4LFHG

Crystal structure of 9c2 tcr
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
229
structure length
222
Chain Sequence
GTKSVTRPTRSSAEITCDLTVINAFYIHWYLHQEGKAPQRLLYYDVSNSKDVLESGLSPGKYYTHTPRRWSWILILRNLIENDSGVYYCATWDRYKKLFGSGTTLVVTDKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWQEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEESLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CD1d-lipid antigen recognition by the gamma delta TCR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords 9C2 TCR delta chain
total genus 41
structure length 222
sequence length 229
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lfhG01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lfhG02
4HFUH 1DQML 1A8JH 3NABH 5GSVA 1NCDH 2A9NH 3KWWA 4WJ5B 5C08D 2PW2A 4MQTB 1BVZA 3F58H 3TVMC 1XF4A 2YOCA 1IM3A 3M1BA 4YUEL 3G6DL 1SHMA 4FQJL 3EYUL 1KTRL 3ULVH 2ZCKL 3DWTA 5JOFB 2XOTA 1CGYA 3RVXC 2P48B 3VFOA 2PXYA 5DTFA 5JPNA 1S78C 4FQXB 1J0YA 3MNWB 1ZHKB 1OTTD 4WTZG 4GRWB 1XGPA 2HJKA 1RJZB 2EH8L 4M7ZB 4ZFZB 1D5MA 1YEIH 2BXZA 3LKNA 2CUIA 2XIDA 1Z3GL 4HPOL 2DQUH 1E4JA 4S1QL 2A9ML 1KJ2A 5FYLL 1PG7X 3RGVC 3KG5A 1QHOA 5T1LA 4PRAA 3CAFA 4B53A 5DRZB 1CLOL 1WICA 2YA1A 1B4JH 1U8PA 5DUMH 2UZYB 1NCCH 4FFZH 1URLA 2PR4L 4L8SA 4ETQB 4U1LB 5HYEA 1FG9C 1RVFH 4WI8A 4IOFD 4E42A 4I2XE 1B0GB 5DMGD 2H2SD 4UT7H 5I1GL 4U6HB 1FE8H 4XPBH 3E8UL 3CLEH 2AJ3B 3R0MA 1H8SA 4LSTH 1M6OA 3LS4H 3QG7H 4NUJB 3T3MF 4F7EA 1SEBB 2OP4L 2HTLD 4LSRL 3D39A 2A2QT 5J13B 3FQUA 3DSNA 5ID0A 4U1HB 5D1ZC 1ZHNB 5IR1A 1SQ2N 2HRPL 1Y6MR 2VO5A 3JV6B 4HKBB 4KH2A 3FN0L 4PUBL 4QRTA 4U1JA 2FGZA 1IBGL 4DOHE 3EO1A 3I6KA 5HVHC 1MREH 4QCIA 1UT9A 1BVLA 3BKMH 3SKMA 5GXBB 4NJ9L 5EOQL 5DQDH 3Q0HA 5HPOA 3KPLB 4HWZA 1TXKA 4RFOL 5D71L 4R4FL 5C0BE 4JO1H 4EIGB 3UYOD 1WBXB 2ZCLH 5L6YH 4ZOCA 4XBGA 4OM1H 5IJKA 1MCBA 1U0QA 5HYQB 1OY3B 1I9IH 4X4ZA 1T0NA 1X5JA 3PP3H 3OKDB 2XNAB 3OKDA 5D1ZD 5E08H 1RZKL 4HUMB 1X9QA 4HXAH 1H5BB 2BVYA 4PJDE 5I73B 5IVXA 1PYWA 1JGUH 3HRZB 4W81A 4CKVX 5CD5D 1PKQE 3U9PL 3TFKD 4QYOB 5GS3A 5MEQA 2GSGA 5E1AA 1YC7A 3RAJL 1FORH 1KLUB 4U1NA 2CRZA 4WIQA 1MELA 2DMBA 3PDDA 3RWCA 1P7KB 2P5WA 1XF3A 5EO9A 4ZS6D 3BP7A 4QOKA 2VB5A 3EO1B 3MROB 4QRRA 5L88H 3DRTB 1PX4A 4P5KB 4WFED 2J4WL 3H9YA 4MA3B 1BBDH 1VFOA 4IHOB 1UM4H 1BX2A 3N9GH 3WS3A 5F9JA 3BPLC 4JPKL 4XCCL 3U4BH 4XNMB 1MCPL 3ARDC 2OYPA 1TZIA 5DURB 2K7PA 3GMLB 2YD3A 3BH9A 4AJ0A 5DSCA 4J3XA 2P42B 1IZKA 1MHPH 1GAFH 5DJAB 5I1LA 1CU4L 2BY2A 1Y18B 4KJWC 2SEBB 1JPST 1HSBA 2OSLA 5JQ6H 2WWMD 3IRZA 2X6MA 2UYLA 5C7XH 4OIIH 3CC5A 4K3DH 4OB5L 5CIPB 2Y36L 1L9MA 3NFSH 5DQJB 1LO5A 3G6AA 4C58B 4KTDH 5DVNA 2Z92B 4QXUH 4OZGE 4N68A 3E1F1 3QDGA 4C59B 1W0YT 2VKWA 4ENED 3V6OE 4UDUB 2Q6WA 1HE7A 5F1OB 1B0RB 4OZFG 1XGPB 1M05B 4G7YL 4S1SH 3QEUA 4JZNA 4RZCA 1OOAA 3LZFL 4XBPA 2PTTB 3UAJD 5CJQH 43C9B 1KCVH 1FLRL 3UROR 1QLEL 2PO6D 1G7HB 5LCVH 3TLRA 5E8OB 4G3YL 5EUOB 4FMKA 5D2LA 4M3JA 5FGBC 2DLTA 2CKBL 2AJVL 5DJ6B 2QKIA 5FCUH 1N3NA 3V4UH 3NCCB 1KFAH 1OM3H 2F54E 1A7OH 5FM5M 3W0WA 4X4YB 1QHPA 2BC4A 5GZOC 3QG6B 3QNZB 5MENA 2BVPB 1VDGA 3HC3L 5HYSB 4AY0A 4GKSA 4RX4D 3EKCA 5FDYA 4ZOBA 2PO6A 3R8QA 2R15A 3UTQB 3VFRA 4K8RC 1MQKH 3AB0B 3MGOA 4XGZB 4OZ4B 1MRDL 4WHCA 1C08A 4PJEF 1S7UB 4XCFL 2XTJE 2V9RA 4KVNH 4UDUA 3KHOA 3DGGA 1NFIB 5CJXC 4WI7A 3V6BR 1HQ4B 5KVEH 5DD1H 3LS4L 2AK4D 1QBMH 1OPGL 1RHHB 4P2OA 4X9FA 5JZ7D 3SJVA 4FN0A 5EZJA 3AS1A 3C5SA 2MCPL 4G8IA 4MB4A 1RUML 3BSZL 5HI5C 1YMMD 4HEME 3KPSA 1I7ZB 1GC1H 3G5XB 3PV7A 1R5IA 3W9EB 3DYPA 4EOWL 5L9DL 2C26A 2L4OA 3MRPA 1ADQL 4C83B 4OM0H 2EC9U 4U1GC 2CLVB 3IJSB 2NTSP 2VLRE 4XCYB 1UJ3C 2FH6A 3GHEH 3KXFD 3MRMA 5F8RC 3TJEL 3BQUB 3QO0B 4HGKC 1HHIA 1IQWL 5KAQF 3J7HA 5SWSB 5CZKA 4XNMA 1PJ9A 4CJ0A 1FYTB 5F9JB 1EEYA 4IRZL 5D96C 5I1CL 3VXUE 3UJTH 4FQHB 3TNMA 1G7PB 2LAGB 4WDIB 4QHKJ 1OGAD 2WANA 2VDKH 1X5AA 1CE1H 5HVFB 2XN9E 1F4XL 3DURB 1FZJA 2YC1A 4R0LC 5J8OA 5HHPB 2YUWA 3DVGA 2MCG1 3UTOA 3REWB 4EI6A 4UUJA 1ZLSH 4PJDB 1CE6B 4XH2A 4MAYC 4ELMB 5D6CA 1JBJA 4PJGB 4MJ2A 4X5WA 2X9XA 3CFKB 3UZEA 5FOBB 3OJ2C 4NCC2 4NPYA 2NXZD 2E9WA 3ROOB 4YHNB 2AK4E 3QG7L 1KF9B 5IP4A 3FB6B 1NGPH 2D7TL 4X8JA 5E24E 2D2OA 3HMXL 3QI9D 4NBZB 2IPTL 3OR6A 1VPOH 3HI6H 1CR9H 3OPZL 1S9YB 2BOBB 4WHYH 4YDIH 5C70A 2UUDH 3EYOB 2OJZL 3ISWA 3ARBA 3VWKB 4MWFA 4KROD 5SWZD 3MACL 2VIRA 2DOCA 1IAMA 3VCLA 3B8SA 3U36B 3U4EA 5C09E 4L4JA 2EDBA 2HT2D 3V6OC 1KG0B 5F6HI 5FYJD 5KANI 3NPSC 4LSUL 1GAFL 4G6FD 4QCIB 5AYQA 2NXYD 5F96L 5HHNB 1GVIA 4C56D 3JV4B 5JOEA 5HYJA 1J18A 2WBWB 3EFDL 4I0PB 4RFOH 4RMTA 5DQ9A 1QSFA 4CDGC 5F7YC 4M8QB 4XWGH 4Y5VC 2LU7A 1OVZA 2DD8H 2XN9D 3REVB 1AQDB 2X2YA 3FB8B 3I84A 4YNYA 2Y7QB 3RX8A 3S3PA 5D1ZB 3QIUC 1HKLL 4G6AC 3UO1H 1E6OL 1OSPH 4NUJA 4IDLA 3SGDI 1L7IH 5I16B 3G08A 3VRLE 3QJHB 2DQHH 2WIMA 1JGUL 1MF2L 5CJBA 3ZKNC 1KNOB 2Y6SC 3ET9F 3R8BB 2VXQL 4Z0XA 4JN1L 1OAXH 2ZUQC 1F3JA 2FJHA 4WI2A 4NOFA 1G6VK 2AEWA 1XR8A 2XWBB 4K9EL 1XGRB 2H6PA 3LMJH 4M3KB 5E8NB 1JF5A 1VFAA 3B9KB 3QUYB 1EHAA 4M5YH 4ODSH 2X4OB 4KI5C 2DQCH 4MDJB 3U2SA 1ZANL 1BM3L 3ZTJH 2WWKT 2GI7A 3OWEA 3LRHA 1DFBL 4JFPB 4HIXH 2IFGA 2CO7B 