4LFHG

Crystal structure of 9c2 tcr
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
229
structure length
222
Chain Sequence
GTKSVTRPTRSSAEITCDLTVINAFYIHWYLHQEGKAPQRLLYYDVSNSKDVLESGLSPGKYYTHTPRRWSWILILRNLIENDSGVYYCATWDRYKKLFGSGTTLVVTDKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWQEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEESLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 9C2 TCR delta chain
publication title CD1d-lipid antigen recognition by the gamma delta TCR.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 222
sequence length 229
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lfhG01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lfhG02
1G7IA 5ANME 2IH1A 5C71A 3OJDB 4C4KT 4OFVA 5L6YH 1J8HA 2E8YA 1YMMB 3UPRA 3MZGB 4U2YA 1QR4A 3GSNL 2F5AH 3QHFH 1XIWB 1MQKH 2K1MA 4JFFD 4LMQI 1I7ZA 5HHOD 1HQ4A 2D7NA 4YGAB 3HNTH 1A14H 1U41A 4PGZA 1LEIA 1GOGA 3AS0A 4PS4L 1UGNA 1IAOB 2Z31D 1WBYB 5HYJD 3L7EB 3BP6B 1CDJA 2EE3A 4G7YH 2AW2A 4KVCL 4OZ4B 2H3NB 1LK3H 1NGZA 2AK4B 1SQ2N 1WTGT 5JA9A 2CDGB 2QQNH 1RJCA 3N1GC 2XQBH 1Z3GL 2HT2C 2EKSB 5LAXA 4TVSa 2YD2A 5KSBE 4PRHA 1N8ZB 4V1DA 2I07A 2CH8A 5EOCH 4J8RB 5GRJH 3DX6A 4DGVL 5J89A 2ZWLT 2F15A 3V52L 3NIDF 3VXMB 4RGOL 4HKZA 1ZEAL 1CDIA 1G7JB 3PL6C 4LVOC 2P5WA 4QGYA 1CN4A 5DRZB 1OT1A 3O4LB 1C5CH 5JO5B 4JFXA 4WRLA 2KQNA 3RKDC 2W0KA 2Z8SA 3RY4A 3P4MB 4NRXA 3L3KB 1ND0B 5EUOF 1UJ3C 1SYVA 5MEOA 2V5RA 3GSWB 3QIBC 4GBXC 4R90L 1RUMH 5BS0B 3IDIB 4JRWA 1JV5B 4ZPTB 4JDTH 1TQCC 4KMLB 3GMOB 3CMGA 1G7HB 1WC7B 3TV3H 1FVDA 3DYMA 5FHAH 1A8JH 1ZHNB 3C08H 4Y2DB 4PBVC 3CZJA 2BNRD 4MXWH 1BGXL 2FHBA 3V6BR 2NMSA 2KQMA 1PDKA 4EVNB 4K3JL 4YHPA 5C0ND 3GK8L 2OCFD 2P8LB 3N9GL 4CBPA 3KLAA 4YK4C 4K7PY 4LOUD 3BX7C 2V2WB 2J3SA 5E03A 1RJYA 4KROD 4XTRC 3VXRD 4F9PA 2ATKA 5FO8B 2FBOJ 4LGPB 3QPQC 4MX7B 1L0QA 1HCFX 4WFHD 4QRUA 4C54A 2VDOL 3QDGA 3NFSH 3THMH 1PG7X 4K8RH 3AB0B 3N0PB 4WU5A 5C0RH 3QUZD 4PJ7E 5FUCE 4M6MH 3BQUC 3GBML 4ZFOB 5ADOH 3VGAC 1MHPL 3AY4C 3EO1A 2HH0L 2ITDB 1IGMH 1AXSB 3WEXB 1FZKA 2P8PB 2HRPL 3WD5L 4KRLB 4LDEB 5HHXH 3MLTA 1RMFL 3WUWB 2JJVA 4WCYH 4YIQA 2UY7A 5DK2B 1IGFH 5AZEH 4WO4A 4GMTL 4E5XA 4J3XA 1WCBA 4NWUH 5C70A 2CLVA 5IF0A 5IV2A 3FB7A 4YFLI 2FJGB 4PJ5B 3U36A 1NFDF 4L9DA 4FQ1H 4OLVL 5D7IA 3SGDH 3PQYE 2V9QA 5FO9B 3WIHA 5BO1H 3HI1A 4PGEB 5HY9B 3AVEA 3UROR 1TFHA 5J06A 3FZUC 3JV6B 4QHKI 2NNAA 2H1PL 4IRJA 3OKLA 4DAGH 4UDUA 3KLHD 1E0OB 4P2YA 4YC2C 1QO3B 2CK0H 3R06B 3VFUB 5FA3B 3FB8B 3DYPA 1U91B 3R0NA 2E6QA 5C7XL 2AJXH 4PY8J 1AR1D 1T21A 3QISA 1BFOA 4X7TB 4EOWH 5GGQH 1DANU 4KKBC 4L3CA 4LCUB 4YGVB 3NACL 1RD6A 4O5LH 2NY4B 2FD6H 2LQRA 3OQ3B 1GGTA 2PXYB 3MFGB 5F89B 3EYQC 3NCEB 5CIPH 5CMAA 3GGWB 4BZ1H 4HS8H 5EU4B 1C8PA 3O3AA 2X5PA 2ZUUA 1K4DA 4NO3B 2H26A 4H0HB 3MRNB 3MV9D 1QFWI 4HT1L 4BFBD 2R4RL 5HJ3A 5K59E 3O6LL 2G75A 3NAAL 1MJUH 3FONA 1I3VA 5FK9B 3KPRD 1N4XH 1NUFA 1XF5B 2FJHB 3L3IA 5ICZA 2X1OA 5JUEH 4PJBA 3HUJE 3IJYA 3IB4A 5T1DH 2W0PA 4D0BB 4CVXB 1QR1A 4GRMA 3B9KA 4H25B 2RR3A 3VXOB 5D6CB 1AO7A 1KPUB 4PGDB 5C0DB 5KVGL 1RULL 2FGWH 2AEIT 3I84A 3AB0C 1UZ6E 2R69L 4KKAD 3WKNA 4AEIL 3AXLA 5M95B 3ES6B 4OZHB 5MP6H 1S9WB 4Y4HC 2OTUA 1I8MA 1MCKA 4M1DH 1KNOB 1V7ML 2A9MH 4W68A 5LBSL 2W65A 2DQIH 1B4RA 3QXTA 1VADA 5HHME 3ZE1E 4H88L 4GKSB 4C56E 3C2AH 3QIUA 4K9EH 1WZ1H 3DXAA 4GJTB 5SWSA 5KSAB 4NQDB 4KHTL 3VXUE 4YXHL 3FAWA 4FG6C 1J1PL 4CMMB 5D93B 2Y9RT 4JJ5A 1M7XA 4WTWA 2VB5A 1ZVYA 4XVTL 4YX2L 4Y5VB 5KVMC 2X70A 1R3HB 4BFEA 5FKPA 1BBJB 3G6JE 3IKCB 5C07A 1KENL 1AJ7L 4P2QE 2PCPB 2VC2L 4XPTL 1CE1H 2G9HA 5A1AA 5IFHH 4DVRH 3TO2B 1KC5L 2EZ0D 5DJXA 1DSFL 5JW4Q 1FYTE 1MUJA 4ZXBD 2FIRT 3BXNA 4HWBH 2Z8WC 4AYFA 1OPGH 1L7IH 1V3MA 4NZTH 4EI5D 5GS1A 4R0LB 5KVDH 3FL7A 3ZKNC 3VI3E 5IB2A 2XZZA 5FYJH 3KYMA 4I0PB 5CP7A 1FBIL 4ODUB 5E7FA 1UG9A 4ALAL 3O3DB 1IM3B 5GXBB 5T1KB 3QRFM 3IVKB 4NGHH 4S2SB 1AGFB 3BIKA 2IFFH 5T1LA 3MRJB 1AKJA 1I8KA 3MJ9A 4TQEH 3U4BL 1J11A 4OQTH 3D48R 2AXFA 4ZUSA 6FABH 4F7CB 5E24E 1GPOL 1Y6MR 1S9XB 2HVKB 4BQCA 4UOW0 3NZ8B 3MJ8B 2PYEB 3BVNB 5GZNC 2LABA 3FQRB 2WINB 4HH8A 43C9A 1J8HE 4I5BB 4EIZC 2B8OT 4BUHA 2Z8VC 5C0BD 3UTZA 1AI1H 2H8PA 4YPGA 5I1JH 5D1XA 3FMGH 1QBBA 1VFBA 4KJPC 4OLYH 1DL7L 4QO1A 1MJJA 3EYSL 4P5MB 5LJYH 1JVKA 4PJIF 4OFYA 2DIJA 3O4OB 2C3VA 3A67H 2ZP0T 1PZUB 1EHLH 1UWXK 4JLRA 1YEEH 1A4KA 4JPVL 1ED3A 5DGRA 1KJVA 1YNKL 3HCVB 1C12B 4XGZB 5E2VH 3TYGL 3RZCB 3CFBA 4MZ3A 1IZKA 2HA1A 4U1IA 4A6YH 4LKXB 5D2LF 25C8H 5E00A 2R1WB 1FIEA 3DROB 1CGSL 3QJFB 4R2GD 4Q0XH 4N0YH 4ONFL 1MCDA 43CAB 1NGQL 1NJ9B 4KPHL 1J18A 3V0WL 5F3BA 5I6XB 4V1DE 3SDAA 3BSZL 1CD1A 3WO3B 1FORH 1MWAH 2BJMH 4PB0H 3H7LA 5JHDB 5HSFA 2I9LA 5IM7A 5BZWA 3MYJB 1OF2B 1H5BA 4WFEE 1DQJA 2W9DL 5T5FH 4MCZB 3VRLE 1J9CT 4LLQA 4S1RL 1UB5B 3ARFA 4CUCA 3IAQA 1JGUH 2X2YA 5D5MF 3SO5A 1RHFA 5DZLA 3PWJB 3V4VH 2JF1A 3WYRA 3CFDA 3MV11 1NH6A 3FOLA 4XC3L 4CVZB 3ZTNL 1MFAL 3QXDA 4S1SL 1DQDL 4GT7A 2OL3H 3ULUC 2FJFB 3HE6C 3MRGA 3P4LA 4F7TA 5KAQG 1NCBH 3WFDL 4ZUWA 4HIIB 2D31A 2AKRA 3N85H 2Q8AH 4LCWD 3SDXF 1FE8H 3BGFB 3W9DB 4PGBB 4U1KB 4GRLD 1FG9C 3R8QA 2YD1A 2ICEA 3RL2A 4QT5B 