4LFHG

Crystal structure of 9c2 tcr
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
229
structure length
222
Chain Sequence
GTKSVTRPTRSSAEITCDLTVINAFYIHWYLHQEGKAPQRLLYYDVSNSKDVLESGLSPGKYYTHTPRRWSWILILRNLIENDSGVYYCATWDRYKKLFGSGTTLVVTDKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWQEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEESLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 9C2 TCR delta chain
publication title CD1d-lipid antigen recognition by the gamma delta TCR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 222
sequence length 229
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lfhG01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lfhG02
1FNEB 2JK5B 5IFJA 4X4MA 1C5CL 3MUGB 3UEZA 1U0QA 1R3JB 4E5XB 3EYUL 35C8L 5HYSA 3S97C 4BH8A 4NRXA 3PF2A 4EUPA 2E6QA 4XAWL 5H35B 4FXGB 2XRAL 5DJXA 5ABDE 2XV6B 4PJ7B 3WEXB 5AWNL 4LHQB 3HI6H 1NGQH 3S34L 4KMTH 1WBZB 2PYEB 1VA9A 2E8YA 1AD9A 4QXGL 1IC5H 4IRSC 4QXTB 1S7TA 1MCPH 3BT2L 5KSBF 4JM2C 4BSVB 3NFSH 4KJYA 4MLIA 4ZS6D 1UWXK 4DGIH 1N0XH 4ZTPH 2DKSA 1GGTA 5F88B 4V2BA 3QRGH 2GSGB 3K3QA 1CDUA 2ZUUA 3VE0A 5FYJD 1D5ZA 3MLUL 1T2QH 1KELL 1ODAA 5D6CB 1CICC 2XQBL 1MAJA 3TYFB 1CXEA 5CWSA 1F4WH 1U3HC 1J0YA 5F8RC 5FHBH 3GJEB 5JUEL 4NN7C 1AO7D 1J5OH 2Z4QB 4V1DA 4B50A 4G6AD 1OGAB 3CPLB 4WI8A 1U8OB 1UYWH 2P8LA 1NFDE 4PGBB 1DP0A 1TJHL 3QDMA 3T65A 4BFBD 2MCPH 1EZVX 3ARBB 3WSQL 3VD4A 3SE8H 1GH7A 4LDEB 1WCBA 3OAZH 1I8MB 5EZIL 5J6HB 5SWSE 1EBPA 4QCIB 4OD1L 3GB7B 1QHPA 4L29B 1N64L 4WTZG 2G5BA 5D7SL 3NA9H 1OTTD 2X70B 4G7VL 1X7QA 1XGTB 3QWRA 5DMGD 2AV7B 4UIMA 3V0VB 1MREH 3MGOA 4MMXC 1J0HA 4O5LH 1J1OH 3MV8D 4HWZB 2YPKB 1MJUL 4NGHL 4JKLA 2B1AH 4NOFA 5ITBL 4G5ZH 2N7BA 5DFVD 4CN1A 5JW3L 4GKZB 4OCMC 3K2MC 2E9IA 4NC1E 3RNKB 5C9JA 5DJ6A 2IADA 4P46D 3LS4L 4KXZI 5ID0B 3MBEA 1F4YH 3KLSA 5L2JB 4L9LA 1NUGA 5IB4B 3M45A 3BAEH 3DGCR 4K8RL 2CRIA 5D1ZD 2EEBA 3RGVD 3V4VL 4YHYB 4GW4B 5H2BB 4WW2A 3RL2B 5B8CC 1ND0A 4DGYH 3MRBB 5JPMB 2YPVH 3ISWA 4HWUA 5K93A 4ONHB 4YX2H 3GKZA 2D0HA 5D7JA 3ETBF 1WZLA 4U1KA 5IEHB 2PCPA 1TJGL 5ESAA 4Q9QL 2D4FA 5HYJD 5C86A 4JPKL 2A6KB 4R0LA 2WMPA 4DVBB 3VGBA 1T1XB 2W65A 4X7TB 4Z7VE 4U1MA 1CGVA 2MFNA 3SKNA 1IFHH 2W92A 5GSRB 4Q6IB 3VXPA 4GRLA 1KYOJ 3U79A 3DROB 2D31B 2X4UA 2EKJA 2C1PA 5FGSA 5HDQH 1BOGB 1VSCA 1X5GA 5DZNA 2K7PA 4XX1E 1R5IB 4MHHI 5IFHL 1DE4A 5FGCB 1U3YA 5ADOL 5I30L 3NCBB 5TDNB 3DMMA 2FEEL 5EO1B 3T0EA 1RU9L 3PWUB 3UTTD 1DLHA 1KCRH 3EKCA 1GZPA 5I8EA 1UVQB 1E27A 4TQEH 4PJGB 4V2CB 5D7IF 1EFXB 5FB8A 5AUMA 3MRRA 4Y1AB 3LRGA 3EO9H 4CMHC 4DN4H 1UZ6F 2CJUL 4XXDA 2DQUH 3WNLA 4M61A 3DO7B 4PJAF 5DQ9B 3ARSA 4KRPD 1AHWC 3L3GB 4L3CB 4J3UA 5KVGL 4GXUM 2FD6H 2HRPL 1IGMH 4KPHH 3P4NB 1YQVL 4OFVA 3AUVA 4LP5A 1RZKL 3AREB 4XX1G 2XWJA 5CJOH 4AT6A 3W81A 4NBXB 5CZXD 5CGTA 3T2PA 1BEYH 5D9SA 1QFUH 1BWMA 5IBUB 2OZ4A 4PD4K 4MWFB 1QG3A 5CD5D 2CK2A 1U8MB 2DJUA 1QR1A 1C1EH 1J1PH 2EKSB 3QQ9D 1L6ZA 1MRDH 3RWDB 1ZGLP 5F9WC 5TFSL 1AGFA 3HUJF 4XRCA 5IOPA 4X80H 1SVZA 2FGWH 1FYTE 4DCQB 4QNPE 2YWZA 3S36X 1IQWL 1FC2D 2UZIH 4HH9A 5DMKA 4NQCD 4KUZH 1S7UA 3TNNB 3C6LB 1Z9LA 2E27L 5JXEA 1YMHA 3O9WB 5GGVL 5EOTA 5IB3B 5JPNA 2HTKC 4PLNC 4MB3A 5J12B 3GUTB 3VXNA 3NZ8B 1ZMYA 5CEZE 2FO4B 4FQHB 1WV7T 5GJTH 4BZYA 5GIRB 2HH0H 1B4JH 1CXLA 3FZUD 4PGEB 4NKMB 1IGYB 4JAMA 3MODL 4XVUD 5TH2A 3V79C 4HPYL 1R24B 1FIEA 2GJ6B 4N68A 3O11A 5HHMD 1R3KA 4G6JL 3ZLQC 4GAFB 1G9NH 3PHQA 4UUJA 2YZ8A 4XVTL 5DD0H 2YN3A 2NY7L 2ORBH 3GK8L 4KTYA 4HMEA 2HN7B 4XPAL 5FXCH 4WFGD 3O2DL 5IBTL 1U8IA 1JPFB 2F54A 3VFRA 3MRMA 1D7FA 3MTRA 4J6RL 3U2SA 2X89A 2PXYA 3TA3B 1ZEAH 3UMTA 2GQHA 4OZHF 2Q76B 3MGTB 1AIFA 1NFIB 5DRXB 4M7JL 4OF5A 1ONQA 2HVJA 3QA3B 3HI5L 3FMGL 1MHHA 3QEGL 4K23H 4B0MM 1HXYB 2IBBA 3GMOA 5C0GA 2DQHL 5DD3H 4E9LA 1N4XH 4WFFE 3GMQA 3KJ4C 4J8RA 4JY6A 5AZ2H 3BDXA 1TNMA 4I1NB 5DUMH 3P3YA 3EYOA 3CSYB 1KEMH 1UWXH 3T1FA 3NH7H 5IESH 3D25A 3MV9A 5JXAL 4JFDE 3T08A 3BKYL 3L7FA 3BH8A 5CIPA 4DN3L 5EBMB 5DJAB 1FVCB 1BX2A 4XWOD 4Y4FC 5BV7L 1MCOL 5T3XL 3U46B 4DWHA 1E4JA 3BGMB 3VFNA 5K9KA 2DQGH 2HKFH 3J7HA 1ZVSB 3O41B 2QBWA 1I8LA 1JGDA 3QIUB 1X5AA 4OM0H 1QUNA 4DK3A 2MNUA 3ARUA 1D5XA 2IPKB 1A1OB 2RFXA 1EJOL 5DI8A 2DL9A 1A6UH 1K4CB 5ALCL 1GCFA 3C8HA 4X5WA 2CLRB 3HNTL 5JOEA 3FB7B 3X11B 3BXNB 1KNOA 5IR1A 4O9HL 5D2NC 4OM1L 1WWCA 3RDTC 2EC8A 1OAXH 4ODTH 1SM3L 3RTQC 1MCBA 4M9OA 2VOTA 2R4RH 1NGZB 3IDYC 3QHTC 4HCRL 1J8HE 1FJ1B 2VIRA 3NIDF 4DKFL 1ZLUH 3WHXA 3OKYA 4PJ8A 1F8TH 2LV4A 3B8SA 4BQBA 4FTVD 3HI1B 4DGVH 2DAVA 3DOSA 3MNWB 3KPMA 5LGJB 3X3FH 3DRTA 5JHDD 5C07A 1YC8A 3D3VD 3IKKA 3BO8B 2IQ9L 2Z35A 1D5IH 3CFJA 5E4EC 5E2VH 3TH3T 5IVXF 2D7QA 4M48L 5F1SA 3V5HA 1CK0L 3BYYA 5IF0B 4UI2A 4P2OC 1A7QL 2LAGB 1HN1A 2JF1A 2AJXL 4YHOL 4JGMA 4S0SD 4PJXF 5EC2B 4HZLA 1JI1A 5EPMA 3IAQA 1CG9B 2DBLL 2RB8A 2X9XA 6FABL 1Q0XL 5DDHA 1S9WA 2MSPA 3BP4A 4I3SH 2EZ0C 5IBLC 5SV3A 4YHPA 1FL6A 2XWBA 4F9PC 1T0MA 1VB9A 2W9DL 1I7UA 2CQVA 2ITDB 3QUXB 2BHZA 2HFTA 3GHEH 3KPOA 5BJTB 3FHQA 4UNVA 5IUSA 4LAQH 1SJHA 2J8UF 4NUGH 3CUPA 3F7RA 3MJ9H 4KKLD 4PY7B 3B2VL 5IHBA 2XZQL 5MP6L 4YUEL 2VAAA 2VXSL 1MCJA 4WV1B 