3SCMB 3ZSTA 3QCVH 5I8CA 5TFSH 1A3QA 2OR9H 3MRLB 5HJ3B 1OT1A 3FQTB 3KJ4C 3O2WH 4ZTPH 1CDBA 1I1FA 3C6SA 3RI5K 3MA7A 4P2QD 1NMAL 4OCRL 1P4LA 4I13B 2D9CA 4IRJB 1XF4B 2EEDA 4YHOH 1ZT1B 3CZJA 4POZC 4WJ5A 1MJJB 2GQHA 4HLZG 3R06A 5C08A 3UTTB 4APQC 4KHTL 1MFAH 2Z93A 3K1DA 4PG2A 4K7PH 5EZLB 1Q9LB 4AH2A 4JM2B 2CO6B 2YPLD 3FAXA 4XCNB 5EBLA 4D3CH 2YPLB 2AK1L 1P7HL 5DJDB 3L5IA 1FVCB 5DUPL 1LP9B 3QEGH 4R3SB 3VJ6B 1LEGA 3BOVA 4Q9QL 2V2TA 1WAAE 4EOWH 1UWXH 2LVEA 2BHYA 3PV6A 4LVEA 3MBED 4OM0L 1A14H 3HS0A 4JHAL 3X11A 4X7SH 1B4RA 3FTGB 4OZGB 3BIKA 2I26N 4E5XA 3CK0L 5IFJA 4PJ8A 1HXMA 2AJVH 2NR6D 4GRLD 4JZJB 5I9QC 1U8QA 5J9PA 5KVMC 1CQKA 4O4YL 3WXWH 2GK2A 3X14A 3C5ZD 4FFYH 4PPTA 5HHVH 2WP3T 2ZCKH 3QCTH 2BVTA 3RUGF 4UDTB 1KXQE 4NGHL 2XZAH 4WNQA 5IB4B 4L3CA 4DCQB 4LQFL 5I71C 1OTSD 5IV2B 3S96B 3MBXL 5KOVC 2XN9A 3ARED 4XVJH 3CXHJ 4Y19A 2HFTA 1EO7A 3AREB 3UTPE 2DMCA 5IVXF 1JYXA 1QSFD 2V7HB 4JAMA 4NNYB 3NCFB 1Q1JH 3WUZA 5KW9L 1MLBB 5C86A 4U6VH 2APBA 3PF2A 2VXSL 4R0LA 3T09A 5IEKA 3IDXL 3WHE1 4RWYH 1S9VA 4JFHE 3VFNB 4WU7B 5JXEA 1I3RA 4KMTL 4QHNB 2BCKB 2E8YA 3P30H 1RVFL 4AMKL 1LK2B 1PY9A 3DX9B 3HNSL 1NGYB 1WTGT 3OAYH 1HQRB 5FA4B 3T2PA 3P4LA 5BJTB 3WUWB 5KBNC 2A0LD 5JXEC 2DDQL 3K4AA 2P24B 5EORH 4GW1A 1OB1B 2D0FA 3ELAT 5INCA 5CEXB 5DLML 3TO4A 1KEGH 4K3JH 5HGHA 1S9WA 3S5LG 5C2BH 4PJHF 4NCDA 1YY8B 2YRZA 5IQ9A 5TPWH 3I02A 5IBLD 3ZE1F 1T0PB 5K9JL 5ALCH 3TYFB 1ETZB 2IMMA 2BNUB 4X80H 1A7RL 4NQDB 1LGVA 5FXCH 2NY2C 4C56B 1MHEA 3QUZA 4GSDH 5IWLA 5I74B 25C8H 3BKML 2P5EE 1ZLSL 4F7CA 2R8SH 4ONHA 4KVCH 4JHBA 1FO0A 2VLME 3HG1E 1S7WA 1JGVL 1NJ9A 2FWOA 3BZDA 5EU6D 1K9TA 1EXUB 3DXAB 1GOHA 3HB3C 3CFCL 3FQRA 4EIZC 4MJ5A 1IAIM 3TZVB 4ZPVA 1AGDA 3V7AE 1IAII 1EX0A 4RMUA 4YDIL 2OJZH 1TQBB 3KPNB 3QDHA 3LQAC 5C0CB 3L3DB 4WW1B 1LEGB 1RJCA 1PLGL 1BOGA 1ONQA 4MNHA 2C4FT 3U30C 2FEDC 3VFPA 1DANU 3EGSB 3T2NH 5F88B 3CNKA 4KRPB 2V5YA 5HD8C 3IDYB 4G6KL 1MI5E 4JM2A 3L5WA 1JHTA 1JUFA 2ICWA 1NAMA 2VDQL 3NH7L 1NC4A 3FQXB 5DD5H 1T3FA 1O7SA 4EBQH 3TEUA 4FXLA 2IH3B 5E6IB 3AMLA 3P4MA 1LDSA 4GAYA 1U2CA 1OSZB 1KPVB 3FFDA 1EFXD 4PYHA 3CUPB 2BSSA 3F65A 3HC0B 4Z76A 4NZTH 3CSYB 4HHAB 1Q8MA 1MF2H 4RFEA 3CSBA 4JHZA 3LEVL 1T03L 2ZUVA 1FNLA 2EDDA 5KSAC 5CUSH 2DRUA 4JKMA 3U9UB 2DM4A 4PJFA 2CIKB 3MUGB 2FX9H 2EIZB 1JF1A 3C8DA 4JM4H 3U46B 3C60B 4JB9H 3RWHB 2YUZA 2ENYA 1U36A 3C60D 5C0EB 2NNAA 4WU5A 2G2RA 4MA8L 1XGRA 2H6PB 3O2DA 3QH3B 4H5SA 3TO2B 5MI0C 4G9DA 4JCMA 3CH8A 3IXAB 4N0UA 4K55A 1BIIB 3BO8A 3GJFA 5ESAA 1FL3A 3ULUD 2YPVH 3M17B 5AYUH 1FVDB 1B3JA 4Z0XB 2BNQD 4S1SL 4HT1H 1JZ3A 1AGCA 1R5VA 1U2HA 5J6GB 5TFSL 3C2SA 3I9GH 4R2GB 4X5LA 4F9LA 2ATPA 5IW6B 1OF2A 1WC7A 1BQHA 1NLDH 4OCLC 5FA3B 1BJ1J 4N9GB 3RWIA 4Y2DD 1DVFD 3WEXA 4FNLH 3E6HA 1ZT4A 1FNEB 4AEEA 5HGAB 1NMAH 3HE6D 4OCRH 4OFIA 1PG7H 5K9OA 2D4FA 1Q9OB 5HDQH 5T5FL 3WDJA 4Y4FA 3BISA 3IFPA 2JIXD 4HH9A 2OJEB 1IAIH 4IMLA 3S34H 2IBZX 5IKCB 1KC5H 1EJOL 5GRWA 5C0IB 2G9HB 3P4OA 1F45A 3RWJA 3FMGH 5D7JB 4L4VB 2WUBL 4HJ0C 4WY7L 4PRPB 1T2JA 3WFEH 3RY5A 2ADJB 3SHSA 3VI4E 1WIUA 3AY4A 4ISVA 4JFDE 2E5EA 5AZEH 3OKEB 4JPIB 1RZ8A 1D5ZA 5B38A 5FFLA 2ZUSA 3DBXB 4IRJC 3S5LA 3F8UB 4ODHH 3VW3L 3S88L 2H2PD 1A3LH 4LCYA 3MODL 3NZ8B 1HH9A 4LGPB 1FZMB 4P4RA 3LD8B 4R7NB 3NTCL 1XGQB 3BSZH 1MWAB 3BDYH 4O4YH 1A6UH 4MGXA 5F7EH 3L5HA 5DFWH 4M48L 2Z0BA 1X44A 4FFYL 1CDGA 3LV3A 5HHVL 1UM6H 1JRHI 1FGVL 3T8XB 1JCKA 1JFQH 1GGIL 1G6RB 3MNVB 2PW1B 4PJEE 1GZQA 3B9AA 3VXRD 2Z31C 4MVBC 5C0BD 4U6XB 4WO4D 2YA2A 2X7LB 2X4NA 3H42H 3TN0D 1OP5H 2VABA 1J11A 4HS3B 2XWTA 2ESVE 1NFDE 5CJOL 4KJWD 1BOYA 1YEFL 1JTPA 2VDMH 4P59L 3LSOB 5GISL 5BQ7A 3TESA 4EDXB 1QYGH 4MNGE 4N0YH 1D9KB 1DANT 3ZKXC 1JN6A 4LKCB 3IJSA 5D5MA 1JTTA 4R96B 2XT1B 1BD2E 5D9SB 1FGNH 3V52H 4QNPF 1J12A 3LAFA 3OMZA 4FXKA 3RQ3A 5J1AA 4IJ3B 5IVNA 2NY7L 4G8IB 1FVEA 3NACH 4NN6C 4KK5C 3KYOB 4R7DA 1AY1L 1SEQH 3FO2A 1E4WH 1RHHA 1K3ZA 3QI9B 1LO4H 4FQLL 2VE6A 5E00A 2EDJA 5SX4I 2JJVA 4JREC 1NFIA 2DB8A 2NZ9D 5E94A 5K9KB 3MUHL 1F2QA 5TPWL 1G7IB 3HFML 3IAPA 4OUUA 2ICCA 5ITFB 4FABL 4IIQA 1A7RH 1NL0H 3LQAH 5SWQA 5KAQG 2HVKB 2VL5A 1AGBA 2WINB 1I4FB 2GAZB 3T0VA 4IRSB 4WI9A 1CGXA 3QIWA 4YZFE 1I1CA 5GJTH 4LSUH 4OLUL 5CSGA 3TA3C 3VXUA 4TRPH 5AG9A 3GSNL 3P9MB 1MY7A 4U0RC 2APVA 5HYFA 2FBJH 4EDXA 2QHRL 3VXPA 4MHHI 4OD3H 2NY3B 4XP5L 1UWXK 3UCRA 1JGVH 3DRQA 5KSAD 3FQNA 1T20A 3MQIA 3QZWA 5C8JA 2PXYD 4OGYL 5FGBA 1S9KC 1HKLH 3UO1L 4APQA 3IKCB 3GSUB 2D7MA 4P5TC 3VXOB 2NMSA 2GJZB 5C07E 4KDWA 4MJ4A 4N1CA 4QT5A 5A40E 3ORJA 1EFQA 2EYSA 2WIIB 1H3PH 5EC2B 3RFZC 3FO0L 4HGMA 2IPUG 1ZTXH 3NOIA 5AYUL 5C71A 2V2XB 2ZSVB 4G42A 3UTSB 4ZAKB 1BPVA 3QDJE 5KSVA 5KZCB 3IKKA 2QSQA 1F97A 4PIRF 1OT2A 4OZFA 5HD8D 3F7QA 4GG8A 1G9MH 4XXDB 3ULVD 2YD2A 3RL1A 1NPUA 1FZMA 2DLFL 2DQCL 4ZS6C 1UWEL 5B4MC 5T3XD 1PG7L 4DN3L 1HINH 3PQYD 2AK4B 5EU4B 1DFBH 1DBJH 3PQYB 3BEWA 3X13B 5KVDL 4CGTA 5CBAA 4KPHL 3RUGB 5HVHB 1O7VA 4HGWA 2HFGH 1U95B 1KC5L 3J8F7 2OR9L 3ZDZE 4ZTOL 2NQCA 2NY1B 1HIML 2CXKA 1UKSA 4XP6H 3JUYA 1W0WA 1QSZA 1HKFA 3SDXB 3WKMH 2R1WA 2A6IA 1T03H 4O51B 4WGVB 2A1WH 3BESR 1DVFB 4LNRB 4UAOB 4AK1A 3P4OB 3ZYJA 5IGXL 1H3XA 4HK0A 