2YHGA 4R0LC 4QOKA 4M8QA 4FFVC 5GS0C 1SEBA 1T66C 3CLEL 3FQUB 4GKZA 1FZMA 5DD5H 1A3RL 5K33A 3WUZA 5TE4L 4LPWA 1DEEB 4QWWD 2NYYC 4TPRH 5ALBL 4NYLB 1W0VB 2BXYA 3GB7B 1KIPA 2PW2A 2CIKB 1A6UL 4JZJC 1DJSA 5IJVB 1DQMH 1KB5A 3QDGE 3C6LA 5I1HH 1J5OL 1G7QB 1NBVH 3GSOA 4M5YL 1V7NL 5I73B 4LCIH 1PY4A 1ORSB 4AMKL 1FFNB 3ME0A 4XH2A 1FV1A 2BOCA 2DQHH 3CPLA 1A9BA 1MCPH 3NCCB 3TYFA 4HLZG 3TFKD 2DYPB 1FVEA 1QSED 3L5HA 4G6JL 2EYRB 3BH8B 3H42H 3JBG7 3SGEI 5DFTA 2RGSA 4L4JA 4WI7A 1XCQB 3TLRA 2C3HA 2CXGA 4K23L 4QY8A 4Y19D 4OFDA 3VJ6A 4WIQA 1I7UB 1MHHA 1QBAA 2FH6A 1NGPH 3DVFA 3WFEL 1QBLL 5D7IE 3MRIB 4OT1H 3JWDH 5F9OL 3SJVD 4UTBL 2DIBA 3RIAF 2OM5A 2UZXB 1LEKB 4JKPH 1F13A 4RRPG 1A4JA 4DGYL 1XGPB 4LDOB 3G5XA 1UC6A 5FECB 5LCVH 3CSPA 2ZNXA 3OKMA 3UTSD 1JGLH 3REVA 3IXAA 4U6HB 4KK6C 5FGBC 3TNMB 3JUZA 3G5VA 1XZ0B 4NKDB 4IMKC 4S1DD 1VACB 1W8OA 2JJWA 5D6DC 4N8VG 3FT2A 3TBSB 1DN2A 2A2QT 2B39A 3A6CH 4IRZL 2ITCA 5EUOB 2AJUL 3UCRA 4WFFE 1KUMA 4MJ6A 5EWIL 4N0FA 1MRFL 1ERNA 4LARL 2CRIA 2EEBA 2Z91B 1AHWA 1KN4L 1FP5A 5D7JA 3MRQA 4KI1A 1EBAA 1JGVL 1AGBB 4G9FB 4NDMB 1J05B 4H26B 5E2TH 4CVUA 5E99H 5DQ9B 1E27B 4D8PB 4TOYH 1LO4H 3WNKA 1YN6B 5CZVH 2HMID 1GCFA 1KELL 3Q48A 4BZ2L 1T2JA 1ZVSB 2HKFL 4NC1E 5DRWB 1KXQE 1K8IB 4J3SA 1ZA3A 4PJBE 3FQWA 2GJ6B 4JG1L 5T3ZH 4IHOA 4KKLC 5JOFB 4ETQA 5J6HB 2EXWC 3IXTB 4FNLL 4QRRB 1TZIA 3U30B 3RI5F 4MJ5A 2X1QA 5JOEA 1AO7E 1GGCH 4LSUH 1MFNA 1UVQA 5DMJB 3TH2T 1JGDA 5A3IC 4I0KA 4MLSA 3PABA 2XPGB 3I2CL 5DK0A 2AABH 1T04B 2E6JA 5I73C 5DWUL 3CFCH 4HS6B 4G8GB 4LCCC 2Z9TA 4YDKH 4OB5L 2QHLA 2NY2D 4LLYA 5FYKH 1I85A 5C09A 2ZSWA 4CAGA 3QCVH 3VG9B 3RU8L 1PGRB 4MNQA 1R3LA 2VR5A 1KLUA 3DXAE 3QFJD 4O2EA 1R0AL 5SWSE 5CEZH 4DQOH 4OJFL 5C1MB 1G9ML 3H7BB 3VXPB 1NFDB 1WISA 1EO7A 4X8JB 3SHSA 3MOQA 1HXYA 5D96B 4L4VD 2VZTA 2BOBA 2M8XA 1S7VA 3QEHA 5I2IB 1IE5A 3LEYL 1BVLA 1NL0H 3G9AB 4M48L 4N90D 3HB3C 1CFVH 5E6ID 4TSAL 1ZA6A 4HAFA 5CGTA 3R1GL 3IDNA 5C07E 5KS9A 3IAPA 1RK0B 1F6AB 3I3BA 3D3VD 3LMJH 3WDJA 4Y4FA 5DJ0B 2VITA 4KUCF 2EC9T 1NGYA 5L2KB 1QEWA 4XI5C 1YYMH 4KVNL 4PJXF 1KB5L 2GK2A 3MRFB 3IFOB 3IDUA 3WKML 5DC0A 1HI6B 2CDFB 4J2XA 3TBWB 3QQ3B 3MACH 3WL9A 1B2WH 4P5TA 4FABL 1U3YA 1U2HA 4IRSD 5AYQA 4PRPB 1FN4A 1X5XA 4PG9A 2UZIH 1X5ZA 2UWEA 4NJ9L 5E08L 2C4XA 1QP1A 5C0JB 4BSVA 1PYWA 5EPMB 3SDCC 5T3XL 3OTTA 4OUUA 4CN1A 2IAND 3KWWB 5I18H 1NQBA 2GK0A 3TZVD 3RWCB 3ARSA 4QRSB 4HJGA 2EDNA 1CD8A 5HI3C 1PY9A 4X80L 1I1AD 1EVUA 1ZHKA 5BXFB 3WDIA 5CILH 1N59B 5IJKA 2MFNA 3LKSA 2D0FA 2QQKL 3QQ4B 4Q58C 1OT2A 4OKVB 3C6SB 4PRNA 3EO0B 3VDBA 1HSBA 3ZE0F 3IDMB 3ALWA 4UT9H 4QYOA 4X7CC 2HKHH 4WWKA 2F54A 4NZJA 4HIHA 3P2TA 3GEWB 3D0LA 1Q9KA 4JB9L 3NCJH 1BZ9B 1JGEB 3UMTA 1A6AA 1H8SA 3MNVA 3LN4A 4PBWD 1QBML 2W9EL 4YFLF 4CL7A 2FR4A 1HHJB 2F8VA 1W72B 1Y0LA 3REWA 3U30C 3EJJX 3QDJA 1HSAA 1WIUA 3HRPA 2FL5B 1RV6X 3VGHA 1BMGA 1U36A 4LAQL 3VWJA 3P9LB 3L3JB 1FL3B 1KIRB 4JFYB 2Y23A 1X5IA 4OZFA 3EFFB 2XTJE 4NSKA 1U8OB 1S9YB 3RBGA 4PRIA 3SQOL 3ARDD 5E2UL 4J4PD 4OFKA 1MQ8A 1PEWA 1TCRB 5JQ6L 5ICXB 2YA2A 1TTUA 2R29H 1C7SA 4JY4B 5FCSH 1XH3A 1T2QL 1XGQA 5F7KC 4C83A 3UJTL 4XAKD 1HNFA 3PWNA 5IMMB 5CKGA 3E0GA 2KZ1B 1JI2A 4P2OD 3TVMD 5HGDA 1HWGB 3WJLC 5J56B 5LVEA 1GIGH 3VCLA 5J1AB 4L9LB 3JV4A 5CFHA 1FNEB 1EZVX 4LLDA 5BQ7B 1IT9H 4Z7VA 5IHZA 3GMPA 4P49A 4LSQH 2LVEA 4NM4H 5TJWK 4JRYB 1MCJA 1TQBB 3SDDB 3SOBL 4OGYL 1AIFA 1IBGH 4NFCA 1FNGA 3L3GB 1YEJH 2DKUA 3LKQB 1BFVH 4QOKE 2OJZL 2BSSA 2OXHA 4HXAL 3VXNA 3BZ4B 1JZ5A 4HIEB 3DRQB 4I4WA 4TSBH 2GT9A 2YPLE 3OKNB 3SCMD 1F3RB 5I8KL 1K5NA 3GKWL 3IDJB 1HHGA 4WY7H 5I66B 3BKCH 1BJ1J 2XWTA 3UBXA 4JFEE 4DK3A 5I8EA 3SGDI 1BQHA 2D2OA 3O9WB 4PG2A 5IFJA 2NZ9C 2JK5A 2MSPA 4QHLB 1OGTA 1DBAL 3WFCL 3PJSB 4MHHG 1CLZL 4JQIH 1VPOL 4FXGB 2FATH 3T3ME 1INDH 1IEAA 4YH6A 4UNUA 5ILTL 1T7WA 1JWMA 1P9MA 3ARBD 3T1FB 1U8KA 4Z7UF 4F2MA 1NANH 2DWEA 4PJIB 1NDMB 1G1YA 1BAFH 3K81A 3RUGF 3CU1A 4OFIA 5INCB 3HLAB 4RAVA 3U7WL 5CEYA 3NH7L 2P5EA 2YPVL 3TCLB 4LEXH 1UYWL 3QEGL 2X4NB 3ZYJA 2HRPH 1IM9A 5D2LB 1UADC 1YN7A 3BGMA 3QQ9C 5FOJA 5IWLC 1QHPA 2ZUXA 1BHGA 1RMFH 1FZOB 1D6EA 5IQ9A 3ZKXB 1ITBB 1TPXC 3B43A 4TTDC 3D2UA 1S7UA 1JFQH 1OAXL 5KTEH 4GUPA 4P23D 4L29A 1VA9A 5GGUA 2NY5C 1A47A 3CDCA 1YEGL 4NNPH 2NPLX 1F3JA 2YRPA 4ZSOB 2A9NL 3S34H 3CXHJ 3K1DA 1U2CA 1MCEA 5F7EL 1UM5H 5C92A 2VQ1A 4HPOH 2WWKO 5D5MB 1GC1C 3QUKA 4JQXC 4HMCA 4NCC1 2MCG1 2UYLB 5C0IA 4Q9QL 4Q2ZB 5I1IL 5HHQA 4J3WA 3TBTA 3QXAB 3IT8D 2QKIB 3BPLB 3PL6A 4J7RA 4PUBH 3ZDZE 4FZEH 3FFCA 4XPAL 5FUOL 3SDXB 2YPKB 4OM0H 4R97C 1EFXA 3CVHA 4PRAB 5EU3A 3PNWB 1Y6NR 2WUCH 4S11A 4GQ9L 3QIBA 4GBXA 4ZMAT 3E8UL 3AFLA 3MV01 4F57L 1RZKL 2P45B 4WTXA 5D7LB 3BE1L 3F7QA 4KMTH 4UIMB 3LQAH 5ENWA 5A2FA 4XNYH 3SE9L 5DQJB 3ULVC 3G5ZB 3OKDB 2ZOKA 3IFPA 1A7NH 3L5XH 4PPTA 4ZQKB 3BZFA 3GM8A 4JFPB 4BA8A 4RGND 3EOBB 3VFNB 4JM2F 5CSGA 4YJZL 4XBGA 3GSQB 3GSRB 2YR3A 2W91A 5I1KL 3IDYB 1Z2KA 3VU2A 4PV8A 3MV8A 3HTLX 3JTSA 4BKLB 5EU6A 4MHHI 3O9WC 4FQQB 1XGTB 3NFNB 4HS3B 3BWAA 5SWQA 2XFXB 5EFIB 5FAAA 2LAGB 4HIJB 4XPBL 1OB1B 2J88H 2YA0A 4UOJA 5KVGH 3WNLA 4XC1H 1PVHA 4H20L 1BPVA 4LRNL 1PSKL 2R69H 4Z8FL 1U6AH 3BQUA 1I9JL 