4LFHG

Crystal structure of 9c2 tcr
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
229
structure length
222
Chain Sequence
b'GTKSVTRPTRSSAEITCDLTVINAFYIHWYLHQEGKAPQRLLYYDVSNSKDVLESGLSPGKYYTHTPRRWSWILILRNLIENDSGVYYCATWDRYKKLFGSGTTLVVTDKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWQEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEESLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 9C2 TCR delta chain
publication title CD1d-lipid antigen recognition by the gamma delta TCR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 222
sequence length 229
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lfhG01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lfhG02
3QUKB 1D9KA 2YUXA 1RZKC 4OBRA 5E8OB 1GIGH 5HHQA 3KPRA 1SBSL 4C55A 1JGDB 5DTFA 4P57B 4ZPVB 4JFED 4DGYH 4LVHC 2AQ2A 2NTFA 4R8WL 2ZUQB 2AEPL 4ALAH 1KCSL 3MNZB 1AGDA 3G5ZA 3SE8H 4JFFE 4L4VD 3RWCA 5L0QC 1AXTH 2J8UE 2HVKA 2UY7A 4MXQC 5EU7C 3RA7L 1KJ3L 1I9JH 4U31A 1LO0L 2X4UA 1N8ZA 1BFVL 5LGKA 4PP2B 5D71L 5DJYA 5ADPH 5JDSB 5C0CD 4X4YB 5J12C 5FYKL 3HB3C 3U4EB 3NFPB 4PS4H 5I73C 1JPFA 3CLEH 4LF3A 4RCAA 3QUZB 1WC7B 4WU7A 2ADGB 3DHMA 4OZFH 3SOBL 5ICYA 3LAFA 4FQLL 1A9BB 4AMKH 3ARED 1RZ8B 5FKPB 2UZYB 5ID1A 4JCLA 3G04A 5EU3A 4LVHB 1ED3A 3TLRA 5C6PB 4JKKA 5C70A 4OT1L 4D9RD 3IDMA 5DUMH 3BESR 3P73B 4LSUH 1CE1L 4OB5H 5L0QB 1PX3A 2P24A 4IOIA 2UV3A 3JV4B 3S9DB 2VE6A 5ILTL 4OCSL 3V6ZA 2XWTA 3BKYL 2A77H 4OLEA 2IEPA 3T8XA 1MY5A 5CIPH 5IESL 1TZHA 4ORGB 2PYEB 4YDVB 5I17B 2JJSA 4UTAH 4XXCA 5JQ6L 5J12B 1FG9C 5DA0B 4JFZH 5I73B 5F8RC 1J10A 4PJXE 1J8HD 3SDAD 3QIWC 1EHLL 3C5ZA 2W9DL 4Q7DA 2AI0L 4BZ2L 5KS9B 3CPLB 3HHRB 4Y4HD 4QCIB 1KFAH 5DK0A 4OGYL 5JZ7D 1YQVL 1J1OL 4MQTB 3ARZA 3U30C 1IGFH 4X4ZA 2A74A 1P9MA 4CL7A 3HMWL 2NX5A 4I77H 1U0QA 3BIBX 3TA3C 2FGWL 1L9NA 3MV9D 3H7LA 5JIHA 1A3RH 1RFDL 2ZCHL 5DMYA 1UH3A 3B2VL 1IQDA 3FO9B 4MA7L 4NHUB 1UM5L 5J7CC 1QSVA 4WDIA 5K9OA 1W8NA 4RGOL 1FAIL 4MB4A 3MCKA 3REWB 4AIXA 2L7JA 2R2CA 5ANMA 5CD3A 3QIWB 3U0TB 2H26B 1GZPA 2HFGL 3K7UA 4XP1H 4DAGL 1MUJA 4GUPA 3IDJA 2V2TA 3VFGH 1AR1D 3PJSB 3NA4A 5D1XB 2GJZA 1Q94B 4ZUSA 4MMZC 5J6HA 4R26L 3S97C 3PQYE 5I66A 4UQ3B 1HHHB 4PJAE 1MHHB 5JA9A 4FABL 2IQ9H 3BGFC 4JHAH 1OP9A 2VIRB 3RGVB 4NT6B 4MWFA 3TA3B 4NRXA 3H9HA 3MJ6A 3Q5OA 2DI8A 4IDJH 1SYSB 2ZCKH 5CD5C 1XEDA 3O8XD 4QRRE 5AD0A 4POZD 3NH7L 1CD9B 2R0ZL 3TGXA 3MLVL 3G08A 3JUZA 2X70B 5ICZB 1NQBA 1VSCA 1VACB 2PW2A 2Y07L 2ZPKL 5GHWL 1TVHB 4WEBH 4N9GB 5D1QA 3G6DH 2M8XA 3QG7H 4C4KT 1WJ3A 1Y18A 1V7NH 2XRAL 3G5YA 1U91B 5DR5L 4Z7WE 5ESVB 2A0LC 2WZPD 3UZVB 3D1MC 1ZT1B 3U0PA 3DYMA 3MJ7B 2QQKL 4JPKL 2A9NH 3ORJA 3N1QC 1I9IL 4QT5A 1ZGLP 5BW7C 1KLUB 3F12A 1NEZB 4J3TA 4DJMA 3BGFB 5F9AC 3H9SE 1FFNA 4NUGL 1C5DA 4X6CA 1A1MB 4HXAL 4PRPD 5T1MA 3WD5H 2UZXB 5F44A 3HE7D 3WFDH 5EU4B 4OFDA 4G9FA 3GEWB 4XPTL 5HSFA 4K8RL 4LFHD 4P5MB 5LXGL 2BVEA 2EDLA 4ZXBC 1KTLA 1I8KB 1OGAE 2J1KA 5I1KH 4PJFA 1S5IH 3CFKB 2D7NA 1KGCE 1AXIB 4U49A 4FOMA 5DRWB 3VFSB 4K07A 1IGCL 1QYGL 3SJVD 3O2VH 3WIFB 3ULUE 3ARTA 3E6HB 1T1YB 4R97C 4CADA 5CGYD 3P3YA 5IV2A 4TOYL 2H32B 1R24A 2MKLC 2F53E 1D5IH 3GNMH 1BF2A 5D7LE 4Z7NE 1FFQA 1MFAH 4MAYC 1CL7I 3MNWB 2DM2A 2O5XH 3BZFA 3WNLA 3A0OA 4FTVD 3WHE1 1TQCC 5AWNH 4ZXBB 1IM9A 3T0VA 5BQ7B 4HIEB 5L8JB 1ONQB 2H3NA 3CVHL 3EJZC 1J1PH 2APTA 4D9QD 1CL7L 5T1DL 4O02H 5JW4R 2BOCB 3NABH 1U8PB 4DTGL 1UWEL 2WP3T 4S0TD 1XCTB 1KB9K 3S37L 1RUML 2RFXB 2V2XB 4B7IA 1I1YA 4HKXB 1NCAH 4O2CA 2I5YH 4R97B 4N0FA 2EYRA 2Q3ZA 4DCQB 1LWRA 5DQDH 1N59A 2YPVH 5J1AA 1M7DA 4MAYB 5HDQL 5FCUH 4ZFOA 2ZJSL 3MSPA 1EO7A 4MZ3A 3MRHA 4PJXA 1TQCB 2G5BB 1BBJA 2EIZB 2CGRL 4OV5A 1ZHKA 5JOEA 1J0HA 4NFDA 3U46B 3KYOB 3MRRA 3VWJB 2JLLA 2VDLH 5LGHH 2VMFA 3VFUA 5IBLD 3LN4A 1KIQB 1YEJL 4AEHH 4ZFGH 3EYOA 5HHOB 5EOCH 1C7SA 1CXHA 3MLRL 3MNVB 4NWTL 1G6RH 4M62L 8FABB 3ULVD 4X5XB 3CMOL 3QNYB 2NQCA 5H37H 3H3BC 1BEYL 2ED9A 1GZQB 1KPVA 3VW3L 4XAWL 1IGJB 2OSLA 1B6DA 2QSVA 4OUUB 2B2XL 4KGJA 3TCLA 1DDHA 3MMEA 5BCAA 3CDCA 3BVNA 4JFPA 5C08B 4HGKC 4LARL 4OZHF 5JORA 3VWKC 4MA1C 1JUFA 2IH3A 2AP2A 4KUZL 3UEZA 4FMFA 4JPVL 3VJ6A 2NY2C 2ICWI 4AIZA 4LVNB 1W72B 1E4XI 5DHXB 3CUPA 5IHUL 4Y1AE 3PQYA 3C08H 4PJAA 1J18A 4U05A 4XTRC 4HLZG 1YEFH 4L29B 1TDQA 4IMKC 4L3EA 4ELKB 4I13B 1DN2A 5JPNA 1JHKL 3L5XL 3VFOA 3QH3B 1SBSH 1T3FB 2P4AB 2CDFA 4YHMH 1EERB 4LLDA 1U8IB 4X4MA 5D72L 3BZEB 3SY0B 1T20B 2Y06H 1NC2B 2R23A 5C07D 1CT8B 3MRFA 3U7AA 1RK0A 1KCSH 4RWHA 2YC1A 3BE1L 4RMQA 5EH1A 2BFVH 3O4LA 3VWKB 4ZO8A 4MA1B 4K9EL 4FXKA 2NY2B 1LO0H 3ARBA 5KSVB 1GSMA 3MTRA 5KG9B 3QWQB 4Z7WA 4PJ9D 1UM4L 3PV7A 4QRUB 3Q6FB 2OM5A 4LRIC 1JGEB 3QIUD 1Q72L 1UB5A 3GIVA 5E99H 5T33L 2P8PB 4JO1H 5SWQA 3CNKA 5GGRY 3MV7D 4F57L 3H9SA 3ZMRA 1ERNA 2PO6A 4G7VL 5FO7B 4HXBH 3FQUB 4F7TA 3NGBC 2AJXL 5FF6A 4JN1H 1Y6MR 5DWUL 1EAPA 1QACA 3G6AA 5DEGA 4FN0A 5DRNA 2XG5A 2M26A 1MREL 3FFCE 4WNQB 4LHUA 5EOQL 3FL7A 3VFVB 5JPMB 4KDTA 3OKNA 3MO1B 3PHQB 5FK9B 1OGAA 1GOFA 5DFVC 1NFKA 3PWLA 1KTRL 3CLFL 2GITB 2ZOKA 1UEYA 5JHDE 2X1PA 5C0JA 1AFVH 3BKYH 2Z4QA 3VGEA 2AV1A 1K4DA 2JIXD 1OARH 3GZKA 3NFNA 5DC4B 5IESH 2XA8L 4O5LH 3CCHB 