5FECB 5CHNA 3KXFB 3I6LE 2QQKL 1KYOJ 1T4KB 4NNXA 3WS3B 5F3BA 1X4YA 4JB9L 4YO0A 2GITB 3U7YL 4KJPD 4ZFOA 3S88H 3U82B 3HZMA 1H8OA 5JOPD 1ADQA 4P3CH 3LRSA 1TZHB 4ZUWB 1NCDL 2DTSA 3SY0B 3VXME 4OLVL 1WFTA 4HWBA 5CLWA 3UBXB 3F58L 2XY2A 2WZPD 3JUZA 1CL7L 1PKQB 3CDFA 3DARA 4PRPD 1P7QB 3TBYB 2EDTA 2F19L 3WYRA 2VLRD 2AERT 4Y4KB 3CH1A 1FVDA 1FFNA 3SDCB 2FZ3B 4G7VH 4XTRD 3FN9A 1JV5B 2VXUL 3FT2B 3IFLL 1BIIA 3GJFB 2O5XH 3L9RB 3BP4A 3SDDA 4DQOH 4TTDD 2B5IB 1EBAA 5KSBF 3QSKB 4KWUA 4TUKH 1HOCA 5T5FH 2FR4B 4QHKI 2CRYA 5DJXB 3S3SA 2EIZA 2EH8H 3MUGA 4HPYH 2K9UA 2DYPA 5ETUB 5CBEA 5C09B 4WUKL 3BE1L 2J6EH 3QWRD 2OM5A 4NP4H 4F2MB 3ULVF 1FG2A 5DHVH 2VLKD 3EOBA 5FDWA 1U8JB 2M2DA 4FZ8H 4RNRA 4UBDC 4Y8DC 3O3DA 1RJYA 3VFSA 3QNXA 5D72H 4XVJL 2YD8A 1I3UA 4JDTH 4WWKB 5BV7B 4WO4B 4DGVL 4M9OA 1DQQB 1SVCP 5JZ7C 1QFOA 5AZEL 3T0XA 1I8MA 1TVBB 3BPNC 4MMXC 2NY7H 5DJCB 4PJEB 3HA0A 3D3VB 4WW2C 3MODH 1YEGH 3D39B 4LAQH 1N6QL 4NKOB 4F7EB 2R23A 3QDMD 3RWDB 3N1GC 2CXGA 5JHDA 4I0PD 3KPQB 2GHWB 1NLBH 4ELKA 4EUPB 1EHXA 4AMKH 2HRPH 4EVNA 3UYPA 1GGTA 4F33B 1ONQB 1WT5C 1L6XA 3LQAL 5DS8B 4HIHA 2JCCE 4X7CC 3RPIB 3NGBC 4YDKL 1RK1A 4ZDHA 1HDMB 5AAMA 2Y1VA 3CVHB 5FAAA 1I1YB 4LQ1A 4MD4B 1F4HA 4NJ9H 2GSIA 3TZVA 1WF5A 1HWGB 3QQ3A 5LXGH 5FHBH 4PREA 3RWEB 2WNGA 2GT9B 3O45B 1N5YL 3EOTL 4UV7L 5IM7B 2P5EA 4X6BB 2X4QB 3LS5L 2R39A 3P0YL 3SGKA 3TO4C 1N64H 2PYFB 2Y72A 4KRPD 4YLQT 4J3OC 2J8UB 5C08E 4DKEL 1CLZL 3TBSB 1FC1A 1T21B 3MJ9L 4LRIC 1RZGB 3RWFB 3TIEA 1YNTA 2AEIT 4ZXBC 4Z7QE 5E6ID 2QADC 4DGYH 3ARFA 5GGVL 4U49A 1DLHA 3DUSB 1ZLWK 1A6AB 4OFVA 4QHUA 4WV1C 3CFCH 1XIWA 1YY8A 1GSMA 5T5NF 5L8JB 1A7NH 1G7LB 2AQ2A 3VMPA 5L8KB 4LVNC 5A2FA 1RIHL 5EZIL 1SYVB 5TDOA 2ZP0T 4N0FA 1BBDL 3QCUH 1UM4L 1JGDB 4NRZA 1T7ZA 4YIQA 4PJHB 2XWJA 3SKOB 5F7WC 1XF2B 1NL0L 1HQRA 1EAPA 5F89A 2CLRB 4F15B 3GSRB 4RBPH 3STZB 3VDAA 1G7QA 3WJJC 4NN5C 4DZBB 4PRBA 4OLYH 1IAOB 4MA1B 4P57A 3OKMA 3QRGH 1J86A 1I3RB 2IJ0C 5DJ2A 2CIIA 3OAZK 1S9VB 4TRPL 5GGTA 3WN5A 2GJJA 1VEPA 1XGTB 4OZFH 4WHTA 3FFCA 5JDJA 5D1XA 4OD3L 3WHXB 1GPOH 4TPRH 3QUXB 3WBDA 3ZO0A 1KCLA 1NCTA 3BGMA 4HUUA 5EA0L 3MLYL 5B39B 3B8YA 1GGUA 4NRZB 4YIQB 5ANME 3EJYC 5EU5A 1ED3B 1U3HB 5FYJH 1NC2A 3H9HA 2CD0A 2OMBA 3D0VB 4IRJD 4KC3B 5IB4A 1A6AA 5L7XH 3DMMA 4IRSC 3TJHD 3RVUD 1F4YL 2IEPA 2HKFH 4NCC1 4TNWK 5JPMA 3WIIH 2D7OA 2X1OA 1RZGA 1DEDA 5C0AD 4CADA 2XZCL 1QLEH 4Y4HA 1Q0XH 1RZJC 5E2TL 5LJYH 4ZQKB 2Q3AA 2O61B 1UWEH 5IW3A 2DBLL 2A6KA 1JHLH 2BVOA 3BW9A 4DN3H 4PJ5D 3QUYD 4BK4A 1CD9B 2CUMA 2E6QA 1N0LA 3FOLA 3CPLA 3IVKA 3QQNA 1X4XA 4U1MA 1C8PA 4ODUB 3JZ7A 3P0GB 3NA9H 1KGCE 4BH7B 2FHCA 4FZ8L 4HK3N 3O11A 2WUCH 2YR3A 1OGTA 4LCWB 3LQMA 5D72L 1JK8A 1FHGA 3OGOE 1MCJA 2ZKHL 4Y5VB 3O3AB 4NKIL 5GRXG 4EVNB 3L3GB 4Z0BL 1DQTA 1MJJA 1Q72H 1YZZA 5FO9A 1WZLA 3LN5A 4ZFOL 1BBJB 2A74B 2BDNL 4RA3A 5IF0B 3U0WH 1X5ZA 5EU3B 3LH2L 2OL3B 1WFOA 4JG0L 1DCLA 5I1KL 2FEDD 2Z8SA 4DKDC 1I8MB 1F5WA 1ERNA 4H0GA 5J11C 5D2NE 3JWOC 1EEUA 5J7CC 5C0FA 2VOTA 3HZYB 5D1QA 3QNXB 3QDMB 2P44B 5IROA 1PVHA 4F2MA 4X6CE 5JMRA 2J8UF 2OMNA 5CBEB 2DYPB 4HC1L 1MY5A 4M6NL 1HYRC 3T3ME 4FQQB 4GUPB 5IJKC 4CMMA 3MRIB 4Y4KA 1S7XA 1UM6L 1TPXC 1FGVH 1P7QA 3RVUC 1N64L 1KNOA 3MRQB 3QEQA 3SDDB 4XP1H 3OKKB 3L5XL 1FLTX 5ESVB 3SY0A 4OLEA 1G7JB 2IH1B 5CFHA 4G8FA 4YHPB 1A9EB 4YNYB 2W65A 3RL2A 3REVA 4Q58C 1S7SB 3QFJA 2NY0C 1IC7H 4LAJH 1GGCH 5GISH 5ID1B 2X89D 3G6JB 4JM2C 1YEGL 5KSBB 5FYKD 1N6QH 4L4TA 4N0YL 1LQSR 1A7NL 1E4KA 1IGIH 5HHNA 4OCXL 3AM8A 4OLXH 5I8KH 2AEQH 3ARQA 5EZIH 2GK0B 5AAWA 3B43A 1VENA 5C0GA 1KG0A 3WFBL 2FLRT 2RFXA 2EYRA 2EC8A 3S35H 2OCFD 4Q0XL 3NCYS 2KZWA 1PKOA 3WFDL 1CD8A 1KCKA 3VWKA 4O51A 1EO5A 3NACL 2MPAH 1E4WL 5DJZA 4WO4C 4OKVB 5DC9B 3GM8A 3INUL 4FA8A 3BPNB 4X6DB 3HE7D 2DQFA 4F7TB 1V05A 2O5ZH 4WEBH 2FSEA 4KUCD 2F53D 4DK6A 3EOTH 5IBLC 1OP9A 1VSCA 1FSKB 3LS5H 4JRXA 1CICB 1HCFX 3HI1A 3QB7C 4PJXB 1KB5B 1IGJB 5GJTL 2AV7B 4N5UA 4UT6H 4DKEH 5HY9B 1OWRM 5E70A 2F54B 5HGBB 1SJHA 3GSNH 4PJCA 4LCCC 3RX7A 4X7FC 2WIIA 4G8GE 2L7JA 1DQDL 2X44D 1OAUH 1INEH 5IOPA 2B8OT 5GZND 1OAXL 4NKDA 3P77A 3QZWB 32C2B 4L4TE 1HHHB 4MSWA 5JW4M 2VQTA 3WNLA 3O6KL 4XX1E 2YK1H 4DGIL 1NCBL 4P2OC 4OD1L 2AXGB 3ARDB 3MV9B 4GRWF 2IANA 2XYCA 3D9AH 4LLYB 3FHQA 1FV1A 1H3PL 5C8JB 2XKNA 4GAJL 1G1CA 3DV6B 3P9MA 3CZFA 3VXUB 1T0MB 3OR7B 3EAKA 1F02I 3QIWB 4LSSL 1UJ3A 3QP3A 2YRLA 5E1HB 4HS8L 4HG4J 4KK9D 3WFHA 3PUCA 5M95B 3HMWL 4ELME 3IB4A 2Q20A 3QPXL 3KPRD 1NDGA 1DUZB 1AGBB 3RRQA 1I7UB 4PJ5B 5HYIA 4PB9L 2JJUA 4Z0BH 1I7UA 4NWTH 5L0QC 5KJRL 1F90H 2UY7A 2VWEE 2W9LA 3KLDA 1NGWA 3CFBA 3BZEB 4FQIL 5E9DE 4G8GD 1X5XA 1VACB 5JXAH 5HGDA 4NWUL 3WFHB 1JN6B 4YDJA 4PGCA 2M26A 4WEMB 2B4CH 4FXKB 1FV1B 4MXWL 2J12B 3U1SL 2FDBP 3VXSD 4A6YL 2R1XB 3HZVB 1NAMH 2IG2H 3PL6D 2C3XA 2R0LH 5BRZD 3PWPE 3OR7A 4JO2L 3DVNB 1F2XK 3BHBB 3DXAE 3MRNA 4PJGE 1JPGA 4X7EC 1YEEL 2ERJB 2EIEA 3DX7A 3IDGB 2CMRL 4P46B 2XKNB 5ICYB 3RJQB 2FYYB 1T5XB 1HN1A 3AROA 1YQVH 3P77B 3DROA 5C6TH 4P3CL 4JJ5B 3FN3A 1G7HA 1ACYL 2ZOKA 3TBTA 2A83B 3ALPA 4LASH 4XPHH 5DMKA 1CL7H 3MOAL 4M6NH 2XWTB 4ZSOE 3WXWL 1A4KA 1H15B 4JZOB 1MI5A 2F19H 2VABB 1IGJA 1R3HB 4Z77A 1WBYB 