4KC3B 1CLYL 1GVIA 2CXKA 2O5ZL 3MGOB 1IAMA 4JVPA 1UM4H 2BSED 3AY4A 3OJDA 4C56D 5E8PB 2W9LA 4NO0A 2VLKB 3VXUD 2NXZC 3HA0A 3QZWB 1K4CA 5E2WL 1U95A 5GRYA 3RNKB 1D5BA 1NGXB 2VDLH 3GNMH 1IAOA 3O2DL 4XVJH 3P4OB 1BZ7B 1WBYA 1J86A 5KS9E 4ZYKB 2BVUA 4YXLL 4PY7B 1NLDL 3BP6A 4P2QD 4YX2H 4OLWH 3HMXL 4PP1D 4OZ4A 2XV6B 2ARJB 2H3NA 2F74B 3EYFB 2AK4A 4PRDB 5CGYC 5IEKB 1KENH 2CDGA 4U6VL 4U1JB 1RZIB 2V17H 3KYAA 3QAZC 1EO8L 1KC5H 1LILA 2EKSA 1CD0A 2NY0D 4N0CD 1B4JH 2WBKA 1N8ZA 3IS0X 5IHUL 5DTFB 5IFAL 1VENA 3LPFA 4UV4L 5TPWL 2A0LD 1ES0B 1Q8MA 3EJYD 2DL2A 2ICWB 1M71B 1OW0C 3X3GL 1L9NA 2O5YH 3VXMA 3MRPB 2DLTA 1U8HA 3OPZL 1BX2B 1CGYA 4FMFA 5DRZA 2A74A 3O4LA 4H5SA 4ALAH 5JO5A 2EDEA 1VFOA 1VEPA 1L7TH 1IAIH 3P4MA 3SE4C 1RHHB 3L3KA 3TA3D 3WXVH 5T3ZE 4UT7L 1F8TH 3S37X 3GSWA 2VDNL 3T4YB 3F7PC 4ZD3L 4EN3D 1RIVH 5BS0A 1P84J 1ACZA 1JV5A 4ZPTA 3GMOA 1J8HD 1GPOH 3VFPB 4XP1H 2F54E 3KPQB 4JN2B 5E5RB 1G7HA 1LK2B 4P46B 1D5IL 2V2XB 4Y2DA 5BJTA 2NY6B 5TQ0H 4K3EL 1G7MB 3TJHD 4PJHA 2L4OA 3O6FB 1DUZB 5D2NC 2XNAB 1WBZB 3KPOA 3I02A 1JTOA 5EO1A 3U0WL 3G6DH 4LVNB 2P8LA 1WBXA 4YHYC 35C8L 4QCIB 2V2WA 4UB0L 5J7CC 1T1WB 3TWCH 3NIGF 5E8DH 2X4QA 2GTZB 4NZRH 3ARGC 5IVXF 3TO4D 4K94C 3SKJL 4F15C 3IGAB 4JPVH 4Z0BL 4ZFFB 2R1XB 1YNKH 5H37H 1PG7L 2DQFB 2Y6SD 3EDJA 4PRIE 1RY7B 4QTIL 3HI6H 2APBA 2F58L 3CVHL 1NMAL 3RVUC 3S3PA 1HILA 4PRHD 3NVQA 1MVUB 3PWVA 4Y4HA 1L6XA 4NRZA 3INUL 5JW4R 3V0WH 1JHKL 2ITDA 4WFED 2QHRH 1FRGH 1U8QA 1ZSDA 2P8PA 1T03L 2P5WD 5ECJE 1G6RB 5DJ8A 5E95B 3O8XC 5MEND 2Y36H 4QNPE 4QWWC 2B2XL 1IC5L 5HVHB 5DK2A 5KAQF 1I9EA 3LKOB 1ZHBA 3GIZL 4Z7VE 1OM3L 4OV6F 2IQAB 3EOAB 3MBEB 3QDME 5E5MA 3DARA 4N1EA 2FJGA 1OAKH 5MI0B 3MUGB 2MKWA 4XPHH 3ZTNH 5FO9A 4Z95H 1DQDH 4PGEA 4GW1A 3LH2L 3MLRL 3WFDH 1JZ3A 1CK0L 3VFSB 4S0SD 4GSDH 1CFQB 2J8UF 1K8DB 4WI9A 4G9DB 3QIWC 5FA3A 2QBWA 1YC8A 4MCYB 3H9SB 2FDBP 2R2CA 5FYLL 1P4BL 1A3RH 1BQSA 5DI8A 2C1PB 4XT1C 4YGVA 1RZJH 1YEKL 4Z7QF 4Z76B 4MWFB 3QDGD 1JNNH 1EMTL 4GXVH 5EOCJ 3RL1B 3WNPA 1JUFA 4ELKB 8FABB 3NABL 3IU4L 1A6UH 4FZ8L 4F3FB 5GGSA 1CLOH 2HT4C 3GGWA 4F7PB 1J5OH 4LHUG 3T0AA 5EU4A 1H0DB 2RCSL 2UVEA 4QXGL 2CGRH 4NO3A 1J8KA 3BW9A 3MRNA 4ZTPL 1HYSD 1QFPA 5IESL 4P46C 5FXCH 4QGTA 1KCSH 5IW6B 1DVFC 2FEDC 3ILQD 2P5EE 3BP5B 5DLMH 3DRTB 5FK9A 5E8EB 5AEAA 4WO4D 1XF5A 3EFDL 1DR9A 3SDYL 1P7QB 4I48B 4ZAKB 1DQLL 3MREA 3NTCH 3VXSB 3T0BA 1INEL 4XP4L 1I1RA 3OHXA 3NZHL 4CKVX 3NPSC 4H25A 3OGOE 4M5ZH 4UT6L 2IMMA 5LGHL 3QXUA 1IAKA 5C0DA 1QBLH 4PJEA 4IRJD 3MLYH 3HE7C 3P0YH 4D3CH 5K9KB 4QXUH 4UTBH 4XCNB 3GSVB 4UV7L 3G5YB 4OZHA 4RBPK 4K7FA 1N0XL 1S9WA 5IBTL 3MR9B 1KNOA 3CDYA 4RWYH 3OXSB 3W0WA 1X4ZA 3SN6N 4J12A 4Z5RB 2J1KA 4N0UB 3V7AG 4YXKL 3EDKA 4WFFD 4MVBC 5DURB 1INQA 4AIZB 3TIDB 3P11L 3PGFH 2ZG2A 3SE8H 4GAGH 1LVEA 1AXTH 5CLWA 2AJUH 5L88H 3PWUB 5GISH 1LO0H 4FQIL 3LD8C 3GKZA 3MBEC 2ADIA 5IMKB 3QUXB 2AQ2A 1UB6A 1GAFL 3MBXH 3ZT7A 1BBJA 5EZIL 1EV2E 1TTFA 3BIAX 3IKCA 3HE6A 2IMNA 4PJGF 1IRAY 4NKIL 4P3CH 2PCPA 3TT3H 4JHWL 5GIRB 1JL8A 1JNLL 4KQ4L 3T2NL 5BVJA 2WK2A 1IGIH 2I25N 2VDRH 1A7OH 3FO9B 4R0LA 2QL1A 3MLXH 1KELH 4X5WB 4GAJL 3GFUA 2X40A 2GITB 2HKFH 1P2CB 5ISZE 3QRGH 3FQNB 4WI6A 1IC4L 3DX9B 3MV8E 3B9KD 4YZFE 5TFSL 2V9RA 1A1MB 4Q9BA 1FHGA 2R0ZL 4XNUH 5EU6E 1MOEA 4ONGH 1IM3A 2G5BB 3HS0A 1TJHH 2EH7H 1KCLA 2QSCL 2WBJB 2XZAL 3SBWA 4GAYB 2DQUH 5J12C 3IVKA 4S2SA 1EUUA 1IQDA 1AGFA 1WWAX 4Z7UB 3RHWK 1BF2A 1UWEL 5DO2C 3QJHA 4I3GA 4CU6A 3RUGB 4I77L 4KKNA 4F7CA 4LSRH 4I18B 1KJ2B 4KI5F 1S9XA 3NZ8A 3MJ8A 1CCZA 2PYEA 5TH2B 2PR4L 3PUCA 4JM4L 4G6MH 2WINA 4NQCB 4NT6B 4I5BA 3QCTH 5SWSD 2F5BH 1YMME 3PV6A 3OG4B 3VH8G 1NAMB 3RVVD 1YJDC 4R96B 5E8OA 3MCKA 2H2PD 5CWSB 5JXEC 5HGAB 1OARH 3IDXL 4RWHA 4Z9KB 2D0GA 4YHIB 3VMPA 3AUVA 4B50A 4BFIB 1I8IA 3HI5L 4HXBL 4Y4KC 4OZGA 3PHQA 1HYRC 1TMCB 2ADJA 3BYTA 1KCRL 3HCVA 5C07D 4XGZA 3LEYH 3FB5B 1NFIB 4IDLA 2BCKA 4M62L 4TSAH 4HUUB 2AK4E 4G80B 4ZS6D 2R1WA 3H9HB 3DROA 3PF2A 4HK0A 1OTSD 2B1HH 3WJJC 1UM6L 3CC5B 2VXQH 1JRHH 4GQPH 43CAA 5KSVA 1LEGA 4MA7H 1F5WA 1Q72H 4NFDA 4G6KL 5EZOH 5FGBA 4QXTB 3WIFB 2D9CA 4IMKA 5B4MD 4YR6B 1OGAB 3RWEB 4FABH 5D6DA 1OF2A 2IAMC 3RX5A 3VXME 4J6RL 4JAMA 5CUSL 4NJ9H 1NUNB 5T1LD 3VW3L 1AKJD 3O4LE 1XCTA 2P8MB 4WW2C 5C6WH 1JE6A 5MEQB 2RFXB 3QQNA 5F9JB 3F8UB 4WEBL 5TE6L 3QUXC 4CVZA 2WUBH 4LP4A 5IEHA 3P9MA 5DJZB 1DANT 3ZSTA 2GQHA 1U3HB 5BS0E 3PGDA 3TT1L 2FJFA 5T1MB 1IFHH 1FFPB 1RURH 4R4NC 1SY6H 4HIIA 1RVFL 4XCYB 4JM2B 5TDOB 2X42A 4HG4K 4PR5B 3W9DA 4PGBA 3KPNB 4U1KA 4AL8L 1NCWH 5B38G 1A02N 1H3XA 2R4SL 5D1XD 4XB8A 1YEFH 1G9NH 3FT3B 5B22A 3MRMB 4BFGA 5BMFL 4JN1L 1SYSA 5L0QB 4OFYD 1P4IL 3V6OC 5D1ZB 5KSUB 2DKMA 3FQUA 3T3PE 2FHFA 4LBEB 2YBRA 2HG5B 3IJHA 1I1FB 1M6OB 2ED7A 1DEEA 2RB8A 4XVUD 1CD9B 1P7HL 2J2ZA 3E6HA 4Y8AA 2CIIB 2CD0A 2H2SD 5FOBB 1W0VA 3GB7A 3WCYA 4GW4A 2FGZA 5IJVA 4ORGB 2H32B 4I3RL 2XTJD 5CJ8A 3HNSH 2Y7QB 3C5ZD 1A3LL 1G7QA 4K7PX 1QPPA 4LAQH 4N1CA 1Z9MA 5KBNC 3SDAD 4OI9A 1PLGH 4M7JH 4HLJA 4YDLC 3QUMB 2VISB 1RZFL 4LCCA 3WNNA 4MQXC 2YSSB 3ULUL 2R9HD 4V2BA 4BK4A 4GS7B 4NN7B 2H45A 3CFJB 5J13B 3AREC 4P9MH 3WSQL 3VGBA 4XNMA 2YA1A 3ARFD 2EYRA 4OCRL 4ZOAA 