5IVXF 4PREB 5DD1L 5EOTB 2CMRL 4KHXL 2ADJB 1B0WA 1ZVSB 4OF7A 3NIDF 4R2GC 4XC1H 3S5LB 4NHCH 4O2EB 1H3PL 1I8MB 3NGBB 3VXUD 1JL8A 1U58A 2F53A 5IJKC 3W2DL 4E5XA 1CE6B 1R5VB 2ICEB 4P2RE 4P9ML 5D7LA 4KDWA 3LHPL 5LKNA 4KK8C 4JRYD 3BH8B 1YQVH 3WIHL 2BVOB 3O45A 5FO9A 4NRYB 1H5BC 1TVBA 4TUOB 3SE4A 3QPXH 4FQXA 3RAJL 3N1MC 3PP3K 1OWRM 1HN1A 4DKEL 1MRDH 3U1SH 3KGRA 4RNRB 5ITBL 1T5XA 1Q9WA 5C0FA 4YXHH 3H0TB 4HV8A 2GSGB 1XF3B 4NWUL 4EDXB 5GRJL 4R2GB 1LO4L 5HYQB 2VC2L 1KB9J 4ZUWA 4JDTH 4X7FC 5HPOA 4MX7A 4LSRH 2VDKH 1RZJL 4Z0XB 4MXWL 1Z3GH 3D85B 3DX7B 1ZLWK 1NCNA 5F3BA 3E8UH 4YHLH 2E9JA 1YJDC 5IG7A 4RMVA 3T3ME 2D3VA 2J8UB 4XCCL 3KWWB 4YGVB 1DQDL 1GPOL 1H5BB 4OLXL 3QEQB 5DT1H 1HSAA 5ENWA 2DF3A 3MRPA 1HKLH 2VLRA 3F62A 3OGCA 2D0HA 5EPMA 5CJXA 4UIKL 4W6YB 2XKSA 5E5MB 1NSNH 1QLRA 5HGDB 4TSCL 2FZ3B 3BRDA 4OI9A 4TNVK 1TZGL 1UZ8A 4WWKC 4HGMA 1DANT 1F3JA 4RAUA 3BP6A 4K94H 4ZSOE 3MOAL 2Y07H 4S1RH 4HUXB 4NZUL 4ZFZA 1Q1JH 2XZZA 1CI5A 4Z7UA 4RZCA 3KVQA 1JNHA 2AQ3A 2FWOB 3VRIB 2VUYA 4NN6C 1TCRA 1ZEAL 3RWFA 4PYHA 1RK1B 3D2UD 1BOYA 4PJIE 2QQKH 1EO8H 4KC3B 4WJ5A 3CJJA 2FYYA 4Y5XC 2OL3A 1B2WL 3KPPB 4LSPH 5DMKA 4MNQE 3BISA 4HXAH 3QHTC 4L3CA 3SQOL 3OJDA 1KTKE 3QUXD 5CBAA 2JK5A 5C0GB 2DOCA 4ISVB 4AG4H 3X17A 3IXAA 4K8RH 5TQ0L 4WWKB 1I7RB 3PUCA 4C83B 1ZS8B 1HNFA 2E5EA 4AQ1B 3LH2L 3P4NB 1FORH 4LCIL 1KIRB 3C8KB 1MVFA 1J05A 25C8H 3DSFL 3BPCB 1P2CB 1M7XA 1ITBB 3WUWB 1LVEA 1KC5L 4HIIB 1MIML 3MR9B 3QR2A 1U3HA 5HGGS 3RVTD 1SBBA 3QJFA 3VD4A 1OB1A 3L95B 3LKSB 3NAAL 4M43L 3WIIL 4ESKA 4UB0L 1XMWA 3CZFA 2VQTA 4Y5XB 1TJIL 3VCLB 2YD5A 4YJZL 1IGCH 1X5GA 2XT1B 2YBRB 2VZOA 4PTUA 2AXGA 3S3JA 4PJ8A 4OIIH 5EFIA 1LK3L 1ADQL 1JN6B 3IJYA 2JKXA 3QQ3B 3IDUA 4JRXA 1F4YH 1KN4L 5EU7E 2G60L 2VLME 7CGTA 3OKLB 2KZ1B 1KJ2A 4AEEA 4S1DC 1D5ZA 4RAVB 4NKDB 5F9OL 3HAEH 3BAEL 5A2FA 2HLAB 3T4YB 5EU6A 3TP4A 3LIZH 7FABL 4G8EB 3OQ3B 2SEBB 3DUHA 2R1YA 5T5NF 2HG5B 3CVHH 5C0AB 1W0WA 3FFCA 5BZWA 3FFDB 5ICXA 4S2SB 4U6XB 4F58H 2IAND 3K1DA 4M02A 1F3DH 5DEFA 3RKDC 3VD3A 1LDPH 4LSQH 5F7UA 3UTSB 5JHDA 3TBWA 5SX4I 2Q86B 5B8CA 3W82A 4YUEL 1B4JL 4LP4A 3N85H 2EKJA 4RWYL 3EYFA 1AGFB 1FZKA 4KJQD 4EI6A 4OZFA 1I7ZA 1MOEA 1TENA 2ZJSH 4HK0B 1XF5B 1FVEB 3DJ9A 5MEPA 2P5WD 1QSFB 1LO5A 1DVFA 1ZGLA 3RY5A 1F6AA 3OXSB 2C1OA 4QRTB 1OLZA 4P2RA 2F58H 1LMKA 2AABH 1R3KB 1XIWA 3EYSH 4K71B 3TT1L 2RGSA 1I8IA 3O3AB 4FQQA 4LL9A 3DNKA 5HPMB 4CVUA 3ZYJA 1R3JA 3NBNA 1NMBL 2QHRL 4OLZL 3EAKA 5TFSL 5ACZB 5DMGD 5IW1A 2JF1A 4G9DA 3BEWA 2F54B 1BEYH 3H7BA 3JVGA 5D5MB 3AVEA 1KIPA 4JY5H 3EIFA 2IALA 3CXDL 2WLYA 3VW3H 3MV8E 3W39A 1NLDL 2NY5C 3WS3A 2ESVD 5I1DB 2HVJA 3MRMA 1ZSDA 1A1NA 1CFSB 3GMOB 1BECA 3HG1B 3WLWC 5KVDL 4Y16C 4KTDL 5SWZD 4JFDE 5KSUB 2B0SH 4JKMA 2Q6WB 4EUPA 4JPVH 4N1CA 3X3GL 4ZUVB 4WO4D 3ZDYE 5AZ2L 1L0XA 3V6OC 3G9VA 4L4TB 3FQWA 1JF1A 3QUML 5I16A 4Q0XL 1PW3A 3VG0L 4EI5D 5D1ZA 3MRQA 3PL6D 3D87B 3W81A 5KOMC 4KXZH 4RGMC 5F89A 3H6JA 3SDXA 2YPLD 3V5HB 4FNLL 2GJJA 4Z7QE 4X4XA 3BH9B 1Y6NR 2XPGB 3TBYA 4DVBA 3KPOB 1ZHBB 3QEUA 4ODHL 4E42A 1GRWA 2DI9A 1P1ZB 2OTUB 5E08L 3VFPA 1D5BB 5F1IB 1IC5L 1UACL 3BE1H 4ZSOA 4Y5YA 4LDEB 1F4WH 1RPQA 3QNXA 3STLA 3JTTB 4ZTPL 5IFJA 4H0HB 1T66C 3SKUD 3IF1B 3KG5A 4M1CC 2NXZC 4LHJB 1U8LA 5A2KH 4I0PD 2BCKB 3C5SB 5DVNA 1JGDA 1X5HA 4OZ4B 5BO1L 2PKDA 4KPHH 4P57A 4ZPVA 2DM7A 2O26U 4RA3A 2VLJB 3I6KA 3JZ7A 3PWPE 5BS0D 2DQIH 4Z5RB 5GSVB 1FL3A 1AI1H 3MNZA 3EO0B 2GSIB 2A6DB 4X6EB 1EEYA 2WUCL 3B2UD 1X5JA 3NIFF 3MRCB 2Z91B 4MNQA 4RGMB 3QIBA 4FFYL 4OZFG 5FM5O 5CLWA 1PEWA 2CJUL 2BNQE 4MAUH 4DUWA 2X1WL 5FB8B 1MREH 2Q8BH 4RFEA 5J3HD 1SJHB 2D7QA 4HWEL 4U4BA 3CSPA 1KBGH 2YK1H 2GW5A 3QFDB 3SQBA 3OAUL 4X5WA 3W11C 5ISZE 1MCDA 2Z93B 4HH9B 5IB2A 5MERA 1G7LB 1WC7A 1TZIB 5GRXG 1MJUL 4LU5L 1RZ8A 5FKPA 5F7KC 2FX9H 3E2HB 3EW3B 4LCCC 5DD1H 5GS1B 5F1OB 2CMRH 4QF1B 3D5OF 1BIHA 3O9WC 1U2CA 2IPKB 1BD2D 4GBXC 4D8PB 4BQ8A 3P73A 5CSZA 4N68A 4I8DA 1GC1C 2EXYC 4XPBL 4JZNB 1CK0H 5I1IH 3HZVB 4MJIE 4XNYL 1C12A 3TPKA 4MNGB 5DJ6B 5D9SB 2DL9A 4PGDA 2OZ4A 3EGSA 4YDVA 4NQXA 5I17A 4OCXH 4QWWC 4JG1H 5C0RL 2EDEA 5JR1L 1WFOA 1G9NL 4JKWA 4KQ4H 3ZSSA 4DGVH 2AEQH 3KXFE 3WSQL 4NQEB 2DJUA 2XQYK 4NCC1 4WUUB 4NQCB 4LCCB 4GKOA 3QQ9D 4PJGB 3O9WB 3I84A 2ED8A 1BBDL 4WHTB 2DS4A 1AQKH 4HUVA 4MA8H 4GBXB 1XF2A 4ZFFB 5JW3L 2O5ZL 3I3BA 1AHWC 1C5BH 3KYMB 4MXWH 5GISL 3RIFF 5FHBL 5KTEL 2HKHH 4DW2L 2VZVA 3D3VE 1CD1A 5KSBB 5FYJL 1E27B 3IVKB 5IB5A 4NHUA 4NBZB 4APQC 1YMHB 4HD9A 4XPGL 4XCNA 4NO3A 1DCLA 4BH7B 1TMCB 3BN3B 3QIWA 3U0TA 3INUL 4UIKH 3ZKNC 4NKQB 1I3GH 3D0LA 1S9XB 3N9GH 1LEKB 5FYLL 3RNKB 3ZSTA 4M6OH 3PJSA 1TZGH 4PJCB 4A6YB 5J8OA 3S34H 3QEGH 5ERWB 1MLCB 4LCWB 4UQ3A 1MHHA 4KY1L 3BW9A 5HI3C 3MRLA 1AHWB 2DTSA 2VKWA 3MREB 4D0DB 2VIRA 3MV8A 4NT6A 4ZOCA 4J1UB 4JM2D 2X89D 4GRWB 3OF6D 1ZEAH 3SDCC 2YRPA 3AC0A 3ZKMD 4NFBA 4JFDA 1LNUA 4EQ3A 1M6OA 2BVUA 3U36B 2X70A 5ICZA 4RMSA 2VXVH 2R56H 3SGKA 5FOBB 4BSWB 2PR4L 4P5KB 1MFBL 1U91A 2VL5B 3C6SA 5IFHH 2X1XR 5GRVL 3UJTH 5A16A 1DUYA 3MJ7A 4NQUA 3HC0B 1NFDE 2ZWLT 3KPTA 1P7QB 3R0MA 5C0DA 1G9ML 2VWEC 4HQQL 1KLUA 3LH2H 4OF3A 3DI2B 4JKPL 2BSRA 3ZE2F 3V0VA 3LKNB 1QG3A 4U3CA 3SDCB 