1TZAA

X-ray structure of northeast structural genomics consortium target sor45
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
132
structure length
132
Chain Sequence
b'ALDNSIRVEVKTEYIEQQSSPEDEKYLFSYTITIINLGEQAAKLETRHWIITDANGKTSEVQGAGVVGETPTIPPNTAYQYTSGTVLDTPFGIMYGTYGMVSESGEHFNAIIKPFRLATPGLLHLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords apaG protein
publication title X-ray structure of Northeast Structural Genomics Consortium target SoR45
rcsb
source organism Shewanella oneidensis
molecule tags Structural genomics, unknown function
total genus 20
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04379 DUF525 ApaG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1470 Mainly Beta Sandwich Immunoglobulin-like ApaG domain 1tzaA00
5HDWA 2F1EA 1TZAA 1XVSA 1XQ4A
chains in the Genus database with same CATH superfamily
3QUYA 1BWMA 2B08A 1T66D 3LB6D 3L4VA 3AACA 4HJTA 4L8BA 5FIEA 4HVBA 1DVYA 3CMGA 2H6PB 1KGXA 4PU2A 1NLBL 3GIZH 4KH9A 3MBEA 2BVQA 2Y5EA 4XXCA 1R24B 3PWNA 3CE1A 1G7PA 2OXHA 4K3JH 2A4CA 4JR9L 4PW4A 4HOZA 2BXYA 2G2NA 4M8UA 1ILSA 1LO0H 2LT9A 4GG6A 4QKXB 5GRZA 4FA7B 2N7BA 2F2HA 4BQCA 4XCYB 4XP4H 5GZOC 4HS3B 2JVUA 3W2DL 3PAUA 4AX3A 5JTWA 5KTEH 3OL2A 2WZPD 1A7QH 4D3CL 1SVZA 1TTGA 4TYUA 4XO3A 3CN4A 4CNIA 4IRSC 2IEPA 4AIEA 4F57H 1B4TA 4LP5A 1EANA 5I17A 2IGLA 4MZ2A 5EZIH 3BUTA 2D9QB 5B7FA 5I1AA 5A2JH 1DBKL 2AC0A 5KAQG 4EI5A 1X4YA 3KS0J 3QZOA 2DQIL 3E1F1 3MJ8A 3REWB 1J5DA 2BWDA 3S8GB 2QPSA 5H94A 5IMMA 4FKKA 4WV1B 3GI9H 4KKAC 2Z93A 1T7WA 4NUMA 4KUCF 2JXMB 4P4RA 4XC3H 4TNEA 4WW2F 1BAGA 1N70A 3RA7H 3N85H 1GMEA 2A73A 3KJ6L 5CGYC 3EHBC 2G3ZA 3EJPA 1XEUA 4QGYA 4ZAKD 4L1HA 3FO9A 3T0ED 1KTRL 3C5SA 3QZLA 1EEZB 3HLAA 1P0SE 3N04A 2OK0H 3CFDB 5D4JA 5D71L 3BAJA 3MRKB 2ODHA 1A7RL 4GSUA 1MW3A 1IAMA 1FP5A 3VFUB 4UT9L 4WI8A 3VXSE 1KTKE 1WC7A 1OARL 1XF3B 