1SMOA 2EC9T 4R90H 4QOKB 4WW1A 3V5DB 1T20A 4OFKA 3JV6B 1TFHA 1M7IA 1I8LC 4PJ9D 5KJRH 1KJMA 1XF4B 4K8RC 1QVOA 5IB2B 4OCWL 4K7FA 5DZLA 2GT9B 1U41A 4CNIA 4CVZB 3MRIA 3KG5A 3A6BL 4RSVA 3L3DB 1ZHBA 4X6CA 1FVDB 4N0FB 5DHYA 5GRUH 1PBYA 4U6HA 1QBML 3J8F7 4YFDB 1Q9LB 2AK4A 4OF3A 4ZUTA 1T22A 2HFGH 4U1NA 4MB4A 1X5HA 1FBIL 3PDOA 1R3HB 5IHUH 3HE6B 4Y7MA 1IT9H 5FCSH 3OKLB 3FB8B 3T09A 3VXSA 1CXKA 4R7DB 1FE8L 3BH9A 5JDSB 3BSZH 2VR4A 4DEPC 3TT3H 1QFHA 2F53E 3N85L 3MRHA 3DTXA 2VO5A 1MCWM 1CFQA 2J3SA 3V6OC 2X42A 4P4RB 4QYOA 3BQUB 5JMOC 4I2XB 1AXTH 1JGUL 3N1GC 3IB4A 3CC5A 2X41A 4OLUL 4ZO9A 5F1NA 3VFPA 4QHMB 3ARTA 4JDZA 3SHSA 1RZ8A 2HMIC 2HLAB 3BIAX 4K3DH 4MQXC 4NPYA 3FT2B 4EVNA 4XXCA 5C0BB 4I2XE 5FYLH 5D5ME 1JF1A 4KWUA 2VC2L 4DOHE 1GC1L 1KXTB 4JFPB 5E9DB 1F3DH 4WWKD 3OAUH 1AGDA 1KCUL 2DLGA 2D03L 5IB5B 4L3ED 4OKVB 5C0BE 3UDWC 3IDJA 2VJXA 2QADB 4Y8AA 4X6DE 2VWEC 1IQDB 2Y07H 4P4KC 1HK6A 2ARJB 3G04A 1Y6MR 4M1DH 4PJEE 2I07B 1RJLB 4NQDD 1AGBA 1E4XL 5E7BA 3TBSB 4KJPC 1FL3B 1MRCL 4WU7A 2OI9C 2Y5EA 3IU4H 3WKMH 4RAVB 4D9LH 1YN7A 3WE6B 1U8QA 4NUJA 4AZ8A 5JOPE 2YPLD 3LVEA 4YGAB 1TETL 4B41A 1N3NB 1OQOA 2DMKA 1KLFA 1N8ZB 4HKXA 4HKBA 3HC3H 2XN9B 3VDCA 4JPVH 4MJ2A 3B2UD 4QHKI 5GGVY 3TJHD 4JLRB 3OXRA 5L88L 3QG7H 3EO0B 4QGYA 3W9DB 3KPQA 2ZUTA 3DLQR 4ORGB 1MCKA 3I2CH 3GMPB 4L8BB 1MFAL 5D7LE 3RHWF 1YEKL 4LCIH 4UINH 3L6FA 2BVEA 1T0NB 4ZTOL 1IM3A 1KENH 1QFWH 1ZGLA 3HG1E 5HYQB 3BKCL 2OL3A 2JJTA 3B9EA 2X05A 3UTPD 3OGOE 3P2TA 4UILH 5I1AB 1KJ2A 4X9BA 4XPHH 4ENEC 3I75B 3P0GB 4G9FE 1BPVA 3MCG1 2EO9A 3DRQA 4KK9D 5ID1A 4HIEB 3MRGA 2DM3A 1EFQA 2IAMD 4WUKH 4PY8J 1LE5B 2HFEB 2IANA 2W0FA 2YK1H 3BFOA 1QSEB 4JHWL 4YE4L 3ZT6A 3DSFL 4JN2B 4U6VL 1T21A 2X7LA 4JG1H 1UXSA 3ARYA 3GI9L 3QNYB 2VISB 3FONB 4NRZB 2H2PD 2LVCA 1Z6JT 2Z31C 5TQ2H 5M7QA 3GRWA 2BVQA 2YRLA 3SOBL 1I1RA 3RWFB 2NW3A 3KWWA 3VXUB 3MRPA 3MREA 3R06B 3SDYL 1U95B 1RMFL 1ZSDB 4BSWA 3MFFA 4PRHA 1E28B 1A6WL 4M9PA 3S88H 1KTLB 3RI5K 2X4QA 3SDCB 3NACL 5DJDB 1JTTA 1G6RA 2EYRA 3LKQB 3O4LE 5C0DB 2YUXA 4S1DC 1LO0H 3H3BC 1CD9B 1I1YB 2P5EB 2ZJSH 4QRRB 2B1HL 4P3DB 3S98A 1IE5A 4MSWB 2VN4A 2Q6WA 4KK8C 4UDUA 4D0DB 3KPPB 3INUH 2IEPA 4OCNC 4FXKB 3RA7L 2GTWA 1JUFA 2VXUH 4J3TA 2ZZUT 2JLLA 1I1AB 1SYVB 2J6EA 1JNLL 4QTHB 4HJJL 4ISVB 4YPJA 4MDIB 3MJ7B 4LSRH 1UM5H 1XGQB 5AYUL 1NSNH 2VSDA 3RY6C 2V7HB 1DQMH 4WUUA 3GSQB 3O81A 5DJCB 4LL9A 2ZOKA 4HBCL 1XMWA 3QHFH 3BZEB 4JZJC 1FGNH 3D5OF 1F6AA 3VXOA 3TBTB 1CE1H 4J3VA 4MVBD 3CFCH 1L7IH 1AQDA 4X4YB 2X6MA 4M7LT 1F00I 3ZDYE 5SWZD 3IJSB 2WUBL 1JK8A 3BN3B 1TQBC 1WITA 3S5LB 4G6MH 4B7LA 5DD6A 3PGDA 5MEND 1VADA 2CD0A 2E9WA 3I02B 2CK0L 3DNKA 3L3HA 4I3RH 4U0RC 1B90A 1BVKA 5M94B 2FCBA 4O2EB 1IGJA 1T66C 4QRSB 1BBJA 4M7KL 3ULUF 3DX7B 4TSBH 4HX1A 5ESVA 4G42A 3UBXG 4X6FB 1AKJB 1Y0LB 2FYYA 4NQEA 2Z8VC 1Z9SA 3SGKA 3UPCA 2ZKHH 3ZE0F 4JQIH 3M8OL 2AKRA 1SEQH 2UYLB 3IKCA 4JO4H 3WD5H 4O4YL 4FS0A 3RWJB 4M6AA 2AV1A 5J56B 1AO7E 1H3WM 2I60L 5C2BH 1YN6A 3ILPB 5D1XB 1S5HB 5C8JB 3KGRA 3ZT5A 3G6DH 3GIVA 3X13A 3FO0H 1RZGB 1YEHH 4MXWH 1RIVH 4X98B 2X10A 3VXRB 1K6QH 1QD0A 3AAZA 2R0WL 4M00A 2PW2B 2D7PA 2ZSWB 3CZJA 5EUOB 1WC7A 2HLFC 2ZG2A 1I1CA 4Y4HA 5DK0A 1L9MA 5EOCH 3W11D 2YC1A 1G7MA 3MNZA 4ONFH 1IGTA 1YNLL 2XTJC 4JANA 4NIKB 1I85C 1OTSC 3ZL4H 3MBXL 5EUOE 5D96B 5DO2D 4PP1D 5TF1H 3VGAC 2I9LA 1OY3B 4JDTH 3MV8E 3S6CA 1DL7L 2CRYA 4BH8B 3PDGA 4NRXB 5HYSB 4EUPB 3EGSA 1BGXL 4X4ME 5CEZL 1RURL 5B39A 4P2QA 3T8XA 3Q3GA 3EOTL 1ADQL 1P4IH 4OLWH 1SY6L 2IH1A 43CAA 1U8LA 1AD9B 4LCYA 4NN6C 3WNPA 4LCCC 4UV7H 1S7TB 5ACMA 3DX8A 3QDHA 4D9QE 1WF5A 1B0GA 3DETD 5T1KD 1DBMH 5EU7C 4NNXA 4TVSa 4Z0BH 3VE0B 1D5ZB 4S1SL 1KTRL 3MLWH 4JRYA 4L4VA 2FB4H 5LBSH 1D3CA 1MQKL 2EDLA 4JKKA 5CWSB 4HWBL 3KDMA 3UJTL 1QRNA 4JO1L 4WI2A 2WW8A 3RWCA 3BEVA 1BZ7A 1GOHA 5AYQA 1RUKL 4V1DB 4Z7UE 5I8CA 4UAOB 2P8LB 4PBVC 4X6EA 2IPTH 2M1KA 5IVOA 3QDAA 3HC0A 3QDMB 2WLZA 4N5ED 3T65B 4HEPG 1KGCD 3BQUD 3ZE1E 1JZ7A 3QR2A 3B5TA 1I9RL 3O2WL 4KJQC 5KN5A 2P47B 3DV4A 4V1DE 3GKWH 5C0AE 4JO3H 5KANG 4HHAA 4K3JL 3F7VA 1HH6A 1IAIM 1DVFC 3D69A 2G5BB 2XKNA 1X7QB 2A2QT 4UIMB 1MWAL 1AXSB 1EUUA 3MGOB 4PJDA 1ZTXL 2UVEA 5MI0B 5FO9A 5E9DD 4JRWA 5DA4A 2ZNWA 3RPKA 3UTTE 3LPWA 5GRVK 4FMFA 2IBGA 1Z9MA 4U31A 2YHGA 1MVUA 1P1ZA 2FJHA 2C1OA 1E4KA 3EBAA 4KY1L 4M7ZC 1ORQA 5C9JB 3GSWA 5DJ6B 2IADB 1XGRA 3D2UA 5C0CD 1JWSA 3CLFH 3X3GL 1RZ7H 3MBEB 1P4BH 4L9LB 4XMLL 2Q3ZA 3A6CH 4OZFH 4PJ5A 2BFVL 3NTCL 4MJIA 3F7PC 5KVDH 4JB9L 4WW2B 1ND0B 4NJ9L 1Q9OA 3VXQA 5E08H 2R0LH 4TVPL 3ZDZF 2ZUQC 3QIWA 2I9TA 5TE4L 2WIMA 2H2SD 1A7BA 4K07A 3S35H 5D7JB 2IFFH 4OD3L 3MLVL 1GSMA 3BKJL 1PX4A 4JREB 3DECA 5FO7A 4Z7WF 3MZTA 3MLYH 2YD9A 2PCPB 4KQ4H 5ESAB 1HCFX 4PRDA 4XMPL 2R0ZH 1NLDL 1NL0L 3HZYA 4AMKH 4R0LB 1KN4H 4HW6A 4OB5H 4J7RA 1QP1A 5L7XL 4R4FH 4NCDA 3PV6A 1VPOH 3P0VH 2W65B 5CGYC 5F3HA 3VWKD 4U1MB 3SKNB 5FYLE 3VXPB 4GRLB 1G0YR 4KQ3L 1P7QA 1BMGA 1NGQL 2X4UB 1RHHA 2C1PB 4KMTL 5FEBA 1KLGA 1PGRB 2DWEA 2GJZB 4ONGL 3MJ8A 4XBPA 1IC5L 2NX5D 2V2XA 1DE4B 3ZDXE 2V5SA 4JRXB 3UYPA 2ATKA 2X1WL 1BIIA 3DMMB 3EJZC 1N0XL 3T0EB 4AEIL 4ZTPL 3TBYA 1DLHB 4DGIL 2AXHA 1CQYA 2PNDA 3ARWA 3TVMA 3QRGL 