3VGHA 3RRQA 2OR9H 3M8OH 4UAOC 4G6JL 5DRZB 2HMID 1BHGA 2G9HB 1TJIH 2AEWA 4P5MA 1T22B 4Z6AT 4YDJB 1I8KA 2C4FT 2YRZA 5GZOC 5BRZE 3DMMA 3P0VH 3PWPA 1U8NB 4ODSH 2YA1A 3CFKA 3VXSB 1KV3A 3DRQA 2J2ZA 3LD8C 3N50A 1YDPA 7FABH 1IFHH 5BW7A 1VENA 2EO9A 5ELIA 3VFSA 2DQHH 3WIFA 3PWVB 5GJSL 3E6HA 2JJTC 5CP3A 1BVKB 2YXMA 3VFMB 4PGEA 5IGXH 4PGCA 1MNUL 4KROD 4UAOB 4UV4H 3K74B 2EYTB 3OX8B 3Q1SL 5IHLB 2IAMD 5ISZA 4JVWA 1SJEA 5FHAH 3SDYL 5L9DH 3VRLF 4YUEH 4ZXBA 1B4JH 1EDQA 5FDWB 4LPTA 3VA6A 4FQ2H 1E6JL 5MHSD 2AAVA 2WQ8A 4JRWA 1UA6H 1X5LA 1P6AB 4H20L 5HHME 3KYKL 5K9QI 3LD8B 1U8PA 3HFMH 3ARFC 2YD1A 4OGXL 1XCTA 4I0CC 3PWNB 2BNUB 1X5ZA 5DMJB 2V2XA 3ALXA 4GMSH 4M00A 4PJDE 5IB4B 4M7LL 5EZOH 1FNHA 4MJIA 4NZDA 3I50H 4WHDA 4GLRH 4DCQA 3LZFL 4MLSA 4X6BB 43CAB 4PRHE 5IT2L 3GO1L 4MAYA 3H2WA 3MCLH 1F58L 4DZ8A 1CD8A 5AUMB 5L88H 4GKNB 4QHUB 4LLMA 3Q5YA 3ZT6A 3FCTB 2PN5A 3QUYD 4TQEL 5ALCH 5H37G 4X80L 1EX0A 2CRIA 2VDNL 1EAJA 3V4UL 3OKMB 2HRPL 3T09A 3OKOB 3JWDL 1LGVA 3BT2H 1KIQA 5C0BD 5IQ7L 1A6UL 1FZMB 1CS6A 3CFJB 4AH2A 3VXME 3ARFB 3NCJL 3X13B 4PLJD 5C0EB 5EUOE 5SWSE 4FXGA 3WMSA 1EFXD 5D6DA 2IQAA 3MNVA 8FABA 2KPNA 4F8QA 3VI4E 4X5XA 2VDOL 3JV6B 3QNYA 5LGJB 4PD4J 2D7MA 1GZQA 1NMCC 4HKBB 1RURL 2HJKB 3QUMH 4Q0XH 1IGJA 1GGCL 4HJGA 4J3XA 4YXLH 4OUUA 4DKFH 2XZQH 3AS1A 4HZAA 3ULVH 1IGMH 4GAJL 3HUJB 1CFNA 1QHOA 2WBJC 1VCAA 3GSRA 1J9CT 1JPTH 4XVUD 4H25B 2CLRB 3B8YA 3QXTA 1W72A 3BSZL 4NKOB 5KN5A 1IC5H 4Y4KC 1CLOH 4KKCC 1S7UA 4AENA 1HWHB 1ZTXL 4JPIB 5HYJD 4M03A 4P3DB 5CJOL 1FBIH 4ONGL 2EDBA 5FA3B 5F7DB 3QH3A 1T3FA 4DOHE 2VO5A 1NMCB 1U8IA 3ARDC 3SY0A 1NC2A 2VXQL 3W9DB 1CT8A 1EJOH 1RU9L 2AJVL 3QDJD 5DLMH 1W8OA 1QVOA 1KYOK 2WBJB 2ZUUA 3VWKA 2CUMA 4KFZC 5CGMA 1KXVC 2EZ0C 1D3CA 4MLIA 5JXAH 4XAKD 5EG6C 4HWEH 5KG9A 5T3ZL 4UQ2B 3SKOA 3P9WB 3Q6FA 4A2MA 1NFDA 4OLVH 2VITB 1JGEA 3OAUH 1MCHA 1HDMA 3QDHA 3TN0D 4P2QD 4IMKA 3QO1B 4WU5A 3QQNA 5GS0H 1ZLSL 3TH2T 2BNRB 4R4NC 1MJUH 1DQMH 3QXVA 5C09B 4JQVA 3BPLB 3MROB 5E6ZA 4HULB 2WV3A 4P3WA 3ARDB 3BX7C 3JWOL 2CDEA 4WNQA 2H9GB 1PG7H 3DVGA 4G6KL 4U3XA 4IDLA 3CU7A 3FN0L 2NYYC 5MP6H 5E56A 3PHQA 4MGXA 5FK9A 1ITCA 1FV1B 3OR6B 4GW1B 4JFEE 3PNWB 5BRZA 1CDCA 3QNZB 2FH6A 5AAWA 2VZ1A 1Y6KR 4L4VE 1CXKA 1NBVH 5D7IE 5K9KB 2W0PA 3JUYA 5T5FL 4MD4B 3VXTB 4OFVA 4PREA 2IFGA 1HILB 4MVBD 3GBLA 5EOTA 2ADJA 2PUQT 1A5FL 1I1RA 2BVPB 4U1SB 3S5LA 3O6FD 4ODTL 1ZWIB 1A7QH 5IK3B 1I8MA 5KBNC 5C0CE 4BFEA 1LK2B 4JJ5B 3KPSB 1V7ML 1R5VA 2ICEA 4Q9BA 1AKJB 5LAXB 3R06B 1NC4B 4P46C 4JFXB 1EO5A 3TWCL 3VGBA 1T89C 1RI8A 4TUOA 3CSBA 1P5UA 3C5JA 1RMFH 2AJSH 1MQKL 3TZVD 1Q9KB 2WINB 1T80A 3WFZA 3HAEA 4RNRA 5EA0L 2BY0A 5DF0A 1D9KD 1MWAL 5BJTB 1HHKB 3MBEC 1KCRH 3UYRH 2H2SC 4N0UB 2GSGA 5F97E 4EDXA 3ILPB 1A6PA 3WXVL 4XPGH 3KDMA 4NM8L 2VDPL 4PJ5B 4WUKH 2FJFB 3HS0A 1JCKA 3HZYA 4XMKH 3TC9A 5KS9F 4KJPD 1ACYH 3FAXA 4NBYB 4X7EC 4LGRB 2DLEA 4PRHA 2Q7NA 3DX7A 1J8HE 1UG9A 1I7TA 1GOHA 1T04A 1S7TA 4P46B 1ZHLB 4MQXD 4HFWA 1KACB 1INQB 4PJEE 2CDGA 1H5BA 1N64L 1A22B 2EIDA 1HI6A 1YUHA 3AMLA 3LB6C 3MLYL 1T0MA 4HC1L 3ZKQD 4JO3L 4ZS6C 4G8GB 4NNPL 1LQSR 1F5WA 3G6JF 3MBEB 1DLHB 3BDBA 5EO9A 5C0IB 2FZ3A 5CEXA 1KENH 4XRCB 5SWSA 1N2RA 4EVNA 3U4BH 4OM1L 1QSEB 1OAQL 4KV5E 1FYTB 2AK1H 3HNSL 3KJ6H 4K23H 3MOBL 3IYLW 5KANI 4HEPG 4QNPF 1KCVH 3DWTA 3G5XA 5DQ9B 4PRAB 2BERA 2FWOA 1NGXA 2A83B 4H88H 4U1KA 2IBGA 3D69A 3VGAC 1L0YA 4RDQG 2OP4H 4IRSC 2O5YL 4HQQH 1E0OB 4HDIB 3KPQA 1X44A 3KPPA 4U7KA 2GK0B 2NY6C 1I3VA 3Q48A 3PE9A 3C5ZD 5DD6B 3S5LG 1G7IB 4CN4A 3AY4C 4XWGH 1F6LL 2GKIA 4NP4H 3BHBB 1YECH 1EEZA 1U93B 4YO0B 5HHNA 4C83A 1ZS8A 4GOSA 1KIRA 1JF5A 3FRPA 4JAMB 4LRNL 2P42B 4KMTL 1VGKB 3EJYC 3IFNH 1P2CA 1G9EA 2NX5D 3WUWA 5A40E 4HIIA 4YEFA 3MR9A 3T2NH 2VXUL 3P77B 3RVWC 3GI8H 4PJBE 4BUGA 2PYFA 2AJ3A 1MVUB 4WFEE 6CGTA 4IRSB 3HC3L 4PV8B 3HAEG 5HI4D 2DM3A 1JPSL 4TYUA 1JFQH 1FJ1A 4Y5XA 3DLQR 2V5TA 2LVCA 1KYOJ 4JFOB 1U2HA 5JA8B 2EDOA 3GHBH 3DTXB 1A1OB 2NY6B 3L7FB 1PFCA 2OMBA 2AERT 1LO3L 1QA9B 4TVPL 3SGDI 35C8H 1NAML 1WEJH 5CBEB 3NCBB 1C5CH 4RAVA 2FD6L 3JSSA 2B1AH 4O2FA 4PRPE 2J12B 3B3IB 5B22A 5KVGL 1WCQA 1V3LA 1T1XA 4H8WL 3FQRB 2Z9TA 3T4YA 5K33A 3NACL 5CAYB 2B8OT 2HH0H 4G8EA 4P5TA 5L2KB 4JQXC 4FP8H 1JNNH 1VESA 5I8CB 4RMRA 3LMJH 5C0AA 2BOBB 1YEEL 4PIRF 3V0AC 2VR5A 3FFDA 5DUBB 1FRGL 2VRAA 4OTXL 4S2SA 4U6XA 4MCZA 1IC7H 1M05A 3EOTL 1IEAA 4XP6H 4M7ZC 3R8BB 4O51A 3WFBH 3O2DA 1QEWB 1RZ7H 3N1PC 1UQSB 2OK0L 1HH9B 2Q86A 4YDLC 2DTMH 1MEXL 4FQCL 4L4VA 5C8JA 4GG6E 5FGCE 3MYJA 4B41A 4Z7VF 1BGXH 4XCYA 1DZBA 3SJVE 2ADFH 4DGIH 5D1QD 3GO1H 5FM8A 5T1LA 4V2BA 1AGEB 4N0CD 1KELH 1S5HB 3RZWA 1YMME 3K46A 3RX5A 4NN7C 2R29L 3KLHD 2NY4D 2IBZY 3RPIB 4DQOL 3OXSA 4M48H 4FTVE 1QNZH 3ABZA 1R3KA 2VDNH 2B39A 3V4UH 3ARGD 1JK8B 4HJJL 3WXWH 5E2WH 3JWDH 5JW4Q 5A3IC 1RHHA 4XBGA 5HPMA 2YMXL 1YEDA 2ENYA 3V4VL 2LABA 5CZVL 4D9QE 4JZJA 1BIIB 1I4FA 4G9FD 5JO5A 1F4AA 3OXRB 1QBLL 4KDVA 3PXJA 4YDLB 4U1IB 4Y4FC 2F54A 1B0RA 5HD8D 3S35X 5AYUL 1ZXQA 4K3HA 4PB0L 4X0KA 3SKMB 2BJML 4Y8AA 1GGCH 3K4AA 3PGCB 4YE4L 5I1DA 4OSUL 4QY8B 3RUGF 3GMOA 1TIUA 2JTDA 5IMMB 4JEGB 1INDH 4FG6C 4XXDB 3S3SA 5ACMA 4NN7B 5KSUA 2HN7B 1YN7B 