2YK1L 4QDGA 5JUEL 3KYKH 5DC0A 4Z78A 1NC4B 4HT1H 3D3VD 3CSFA 5KUMA 1T2QH 1RJLA 2EO7A 1HDMB 1MVUA 2V3FA 2BP8B 4IIQC 4Q89A 2LFGA 4I3GA 4O4YL 5EU6B 5BS0E 1QSEA 4K3GA 5IESH 2XTJB 3LKSA 2HJFA 3QQDB 3U6RB 1A64A 1GH7A 3WY2A 35C8L 4FKEA 1L6XA 2E6QA 4CKVX 3Q6GL 4HIXH 3GI8H 2DBLH 1JUFB 4YHIB 5DI8B 3MRNB 2DQCL 3QEHA 5L4IA 3HHRB 2N3JA 1KTLA 1FYTD 3VRLE 4QHMA 5F9WC 5T1KB 3BLBA 1NTDA 3DOSB 4U3SB 1F02I 4UQ2B 1AGCA 1X7QA 4Z7WB 2W65B 3I6SA 2NLJB 1MJJA 4URTB 1U93B 2I7OA 3F7LA 3QIWC 5D1QE 1RJZB 1XTMA 1TLMA 1DUZA 3EYSH 4DOHE 2A6JA 4GT7A 1VA9A 3A6BH 4YK4B 3H9YA 1R3KB 4PREB 4KQ4H 1CBJA 4KBPA 4OKVB 3LNEA 3IFNL 4RIRA 1UENA 3UC0H 5ISZD 5IJBC 1KN4L 3E2HC 3QXAB 1A4JA 1TDQA 4HJGB 3O2WH 4XNQB 5KZCB 5C09B 5LHDA 5DHYA 3UYOD 3IS1X 4YNYA 4H8PA 2EINB 4XPGL 3VFSA 3VDAA 2JE8A 2P5ED 1XSIA 4R4ND 5F7MC 5D7KD 3ZKND 1ZIBA 5TE7H 4BQBA 2ZXAA 4Y4HD 5I6MA 1DBML 4BRJA 5DRXB 3QJZA 3CCHA 4M6NH 2EDOA 4Y9CA 1NDGB 5EU5A 1BQUA 4Y1TA 2PO6D 5D7IA 4EPSA 1DSWA 1FVEA 4WQOA 3VFOB 3IE9A 5GIRB 1JZ7A 2ZJSH 5J6HB 2IH8A 3ARSA 4O9HH 5CHNB 2IDTA 4WGVB 1ZLSH 4B9CA 5T1DH 4N2GA 4A63A 2FHCA 43C9A 4LCUA 4L29B 1HILB 4L3CB 1OTSD 2K8MA 2VDRB 4M8QB 4XPFL 5J3HC 2TAAA 4FFZA 3FHQA 2YD4A 3FTZA 4GI6A 4DFHA 1TTAA 4RETB 3RGVA 3TASA 3BEWB 2CIIA 2UZYB 1XH0A 2F15A 4JFUA 5IQLA 3WEXA 1Q72L 1KLFA 1OCCB 3DX9A 4BYHA 1TTCA 1FAIH 4NKDA 5GHWL 4NLAA 1NCDH 2AZUA 4XN2A 3VW3H 3D39A 3IGAA 2WYIA 3IDNA 4QO1B 3O6KL 4QHNA 5TFSL 1J9QA 1DJSA 3AW5A 4QI3A 3ZKMC 3WJMA 2HKFH 4P46D 4LLWB 3VI4A 2LR4A 3DJTA 4N9GB 4NQVB 5ESVB 1YVLA 3A67H 1FVDB 1ZHNB 2NY0D 3FU8A 5IJCC 2FJGA 3COOA 4Z7VE 5GGQH 3CFJA 5FA3A 3BSZL 3PPSA 5E6YA 2HFEB 12E8L 1SXNA 2QV2A 2YSSA 4GW1B 4LXFA 2BVPB 2R69A 2Y2YA 4XNXH 3CZGA 4JZJA 4RNRB 1E8ZA 4CMHC 4Z7NF 3TS8A 3S35L 2J1ZA 3B2PA 4JUTA 4ZUVA 3L54A 5ALBH 1FO0B 4HWEL 4R7XA 4FF9A 1KIPB 4IOSA 4N68A 5I5RA 1QUPA 4GOSA 4GQ9H 2EE9A 2HX7A 4JM2C 4LAQH 1J86A 