1GZPB 2NY0D 5I8EB 1E27B 2A1WL 3G5VA 4HWEL 1PKQE 1T2QL 4O2CB 5CUSH 3FFCA 1U6AL 4PG2A 4JRXE 1F4WL 5FB8B 1WWAX 4CL7A 4HC1H 3MRRB 4N0CD 2OK0L 4TTDD 1NGXA 3SDXF 4Y89A 3BD5A 4XXDB 4M61B 5FO8A 4JKPL 5HHME 4PJBA 4MB5A 3O3UN 2F5BL 5BS0D 4IMKA 1MNUH 5TQ0L 4RGNB 1NMCC 3S37L 4F37F 1R5WA 3MSPA 5F89A 5HVWA 1VFBA 1KV3A 2XWJB 4WFGE 5D1QA 4RGNE 1IAMA 3NA9L 4AT6B 5DMIH 1BFVH 4Z7OF 1D5MA 4NFCA 5D9SB 1LE9A 2AVGA 3JWDH 2NY2B 3VFUA 4EIGB 3MCKA 4S1QH 1J1OL 1QR1B 2W60B 1F90H 3C9NA 5DUBA 3GRWH 2GK0A 1AGFB 3SCMA 2NZ9C 3ZTJH 1FNGA 4XRCB 5KS9A 5DC4B 5DHVH 5IOPB 4NQXA 1M05A 3CLEL 4F33A 3QIBC 1F4YL 4ZAKA 3RZCA 1DFBH 3BAEL 4IRSD 4D3CL 5E2TL 4ZOAA 4L8SA 1RULH 5FDWA 4HH9B 5DMKB 5KW9H 5DD1H 1BQSA 1S7UB 4N1CA 1P7KA 1JL8A 3A67L 4DGYL 1YMHB 2YPVL 1AD0A 5EOTB 2BSSA 3CX5J 2C3XA 4NDMA 4YDIH 4L3AA 5C0FA 5CJXC 5JPNB 4O02L 5EG6C 2NY1B 4LPTA 1JNNH 4G7YH 3VXNB 1CICD 1RFDH 1V5JA 2DQTL 4AL8H 2CRMA 4HMDA 1U3HD 1EIBA 4JCLA 3TO4A 1BLNA 4JAMB 5TH2B 3NN8A 4D2NA 3KPSD 1TCMA 2N7AA 3O11B 1R3KB 2WWMC 2WP3O 2OTUB 2AEQH 1MCRA 3PHQB 4KXZH 4UUJB 5ANME 2DICA 1MPAH 2DI9A 5DZOA 4OQTL 4NN5B 2GI7A 5EBGA 3SJVE 2OXHA 1CXHA 1QFWM 5HDQL 1J9CT 3T2NH 1U8IB 2F54B 3D18A 1D9KA 4CU7A 3MRMB 5D1XD 4U2YA 2I24N 4FTVE 3T04D 3WO3B 2PXYB 1CU4L 1NC4A 1RK1A 3NPSC 2JELH 1OM3L 4KVNH 4FQXA 4Y2DA 1S8DA 1AIFB 4GRMA 5JHDE 1KCRL 2Q86A 3CSGA 3FCTA 3D3VE 1ONQB 2HVJB 5EIQA 3WJJA 2QQKL 4Q9RH 4TQEL 5I8KH 3GMOB 5ISZA 5C0GB 4LASH 5I1LA 2MPAH 3GMQB 4J8RB 3TGXA 4JY6B 4PJFF 1QHOA 5DC0A 2AEWA 3IJHA 5D7KD 1FVEA 4OZGA 3EYOB 1YQ2A 3PWPE 3T1FB 3SE4C 3D25B 5GZOD 5DEFA 4DN4L 4WHDA 5IROA 2DQUL 3GSOA 3I50L 3MV9B 1DEEA 4TSCL 4IOIA 3FB5A 3L7FB 3BH8B 4PP2A 5CIPB 1JVKA 1CLZH 2FD6L 1SHMA 1YEJL 1BX2B 2GHWB 4G3YH 4GUPA 3V7AG 1IGML 1IM9A 1KCSH 4KPHL 1FZMA 5CP3H 1UXWA 3IAGC 3VFNB 5K9KB 1J8KA 3WIIL 5F72S 1JGDB 5FA3A 1NMBH 4NKIH 2UUDK 3EUUA 3Q0HA 4XCCH 2SEBA 1D5XB 1EK3A 1A0QL 2RFXB 1NAML 2VDPL 1WFOA 3TIDA 3VFGH 5DI8B 1FPTH 4JFXA 5GJSL 1QFUL 3SDDC 4X5WB 4DZBA 2X4SA 3WIHA 1UB6A 2N56A 4MZ2A 4IMLA 1KNOB 4U0QB 5IR1B 1SJVA 3PQYD 2F5AL 1MFCH 3ARFC 4CKVX 5EU6A 1Q9KA 4YJZL 3F5WA 2GFBA 1JGLH 2YS4A 5I1EH 2FGWL 5L2KE 3ARDC 2VIRB 3WHXB 4PJ8B 1JGEA 2UZIL 1PZUB 3QDMD 5L9DL 1JGVH 5MEOA 4KUZL 1G1CA 3VW3H 3KPMB 3NABH 1JZ2A 2RCSH 3H8NA 3DRTB 1MH5A 3O4OB 5C07B 1QLRA 3DO3A 1FN4A 3IFLL 4WDIA 2UWEA 5EO9A 2Z35B 3CFJB 5CCKH 5GS0L 2R2BA 3V5HB 4P2YA 1RZFH 1OAYL 2ICES 5GJTL 1Q1JH 2HH0L 3H9SA 3MRJA 2I27N 2ZCHH 3HE7A 4DTGH 1C12A 2NXZB 4M02A 1F4HA 4HZLB 5EPMB 2DTML 1CDIA 1WSST 5BRZD 4I9WD 1A7RH 2ZPKL 3SO3C 2CDGA 1TNNA 1FLRL 4NO5A 5DDHB 1S9WB 3BP4B 3KS0J 4GSDH 5A40E 1FSKB 1OAUL 2NLJA 4W4OA 1KJ3L 5DD0L 5C09A 4YHPB 1FL6B 2RBLA 2XWBB 1T0MB 2H41A 1I7UB 1TQCC 2ORBL 1NGPH 4K71C 1MCCA 4BZ2H 2AGJH 5ERWB 4GMTL 2J88H 1SJHB 2IALA 3BRGC 4L3EE 4JG0L 3CUPB 4XNYL 2VQ1A 1FDLH 3LKNA 1BREA 2VAAB 2QQLH 3ZKXB 4YHML 1QA9A 4WW1B 1QACA 4QY8A 2FSEA 5IK3A 4XHJC 1T20B 1OHQA 1M7IB 4YEFA 5FYJL 3SDAC 4K23L 3IRZA 4OUUA 1KJMB 4NQDE 1QVOB 12E8H 1LD9B 5J13B 3BPCB 4K7FB 5DD3L 1HZHL 4CNIB 3AB0B 3MRIB 5AZ2L 5CJQL 5DUML 4NQUA 3RGHA 1ZHBB 2P46B 1I8IA 4X6CB 1HHIA 5DHYB 1DBJH 2PTVA 2WBKA 4PUBH 4U6HB 4I77L 1AE6L 1DSFL 2AK4B 4ZUTB 1T22B 4U1NB 4FFZL 2IPUK 3GNMH 3PDOB 4Y5YC 1EO8H 4J3WA 3T4AA 5IMKA 4PJIA 3VD3A 3OJDA 3ZHDA 1IZKA 1U91A 2HTKD 3VXSB 3PL6A 1BBDL 1BQLH 3BH9B 5E99H 5I18H 5FK9A 3CD4A 4OBSA 2HKFL 3CFEA 2NPLX 3N06B 4HIHB 4KUCF 3MRHB 1DLFL 3DTXB 4F7MA 3WFEL 1CFQB 1RJZA 5GXBB 2GAZB 4QYOB 5HGGS 2R0KL 4KVCH 2EDDA 5INDA 1IAIL 3V8CA 3CC5B 3W0WB 5F1NB 4JDZB 1RZ8B 2YXFA 1Z3GH 4NPYB 4EVNB 4YQXL 4AENA 1JF1B 2WINA 1DQDH 5GS2D 5HGAA 4NT6A 3W0WE 1CD8A 1EO7A 1AGDB 2NYYC 4YLQT 1H5BC 2DBJA 3ZYOA 4LFHG 3IDJB 1F8TL 4G8GA 4J23A 1YEFH 2DQDH 3IETA 5DUPH 2VLKA 1RY7B 3X3FL 2Q3AA 3KPRA 3G04B 3PHSA 3LEVL 3BPOC 1NCTA 3MLXL 2RR3A 4N9GA 1CDGA 3MUY1 1D5IL 4XNZC 1AGBB 5E2VL 4XCYA 5HI3C 1B0WA 4WU7B 2BERA 3H7LA 5I75C 1V7NH 1BVLA 4MAYB 4M1GH 1YN7B 2V5YA 4OZFG 2L4OA 3LQAC 1U8QB 4NUJB 2OTPA 5E6ZA 5IIEA 3LZFH 1W72H 4MD0A 4F15B 4HKXB 4HKBB 3QXWA 2A9NL 1UJ3C 1U9KA 3AS2A 1PJ9A 2FX8H 1R3LA 2DB8A 3O6LH 4YIQA 3AY4C 5DRWA 1LHZA 1QBAA 3OXRB 3HAEA 2DJSA 4ETQA 5CKGA 3D39A 3T2OA 3KPQB 3I3BA 2NZIA 4WY7H 5E0QA 5C3LD 2GCYA 5J4MA 2VUYA 1D6EA 5ADPL 5IT2H 3L6FB 4LAQL 3CDGA 3B4NA 4YXKH 2W07A 3NPZB 1IEBA 1IM3B 2NY5L 3U48A 1ZGLB 2XZCL 4OZIE 2G60H 2OL3B 4ZXBC 4HJGA 4LSPH 1W0VA 1KJ2B 3LMJL 5F44A 2P42B 3KYAA 4LDOB 3OV6A 3DXAD 5C3TA 3RDTD 3DRQB 5ID1B 1W2KT 3MRGB 2A6DA 1L0YA 2C5DC 3RTQD 2V9QA 4MXQC 2IANB 2W0FB 1A6AA 4XNMA 5GGRY 1T21B 4TUKH 2X7LB 1UXSB 4QF1A 3TIEA 4MGXA 1V3JA 1PLGH 2M8XA 2R2CA 3Q6GH 5IJVA 2VXTH 2CIIA 5F9AC 2Q8AH 1A1NA 1SMAA 5GRUL 1NMAL 2BVQB 4GBXC 1KCKA 5SWZE 2KDGA 2ZOLA 4KK5C 3MV01 3F62A 5EIIA 2NW3B 3KWWB 5C0EA 3MRPB 3MREB 5K9JL 1IT9L 4H0IA 4X4XA 3ZKSD 4PRHB 3BSZL 3RX5A 4J4PC 2X4QB 2QQQA 1CN4A 3IDNA 3MJGX 5F1IA 3GSNL 1HXMA 4P2OD 1N6QL 2AERT 4H88L 1G6RB 2EYRB 3DURA 4MA1C 4UQ2A 4GW1A 4EJ1C 4FFYH 1AXTL 3WNKA 4L5FH 2XG4A 3CMGA 4FQ1H 3L5XH 1L7TH 2EZ0D 4OT1H 1C8PA 1XCTA 5IBLD 4K3DL 5KZCD 5GSVA 2W9EL 1FL5B 1ZS8A 2Q6WB 1UACH 4UDUB 3C8DA 4XNUH 2UUDH 3NCCB 2VE6A 4M6ML 3TEUA 2JB6A 