3LQMA 3WUWG 3WNOA 1OTUC 2J8HA 3QXDB 1RJYB 2DQGL 2Z92B 3TV3H 1VFOA 4L4TA 1YNTB 4PJEA 3T4AA 3FN3A 3RL2B 4N5ED 3U79A 4Y4HA 4F37F 4K7FB 2YUZA 1VEOA 4TUKH 1ZHNA 3PF2A 4Y4FB 2NY0D 4U3HA 1IM9D 4QTIH 4EKXA 2FHBA 2XPGA 1F4XH 1YC8A 2DICA 1ZHBA 3ULVE 4LMQI 1P1ZA 4BKLB 1UT9A 4NPYA 5KVFL 1D5BA 1EZVY 5EU5A 1YEKL 5F1IA 3LKQB 4H26A 2DDQH 3IJHB 4Y16A 1MIEH 2EDYA 4I2XA 5J89A 5F6IC 2DLTA 1BAFH 5DMIL 3JTTA 3BQUD 5KJRL 1OM3H 4TULL 2EDJA 3FOLA 4OCYL 1P4IH 2JCCE 2LFGA 3CVHB 3V6OA 4IM8A 4M1DH 1OY3B 4OZ4A 1K8IB 3W0WB 1JGVH 3B6SA 4Z5RA 5I1HH 2A6DA 4X6EA 5DGRA 1CG9B 1HEZB 2Z91A 4U1LB 5MEOB 2DJ4A 4LDOB 4N8PA 1HIMH 4HWBL 2A6IB 5H94A 4GRLA 1HYRC 1NCDL 5FB8A 1SJHA 3VI3F 1FZOB 2HA1A 4MNHA 3BD3A 4HPOL 1GAFL 5DJXB 5E2UH 3AAZB 5HVHC 1ZGLM 1VPOL 1N5AA 1E4WL 4JDVB 3RVUC 3SGJC 3QISA 4YQXL 3MUHL 4Y19B 1VFBA 4HH9A 5EC1B 1IAOB 3ES6B 2FO1A 1TZIA 2AXJA 4ZQKB 2F5AH 2LU3A 3GB7A 5TDNA 3RJDA 3FB5A 4HFUH 3SKNB 1MFEH 3GMLB 5GGVY 3BKCL 4HS6B 3GIZL 4D8PA 5T3XH 4Y89A 3LS4H 5F7HA 2GTWB 3C60C 5ADOL 2MSPA 5IBUG 3VRJB 1AGCA 3MV7E 1V7MH 1MCBA 3X12B 2IG2L 5F1KC 1EH9A 2LAAA 2UYLB 1A7NL 2F5BL 4XP9L 5DJ6A 5D9SA 4UNVA 2BXZA 2A1WL 5CP7B 5HVHB 1GYAA 3V0WH 5BOPA 3LRHA 4L3ED 3O3BA 2XN9D 4PG9A 4HIHB 1R3IH 4K9EC 4ODUB 4M9OA 5IVOA 1WTGT 4M7KH 1KIUA 3WCYA 4NCDA 1PZUB 3VMPA 4FZEH 4PJGA 3O9WA 1QZ1A 4V1DE 4KKBC 4XI5C 1K8DB 4PLOB 4ZFFA 1OSZB 3WNKA 1ROWA 3PV6B 3DV6B 2R2HA 2I60H 3C60B 4MJ6B 1K6QH 3KYMA 3O4LD 4UT9L 5IB3B 3QFJB 2X4TB 3X3FH 4I3SL 5L2JB 4F8TA 3BP4B 3VXUE 5AZEH 4AM0A 1JHLH 4HT1H 5I1GL 1GJIA 1G7JB 2DQFA 1E27A 2Y6SD 1YMMA 2FEEI 3QXAA 1DQQA 4KUCF 3QAZC 2PCPB 4LKXB 1DFBL 2V7NA 3I3DA 4JRYE 1NMAH 3DGGB 4LLAA 3O4OC 2PO6D 4I4WA 2ZUTA 2BC4A 5ESAB 3Q2CA 5B4MD 4KKLD 1S9XA 1I9EA 1LEKA 1OT2A 5E7BA 3Q6GL 2FEEL 3RNKA 4X6FB 1P7KB 1U8OA 3F6LA 4ZYKA 4PJCA 3DRTB 4LHUD 4TSBH 4CN6A 5IKCB 4JFQA 4JQIL 4QYOA 5ERWA 3SO3B 4LCWA 2J88H 2W38A 3HNSH 4XC3L 4ODXB 4LEXH 1OGAD 2IMNA 1AHWA 4D0DA 2GYSA 2MHAA 4J1UA 2APWA 2J8UF 3WFCL 1A3LL 2FLBT 2FHCA 2FR4B 1VADA 5EZIH 2X4NB 4APQA 5I8EB 3QAZB 4L5FL 3P9LA 4HUUA 3U36A 3MOQA 2CPCA 2WIIA 2J4WL 3O4OB 3HE6D 2FB4L 2DQEL 4NN5C 1FPTL 2W91A 5FOBA 5H35B 4XWOD 4BSWA 4OD3H 2F53D 1IAKB 3Q3GB 2A9ML 4U1JB 5D7LD 2R2EA 1T1ZA 3UAJC 2R1WB 3VXQA 1A2YB 1P7QA 4JJHA 1N7ML 3RWIA 3TJHC 3KAAA 1HXMA 1BJMA 1RZJC 5DC9B 2X42A 3SKJL 3LKNA 4C59B 3HMXH 3N0PB 4KKAD 2CKBH 2M1KA 2VXUH 4LAQL 4LFHG 3PP4L 3WS6A 5DUPL 3HC3H 5E00B 1AO7B 3EDJA 2G9HA 1IARB 4IRJD 1FFPA 1RZIA 1T22A 3MV01 4HF5L 2QADD 3FT4A 4YDJA 3EHBC 2JCCA 4GKZB 4NN5B 5H2BA 2EH7L 4P4KC 3P4OB 3L3DB 4ZTOL 4KRPC 1ZANL 2B7DT 1I1FB 3EOAA 1WZ1H 1OAUL 1NAMH 2FD6H 5KVGH 2X10A 4MDIB 4E41B 2R69L 4ZO7A 4JREC 4X7DC 1PEZA 5TDOB 3TH4T 5GS2D 5I1CL 1JV5B 1OF2B 3ECBA 3BO8A 2J6EA 3PWVA 1HYSC 1YEEH 1DBML 3OMZA 2VLRD 4TNWK 3VFMA 2FX7L 5F7WC 3D0VA 3EOBB 1DQJB 2X05A 3S96A 4PRNA 2FEDD 3OX8A 4CU7A 1TETL 1JWMB 3ZDXE 3W9EB 4GG8A 1E4XH 3UC0H 4F33A 1CFQB 5DHVH 4P59L 3VGGA 3BGMB 3GBMH 5FYKU 4JDZB 5IIEB 4KVNL 3T1FA 4S1QH 5FDWA 3MV9B 1RIUL 2NY1C 4P4KB 4RRPA 4KRPB 1FP5A 1VFUA 5L7XL 4POZC 3BZ4B 3QIUA 4PRIE 4JREB 3RWHA 3PWNA 1HHGB 4KMLB 2BNUA 4KJWD 3QJHA 3ISWA 3EYQC 3AM8C 2IBZX 3MX0A 1H0DB 2Z31D 1ZOXA 1NGZB 4X6BA 4N0YL 43CAA 1T03L 1I7UB 2VTFA 5CZVH 3ULSB 1SY6A 3OHXB 3FO2B 1QBLH 2IANE 3QDME 5AUMA 1KN2H 5TE7H 5I1LB 4C4KO 3TNNB 4GKNA 3F7VB 1PZ5B 4QHUA 2GI7A 4UUJA 5AYUH 3FCTA 4QRPE 3MRJB 1XGQA 3FHQA 5KAQG 3F58H 4YWGH 2JIXA 4PTTA 4G80A 4V1DA 1D5XA 3O8XB 4P4RA 1EUTA 1CBVH 1AQDA 4OCWL 4Y2DA 4NZRL 4X7SL 4K3JL 1U3HD 4QXUL 3ARFA 2XKNB 3ARRA 4Z7WF 5C0EA 1U8QA 2K7PA 3VFWB 1GXEA 2LE9A 4NSKB 1AY1L 1JP5A 3JV6A 4IOSD 3LRSA 1NJ9B 2EDRA 4OFKA 4UI2A 3QZWB 5LGJA 2D7TL 3RNQB 1YYMH 4PJ8D 4QO1A 1AJ7L 2L0DA 2HJKA 4JRXD 4IRZL 2XIDA 5F88A 3AU1B 4JRYA 4KWUA 1UENA 4ENEC 5BXFB 4J8RB 1FH5L 3BXNB 2I25N 1QFOA 1MHCA 5EU6D 2WUBH 2VQUA 4WI5A 2QJDA 2GJ6B 4H25A 1G7HA 3HE7B 4S1SL 5GRVK 2FO4B 4NKOA 5I30L 1KCUH 2XXCB 2VDML 1LP9E 1S7XA 2IJ0C 4BQ9A 1XF1A 1VKXB 2MCPH 3H8NA 1EZVX 2Q8AL 2CUHA 4CAGA 5DMIH 2ESVE 3UYOD 3R4DA 4JPIA 3VFRB 3BGAA 1CLYL 1Z9MA 4PUBL 2UVEA 1X7QB 3ZKSD 5JHDD 4P3DA 1L7TL 3FOMB 3N06B 4YXKL 3IKCB 3D9AH 4UBDD 4LPVA 5F7DA 1U8JB 3QDGE 3ULUF 2PF6A 4R7NB 1C16B 5JLZA 3IU3A 3QQ4A 3S36L 1JGUH 3DBXA 3VFNA 2EYSB 4JHWL 3W9DA 2IH1A 1CF8L 5JTWA 1NBZB 5TPWL 4RRPG 4DN4L 3RI5K 4Z7NF 2WBJA 2VDQL 3ARQA 4YH6A 5F7NC 4F7EB 1DVFD 1CDYA 2AXFB 2YPLE 3A6CH 1XIWD 3T3PE 3VMOA 1FFOA 5CZXD 5A2IH 4Y4KA 4YQXH 3PGFL 3QRFM 1K5NA 1G7MA 5TDPA 5T1KA 3EYVA 5GGSB 5IB1B 2DQUL 1MRCL 3LQAH 4I3RL 2BY1A 5C09A 3BN9C 3MROA 4X9GA 3UX9B 2P49B 2KL6A 1PX4A 4CN1A 5INCB 3ARDA 2R4RH 4NFCA 1DN0B 3SCMA 3AGVA 4CVZA 1R0AH 3QULB 4OFIA 2Y5TB 1G7PA 1ZT7B 2H9GA 2MTPA 1NGPL 3BJ91 2FJGA 1BVLB 5DRXB 2DD8L 2YA2A 3ILQC 3PNWA 5ADOH 5DJZA 5BS0E 2Q76B 3QNZA 4ETYA 5FIEA 1QLFB 1UB6B 5DJ0B 1A7NH 5GRZA 4XVSH 2ZUVA 2YOCA 4MD4A 3I6GB 1Q9LA 4CMHC 1WLHA 2C1PB 4K3DL 3OV6A 4GAGH 4PBWD 5ITFB 4F2MB 3GSOA 4L4JA 5D1ZD 4U1SA 2QHLA 5TE4L 3RVVC 4R0LC 5IK3A 1LK2A 1H3GA 4JJ5A 3IJSA 2R9HD 1N0XH 3O6ML 4HCRH 5T3XE 1CGUA 3MGOA 3MLWH 5C2BL 3QUMB 4MJ5B 5SV3A 1KB5L 3C09C 3U6RB 4R96B 4ORZC 3U7YL 3U2SA 5IR1B 2Q3AA 3NPZB 