4Q7DA 2PF6A 1SYSB 4JFSA 1TEGA 1RQ5A 2OP4L 1YC7A 4JRYB 2VR5A 5D6DA 1NGZA 1A02N 3IDGB 4KTDH 1A1OA 2YMXL 1NEZA 2BIPA 5IW1A 3LKNB 4N5ED 1JHLL 5JQ6H 4X7EC 1JMZA 5F21B 1IM9B 1AHWC 1UT1A 2C3VB 2ICES 1AD0B 1UM4H 5IFAH 4KKLD 5EA0H 2UVFA 3KBEA 3JWOC 3RVUD 3APNA 1WEJL 2QHRH 3TOPA 1SXAA 1SBSH 4P3CL 1K3IA 1H15B 2FUTA 3BEVB 3P0YH 5TPWH 1OZUA 1GOHA 1I9JH 5AW6B 3ABKB 6FABH 2J88L 4QHLA 1UOLA 2DD8H 3UP6A 2KBGA 4WUKH 2Q6WB 1OAYL 4BWTA 1BP3B 1L7TH 3QR1A 1I1AA 1WAAF 1M71B 4BBWA 2YUZA 3ZYOA 2W95A 4JJ5A 2HG0A 4NZTL 5EORH 4KHXL 1NA8A 2KQMA 1HH9B 3FH8A 5JXED 3CNKA 3EXLA 3KEHA 1DVQA 3OR6A 3TO4A 4CA4A 3WTTA 1HINL 1HCFX 2N59A 1CICD 4M4RB 1KENL 2NRDA 4XPBL 3T8XA 3TC9A 5I0XA 1COBA 2YEQA 1LE9A 3CDZB 4TTGA 3S34H 2E59A 3QQ4B 4UDTA 1PTZA 4XO8A 4DGUA 2GJ6D 3DPBA 5E1AB 3G04A 2FNWA 4ZFQA 2DJUA 4NWTL 2F19H 1AR2A 3CXDH 4OZIB 4K94H 5AL0A 4KXDA 3WSQH 4ZUUA 2B5IB 3DO7A 4Y4FA 1QSFB 2AJVH 2E7LA 3OXSA 4MD4A 5E8PB 1E9OA 4LPTA 4PCTA 4PJHA 4IKLA 2I26N 1B2YA 1KGJA 1G6RB 1YEHH 3QDME 4AM0Q 4KROB 3UTPE 1ES0A 4H25A 3I02B 2UY7A 4NZUH 2OR8A 3BX7C 1IX2A 3QZWB 4J2QA 5GGSB 1NAMA 4F9PA 1NCCH 2WUBL 4YN3A 5C7ZA 5C0NC 3U30B 2NTFB 1PF3A 2HUEA 2KMWA 1PZ5A 2PW1A 1MFUA 3GMNB 3GB7A 3QDJD 4H5SB 4BKLA 1WPCA 4ZFGH 4E0RA 1QVOB 4C56D 3SSGA 3TZVB 1GGTA 2QQNH 3RUGE 1UQSA 2FT7A 2WLNA 3EGXA 4WHYH 4PUBL 4RCAA 4OCWL 1GHFH 3CX5J 4HIJA 5E4OA 5BVPH 1JI2A 2O6CA 4OZGA 2BY3A 2D0HA 4B27A 3H42L 2BSCA 2J72A 2HMID 1U3HD 4HSCX 1QBML 3GF8A 3RLSA 4ENEC 3L9BA 3BMWA 1JJUA 2YXMA 5LGYA 4LSTH 3ZO9A 3DK2A 1QI5A 2IV8A 4W6YB 4JPVL 4K3DH 4KAQL 2OJEB 4QRPB 2V2WA 4P07A 2C3HA 3RWFB 4JQXA 5IB2A 3WNPA 3GKWL 4EUPH 3JWNE 3Q0HA 4N0YH 3CX2A 4JMNA 3T0DA 2Z8WC 1GPOL 4I9WD 1KYUA 1TZOA 3QVAA 4PI2A 1JD7A 2VDMB 3GSUA 4XB3A 4MZRA 2A74A 4WTQA 5JIDA 5D1ZC 3TV3L 1B0IA 3QQ3B 4BKSC 2DW5A 4GO8A 3TBWA 2X4QA 1ZEAL 2E8YA 2RCSH 1WTGT 3QUML 1TJHH 3K4DA 4BFOA 4PLJC 2Z31D 