1BGXH 2C1OA 3ZDZE 4DZBA 3NH7L 3STBA 2P5ED 1X5KA 3FO0H 3FT2B 1F3DJ 1SVCP 3C60D 2XKNA 4KDTA 4N0UB 3VI3E 3GJEB 1ZT1A 4ODWA 1N2RB 3QNYA 3ZTNH 4Z8FL 3IDXH 4NDMA 5BMFL 5JMRA 2B5IC 1KPUB 4YDJA 3MRDA 4WUKL 4X6FA 2YMXH 4P57B 1AQKL 4PJGB 3T08A 3TJEL 2DLEA 1X5YA 4NQSB 4X4XB 4U2YA 1DLHA 2X42A 3BZFB 4PBWD 3MODH 4QY8A 4RWYH 5J6GA 4OD1L 2I25N 2GJZB 2YUVA 1MJJA 4GXUN 4L4JA 1ERNA 4PREA 4TPRL 1I7UA 3JVGC 1OAKH 1BPVA 4OLUH 1ZANL 1UB6B 4Q74A 1BFOA 2EYRB 4J4PA 4X6BA 2ZOLB 2JB5H 3Q6GH 4DVRL 3U6RB 3OPZH 1JI2A 4ORGB 4V2BA 4F7EB 4ONHA 4ORZC 2YK1L 4WU7A 5SX4H 5I8OL 4HWEL 4WTZG 3ZYJA 5TPWL 2I9TA 1S7SB 3WD5H 3FT3A 3IGAA 1NDMB 1IEBB 4EBQL 3QQ3A 4JO2L 1PLGH 1F13A 3QH3B 1ZLUH 1OPGL 4GG8A 3H9HA 1K5NA 4YNYB 1MFCH 4KJPC 5GRVL 1TZHB 1KJ2H 4IMLA 5IMKB 1KLFA 2ARJB 1GL4B 1UQSB 3L5JA 1KPRB 4XPAH 1FFPA 1FG2A 1G7QA 1HSAA 2XXMB 4Z7UB 3S4SB 4YIQB 2BVPA 3WSQH 1MUJA 4G6FD 1V5JA 2ADFH 1S5HB 1JWMB 3ULUF 4K94L 3UAJC 1FYTE 3U0PA 4G7VL 4GRMB 2FD6L 4BELD 1IAIL 1U3HB 2L0DA 4WUUE 3U36A 1WBXA 5D7IF 1Z9MA 1RJLA 2X4RB 1G0DA 5EIVA 4M1DL 5E2UL 3X13A 5CJQL 3RNQA 4AJ0A 4P23A 3K8KA 1GCFA 4PY7A 3O6FB 3UYPA 4UTBH 2RR3A 5ILTH 2EDEA 1JHLL 3GSWA 3S36H 3RDTB 4X4MA 3ZE2E 1TZIA 2XTLA 2Z93A 4MQXD 4PJFF 4YGAB 1AJ7L 1XGYL 4H88L 2BY1A 4KK5D 4YK4B 5DK0A 5EBWB 5ESAA 4R8WH 4J3WA 4OCMC 2AQ3A 4WEMB 1DN0B 1CXEA 4D3CH 1NCBL 9CGTA 4N0YL 4TUOB 5CUSH 4XPTL 4YXHH 4YHML 1H15B 5CZXC 3FQUA 2OCFD 4CU8A 4XX1G 5JA9A 5KAQG 2XZCL 1URLA 3R1GH 4M1CD 4XPBH 4KI5C 3ZKMC 3MV8A 3KJ6H 3CSYA 1RIUH 4WFHE 3C8KB 3VGAB 4K7FA 3DVIA 5T1MA 1UB5A 4LRNL 3VFTB 2A83B 4LLMB 1WWCA 2MCPH 3MMEB 4JGJA 4JPWH 1CFBA 2WWKO 2AS5M 3MRIA 4KI5F 4MYWB 4FFWC 4UILL 3SKOB 1MCCA 3G5ZB 4U6VH 1N8ZB 3QIBD 3LB6C 4JG1H 4IDJL 2YBRA 5INDA 2GT9B 5F7FA 2O5XL 1JRHI 2HT3C 2C3VB 3EOBA 4LHQB 4NQED 5E08H 2P8MA 3BPOB 4RGMC 1I9JH 4H26A 4P5MA 4Y5VB 4WU5A 2YUXA 4ACPA 1MFDL 4HIHA 1BECA 3CDFA 1Y0LB 3LAFA 1JMZA 1WBZB 