4H1LB 3UMTA 3SN6N 2IC2A 3GKZA 3VMNA 1BD2E 4JANB 1XF4B 3WJLA 2WINA 3GSVA 2WAHA 1HH6A 4AT6B 1JBJA 5CCKL 3RIFK 1PBYA 3LEYL 4PRIA 4CMHB 4N0UA 3IXTB 4LLYB 1QRNB 3WFHB 5IOPB 1NFIB 5GS3A 4R0LB 4XNQB 3WBDA 2Y9RT 2OR8A 3B5HA 1JRHH 4MNQD 4NO5B 3OWEA 3EZJB 4N90D 5EO0B 5BV7L 2W0KA 3QIBD 3B9EA 4OF8A 1TLKA 2HT3C 2BHZA 5I6XC 4GSDL 3QDMA 3OAYH 3C09B 4JQIH 4F7CA 2WNGA 1T89A 1KCLA 3V52L 3KLAA 3P4LA 4QRPA 1MCIA 4NJAL 2VNCA 1I8LA 4FMKA 5DYOB 4JE4B 4TTDD 3QUZD 2FH8A 3EO1B 3PHOA 4G8GA 1RUAH 5CWSB 3MBEA 5E94B 1OAZL 5C07B 1DLHA 5C0IA 5MENB 4Z95L 4XRCA 1QQDB 4YDIH 4L5FH 1QSEA 1FYTA 1XZ0B 3NTCH 4LGSB 4PGBA 1G9NC 1PKOA 4URTB 4X6DA 1FPTH 4M61A 1GGBL 5J6GA 5DQ9A 1OVZA 2Z35B 1OWWA 1TQBC 5I6XB 5GPRA 1S7WB 2HT2C 1MFDL 2A83A 5FUOL 4PJ7E 2ITCB 3UBXB 4X7TA 5IHZA 4XMLH 1J12A 5IWLC 1PLGH 4HDIA 3CVIL 1DTUA 3HB3D 4QHNA 2C3WA 2QLVB 3IFPB 2JELL 5DD6A 4K2UL 4X7CC 1NH6A 4OLYH 3C6LC 3QSKB 2DQTL 5DUPH 4HS8L 4HS3B 2NXYC 3IFLL 3BHBA 4NQDB 3ULUL 2EE6A 4JCMA 1ORSB 1U93A 3I2CL 2DMKA 3ET9F 2XQBL 3QDGA 4I1NB 4L8BA 4K7PL 3GSNL 1ZANH 3QHFL 4UOW1 1TQBB 4OM0L 4J6RH 4DN3L 3P77A 5FUZH 1MVUA 5F8QC 1JTTA 4GQ9L 4OKDA 3O41B 4JFOA 4W6XB 4WGWB 2YPLA 1A1OA 1IEBB 3X11B 3L7FA 3QIWD 4XZUB 3SDDC 1S7QB 3C6LB 5C6TH 2YPKA 3AY4A 2UUDH 2ZUXA 4IHOA 3LN5B 2NXYB 3QP3A 2X1QA 3ROOB 1GHFH 3FQRA 2QSCH 3R1GH 5D2LE 5EO1A 4I5BB 3TYFB 3NZ8B 2BOBA 1CGTA 2V6HA 5EORH 3MA7A 1JWSB 3PXHA 2A6KA 3TA3D 3DYPA 4HIJB 3EUUA 3C9NA 4KI5E 2DQCH 3T3MF 3H3PH 2DIBA 1RULL 1G9MC 3U7WL 3WO3B 3CDFA 5DA4A 5DJDB 5E2TL 3TO4A 3SDDB 5JQHC 2X7LA 1NBYA 4BK4A 3MRKB 3RTQC 3O3UN 4J3VA 1NAKH 2P48B 1MJJB 1S5HA 5HHPB 1HQRB 3OZ9L 4BFBD 4ELME 5BMFH 1TJGL 1DBJL 1Z5LA 1OP5H 4JQXA 5CEZD 4U1NB 1F2XK 1BJ1J 3WE6B 1UH4A 1T7WA 3B4NA 3J8F7 4IOFC 2HP4A 4OCWH 2BY3A 1T7VA 3CIQA 1MRFL 2ZP0T 5CD5D 2DIAA 1W2KT 3GSQA 5HYIA 3I02B 1BIIA 5MHSE 3IS0X 1PYWB 5F7YC 2OL3L 4PJIF 3OXRA 1BD2A 3ZHKA 2ED7A 5B38B 3CAFA 2GUOB 3GKWH 2CK0L 1NGQL 1VA9A 2MKWA 3TT3L 3LCYA 1IGIL 2AJZB 3VXRB 2VZUA 2C7UA 4G6ML 3RTQB 3D2UB 2JJUA 4KTEL 3PGCA 1XR8B 5CZKA 3PWPD 1A9EB 4QY8A 1LE5B 3CFBB 4AL8L 2A0LD 4I18C 1FH5H 2UWEE 3DO3A 1UH2A 3K2MC 4UTBL 2PNDA 2YS4A 3FONA 1M71A 3TVMC 2E7LC 1RJYA 4OF5A 4PJHE 1YNTA 1WBXA 1AGBB 1FC2D 3RL2A 2XNAA 4UT7L 4N9OB 2E6PA 1QLEL 4Q9CA 1YEHH 5DD0H 5LCVL 5C0BE 4M4PA 3O6LL 1OAXH 4HLZH 5FKAB 3MLSL 3QG6B 4JLRB 4Y4FA 1MCPH 4ZXBD 3GUTB 2WW8A 4YR6B 4R90L 3FZUC 1VDGA 3O3EB 2V17L 4JHWH 4BKLA 3HUJF 1EVTC 5LBSH 1GIGL 1J87A 2XICA 4I18B 4XNXH 4DGYL 3CFIC 1QR4A 5EIIB 4ALAL 2XWJA 3E3QC 4IIQA 4MJID 3SE8L 1XGPA 1BLNA 1AXTL 4R7DA 1QFWL 3RWJB 4XBPA 1HNGA 3W0WA 2HRLA 1CCZA 1FGNL 3HTLX 3JWDC 1I9JL 2VAAB 1T83A 5D93C 5HI5C 4MAYD 2DQUH 1CG9A 1HEZA 2X4RB 1OQXA 5ADPL 1BMGA 3AS2A 2A6IA 1ACZA 2HT4C 5FEBA 5GSRA 1X6LA 4F7PB 5HYJE 3ARWA 3CLEL 3EJZD 3L1OH 3FT3A 4OLWH 5JMRA 4AMKL 3AAZA 2NY7H 1IAIM 1UM6H 4JDVA 3TBSB 5ID0A 4XHJC 1TITA 2DMBA 1A14H 3SGEH 4YX2H 2C3XA 1YEGH 5E7FA 5DUML 2OR7A 4JG0H 3X14A 3FB6B 5TH2A 4LSUL 4OB5L 1XH3B 5J0BA 2EEDA 3KYAA 1I1CA 1YQ2A 4NZTH 4XAKE 1PSKH 1EPFA 3GMLA 1BZ9B 5D93B 2P5WB 4YNYB 3D48R 3KR3H 3S4SA 1PY4A 1RVFL 3QB7C 3TCXA 4P2QE 5BVPH 3MLUH 4S0SD 4M7JH 3AXLB 5MI0B 4WCYH 3FT2B 1RIVH 3DX8A 4OZGE 5DVKA 5HY9B 1N5YL 5LVEA 1JI2A 4OZHE 1MCKA 1A6ZA 3UTTB 3WJJC 2BVYA 4Q97A 5E4EC 4KK5C 1KFAL 1MLBB 1MH5B 5C86A 3TPUA 2FECI 2PW1B 3CDGA 1OPGH 2YD3A 2W0FA 2GAZB 4WIQA 4C56B 1IGFL 1TCMA 2X4SB 4PYGA 2E7HA 4MA3B 1DBAH 3ZDYF 4BH8B 4I77L 1NC2D 3KHOA 1A3RL 5SWZB 1OSZA 3PV6A 3C60A 4L1DA 4TSAL 4MJ6A 3VWKD 5BV7H 3RGHA 1MJ8L 2X4TA 3BIKB 3L9RB 5DHVA 3BP4A 2NY2D 1JYXA 4Z7QF 3TESA 4HJ0C 1D5MB 3JWOC 1G7JA 2VH5H 3MUGB 4PR5B 2PCPA 2OQJB 5E4EB 1ZLUH 4XTRD 3VGFA 3VFGL 1NDGB 3DGGA 1P6FA 4BFIB 4IS6B 5ESAA 5I1AB 4AJ0A 4WRLA 2C26A 2RB8A 1EA9C 2IQ9L 1NUFA 3OKKA 2H1PH 4YHKH 4JHAL 3ZTNH 1P7KA 3FRUA 1MI5B 3KLSA 1T0PB 1J11A 5JOPD 3DRTA 4U1HB 5IKCA 2LU7A 4IDJL 2VLKB 4OUOA 2ZCKL 5KTEH 1J7VR 1YY8B 4FFZL 5BRZD 5FV2A 3TNMB 4N1EA 1IT9L 1LD9A 3ARXA 3IU4H 4XNZC 4I48A 3RDTC 1IEHA 1CGXA 1BWWA 1HHJA 3RHWK 2FR4A 4WEBL 4OCLC 2X4NA 3QG7L 1WBYB 4QHLA 4RQQB 1AD9B 1WF5A 4NKMB 5IUSA 5JIIA 2A9NL 2JELH 4PJHA 1CYGA 3EBAA 3L3JB 2YWYA 3QUYA 2MWCA 2R0KH 4XVJH 5IVXE 3DUUB 1MAJA 3TBTA 3OJMB 1IAKA 3Q3GA 2XI9A 4KRMB 4RMUA 1A6VH 4U1JA 3V6FA 3S4SG 4O58H 1V5JA 3WHE0 1VFAB 2R1WA 3I2CH 3WD5L 5I15H 3BOVA 1KT2B 3BWAA 3WFDL 4HMEA 1WT5C 1T6VN 3MFFA 1EFXA 1J0YA 5DDHB 2WM0A 1WZKA 4PLNC 2EE3A 2I07B 4LEOB 4XNZB 3RDTB 2W07A 4D0CB 1DSFH 1FNGB 4M8QB 2X44D 5EZLA 5I1KL 1EVUA 1B6UA 3HZKB 5E00A 5ETUA 4PY7B 2ATPA 2V5RA 4HKJA 1T4KA 5FO8B 3CC5B 1S5IL 1ZT4B 2X4OB 1SYVA 4R2GD 3DSNA 1CXFA 4I0KA 3P4OA 3DUSA 3BZDA 1SEBB 5I9QC 4PRHD 1MWAB 5EBWB 3CGTA 5CEYB 4PFEA 3ZYIA 5FUCC 4KK8D 1UXSA 3OJVC 5F9WC 3GMRB 1D5IL 2VSCA 5DJ8B 1JTPA 1H3TA 5E8DH 3GNML 5F7FA 1OF2A 1MFAL 1MFNA 2R4SH 2VN4A 2O5XL 5HYJA 2FRGP 4ZNEA 1JGLH 4YC2C 5B39A 3WEXB 3EOBA 1DQJA 4NRZB 4KVCH 5C92A 5GS2H 2CK2A 2NX5E 1J1PL 1JWMA 4OZIE 5SWSD 1BX2B 2X4QA 1KPRA 4XPFH 3K2UL 2Z0BA 3BGMA 4O02L 3M07A 5E8NB 3IAQA 5IIEA 3NABL 1NUGA 1X5XA 5C6WH 2DWDB 3DIFB 1R3HA 2ZOLA 4P4KA 2ADIA 3VDCA 2BMKB 5I9QB 3GJFH 1OW0A 1NCAL 5ANME 2I5YL 4QOKB 3HPLB 