2VDNH 5F7DB 5HXMA 4LLDA 5A3ID 1IKFL 4MJ5B 4PS7A 3UZVA 3R06A 2A9AA 1GZPA 1CT8A 3IDXH 1VFAA 3F01A 2XWEA 1LEGA 4POZC 4R90H 3VXRB 1T80A 1TQUA 4KK6D 5AOIA 3V0VB 3GM8A 1ZHLB 2HG5A 5L6YL 4NYLB 4GMSH 4LEXL 5J6SA 2J20A 2VXQH 4XH2B 1N59B 1ACCA 3BZ4A 2C7FA 4HXAL 5DZNA 5DJAA 4XCEA 3LV3A 1LDPL 3QQ9C 2ENSA 2B9AA 4PD4K 2DQEH 2P5PA 4ZS6C 5DJZA 3TJEL 1AQ8A 3I3EA 2YAQA 3FL7A 1AVAA 3OHXB 4HKZA 2FLBT 3ARBB 3HE7C 2R8SH 1A9BA 1RZ7L 3FHAA 5LCVA 3ZMRA 3HPJA 2ORBL 3LRKA 2VDKB 1CFVL 1MCBA 4J4PC 1FPTH 4R84A 4E9TA 1DN0B 4PJBB 1N6UA 4LCYA 2EXWC 2WXIA 2WWOA 1XB8A 1O5PA 1E9PA 1SOSA 4FA6A 1Z9SB 1IGFL 2ADFH 2WBKA 3F7QA 2WXOA 5DF0A 4G6KH 4Y5XB 2ICWI 3LDBB 4MSWA 1HAWA 3ZN6A 3RDTB 2FR4B 3ZTDC 2YRLA 4Z7VF 3VRJB 1Q9KA 1LP9F 3MLZL 1QUNA 2WAHA 5E1HB 5F88A 5ADOL 3WTXA 2WO2B 1OT4A 1KGUA 4Y2DA 2V2XB 4D0BB 4HIHA 5KANG 4PTTA 4ZDHA 5E1GA 3ARDB 3RWIB 2D03H 1INEL 5C0CE 1M2VA 3FH7A 3AAZA 4TXVB 5DJCA 2AQSA 3IAPA 4WFEE 3VXMA 1N0XL 5D1XD 2YD1A 4DEPC 5BOZG 5IM7A 1VKXA 4HHWA 3V0HA 1MFVA 2CNYA 2ZCHH 4HK0A 1GC1C 5E6IA 4ZXBD 3OPUA 4OLVL 1WHOA 5BJTA 3JV4B 2X4UB 3WJLA 1NBZA 4TTDC 5C70A 1WCBB 3NA9H 5A40E 2V5MA 1U91B 3G7TA 3GT6A 4MXWL 3FUIA 1A9EA 2H1XA 1FE8H 2FLMA 2VR4A 4IK6A 4KKBC 2APFA 3TCXA 4J8RA 3U4KA 1X5AA 3L2NA 1L9QA 3VH8B 4M5ZH 1A7NL 4RFEB 3TN0D 1G5AA 3CV5A 3VVWA 3WFCL 1V3KA 3ZRCC 4UQ3A 3Q2CA 2YPKA 3S4SB 1S7VB 5CD3B 3K71A 2CO4A 2OX5A 3P0VH 4XI5D 3U1PA 3LZNA 1UWEL 3BKML 4R8WH 3KPTA 1XH1A 3ZLQC 4L8SA 4R4FH 3IT8D 3L7FA 5DURD 3TA3C 3KPPB 2ZKMX 3BFQG 4C59B 4OLYL 1F1DA 1BXAA 4KK5C 4ILDA 1Y6NR 4EI0A 3QWRA 4MX7B 3BP4B 4WU5A 4Y2OB 3KBHE 1NAML 1UEYA 1YSOA 2XN1A 3LHPL 4OGYL 2X6CA 3QEGL 3ZKSD 4Z7OB 3TESA 4Z7UA 3N40P 2AK1H 4JQVC 2PWDA 3IMWA 4QRRA 5KVDH 1U8LB 2BW5A 4TNWK 1JWSB 2XU9A 1PG7L 2IANE 3FRPG 4ERSH 1NBVH 5DFVC 1LXMA 5HHPB 1BQRA 4WJG3 4Q6IC 4JMXA 4YR6A 3QYNA 2DQTH 3ABLB 2BSRA 2ZTBA 3NP4A 4GS7C 1YJDC 2ERJC 3SKJL 