4JFDE 1PY9A 3M8OL 2CDGA 5EZLB 3V4UL 5IIEB 2IAMC 1AQDA 4QHKJ 1FBIH 4OAWB 3BZDA 3HE7D 5FKAA 4EIZC 5DD1H 4QRRB 1DBML 4S2SA 4JGUA 4XBPB 5CIPB 5IVXB 5JLZB 3FT2A 3O2DA 4LHUB 3LD8C 5I1GH 3EDFA 1YEDA 3GJEA 5F1KC 1X7QB 1JGEA 2O26U 1T2JA 4G8GD 4YHNB 1DN2A 3AREA 4U1MB 5J1AB 5CSGA 1LE5A 4YDIL 4L3CB 1XCTB 3WO3B 1XAUA 3R06B 4PJGA 4RMUA 3N9GH 5ID0B 4KMTL 2I27N 4AL8H 2EKJA 4NQSA 5KS9F 4X4XA 3SGEH 4E41E 1VGEH 4P2QB 1RZGB 3FQRA 4ETYA 4XXDB 4PRID 3RL1A 2XA8L 3L3OB 3MBEA 3O8XD 5I17A 1F6LL 2VOTA 2VLKB 4BUGA 2W59A 3CPLA 2EYRA 3G6DH 2ZCHH 2ZOLA 3DRQA 4PGCA 4X0KA 4RBPK 3U6RA 4XH2A 1SEQL 4I5BA 4ODUB 4ORGA 1A7QH 3AUVA 2JCCF 3MGTA 1D9KC 2FIRT 1YMME 5ADPL 4M5ZL 4W6XB 1S7SA 2KBGA 4KI1A 1JTTA 1NDMA 1QBLL 3E1F1 2K3TA 3NZHH 3QQNA 5HYFA 1WV7T 3RGVB 1FZMB 3HI1A 1OAXH 2ICWB 3UTSB 5BXFB 5HHVL 3O4LD 1R5WA 4LFHD 3QWOB 1E4KC 5EC2A 1A3LH 3SE9L 4QHLB 3TFKD 4YNYA 1HHKB 4DKEL 4RFOH 1IKFH 1H8NA 5FB8A 1YY8B 3D2UA 2AEPL 1TQCB 4MWFB 3LS4H 4HQQH 4NRXA 4PJXE 2DQEH 1GZQB 4K8RL 1UQSA 1X6NA 4YDLB 1FLRH 1KPRA 4XPHH 4Z7UA 1T0NB 4POYA 3S4SA 3D85D 1YQVL 4YDKH 3GMQB 1CT8A 1S5HA 1RUPH 4K8RD 1U3HA 3GSQB 5EOTB 2GTZA 3CFJB 3ECBB 4ZTOL 3LCYA 3FONB 3MTRA 4P2RD 1BIIB 3KS0H 3C5ZB 3W11D 5D96C 3RZWA 4NZRL 2MHAB 4MVBD 1JK8A 2FX8H 4G9FD 2YUZA 3BYTA 4U1JB 1KSRA 2DLHA 2XTJC 4X4ME 1A1MA 1YECH 1YC8A 5E70A 1N26A 2EDBA 3FN0H 3SGDI 4NFBA 3PGCB 4DKFL 1EXUA 3EYSH 3P73A 4XCFH 3SBWA 3HE6A 3VD5A 1KB9J 4AEEA 4XP4H 4XVTH 1NCCH 1YMHA 5MERA 4LCWA 2E7HA 2ITCA 4NN7B 4O51A 3U9UA 1H15A 1K85A 1BM3H 2X4PA 2KH2B 4LMQE 4UV7H 4RFNB 1BD2D 3KYMB 3SDXA 3OB8A 4OUUA 4QOKD 2CKBB 3MV8E 5I19L 5D9SB 5I73B 3KHQA 1N4XH 1CGTA 2EDHA 3TJHC 1QZ1A 1I85A 1EO8H 1ULVA 3DX7A 3JUYA 1A9EB 3JTTA 3V6OA 3MMEA 1S7UA 3RL2B 1ES0B 3BZ4A 5IWLC 2PXYB 3DX6B 2AVGA 1DL7H 1IGTB 3P2TA 5TDNB 1HILA 3T0EB 4WO4C 3THML 2AXJA 2Z8WC 3SKOA 3G5ZA 4H1LH 3EZJB 3MX0A 3U9PL 1KXQE 5L7XL 1U6AL 2UZIH 3UX9B 1UJ3B 