1ACZA 2X4NB 4YXKL 4NGHH 4BQ6A 4X8XA 5DEFA 5FGSA 3VH8B 5K9QG 2DTMH 5SWSE 4NM4H 4FQXC 2F54A 5HGBA 5JTWA 3SE9L 3B4NA 4OI9A 4F7TA 2VISA 1A7QH 4M7ZC 4PJ7B 3SBWA 3LB6C 3SGEI 4MHHG 4L3ED 1T66D 1FFPB 1Z6JT 4LEXL 5E9DA 3QEHA 3GBML 4RFNB 4PV9A 3QO1B 2CDGB 5I17A 2APWA 4ZS7H 4YDLB 1I8LC 4RWYL 4O2FB 3FT4A 2XA8H 4OCXH 4UIMB 4OKVA 4KV5E 4L4VA 1U9KA 4L9DA 4F9LC 5F72S 5EOCH 4Q9BA 4BQ9A 3EW3B 4HAFA 4PRHB 4RMRA 3SJVE 1T22A 3AU1A 4N8VB 1YN6B 5FV1L 5LQBL 2RFXB 3IFPB 5C0GB 5F9WC 5D7JA 1IKFH 4NBXB 3DRTA 5TF1L 3ZZ1A 5B8CC 1G0YR 3E6HB 1I1AD 3TYGH 5BS0E 3UTSE 3TBWB 5DD0H 4Y4FB 1Q9OA 4V1DD 4WI3A 2DLGA 2GSGB 5E1AB 3W2DL 3QWQB 1KENH 1RIVH 1AO7A 1HILB 4HXBL 4YHPA 3SE8H 4ZXBA 4UIKH 4PJCF 1AGFA 5I30L 3O8XD 4UINL 2ATPB 5IW6A 4B0MM 5B3JF 1P5UA 1HHKB 3V5KB 1R5VB 4RGOH 1CCZA 3ARBC 4CNIB 4U3XA 3HE7B 3GSOA 4IRSD 4OSUH 1ZGLM 2B20A 2AJZA 3BO8B 1F3DJ 1EA9C 3P0YH 4OFYD 2YK1L 3H9SB 4G9DB 2AJXH 4N90E 4AM0B 3WO3B 3D0LA 2NXYB 1TPXB 4JKPH 1ZS8A 3WFCL 4R97B 3RGVD 3Q6GL 4PJFB 4E41A 5C0FB 1QFWI 1DL7L 4HG4K 1Y0LA 3WHE0 4GAYB 1B0WA 1A7BA 1NBZB 2C1OB 2MPAL 4JDZA 3LN5B 4HS8H 3CSYA 4NQED 4XT1C 5T3XE 3UTPD 5CGYC 5JNYB 3U79A 3V6FB 1JIBA 2L7UA 3D6GA 5DJYB 5BS0D 2ICWB 3OX8B 2IADA 3TVMA 4Y5XA 3TBVB 2F53B 3N1PC 4QTIH 1FP5A 1A0QL 4BH7A 1B0GA 3R1GL 2VLJE 1NAMB 4JKKA 4MJID 5HGGS 1INQA 1YNLH 4RAUA 3L3DA 4NZTL 4TVPL 3O11B 1GIGH 3T0WA 4PRAB 4MCYA 1A47A 3VGFA 3VFPB 3H3BC 3W5NA 4MNHB 2BVOB 3B9KC 4EN3C 5J6HA 4CRPA 3IVKB 3CFJA 1K8IA 2X1XR 2Z91A 3FOLB 1OLLA 2AGJL 2NY1D 2DQGH 4Z78A 3S97C 5IHZA 2WMPA 3HE6B 2I9LB 5T1KB 2E7MA 4ONHB 1KT2B 1K5NB 2C5DC 5BZWB 3DXAA 5KS9A 4X6EA 5ILTL 3DMMB 3BXNB 4QRPA 1R24B 2B0SH 2EEBA 1FO0B 4HLJA 5AWNH 3KGRA 4FZEL 4K8RH 2OX5A 4K8RD 5C0ND 5AZ2H 4NUGL 1X5YA 1XCTB 4D9QE 5C1MB 3TYFA 4NIKB 2Y6SD 1ED3A 1NBVL 2KUTA 1CFVL 2YD7A 3BMWA 3S8WA 1Q0XL 5E2TH 3SDAA 3O2DL 3VFTA 2NW2B 2XACC 2LABA 5HDQL 1QR4A 1YUHB 4GW1B 1Z9MA 3OTTA 5E2WH 4L5FH 3DJ9A 3WN5B 4I3SL 4U2YA 4MJIE 3GFUA 3BN3B 3S34L 1A02N 5M7QA 3RDTD 1DR9A 1NGYA 1CI5A 1B2WH 1FJ1B 3NFNB 3FFCB 2VAAB 4XNUH 2YMXL 4KQ4L 4J3VA 3D18B 2EE9A 4OZGF 2WUBH 2IAMC 2HLAB 3RHWK 4TULH 4CN1A 3KLHC 1GYAA 4Z8FL 5KG9A 4KQ3H 2X09A 2JE8A 1RSFA 5ERWA 1BJMA 2PCPA 5AG8A 5ADPH 1N0XL 3ROLA 4QHUB 4HJGA 4LLQA 1YEEH 1MFDH 5LQBH 4MD0A 5EUOF 5I8OH 2Z8VC 1XF5B 1D5XB 2AJUL 5C6TL 3DYOA 2H2SC 3L3KA 4PRHD 4RQQB 5L0QB 1AI1L 3C2AH 5IV2A 3RNQA 1C12A 3VWJA 1T21A 3IU4H 1CDUA 4KHXL 3KYNA 3ARFB 5IHUH 4NO5A 5FYJU 2ORBH 4TTDC 4V2CB 1F6AB 2C3GA 4QKXB 3VGDA 4HZLB 4DAGH 5GRYA 4DCQA 2C4FU 2X9WA 4NM4L 1DJSA 1IEBB 4GW4B 1ES0A 1G7MB 2B1AH 3ULSB 3QQ3B 4P5TA 4NKMA 4OI7A 5C6PB 1DLFL 5A43C 2GSIB 3BP5A 3AY4C 2HN7B 1BQHG 3EDFA 4KKAD 3PWJA 3QIBD 3IF1B 3RUGE 3UJJL 1QYGL 1QNZH 3H9SE 4R3SA 3VJ6A 1OD9A 4P4KA 4JFXA 4EZMA 1CTOA 3LKPA 1FC2D 4HFWA 4MCYB 1I85C 4AENA 1MUJB 3I3DA 4OI8A 1HDMA 3RU8L 5EOCL 1TVHB 2H1PH 3Q6GH 3U7WL 1CICD 2VL4A 4P49A 5D7LE 1L9NA 3TCLA 5GGUB 5IMLB 1OQXA 4J8RA 5EULV 1A6ZA 5HDOA 4WWKD 4LFHG 1WZKA 4OLZL 4OGZA 1GGCL 1BQLH 3PXJA 5JHDB 1MRFH 4P5MA 2GFBA 4TYUA 3BVNA 5CZVH 1C7SA 2NY2B 2R23B 4AQOA 3MA7B 2FJGB 5F9OH 5IFHL 3HFMH 3BEVA 3MRFA 3BZFA 1RJYB 4TSCH 5H2BA 3MJ9A 1R3IL 3RWGA 2DM7A 1R0AH 4H25A 4B41A 5E5MB 3WFDH 5I8CB 4FQPA 2BNRA 1VGEH 3QQ9C 3SCMA 5EWIH 4RGMB 3QJFB 4XBEL 2DJUA 1BFTA 4HXBH 4LHJB 5D5MF 5D7IF 5C09A 1S7QA 2VTFA 3KPPA 5I2IB 3DTXB 5F1NB 1QEWA 3RA7H 3SDYH 5FO8A 1S5IH 4HKXB 3EOBB 1VERA 4GKOA 2FRGP 4WEBL 2R0ZL 1J5OH 2D31A 4WW2A 43CAA 2MFNA 3LOWA 3VFGH 4QNPE 3H9SA 5EU7C 1EJ6A 3QIUB 2EE3A 1F3JB 2JB5L 4M7LT 4KRNA 1K4CA 5DR5H 1HHKA 3V5KA 3DECA 4JKPL 1MWAH 5D7IB 1DQDH 4DN4L 4PJHE 2Q76A 4LGSB 2CDEA 1V3KA 4M7KL 3ES6B 1RD6A 2XY1A 3HZMB 4Y2DB 5F71A 3KJ6L 3TPKA 1AKJB 3GKWH 3RVWD 3O6KH 5JLZB 1YN7A 1NCBH 4NQEB 2OQJB 3STBA 5E6IC 2VDLL 1MRCH 4HBQA 2ESVD 4D94A 4ZD3H 3FO1A 1KJ3L 2VXVL 4LNRA 1AQDA 3MREA 5D2LE 4YBLB 3SCMC 4I3SH 3C09B 4LLDB 5F3BB 1OARL 1LWRA 1MSPA 4C57C 1IFHL 1BWWA 4KXZI 1EMTL 1KIPB 4NN7C 4YAQA 3V9FA 4BM7A 3PDOA 1RV6X 3OSKA 5HTSA 4KI5E 4LSPH 4MXVF 4XNUL 1QQDA 5EIQA 4X4XB 3V5HA 3QPQD 5IGXH 5I17B 5MI0B 4PV9B 1ND0A 2YSSA 3GIZH 2MJWA 1WK0A 4OLWL 1CXKA 1LO3H 4ZPTA 1CT8B 1CFBA 5FOBA 4QRSA 2QR0A 1IRAY 3U7YH 1V7ML 3VXTA 1Q9WB 4JM2F 1A5FL 1QBLL 3D2UD 5DRXB 3WL9B 1NBQA 5JXAL 3SKJL 4OZFB 4XPTL 4RGND 3UBXG 3DVGB 3IFOB 1HCVA 3STLA 5HHPA 2B4CL 1UQSA 3U1SH 3DURA 1U8HB 5AZ2L 4ZAKA 2FB4L 3IKCA 3CU1A 2R0LL 5JHDE 3CSPA 1I7TA 2D7PA 1J1XH 2VQ1B 4UUJB 3IFLH 1FYTA 3QDAA 5EC2A 1DEEB 1X7QB 4Z7UB 1YNKH 2X4TA 2IC2A 4X0KB 2BZDA 3NN8B 4JJ5A 2CUHA 5E4EB 1QFWM 1T2QL 3DROB 4RBPK 3SOBH 1G7PA 4WDIA 5CJXA 4PP2A 5ICYA 4OCSL 4LMQE 4XHJD 1DLFH 1JPGB 4OJFH 2CLVA 5I18L 5GJSH 5FKPA 4OFKA 1OAKL 4C83A 5B39G 2HTKD 4K07A 3CX5J 4I48B 1KPUB 5D1QC 1HH6B 2WINA 4L9LB 4YHLH 1EO8L 1U8KA 2ZJSL 3U0PB 4JO4H 4QRUA 4D0DB 3C5SB 5HDLA 1EV2E 1KCSL 1G7IA 4P3DA 4Z8FH 2EDWA 4KQ3L 5D2NB 2BJMH 1MOEA 4CVXA 4WFEE 3O4LA 3OKNA 1FFQA 3ZKMC 1OCWL 3DX8B 2EKJA 5E5UB 3V2AR 1H3TA 4AQ1B 3FO2B 4URTB 2OK0H 2DQTL 3RZCC 1F8TH 2NX5E 5GGQH 5ITFA 5I1HH 3T08A 2X5PA 1RZIA 2VH5L 3EHBC 2ZUUA 5IFAL 4BFGA 4FRWA 4OFPA 3PABB 3V5DA 3RKPA 2G60H 1DUZA 2GIYA 3QHTC 1NFDF 4D0DA 5GS2H 3P9LA 