4N2EA 5TE4L 1IC1A 3NFSL 4QXWA 3PIQA 1G9ML 5HHXL 4C8XA 5I66A 3KBFA 1XIWB 1BJ1H 4F2MB 3WNMA 1U58A 1JPGB 3ULUL 2MWCA 1PMYA 5BRZB 2FEEL 3EFFB 4WF7A 1DCLA 5EC2B 4HWZB 1J8SA 4JRWA 4NFCA 5D70L 1KPVA 5GZOA 1U92B 3UTQA 3GK8H 3O3AB 5I1EH 5DD0H 2R4SH 1K4DA 1BHGA 2BSTA 1YY8B 1IEAB 4I18C 4BZYA 1FA4A 1VAHA 4TRPL 4UCFA 5F1IA 4HUCA 4K5LA 1ZHKB 3BAWA 2Y9RT 1P6WA 1OLZA 5HYJE 5EU7C 2JKSA 3OGOE 3UBHA 4FNRA 1SEQH 4P2OC 5CZVL 3ARFA 3IDYC 3TU6A 4A2DA 3TEWA 5E9DE 4L2YA 2AEOA 1OTUD 2BOBB 2GFBA 1QFUL 5EWIL 4LARL 5FM4A 4UNIA 2UZIH 3OXRA 3C75A 2EZ0D 3BIKB 2BNRA 3O41B 4DK5A 5LXGL 4AK2A 5B1BB 3EBHA 4AK1A 1V8HA 3MA7B 2CBOA 2ZOWA 4D0DB 4M7JL 2R23A 3MNZA 4PRAA 5E70A 5EOCL 5LNEA 4S1DD 2IDUA 1FNFA 2Q8BL 3IMVA 4OZGE 4U1KA 5GJTH 1E8YA 1QSZA 5DK2B 3VXTB 1JPTL 2JMRA 3QIBD 2QL1A 2EKSA 4I88A 2VZVA 2XFXA 3UYPB 2VLRB 4OIFA 2FATH 1I3RA 2E27L 3EH4B 3AWEA 3N44F 5LO7A 4JPQA 2J8OA 1S7TA 3EFOA 1AIFA 2WK2A 4FI6A 1I8IA 1P2CA 3GSRB 4YSDA 2W07A 4XO4A 4QXUL 1BPVA 2HP4A 4FI8A 2HLFD 2DQHH 3CSYA 3MUHL 1JWUB 4PGEA 3DDFA 5E6SB 4ZD3H 3F6IA 5DU7A 3WOVA 4QRSA 5AG8A 3DIVA 2GQHA 3U0TB 4UIMB 4CBPA 1DLFL 2VLLA 1M7IA 3L4WA 1G7IA 2CHZA 2ZAHA 3MGTA 3QIWA 4NQTA 4UZGA 4EKJA 3P3SA 1UA3A 4N8VB 1FL6A 1O7SA 2JIXD 5K1NA 3F7KA 3CC5A 1IKNC 4WUUD 4YBLC 4NHCH 2JKLA 2WKOA 3AG2B 3KXFA 1D9KD 1NMAL 3LZLA 3SE4C 5FUOL 3INUH 6PCYA 1KEGL 1H8NA 1TYEB 3PL6D 5GZNA 2QPDB 4RWYH 3QAZC 3GHEL 4J3OC 4WHCA 3T1FA 1ZA3A 5FO8A 4NQCA 1EHXA 3VMNA 2IDSA 4B60A 1I8KB 4L1BA 3LOWA 1QA9B 5HY9A 1VGKB 4KQ3L 4F7MB 2VUYA 4MKTA 2BCKA 2ZAIA 3GHBL 3KNBA 1OPOA 1YMMB 1E3FA 5D7IF 4Q74A 4XMUA 4OCSH 3KWWB 3UZQA 5FEBA 2JELL 4XRCA 1OOAA 4TVUA 3P73A 5JIKA 1CGYA 1WF5A 3MV01 3UTZB 3WO3B 1JL8A 5HPMA 4M6AA 1XB6A 4PGJA 4OFPA 4JHBA 4J27A 4ZMVA 1NICA 3GBMH 4Y1AB 3M17A 5J9PB 4NWUL 1JZJA 7FABL 2UZXB 4JO1H 4ODWA 3QDGA 3BQUD 3C6LD 3CUPA 4HX1B 3O4OB 3RZWA 2WGXA 2QGBA 4OR1A 3H9SB 4XCNA 