1C5CH 1LD9A 5K9OA 3I9GH 2CMRL 5I6XC 5J06A 5IJKC 4FTVD 4Y5VA 1CDIA 3VDCA 3FKUS 3FFCD 3GMMB 1Y0LA 5HGHA 4U3XA 1NH6A 4K3JH 5DT1H 3QQ9D 4YZFF 3LZFL 2ITDA 1QYGH 5IIEA 1DBKL 5CEZL 1U3ZA 3EYFB 1WWAX 1VCAA 4MDIB 3MLRH 4HUWB 5KJRH 3RTQD 4ZS7H 4QRRA 4RX4D 4FNLH 3BRDA 4G6AD 3MOAL 4XBPA 5CIPA 3DV6B 1U8NB 5JLZA 4XBGA 4LHUA 1RURL 4MJIA 5BVJB 1L0QA 5CEZD 3CX2A 4JHAL 1IAMA 3DVFA 2F54A 4IRZH 4NQUA 3ULVL 3QUXB 3TC9A 4L3CA 1P4LA 2J8HA 5L2KD 2N7AA 3CLEH 4NZJA 2R9HD 2XN9B 4PV8A 3GMOB 2ICWI 4M7LL 5ID0A 3KPPA 4RGNB 3W82A 1IGFH 3WHXA 1NFKA 4KRPD 2W91A 4JPIB 5BO1L 3TNMA 4NFDA 5HJ3B 3ULVD 1NLDL 1H3UA 1S9XA 3C2AH 2JJUA 3CDCA 4WRLA 4RMTA 2XACC 2XFXB 4WY7L 2VLKA 1I8IB 1HWGB 2BMKB 2LVCA 3AY4A 1KB5A 3MNZB 4WDIA 5E1HB 3OKLB 3FB6A 3KXFB 4XVUC 5B4MD 5CHNA 3EYVB 3MRGB 5AYUH 4M5YH 4PJEA 3TO4C 3A6BL 2ED9A 3AB0C 4Y7MA 1FZMA 2ICWA 1D5ZB 3MLUH 4QHMA 5BXFA 4OLZH 3IJSB 3S4SG 4LSTH 4PJ5D 2NY6C 4RAUB 4MHHI 3UZVB 1HHKA 3I02A 5D7LB 3NFPA 1DDHB 1TJIL 1RU9H 3MLSL 4NWUL 4H0GA 4Y5YA 4OIIL 4MWFA 3C6LA 1EJOL 1GZQA 3RFZC 1HINL 1IAOB 2D3VA 2R0WL 1XR8A 4JQIH 4RNRB 4I3SL 1ZT7B 1CE1L 1T0NA 5HVFB 1EHLL 4U7MA 1NCWH 2DKSA 3RPIB 2VAAA 4LKCB 3MUHL 3Q3GA 1NUFA 3PWJB 3ROOA 1OSZA 2IPUG 3T4AB 2IFGA 3T0VA 4Z5RB 3CFJA 3ECBA 4RIRB 4LDLB 3GM8A 4F9LA 1JZ5A 5E94B 1XGUB 3ZT5A 2VZ3A 1FNAA 1P7QB 1NAMA 3TBVB 3C5ZA 5CMAB 2VN4A 3KLHC 5CZVH 1T6VN 1ITCA 2FJGB 4ZSOB 4U1JA 1JWUB 4HD9A 1EVTC 4XCNB 3BISA 5LVEA 1FVEA 5DS8B 5GGRA 3HNSH 5DMGD 2HN7A 3PGCA 1F58H 1FG9C 5C6TL 5ICYB 4GXVH 4CKVX 1P4IL 1D5IH 1FGVL 3OG6B 4G6KL 4ZDHB 5HI3D 4LP5A 1N5YH 4NQVA 5IQ9B 2CK0H 3BW9B 4HF5L 5LJYH 2IJ0C 4QHUB 1BMGA 4X4ZA 2Y1VA 3I2CH 1FCCA 1EEZB 3H9SA 1NDGA 4LCWE 2I5YL 4PJ8B 3MGOB 4YXLL 3E2HB 1QSFE 2YPLB 1C08B 4JZJB 3S3JA 4AT6B 3KYMA 1OGAD 4CW1B 4YHOH 3SDXE 5E24E 2VXQL 15C8H 2YUWA 3H8NA 1LWRA 3PHOB 3LN4B 5DD3L 1NCNA 5HI5C 3VFWB 5D9SA 2WSKA 3MO1A 1JNNL 5FGBC 1YEJL 2NW2B 1A3QA 