3RWHB 5F6IB 5GGTL 1HE7A 1YZZA 3P0GB 2DD8L 2OTPA 4TNVF 1Q94B 1SJHA 3DGCR 4O2CB 4OCXL 5CAYB 3T77B 4MJIA 1I7UA 1JWSB 3MXWH 3O6KH 3L1OL 3MRIA 1LDPL 4HH9B 3CMOH 2F9BT 5FUCC 3ZL4L 5J6GA 1XGPA 1G9EA 1DBML 3ARBC 4X98A 1I9IL 4QOKD 1A7RH 4CN6A 2MOVA 2XG4A 2YWYA 4UU9A 2ESVA 3JWOC 5SWZA 4OV5A 3TNMA 3VXQA 2JELL 2EE9A 4LHQB 3D5OF 4NKDA 3AMKA 1VACA 3DTXB 1NC4A 4U1LA 3CXDH 2OJZH 2X4OB 4HXAH 3CZFB 2X4TB 1IAIM 3TCXA 3B9VA 4L8CB 4P2RD 4F80A 5EUOA 2BVQA 5C3TA 3LEXB 3EIFA 3SDCA 3MLVH 5I1DB 3VD5A 4KFZC 3GKWH 3O6ML 4DZ8B 4N5EC 2CUHA 5L2JB 4Y1AA 4NOFA 5E4EC 4NBYB 5E1HB 3RVTD 3TN0B 3HR5B 5DMIH 5DC9B 1JHLH 1DBBL 1T5WB 4G9FA 4URTB 3FQXA 4PLJC 1OP9A 4NDMA 1WEJH 3K4ZA 1IGTA 3UTTD 2Q76A 5D9SA 1M05B 3WUWG 2YK1L 1VPOH 4JO1H 3F7VB 3VFOB 1HDMB 1MAMH 4K3GA 5DQ9A 4QHUB 2XOTA 5T3XD 5ILTH 1E27A 4D8PA 5IMLB 1YN6A 1HEZB 4LU5L 4XMLH 1ZVSA 1ADQH 4IDJH 5D1ZC 4X9IA 1OD7A 3VFGL 3QCUL 4M3JA 4RCAA 1NGWB 1LP9A 5HHVH 3BEWA 2Z31B 5IVXB 2AGJL 1A6VH 1TIUA 2GJ6A 5JLZB 3U7WH 1JPTH 5HYJB 5JOPE 3QXVA 3FN0L 2J4WL 3QEGH 1PEZA 5J9PB 2CKBB 4PBXA 3VRJA 4QRRA 2FX9H 1KPRA 5FFLA 2HT3D 1JZ7A 2JB5H 3KNBA 1RK1B 4POYA 1ITCA 1DUYB 4HBQA 1X7QB 1YQVL 4YHKL 4KU1A 4OZHE 1AGCB 1T04A 3LDBC 4KHXL 4XPFH 3JSSA 4B7IA 2Q3ZA 5F9WB 3VI4F 4HS6A 4G8GA 1OAXH 5E6ZA 4Z0XB 5JORA 4YAQB 2HFGH 4GS7C 2D03H 4NN7C 3B9DA 2YOCA 1W72H 2A9NH 3UYOD 1D5XA 4HV8B 5IROC 2NR6C 4EDWH 3VE0B 4NQDE 2BERA 3OX8B 3H7BA 4MMZC 3OKEA 4U1HB 4X8JA 3KGRA 4NRYB 3WJLA 4DUXA 1NAKH 1I8LC 3S88L 5D7JD 5I1IH 1FNHA 2CJUL 5DD1H 5DK3A 1CQYA 5CJ5A 2EE2A 4P48A 5H37G 4OCYL 2FIKA 4I3SL 4M7LL 5FUOH 1DBKL 1R6VA 2J8UB 5H94B 3ULUE 4X6CB 1F2QA 5FB8A 3RWIA 3V0VA 4JG0H 4D0DA 4OF5A 3WLWC 5L2KA 3I3EA 4E42A 2IBGA 2BNRB 1CU4L 3C5SB 3E8UH 3IFOA 4CJ0A 4LLVB 2C3GA 3X3FH 3BE1H 5C2BH 4R7DB 3TBWA 3QQ3A 4XNZC 4QHNB 3SE9H 2VXSL 1KT2A 4P57B 5HYIA 2NY7L 4HK3N 5GS2H 4KROB 2V7HB 3LEVL 4LSTL 3VXRB 5C0JA 4PJDB 3GBNH 3QHZL 4U49A 2YXFA 1KCUL 3QPXH 5HPOA 1QZ1A 3KWWA 1IKFH 1DFBL 3VWKC 5J57B 2KKQA 1A1NB 7CGTA 5I1KH 2M2DA 3CUPB 3LRSB 3RAJL 2AK1H 5JW3H 2OR9H 3NFPA 4RMRA 5TGBB 1YY9C 2KL6A 5LGJB 3QG7L 3ZE2F 3QUZB 3FB6B 4RFEB 5BXFA 5IBLC 1N59A 3BKYH 5ABDE 3QT2A 5C09D 1DN0A 2AERT 3QQ4A 3RVWD 2PYEE 3G08B 3C6SA 4MNQD 4OKVA 4LNVA 5FO7B 3EO0A 5ALCH 3IDMA 2IQ9L 3KYNB 2W60B 5E5UB 5JZ7C 1E6OL 1MIEL 4M7ZB 1CLYH 3LRGA 4XP5L 2O5ZH 5EZJB 2P46B 2NXYD 4FQXC 3S35X 4L3AA 4FP8H 5F93C 4MXQC 5K9JL 3UTPD 3T0DA 1JGEA 5IWLA 1FVCB 2YWZA 1HHJA 3QO0B 3L3OB 4U1SA 2NY1B 5HI4D 5GRXG 4GH7B 2D7OA 4HUWB 4FQLL 3S4SA 4Y4FD 4PV9A 4NC2B 4HUKB 2FL5A 3TA3C 4DN3H 5EO0B 1HOCB 1T5XB 3O2DH 3P9LA 4DKFL 1WT5A 3L3JA 2Q8BL 4FTVA 5GRZA 2ADFL 2F53D 5DUPL 1AY1H 5KG9A 3HMXH 4O9HL 4P5TD 3TM6A 2BNUB 3FO0L 3QULA 5BZDB 4IOIB 1B0GB 1X6LA 4P4KD 12E8L 5JHDE 3G6AA 2YZ8A 4U6VH 5I1LB 3EYOB 4JY4A 1EO8H 5IUSA 4JQXA 1T6WA 3P0VH 2YZ1A 3MA7B 3CFEB 1IILE 3PP4H 1J87A 4HC1H 5TPWH 3O3EB 3MMEB 3V4UL 3ZYIA 1KULA 4M9PA 2ZSVA 4PJGB 4X5XB 3U9PL 1GZQB 2VUOA 1BIIB 3OPZH 1F4XL 5BQ7A 1CICC 5FUZL 5KJRL 3ZYZA 3KPLB 1JJUA 1OAQL 3CDGA 3MV9B 4Y5YB 1OAUL 2QQLL 4WWKD 1NCAL 3SDDA 2F54D 4HPYL 1A0QH 2VDNH 2OP4L 3W9EA 1MIML 4L8DA 4PRBA 3KPRB 4CW1B 2FX8L 3L3GA 5EBMA 4DTGL 1A6PA 1F4HA 2R0LL 5CJOH 2DI9A 3L3HB 4LNRB 3BZ4A 2YEZA 4HIEA 3VMNA 3OKNA 4JKKA 4K3EH 3IDJA 2NY3B 2OSLB 3QDJD 4LCYB 5I8OH 2EIEA 5I66A 9CGTA 3VWJD 4PREB 4W6YB 1VGKB 3L5JA 3BAEL 4MJ2A 1H8NA 3KXFA 2P42B 2EEAA 4MA1C 1Q0YL 2VLRA 4LIQL 4X9GA 3KPPB 3O9WA 5J11B 1QSFD 2ENYA 35C8H 1WLHA 3U1SL 4PRID 3PJSA 3ORJA 5IVNA 1S7WB 2GCYA 3BUTA 1C5DB 5SX4H 5C0GB 1RZ7L 2K7QA 3CDFA 4Z0BH 2GEEA 1X5JA 4G3YH 3QEUA 4PJFA 4V2CB 4R9HA 2A83B 1PKQB 1YECH 1EDQA 4QTIH 3SO3B 2H9GB 5IB5B 3H3PL 4U4BA 5HYSA 1C16A 3BKML 3MFFB 4PJIA 1NDMA 1NLBH 4NQTA 4U1NB 4D9LH 5CHNA 5BVPH 4E0RA 1T4KB 3KHQA 4APQB 5DA0B 3TCLA 5ID0B 2X4NA 2BHZA 5D2LA 4MJIE 2V2TB 4LF3B 3UZEA 5GGRA 1BP3B 5DR5L 2NY1C 3CSYB 2AEPL 1KJMA 3VGFA 3W39B 1FO0L 4U1GB 2YD8A 4N9GB 3GIZH 4G8IA 1YEDA 2JIXD 3EO9L 3MOAL 4ZXBB 2BRRL 3VFVB 1AP2B 3K2UL 3VFTA 1DLFH 1BQLL 4M6OH 4EI5B 2CDEB 4OBRA 5HTSA 1IZJA 2QADC 3NIDE 1OSZA 2BVTA 1KIQB 5DJ2B 2ESVE 5I1GH 4M6NH 4ZSOA 3ET9F 3PXJA 4XX1G 3MLRH 3DV6A 4J3TA 5C0CA 1ZAGA 2GHWB 1N7MH 3D39D 4KV5F 2VLME 1Z0NA 2IBZY 1U8IB 1DQQA 4WO4C 3LSOB 5EUOE 3GMRA 4Q2ZA 1CVRA 1OW0A 4N9OB 4JO2H 4Y1AE 2VDKH 2QKIA 1CGWA 3RDTB 1P4BH 4LPXA 5FCUH 4O58L 4XMPL 1A2YA 2YPKA 5B3JF 1Q1JH 4G9FE 4QRQB 4NP4L 3MLZL 3SE4A 3PNWA 1J1OH 3STBA 3UAJD 3HZMA 5BCAA 4N8PA 4R6UA 1K6QH 1RJZB 4FQCL 1O7SA 1CFTB 2IPKB 4XCEA 4I2XB 5C0BB 3ABZA 3IU4H 2ZG1A 5GHWH 1RUKL 5DQJA 3G5ZA 3BESR 2RCSH 3OKDA 4Y89A 4Y0GA 2NY5L 4TVPE 1TNMA 1EJ6A 2AJ3B 3S9DB 1JK8B 5DXWA 5IESH 1IM9D 4JFPA 4U7KA 4TN9A 3X11B 1LP9E 1FGNL 3EOBA 2GJ6E 3KDMB 5ID1A 5ITFA 1EHNA 3GSQA 1OY3B 5C0AB 3GSRA 4Z78B 5D2NA 2NY3C 1GC1L 2VLLB 3BEVA 2XY1A 4J3VA 3WFZA 5JXAH 4QRRE 4ZS7L 1YQ2A 1AR2A 3DJ9A 1KLGB 4WI5A 4MAUH 3D2UD 4YWGH 3QG6A 1INEH 4R2GB 2MQ3A 4UINH 4HS3A 1RI8A 3ARGA 2IFGA 5EFIA 4Q97A 2VXUH 4G8GE 4KK9C 2HT2D 4XNXL 1OQOA 1U8NA 3F12B 5AYUH 3EAKA 3E2HC 3EOYG 2GUOB 4KDVA 4NC1C 3UP1A 2HP4A 4K8RC 1YUHB 3RI5K 1JF5A 1UXSA 2XYCA 2QSQA 4DEPB 1GL4B 3FRUA 5IBTH 5CD5C 1BD2B 3PWLB 5CINL 