1A6TB 4PVMA 1VHPA 4PP2B 4JZNB 3DGGA 4PJEB 1NKRA 2YGNA 3HN5A 1IIIA 4HBCH 4JS7A 5DD1L 3O6FD 1SLWA 1VACB 2ZXGA 1FGVH 1T22B 3D09A 1INQB 2DIBA 3C6SB 2OULB 3D0VA 2J8UB 4GI8A 1WSST 3X3GH 3ALPA 3SEPA 4W70A 2IJ0C 2YAMA 3GZPA 4Y0GA 5F3HA 2CH8A 4NT6B 2R1XB 4NXKA 4IGBD 2WV3A 4JFXB 5DDHB 1NSNL 2F61A 1J8HD 4XTRC 4P2RB 3R7RA 1RH8A 4HLZG 3WN6A 1OGAA 1AXSA 5KW9L 5IK3A 5MEOB 5JHMA 2C7UB 2A0LC 1KN2H 5JIHA 5JHDA 5IWLA 3W11D 2ZWKA 1F4YL 1T0MA 3QEQE 1IC5H 5JO5B 2LU5A 3KLKA 2NY2B 1DBJH 3VD1A 4ZZKA 4PMEA 5FYJL 2VLKD 1KACB 3IJSA 3A23A 2C3WA 5EU4A 1JPFB 3B9AA 3JWDH 2PR4L 1FFQA 4NM4L 4QLRA 4G9DB 5AWNL 3X2QB 4Q9QH 4JPIB 4S2SB 3EYVB 4A2FA 1ZT1A 4JRXB 2XG5B 5DSCA 4HJ0D 3ORJA 3MV8B 4AC2A 4ONHA 3QNZA 4BSVB 3KHQA 5H2BA 2G0KA 43CAB 1AHWA 3MAWA 4OM0L 5E08H 2AEQL 2QLYA 4ATTA 1B6DA 3G5XB 3L3DB 4WW1A 1FV1A 5KYUA 1MW2A 4OLUL 4Q56A 3BI9X 4UNUA 5JHLA 3HG1D 3Q44A 4DWHA 4JHZA 1SHXA 5C08E 5F1KC 4GXUM 4IRJC 3GSOA 1A8JH 3EKCA 4PJ5E 1CYWA 1G1CA 3S6CA 5IWLC 1XGRB 3ZHFA 3DI2B 1OIOA 3MV7A 3W9EB 2K6WA 2OTUA 4EUPB 1ZT7A 2Y3NA 2F5AH 5B21A 4AJYV 3ZE1B 3HCVB 4MLSA 3WHE0 2IBZX 5FO7B 3KGTA 2F53B 4GBXA 4UTBH 1LO5B 2FZ3B 3A21A 4LLVB 4DT2A 1G0XA 5FUZL 4KGJA 1JPEA 1RHHB 1JK9A 1N12A 4U1GB 4FQJL 2X6VA 1F90H 3GXPA 4N2IA 2A99A 2VDNB 4S1QL 5AVYB 3SKOB 4EDXB 2C1OA 3SYOA 4Q0XH 4P9MH 1SM3L 4Z3HA 2YBRA 5JW4Q 4LPYA 5E51A 4WUUE 3BESR 5FYJE 3ALWA 5AVQB 1N6VA 5CBEB 3SJVB 3MACH 1T21A 4U1HB 3KPNB 3FT2A 3S96B 2GPZA 5ICYB 2EEXA 5IFHH 4AL8C 3JTBA 4LHUA 3VFTB 1HX0A 3VMOA 4PJHF 5E4EC 4R26H 2Z64C 4GINA 1NAKH 2A9DA 4XAKD 3B1TA 3PWJB 3RFRA 3NN8B 3OMIB 4H8WH 1JE6A 2FO4A 3EYUL 5LAPA 1FNEA 1PAMA 1S7SA 2XG4B 4ZTOL 4CMMB 2ATPB 3KDMB 3BP6B 4KX8A 1A22B 3KYOA 3H3PL 3CDGB 4MMZB 3BDYL 3MRCA 2K7PA 4ZFZA 3I3DA 4PJ9B 4GKSB 5DMYA 4F8TA 2V3EA 1PZ3A 4QCIA 1F4AA 2CJUL 3ZJAA 5DHXB 1BZEA 2VC2H 4OZFA 1ZCRA 1QRND 3BWAA 3GM0A 1DCEA 2Q3ZA 2QKIC 3CSBA 2BCMA 