2GIYA 3QHFH 3QP3A 4MXQC 3BWUC 1ODAA 1XH3B 3KPTA 3IXTA 4M7JH 3JWDH 5IUSA 3V6OE 1ES0A 2PXYA 2CDFB 3O2VH 1IGTA 3BT2H 4APQB 2VB5A 5D7IA 5EZIL 3CC5A 4CN6A 4LRIC 2MFNA 4MGXA 1PEWA 2AV1B 1GAFH 3VXRE 4OCXH 4HBCL 2ZUWA 3IJYB 3NTCH 1JTPA 4U1HB 4YBQC 1I8LC 3QI9C 1BZ9B 1CFQA 4X9BA 4QXTB 2HKHL 5HYSB 3BO8B 1KJ2B 4LHUG 1SQ2N 1Q72H 4NJAH 3WFEH 1M1SA 2EIZB 4MCZB 3F6IA 5DF0A 1KJ3L 4J23A 3HLAA 3AM8A 4LNRB 5I66B 1XZ0B 2NXZC 3V8OA 4U33A 1CD9B 3EYFA 2VDNH 3S37L 4YX2L 5GGSB 2R0LL 4HUWA 1LEKA 1ZMYA 3SKJH 4HIIA 5C0RH 3QEQE 1OAZL 3DV6A 3DXAA 1A0QH 4M4PA 2VUYA 3ESUF 4Q6YA 4B0MM 4H8WH 3O6KL 4MJIE 5C0DB 2FECL 3QWRD 4NUGH 2DWDB 1A3RH 2IWGA 5IFHL 2EXYC 3LQMA 1OAYL 1RZJC 1CCZA 3VXQB 5ITBH 2F54E 1BFVL 5T1LD 1NSNH 5H94A 2XN9A 2VDLH 3GMOA 1INEL 5FYJE 4OFVA 5E2WH 4P3DA 1JV5A 2DBLL 1A1OB 4N8VB 1BAFL 2G75A 4LCCB 3H3PL 3BQUD 5EN2A 2A74B 1CDCA 2WWKT 4Y1AD 1I4FB 4UT6L 3MA7A 1E6OH 3NMEA 3MLPA 2XFXA 3BH9A 2O61A 1YEEH 4TVSa 1RQ5A 3IFLL 3OKLA 1K8IA 5F6HI 3KXFA 5I76B 3GI9H 1G1YA 1RMFL 5E6ID 5FA3A 3P4MB 1CG9B 5FDWB 3ZDXE 5L8KB 3U7WL 5HYJA 2D7QA 3CFCH 4MAYB 4ZXBC 3FRUB 2XY1A 3LEXA 3RWGB 1N59B 3BKCH 5CD3B 1A9BB 4DCQB 4DAGH 4RAUA 2OR7A 4X80L 4Y16C 5EU5B 3BXNA 5D7LA 3TVMA 1DSFL 1A2YB 3EYQD 3MV11 3MJ7B 3QDGB 5I18L 5F3HA 2IAMA 4WCYH 2NR6D 1SJEB 5HHNB 1CLYH 5ETUB 4OGXL 1KN2L 4MA1C 4MHHG 1LO5B 3IKCB 4DN4H 4LKCA 2Q7YB 5D1XC 3T3ME 5KS9A 3PHSA 1QA9A 2APTA 2YD1A 4PR5B 3T4AA 3T77A 3ARGB 4Z5RA 1MCWM 2BRRL 5CP3H 1FYTB 1WVZA 4RIRA 4KQ4L 1G9NH 1S5IL 5LWYL 3SJVD 3IF1B 5E8NB 5EPMB 3WNNA 3UO1H 1G9ML 5ESQB 1QLFB 2CO6B 3TBVA 5DEFB 3QUMB 3PL6C 4HUVB 2FL5B 1RIHH 3D69B 2O5ZL 2FJGA 5J12B 1JP5A 1YNKH 4LLWB 3BGMB 1F11A 2JCCA 1ED3A 1B0GB 4XCNA 3SDDC 4GUPB 4BFIA 3OGCB 1BIHA 1KCSL 3F7YB 3IRPX 3R8BB 4R2GC 4X5LA 4CVXB 5IB2B 5FYJH 1KCVH 1ACYH 4Y4FA 1OP3H 4XP5H 1OVZA 4OZIF 3V2AR 3ARWA 2DTMH 4FQQB 1DUZB 1VFAB 4Z7WF 3GBNL 3WNLA 4JHWH 3H9SE 5I1LB 2YPLA 3CCHA 