2GTWB 3UYOD 1JUFB 4RFEA 3OAUL 5E1HB 4N8VA 2G2RA 3MV9D 1LP9A 5DS8A 1NJ9A 1KEGL 4YBLB 4RMSA 2Y07L 4OTXL 3VMNA 1JYXA 2W0KA 3FAXA 4W4NA 4YK4C 3TM6A 2DIAA 3SGDH 2O61A 4WUUB 1JF5A 4KKCC 4M1DL 4KMQA 4ZFFA 2ZOKB 4R97C 1O7SA 1N2RA 1J05B 1MAML 2MQ0A 1PQZA 3ZTJG 1PFCA 1FAIH 2ZUXA 3VXOB 3NCEB 3WKML 4QTIL 2VXVL 4D9LL 3U82B 2EDJA 4WUUE 3FRPA 5D70H 2WUCH 1AQDB 4R9HA 4L9DA 4YFLF 1KC5H 1N7MH 4NOBA 5I17A 4ZS7L 1O5DT 1EMTL 3T3MF 4LLYA 6CGTA 1JK8B 3HC3L 1T1WA 4KJWC 5DGRA 5DD6B 1IGIH 3PGDB 1VADB 3G6JA 4R7NA 5CLTA 3QG7L 3D9AH 2XG5A 1IGJB 1GXEA 1T3FA 2OR8A 1BBJB 3C2AH 5B21A 1B4RA 4HX1B 4UINL 4G42B 5ESVB 3DHJA 2FYYB 4NQEB 5F1KC 4ERSL 2OQJB 3LSOA 1QFWL 1H9VA 1X5FA 3IKCB 4UV4L 1S3KL 2XZAH 5I15H 1MFEH 2AV1B 3WIFA 2HMID 3ZMRA 2J8HA 5B3JF 3N0PB 2DMBA 4Y5XA 5GS1B 1T7VA 1A6TA 1YN6B 3OKEA 1I9JL 3RU8L 4N9OB 1KGCE 1T83C 3GIVB 3X13B 1AFVH 4FQCL 3MV7D 3AAZB 4JG1L 5IJKC 1WC7B 3TJEL 2HKHH 4U1HA 1KTDA 1A6VH 3L3IA 4Y4HB 5DK0B 2YC1B 1G7MB 3MNZB 1IGTB 2NMSA 1MLCA 2H26A 4JANB 3BJLA 3JV0A 4P4KD 4HFUL 1GPOL 1TZHA 4UT9H 5D6DC 3E3QC 3BP7A 5IHZA 2I9LB 1VACA 4U49A 2YD2A 3EGSB 3K8KA 2VLRA 1MY5A 4KJPD 3S88L 4YDLC 5B39B 4P2QB 3T8XB 3Q3GB 3HHRB 3MCLL 1HNFA 4WU5A 4NZRH 5L6YL 5C0CE 4JJ5A 2IH1B 43CAB 5EULV 3WO4C 1ITCA 1EXUA 1U8LB 3O2DA 4LCYB 1CI5A 3LKRA 3FJTA 1AY1L 3DX8B 4FABL 4F8QA 1YMMA 2Q20A 4DK6A 1F58H 5DEZA 4HWNA 1B0GB 3HS0A 4CUCA 3U0PA 1LEIA 3O6MH 4IHOA 2NXYB 4NNXB 5GS2H 1QFPA 4JRYB 4L4VB 1HHGA 3QUYA 1Q72H 3KDMB 2VZ3A 2HP4A 1QRNB 4ODWA 2KPNA 3RWCB 3BEVB 5BVJA 2PO6C 5GGTH 3P77A 1X44A 1BZ7B 3L95A 1BQUA 1UM5L 4HEME 4MAUH 4ENED 2EO1A 5HPOA 3OHXB 5I8CB 2QJDA 4RWYH 4LQFL 4X6EB 2O5ZH 4HK3N 2EDBA 4WO4A 3HC0B 5HPMA 1MCEA 4Z7QF 3VXMD 3FQTA 3ABZA 5JTWA 4R4BA 5KN5B 4M5ZL 1CLCA 3DV4B 2BVPA 3G9AB 2K9UA 2BNQD 1L7IL 1T03L 4HHAB 5B39G 3IFNH 2Z92A 3F7VB 1HH6B 3OG4B 3D69B 4PJHE 5DC9B 2XKNB 2DIJA 1YNKH 3O8XC 1RUMH 2NX5E 4NWUL 4FZ8L 5IWLA 2JCCE 3F6LA 3RVXC 4PJDB 4G6ML 5FO9B 4PJCA 4XCEA 1NUNB 4I3RL 1OTTC 1C5CH 1DBKL 4PLJC 1I7TA 3SBWA 1HKLH 1MVUB 1P1ZB 2FJHB 2C1OB 3BD4A 2R4SL 3EYUH 3SE3C 1ORQB 1II4E 35C8H 3GSWB 4TSBL 1XGRB 3D2UB 1JWSB 3MC0A 4HCRA 4S1DD 4C54A 3LS5L 4PJ5B 4XAWH 3V52H 1T5WA 4MJIB 3S3SA 1SEQL 4PRIA 3WD5L 1YDPA 2DQIH 3U30C 2X1PA 5T1DL 5AWNH 3QDJD 3S34H 2EDKA 4LBEA 3QO0A 2HA1A 1MCDA 1N26A 1Q9OB 1ZA6A 4KK8D 5J3HC 3VXQB 3IDGA 4GQ9H 3RUGF 5C2BL 2DLHA 4MNQD 3QIWB 2I9TB 4MJIE 4XB8A 3U0TA 3P4LA 3FO0L 1YEHL 3BT2H 1RIVL 4UOW0 1IL1A 5FO7B 3H7BA 3VFWA 4PRDB 2ED7A 3P9MA 4OGAC 4TNVK 4D94A 2ZSVA 3HZYB 4ONFL 1QSFD 1ZAGA 3MLUH 4JFFA 3VFMA 1KELH 2DIBA 4RRPA 3DYPA 2XQBH 4X9HA 1RZIA 3PV6B 4JDTL 5F3HB 3BZFB 5I2IA 2ENSA 5FYJU 3S36L 4WFHD 2FLRT 4KKAC 4CAGA 1P7QB 2G9HA 1RHHB 2WIIA 1KLGB 2DWEB 1NDGA 2KZWA 2YSSA 3MJ8B 4XBPB 4WTWA 3WSQH 5EU4A 2V2XB 1EHAA 2XI9A 3UJIL 1X5KA 1WQVT 2C26A 2CO7B 5EZIH 4DJMA 3QCVL 3JBG7 2X1XR 5CJ5A 2ATKB 3WNNA 1BIIB 1XR8A 1N64H 5D7SH 1DJSA 4HZAA 4XAKD 3TVMB 2NNAA 4G7VH 1CFSA 3QXVA 4Z0BL 4NRYB 3G5VB 1T66D 1JF6A 2A9MH 1W72B 3FFCB 5I8OH 2FB4L 5LBSL 3FQRA 4GRWE 4AM0A 3HAEH 3QZWA 4NGHH 1YPZE 3SQBA 2EDXA 5ITBH 1NGXB 1U8PA 5C70A 2B4CL 5JW3H 3KPSE 4HUXA 1YA5A 1B6DA 5FO8B 3BRFA 2PETA 4PJBB 1JJUA 1BD2A 3FO2A 4HS8H 5C0RH 4I0PC 4PREA 2WK2A 4K8RH 1NANH 5C6WH 1T7WA 1QO3A 4GMSL 3FT3B 1R5WB 4X99B 1UB5A 2V17L 2QHRH 5A2LH 5F89B 3GKWL 2V9TA 2HLFD 4G6KL 3HPLA 2AXFA 4GJTB 1HQRA 1VFBB 5D1QB 2QQNL 2IMNA 1MY7A 3AROA 3BN9C 2XTJD 4JY5H 3WLWC 1OTSD 5DF0A 1D5MB 1LE9B 4L4TD 2X9YA 3VGDA 3VFUB 2PW1A 3MCKB 5IMLA 4M3KB 4LSUL 5D72L 3C9NB 5DUBB 1OCWH 5HJ3A 3BISA 3ARZA 2GK0B 5JIPA 3SCMB 3H42L 1FNGB 5KS9B 5A2KH 1AC0A 1M05B 4NQXB 1H8OA 4PJ7F 4F33B 3U36A 1CGXA 4WI7A 4ZAKB 3RZCB 3HZKA 3A6CL 1UG9A 1YJDC 4L8SB 3R0NA 2Y6SC 3LQMA 5FDWB 4RFNC 4WTZA 3VD5A 4D0BA 2EDNA 1P7KB 2VH5L 2ADFH 1WBZA 3QUZC 4ZUUA 1AD0B 2BSSB 2R0LL 3SPVA 4NDMB 5C0FB 4QXTA 4OLXH 5IFHH 3UX9B 4JFZL 4ZMAT 1W8OA 3S7GA 2Z93A 5I30H 4CBPA 2ZCKH 5EBLA 1RU9H 3PE9A 4P9MH 4I8DA 1LMKA 4OKDA 3MZGB 1CR9L 3TO4B 1BLNB 3MNVA 2V2WA 3K4DA 1U2CA 4AMKL 4Z7NF 1BZQK 3NN8B 3MRKA 1YEIL 1LK2A 5J11B 5KBNC 2XKUA 1EZVY 5KSBE 4D0CA 5KSAC 2O5YL 3WJLA 1CL7H 1Q9WA 2R69L 2BSTA 1NFDA 3OKDA 2PN5A 3P0VL 5SX4I 2X4RA 3HMXA 3PQYE 1OLZA 4KJQD 1MSPA 3ULUD 4OUOA 5SWSA 3MXVH 4C56A 5K9OA 5KVGH 4HUNB 2FH6A 1DVFD 4UU9A 4EI5A 4K94C 1D9KB 2L7JA 4PRNA 3V6BR 1NC4B 1RK1B 4P5TC 4J1UA 1G0XA 4FQXB 2FEEI 2OX5A 3AXLA 1S8DB 4GRMB 4HDIA 4Y2DB 3X12A 2Q86B 5FOBA 4ZNEA 3MGAA 3FCTB 3HMWL 5KAQG 4P59H 4PBXA 5CUSL 2L0DA 5ISZB 5IV2A 4Z5RA 5I1LB 5KVFH 3IJHB 1DUYA 1FVEB 4OZGB 5D93B 1ZT7A 3RWIA 5DEFB 1BQHG 1R3IL 5TFSH 4LPVA 5BRZE 4I9WE 3GSOB 2AJ3A 1NUFA 4LEXL 5DR5L 5B38G 5HYEA 1DEEB 4IOIB 4ODVH 3FB5B 4XP9H 5T3ZD 4P3CL 4PP2B 2B2XL 1P2CB 1INEH 3NGBB 4IOFC 5I1KL 2DS4A 4P23A 4GUPB 2LU4A 1IM9B 1FZMB 1UXWB 3TO2A 3EFDH 2R23A 3QEHA 3JWOC 2E27H 1XF5A 1QFOA 3PWJA 4R4NC 5GGVH 4QHNA 5FA3B 2V9RA 4TRPL 2SEBB 1BAFL 1IRAY 2UZYB 2AXGA 2VABA 1OARL 2P7TA 1BFVL 3TIDB 4JFXB 4YFLI 4DZBB 2X4SB 1UB6B 5H37H 2O93L 4IMLB 1G7IA 1TITA 3CSBA 4Z7VA 3MODH 1QQDA 4ZUWA 5EU6B 3FO9A 1Q9KB 3IDXH 1WWWX 3F5WB 2GFBB 2EXWD 3WHE0 4G6JH 5I74B 3KLDA 4NHUA 4XVTH 2IQAA 3WJLC 4ALAL 3A0OA 