4M1GL 2XA8L 1DP0A 3P9WB 2V5SA 5E8PA 5AUMB 3ULVL 4ZFGL 5DJDB 4APQC 3PL6D 1TETH 1J1XH 4JANA 3RWFB 3FFCD 1CZ8H 2XWJA 5BRZA 3FN9A 3O8XA 4JFHD 1WQVT 1A5FH 5ETUB 1EFXD 5DEFA 3LIZH 3RKDD 4WV1B 3OMZA 4ODXA 3MRKA 3QIBD 4GBXD 5DD6B 2BFVH 1BZ7A 4MAYB 4PY7A 3I6GB 1XGRB 3MRBA 2FB4H 4MD4B 5L2KE 2F74A 3EYFA 3RA7L 1G6RH 5EZIH 2DQEL 3H0TA 4WI2A 4POUB 1JWUB 4U1JA 4DZBB 3QIUC 1MCQA 3QO1B 5IGXL 5D1QB 1G0DA 4X7SL 2GY7B 3MLUL 1Q9LA 3C9NA 3ZDYF 1JNLH 4ODVL 3T2NH 5K9OB 1MRDL 1ES0A 4BQBA 1U8JB 3MV8D 4PJAF 1R5VA 1ZANL 1JZ4A 2HWZL 5EU6D 2ICWA 1M71A 3B2VL 4GAJH 4ZPVB 5GGVH 4JKMA 4JKLA 4OLUL 3QPQD 1BX2A 2WWMC 3L6FB 5TFSH 4YBQC 1ORQB 3C60B 2GKIA 1NC2D 2QSCH 3STZB 4EI6B 2ZUQB 2XACC 1UZ6F 1T3FB 3T4YA 1HIML 3BQUD 4FXLA 1UWEH 4WU7A 5MHSE 1QSEB 4L3EA 5FYLD 1G1CA 2OJEB 3MODH 5DHXB 1XF3B 4JN2A 5DUML 1H3VA 4OCLC 4NO0D 3EGSB 4WUUA 4P46A 3R8BB 2PW1B 3LN5B 4U05A 4XCCL 4Y19B 3QH3B 1DVFA 2EDRA 2W0LA 4B7LA 3JV5A 3LV3A 5ADPH 3UO1L 1DUZA 3O0RH 5HYQB 1WWBX 2X4PB 2CKNA 1UXWA 4KZEH 3AROA 4HGWB 1XMWA 2R2HA 3MCLL 2ZG3A 2HVJB 3IDXH 4ZODA 5JPNB 5F8QC 5I15L 3SJVB 4PTTB 3WN5B 4QCIA 4OGAC 3F65A 3LKPA 3HC3H 2QR0B 2AK4D 4XAWL 5IMOA 2GTZA 3STLA 1D9KB 1IGCL 5MEPB 1J0KA 4ZFFA 2HJFB 1SBSL 2R1XA 4LQFL 3V0AC 3FZUD 3T0EC 1X5YA 2DQFA 5KVFL 2B4CL 1F45A 4M00A 3V6ZB 3HE7A 1S9VA 1U8PB 3MGTB 1MVUA 3GM0A 1LO5B 4PFEA 4Q6IB 3H9ZA 4NCDA 1GH7A 3QNZB 5TQ2L 4X6EB 3DI2B 4OTXH 4HJJH 4IJ3B 4KKBD 2NW2B 4UTAL 5C6TL 5DJYA 2YUWA 1TITA 3FKUS 3O4LD 4AJ0A 1YPZA 4JREB 4XMKH 1IC7L 4K9EC 3EYQD 2DRUA 4Z7NF 3MRCB 3VW3H 4PJXA 2IQAA 1ZGLB 5E2JA 1EA9C 3MBEA 3U0TB 4MAYC 5EUKA 2DM2A 3ZT5A 1KFAH 5BS0D 2AXGB 5JQHC 4KKCC 4WEBH 3MUGA 4JRYE 1N2RB 3SDAC 4K94L 5EZLB 4GG8B 3Q5TA 2OL3B 2NX5A 3VFSA 3R4DA 1CFQA 1XGYL 1H5BC 1QFWH 4XVSH 2QLVB 1H9VA 4NQXB 1EEZB 2AEQL 2VDML 4MCYA 3H9SA 3D69B 1OTUC 5I74B 2EDKA 1Q0XH 4F7MB 4TSCL 2W92A 1CR9H 1MELA 1RUAH 2C1PA 1KEML 3S3JA 2VXVL 1MFEH 2ORBL 4Z76A 3C60C 4MWFA 4OLXH 3X12B 2QTEA 3AS2A 3RL1A 1A6WH 2BSTB 4E41D 1SMAA 2NY2B 2WM0A 2ZUQC 4ELKA 5EB9A 5C0EB 4OIAA 1MCLA 4Y4HD 1II4E 1ZLUH 4F7PA 1FIGL 1SBBA 1IARB 3QFJB 4PJIE 2DM4A 4MA8H 4OZFG 2IH3B 4XNQA 3SPVB 3VRIB 1JZ6A 3EZJB 2MCPH 5DT1H 1FDLH 2ZPKL 1HH6B 1KXTB 3GMLB 4HK3J 3DRTA 4FG6D 1RU9L 4KK5D 3N1FC 3WSQH 5F44A 3D9AL 5D2LE 5JXEA 3U79A 5E6IB 3GJFK 1A7BA 3RKPA 5GGTH 2DD8H 1AXIB 1JYVA 5J4MA 4G43B 1KJ2H 2ZOLA 3KJ6L 4Y4KA 3C6LC 3D3VB 5ACZA 3ULSA 4MDIA 1N6QL 2I5YH 4RAUA 3GMQB 1D9KC 5E8NB 3HPLA 4FQPA 3GDBA 5LXGL 4LLUB 3O2WL 5KOMC 4Q74A 2X9YA 3O3BB 3ZO0A 4BH7B 5JIHA 3L1OH 5B21A 3C5JA 2VABB 3WJJA 2X4UA 4ZSOE 3U83A 3IFNH 3SGKC 5IR1A 4IRSB 5K9KA 4QRTB 1L4IA 3G5YA 3L3DA 5C0CE 3ZKND 2Q6WA 1DBMH 4OQ1A 5D5ME 1I9IH 1OWRM 3EBAA 3OXSA 5C9JA 5IVZB 3TESA 5HI5C 3V8CA 2IANB 4Z5RA 1PX4A 5C08B 3TZVB 3U46B 1VKXA 2ZUTA 2IAMA 3NN8B 1GHFL 4B5EA 2OZ4H 5EC2B 2V7NA 3BDXA 2EDQA 4D9RE 3LQZB 4R7NB 2ATPA 4EBQH 4WW2A 3O11B 3SDXE 8CGTA 2UY6A 2NTFA 5D70L 2R0KH 4JHZA 3BPCB 3PP3H 3S3SA 3O6MH 3MRHB 4XCFL 3RTQB 4BH8A 3QUXA 1T1XB 1SEQL 4LKCB 1X5FA 5ANMB 3NIFF 1B9ZA 4RMVA 5E94A 5EC1B 4ODSL 5GZND 1MREL 1LHZA 1DBBH 4QF1A 5AWNL 4ISVB 5DHYA 2DDQL 5EIIA 1FJ1A 3UX9B 4LSSH 5GIRA 1S5IL 1S5HB 3WFBL 5KSBA 1YY8B 4KJPD 2G60L 1YDPA 3ECBA 3V6OA 3FO9A 5ITBL 2R15A 1AQKH 5D7KE 5I1EL 4YBHA 5JOPD 5JPMA 1P2CA 3HZVB 4HKJB 3DX9A 1X5LA 1A1MA 5AAMA 2DTSA 1OAYH 3MNZA 1FPTL 4GAYA 3WIIL 3HHRB 3CVIL 4X6DA 2FYYB 1KTDB 5T5NF 3ARDB 4Z7UA 1HZHL 1BEYH 4HFWB 3OZ9L 1YNLL 3ZZ1A 4NPYB 3DOSA 1MFDH 2DJUA 4IIQB 5IP4A 1RZ8B 3HZKB 2V9TA 1E4WL 3W0WD 5F7NC 2ICES 3OF6A 2ZKHH 5H35A 2ZCHL 4R4FH 2DM3A 3OR7B 4KHXH 5CS7A 4G8EB 4NQCA 1F58L 2GTWB 4NT6A 1R5WB 5F7UA 4P2OB 3AREA 3CSGA 3TVMB 3D25A 1LWRA 2VLKE 1NAMA 4NO5B 3M8OL 5IG7A 1ZT7A 3RWGB 1N64L 2C9AA 2H32H 4R96A 5BRZE 5BV7B 5CWSA 1FAIL 4NQED 1CDBA 1UKSA 1TJGL 1EHAA 4BFIA 3QUMH 2VIRB 3CH1A 5B8CB 4LVEA 3EHBC 3CXHK 3ULUD 1ZGLP 3HE6D 2UUDK 2HAZA 1JIBA 3U7YH 1HN1A 4HUUA 3FOMB 1RJLA 2EDTA 4G80A 3H9HA 1MHEA 2EEDA 1MPAH 4L5FH 1D5MA 4PJ7A 5SX5H 3ZKMC 4ONOA 5DA4A 1I1CA 1L0YA 3JWDC 5TF1H 3K4AA 2R2EA 4FFVD 3BD5A 1T66D 5GS0D 3SCMB 1W0YT 2AJSL 4WI8A 4QXTA 4NQSB 3WIFA 5E9DD 2R0WL 2VLJB 3AM8C 1MCWM 1OGAA 3RWEA 3NOIA 3RGVC 1KTLB 2HLAA 2VXSH 2NXYC 4F33B 2NYYD 3LZFH 4ELMF 5DMGC 5TE7H 3K46A 3S7GA 2YN5A 3HFML 1OP5K 1NKRA 1YJDL 4WNQA 1QHOA 2P8MA 3MRRB 3V6FA 5MEQA 3ZLQC 2RFXA 4PJ9C 2IALA 4YHLH 2OTWB 1KCUH 5DUBB 3UBXI 4AEEA 3QFDB 4NUGL 5A40E 4UILL 5F9JA 1S9KC 4ZOEA 2O61B 1DFBH 3RTQC 1H15A 3GRWA 3PQYA 1FNSH 5DJZA 2CMRL 3LPGA 4FQ2H 4LMQE 2W1NA 3QZWG 3PDGA 3BD4A 5IW1B 1QQDA 5T1MA 2VDQH 2RHEA 2FO4B 4K3DL 1HWHB 5TDOA 2EDHA 1WUNT 1F90L 2A6JB 4PR5A 4WUUE 4LRIA 1CIUA 1IL1A 2JCCF 4RFOL 1I4FB 3QXWA 5ESQA 4TULH 3PXHA 2ID5A 2WLYA 2P7TB 4R8WL 5AZ2L 4NNXB 3MRMA 5KW9L 2K9UA 2IQ9H 2WWKT 5D1ZA 2XWBA 1DBJL 4LBEA 3SGEH 3QUYC 4HULB 5L7XL 2VH5H 5CD3B 1OL0A 1I1FA 1M6OA 3WLBA 4DK6A 3SKOB 2AVGA 5IJKC 4R3SA 5FOBA 3GSNB 5F96L 5CP3H 4K7PL 1B6DA 2EE6A 4JFQB 2H32A 4JFOA 4ORGA 4X9BA 3T65A 5IB1A 4LLMB 3GI8H 2ARJQ 2BY2A 5DHVA 3KYKH 4G5ZL 4RMSA 1QFHA 4KK6D 4KTEH 3V5KA 3DSFH 2VISA 4ZTOH 5DUPH 3RY5A 4WGWB 3PV7A 2B0SL 4DN4L 2CKBH 2HTLC 1J0YA 3CFJA 4X4YB 5CZXC 3VFMA 