1WFNA 2YS4A 4Y5YA 1R0AL 5DEGA 2WWKO 5J1TC 1EHLL 1QRNA 3MGOB 4R4BB 3PJSA 1GGYA 3VFRB 4I48A 1WCQA 5TJWK 4LCUA 1S3KL 1SBBA 3B3IA 2YXMA 4G5ZL 4YHZL 3QDJB 5HYSA 1H3GA 1A1NB 1I3GL 3DIFB 3KPOB 3KAAA 1U93B 2AI0L 3RGVB 3WLWD 4JRYA 4ALAH 1HWHB 1J5OL 3EHBD 4X99A 4MAYD 1J0IA 4LP4A 4XBPB 4XCEA 3CDGB 2C4XA 1EUUA 1QSFE 3BT2L 32C2A 1IGFL 4OFDA 1KYOK 3CMGA 1IGMH 1Y6KR 2X7LA 2NXZB 5E8OA 1D5IL 3RX5A 3F7PC 3A6CL 4TNWF 5CZXC 3NAAL 3STLB 1XH3A 5D7SL 3TJHC 2QV2A 1FL5B 2CSPA 2ICES 3QDGB 3WMSA 4Z7NF 3QIUD 4RGOL 2IF7A 5DO2D 4JFYB 4Y16A 5F7NC 3PNWA 5GHWH 4CMHC 4M7KH 6FABL 1NAKH 2XZZA 4WFGE 5DVKA 1Q9WA 4X83A 2GJ6B 2NCMA 1CG9B 3KPRB 1FQ9C 2QR0B 4X6FB 4YFDB 4Y5XC 4KROB 3AUVA 4FXGA 1A9BA 1MWAA 3AS3A 3EO9H 1PX3A 1XIWC 1AQKL 4F8QA 4UB0H 5B3JE 1MRCL 1YJDH 4Q9RH 3EFFB 1GZPB 4NYLA 3AGVA 5I75C 2FGWL 1EDQA 3L1OH 3OF6A 3DBXA 3GI8H 3TA3B 4KTEL 4WHDA 3HAEA 5TE6L 3VGAB 1U8NA 4RSVA 2DL2A 1EGJA 2ITDA 3RWJB 4FMFA 4JQXA 1OARH 3IFNL 1XFPA 1U41A 4KRPC 1FNAA 5GS0L 5L8LB 2V6HA 3QRGL 4ZSOA 1AKJD 5ENWA 2G5BB 1CF8H 2WM0A 3C5ZB 4KY1L 4LPYA 1GPOL 3GMLA 5E2JA 1VKXB 4OF7A 4QTIL 3NIDF 4JFEA 1K4DA 1T1ZA 1M7IA 1ZA3A 1QBBA 1P9MA 2OJEA 1KLUA 1VHPA 1LNUA 2ED8A 1S7SA 3UEZA 5BRZB 1MCWW 2CGRH 2CQVA 4BA8A 3OB0K 4UILH 4P46D 2DF3A 3HRZA 1A9EA 3LEXA 1YEHH 3QFJE 4N9GA 4UOJA 3MR9B 3N85L 3DO7A 2EDEA 1U8IA 2V17L 2NX5A 5DD6B 4PJ7F 5I1AA 2FIKA 4ERSL 4WU5B 1JWMA 5E2VH 5C3TA 2VSCA 5HYQA 5DI8A 5ADOH 5GZNC 4HWEH 1JF1B 2WP3O 1OGAE 4MA7H 2CIKA 3AS0A 1L0QA 4RMQA 1RK0A 3SKMB 4ZFFB 4OCSH 4W4OC 1WCBB 1QEWB 1W8OA 2DWEA 4HHAA 4HDIA 2IALA 5FGCB 2BMKB 4MXQD 2YPLE 1N6UA 4ENEC 3KPLA 4HWZB 1KBGL 5C0BB 2X42A 4HH8A 1WQVT 2DLEA 4K23L 3FB7B 3UTTD 2BNRB 3TH4T 5LBSH 4RFEB 3ZDZF 1HK6A 3AMKA 5HDBE 2UY6A 1XAUA 4YH6A 3WCYA 1AXTL 1F42A 4QRTB 3H3KA 3BKCH 5H35B 3WJLC 4L5FL 2V5SA 3KYKL 1LHZA 3BVNB 2AKRA 5JW5B 4O2EB 5D6DA 3ABZA 3K4DA 2OK0L 3S36X 5IB1A 1V7MH 4XNZB 4Y5VA 5I1HL 3OJDA 1B2WL 5EC1A 4J8RB 3IXTA 2DJSA 1CIDA 3QXAA 3SDCC 3SKJH 3DV4A 1U8PB 2HG5B 4OQTL 5GRJL 2AQ1A 4C56E 1IM9B 1SBSL 3VA6A 3GO1L 3LRGA 4YE4L 4DVRL 3ULUE 1KEML 4RMSA 1SYSB 4GRLB 4P4KB 3Q5OA 4IDJL 3V6OA 3DO3A 3U7AA 1U8OB 3MNZA 4JCLA 1D5MB 3KPNA 2OR7A 4KAQH 3RZCA 4XZUA 3PWJB 3HAEG 2UZIH 2AJUH 1U58A 5DUBA 4X98A 2QSVA 3K46A 4OBSA 4YHZH 4OCYL 1I3GH 1FFOA 1T2QH 2RQ8A 3GHBH 3UC0L 3FRPG 1G7MA 5MERA 2AW2A 3MFFB 1RJZA 1AC6A 5I18H 4JLRB 2HJKB 3QUMA 1K8DB 2Y06L 2LAAA 4HUVB 1WEJH 3HCVA 4G9FA 3MNWA 3ULUC 4WWKC 4PRID 1CDHA 1E4XH 1MCOL 4XP4L 5F97E 1BVKB 4PRIB 2Z31B 3L5XH 2X4PB 5BW7A 4L8DA 3OXRA 4YDVB 3KYNB 5JOFA 2HT4D 3I02B 1T04A 1NFKA 2W0PA 4GW5B 4R8WH 3ZTNH 4H8WL 4NQDA 3HPJB 3UXFA 1XF1A 2DQTH 3RKDC 1F8TL 2ADIA 1F13A 1MHPL 1TZGL 4U3HA 1I85A 2XG4A 4JEGB 2W9DL 1ZHBA 2C7UA 4E9LA 5HGHB 5L2JA 2P47B 3GSQA 4OZHB 5BXFA 3Q3GB 4EI5A 1A6WH 2AEQL 1YPZE 4ORZC 1MJ7L 4MJIB 5IG7A 4XVUC 1QLFB 3CVHL 4P23D 1C5CH 4HWBL 2NYYC 2QLVB 1F6LL 3DETD 3MGAA 4JFOA 5FA4A 5D70L 4BUGA 2GEEA 3DVFA 4K2UL 2BRQA 3FZUC 5DRNB 12E8L 4ZO7A 4QXUL 5CWSB 1FAKT 2MHAB 4N0UE 1MCSA 2ERJC 4W68A 3LHPL 4XNQB 3SKOA 4TOYL 4PGJA 4LF3A 4W6XB 4XC3L 4N0FB 1NEZB 3GRWH 4N5ED 5EU6E 5JORB 4UI2A 5K93A 1M4KA 2WQ8A 3MV7A 1KN4L 2CKNA 3M8OH 3QRFM 5GRUL 3SGEH 5T1DH 2VLJD 2AV1A 1NQBA 5DZLA 4JPVL 1BLNB 4UDTA 3JWDH 1NGXA 2AQ3A 5MP6H 3E2HB 1YNTB 2VLJA 1FIGH 2ESVB 3NAAH 1KIUA 1CXIA 1DZBA 4KZDH 1A6PA 5DK2B 3C5JB 1IC5H 4UQ3A 1INEL 2YUVA 3HC4H 5IFJB 4K94H 1A7OL 3WUWG 3BUYB 1BJ8A 1KT2A 2JELL 3B6SA 3OZ9H 4I3GA 3SGKC 5F9AC 5T1KA 2PYFA 3GMOA 3K3QA 3GMNB 3JTSB 3GGWA 1V8HA 1G9NL 1XMWA 2XQBH 2Y5TB 3O45A 3NCJH 2X1PA 2JB5H 3ESVF 2QSCL 1HXMB 2C3VB 4WFFD 5IHBA 5DRNA 4QTHB 2CKBB 3ZLQC 1PY4A 4P23A 2IPUK 3H7BA 4OZGA 3QDGE 3RVVC 3I2CH 4MD4A 1OTUD 2B2XH 3O6FB 4XPAL 1C7TA 3BJ91 1X5GA 3O6FD 3H7LA 2V2TB 4NQSB 1J8HD 4AIZB 2XKUA 2W9EL 5GS1A 2NPLX 4K23H 2VDLH 2J8UE 1OAZL 5C08B 1QSEA 1UADC 5LBSL 1RUMH 4ZD3L 5IT2H 1LE5B 5IQ7L 4F3FA 1GC1L 1DE4B 4JY4B 4Y5XB 4KROC 3ZDYE 3TVMB 4KDTC 2YWYA 1I7RA 2I24N 4GW5A 2HJFA 5DJYA 3X3FH 4DVBB 3NIDE 2ITCA 1ADQH 2Z93B 4CW1A 4Y4FC 2YZ8A 4PJEA 5I75B 1Q9KA 1MFEH 2Q8BL 3S4SA 1NANH 2GYSA 4QWWD 2C1OA 2VWEC 3L6FB 3MRGA 4M1GH 3ZE2E 1IGCH 4PFEA 3IGAA 3UPRA 1K6QH 1YEHL 1AXSB 3HI5H 3NIFE 1EK3A 3MRLA 2VZTA 5MERB 2JJTC 2F74A 5HDBF 5CS7A 4GQPH 3B9KA 1AD0B 2BP3A 3MX0A 2UWEB 1TENA 4WUUA 1BD2A 2R2BB 3HNTL 2AJZB 2XTLA 1QOKA 3BZ4A 1U8OA 3ZKMD 1YQVL 4P48A 3GSOB 1WT5A 2D3VA 2PXYC 2FECI 4CNIA 5DHXB 3V0WL 3BP4B 5DEZA 5J3HC 3HLAA 4JR9L 5EIIA 2XICA 2GTWB 2PETA 3QXAB 1JPSL 3O3BA 4ODXA 3CH1B 3DOSA 3FB8A 4HUNB 1BD2B 3MV7E 5J13C 2B5IC 3G08B 3BKCL 5H37G 4O00A 4WCYL 3WJLA 1B88A 5SWZB 4XVTH 2I5YH 4R8WL 1QRKA 1AXSA 4W6WB 3T0ED 2R4RH 2F5AH 1YN6A 1T22B 4ZS7L 4D0CB 1F11B 4AEIL 1F3RB 2XPGA 3IAGC 2X4RB 5BV7L 2MMXA 4M6AA 1JWSA 1W0WB 3SE4C 5DC0A 3K74B 3ZHKA 3MRRB 2VR9A 1DN0B 5HI3D 1KEMH 4OIAA 4JG1H 5FCSH 1XZ0A 3L7FB 1RUPH 1LE5A 1E6OH 1OSPL 3EDDA 2PN5A 4Y2OA 1L7IL 3BEWB 4LLMA 3HAEH 3X13A 1MCCA 2O5YL 3QNYA 3QEHB 3MV8D 3PWLB 1IKFL 4XNXH 4LMQI 3CX5K 1NKOA 3OR6B 2FIKB 4PJGA 3MA9L 2BSTB 3TYGL 3MV9E 2ZSWA 4XNYL 4BQ8A 1FNFA 3WO4B 1RY7B 1TDQA 1BIHA 3L3HA 4NQXB 5H8DA 2X1WL 3W2DH 4X5WB 3QZWG 1MCOH 3BAEL 3FRUA 