1TIUA 2NY7H 1JGEB 1LVEA 1RULL 5DVNA 1A47A 3TYGL 3UTSD 5DMYA 2NTFB 4FHBD 4NJAL 5KW9L 4XPAH 5MEOB 3UPRA 1WTLA 2J2ZA 3EJZD 3O2DH 5IBTH 1MH5B 1QLRB 1XAUA 1FN4B 4WDIB 5EO9B 2UWEB 3R4DA 4J6RH 4M03A 4MNGA 2VITA 1JNNL 2R2BB 3ARBC 3F65A 3CK0L 3H9SB 3MRJB 4XPFL 1NCUA 3HE7B 4PJGF 1C12B 4M7JH 5T1LA 4M1CC 4TPRL 5E2WL 3QEGH 3FMGH 2HTLC 4CVWA 5IGXH 2CDGB 2DQHH 4NO5B 4XNXH 2AEQL 2VR5A 5E2UH 1GGIL 2NLJB 2CIKA 3D2UD 5C09B 3VRLF 1JHTA 3CXHJ 4NO2A 5JXAH 5GHWL 3BKYH 3ESUF 5D7IE 1MAKA 1NCWL 3TT1H 8FABA 1VKXA 2IALB 4X5XA 5BV7H 1FQ9C 3PXJA 1UZ6E 2VQ1B 4MNHA 4OSUL 4PJAE 4HT1L 1ZWIA 4JVPA 4NWTL 4YHYC 4Z77A 1S7VA 1QA9B 2MKLC 2XZZA 4KVNL 2A6JA 3WFHA 4QY8B 1XIWA 2FSEB 5IK3B 5T5NG 3QJHA 1CD1A 2C3HA 1FCGA 4KROB 4G8EA 4OUUB 2JJSC 4K9EL 5ALCH 7FABL 4EQ3A 1MLBA 3HNTH 1IC4L 4QNPF 1AR2A 1FG2A 2NZ9D 4GS7B 5I8KL 1QSZA 3L1OH 1QBBA 2IPUG 1FYTA 3BPLB 4BZ1L 3QIBD 4XP1H 5JA8B 1EEZA 3SEPA 4O9HH 4OM1H 4LGPB 2DL2A 3G5XA 4CRPA 1I8IB 2E3VA 1HHIB 1SM3H 1ACYL 4XCFH 3PGCA 2YBRA 4EN3A 2Y4SA 4HCRH 4BELD 1QTYT 2H1PL 1P7QD 4DKFH 3S4SG 3T4AB 4NZJA 5IMKB 4PJIB 3OJDB 4G3YL 4U6TA 1U91B 1E4WL 1KCSL 3PL6B 4JE4B 2V5TA 5FK9B 5I6XB 1LDPL 3HUJE 4Q6IC 3CFEB 1CCZA 4P5MA 4F7MB 3FTGB 4XCCL 1JZ4A 1SY6A 3VGHA 2PYFA 1KN2H 5INDB 1FPTL 4F57L 2WWMD 2Q87A 1A7QH 3EHBC 2UY7A 4PGEA 2AJXH 4YHOH 1VDGA 4ORZC 4LVNB 4Y16A 4AENB 1WZMA 1MFCL 5D2NE 3DXAE 2WINB 5FGRA 2DBLH 5JOFA 2DI8A 3ULVF 4LPXA 5HGAB 2F9BT 6FABH 4NT6B 1CXFA 1HWHB 1Q0XH 2APBA 4MQ7A 4URTB 5I1EL 1A3LH 4Y8DC 1P69B 2F8XC 3DV6A 2OYPA 3QQNA 4A2MA 4G8GB 5JHLL 4ZYKA 1S7SA 3OQ3B 1JGVL 2LAAA 3H3PL 3IXTA 3NABL 3NA4A 3IETB 2VLKB 2RCSL 3KPRB 3QDGD 3R1GL 3DHMA 1WT5C 3KYMA 3B2VH 4ZFOA 4N9GB 1OSZA 2XZQH 1W8NA 4WCYH 5MP6H 5CCKL 4YUEH 4NP4H 1LILA 3F8UB 4HK0A 2YUZA 4XCYB 2B4CC 3BJ91 3VI3F 1TCRA 4QHUA 1RZFL 5HSFA 5A1AA 1RVFL 2VLKE 3DVNA 4HV8A 1BVLB 3KPRE 2GSIA 3AREC 1EGJL 2Q1EA 2AEIT 1KXVC 4NQVA 1UZ8A 2NY6B 5IIEB 3MYJA 1A7RL 1PEZA 2COQA 4MD0B 4OCWH 4JFDA 5K9QG 1F3JB 2VL5A 3F58H 4OZHE 1MWAA 2FHBA 2DLFH 4GSDL 2EIZA 4KI1A 1R3LB 4YIQB 2Y7QA 5DRWB 3HAEB 3RY5A 4ODSH 2EDWA 4ETQB 4C83A 1QBMH 3D39B 3QI9A 4LMQE 2GCYB 1D6EB 5EBMA 4R97B 1CZ8H 2VLME 3B2UC 4UIKL 4Y19D 5IMOA 4HULB 3CDGB 2A74A 2YKLL 2Q7YA 1IEBB 4HJ0C 2AK1H 2MKWA 3UAJC 3SDDD 4HJGB 3N85H 3VDAA 1W0VB 3TPKA 3CNKA 3DGGA 2W9LA 3C6LC 1P5VA 2A73A 4BH7A 1JGUH 3ARFD 3O9WC 2Y9RT 4GLRI 1OL0A 3TN0A 1KCLA 2A6DB 2EDYA 4OLUH 1G9MC 2FX7L 1RI8A 1A6AB 2D9CA 4FMKA 5J12C 4XNMB 1HQ4A 5CP7A 1J8HA 2YXMA 4NKQB 1DN0A 4QF1B 3TIEB 4UB0L 2AP2A 3GJFH 4GKSA 3OR6A 4KK9C 3MQIA 1ZHLA 4MJ5A 5IJVB 1J87A 2CIIB 1KB9J 1GC1H 1A1NB 5GS3A 3RRQA 3AS3A 4LPUA 3MRLA 3AM8C 1RJCA 4OFIA 5T3ZH 3C8KA 3WV0A 5EIIB 5C0EB 3GNML 5I73B 2D03H 1XCQA 3GSUA 1J0IA 3U7WL 1A7OL 4KGJA 4QXUH 1G9EA 1AQKH 3OJVC 1LWRA 4YAQA 3ULVC 5I18L 1A21A 2WBJA 3H0TA 2VAJA 4C4KT 3IDNB 5F1IB 3HAEG 1HXMB 4QRTA 5IW6A 3DURB 4UQ2B 3V6OE 2MCG1 4GW1B 3W5MA 5I19L 4A6YH 3NBNA 1MRCH 1MHCA 2X4PA 4IM8A 5D4QA 3BKML 1L0XA 3VWJA 1NCBL 2WANA 3TA3C 1Z3GL 1XCTB 3VFVA 5GSVB 1ZS8B 1UM6H 3GMRA 1TETH 2O26U 4X7SL 2VE6B 3D0VA 1HSBA 2JB6B 5IVXE 1DQDL 1MFDH 5A43C 2WLYA 4RFEB 3NVQA 3QEUA 4N8VB 3MV7E 2G2RB 5F8QC 1LP9B 5DS8B 1NJ9B 3BEWA 1DANT 2XIDA 4PJXE 5L88H 5DRNA 3QCUL 1FZOB 2BY2A 2GUOA 4XZUA 1PD6A 3FRUA 2DQDL 1LP9E 1MIMH 2BC4A 4XHJD 4Y4KA 2O61B 1NAKL 4LRNL 3CX5K 4UMGA 3SDAD 1N2RB 3BKCH 1WLHA 1PQZB 3QULA 1BM3L 3BD3A 5E6IA 3P30L 1TTUA 1V7NL 4M1GL 2J8UE 1WTGT 3QIUC 5I17B 4DUVA 1RSFA 4U6VH 4LLYB 1OWWA 1T1WB 2FBJL 4XVSH 2CXGA 3CFDA 4MLSA 3G6JB 5FHAL 4R7NB 1CGWA 3KJ6L 4LLUA 4H0GA 4LKCA 4WY7L 2F53A 3SOBH 1T3FB 4S1RL 2EXYC 3SDYH 4LSDA 5IT2L 1RMFH 4Y88A 1XF3A 5HY9A 4YXKL 2ICCA 2ESVD 4GG8A 2NQCA 3LSOB 3Q5TA 4N8VG 1A6WH 2G60L 3HZMA 3AVEA 3NACH 2JIXA 3MRDA 5ITFA 4PLKC 3V7MA 3WIFB 2ERJC 1HE7A 4Y5XB 2HRLA 1A6TB 5D5MA 2PTTA 1IILE 3OKEB 4NSKA 4HUWA 5EO0B 4UOJA 1I1FA 3VXME 3UP1A 1UGNA 4X6DF 2B1HH 5J1AB 2BNQE 4L4JA 1PLGL 4U1HB 1KTDB 5JW4N 4JVUA 3KXFD 3L3IB 3OPZL 4X6DA 5B3NA 5C09D 1MLCB 2H26B 3FRPG 4PJEF 5BW7A 2DYPA 3EDJA 1TZHB 1N5YL 2KQNA 1JNLH 2Z91A 1PG7W 3BP7B 4PJEA 5IHZB 4J3OC 4HJJH 1VACB 3DX9A 3W11C 2VLRB 1IC7L 3QEQE 5BQ7A 5HI3D 3QUXC 5EORH 3EYQC 4OQTA 1EAPA 5GGRA 3C60A 3OSKA 4WU5B 1KLUA 3KR3L 4JJ5B 3OKOA 5L8LB 5TE7L 4FFYL 3ZKMC 1EXUB 1DBBH 3LKRB 1P9MC 4L5FL 1E0OB 3GO1H 4FQ1L 3RIAF 1SVCP 1YMMB 2DLTA 4WHCA 3ARPA 3L5XL 1L7TL 5EIVA 4OIBA 4WV1C 1FFPA 3HS0B 5E6IC 5ALBH 1LEIB 4XNUL 1NCAL 4IHOB 4LLDB 1X5ZA 4MNQE 1GGCL 5I1HL 3L3KA 4WJ5A 4APQA 4LKXA 5D7LA 2BHYA 1HHGB 3QUYB 5FUOL 1L4IA 4ODWB 3B9KA 3HG1A 3ZTNL 4ZXBD 5BVJB 4PLOB 1QSFE 5H37G 3P77B 3L95B 1QPXA 5BMFL 5CHNA 4M7KH 4P57A 2KBGA 4W6WB 4PFEA 4G9FA 2I26N 4ZOEA 2Q8BH 2FH8A 3HE6C 4LLWA 4WO4B 1KBGH 1FFQA 4P3WA 5HPMB 2XYCA 5BV7B 4MXQD 4O4YH 3FQTB 4WFHE 4R4BB 4KUCD 3UC0H 3I75A 2BVPB 5SWQA 1EEQA 4OZ4A 2I60H 1CVSC 2Z92B 1B0RA 1N7ML 1NAMA 2P4AB 3MROA 5HD8D 4BK4A 3EDEA 2VLJA 4KK5D 2R0WH 1YYML 4PV9A 4MQSB 1IGIL 5F7DB 4PJCB 4XCEB 1K4DB 3PP4H 3WS6C 3U9PL 5C9KA 3PP3K 2ADGA 5GZND 4J4PD 4FN0A 1I7TB 4UOW1 3BUYA 3MBXH 1QBLL 3O4LA 3C2AL 1WIPA 5A2JH 1BZ9A 1T6WA 2CDEA 1RURH 1KACB 1MCLA 1T5WB 4Q7DA 3SDCA 2QADC 4PRIB 3EOTH 