3L3GB 3OZ9H 1E6OH 2GTZB 1TJGH 5F9WB 5DQDL 4HUNB 2F8XC 2YPVL 4QRSB 2CRYA 4KHTH 4KU1A 2BDNH 4X5LA 4D3CL 4NNYA 5FCUL 2C3GA 1FO0A 4X98B 5ALBH 2XTJC 1H0DA 4OZGA 4YC2B 1KEGH 4ZS7H 1NGZA 2FL5A 4CVWA 4OZHA 2ZUSA 3WN5C 2P8MB 1I7UA 1JYWA 4POYA 4A2LA 1AE6H 2OL3H 1ZA3B 2CK0H 2VDLL 5LGHL 4WWKD 1KG0B 2QKIB 3TNNA 3F7VA 4MD0B 2P5EE 1PZ5A 2AK4E 3JV5A 3HI5H 4AEHL 4YAQB 4ZFGL 5EOCL 1P4LB 3BJLA 4JY6B 1G6RL 3UP1A 3F65A 4M6NL 5M7QA 2GQHA 2YXFA 4RAHA 1MHEA 1ODAA 2EH8L 4AL8H 4U33A 5BVJB 4XMPH 1IM3A 4H8WC 4LLQB 5EWIH 2ZUQC 4GW4A 4HCRA 3VFWA 1A6WH 4NSKA 1QR1B 3QCVL 5F1NB 5DURD 2K7QA 3S35H 1WWWX 3KLDA 1YPZB 2GCYB 2D31B 1BQLH 2HLFC 3CFCH 3WN5B 1BFOA 2A6JA 4KMQA 4HWZB 5I1EH 3AU1A 2X4PB 2CIIB 5HGBB 3STZA 4WFGD 5BXFA 5JXEC 4YPJA 2HKFH 3T2QA 5EZJB 1UWGH 3C08L 4G9FE 4R90H 1DUZB 2GJ6A 1YEFL 3O0RH 2NW2B 2V17H 3T0EC 5DD3H 5C0AD 1ADQA 1KJ2H 4KROC 4QHKJ 5DO2C 4EIGB 4RDQF 1CIUA 2R1XB 1NAMB 2DLFH 4YHML 5FCSH 4PJFE 2NW3B 2Y06L 5HYSB 5J57B 5B39G 3DROB 1VGEH 4PP1D 1J0KA 3LKRB 4WW2A 3IKCA 3CZJA 4YHIB 1N6UA 2BFVL 5DVOA 1QFWH 3BPNC 1C16A 1DQTA 1BVZA 4DZBB 3A6OA 5F9JB 1FGNH 2OLDA 5D2NE 4WW1B 3W5NA 3FB8A 1PG7X 4S1DD 5T1LD 3ZL4L 1NBZA 2B4CH 2WQRA 6FABH 4GRMB 2VXSH 5FGRA 1CFTA 2E3VA 3D39E 5IVXA 5E99L 1Q0XH 4JO1L 4ODWB 4L1HA 2EE9A 2WMPA 3OKEB 3MC0A 1K3ZA 1FDLL 3T0EB 2G5RA 2QQLH 4KROB 5IVZB 5IMLB 3P30H 4HXBL 5F7EH 1U95A 2IAMB 4JN1L 3RKDD 4FFWC 3DVFA 3CMGA 1BQSA 4ODBD 4PLKD 2XTLA 2EDTA 2F54D 2PETA 4PJDF 5INCA 3BPNB 2MJWA 4P9HH 2MFNA 3KPLB 1REIA 1ZT7A 5E03A 2RCSL 1AFVL 2L7UA 1JWUA 1OARL 1A7PH 2DJSA 3PHSA 4R3SA 4UDTA 4BFGA 5DS8B 4O5LL 1MFCH 5HHVH 3HG1D 1HINH 1RVFH 1U8MB 5DI8B 3NCYP 1QLFA 2AJYH 5GGUB 4XC1L 3L3HA 2PTTB 1UB6A 4NHCL 4ZD3H 5DJ0A 3HC4H 2UWEB 4UU9B 3U82B 2GEEA 3FO0L 1N5YH 3I6GA 3GRWA 4L4TD 4LP5A 2HJFB 2APXA 1WQVT 5EBMB 3ARUA 1P4BH 2Y5EA 3GSUA 5D1XC 3V5KB 3VH8B 4EUPH 4Y0GA 4P49A 4XVUC 1CFBA 5EUOF 2P7TA 2I9LB 3GMNB 5GGVL 2XZCH 5C1MB 2MOVA 1K4CA 1X4YA 1E4KC 3QPXL 1XCQB 1NEUA 5CKAA 4XH2A 1N3NB 3RGVC 1MRDL 3U1SL 4OZIA 4RGNC 4MJ5A 5EC2B 2KBGA 4R96A 3TJEL 3V8CA 3HRZA 5IR1A 4H1LA 4YXHL 5KVEH 4TSAH 4Y16D 3G6JB 1MJ8H 3I75A 4JANA 32C2B 5DK2A 3CFDB 2CQVA 4RISH 4MSWB 1ETZA 2VDRL 5E9DE 3CK0L 4AT6A 4L8CB 4HPYH 4JDTL 4LSRL 4P0DA 2VDKL 1JZ7A 3IDNB 4QLRA 1XR9B 1Z3GL 2C4FU 1EK3A 4LLYA 2E8ZA 3E8UL 4LQFH 4YHLL 1QRNA 5JW5B 3DXAE 3NZHL 2DQDL 3NN8A 4NO5A 2QV2A 5DT1L 5EO0A 1NANI 1JYNA 4L3EE 1HKLL 2XN9E 1KJMA 4GRLD 1F8TH 1C08A 2EC9U 2P43B 4RGNB 2P5EA 2AK4A 1NSNL 4X4ME 1KF9B 5EN2A 3LEVH 4FFZH 1CGYA 1IT9H 4P2OC 5DYOA 1T66D 2NXZD 4EDWH 4K94L 1A6TB 4I9WD 1L4IA 4S1RL 2NCMA 3O4LE 5E94A 1Q1JL 5E5UB 1IGYA 3QDJB 4BA8A 5MENA 1UZ6E 4WFED 1QQDA 4Z77A 1H8SA 3UPAA 2DKMA 4MD5A 3KS0H 2QQQA 1EO8L 1RZKH 3QA3B 4WI8A 1MCOH 1I3RA 4NJ9H 3PDOB 1IBGH 2Z35A 1OTTC 3CH1A 3EO9H 3QHZH 1PKQE 5GGRB 3ARGA 4LSPL 1WUNT 2H6PB 2ITCA 2VLLB 3UYPA 3O6FC 3W11D 4AG4L 3GM8A 4P2OB 1ZV5A 1CTOA 3T04D 3RZCC 2PXYC 4LCUA 1IMHC 4NQED 3BEVA 5GRUL 1FL5B 2OZ4H 1FORL 1S9YB 4WUUD 5D7IF 5IJVA 1WBZA 25C8L 4PG2C 1LEGA 5IW3A 4NQDA 4OLUH 5TE6H 3O9WD 1ORSA 1ULVA 3TBVA 4GBXD 5IEHB 4GQPH 2A73B 3IS1X 2EXYD 1L6ZA 5D2NA 3E3QE 4M5YH 1CGSH 4H1LG 2B5IC 3EFFB 3PABB 4OIIL 2YSSA 5FV1L 1F4YL 1YMMD 3D39A 3O6FB 4Z7VB 2V7HB 1ES0A 1KLGB 1KNOB 4QWWD 2IADB 2Z8SA 3F6IA 3LDBC 1RUQH 4PRBB 3RZCB 3VXPB 2PXYB 3LIZL 3P40A 3C6LA 3ARVA 5LWYL 3VWJC 4D0BB 4F58L 3K2UH 5CMAA 1F11B 3TZVB 3NFSH 2R0LH 4LCWD 3PGDB 4O4YH 3VA2C 4PV9A 5DC0A 3BQUA 1LDPL 5GIRB 3TYFA 1I1AC 4LSQL 2X9XA 5IVNA 1D9KB 1Q9OA 5CLTA 1JWSA 5HHQB 1CQYA 3QRGH 3KPRB 4FFVC 2B5IB 1NLBH 2YKLH 2RIKA 1M7IA 3TIEA 1JPGA 1IKFH 3N85L 4HIJA 1ZLVH 4XGZA 2ZUYA 4KI1A 4HK3N 3ZZ1A 1AGDB 4APQD 3G5ZB 5B21A 4D3CH 4KZDL 4PJEF 3LDBB 3RWCB 5HVWA 3MACH 3DV4A 4HIXH 2HVKB 5CFHA 3RUGB 2D4DA 1U8KA 2AVGA 3BKJH 3ZKND 3MRKA 1N8ZB 3GDBA 1NL0H 2VLRE 3AB0B 2F58L 2BK8A 4OAWA 2AABL 4LVNC 4NYLA 3EYSL 4LPCA 2JJSC 1MF2H 1HQRA 3LSOA 5C0NC 5IQ9A 4TN9A 3MA9H 4DWHA 1P7QD 1I1AB 4KV5F 1A21A 5HI3D 5ESQA 1CICC 1RSFA 4M6NH 4XT1C 5ID1B 5HXMA 1RJZB 4ZOBA 2EH8H 4R6UA 1NGYB 4Z7UE 1ED3B 3LKOB 4JY5L 5CEZH 3I02A 1U3ZA 1PYWA 3IDMB 5B38A 1K85A 4G6FB 3QCVH 4MQ7B 3CH8A 5E9DA 2P24B 2W9EH 3MODH 3IETA 3BI9X 2CIKA 2B0SL 3RTQA 5EIQA 3T8XB 4FQHB 2CLVB 4LLUB 4JPWH 1XR8A 5F21B 1A9EA 1LE5A 4X8XA 4MZ2A 3VXSD 3DXAA 15C8H 2E27H 5A2LH 4PRDB 3VFTA 1R5IA 1QFUH 2XN9A 1CICB 5TQ2H 2VISB 1ZK9A 1SHMA 3MJ9H 2ZG1A 5DK0B 1IQWL 4XX1E 4CVXB 2BSED 4LVOC 4J2XA 3LQZB 4RA0C 4PJBF 5CP3H 3GI9H 2A74B 3QG6A 1WITA 2H32H 1F4WL 4YR6A 5E70A 5GZOD 2X5PA 3GSXB 1BREA 1S9VA 5GXBB 5GS0D 3REVB 5DGQA 5TF1H 3ZL4H 5IMKB 4HGWA 5K9OB 4JRXE 4KPHL 2BRRH 3TM6A 3MCKB 3V7MA 1MCFA 5JHLH 2DQIL 3IT8D 5DJ2B 2ARWA 1AI1L 1FDLH 1PKQA 4IMLB 1GZPB 2FATH 3TVMA 4DKDC 3HCVB 5SX5H 1S3KH 5EU6E 1MUJB 3RWJA 1CDGA 2V2TB 2GJZB 4LHQB 4MAUL 4ZUSB 2VAAA 4LVOB 5J6HB 2O61A 2Q8BL 3UO1H 4L8DB 3WHXA 1KBGL 2YK1L 3OGOE 3V6BR 3U0WH 4LGPB 3EFDL 2X4RA 1MCWM 2ZUWA 5DFTA 4GG6F 4R9HA 2OJZH 4HMDA 2RCSH 4OD2A 4JO4L 3UZQA 3DYOA 1EHXA 4V1DD 4WGVB 2FX9L 3IDYB 4Y2DD 3G08B 3ARFD 2LQRA 3EYUH 4EN3C 2FHFA 3NCCB 5E6IC 2Y1VA 3HE6A 1MAMH 1QFPA 3FO0H 2AJUH 1XH3A 5B38G 2EIEA 3G5YB 5D7JA 1CK0L 