4ZUUB 3UTSA 3RTQD 2Z31D 2Q86A 3E0GA 5DK3A 2LU4A 1JHKH 1BM3H 2NR6C 4GRLC 4JFED 4JVWA 1D5BB 2XKSA 2H41A 2A6JB 1K4DB 4R2GD 5SWSA 1MJ8H 2AI0H 2BSED 2H45A 1FNHA 3DXAD 3GSUA 4UQ3B 1YEDA 1ZA6A 4M93B 1X4ZA 4LBEB 1EVTC 3X3GL 3BPOC 3VFMA 4MNQD 3DX7B 4M02A 3GUTB 4PRNA 4KUZL 1CGVA 3O2WL 1UM5H 5EU6B 3VXNA 2DICA 1A6WL 4G6AD 2F8OA 3HNVL 4NFCA 5GGVY 1AXIB 1BHGA 3MLSL 3TA3A 3QQ4A 3G04A 3WLBA 3N1FC 4MJ6A 2B2XL 1MFAL 4HCRL 5FYLE 1FCGA 1I4FA 2GAZA 5LKNA 4M62H 1NUDA 1JMZA 5SWQB 2HKHL 4RCAA 4LLVA 2QEJA 4FXGB 3MLUL 1JGLL 2AK1H 2P8MB 3SO5A 4AT6A 4H1LB 4Y16D 5K9KA 2VLLA 2FEEI 4TVSa 3RY6A 3WSQL 5ITBH 1T7VA 1ZSDB 5MEOB 1PAMA 5INDB 1N7MH 1NCWH 3UTQA 2BY0A 1FL5A 1IC4H 4QRRE 2IQ9L 3ULVL 5HHMB 4X4MA 3GIVB 1C08B 4MA1C 4X6DE 2P7TA 1ZHBB 5GS0H 4YXHL 2BC4B 4IOFC 4M1GL 3MO1B 4L8SC 4IIQC 2PO6B 2E7BA 1AP2A 1ZLVH 1E28A 4Y1AD 4KY1H 4E41D 4EN3A 4LKCA 3HC4L 5T1MA 3H8NA 2Q1EA 3T3PE 4HPOH 3K2UH 5EUOA 5T1MB 2IANB 4R26H 4XHQA 4QHMB 1FDLH 3OXRB 1UXWA 3LQZB 4YDVA 5GSRA 2EDRA 4MAUL 4BUHA 3B3IB 2O26U 1N3NB 3NCJL 1SJXA 2AXHA 4KMLB 3PQYE 3F7YB 3U30B 4D0BA 2KBGA 2H8PB 3ALXA 2P7TB 5EZOH 1K8DA 1S78D 1BFVH 3IU3A 1T1YB 3I2CL 3MFFA 2OTWB 43C9A 4XPAH 3E2HC 2VZ1A 4NRXB 4N5EC 4I2XB 3T8XA 2W0LA 5INDA 5MEOA 1JPSH 3G6AB 4ODTH 3WV0A 1IL1B 1M05A 1RZIB 1U58B 2ID5A 5DUBB 3IDXH 1YY9D 2P8MA 1AO7D 4JRXB 2VDPH 1UACL 1G6RL 4RGNB 1DUYA 2IBGA 3SPVA 2R2CA 35C8L 1WZMA 4LPTA 4OTXL 2OSLB 1IZJA 2RCSH 2GTZB 1HSBB 4R7NA 1PQZA 5F1KC 4NNPL 1V3LA 3HPLB 4LCYB 1BD2D 5FK9A 1GOGA 1R5WA 5CP7B 5DFVD 4JPWL 5DF0A 5E6YA 3S37L 3OKEA 4RGMC 5DMIL 1KB5H 3G5YB 1X5LA 4L8CB 1BEYH 4K3JL 2UZXB 3RBGA 1BMGA 5JIHA 5SX5K 4JGMA 1KIRA 5CILH 1W8NA 5IK3B 3AM8C 5DYOB 2A6DB 1M71B 4Z7WF 1E4KC 3ARRA 2DQEH 4QOKB 1DEEA 1X7QA 1RZKH 4WTZA 1CBVH 4PP1C 5C0JA 3D3VD 5TE4L 1EGJL 4MAYB 3FRUB 4ZUUA 1F4WH 5TH2A 5HPMA 3F6IA 3DSFH 1MIEH 2FEEL 5BMFH 2H3NA 4HC1A 1SBSH 4W6YB 4XAKE 2JCCF 4XMPL 1G7JA 2IH1A 1PFCA 1E6JH 5ICZA 3IJYB 1H5BA 5J3HD 1OF2B 3MXWH 2Z35B 4ZNCD 4ORGA 4M61A 1DQJB 4UV4L 3V6ZA 1CGUA 1BZ9A 5GS2D 1KIQB 4ZPTB 4PG2C 1PYWB 2YSSB 4HQQH 3MLPA 4ESKA 1A6VL 5I1JL 8CGTA 3GI9L 5F6IB 1CDYA 3TO2A 4GQ9L 4S1DD 1T0NB 3UJIH 5C0DA 1XT5A 3T2NL 4X4XA 1IQDA 2D7NA 3C09C 2Y06H 9CGTA 4XHJC 1VFBB 5HYSG 4YEEA 2R29H 3WD5H 4G6KH 2EIBA 2IGFL 4LSDA 3QDJD 3MLRH 4GMSL 1HEZA 2XPGB 2NY4C 5BRZA 1UM5L 4LCIL 3QHFH 4LLDA 3KR3H 1ZHNA 3ULVE 1HI6B 2PNDA 3T1FB 1NANI 3BWAA 4K3DL 3HC0A 1YEJL 4Z18A 3IDJB 2YWZA 1LO0H 5IK3A 3JV6A 1P2CB 1BBJA 3WE6A 2O5YH 3GMRB 5IR1B 5FO9B 1UCBH 3RP1A 2Y07L 2IQAB 2XZQL 4HJ0D 4OQ1A 4U6HA 1T3FB 3OG6B 4CU6A 2W0KA 3U48A 3ES6A 2ZUQB 2Z8RA 4LCWA 3I75B 2AJ3A 5ALBL 5C92A 3LZFH 3VXMA 1WLHA 1GZPA 5KS9F 3EGSA 1RFDL 1A6TA 4Z7VF 2VXTH 3VFWA 4ODUA 3A6OA 3ZE0F 1FO0H 1GOFA 1RAMA 3CPLB 1I8IA 3RA7L 2VLRB 3NABL 1CG9A 3G9AB 1S7VB 1AGDB 5E4EC 1D9KC 1N4XH 4QXGH 4FQXA 3UDWC 5A3ID 5KANG 1AD9A 4UNUA 2R0ZH 4OBRA 4GXVH 5T1DL 4FQJH 3QR2A 4XMLL 4ZFZA 4K3EH 1AFVL 4PRPE 1BZQK 2HA1A 1CDIA 3JWDL 3DUUB 2W60A 2K1MA 3L3IA 5MP6L 2D03H 3VDCA 3QJFA 4HZAA 3Q1SH 3F7YA 2X10A 5DTFB 3SKUD 1FIGL 5E5MA 1UB5A 3C8KB 3MLXH 2GCYA 1VADA 3PWUA 1WWWX 1B6UA 4ZAKD 1W0VB 3ME0A 5F6HJ 1O5DT 3MRDA 1MAKA 4QWWC 2FJGA 4UZGA 4DVBA 1I7RB 4I5BA 3PGFL 4P5MB 1JMXA 1QSED 3CX2A 1QBML 1NC2B 3H9HB 1CLYL 1AP2B 4UT9H 2F58H 5A2IH 2XV6B 1QSEB 2EC9T 3JWOH 5K59E 3ZDXF 3PJSB 5IUSA 5DVOA 3WSQH 3JWDC 4HUXB 4JN2A 3MYJB 4FQCL 4Y5YB 4L8BA 5EIVA 1P4BL 1IC4L 1LEKB 3B2VL 4K7PX 2HVJA 1CWVA 3TGXA 1RZKC 4ODHL 1TJHL 1BP3B 3S37H 3VW3H 4X9IA 5DMIH 5BJTA 4F7PB 4YXHH 3JTTB 2VLLB 4KDTA 2NW3A 1H3VA 1U8LA 4H1LH 3STZA 1B9ZA 1EAPB 2A9NL 3C9NB 5F89B 5EO1A 5EOTA 3KYMB 4NKMB 3QDME 3UJTL 1PZ5B 3EBAA 2Z4QB 1K2DA 2FATL 1I9JL 2BERA 3G04B 2XRAH 1RZFL 1RQ5A 5BO1L 1GGIH 4L4TD 1D6VL 2VMFA 2Q8BH 2ESVA 3V4VH 3PGDA 2NXZC 3O2VL 2ZOLB 3F6LA 4U1KA 1QFHA 1F6AA 4NO5B 1BFVL 4PG9A 4JFFD 5CP3H 1BLNA 1HHJB 5I0ZA 5IESL 3GKZA 3D48R 2J7LA 4HJJL 2HTLC 5C07A 5CMAB 3D5OF 3RTQC 1NGPL 1PZ5A 5GGRB 4FQ1L 1XF5A 1D9KD 3P11L 4EEEA 4HXAL 2X4QA 2E7LC 2QQLL 4XNQA 4PTTA 1E27B 3LIZL 4OTXH 5ERWB 1FGNL 4PJ8B 1PSKH 3C87A 4PREB 3MCKA 3JTTA 3L3HB 4GQ9H 4QOKE 1TQCB 3E8UH 3VGAC 3R0NA 3UJIL 4LCWD 1NEUA 4LSTL 4JPWH 4P99A 4ODVL 2BVQB 1NFDB 3IS0X 4Z7UF 3F62A 4L8BB 4LSVL 4LARL 3GMPA 4LGRB 3MYJA 5DS8A 4YHLL 3EFDH 3PWLA 2YUXA 4O02L 1TJGL 3K8KA 5JMOC 2GJ6D 3QHFL 1MJUL 1ND0B 5DJDA 5B21A 2R1YB 5BVJA 4LLUB 4NC1E 4CAGA 1WJ3A 1A3RH 4JPKH 4XCCH 3U4BL 4NHUA 1ULVA 4OGXL 2HFEB 4Z95H 3CSGA 1YUHA 4MLIA 1IBGH 1AR2A 1MCWM 2I5YL 2DQEL 3NCYP 3MRRA 2NZ9C 4W4NA 4JDVB 2OXGA 3ARZA 2V7NB 1PEZA 3D3VA 3WIHL 4RFNC 1P53A 3UTTA 2NTFA 1UVQA 1W0VA 1CK0L 3EIFA 4TUJA 3PWUB 2VZOA 1ZEAL 3HG1A 2GCYB 4PRIA 4Y4KC 4D0CA 1S5HA 2EXYC 1II4E 5KTEH 1JPFB 2VXQH 3KS0J 1KELH 1ORSA 4WWKA 4EN3D 5CEZH 1N2RA 4ZUTB 3QUMB 3VRIA 4OM1L 3PWPB 3FQTA 4HUVA 4NT6B 5HJ3A 1I9IL 3O41A 4GJTB 2I25N 3D85D 1BAFL 3MJ7B 4WI6A 4OB5H 4KJQC 4NSKB 3P3YA 2EXWD 1JI1A 4QY8B 1P1ZB 3RZCD 5EN2B 5JLZA 1RUAL 3FO0H 3QPQC 4XZUB 4HULB 5I1JH 3U9PH 1H0DB 2J88H 5TE7H 1KPRA 3GI9H 3JV0A 3SN6N 2WWMC 5JIPA 2LV4A 2ZNXA 2VDRL 1WWAX 4DUVA 4M7JL 3O9WD 3F7RA 1FNGA 1PG7W 2CPCA 3G5ZA 3BT2H 4R9HA 4RAUB 4DKFH 5C0AA 1FFNB 