2DI8A 1KG0B 5JA8B 1MCOL 2XI9A 5IROA 3VFRA 3FAXA 2CLRB 4LPTA 3KYOA 2NW3B 2WIIB 4GXUM 4XPGL 5EBGA 4KRMB 3V7MA 2AV7A 1Q94A 1CI5A 4TUOB 4GO6B 1I8LA 1QOKA 4PJXE 3T0WA 5HHPA 1YYLH 4X4ME 5DMKA 1JWSA 1WJ3A 1TZGH 5F7LB 4FN0A 3U9PH 4GMSL 4KMQA 2A77H 1UCBH 2BC4B 4HH9A 2X05A 3RFZC 3ZMRA 2R23B 2NX5E 3NA9L 3MA9H 2FRGP 4RGNB 3LN9A 4JO3H 4PJAB 1NBZA 4JFDA 3TP4A 4JRXB 5J1TC 3WDHA 3HAEB 2VL5B 1R3KB 3BT2L 2OP4H 4YBLB 1MFBL 4R4BB 1UQSB 1YEIH 2J12B 1CDYA 2AV1B 1HINH 2R0LH 3H9SE 4KKLD 2EXWD 2X4TA 15C8H 2DLFL 5I1DA 5EORL 1P84K 4P3DB 4PB9L 5A3ID 3VWKA 4BYHA 1JPFA 4XHQA 3ZE0E 3MV7B 1PD6A 3RVXC 3HR5A 4X7FC 4C58B 3MRLB 3MNWB 4LPVA 3DUUA 1T5WA 1A1OB 5HHNA 2WP3O 1Q38A 4G42A 1S7SA 4OCSH 1NEZG 1M05A 4WENB 3GHBH 4C56B 3F7VA 3V4PH 4XXDB 3IJSB 3VXUB 3PDOB 4QHUA 1AGEA 3S96B 2P44B 4HLZH 1ZS8B 3WXWH 4OSUH 2CLZA 1HEZA 3K4DA 3QSKB 4HGMA 1DE4B 3L95A 3GSUB 1F11B 2YKLL 2I60H 4OAWB 4MJID 5IVXA 3H3BC 1GSMA 5F97E 3G6JB 5A16A 5EH1A 5DSCA 5DFWH 3LS5L 4AT6B 2CKBA 4QRPB 5I9QB 4JR9H 5GGVY 5DR5H 5LQBH 1CXFA 4XI5D 3GI9L 4U6XB 1FO0H 4OCWL 2PTTB 4H0IA 2Z92A 1DUYA 3WE6B 2ESVD 3GRWL 1R3JB 4K3HA 1AGCA 4RX4A 5SWZD 3EO9H 3MOAH 2EO1A 4Z0XA 1CXEA 5B39B 1NC4D 2XG5A 5D8JH 5EU7C 3WNOA 4GXUN 4F7EA 2VLMD 2YMXL 5EBLA 1UH2A 1MI5B 1ZTXL 2C1OA 4XWGL 3TBYA 4FFYL 1ZT4B 4HV8A 3SDCD 1W0WA 1EGJH 4YHZH 32C2A 2EIDA 3VE0A 2E6PA 3I9GL 4Y1AD 3OX8A 5FDWB 5B38B 2X4RB 2FWOB 3H9YA 4U1HA 3T8XB 3OBAA 4NRYA 3E3QC 4YNYB 5HI3D 4X5LA 1VSCA 4G9FD 5TDNB 5DJAB 2GW5A 5E70A 5C6PB 4M7KL 4EN3B 1CICA 2FX7H 1LO2L 1DEDA 1G7IB 4JGJA 5FHBL 4OI7A 3UYRL 5H94A 2R1YB 3BGAA 1QFWM 4HX1B 3VGDA 4NP4H 3MLZH 3QNYB 4WFGD 1REIA 4YFDB 2IADA 5FA4A 2ADGA 4FQCH 1HQ4B 1EAPA 4HEME 3ROLB 4TVPD 3JTTA 4YBLC 1LEIB 4R7DA 3V6OE 4QHNA 2GJ6D 1RUKH 1OTTC 2DMBA 5I76A 2UZYB 4MA3B 5D71L 1MLBB 4QRRD 3WS3B 1NGZB 1KV3A 1M4KA 2VMFA 2BK8A 2HTKC 1JPST 3TO4B 1T0MA 3O81A 5GJSL 1VDGA 1EUTA 4X6DE 1DLHA 1A1NA 4ACPA 2Z93B 4Z7UE 3CUPA 3LRSA 3DLQR 5LAXB 2VZSA 4PRHB 4U2ZA 3DV4B 4G8GD 4LQ1A 1BBDH 2X9WA 2DB8A 2DICA 3G08A 4NQCE 5FO7A 4HKZB 3B4NA 4YUEH 1CL7L 2P5WB 2OI9C 2VSDA 2BVYA 3KYNA 4GKNA 2H6PA 4JFXB 2CRYA 5KVEL 4DW2H 5C8JA 5MENB 1NMCB 4L1HA 1CGVA 4RRPA 3S35L 1KYOJ 5MEOB 2PYFA 2XXMB 4YDIH 1UACH 4P59L 4M8VA 2Z4QA 5CINH 4M1GH 2D7MA 3GSXB 3V2AR 1UWGL 2MPAH 1FSKC 4I9WE 4Q9RH 2H41A 3QO0A 3L3OA 1QSVA 1WWCA 1QYGL 4N8VA 1KTKE 5F6HI 2I26N 5L2KD 1EGJA 3PHSA 1EH9A 1HOCA 1M7IB 3H3KA 1LO3H 4AENB 3WO4C 2APTA 1QTYT 2BNUA 2VZ1A 1B0GA 4PLOB 3OSKA 3W11D 1XIWC 1RJYB 2DWDB 1OGAE 3RWJB 5I1LA 3EYOA 3OWEA 1KBGH 5IGXH 4DUVA 4MNHA 1C5BL 4N8CH 4M02A 4GLRI 3O3EA 1W2KT 3L9RA 2YRZA 4HWEH 1ZANH 2NZ9D 4DGIL 4PJGA 2Y5EA 1BIIA 1MNUL 1JHTA 3RZWA 3MLSH 2AS5M 4P0DA 1I7RA 4HBCL 1URLA 1AFVL 2X1PA 3S37H 5MHSD 4CNIA 1E6JH 2BP3A 4CRPA 3S98A 5JHLH 3IS1X 3MROB 3CNKA 3CFKA 4MGXA 1HIMH 3LHPL 4F58L 3CK0H 1RFDL 4GRWF 4E5XB 2LTQB 5IF0B 2CLVB 2XT1B 5IV2B 3L3HA 2Z0BA 1KEGL 3LQAC 2GFBB 2BSRB 2GYSA 5DUMH 1QNZH 3QQ9D 3MJ7A 3T09A 5IBUB 3W5MA 3MLWL 4G8FB 4HF5H 3AGVA 2BVPB 1MSPA 3HI1B 3DMMB 4M4RA 5EN2A 2DQGL 5ACLA 4PREA 4FTVD 4TTDD 2L7UA 2NNAB 4IRJB 5J3HC 4UDUB 1OSPH 1KGCE 5JR1H 5I15H 4CMHB 4O4YH 1I3RB 4WTZG 3BRDA 1S7WA 4G7VL 1C5DA 5C0GA 5EIVA 2R56L 4MDJA 1S8DB 1PKQA 2V6HA 1T21B 1BFOB 3BIBX 5C2UB 4Y2DC 5I30L 5KVFH 2B4CH 4L3CB 1QLEH 2H9GA 5IB5A 5JW4M 3MFFA 5CSZA 1TVHA 2UWEF 4YEEA 4WW1A 4YQXL 4MZ2A 3F6IA 2XRAL 1T4KA 1N3NA 4UZGA 4APQA 1FL6A 1J10A 1CXIA 5CMAB 4RNRB 3K8KA 5FKAA 5C6TH 3PWPB 5ID0A 3QR2A 3CAFA 2FHCA 3O3AB 5D72L 3MUY1 1K4DB 2H26B 3CSYA 5GSRB 1MH5A 3GMNB 4C57C 3MLPA 1D3CA 2ED8A 3MO1B 4N9GA 5CCKH 3X14B 4B41A 1TZHB 2YXMA 2M26A 4LFHD 2Y4SA 3VFVA 1AP2A 2Y72A 1MJ7H 3ULVD 3L3IB 1BM3L 4XBPA 4NKOA 4JFDE 2CDEA 4PJBB 3OG6B 5DJ2A 1KIQA 4ELMB 1VGEL 5ESAA 3TPUB 1QR1B 4GRMB 3B9KB 1ACYH 1U8IA 4KK5C 3TF7C 3HR6A 1OP3H 1AD9A 3KXFD 1MCNA 2AEQH 3QWOB 4XP6L 2XZCH 2VLRD 3O9WD 3BD3A 4OGXH 2DTMH 1G84A 3AXLB 1DDHA 2PF6A 3J8F7 3RDTA 1I8MB 3K74B 5L6YL 1ZKAA 1KEMH 4QRQA 3ZDXF 1EIBA 1M7DA 2VXVH 2DM7A 2F5AL 4JVUA 2JCCB 4NFBA 1MQKL 3MCG1 4KTDH 4OF6A 1QA9A 1RJZA 1XGUA 1MJ8H 3HNTL 1A14L 1J88A 1CFTA 2WQ8A 3CJJA 5CIPA 1JPSH 3FCTB 1MVFA 4JJ5B 4LP5A 2NXZD 3CLFH 4ZOCA 1GGBH 1I9RH 2AJ3A 1AC0A 4G7YL 3NIGE 1JK8A 5FF6A 2X70B 1LK3L 3BOVA 3Q6FB 5K93A 4DKDC 5IVXE 2ZPKH 3KDMA 4DKEH 3VD3A 5HYJE 2NY4C 5C0AA 4OD2B 4Z78A 2VLLA 2X44D 1F4YH 2G9HB 2PXYC 3DMMC 2XQBL 3D9AH 5DJXB 1KLGA 4Z7VF 1MUJB 3DO3A 4FFZL 3BXNB 3KJ6H 5EOCL 1OHQA 3HNVH 5CGYD 1PAMA 5JW4N 5IB2B 5EBWB 3T0EA 3WIHL 3F7YA 5C0CD 2L7JA 1C5CL 5AD0A 4AH2A 2EDXA 4MMXC 2E27H 3HPJA 1YUHA 4JKWA 3BIKB 5T1LB 1BD2A 2VOTA 1AKJB 1CQKA 3OAZH 5AUMA 3FN3A 5DJDA 5GJTH 3BPOB 4N68A 4ZUSB 4JDTL 4HDIB 4D9RD 1N5YL 1RUPH 2BX5A 3TV3L 3UTOA 5FHAL 3F7RA 4ESKA 4WHCA 3NGBB 3C08L 4HQQL 4P4RB 5DD6A 4O02L 5AAWA 5HDBF 5D70H 4MAYA 1CFSA 3I6GA 5IK3B 4O51B 5ESVA 4YPGB 1MY5A 1BQUA 2E5EA 4MD4A 1JNHB 5D1XB 5EIQA 3S5LA 1MJJB 2BNRE 1P5UA 3DETC 4RMWA 4ZNEA 1MREH 4HMDA 1AE6H 5AWNH 2DDQH 1FH5L 4ODTH 1JWUA 4JLRB 4DZBA 1Y6KR 3CIQA 2Y07L 1AQDB 1ED3B 3QO1A 5CSBA 5D1QA 5KSAC 4Z7QE 3CFBB 5F3HB 5K9OA 3NFSL 1CFNA 3B8SA 4Y2OA 3THML 3VXRE 1WTLA 4K8RL 3I75B 4HWBA 1BLNB 5D93C 