3EO1A 1C08A 4XRCB 4ZUVB 1FCGA 2V9RA 3BYYA 4I48B 5I15L 2ZSVB 1N0XL 2Y6SC 3MNVB 4CDGC 1JPTL 2DLGA 1FSKB 2NW2A 5FO7A 1IBGL 1E4KA 5BQ7B 1ETZB 3GSRB 3QIWD 4PJBB 3OV6A 2KUTA 3HC4H 1XH3A 2Y9RT 4DGIH 3EO0B 5DHVB 2W0FB 5MP6H 1A7OL 1MCKA 3MYZA 1T0MA 1YN7B 3WXVL 2R56L 3D39E 5D7IE 1J8HB 2DICA 4MNGE 1JGVH 4QTHA 5EOCL 3REVA 1LMKA 3MJ9L 1NC2A 1YEKH 2CLZB 4HLZG 5BV7B 3IJYA 1K3IA 4U1HA 3BP4B 3IXAA 3SY0A 4YHLL 1BZ9A 1LILA 4QRPB 1BGXL 4C54A 3JBG7 3MUZ1 3JSSA 5HYSA 4V1DA 3S88L 3QHTC 4UT7H 3OKNA 4L9LA 5KVGL 1DEEB 4L8BB 2L4OA 3PWVB 5E5MB 4PJFE 1UACH 2YD9A 3V5KB 4JFDB 1RPQA 2GUOB 4LNRA 4KZDH 5FCUH 2KQNA 4YPJA 3ZTNL 3ZKSD 4OCSL 2JLLA 4BSVB 2IANB 5GGSA 3TYGH 1B9ZA 4MA7H 4AENB 2XT1B 2FSEB 2B1AH 3VXUB 3DXAE 4ZS6C 2OS7A 3GSXB 2P8PB 4CJ1A 2Q86B 1GGBH 2P1YA 5DK2B 2DWDA 1E0OB 2QSCL 3QDHA 3FB8A 2V6HA 4JAMB 4I9WE 1AGCA 3HPJB 1I3GH 2DTSA 3TLRA 1OAKL 2E9BA 2EE3A 4MZ2A 2EDJA 3VH8A 4P59H 4KY1H 4UIKH 4L4TE 4CUCA 3OPZL 3S9DB 1CLCA 1INDH 6CGTA 2HTKD 1NGPL 1I3VA 2A9NL 4KI5E 2NY1D 5BRZE 2A74A 4BQ9A 1I4FA 5F7MC 4D0DA 1PGRB 3MACH 3Q5TA 2NY4B 4KK6C 3G6AA 3VXPB 3H7LA 4JLRB 3QJHB 3P0VH 4YDVA 4FQXC 4KAQH 3PDGA 4ZAKC 1HQRA 3U30B 4XCCH 4N1CA 1CZ8H 1CXKA 2N56A 3P77B 4WO4A 3TBYA 2DLTA 5HHOD 5I76A 3PNWB 5C09D 4M8QB 3RVVC 1Z9SA 2NTFA 5FDWA 5JXAL 2NXYC 3O3DB 4F80A 1NFDF 1NANH 2C5DC 3MXWH 4DZ8B 5HYJE 5EUOE 1G7PA 3KYOA 4XPAL 3N85L 3UJJL 4MAYA 3FRUA 3ARBB 5HGAA 5IJKA 3L3HB 5TE4L 3PABB 3PG2A 3WSQL 1A9BA 5E4IA 4DCQA 1LK2B 5FYJU 4L8CA 2ADFL 2E7BA 5CSBA 4UBDC 3FQXB 4H1LB 1A2YA 3GBML 5J9PB 1HYSD 3FO9B 2KQMA 4I0CC 4JFED 4I18B 5DLMH 1SJEA 4HS3B 3G5VA 3OKKB 4PJXB 1IM9D 4RQQA 2R23B 1EO7A 2JJSC 1IC1A 1KELL 5HDQH 5GGVH 1LO5A 3U2SB 3IKCA 4ZNEE 1DBAL 1WFUA 1AXTH 1UH2A 4WWKB 5GS0H 3MZGB 2VWEC 2J6EL 3SCMB 4CADA 3GB7A 3O3UN 1ZHKA 1YZZA 5E8NA 4R8WL 2CIIA 3FN9A 4M6NH 2D7PA 4JANA 5ESQA 3K4AA 3DUSB 4D3CL 2AEQL 1X4XA 5J0BA 3KPSD 2BHUA 3ZTJH 3QUMA