3KVQA 1I3VA 5FIEA 3Q1SL 3QIUA 2CDFA 3A6CH 4KUCF 4OD2A 5IB1B 1QR1A 1HSAB 5LG1A 4LDEB 2D31B 4WW2B 1NH6A 5F44A 2XQYG 2E6PA 2QBWA 1IKNC 3VG9C 3OKLB 1YEJH 4PJCE 2F74B 3VWJD 1HNGA 1MFBL 3U83A 3V0VA 4PR5A 5F6IC 1Q94B 4FFWC 4ZUTA 1UCBL 2R4SH 4JDZB 4GRWH 1JPFA 3OAZH 4JANB 4G43A 5DGQA 1QA9A 1MQKL 1KGCD 5JQ6L 3S4SB 5K9QI 2CJUH 4YHKH 4H25B 3PP4H 1EH9A 2ZCHL 3B5GA 4POUB 3RWGB 3UAJC 4XCFH 2E3VA 5J12C 5MEPB 1YMHB 3GI8L 1UVQB 3BZFB 5T5NG 1IGTA 5D1XD 1VFBA 5TE6H 2Y36H 5DT1L 1WUNT 4AM0A 1ZLUH 4KTDL 3UTSD 4PJAA 1TJHH 1RMFH 4BH8A 3B2UD 4F3FB 1CVSC 2IBZY 3ZE1E 1FO0L 2B1HL 3CK0H 1JNLH 4MZ2A 1WIPA 5ACMA 3UPAA 4PBVC 3ARWA 5IMLA 1BZ9B 2EECA 4NQSA 1OAYL 1NCWL 2NX5D 4GXVL 2V9TA 1JTOA 2BVQA 1KCVL 2NX5B 3GDBA 4XVSL 5LCVL 2CRMA 2O5XL 1KCUL 1YJDC 2Y4SA 4ZXBB 2ATKB 3TJEH 4V1DA 3O9WA 2LQRA 4RIRB 4TNVK 1OAQH 3IF1A 5D6CB 2CKBH 1E27A 5FCUL 5JW4R 3IETB 1XGUA 4PLNC 1A2YB 1MCDA 1XR9A 5IB3A 1J05B 2RJMA 5DDHB 4LVNB 2JLLA 4WGWB 3RBSA 5KW9H 4D8PA 3B6SB 1DSFH 2YC1B 4J3TA 4Z6AT 1S8DB 4R26L 1IT9H 4UT9L 3T0EA 4NQTA 3CDYA 4MNQA 1MCQA 1EEYB 4F15C 1RPQA 3Q2CA 3AU1B 4PJFE 5SX4H 4NC2B 3RZWA 3LIZH 3S98A 3W39A 4CBPA 4FQCH 2ZOLA 4NO0D 1WGOA 1X6NA 4KVNL 1WBZA 1JVKA 3MRMB 4OZIE 2AV1B 1V7NH 4PJBF 4J7RA 5D93C 3MV7B 5DD1L 1QTYT 1MCFA 3HPLA 5EORL 4AG4L 4ODTL 3EFFA 1KN2L 5DLMH 5D2LF 2MQCA 1R5IB 2E7LA 3G5XA 4YBQC 1A9BB 5FYKE 4GOSA 3EJJX 1NLBL 3PHQA 4BSVB 3VI3E 1J88A 5I66B 1A3RL 3SBWC 2GJ6A 4Z95L 2YKLL 1T1XB 2H32B 4U2ZA 3NCBB 3TWCH 2V2WB 4WUUD 2DI9A 2OTWA 1FVEB 1HHGB 1T5WB 3V4PL 1T89A 4M5ZH 2C7UB 5I1IL 4I3RL 3H6JA 4KVCL 3CDGA 5CILL 3O6LH 3S9DB 1N5YH 3HPJA 3TN0B 1UXWB 3LQZA 5D5MB 1F4XH 1BAFH 5SWSD 3RGVA 1D9KA 5CD5C 3VFTB 1J0KA 1FYTD 4BZ1H 1A1OB 3PWVA 3BHBA 2EE6A 3QWRA 2X4PA 5TE4H 2Z31A 4MS8D 5E6ZA 3UYRL 3HZVA 1U92A 4LRIA 3DSFL 2IANE 1UGNA 1FL6B 4PGBB 5B3NA 1R24A 1PLGH 5E7BA 4FG6D 3BXNA 2ZPKL 4YDJB 4X6EB 5GGVH 1HXYB 5LGJB 1UWGH 2PTTA 2FLBT 1FFOB 3CXDL 4JFHD 2IPTH 1E4XL 1VPOL 3HI6L 4HS6B 2H32A 1T1XA 2E6JA 4Z78B 2HT3C 3LKOB 3OPZH 1RIHH 4B50A 2VLRA 2AP2A 3TP4A 3RZCB 1CFQA 3MNZB 5DFTA 1MH5B 2FD6L 4JFZL 5J6HB 5F7UA 1IEAB 3TZVC 4XC1L 4HF5H 2UVEA 2DQIL 2N7AA 3FT3A 3QXTA 4CL7A 3FFCE 3QULA 2XFXA 3WD5L 5J11B 5FHAH 4K3HA 4JPIA 4NQCB 3ILQD 5EUOE 2R4SL 4QEGA 3QAZB 4ISVB 4U0RB 1HH6A 5F93C 4CN6A 5DJ8A 3VXNB 5CEZL 4PRDA 1L6ZA 5CUSL 3PP4L 5EA0H 4EI5C 4YHOL 2HWZL 4O2EA 4XWGL 1SJEA 5KN5B 4PRNB 2AKRB 3KPRE 1UA6H 4M03A 3BGFC 1UC6A 2VZVA 2OLDA 4LU5L 5D4QA 1C5DA 5DT1H 2HTKC 3BH9B 5JNYA 1EFXB 3T1FA 2AXGA 4MA8H 5HI4C 4JO3L 4TOYH 2A6JA 1DQMH 5L7XL 2F8VA 1NGZA 4OZIA 1I9RH 3EDJA 1Y0LB 4HH9B 3NBNA 5BS0B 5E9DD 1VGKB 3GMQB 5AD0A 1WIOA 4HT1L 3OV6A 4ZYKB 3M8OL 2IALB 2HYMA 2P4AB 1WCBA 1WAAF 1FZOB 4K9EH 5ESQB 4YQXH 4L3AA 4XVSH 2HMIC 5ELIA 4U1NB 5DRXA 1KCUH 5BVPH 4CMHB 3CD4A 1U91A 1CICA 2FCBA 3ZTJG 5CINL 1DQLL 3H9SD 3T1WA 4PJ9C 3ZKSD 2NY4D 1XGYH 4F57H 2DIBA 3B9KD 2RAMA 3HE7A 3SGJA 3SQOH 5E8DL 2A77H 4UMGA 3TNNB 2EDKA 4ORGB 4LIQL 4JVUA 4N8VG 3VI4F 4BH8B 2G2RB 2J8HA 5C0EA 1U8IB 3X12A 4QGTA 5I1DB 5DZNA 1G9NH 2XQBL 1LE9A 2XZAL 2XG5A 1FZOA 2E7CA 3MZGB 2QSCH 2W0FB 2X70A 1B4JL 4HUWA 5CSBA 5T1KD 5HXMA 1TLKA 4UAOC 4ZNEE 5E8EB 4F58H 3KLSA 1KIPA 4YAQB 1VGKA 1P69B 1G9NC 3GMQA 1JNHA 4MNGA 4UU9B 4Y2DC 2ARJA 3C5ZC 3I6KB 1JE6A 4D9RD 1M71A 1REIA 2VITB 3QWOA 1E4XI 2EE2A 1JNLL 1I9EA 3LH2H 1OAZH 4NO0A 4JG0H 1FSKC 5ENWB 5GPRA 5KN5A 4X9GA 4O9HH 5DFVC 4Q9QH 5FGCE 4PRHA 3S36H 4L8CA 5D7JC 1R3LB 3G5YA 4M48H 5E8PB 3X3FL 4G8FB 4HKJA 5DVMA 2GTWA 1NMBH 5ESVA 2AJSH 4UQ2B 4Y4KD 5DQDL 4Q97A 2YRPA 1KEGL 5C6WH 1DUYB 5F8QC 1KPRB 1CFQB 2JJTA 3VXSB 3NFPA 4I9WD 4OF5A 4YK4B 4LPWA 1N8ZA 3RIAK 4KDVA 5T1LB 4LPCA 2VISB 5J57B 1P1ZA 1IL1A 4LVHB 3VU2A 1YEFH 1LD9A 4Q2ZB 3N06B 2VDML 4IEFB 2FATH 3MSPA 5BO1H 3A0OA 25C8L 3HNTH 3IU3B 1C16A 3NIGE 4NQDD 3UYRH 5JPNB 2PUQT 3RAJH 4CVZA 3JVGA 4Q6IB 4D9RE 1IC7L 4YR6A 1QFWH 2D0HA 3AS2A 3BEVB 3MRFB 4WENB 4NFBA 4AG4H 2EXYD 2A74A 5DMGC 4M1DH 3MCLL 3QDJA 2BNUA 3QUMH 3C8HA 3KWWB 1UB6A 2P5WE 4O58L 4JQVA 5GRVL 4KI5D 1PSKL 1DBKH 2G75A 5GGUA 5SV4A 4AIZA 4DK3A 1F6FB 4U1SA 3P9LB 1OGTB 2DDQH 4AENB 4PLKD 3QIBB 4P4KD 2V2WA 4HK3J 3LKPB 5FHAL 3CFBB 4LARH 3INUH 2BOCA 2DI7A 5D93B 5BV7H 2CKBA 4I3RH 4JO1L 3I6GB 1LK2A 3DX9A 1MJUH 2ZCLL 4NQEE 5L6YL 2OZ4A 4PTTB 4OT1H 3OJMB 1CXFA 4LLVB 2HN7A 1XCQA 4X80L 5T3ZL 1YEKH 3SO3C 1AGEB 2FECL 3T04D 3K8MA 1S7RB 4OGYH 2BHZA 4GRMB 4LEOB 3ARPA 4R0LB 1BECA 5E08L 4KZEH 2O61A 4Y4HB 1F00I 4QRUB 1Z5LB 2R8SL 2B7DT 3TA3D 5DK0A 5DD3H 3C6LC 1MNUL 3IDMB 1NGXB 3FKUS 1N5AB 4MNQB 5A16B 4EQ3A 4DGIH 1UWGL 4LBEA 4NQCE 4WV1B 2J8OA 1FLRH 5FUOL 3D85A 1AHWB 4OD1H 3AFLA 4LLYA 5CD3B 3OAYK 2Y9RT 5L88L 3O6MH 2DLFH 1J10A 1DBMH 4D8PB 1QFPA 1YECH 4K71C 1D5BA 3RY4A 1A2YA 4G6MH 1TJIH 4JZJA 2MOVA 4NKDB 2Q86B 1DTUA 2HFFA 3F12A 4GAFB 5E8DH 3WHXA 4KPHH 3O9WB 5D1XB 3QUKA 2X9YA 1UQSB 4WHTB 4ZO6A 5KG9B 3BIKB 3I9GL 4JFOB 3X3GH 4GG6B 3HS0B 3V79C 5DHYB 2EO1A 2HVJB 4DKFL 1BZ7A 4MJIA 4C55A 1KB5A 4HWNA 3FZUD 5I71B 4PRBB 5JA9A 5FF6B 5K59F 1JZ4A 2I9TB 4U1IA 3HI1B 1X6LA 3GSQB 1ZVYA 4HIIB 3ETBF 1CT8A 1XF2A 3MXVH 4PB9H 4ZODA 2ADIB 1IAIL 3MV8A 4P9MH 3VRJA 4NWTL 4XCNA 1Q9LA 2I07A 5EZLA 