1MFEL 5I15L 1ADQH 1EVTC 4LBEB 3QO0B 4XGZA 4D8PA 4NO0B 4AEEA 4OIIL 1A64A 1ZA6B 5FDYA 3IDGB 4U4BA 1X6NA 1X5JA 3U0TB 4R2GB 5HHXL 1IL1B 4WRLA 3H7BB 1JWMA 1I7RA 3VFWB 1Y6NR 1VEOA 3BP6A 4E41D 4KI5F 1B2WL 3P9MB 4G80A 2ZSVB 4FXKA 3UBXA 3E8UL 2BX5A 4JFFB 3VFMB 2XTJE 4IDLA 3EFFA 4DQOL 4RIRA 4HWBH 4L4TE 4UT9L 1RZIB 3ULSA 4JO1H 4KKCD 5I2IB 2DM7A 1XGQA 1DUZA 1OT1A 3TV3L 3DIFA 3N1MC 2WIIB 5CINH 1A2YA 1DTUA 1NDGB 2YSSB 3Q5OA 1QPPA 5EU4B 3I6GA 3N1FC 3O2WH 4XC3H 1KB5L 2AJSH 1F58L 4MD5A 4KJWD 2E6JA 2H32A 5JMRA 5DVOA 1WEJH 4LSVL 3EJJX 2V6HA 5EU7E 3O6ML 4JHBA 1AP2A 2NNAB 2YA2A 2BY0A 1CFSB 1CGTA 1G7LA 3MLZL 4JFYA 1A3RH 5HI5D 1MWAH 3FN0L 2YA1A 3MYZA 3CDYA 1DANU 1Q72L 3FQRB 5GRZA 4AM0B 3QZWB 4X4ZA 4Q9CA 4TNWK 3PIQA 1FORH 4X0KA 4OD2A 5GGTL 1U8PB 4QRSA 4HUXB 4QLRA 4P9HC 1AO7A 4MAUL 1FNFA 1BD2B 1Y0LA 3FO2B 4TUOB 3X3GH 4RWYL 2V7NA 5CS7A 4XMLH 2YMXL 4PREB 5FGBC 2BFVH 3NTCH 3LH2L 3W2DL 1QO3B 3STLA 4JB9H 5E8NA 5DVLA 3O3BA 4I5BB 3VMPA 3SDCC 1FC1A 3HPLB 2FECI 3VG0H 1HQRB 4YXLL 2H8PA 4GAGL 2PUQT 4TVPH 2OSLA 5EUOF 3ZE0E 5TE4H 3RVWC 1JRHI 3BKJH 4O51A 1YUHA 2W38A 2PW1B 5IMLB 3MV8A 1NLDH 4BM7A 4RMTA 1NL0H 4JO2L 4UNUA 5HJ3B 4ZO8A 5C08D 4YDKH 1N0LA 5BZDA 3IXAA 5E2JA 1HKLL 3MUZ1 4LHUG 5L7XH 1S9KC 4P46A 1MJ7L 1VESA 4KI5C 3U36B 1I1AC 5DWUL 3HZKB 2RIKA 5IVNA 3Q6FA 4KRMB 4F7CA 1CFVL 3CJJA 5EA0H 3V52L 4F7EA 4GKNA 5D1ZA 1G9NC 2X40A 5FCUH 4KQ3H 3RGVA 3QZWG 2DQIL 4X7DC 4D0BB 1XFPA 3EDKA 3LN9A 2DD8H 5T3ZE 4ZUUB 4ONGH 4GQ9L 5CBEA 3SPVB 3KPTA 2ILLA 3O45B 3QFJD 2Z93B 5EU3A 4QHKJ 5C7XL 5EBLB 4AEIH 4PD4J 1PSKH 5JIHA 1UADC 4RDQG 3MNVB 2V2WB 3T77A 1X5LA 2A1WH 2PO6D 3MRKB 4HWEH 1LK2B 1A5FL 3QXDA 1U6AH 3W5NA 1H0DB 4Z7UA 4D0CB 4IRJA 3ZE1F 4O2FA 4CDHA 1Q9WB 4BQ8A 5EFIA 2BSTB 4NQSA 3OKDB 1NFDB 3WFDH 3QAZB 1Z2KA 2OK0H 2X4RB 1TJIL 4DAGL 1MCNA 1GGBL 4MXVF 4JKPH 2IMMA 3BHBA 1NBVH 2F5BH 5SWSB 5C0AA 5HXMA 4C56B 3JVGA 3LQAH 5EB9A 3W39A 5K9OB 5TQ0H 4UU9B 3O8XD 4EI5B 4EOWH 3NIFF 3S37H 3MJ9A 5EWIL 2HT3C 3UTSE 4PRNB 5DFTA 3RVXD 4C56E 4J1UB 3EOBA 1Q0YL 3UTTA 3AXLB 4HDIB 3OZ9H 3X12B 1YEEL 5FOBB 1ZT4A 3GMNA 1EEUA 5D1XC 4PLJD 2YUWA 1AXSA 3RIFK 2A9ML 1C5BL 5I8OL 4I48A 1ZLUK 5IV2B 4G9DA 4YNYA 4Z5RB 2APXA 1DUYB 3V4PL 3PWVA 2F8VA 1ZT7B 4Z78A 4ZNEE 2MWCA 1YEDA 1U92A 3RWIB 1FCCA 3OXSA 1X5XA 2AJ3B 1P6AB 3CLEH 4HS8L 5J3HD 4WW2F 5D96C 2QEJA 5C0RL 4D3CH 4P23B 5E2TH 3VMOA 5GZOC 2W0PA 4N1EA 3ZO0A 3WHE1 3TO2B 2R23B 3A67H 3QEHB 2QHRL 4GAYA 1XF5B 5MERA 1TXKA 3PWJB 2BNRD 1YMMD 4QHNB 4YHKL 1MFBH 3LCYA 4O02H 4OGAD 3CFBA 1SJEA 5FKPA 2AXGB 2VABB 2P7TB 1GRWA 5AG9A 4JY5L 2CPCA 1H8NA 4X8XA 4HKZA 3CXDL 2DQTH 1X3DA 3MACL 3FOLA 3MA9L 5F7HA 1G7IB 3NCFB 3ZDZE 4Z7VB 3IAPA 2VL4A 1OCWL 1QQDB 1S7QA 4ZUWB 3FO9B 5D2LA 4KZEL 4KKAD 5HDLA 4DW2H 3GGWA 5I71B 3ZDXF 1VHPA 1UH4A 4NHUB 3JZ7A 2IQAB 4L8DA 2D7NA 1JYVA 2BY1A 4K3EL 4OQTH 3PP3H 2ED9A 4WO4D 3UTZA 3UPRB 2ADFL 4Q2ZA 4I18A 1OSPL 2GJZA 4ZUVA 2ED8A 5IHLB 4UAOC 2HT4C 4OLXL 5DTFA 5CSGA 3ESVF 5E5MA 4HF5H 4MNGB 2VITB 1PKQA 2EYTA 2EE9A 4YXHH 2DKMA 1CU4H 4JRXA 4MCYA 1NBZA 2ZCKL 1OM3H 3HRZA 2P5WD 4P9ML 1ZLVK 1I3VA 5T1LB 4RBPK 3VD7A 2QQKH 4MS8C 1MI5D 4MNGE 1JZ6A 4G6FD 4O2CA 1WZKA 1BF2A 3D48R 1CL7L 2A0LC 1IAKA 2E7HA 3WKNA 1WBXA 3BVNA 1FFRA 5MI0C 4I0PD 3V0WL 2CIKB 3W82A 1SBBA 1DBAH 1JHTB 3HNSH 4NO2B 3I50H 4TSCH 5IW1A 3UPAA 5DK3A 5E8DL 3MXVL 8FABB 4OCYH 1YEJH 1VKXB 4X5XB 3CZFA 3MBEC 3GM0A 3SDXE 3VJ6A 3BN9D 1ZE3C 2XQYK 3IYLW 4L9LC 3E2HB 3WLWD 4MNHB 1ZWIB 1LO3L 3WIIH 3RWHA 4Z77B 1S7VB 4WW2C 2A6JB 3WFHB 1JMXA 1XIWB 1A0QH 4NZUL 3QJHB 1NAMH 1CD1B 2VDPH 3HLAA 1A3QA 4N90D 4G8EB 4P59L 5GJSH 2IH3A 1MLBB 2ADIA 1FG2B 5DSCA 5D7JC 3O6FA 4JFFD 5HHOD 2Z9TA 3T3PF 2Z0BA 1FYTB 5KVFL 2W60A 3GI8L 4JREC 4F9LA 3I6LD 4HFWA 1EEZB 2F5AH 5I16A 1SYSB 2NR6C 3G5XB 2Y6SD 1INQA 3PGCB 4QRUA 2YBRB 4R0LC 4EN3B 5KG9A 3QBTB 4ODVL 1S7XA 5DGQA 4XP9L 3QUZD 2ZUWA 3GBNH 1INEL 3BYTA 1FV1B 4BKLA 1DZBA 1FNSL 4JFEE 5L9DH 1XR9A 3EFDL 2EDHA 5LWYL 4D9RD 2HWZH 1JE6A 4GRLC 3AC0A 4N5UA 3JUZA 4P5MB 4XI5C 1CBVL 4Y19E 3IFLH 2X1QA 5I66A 5EOQL 2PYFB 5GS0H 2X9WA 3PHOA 4JQVA 1S9VA 1OAYH 5KSAD 3PDDA 3LEYL 5CSZA 2P44B 5EBWA 1BF8A 4TSAH 1N6UA 5GGUA 4GH7B 2JJVA 4OGYH 3MR9A 2YOCA 5ELIA 5ANMA 3DMMC 3NCYS 4GG6A 3QUML 3T0EC 2ZUSA 4Y16B 5GRJL 2DTMH 2ZPKH 4XC1H 5D8JH 5JOFB 3IDXL 3ARGA 1FLRH 3VI4F 3SJVA 1REIA 4HBQA 4MQ7B 2OTUA 3CCHA 3VRIA 4HG4K 1OAUH 1KJ3H 3DV6B 3C5ZA 1N5AA 4LCWB 3VXTA 4HK3J 5HHPA 4FTVA 4ZYKB 1S7SB 1ACZA 1LQSR 2OR7A 4P5TD 3IXTB 1IKNA 4GMTH 4CDGC 5JHDA 2D2OA 4JG0H 4LCWE 3PWLA 3UYRL 4XNYH 5HGBA 3D3VA 3K2UL 3KYMB 4W68A 4ZFOB 1OSZB 1ULVA 4RGNC 1TDQA 4HK0B 2PR4L 5EU5A 2H32H 1TCRB 4QHUB 4YHMH 3DVNB 4HV8B 2DM2A 2GSIB 1GL4B 4N0YH 3ROOA 1ETZA 3PWPA 4QRPD 5FYJH 1MCQA 4NQVB 1UZ8B 3UBXI 1UFUA 3MYJB 1T2JA 1DQJA 5IGXL 4JFDB 1HZHH 2VL5B 2ICWA 1MWAB 4XNXL 1H3VA 5CJQH 5E2UL 3QP3A 3GHBL 2EIZB 3CU7A 2NY2C 4IOFD 2Y7QB 4UNTA 5FECA 4XWGH 4BUHA 4I77H 4C83B 1AE6H 1I75A 3QI9B 1DSFH 2OL3L 1UCBL 4FFZH 3LPGA 4R4ND 3TT1L 4E42A 5IMOB 5E94A 5BO1H 2A74B 2PYED 4HPOL 2Q7YB 1BBDH 4KDTA 3I3DA 2BMKA 2Y06L 4OF8A 4H0HB 1JCKA 1FNHA 2BDNL 1BJMA 1DLFH 2CLZA 3WFEH 3N9GL 1JI2A 4KZDL 3DGGB 5JXEC 3K80A 2A73B 