5I1IL 3BMWA 1BZ9A 4JHBA 3LRGA 5GGTH 3U0PB 3TO2B 3L5HA 3F12B 1BQHA 5GGVH 4WI9A 4OCXL 4R4FH 4JG1L 3MRBA 1C5DB 4X6CB 4KQ4L 4O9HH 1HHIA 5I19H 1MPAH 4DGVL 5T1MB 1AC0A 2AEQL 2HWZH 4FXLA 2NR6C 4LLWB 5HY9A 2IFFL 3TJEH 3HPJA 1U8HB 1LDSA 1JIBA 1TTGA 3UTTA 1FLRH 4IRJA 5ECJE 5FDYA 1TTFA 4EN3B 1MH5A 3T77A 1KTLB 2I27N 5E6IB 1AQKL 1CVSC 4MA8L 3DX9A 2VDRH 2HFTA 1RJLA 3CK0H 1W72H 1A7OH 1Q0YH 4C56A 1R5WA 2YA0A 4EBQL 1S9WB 1C5BL 5DSCA 4F3FA 4MA3A 2PTVA 2D7OA 4UILH 5FM5M 4LPYA 2HKHL 2E6JA 3HRPA 4JFFB 2K9UA 2QQNH 3NZHH 1QD0A 4N8VA 2DQDH 4KQ3H 2LTQC 2WBJD 3BIKA 3L9RA 1ZA6B 3MRGB 3SDXE 1D5MA 12E8H 3C87A 1I3GL 3ULVF 3K4ZA 3S37X 3K0WA 3N9GL 3WJJA 4HX1B 3BZFB 3MUGA 4Y4KD 4KKCD 3GJFA 4M6OL 3FQTB 4JGMA 1RQ5A 4BFIA 5T1KD 3S34L 3QEGL 1W0VB 5I2IB 2BNRD 5I1AA 2H3NB 1UCBH 2EXWC 1FAKT 4RMTA 5C09D 4LHUG 3ARDD 3SCMD 2JCCF 1MI5A 3IFOB 1UCTA 4U1HA 2L4OA 2NPLX 3G9AB 1A4JA 1YY8A 4XNUH 2LTQB 1I1YB 4OJFH 1P53A 2EZ0D 3DVNA 2EYRB 4WFHE 1P84K 4HAGA 2VXVL 2Z31A 2FJHB 2R56L 5TGBB 4N90E 5J1AB 4AEIH 2EIBA 1OGTB 1NCBL 4PJXB 1WBYA 1AD9A 5IFHL 3UJTL 4KRLB 4MCYA 4NC0B 2G2RA 5DHYA 2R8SH 1ZHKB 3L3JA 4R4ND 5GRUH 3WLBB 5F6HJ 3DUUA 4B50A 1VHPA 4DUXA 3QEHA 1J5OH 3KPSD 5HGHA 3VFUB 2FX8H 1BQHG 1VFAA 4HZLA 3EYOB 2NYYD 5TF0A 1KT2A 2OR9L 3M8OL 4G6AC 3ZE0E 4ODVH 4GMTL 5DJCB 1KPVB 4D0CA 4MDJB 1FNGA 4J7RA 3O11A 3UJJL 2OSLB 3FTGB 3P0VL 2FSEB 3HZKA 1CGWA 3L5WB 1DDHB 2VR4A 4PRID 1XGUA 1KB5B 2CLZB 3BVNB 4JFPB 4ODSL 3CC5A 1ZT4A 1S8DB 2X4OA 4UNUA 5JORB 1JI1A 4JGUA 3LOWA 1JUFB 1L0QA 2IH3B 2PYEE 1A6AB 4AIZB 3E6FA 1ND0B 4TNWF 5GJTH 3ARBC 1IFHL 3IDIB 5LWYH 2DL2A 2DQHL 1MWAA 3RL1B 4N8VG 5CEYA 2BVQB 4K71C 1T5WB 3PQYB 2DLGA 1G0XA 2UZIH 4PJAB 5D4QA 4P46D 5IEKB 5IGXL 3QDMD 1ZE3C 3T65A 3DOSA 3GMRA 5DJ8A 5DD5H 4L3EB 5KS9E 1WT5A 4UV4L 3NCFB 2PO6C 2AS5M 5FHAL 2YN5A 4J3WA 2C9AA 4QRPD 3VFOB 3LKPB 5L9DL 5BV7B 4LLDB 5FXCH 3A67H 4QRRB 4G8GD 3MBED 4CNIA 4FQ2L 1J8KA 3MRFB 3G5VA 1T1WA 2H2SD 2YC1B 4KZDH 5JDJA 1UA6L 3TFKC 5IMOB 4OGZA 1QSED 1FYTD 5A1AA 5FYKD 1I85C 3HFML 4FXKB 4EJ1C 4WV1C 2DWDA 3DIFA 5CHNA 3RY6A 3ARBB 4WWID 4DVRH 4LNRB 4Z7WB 4GMSL 2BMKA 1PVHA 5EZOL 3VDAA 3I50L 3I85A 4JN2B 3HPLA 4QOKA 5DVLA 4BK5A 3IRZA 3GIVB 3BD4A 4JO2H 5SWQB 1DBKH 3ULUC 3CSGA 3H9SB 4QNPE 2PO6B 2NY3C 4F80A 3MCLL 2F8OA 3RWDB 5FF6B 4X98A 5L88L 3LB6D 1EAPB 1YJDH 1N4XH 4ZS6D 4NDMB 5M95B 3MGTA 4ZAKC 5ALCL 5I1JL 3I6LD 3GMPB 2IWGA 1OGAB 2QKIA 1L7IH 4LIQH 2YUVA 2R39A 3BT2L 3PWLB 4XX1G 4FQXC 2ZOKB 4YAQA 4WV1B 1P7HL 3C2AH 3QDGD 1BFTA 2Z4QB 2AV1B 1K4DB 4JY6A 5E6YA 2WLZA 5KZCB 1CXLA 4JZOA 1IGTA 1YNLH 5BVJA 1YN6B 4WY7L 3WO4B 4LLQA 5CUSH 4YXLL 4DKFL 3M17A 2NY3B 1HCVA 2XZQL 3ULVL 1QR1A 3ZT5A 3IDXH 3UDWA 1IGML 3P9MA 1U58B 2F53B 3GSNB 2G75B 4ZNCD 2NY6D 1OSPH 5D7LB 5CEZE 3HR5B 2GCYA 1JPTL 3MUY1 1IQWH 3WN5A 2EDFA 4ZAKB 4HWZA 1S7RB 1YYLH 4Z76A 2CIIA 2CO6B 3MBXH 3O45B 5IBTL 3FB7A 5FO9B 5JNYA 1TVBB 4YHNB 5FECA 2WBKA 4FQXB 5EZJA 3HR6A 3B83A 3KPNB 1F4HA 1CLOL 3OKDA 1VEPA 1UVQB 2VB5A 2NW2A 2HTLC 4GKSB 1T5XB 1PJ9A 1Q9WB 2D0FA 1WV7T 2H45A 3EJYD 2DQJH 3QUKA 5ABDE 5M94B 1FBIL 5E8OA 2DBLL 2ICES 5EB9A 3E2HC 5HVFB 3H3KA 3RVWD 4MXVE 1EHAA 2QADB 5GS1C 3RI5F 4M93C 1S7VB 1EJOL 4ZUWB 4Q9RH 5DLML 2DRUA 4MX7B 3LKRA 3K1KC 2B1HH 3THMH 4QHMB 3TO4D 1U3JA 4WTWA 1J1XH 5F9JA 3O2DH 4WW1A 3RVXC 5JXAL 1V8HA 4PP2A 1SM3H 5JXEA 5ENWB 1NGWB 3EFDH 4OLVL 3ZDXF 5EPMB 5JDSA 3UBXI 3UTOA 1XGYH 4X4YA 4ODWA 5F9DC 3U4EA 3NFPA 1RZGB 1DL7H 3T0EA 3QUZA 4JO4H 2ADGA 5IVZA 5GS0L 4U6VH 4NIKB 5IMLA 5EBLB 1DBBH 1QLRB 5T3XD 1A9BA 1DQML 1I9RH 3BUYB 4X9HA 1F3JB 4RAUB 1IAIH 4M93B 1PG7L 3BP7B 4ZFZB 4NO2B 5MP6L 3GBNH 5I8KH 1FE8H 2DN7A 4RZCB 5I18L 2BSTB 4TUJB 4X8JB 3J7HA 1JNHB 3JV4A 3MLZH 1A7RH 5C7XH 3KPLA 5KANG 4P3CH 1FIEA 3RWFB 1SY6L 4OI7A 1NBVL 5DS8A 2A2QT 4EUPG 2OL3B 4ORGA 2PYEA 3U9UB 1U8MA 1PAMA 1EFQA 5DI8A 3VE0B 1BFSA 5DMKB 4PJ8C 5GGUA 2PTTA 4YIQB 3AROA 3B9DA 1FNFA 4UU9A 1A7QL 4Y1AB 4HBCL 5JUEH 5CBAB 2IFFH 3S88H 1RIHH 5A3ID 5KS9A 3CPLA 3IXAB 4QCIA 5EIVA 3V5KA 4X99B 4HUMB 4NQSB 1SVCP 4M4RA 2I9LA 3GMNA 5HHOE 3BFOA 4Y4FD 5H8DA 4EBQH 1RUPL 4MHHG 4YFLF 1XCQA 1RMFL 2AJSL 2XG4A 1N3NA 1U3HB 3QJFB 2CUIA 5J11C 1FNAA 5GGQH 2YN3A 3CZFB 1KCRL 2Y72A 3FO9A 1NPUA 3UYRL 4PTUB 4PJ8B 5EFIB 3REWA 1OTUD 2NY5H 4WUKL 2VOTA 4XMKL 3LS5H 2H26A 3OB8A 4HKZB 1ACYL 3RY4A 1CGVA 3V4PH 1XR9A 3W0WD 3H9YA 1LP9F 5D1XA 1Q94A 3U4AA 1HHHA 4GXVH 1W0WB 3FFCB 1E4KA 1U6AH 3S8WA 3RGVA 2XFXB 3TA3A 2COQA 2GY7B 2Q20A 2VAJA 5J11B 1SYSA 3MXWH 4AYFA 5JHDB 1A8JH 4QGTA 1KENL 3U4BL 2CSPA 1CN4A 1T2QH 1QRKA 3VI3E 1UJTA 4UINH 1CZ8H 2EDHA 1VACA 2AK1L 2E7MA 3SO5A 1F42A 2EO1A 3KJ6L 4K23L 1TVHA 1FZKB 1KCVL 2DWEB 4N9GA 4OZFB 3T3PF 2E7CA 1NCBH 4O00A 3MZTA 4BM7A 5ESVA 1ZT1A 4H88L 5MEPB 1LO5B 3A6BH 1F6AB 3QA3A 4M6MH 2C1OB 2OP4L 4P2RB 2NTSP 1NEZA 1F13A 2W60B 1I8IB 3AFLA 1UGNA 4FQQB 1A1MA 1X5YA 2H6PA 1YY9C 3TYGH 1R3JB 2ZCLH 5EU4A 1XGRB 5CILH 4XWGL 2ZSWB 1CTNA 2ZNXA 4GMTH 5CIPB 5JOPE 4NP4L 4G9DB 3BEWB 4P2OA 1YECL 3VD9A 1OTSC 5SX5K 1H8NA 4HWNA 1KIPB 2XWBB 3ZDZE 4NKIH 1KEMH 4XPAH 3UJJH 1X6NA 2IPUK 3WS3B 3NA9H 1ZVYA 3OTTA 1PQZB 3OL2A 1ZSDB 1A1NB 3FMGL 4KI5D 3IFNL 2Y36H 4QEGA 4CMMB 4M5ZH 5E0QA 