6PAZA 3LPGA 3T09A 2ZXWB 3ZYZA 4OZGF 1K9TA 1KF9B 4PV8A 3EZJB 4M62L 1F11B 1ZDQA 2MH4A 3GD1C 3MBWA 3UTTD 4A2MA 2B1OA 4OFYD 5DUBB 3ULUF 3AMKA 2NUPA 2NY6D 2QR0B 2V4LA 3GSXA 1RUPL 1XCQB 3OD3A 5ACMA 3WKQA 3IETA 5SV4A 6CGTA 5I1JL 1OQOA 4P23B 2MCAA 2V3DA 1BQSA 2FUQA 1I7ZB 2V17L 2C1PB 2EXTA 3KGSA 3TBVA 1I1YA 4EN2A 2VN5A 3GMPB 1AXIB 1NLBH 1ITBB 2J43A 2Q76B 2ZXCA 4H8QA 2PCPB 1FSKB 1ADWA 2HFFA 4PRPA 1ZXKA 4L37A 1OP3H 2EVHA 1AGBB 2EADA 3BT0A 4FP8L 4JR9H 2JKXA 3SE3C 2FWSA 2PTVA 4BUHA 3VXPB 3GRGA 2CO1A 3ZMEA 4APQD 1KLUB 2HRLA 5F8RC 3EO1B 3W2DH 4EQ3A 4U1LA 3IEAA 2B4CL 2PNDA 4W9EC 2X4TB 1BM7A 2VN3A 2YC1B 2F7IA 5I73C 4ENZA 4D3CH 1RMFL 3QK0A 3ULSB 2OMVA 3IDIB 5J06A 1Z9MA 1D5BB 3RNQA 1E67A 4OBSA 4AUYA 4Q2ZA 1CLYH 3W37A 4PRID 1AKPA 4HSAC 1NGQL 3GIVB 3Q8BA 4OKDA 2QADD 5EN3A 1DBKH 1HHGB 1BZ9B 2P5WA 2DQIH 4JFYA 2CO7B 2H3XC 4U1IA 1HXKA 3AREB 1HSBA 7PCYA 4FXGC 3Q6FA 3O8XA 3PP4L 2H2PD 4NKMB 3SQRA 5C0GB 2V9QA 1KBBA 5I1GL 3KJ6H 3O3BB 3FQ2A 3GSWA 4CDGC 3D07A 1OGSA 2QMJA 5CJQL 3EJJX 4GQZA 1XCTB 2NYYD 3QUZC 2G2RB 1KT2A 1A7RH 3S97C 3BO8B 3LQAC 4YDLB 4L9LB 4UT9H 1OARH 2YK1H 3KPSE 5JUEH 4N8CL 3D18B 4IEFA 4K7PY 2RD0A 4PJ6A 5SWSB 4ZUSB 4WJKB 5I6LA 2D3LA 3HE7A 3KCPB 5CJOL 3DYOA 4HUMB 4Y4KB 4O4YH 4G9FA 3EFDL 1S7QA 4GXFA 4OCXL 1U8IB 2H32B 2YPLE 3K8MA 1RSYA 3MRLA 4GP5B 1HSAA 35C8H 3RX8A 1H6UA 2BVUA 1IAKA 3Q6GH 5A2FA 3ECBB 4PRBA 2EIDA 4AV0A 1OSYA 3ILPA 3IXAA 1QFHA 2HJLB 2PCFB 2DQCH 3DROB 3EOBA 4IHBA 4KVNL 3T71A 5EIIA 2DKMA 5KYNA 3DETC 3WLBB 2WD0A 2ZUXA 4LAJH 4PGDA 1PIGA 5KN5A 2FGWL 3AS3A 2C4XA 1LE5B 5DQJA 2Y24A 4E68A 3BYYA 3V4PA 4L18A 1A4KA 3I9AA 3RVVC 4FLOA 2GY7B 3AT9A 3CFTA 1M57B 2QVFB 3EH3B 4IYKA 2XWTB 4XAKE 3CHXA 1WA2X 2HT3C 3IJHB 1AD9A 1MDAA 2EDJA 3ARZA 3IFNH 4LMQI 4NPYA 4FNPA 2MHAB 4XWGH 4Q4EA 4FJZA 5MHSE 4UQAA 2GUYA 4GT0A 3F05A 3OVUB 3SGDH 3EG9A 1BX2A 3NQKA 2FEJA 3GSVB 5J6GA 1WUZA 5FM8A 