5E00B 2R8SH 5C0RL 2ZCKH 1JYNA 4OD1H 2DKSA 4Y5VC 4M6ML 1B88A 2XTJB 3ARGD 3BDYH 2I24N 3C5ZB 2ZJSH 4HKBA 4KY1L 5F3BB 3L6FA 1ORQA 3B5TA 3G04A 3C60A 1IGML 3RVUD 5HHXL 1GJIA 1RZJC 3CVIH 4NWTH 1QLFB 2FECL 4WCYL 3T0XA 1DQJB 3MGAA 5BOPA 1IGFL 1LGVA 3ARFB 5DD3H 3EOTH 4NWUL 5SV3A 4TTGA 1BOGB 4OQTA 2E7MA 2OJEA 4AG4L 3GO1H 3EGSA 4I0PC 5A2JH 3CFDB 1VERA 2YPLA 3LN5A 3QYCA 5BRZD 3O8XD 3QH3A 4BQ8A 1XR8B 5BO1L 3QXDB 3SBWC 4RISH 1RIUH 2A6DB 3MRGB 5HYQA 2X4PA 3DVGB 4JFEA 4JFZH 2ICWJ 1I3GH 2CUIA 2LVCA 2MJWA 2Y5TB 4RFNB 2HVJA 4DAGL 2AJYH 4ZFZA 1TJIH 4ETYA 2HJLA 4AEHL 3WN5A 4PTTA 2CK0L 5CLTA 2ICEB 2W38A 3D18B 4DOHB 5E1AB 1A22B 4FMKA 4M1CC 2QR0A 5A2KH 4ZO9A 3MYZA 1D9KA 2LE9A 5MEPA 2YUXA 2HJFA 4M8QB 4MLIA 2F19H 5DRXB 6CGTA 4GKZB 4EOWL 4KWUA 5GGQL 1FZMB 1KN2H 3M17A 3QI9B 3SGKA 4O5LL 1HH9A 4A6YA 2FD6L 5I19L 3QIWD 4NOBA 4DCQB 5F71A 4P2RB 3QNZA 3N06B 2VR4A 1G7PB 1KIPB 3O4OC 2PW2B 1UENA 2AJSH 4NQVA 2HLFC 2EIZB 1KB5B 2NW2A 5I17A 3ARYA 3EDEA 1XF2B 1KCVH 1MWAA 3GSOB 3HMWH 3QHTC 1Z9SA 3OB0H 3RZCC 2DLEA 4PJGE 3A6OA 5CEXA 4KAQH 1X5AA 3U9UB 4KDWA 2D0HA 4NBXB 4XH2B 4UIKH 1FV1B 1U8LB 3MRCA 3UTTB 2BOCB 3WHE0 2DF3A 3CPLB 4HIXL 1A9BB 4WEMB 3MJ9L 1CE6B 2HT4D 3TYFB 5IQ7H 2KDGA 2Q7YA 1HHKA 3VGGA 1N4XL 2AXGA 4L3ED 4NUGH 4XXCC 1HXMB 3KR3H 4UOW1 4YO0A 5JUEL 3MXVH 7FABL 5I6XC 1N2RA 2GAZB 2CMRH 4WUUD 3KPRE 4P46D 5T1DL 4QY8B 2CPCA 5FM4A 1DVFD 2OL3A 2FEDD 2NY6D 2B5IB 2X1XR 1MHHB 3BKJL 4R8WH 2VZOA 1UA6H 2C7UA 5KW9H 4BZYA 4X6BA 5MP6L 1DBJH 4OD3H 4NKMB 4M1DL 3G5XB 2A9ML 4NJAH 2LFGA 4KI5E 3OKMB 2DQIL 5L7XH 4OF3A 2VXTL 4OIIH 4P9HH 3G5VB 4U31A 3HE7D 2EIBA 4WJ5A 1G6VK 3C2AL 4K9EL 3BGFC 2BSTA 1FNFA 1EVTC 4PD4J 3S4SG 1PKQE 3ILPA 3GHEH 3S36H 2ITCB 3MTRA 4NHCL 2MKLC 4G5ZH 2XICA 4KJQC 4MJ6B 2I9TB 1WFUA 3K80A 4HHAB 4H8WH 1WVZA 2VDPH 1AHWB 4MVBD 4CN4A 4IOFC 4LPUA 5IB3A 2B1AL 1HH6A 1HKLH 5D7JB 1P4LB 2AJVL 1LNUA 1AD0A 4D0CB 5BOZG 5IFHL 2GJJA 1IKNA 4IEFB 3MBED 1IQWH 2EH8H 4HWBL 4H1LG 1OPGL 1L7IL 4Z7WF 3I6LE 3IYLW 5KVDL 2XKSA 2SEBB 3GMQA 4RGMB 4YE4L 3OJVC 4K71B 3ZKSD 1XF1A 1ZA3B 1SM3H 2NX5D 4Z7OF 4GMSH 3FQWB 3O3BA 1QRNA 5BV7H 4YHMH 3QI9C 2A38A 4IHOB 3D0VA 3GJEA 4NGHL 3V79C 1C7TA 4P99A 1A9EA 4ETQB 3FQTA 4X0KA 2GSIB 2IFFL 1MEXH 2RQ8A 1YMHA 2XQYK 1TZIB 3F58H 4TQEL 4MJ5B 4OLZH 1FL5A 3TJEL 4PJHF 1S7QB 3BYYA 4OQTL 3UC0H 3AM8A 3P77A 1MFBH 4LDLB 1MRCH 1JGDB 3MUHL 5C08A 3RP1A 2ZCLH 3RGVA 3NN8A 3PABB 5EC2A 3WFHA 2WBWB 4I0CC 3LQZA 5ELIA 1S7XB 4QHKJ 2IBZX 3DVNB 5DO2D 4PJ9A 5C09B 3BPCA 1AI1L 4PB9H 4MNQB 3RTQA 5I1JL 1P1ZA 3FMGL 4GRWB 5DC4B 1CF8H 4HCRH 1HHIA 2OYPA 5C0BE 4I2XE 3A67L 4ISVA 2LU7A 1EHLL 1EEYA 3OKOB 2EDBA 4PLKC 3MJ6A 4JPKH 2BOBB 2C3XA 4HKXB 1S5HA 2B5IC 3QEHB 2J6EH 3BI9X 5E2VL 1BVLB 5JXED 4A6YL 1ZA6B 3U4EA 2XKNA 25C8L 5C0AE 3IDNB 4U0QB 2R2BB 4Y4KD 4Q0XL 1G9NC 4N0YL 4U3CA 4Y4FB 2VITB 3HZVA 3QUYA 3OKYA 4LSDA 2E9WA 1FORL 2HN7A 1MWAL 2GSGB 2BJML 4OF8A 2F53B 1F2XK 4PB0L 4PJ8B 4HUXA 4PYGA 3WL9B 3DIFA 2FYYA 1KTDA 1JF6A 2XN9A 3T0EE 4HFWA 5T5FL 5GRVK 4P4KB 4PG9B 3P73A 2UWEB 2C4FU 4NPYA 4MS8C 2GIYA 5DDHA 4GFTB 4BSVB 1JGUL 1LMKA 3HZKA 4OCWH 1WZMA 1VCAA 1PYWB 1WFOA 2CK2A 3V4VL 5EO9A 2ZZUT 4HSQA 1EK3A 2DL9A 2IAMD 1BD2E 4Y16B 5HVWA 1R5WA 1QVOB 4YHNB 4PY8I 3GSNH 3LKNB 1NCBL 1ZHKB 3FO2A 3N85L 2Q8AL 3SE3C 1FE8L 1OD9A 3LKSB 2IPTL 1UH4A 5TDPB 1B0RB 2AQ1A 4JZOB 4PRNB 3QUXD 3DI3B 1G7LA 4PS4H 4TUKL 3WHXB 2F54B 5IT2L 4R4ND 4KVCH 4RGMC 4M93B 5DD5L 4M7KH 2Y25A 1LO2H 4JDZB 3FOMA 4ZNEE 3D0LB 2HFFA 4EUPH 1QLRA 1I3UA 3FTGB 3VG9C 4TPRL 1A6AB 1Z3GH 4GW5A 3MNVB 2FR4B 5IVOA 4PGCB 1ZVHA 3MJGX 4LEOB 1CGXA 3REWB 3QDJB 5DRNB 5I1HL 4J23A 4NQSA 4DGVH 2VLJA 5D96C 4LHUA 2FH8A 4B0MM 1NBVL 3LOWA 3VWJB 3V52H 3BPNB 4F33A 4OZFB 4RGOH 3OXRB 1ZEAH 1ZLWH 1QSFB 3HZYB 1ZLSL 5FYJE 5D71H 3MUZ1 3MRRA 3QDMA 1MCPL 2IEPA 2X41A 2DQDL 4Q6YA 3ETBF 1UZ8A 1GYAA 4LPYA 4O2FA 5DUBA 3QFDA 3HAEH 3H42L 3FFDB 4PJEF 4X4XB 5HXMA 1U58B 4R90H 4MQXD 1XGQB 2P24A 4C83B 5IW1A 4NQCD 3N1MC 1QSEE 3PWNB 3QNXB 5MERB 3FHAA 3ARED 5HGDB 3AU1A 2A6JA 3S6CA 3W2DL 3W11C 1I4FA 3HKFA 4Y19E 1Q9OA 2ZNWA 4LLDB 1BGXH 4OT1L 5GQBA 4Z7VB 2J5LB 3JWDL 5IHZB 3TNNA 5KVEH 2FZ3B 4JKPL 4K3JH 2DLIA 5ACMA 3GK8H 3N9GH 2G5RA 5LCVL 4I9WD 3ROOA 1JGLL 5FM5O 3SJVE 1A6ZB 4ZG1A 1WK0A 4IBLT 2I27N 2VZ3A 2JIXB 1FFQA 3SKOA 3VI4E 1UWGH 4PJ8C 5DYOA 3BZEA 3ARZA 5F88A 2BSSB 3Q1SL 3VXNB 2ZUVA 2VDOH 4ERSL 4UDTA 5HVGB 2XTLA 2JTDA 1KPVB 3D39B 2ENSA 3GBMH 1OGAD 4OZIF 2R39A 1MHPH 2X4SB 2HH0H 5I8EB 4Y16C 2APFA 3FO1A 4X4YA 3AAZA 2VERN 4LSPL 5IFJB 3WD5H 5EOQL 4U0RB 3SKMA 3PHOB 2CLRA 4N5ED 2WIIA 1H3GA 3DUSB 5E99L 1CDCA 4GMTH 4G6FB 1C5BH 4TOYL 3PQYD 4O00A 1LO4L 1WT5C 5CZVL 1U8KB 2LAAA 3IF1B 2X7LB 4NN5B 4F2MB 5F1NB 2DWEB 4PLJD 4QTHA 1F6LL 2MHAB 2F8OA 3CX5J 4OLVH 3C09B 4POZC 3K7UA 5T3ZL 5CEYB 3LVEA 1XEDA 2BC4A 3C2SA 4J3OC 2IF7A 1ZGLM 4MQ7B 2R23A 3RWDB 1IM9B 3BGMB 2H1PH 1JZ8A 5JNYA 5D1ZD 1GGCL 3HG1B 4JRXA 2WANA 1JPGB 4LSUL 1R3KA 1ONQA 3OGCB 1KB9J 1VEMA 4HWZA 3RJQB 5C7XH 2AABL 4N0RA 4L9LC 3ZE2E 1S7UB 3CFCL 4YDKL 5I1AA 4OZGF 4GUPB 4WHTA 2C26A 4NKQB 3DBXB 3DWTA 3NACH 5FYKL 4J1UB 1F3JB 3VH8A 1EHXA 2CRMA 3QCVL 4P3DA 5ICYA 2CQVA 3MV7A 1NDGA 2DQGH 4FXKB 