2R0KH 3MJ6A 4BH7B 4PYGA 4PJ9A 4PGJA 3NFNA 3SN6N 1IAIH 3TN0B 1F2QA 5E8PA 1XH3A 1FO0H 4AG4H 1OPGL 2NY1C 3L1OL 5L2KA 5BXFA 1HQ4B 4QKXB 1J8HB 5CP7B 1DN0B 4XP1L 3OGCA 5F7EH 1EERB 4YQXH 4GKSB 3OR6B 1Q38A 3K4ZA 2GY5A 1ZHLB 4MJ5B 4TVPE 2QLVB 3CX2A 3EAKA 4XCFL 4ELMA 3MRLB 1YY9C 5DA0B 3C8KB 2EICA 3ARGC 5C6TH 4Z9KB 1JV5A 1PX3A 1G6RL 1OGAD 1XCQB 3GSUB 3B9AA 3WN5A 1FH5L 5HI4C 3DSNA 4LNRA 4HXAL 4MZ3A 4YAQB 3ET9F 3HZVA 2WBJB 2ERJB 3ARBD 3H0TB 1O7VA 4NN5C 4QRTB 5IW6B 4WFED 3ZE2F 2AQ3A 3LEVH 4M1CD 3MLXH 1KULA 2HTLD 2ESVE 2AJYL 1KN2L 2R2EA 1MHCB 2C3WA 2X4PB 1CVRA 4HIJA 3VWJB 2C4XA 5JQHC 2PXYC 5SV4A 1OVZA 5F21B 3VFVB 2ZP0T 4K3HA 3GMRB 3D0VB 3BE1H 1P6FA 1YY8A 1HSBB 4WVRA 1NPUA 1ZLSH 2FIKB 5JW4M 1JNHA 2A9NH 3UTOA 4WWKA 5CAYB 1A3LL 3QEUB 4GW5A 3MRFA 4RQQA 3CFIC 4LVHB 3BEWB 1MJ8H 4L3EA 2GTZA 1MF2L 4POZD 5DRNB 3KXFE 2X5PA 5KANI 3FQXA 2GUOB 1F97A 1NKRA 3MRCA 4P23D 3VG9B 4RMVA 4XZUB 5ADPH 3FRUB 5L0QB 3GIZH 5ERWA 2EDOA 4RMRA 4HH8A 4JGUA 2WNGA 3MXWL 2BC4B 1S78C 4W70A 1L6XA 4Y4KB 1RD6A 2NY5H 4FXLA 2XZCH 2OMNA 3GSVA 4NQDA 4WCYL 1SQ2N 4NP4L 4AJ0A 1B3JA 3QULB 4YBQC 1VGEL 2K1MA 5E6IB 3LMJH 3LAFA 1OW0A 2BVUA 2YPLA 1CF8L 1LD9A 3BPCA 3RVUC 3LHPL 2NW2A 3MO1A 4X6CF 3F58L 3RVVC 3KPLA 5ICXA 2DLFL 1LDSA 3CFDB 4JHAL 4N0UA 3ES6A 4N0RA 2BVOA 4ODSL 1ZLVH 1NMAH 4Z76A 4LLUB 2YN5A 4RBPH 3E6FA 1F02I 4LKCB 2BJMH 4NNYA 5EZLA 3ULUL 1MFNA 2F53B 3TC9A 4LLAA 5K9JH 1JHKH 4PGCA 5J6GA 1CZ8L 1UM4H 1XF3B 5HY9B 2YD7A 4R8WH 4GG8B 2AK1L 1X4XA 2ID5A 4OZFA 4PJ8C 3HZMB 2HVKA 2VZUA 2JIXB 3GSNH 3MRDB 5ITFB 4HIHA 2ZG3A 1N6QH 3EHBD 4H88H 4KTEL 4K2UH 3DYMA 2GAZA 2WQ8A 1BP3B 4CADA 3E6HA 2PTTB 3O4OC 5D5MB 4DOHB 4NSKB 4HUWB 4P48A 2D7TL 3RPIB 2AABH 2IAMA 1I1FB 4PB0H 3W0WA 2CMRL 3AMKA 3QHZL 2FX9L 2W9EH 1EFXD 4ELKA 1YJDH 2FDBP 3LDBB 1YNTA 4M6MH 4Y1AD 3T0VA 2NXZC 4X6DB 1VFMA 3PG2A 3K4AA 1L0QA 2X4OA 5T3ZL 2DYPB 1KEGH 5D71L 2APWA 3CFKA 1CDYA 2Z91B 4QXUL 1C7SA 4PJEB 5JDJA 1F6LL 3OF6D 1AQKL 1FSKC 3DX9B 5CZVL 4OTXH 5BQ7B 2ZUYA 4JQXA 4PRPE 1EDQA 3WDIA 5F9DC 1EAPB 4Y5VA 5GGRB 3ARED 3C60B 1KLUB 1S7RA 1RUPL 3OKOB 1MAMH 4U05A 3GSXA 4JFOA 5IKCA 3RI5F 4A6YL 4QTIH 2VXVH 5HVGB 2CO6B 4MAYA 5DQJA 3V5KA 2BXZA 3ZKXC 1FFPB 5J8OA 1UM6L 3SQOH 1CQKA 1FZJA 4M8QA 4ZS7H 2JE8A 4LU5H 1M71A 1EMTH 3L3KB 4BA8A 4WJ5B 4APQB 2NY4B 1MFDL 4LKXB 5D7LB 1NCNA 5J13C 1MCFA 4M3JA 3AB0C 3SGJA 4K94H 5ETUA 3B9KB 4HC1A 4E41E 3HG1B 4HJ0D 4OZIA 3UAJD 4IOSD 3EYVA 1WBYA 1HI6A 2VN7A 5CHNB 1OB1A 4P57B 5C2UB 2I5YH 1MIML 2FEDC 3C6LD 1JPGA 4G9FB 4ERSH 3O9WD 4LSSL 3BMWA 4LLWB 5B22A 1M6OA 3E0GA 1K5NA 4UV4H 1S3KH 3RBSA 2XY1A 3NIGE 4JZNA 4WEBL 5SWQB 4OZ4B 1RK0A 3CH1A 1I9JH 5DMJB 1B0RB 3RU8H 5FYKU 1V3LA 1NAMB 3MROB 3NMEA 2EIDA 5SWZA 2GJ6D 4Y16D 1QLEH 2VLJB 1H3UA 4FQCH 4R3SA 4PV9B 5E6YA 4IIQA 3OKMA 3TJEH 4XVSL 3T0DA 5A3IC 3RWGA 1NBQA 5MENA 4S0TD 4MDJA 3WFCL 3M17A 2WP3T 3HC4L 3ULVD 4XXCC 4BK5A 2ADGB 3CXHK 2VLJE 3DUSA 1FYHB 4HFUH 2Y25A 3BUYB 4JCMA 1GPOH 5EC1A 2YRZA 3BGFB 3O4LB 5DHVA 4P2RE 4ZUSB 4LP4A 3KHOA 1BZ9B 1AC6A 3D85A 2CDEB 4LF3A 3ZYIA 4ZFGH 3JV4A 3MCLH 3TF7C 3TA3D 5L6YH 2BSED 4XGZB 4D8PB 4JPWH 3FOMA 2R1YA 2VSCA 1BFOA 5E1AA 1CD0A 3RP1A 1AY1H 4FABH 2DM4A 3DBXA 2PF6A 5DLML 4JFDD 4P99A 1FL5A 1JWMB 1HIML 1I7RB 1A9EA 3BP6B 1R5VA 4MAYC 4G80B 3UBXB 4F2MA 5FOJA 3CDFA 5T1MA 2J5LB 4F15C 5CGMA 2AJUH 3PGFL 2FHCA 5HHVL 3EFFB 4RIRB 3BWAA 1X9QA 3ULSB 2LU7A 3UTQA 4ZO7A 4A2LA 5KVEL 5F9OL 5C08E 5CZKA 5EORL 1DUZB 3MOAH 3DIFB 1NCDH 4JDVA 4LQFH 3NOIA 1A2YB 3QIUD 3K0WA 4LCUA 1J05A 3QG6A 3IFOA 1FAKT 1DBBL 4TUJA 3GFUA 3I6GB 3GO1L 4M5ZH 2JJTC 5HHNA 1XGYL 4MD5B 4KV5F 1T03H 2H32B 5T1KA 5ALBL 4NC2B 3LN5A 3P9LA 1AP2B 1NC2A 4NWUH 4FZ8H 3RBGA 1G7LB 4JFYB 3BIKA 3QPQC 3QFJE 5LGHH 2E7LA 2EXYD 1ZHKA 3Q2CA 4BQCA 1DBKH 3JWDC 3PIQB 2KZ1B 5FYJE 4X0KB 4OD2B 3T3ME 4PLKD 2R4SH 1AO7B 4UDTA 2J12B 2DRUA 2HJLA 2OQJA 4LRIA 1FNLA 1G1YA 2V7NB 2W1NA 3LS5H 2Q8BL 2EH7L 4OCRL 2XA8L 1KBGL 5CJ8A 2EC9U 2UZXB 1IEAA 3STLB 5T1DH 5E8NB 2H3NA 1WFNA 5CP3A 3UC0L 2V5RA 1OAKL 4OV5A 3O3BB 4JPIA 5GS1A 3UXFA 3H3KA 5TGBA 2H8PB 5F70A 1NLBL 1U42A 2OSLB 5F6HI 4AQOA 4PR5A 2FZ3A 1MIEH 4FQ2H 4OLZH 4Z95H 4UBDC 5BOPA 5F6IB 5B3JE 4O51B 1YUHB 1ZV5A 4JM4L 5DQDH 3MV8B 3PP4L 4Y0GA 5F7NC 5DEGB 3L5WA 5LAXA 5BZDB 3IXAB 4YHLL 1F42A 1J0ZA 3WXVL 2E7CA 3QUXD 2ZNXA 3EYQD 4OLVL 1T89A 4P46B 5C0CA 1KFAL 4IEFB 3TZVA 3U6RA 3ZKMD 3SE9H 3Q6FB 4FRWA 4F7CB 1Z0NA 3S36H 4F7EB 4YGVA 4GKNB 4YBLC 5D1ZB 3H9HA 3RGVB 3BZDA 3PUCA 3RAJL 4JY4A 5E6ID 4NHCH 4QOKD 5CBEB 5HGDA 3I9GL 1A1MA 3UJIH 1EV2E 4RX4D 2CGRH 3JTSB 2AAVA 2LFGA 2HT2D 5HTSA 4FQIH 5EU3B 3QCVH 1WIUA 2BNRE 4PTTA 3NZHL 2IJ0C 2VZOA 3KLHC 4KTDL 3T77B 5DT1H 2XXMB 1LO5A 2IF7A 1WUNT 3OKKA 3QXDB 4IDJH 5JO5A 4Z7UB 4IRJB 4XMKL 1HILA 4O2FB 2VZSA 1PG7L 3BGAA 3CIQA 5EFIB 4NQSB 2YD4A 4FNLH 2E7LC 3HE6D 5HYJE 1U93A 4HUKB 3VWKA 5BOZG 5F71A 2B4CH 5F1OB 4LPYA 4S11A 4B53A 3BHBB 3OHXA 5C0AB 3W39B 5K59E 4OCSH 5CINL 1JBJA 4PJHA 3UROR 4GMSH 2NX5A 3SGKC 2JCCA 3K8MA 4KHXH 2V17H 3JSSA 3P73A 4XC3L 3ULUC 1OAZL 1X5YA 2AJSL 2VTFA 4G6KH 4JFHD 5F7LB 1T4KA 1CT8A 1WEJL 1HINL 3EOBB 3UTTB 2F58L 2QQNH 3TPUA 4PJDF 1ZT4B 3GMNB 5GS1C 1VFAA 5C0BD 4Z7QE 1A3RL 3CVHL 