3SDAD 1A4JA 5CCKH 3SDAB 5J06A 1I9RL 3MRDB 3LCYA 2MCPH 5T33L 3D69A 4NO2B 5E4IA 1BVKA 1N59B 2NY1C 2ZCHH 3K4ZA 4MQSB 4YHIB 2W60B 3L3IB 3ARTA 3KLAB 3DUUA 3VD4A 4F7MB 4Q7DA 3GJFK 4KFZC 5C07D 4RISH 2CMRH 2AJSL 1P4IL 1RMFL 2BFVL 2CRIA 3I3BA 2EH7L 5FO7B 5SV3A 4ELMF 3OKLA 1X5KA 2I9LA 3GM0A 5JQHC 1ACYH 1DQLH 5EBMA 2YPVL 4L4VD 1S7VA 5GIRA 1KFAL 3V95A 4IRZH 2O93L 4PLJC 4TVPE 4OGAC 4YZFF 5FGRA 2J6EA 3QUYA 4YGVA 3HC3H 3H9ZA 2DQJL 3T77B 4NDMB 2W91A 3VXMB 4Z7WE 3O8XC 4GRWE 3BH8B 5GS0D 2R2EB 4NC0B 2VSDA 2EKSA 3IXTB 3EO0B 2X4SB 4G8GB 4PTUA 1A7QL 2P8PA 3OGCA 4X9BA 3KPQA 1VEOA 3SDXF 4ZNEA 3VXRB 5JIIA 3ZKQD 3GMRA 5I16A 1IT9L 1JNNL 4LFHD 2YBRB 4D9LH 4TSBH 4NSKA 1WWCA 3HMXH 1BGXH 3QHZH 3V6FA 5FO8B 5JW4Q 2XA8L 3VMOA 1G6RH 1SY6L 3QUML 2ZG1A 2PR4H 1N2RB 1R3KA 2RCSL 3S36L 1DBKL 3LVEA 1NCUA 5L9DH 4PLJD 1YDPB 5I1GH 3MGTB 1AJ7L 3HG1B 2GUOA 3L5JA 3VXQB 4LLWA 5J0BA 4HDIB 1UYWH 5BCAA 5EU3A 5FUCC 3PL6A 1A1MA 1A3LL 2OP4H 3IDYC 1AIFB 1CXLA 1FNSH 4J1UB 1RK0B 2YA0A 1CFTB 2GJ6E 5F96H 4X4ME 1QRND 3VCLB 1DE4A 4JY4A 3IYLW 2AEPH 1CDCA 1A6UL 5F7EL 3BWUC 4X7DC 1MVUA 3JWNC 3EYOA 5DD0L 3S35X 3HE6C 1OTUC 1A6ZB 3EO0A 5DI8B 4UV7H 2FR4A 4HD9A 1JWMB 3LY6A 1YEKL 1RIVL 1TVHA 4M61B 1IEHA 5CEZE 1JFQL 4YFEA 4KZEL 3SE8L 3O6FA 4OKDA 4XNZC 1EEZA 1ZHLA 4OLUH 3MR9A 3DO7B 2DQHL 4UINH 2FZ3A 1T80A 1CGTA 4GKZB 3AVEA 4MAYA 5TDPB 2RB8A 1ZOXA 5C9JB 2OZ4H 1TFHA 1F4AA 3MOBH 5IVXE 4P4KC 4EI6B 3CFEA 3LRSB 2VLKE 1KSRA 3U6RB 3C60C 2VDNL 1C1EL 1ES0B 3BRGC 3T65A 2AJXL 4E41E 2PYEE 1QLRB 3LPFA 5F1IA 1DBML 5DYOA 3C5JA 1KIRB 2JCCB 4GXUN 4G6ML 4N0RA 4B7IA 1TVDA 4JFFA 5FECA 4LPVA 4OAWA 4MMZC 1FORL 2ZPKH 3OBAA 3VFVA 1CGWA 2FIRT 4P2QB 4NZRH 3MZTA 4EDWH 4XP9L 1ZVSB 3B9VA 5IVZB 2QQNL 1UH2A 1G9ML 3VG0H 3MBEA 5ACZB 2Z4QA 4LCIH 2CDGA 4MLSA 3G5VA 1T6VN 2R56L 3KR3L 4LDLB 4I18C 2DIAA 4YPGA 3GMMA 1P6AB 4Y16C 2H9GA 4FABH 2OXHA 1JZ6A 1QVOA 1ZT7A 4X6FA 2JK5A 5T3ZH 5EZJB 4ZUVB 2XTJD 1ZWIA 4P9ML 3R1GH 1IJ9A 1CICC 2I9TA 4MDIB 1H9VA 1QLFA 1GIGL 5IG7B 1XH3B 4D3CL 1LEKA 3QUKB 3NFNA 5KSVB 1QACA 4OZHA 4KJYA 5E99L 2CLRA 2HKFL 3QIBC 3GBLA 2XWJB 4D0BB 5GQBA 3WIIL 4X99B 1CD0A 2Y25A 3QUXC 5HSFA 1RFDH 4JHAH 3DVIA 3HB3D 3VXOA 1KJVA 1P4IH 2BFVH 4JRYB 3O6ML 5HHQA 3D85B 1QG3A 2H26A 3L3JA 5FUZH 1INDH 1T04B 3DNKA 5HI3C 3EDEA 3LEYL 1N5AA 2OL3H 3FQNB 4CN4A 5ILTH 3VGHA 3DRQB 1VADB 2QKIB 5CKGA 1NMCC 2ZNWA 3IDIA 4RGNE 4IOIA 4BYHA 1KTLB 3VXUD 3HCVB 5CJQL 3GIVA 5GRZA 1Z5LA 4JLRA 1AFVH 1W72B 3D2UA 4Z7OE 3JSSA 3TT1L 3QXWA 1K5NA 2D03L 4G8EB 2IMNA 3ARGC 4TSAL 1N6VA 1J8HA 3ECBB 1AD9B 3FJTA 4RAHA 1FAIL 4DQOL 4NO3B 3K2MC 4LHUG 3VWJC 1ZSDA 1K85A 1HINL 3MLXL 5IM7A 4X98B 3QEQE 2ZUWA 2X05A 3S6CA 4NKIH 1XGYL 2RGSA 3LN9A 1I8IB 5KVDH 4KHTH 3SQOL 1K8IB 2WBKA 3I6LD 4BFBD 4LIQH 4XB8A 1JNNH 3EYFA 4DZ8B 3PIQA 3QIBA 4TSBL 5CCKL 3KLHD 4P3DB 5E5RB 2YMXH 4NQUA 2HG5A 5DJ0A 5T33H 2A1WL 3QQ4B 4PJIE 4TULL 1UJ3B 2G75B 4H0HB 2QQKH 4TUOB 1UXSA 2VLKB 4KKLC 2FX8L 5CGYD 4W4OA 4Y7MA 5HYJD 1NUGA 1E0OB 4X7SL 5C09D 3BI9X 2IADB 3W81A 1P2CA 3MUY1 5TF0A 1CVRA 1TTUA 5H35A 4JQIH 3IDJA 4PV8B 3Q6FB 5DHVB 1MQ8A 5JO5A 1HI6A 3FHAA 4G9FE 3MMEB 1NBZA 2DS4A 3BD4A 4P2YA 5C0AE 3F5WA 3GB7A 5E03A 4G7VL 3FB5A 4X9HA 1SJVA 4R2GC 3O3DB 3VFSB 3DX6B 1I9JH 2VN4A 1R3JA 3IFOA 4XP1L 1D6VH 3RWCB 2ZSWB 1HZHL 4LQFH 3N0PB 4NM8H 1IQDB 3ZYZA 3O2VH 2YPKA 4FQ2L 2Q8AH 4C4KO 4JRXD 3NVQA 5D6DC 4WFFE 1KXTB 4L3EB 4PGDB 4AEHH 4TTGA 4JFDB 4H0IA 2P46B 2R2HB 2VJXA 3Q5YA 2B4CC 1C5BL 3BE1H 4U6VL 2VDKL 4Y19E 5B8CA 4NP4L 1KOAA 3FOMA 4NKQB 3PWNA 1CL7I 2VDNH 3RDTA 4FQ1H 5DD6A 1BGXL 3L9RA 3QHZL 4UQ2A 3S5LB 1CLZH 3FCTA 1AGFB 2EIDA 5B38B 2EO9A 2VZUA 4KMTH 5DJZB 5M94B 4S1DC 1HILA 4KK8D 1EBPA 5BZDA 3O3EB 4K7PY 4ZUSB 5J12B 4E0RB 2X4RA 4AIXA 3S35L 2DKMA 3UBXA 2Q87A 1ZXQA 4I0PC 4ZUWA 3CIQA 1UYWL 1D7FA 3QWOB 1BQLL 4R4ND 4LAQL 5F9WB 5KSUB 3ESUF 4LSVH 1I1AB 5CZVL 1CR9L 2X89A 1WFUA 1GRWA 4M1CC 4YO0B 2J2ZA 2HMID 5IKCA 2A6DA 4J3WA 5KSBA 4G9FD 3I3EA 4O02H 5F9OL 5IFHH 2CR3A 4O58H 2IWGA 3QFJB 4HV8A 1M7DA 3B83A 1DVFA 3O3EA 1ZGLP 1OWWA 4XTRC 2R1WB 2YXFA 2ITDB 4IS6A 2EYTB 4BKLA 4GSDL 3WEXB 4OCNC 3BUTA 1SEBA 3WIHH 2CDEB 4UT6L 1S7TB 4M6MH 3ZKND 5D7IA 4JRXE 3SE4A 4X6CB 3OKKA 3VGBA 3QEQB 4HGWB 3PWNB 3RUGA 3FOMB 1UKTA 1BF2A 1KELL 4U1LA 5E9DB 3TH3T 2OZ4L 1FFPA 5MHSE 4PRIE 5AEAA 3WNKA 2PKDA 3LN4B 4G80A 4KK6D 1KJMA 2UWEA 3O4OB 4PD4J 4S1RH 4B7LA 3RL1B 4Z5RB 1AD0A 3ZDXE 4I2XA 3WXVH 2R0KH 4EUPH 4KMQA 1UH3A 2DIJA 2NYYD 3WDHA 4HMCA 7FABH 2NXYC 5DEFB 5JHLH 5LAXA 3DX6A 2J88L 5TE7L 1T1YA 3O8XA 5E7FA 5D1QB 2J1KA 3F5WB 4G42B 1RULH 2V2XA 1A4KB 1H15A 4NZRL 4XCEB 4OZIB 4PBXA 2A83A 5KOMC 4WTXA 2OR8A 1JPTL 4ONGH 1EFXA 4J6RL 5JO5B 2QQNH 4PV8A 2ITCB 2NZIA 3CUPA 4FNLL 3QPXH 4JREB 5IF0A 2E8ZA 1U93A 4U4BA 4JRYD 1ZANH 1YECL 1IM3B 4MCZA 2GFBB 3IDGA 3M07A 4NRYA 1JGEB 5L2KE 4FTVE 1V3MA 3TT3H 1UXSB 3EZJB 3OKOA 3QCVL 4R4BA 5D7IE 1F90L 2K7QA 4RWHA 3TCLB 4K7FB 3K0WA 1JHTB 2PF6A 1MUJA 2E9BA 1LO2H 2WUCL 4IRSA 3THML 3EYFB 4TPRL 3EOAA 3UTTE 3BN9D 2P8LB 2CJUL 4YHKL 1T6WA 1MH5A 3MXVL 1JYVA 4MXWH 4AT6B 4DW2H 3GJFH 4QRQB 1NAML 2UWEF 4PJ5A 2Y5TA 4MQ7B 4KK5D 1RUQL 2X40A 3GGWB 2BVEA 4P5TB 3ILPA 3ULSA 4HFUL 5D2NA 1INDL