2VQ1B 5DEGA 1TQBC 3MRLA 3MNWA 3SDDC 4DQOL 4ONHB 3QEQA 3QUKB 5JW5A 4ZUTA 2VKXA 5C0IB 3QFJE 5HHQB 1NL0L 3TBTB 2QV2A 4EQ2A 4Y88A 4HT1H 4XXDA 1FZJB 1CFVL 2R4RH 3PDOA 5J0BA 1TVBA 3EYVB 2NR6D 3FFCB 3O6LH 3NAAH 1S78C 2QEJA 4D2NA 1EFXB 1DE4A 3GSUA 3CVHB 3LMJL 5ISZA 1F11A 2DQCL 3NA4A 1UJ3B 4OAWA 1YYML 3QIBB 4GBXB 2VWEE 3OAYH 3D3VE 4JVWA 1TQCB 1IEBA 3MACL 4AT6A 3KPSA 4QRPA 1KOAA 1N5AA 5FV1L 4YDVA 2ZOKB 2W59A 4YFEA 1PKOA 4LASL 2UZIL 2OQJB 3WLWD 1RULH 3RHWF 5KN5B 3V8OA 1QRNE 2BNQA 2PTTA 4JFDD 3RPIB 4M61A 4XBGB 4AEIH 4MXVF 2YN3A 5GRUL 5F8RC 3EJZC 2GY5A 5HHMD 1GGIL 2A1WL 1V7MH 4YK4B 2M1KA 5BW7C 4KJWC 4PV8B 1YMMA 3MV8B 5LBSH 1F02I 4ZO7A 3JTSB 4MQSB 1JMXA 5EU6B 4RDQG 1XIWA 5GRVL 1MI5A 4H88H 5C08E 1ZT4A 4U0RC 5CILL 1BIHA 1GOHA 5KZCD 3BWAB 3U82B 3K8MA 3QA3B 3ISWA 4KHTH 3VWKD 4YXHH 5B38A 2X4RA 1FNLA 1J1PH 1NC2B 1ZT1B 2P48B 4QEGA 3L7EA 4UT9L 3ZKXC 3BN3B 2HKHL 1YY9D 4YNYA 4XP6H 4XVTH 1F4WL 5TDNA 2BHYA 1MFCL 4AK1A 3BQUB 5IBLD 5DVNA 1JZ2A 3PIQB 1BOYA 1WF5A 3VGAB 3C09C 1FYTD 1V8HA 4F37K 2R1YA 4X6FB 1AJ7H 4HX1A 2VC2H 4XPTH 3NCJL 4NO0B 3QNYA 2JJSC 1DSFH 1K4CB 5JZ7D 1U95B 5M7QA 1D5BB 4J8RA 3ROLA 4W70A 4FQXD 3DX8B 1T0NB 3UTQB 4MXQD 1EPFA 1G7JA 3BPLC 4MA3A 1CXKA 1FBIH 1MLBA 5L8LB 3WS3A 4ZOBA 3T08A 3TO4A 4EXPX 1Y18B 2BY0A 1ND0A 2R29L 2Z93A 3S8WA 2OR8A 2XN9E 2IPUK 3U4BH 1T83C 4YC2B 4RX4D 3IDIA 4FFZH 4R26L 3DV4A 3ZHDA 3IDGB 2XIDA 4EDXB 3DHMA 1WC7A 1GIGL 4TNWF 1ZHNA 2KUTA 4FFWD 3WIHH 4XAKE 2Q20A 1U8HB 2AXJA 1IT9L 5I1CL 2A74B 4H5SB 5MENA 4EVNA 5FYKE 4LSQL 4Z7WB 1DL7H 2APWA 3IDYC 3EYSH 4NM4L 3DGGB 4ZUVB 5CEZE 3GSXA 1IBGL 1CICD 5FO8A 1YEJL 4MX7A 1N5YH 1BFVL 5HPMB 3TYGH 4MQTB 4WVRA 1IGYB 2A6KB 5HVFB 4TSBL 4HQQH 4NUJB 3PGCB 5BJTB 4KV5E 4V1DD 4O02H 1CGSH 1M7IA 4PJHB 4WY7L 4ONFH 3BKCL 1NGQH 1P69B 3KPOB 4AENA 3I02B 5EO1B 4ZFOA 4KPHH 3BSZH 1WBXB 1AXSA 3WEXA 1PQZB 1JCKA 2VLJE 2DWDA 1FH5H 2FBJL 3RWJA 1LP9F 2X4QB 1NEZB 3BP7B 4JQIL 5B3JE 2FATL 3WUWA 2Y07H 1INDL 2W9DH 5HYFA 4S1RH 4NZUL 5JMRA 5EU5B 1KCKA 1HILB 4E41B 3W82A 1BAFL 4PJ5A 3TIEB 1RIHL 4XC3H 3PWVB 4Y4HB 4I13B 3AS1A 4NRZB 4ZNCD 1MFAH 4U3HA 4S1SH 4KY1H 5HY9A 4F9LC 2ZUYA 4U7SA 4LEXL 3JV6A 1U8QB 1ZSDB 4X6CF 5DJ8B 1QO3A 3MROA 4U1MB 3IKKA 4UBDC 3R06A 3VFUA 3FB8A 1X3DA 3P4NB 1U91A 4EJ1C 1ZHBB 1LQSR 4WUKL 3CLEH 4L4TB 3D85B 4QHMB 4AG4H 5E5MB 2GFBA 2BSRA 4X7TA 1JFQL 4GG6F 1SJVA 5KTEL 4XWOC 4LCUA 2NY1D 4G8FA 5TE4H 4NNPL 2BVPA 1LD9B 3S34L 2PXYA 3DMMA 4GW1B 5ALBH 3V7AE 4PJDF 5F89A 1UM5L 4HPOL 4HAGA 3J7HA 1X4XA 4AEHH 3MQIA 1MF2L 1I3RA 5IIEB 2QADD 3A6BL 4M5YH 1V7NH 3O2VL 4AMKH 1EXUB 1S8DA 4PUBL 4FZEL 5EU7E 3OR6B 5F21B 2NY6C 3Q3GB 5DI8B 4OM0L 4OM1L 5CJQL 3O6FC 2FJHA 4G6JH 3FRPG 5I19H 3QB7C 4LVNC 2WUCL 1Z6JT 1JUFB 5JIIA 4K23H 4JY5L 4KMTL 4D0BA 3LQAL 3DSNA 4RNRA 5GGSB 3E3QE 4CVXA 3PWPA 4KRPB 4XNYL 1HNGA 3VXOA 5D6CA 1KPUA 1A7NL 3BW9B 3L5XL 4PGDA 3WFEH 5C9KA 5GSRA 3GMNA 1X5HA 3MO1A 3FJTA 3X14A 5F9OH 4RMQA 1TZHA 3OKKB 4HIXH 3ES6A 3ZDYE 3MJ9H 2KPNA 2O5XL 4DGYH 2J8HA 4CDGC 3KAAA 4RGNE 4PJAE 3SGJC 4JRXE 1TLKA 3MREB 7FABH 4ELMA 1D5ZB 3OHXB 4GKSA 3TPUA 5HD8C 3RIFF 3GUTB 5KSAA 2NY3D 4NQDA 5HVHC 4IRZH 3BKJH 2J88L 4CMMA 1IAKB 3T1WA 4PJEB 3F6LA 4XC1L 4KI5D 3QWOA 5EWIH 1MRFH 1U6AL 4LARH 4Y5VA 2EDOA 1R3HA 3MV7E 1KN4H 4K7FB 5MI0C 1UM4L 3QEQE 1V3JA 1JGVH 3W0WB 4KK9D 2UVFA 4EUPG 3TO2A 2JCCA 4PTUB 5DD0L 3RBSA 2VXTH 2K7PA 2PO6B 1INQB 4HUMB 3OL2A 4YEFA 4K8RD 2VDLL 3GNML 5CD5D 4XVJL 3CD4A 4BZ2H 4KRNA 4APQD 4NQEB 3FCTA 4NHCH 4ZFOL 4I0PA 4OLWL 2ADIB 4ODUA 4ODHL 3Q6FA 3U6RB 1UB6B 4JG1H 1AO7D 3O3DA 2B1AH 5T1KA 3W81A 3QP3A 4OD2A 4EKXA 3HE6B 2AJVH 5IHLB 3EZ8A 2V17L 4FNLH 3MRJA 3KPSE 3I6LD 4QRPE 4HEPG 4JPWL 3HAEG 3GBLA 1B4JL 3MX0A 4DVBB 5BVJB 4AY0A 4OZIB 2BNQE 5FGCB 2HVKA 3I2CH 3BVNA 1O7VA 4KK8C 2J8OA 2O5YL 3FQRA 4YE4H 1IJ9A 5DWUH 5EBWA 2E7LC 3QIUD 4OB5H 3DXAD 5DGQA 4ENEC 5E9DB 4KZDL 3ULVF 2OMNA 3LB6C 3HS0B 3RU8H 1MI5E 1L7TL 3RX7A 1IAIL 3WXVL 4Z7NE 4P5MA 1IQDB 1F8TL 1WFTA 1R0AH 1PX3A 4OJFH 4ZAKC 1G9MH 4JZJB 3TJEH 1RIVL 3QJHB 4OFPA 1J0ZA 3RDTD 4HDIA 2WWMD 4YBQD 1K85A 4KRPC 1C12A 4Z77B 4XP1L 3RZCA 2COQA 5A2LH 4M48H 4LKXA 1QFOA 4P4RA 4YLQT 2NQCA 3R1GH 5TQ0L 1GZPB 3QJFA 3PV6B 4D94A 3BISA 4PJFF 5IK3A 4UQ2B 3JWNC 1NJ9A 4O51A 4XXCA 4JDVB 1UWXH 3G6DL 1JNHA 3MCKB 4KVNH 5E8OB 1KB5H 1Z0MA 5I0ZA 4RA0C 3WKMH 4HUNB 2FEEL 1H3PL 5JHDA 2PTVA 3TWCL 3QWQB 1SVCP 1I8IB 5E8DL 4OZGB 3QWRA 3MYJA 4NZRL 3PHQB 2ADJB 4NHUB 5C0AD 1K3IA 1AQDA 3RNQB 2DAVA 4MCZA 1TTGA 5E08H 5F3HA 1UB5A 3HI6L 2BCKB 1U92B 4NC0B 3B2UC 3I75A 1BLNA 3ARRA 5A2IH 5T3XH 3UJJL 4OGAD 3PWJA 1VB9A 4HK0B 1S3KL 5B39G 5KSVB 3BMWA 3C5ZA 5F7MC 1LEGB 3U0PB 4PRHE 3WMSA 3T0ED 4X80H 2QHRL 1JF1B 2XKUA 3GMMB 3HC0B 1FRGL 3ZHKA 2QQKH 3I6KB 4ODBD 2PO6C 3M45A 2Y36L 1QLFA 4FHBD 3KLSA 4JAMB 1T2XA 1A6TB 4QT5A 2P5WE 1BD2D 1BOGA 1XCTB 5MENE 1E4JA 5DJCB 1OAKL 2EO9A 4XPHL 2OR7A 1WAAF 1U93B 3P9MB 5IEHB 1XR8A 4JB9H 4Z95L 2WBJC 3PGDB 4NYLA 2A6DA 1QBMH 2W9EH 3DVGA 4JHAL 4U6YB 1X5KA 4GSDL 1A21A 1ZWIB 2Y5TA 4MAYD 2CIKA 2IBBA 2IPTH 4KKCD 5I75B 2EDJA 1YC7A 2CO6B 3D18A 5E1AA 4TUKH 1MCSA 1VFMA 4I18C 1SYSB 1UKTA 1ORSA 1FFNA 1F42A 5IT2H 5DRXA 3BRFA 1LE9B 2YBRB 2WP3T 3S