4I48B 4G9DB 1CE6A 4YNYB 5HGHA 4LSUH 5HVFB 1NBYA 3BPNB 5ENWA 5D72H 3L3JA 3SKMA 3PWVB 4Z78B 1FORL 1YEDB 4YC2B 1U92B 4UT7L 2QADD 1F45A 4Y4HC 3OXSB 3H42H 2FGZA 4NBYB 3CU1A 3N1PC 4KRPB 3RY4A 5BS0A 5E70A 1G9MH 5CILL 4KGLA 1MCWW 2VH5H 3B83A 4GAYB 1MVFA 5MERB 1PDKA 3WIHL 3VG0L 3CFBB 2DI7A 1SJEB 5FKPB 1JPSH 3MRNA 4JFZH 2EYSA 1P84J 4XH2A 4HKZB 4JR9L 1TPXB 3FFDB 3FOLB 2XN9D 1XGPA 2B5IB 5D7LD 1MJJA 3RUGE 1CR9H 4WEUD 3ULVH 2J8OA 4YDKL 1S7QB 4P5KA 1YEIH 5JR1L 4N90E 5D2LB 5CKAA 2NXYC 2O5YH 1PZ5A 2MTPA 1EUTA 2R69H 3GGWB 5HHOE 4UTAH 2BXYA 1RAMA 3BZFA 3I6LE 4L8DB 4JM2F 4IRSA 5EA0L 1U8HA 5D2LE 5FCUL 3JTTA 3UTZB 2EXWC 4JM2A 5F96L 4ZOCA 1NCCH 2DD8L 4Q2ZB 4I18B 2GJJA 4ZUVB 3NAAL 5T5FH 1A7PL 4DKEL 2WV3A 5DTFB 5E5MB 1ORSA 4XP6L 1PKQB 1YPZF 2EYTB 4NQCE 1RIUL 2J1KA 1CICA 4MCYB 1NBZB 1QSED 2N1KA 2XOTA 3HRZB 1PSKL 1YPZA 1U3HA 4HUVA 2Y72A 1VEMA 3R8BB 2VDNL 3HMWH 4XPBL 4NRYA 3KPSA 1W72A 4ZOBA 4HKJA 5HHMB 1CFTA 4AEHH 1IAKB 3VXUD 3WFDL 1WBXB 3BVNB 4PJBF 3H6JA 5TF0A 3RX7A 4C57C 3H9ZA 1R3IH 2XQYG 4UQ3A 4LEXH 4YHZH 5DR5H 1GIGL 5IW1B 1NBVL 4TYUA 3SDCD 4P3CH 3LQAL 2B2XH 1E4KC 4M4PA 5I1KH 3PABA 3CZFB 3RVWD 3O0RL 4FQQA 5C0IA 4EOWL 3IDUA 3SKJL 4WHYH 3FT3A 4ZD3L 3VJ6B 4X99A 4YZFF 3BI9X 3KVQA 5JW5A 4NKOA 4ZSOB 3RWHB 4TRPH 1HHKB 2CLVA 2P5ED 1BAFH 3B9DA 4QRRD 3IU3A 3OZ9L 4IJ3B 1OARH 3HLAB 5JORA 1UH3A 1JWUA 1ZANH 2IH3B 3QIWC 1PKOA 2ADIB 5E8EA 4LLMA 3OB8A 5F97E 2BRQA 5DSCB 3O6FB 4ZSOE 4RWHA 4Q9BA 4KI5D 3U7YH 1DQTA 1I1AD 5KS9F 4HFWB 4DFIA 1C08A 5I16B 4M43L 4QRPE 2VDQH 1AI1H 1INQB 2DQJH 4QRUB 1NGYA 1CLOH 2W59A 5B8CA 3B5GA 5KG9B 3OB0K 1S7XB 3L3OB 3ILQC 4ALAH 4BKLB 25C8H 3CGTA 5KAQF 1MRFH 3TYGH 4NJAH 3TWCL 1XR9B 4PJ7E 1K3IA 4H25A 4H8WC 1MFBL 2R9HD 3REVA 1W0YT 2XKSA 1ZLWK 2PYEE 5I66B 1WWBX 5HYFA 2YD5A 2YD3A 5KSBA 3OG6B 5F9JA 3PHOB 2GEEA 1S9VB 4UT6L 3CK0H 1MUJA 4XPFH 1N59A 5CSZB 5EBWB 1BQHA 4AH2A 3AGVA 3E1F1 5GGUB 3VGFA 3MR9B 4TPRH 5E2WH 5B38A 5ANMB 5I1JL 3MOBL 4GG6B 1KTKE 1IMHC 3PQYA 3JWNC 3VD9A 3TVMC 3ARGB 3SJVB 4DW2L 3KNBA 3TESA 3ZYJA 3CCHB 1CDCA 3VRIB 1GGIH 4PG2C 1GHFH 4HS3B 1ED3A 1AKJD 2Y1VA 3C5ZB 4GG6E 4PGZA 1N5AB 4ZPTA 4Z7NE 2GY7B 4OQ1A 3VXTB 5HHPB 2HT3D 4FTVB 5GHWH 4C4KO 3PWNA 1NCWH 3VCLA 3THML 5C0NC 5MEQA 2DJ4A 4O00A 5JHDB 4OI7A 1OGAE 3PWLB 5HGBB 3D3VB 3U9UA 2CKBL 4IMKC 4LEOA 4HF5L 4OSUH 4HT1H 2KQMA 5I76A 4F7TA 1WCQA 4YXHL 5EU5B 1UA6L 1I9IL 4NWTH 3WXWL 4OFYA 4YPGA 4U6YA 3OWEA 3VXRD 4WFEE 3ROOB 1ETZB 3PWPB 3K46A 3LKSA 2GK2A 4K9EH 7FABH 2EEDA 1IC4H 5D1QC 5BRZA 4OZGF 2FRGP 1BJ1J 4RMUA 1DQJB 2DDQH 5IFAH 4LAJH 1AHWA 2ICWB 4BZ1H 4POUB 2H6PA 1U36A 1BECA 5FECB 1S5IH 1DBAL 1ACYH 3HNSL 4OJFL 1E6OH 1O0VA 4KHTH 2UV3A 1NEUA 4D9QD 1P2CA 2H1PH 3SCMC 5F7KC 4E42B 4OCYL 1MEXL 5E94B 2EECA 3LB6C 1E4WH 2FR4A 4ZAKC 3RZCC 2BMKB 2BOBA 3P11H 1LDPH 4QGTA 1TLKA 1VFOA 4L8SC 1EEYA 2CLZB 1JPTH 1U8NA 5DJYA 4AEFA 1TZGL 2OR9L 3VRJA 1A4JA 1BJ8A 4G8IA 5I1DA 4PJ9B 3NFNB 5E8PB 1XH3B 4F57H 2A6IA 5IMMA 4ZFZB 1HKFA 2AJZA 4Y2OA 5L2KB 5BXFB 4UZGA 2CXKA 4IRJD 3OGCB 5FM8A 3W9EA 4ZG1A 4C59B 1JP5A 5AAMA 2OCFD 3TO4C 4HXBL 4ELMB 5J11C 3TCLA 5T5NF 1JV5B 3GBNL 4V1DD 5C0AD 3WN5B 2HT4D 2DOCA 4LNRB 3UZEA 4NO3B 5JHLH 2NTFA 1LNUA 3HZVB 3H3PH 4ODBD 3HR5B 4ELME 2UWEF 2HWZL 1CGUA 3R1GH 2YD8A 4MS8D 1YYLH 1D9KC 2F19L 2R2EB 4IRZL 5I9QB 3QWRD 1RVFH 4LHJB 4HIJB 2A0LD 1KB5A 4TSAL 5FGCE 3G5YA 1EGJH 3EOAA 4OGYL 4O58L 3DWTA 4FQXC 4Y2DC 1RZJL 3TBWA 1YY8B 4XC1L 3OX8A 5D8JL 3S4SA 2EH8L 3KHQA 3WJJC 1T1YB 2VUOA 5D7IA 1JNHB 4WWKB 5J89A 5HVHB 4GW5B 4WGWB 4XBEH 3MRFB 4PJGE 1WK0A 4RQQB 3MLSH 1G84A 4L3EB 2GTZB 2YZ1A 3MBED 2B20A 3QYCA 2MHAA 1KIRA 4Y1AE 3T4YA 5D93C 3FQXB 4PJAA 4Z0XA 3RFZC 3B6SA 3MRCB 3WS3A 5GGTA 4MD4A 5IROC 2R56L 5IG7A 4UIKH 2D3VA 1KIUA 2YKLH 4ODUA 4H20L 1TVBA 3VRLE 1JN6A 1T5XA 1JYWA 3NGBC 3GSVB 4NQDB 1PEWA 1A14L 5D7JD 3ZKND 5A2FA 3S3PA 2YD1A 4N0YL 5AD0A 1FGVH 4R6UA 2NR6D 2YPLB 5CBAA 5FM4A 3V6FA 1AGEA 1HDMA 2FX7H 4P9HH 1B88A 5FYLD 2NW2B 1GZQA 3MO1B 3KPLB 4FG6C 5ICXB 4UB0H 5DD5L 2YPLE 4N0UB 3ES6B 4PG9A 4XWGL 4Y4FA 2BVOB 2X4NA 3OAYH 4RGMB 2AQ2A 4Z76B 3E6FB 4PJIF 3HUJA 1QKZH 4NNYB 4ZQKA 5EZLB 4LGRB 4LLQA 4GRLD 2Z8RA 1T1ZB 4LVOB 4PGCB 4XI5D 3U7WH 5J6GB 1A7OH 3IT8D 4N0UE 5BO1L 5I74C 4F7PA 3OR7A 1EH9A 2VDKL 4U1JA 4OZFB 2HVKB 5TE6L 4G43A 3FTGA 1IBGH 4JRXD 1AR1D 3FAWA 3DMMD 3T0ED 5CMAA 4NNPH 5D2NA 4K7PL 4CADB 3DXAA 3E6HB 4Q0XH 3RDTA 5I19H 3UTPE 1FO0L 2IAMB 4U1LA 3RTQA 4EIZC 4AG4L 3BKMH 5A2IH 1NCBH 4WTXA 2P49B 4X7SH 5F7EL 4ELKB 4S10A 4Z6AT 3HE7C 4EXPX 3T0AA 1YNTB 5B4MC 3EZ8A 4WEMB 2CKNA 1F4XL 5IBUG 2GJ6E 1BFTA 2X4OB 1FFOA 1RUAL 5FIEA 4FQJH 5C6TL 3MX0A 3CFKB 2BVTA 3G6AA 3QCUH 4W4OC 3ULVE 4RGND 2AEPH 4M5YL 4P2OA 4Y5VB 3SY0A 1BFSA 2AJVL 1S7RB 1NAKH 3TFKD 3OB0H 4LRNH 1UWEL 3GSXB 4JFOB 3IGAA 3V9FA 5IKCB 2EEAA 1BM3H 4LOUC 4GRWH 3P30H 4OZHA 5C71A 4U33A 4X7EC 5DQJB 3V5KB 4U7SA 1A8JH 3VA6A 2NY2D 3O6FD 4NC0B 2IBZX 4F9PA 1FZJB 3BE1L 4M8QB 5LQBL 2CH8A 1M71B 4KROC 1F3JA 3VI3E 4RAUA 1ZLSL 1ZLWH 2E6PA 2FBJH 4GS7C 4ZODA 3ZHKA 2R39A 5DJ0B 1NFKA 1MJ8L 4WI9A 3BPLC 1UWGL 5FHAH 5ETUB 4TULL 4FP8H 3KJ6H 4NM4L 4OZIB 3WUWA 1AGCB 4R26L 3EYVB 1G7HA 1KYOK 1WBYB 3FT4A 2AW2A 1HI6B