3NIGE 4S11A 4E9LA 1CIDA 3T2NL 3MJ9A 4M7LT 3GI8L 2AGJL 4LPXA 5IEHA 2A73A 2H2PC 3C60D 1JFQL 1SMOA 5DRWA 3R8QA 1X5FA 2EC9T 3QFJD 1INEH 1T1YA 3MRDB 3FQWB 4FQJH 4ONFH 3PABA 4RIRB 1JF1B 2XZAH 3GHBL 2H32A 5I16B 4OGAC 4NO0B 4HUKB 5D1ZB 3BKMH 2V7HA 1GC1H 1WWBX 35C8L 5LQBH 1WEJL 4OQTH 1C5CL 3MNWA 2B1AL 3P0YH 3QIBC 5D7KE 3FQXB 3RZCA 3UTZB 3VXPA 2PXYA 2HH0L 4DVBB 5BQ7A 3QEUB 4HIEA 4E42B 4FP8L 1ONQA 2FLRT 1JNNL 3FAWA 3LMJL 3VFPB 1JTOA 4PG2A 4ZSOB 4D94A 1IC7L 4KKBD 3STLB 1WK0A 2BOCA 5IFJB 4XP6L 3WFBL 5GIRA 1CR9H 1RZ7L 5K59E 1X5AA 1U8LB 4EOWH 1E28B 2RFXA 1J86A 1MCSA 5HHXH 4PJIB 2DTML 1TJHH 4HKXA 2KUTA 2IGFH 4A6YH 1KJVB 1BGXL 3I6KB 1FL3B 2ADFL 4DGIL 2JB5H 1EEYB 4MNQB 4YFLI 1F90H 1KELL 3QIBB 4GRWH 2G5BA 4Q2ZB 1OD7A 3RUGA 3L3KB 2EIZA 3QEQE 2ZSVB 4RFEB 4M48L 2MPAH 5I1JH 1QNZL 2DYPB 3IRPX 3U46A 3KYOA 2J5LC 5DK3A 3VWJA 4X5WB 3WXWL 5E2WL 5F3HB 4HBQA 5HVGB 1NEZG 5DZLA 5HHOA 2WSKA 5IB2B 3P4MB 5MERB 1I1AA 5GGTA 2W92A 3QWRA 5HYEA 1RJZA 2WWMC 1NGYA 1FNSH 1N6VA 4Z7OE 1LEIB 3LKOA 4WY7H 3L5JA 4ONHB 1AO7D 4PJ7F 4XVTH 4BELD 1EIBA 5CSZB 3FKUS 2N7BA 4ERSH 5EOCJ 4G42B 4MQ7A 3ZE1E 5C08A 1INDL 2CRMA 3NPSC 4YBLC 1C12B 1R6VA 4FQHA 5CKGA 2CLVA 1CLZL 4LLUA 4LIQE 2ARJB 5IBTH 2J5LB 4PGDB 4YHOH 3EGSB 3GMQB 4NQXB 3ROLB 3WNNA 3TV3L 3UAJD 4CDHA 4BZ1L 4JM2F 4E41D 1YZZA 4PRDA 1QTYT 4L29A 3TJHD 4ELKA 4KK9D 1CICA 3F7PC 4TUKL 1UJ3C 1EXUB 2VISA 2DBLH 3BPLC 1HK6A 4QTIL 2EDXA 3BZEA 1F4XL 1WZMA 4CVXA 1T20A 2P44B 3WDIA 4HUVB 1LO2H 3SEPA 3LQZA 1XF2B 2J6EH 4FQ1H 4J4PC 4JM4H 3UJIH 2DDQL 4PB9H 3L3OB 4P23C 1YPZF 1MIEL 3EHBD 3NPSB 5B3JE 5DVMA 1BAFL 4YBLB 1RZFH 1OM3L 3GSXA 4P4KD 1QKZH 1CD1B 4KRPD 5KSVA 2IPUG 4TPRH 5TJWK 3REVA 2RR3A 1P4IL 5IB5B 4QRUA 5IMKA 4ZG1A 4M1DL 5HDOA 1JGVL 2QSQA 5GRWA 1LE9B 4KAQH 4W4NA 2P8PA 2ZNWA 4XCNB 4NO3B 1N0LA 5DJ2A 3SGKC 2C5DC 4POUB 4HHAB 4WFGE 5I1HL 4IMLA 3D0LB 1HYSD 4QXWA 5D2LF 1UJ3B 5FO7A 3HCVA 3FQUA 3O6KH 1DQLH 5E4IA 1HIML 2F19H 2V9QA 5C0AE 1FN4B 2DB8A 4WI6A 3ALWA 4L8DA 3U30B 2KDGA 3VFVA 5JPMA 1G0YR 3MO1A 4KI5F 3BW9B 5E2UL 3MCG1 3MRLB 1QBMH 1UKQA 3ME0A 5I18H 2C4XA 4P23B 4JFYB 3MV8B 4Z8FH 3D18B 2GITA 4G5ZH 3GSWB 3UTSE 2NY1D 5D96C 1SY6H 3QYCA 2F5AL 2DAVA 3CCHA 4JFDB 1LNUB 5D7SL 4LRIA 1M6OB 2D9QB 4LOUC 4HFUL 4KGLA 4MB5A 1MFEL 4ELMF 1ZVSA 3RIAK 4NGHH 3EYQD 4N8CH 3DMMC 4O2EA 5T3XL 1F45A 4HBCH 3LS4L 4HK3J 1G6RB 1QSFE 3C6SB 1CE6A 4X9BA 4XP4H 5A16B 2I26N 1DUYB 3TO2A 1RY7B 4ZO6A 1CFVL 2OS7A 3BH8A 5C0DB 3GK8H 2BVOA 3L6FB 3MRNB 4NRYA 2YHGA 4ZUUB 4PY8I 3V0WL 2R0WH 1RUPH 1UYWH 1WAAE 2BSRB 5E95B 4EZMA 3V0VB 5I76B 2GJ6D 1R3IL 2OCFD 5D96B 4LSTH 4LLWA 2FBJL 2F54E 2X1OA 1U8HA 5MEQB 5D5ME 4M7KL 3H0TA 3MUZ1 1A02N 4FZEL 4B5EA 1XF3A 3SE3C 4EN3A 4FS0A 1OD9A 1WIPA 2UWEF 4OCRH 5E6IA 5HYQA 3HG1E 3DMMB 3DETC 1DJSA 4KH2A 1D6VH 4Z0XA 2I60L 1S9WA 2ATKB 1K6QL 3PWPB 5IJKA 1K3IA 3D85A 3X3FL 4PJHF 3ARPA 3DRQB 5I8OH 4JFFA 4CKVX 2J8UA 5AZEL 1JHLL 1FZJB 1YDPB 4HT1L 3KWWA 5CINH 4L4TE 4YGVA 4ENED 3EZ8A 3QEQA 2BNQB 1FIGH 2HFEB 1D7FA 4X9IA 1MJ7H 2YD2A 2QTEA 4PGEB 1GGIH 1ZA6A 3MRGA 1NMAL 4PGCB 1IZKA 5E5MA 4DFHA 3QPQC 5ISZB 3B5GA 1SJEB 5HGDA 4HX1A 5K93A 3U83A 4XHQA 5GZNC 3FQTA 3QCUH 4TSBL 1MY7A 1UEMA 1W0VA 5I2IA 4CW1B 2J88L 4I2XE 4HUXA 4LEXL 1A64A 3RHWF 2OXHA 3IFOA 3VRIA 1JPST 3U9PH 4F9PC 4XNMB 1RK1A 2ZKHH 5FAAA 3HKFA 3V6OE 5D6DC 4BQ6A 2LAGB 5EZIL 2VLJE 1EUUA 4MJIB 1Z6JT 4RFOL 4KK6C 1MHPL 2FJHA 5TGBA 2VZSA 3HI6H 4M1GH 4OD3L 5K9JH 1HZHH 5C0GA 4DZ8B 4ISVA 3WKMH 1OGTA 3KXFB 1QUNA 4WWKA 4LLMB 1I7RA 2CR3A 3WLBA 2VERN 3BN9D 3BYYA 4JB9H 3P4NA 2XY1A 1UFUA 3C8KA 3FMGH 1TTUA 3BPCA 5FGSA 4AH2B 3HMXL 4I9WE 4UOJA 2GT9B 4U6YB 2CKBL 2NZ9C 2RBLA 1UWXH 4FXGB 2AGJH 3L95A 3LKSA 2IQAB 3L7EB 3ILQD 5DJCA 3VCLA 3D3VB 2YBRA 4MDJA 3QI9C 1T2XA 1JN6A 3FTGA 5C9KA 3QQ3A 4HJGB 2FSEA 5LJYH 3L5WA 3VU2A 1EGJH 1KB5A 2CLZA 3OKLA 4OZGF 1WZ1L 1FCCA 1CFNB 1S8DA 4MNGE 4NKDA 1QRND 3GSRB 3RVVD 2HLAA 1A6AA 1ND0A 2SEBA 3IDIA 4K94C 2HG5A 4YBHA 5KN5B 3RL1A 2BVQA 4G8FB 1T5WA 5FA4B 4NQEE 5IEKA 1S7UB 4AENB 1ZKAA 4NQCE 2P5ED 4WUUE 4I3GA 2AK4D 4M6AA 4Z0BH 4ZOEA 4YHZH 5DZOA 4PJGE 2JJWA 3LN9A 3UTSA 1E4XL 3UC0L 4JQVC 3LKPA 43C9B 4FHBD 2HJLB 5IW6B 4HUWB 1BQUA 1NBQA 1WGOA 3GBML 2I24N 3QI9B 4QRRA 4R8WH 4S1QL 1S78C 2AEPH 1AGFA 1QBBA 5MEND 1QVOB 1F3DJ 3V79C 5IMOA 4HK0A 5KSBE 3FJTA 4KJYB 1XF5A 3B9KC 1T0NB 2E6QA 3RA7H 1FVEA 4K8RC 1KJ3H 1IZJA 1QSFA 1L6XA 1S7SB 1BFVH 4QRTA 4LNRA 3SKOB 2HT3D 5D71H 1NFDB 4JN2A 1HDMB 4WHCA 4WEMB 1BZ7B 2WBWB 3O3AA 5FYKH 1CDBA 1KXQE 4WU5B 1WAAA 3SOBH 3RWDA 1RV6X 4PJCE 4FQLH 1DEEB 1KN2L 5TE7L 5ACZA 2NZIA 4LCWE 2CDEB 4NDMA 5D5MA 1TXKA 3GGWB 3DVGB 4WW2F 3GMPA 4OT1H 3F58L 4YWGL 4D9LL 4L9LC 4LPUA 3B9VA 4GRWE 1CE1H 4NQDD 1CFSA 1CBVL 5J9PB 5BRZB 3HG1A 3B9KB 3FRPG 4J23A 4QHKI 1I85A 5ILTH 4OCSH 4WV1A 4M8VA 3MJGX 3CX2A 2Q6WA 1QPPA 2OX5A 3N1FC 1CLZH 5J56B 1JNLL 4MS8D 4ZUVA 3KPMB 2HT2D 1YYML 4LASL 4BZ1H 5JQ6H 3T0DA 5FGBC 1YN6A 3DURB 1A0QL 3D39D 5LG1A 4NNXB 4HSQA 1EHLH 2W9DH 2AI0H 2EEBA 4FZ8L 4BZ2H 3GSNA 2G75A 3RU8L 3V5HA 4QGYA 4OF0A 3ZKXC 4GJTB 4DK3A 3HR5A 2WUBL 3BH9A 4CBPA 2UVFA 1WCBB 3KPOA 4OGYH 4ZAKA 3ALPA 3C6LD 1Y0LB 1S7RA 1J1OH 5FYJD 2OTUA 4L9LB 2NXYD 3FO1