5IBTL 3T77B 3MDJA 4XPGH 1HESA 1P7KB 1I9EA 2V7NA 4LCWA 2DWDB 4ETQA 5H35B 3K2IA 2VQUA 1RJCA 4HH9B 1DBMH 2JKIS 3Q7JA 3MLUL 2HLAA 1UWYA 4UDUA 1XB3A 3TCLA 3OAYK 2N1TE 5FS5A 2Q1EA 5K1VA 4GMTL 2B3RA 5EFIB 3UTTE 5TH2B 5EG6C 4TL4A 1KPRA 3B3BA 4MDRA 2ZWSA 2BFVL 3EGSA 4XPFH 2VZ3A 3UGUA 2EDLA 4MXQC 1DUYB 2NSXA 1PDKA 1UACH 3BFWA 4Z7UF 5CBAB 3X17A 5I6XB 3VFVA 3BKJL 5GS0C 1Q72H 2V9TA 1FL3B 2MCG1 1AGDB 1VDGA 4NCC2 4LEOA 5T1MB 1NCTA 5GHWH 1QFWH 2NNFA 4OD2A 2QSTA 3O6KH 5TFSH 1WH0A 1PW3A 3IB4A 2AJSL 5CGMA 4Q6IA 2A6DA 4FI7A 3UEZA 4BE5A 4LSVL 1QNIA 3FSZA 3BSZH 4IQHA 4CRPA 12E8H 5T5NG 1MAML 5CSGA 3E80A 1IB5A 3APDA 3TBYA 2XOTA 3S35H 1NZRA 4IS6A 4HWEH 3E6HB 4HIQA 1BZDA 1MUJB 4PJ8D 4ANUA 3NGBB 3D9AL 3CPUA 1PEZA 1UXWB 3HW7A 4HIIA 2G3NA 1UM6L 1BLIA 2BP0A 1BIIA 2XKUA 1MRDL 2A77L 2NY3C 4UM8B 1QQDB 2AMGA 2PLTA 2OP4H 4W1TA 4Z3EA 1P9MC 4BWUA 3DGCR 3HZMA 2YMXH 3C60C 2QQKH 4YWGH 1JHLH 4RAVB 1FORL 4L8CB 3BAYA 2DQ6A 1M1XB 5E2TL 5TK2A 4RQQA 4MWFA 4FMFA 1XEDA 3CH1A 4MCYB 1OO2A 3F7VB 3ME0A 4E5XA 5IHLB 4C58B 4YAQA 1IJNA 1WQVT 4PW3A 3ROLA 1QHOA 1WEJH 3NIDE 3MV11 5C0AE 3DXAD 2NY4C 3PS6A 4P3CH 3Q06A 5IVXA 4JFDE 1HL5A 3WFDL 1GJUA 3FUNA 3OR7A 2XX0A 2DWSA 4P2OA 4OV5A 1T4WA 1ZS8B 5FWRA 5IOKA 2J88H 1BVKA 1C5DB 4AQZA 2F74A 2Y7LA 4KRPD 3KHOA 5CFHA 3UJJL 1OAYH 2PR9A 1AI1L 4I2XE 1CGWA 4X4YA 1OT2A 3WMQA 4NZTH 5D6CB 1OSZA 5F7NC 4BCZA 5I18L 3B2XA 4KHXH 3I50L 1MI5D 3HLKA 3PWUA 3BUPA 3MZTA 4PWJA 1HINH 2ESVE 1KENH 4XPBH 4QGTA 5ETUB 3RTQC 2BRRL 3ZQ9A 3D05A 4RGOL 4AC4A 3V8OA 1Y7VA 3AITA 4XZUA 3K5SA 3BPNC 4JRFA 5FGCB 5I2IA 4XVUD 4DO4A 3QJXA 2P9RA 2R2BB 4XOAA 5ERWB 5FFOA 5JPNC 4RVBA 1HIML 4NWTH 1XT5A 2DI8A 4BSWA 4Y5VC 3MV9B 3JWNH 4ANVA 3C9NA 4XXDA 4ZMZA 4X6DE 1JERA 2XZCL 3HKZA 4G8GD 2JK5B 4MYWB 5IW3A 1QRKA 5HDBE 3WL9A 2FECI 5EZJB 2LTQC 2WKOF 1HHKA 1SVBA 2Z4QB 2VAAA 2X38A 2J1KA 2ZSWA 5AALA 2DOCA 3V4PL 1R3JB 3PHAA 2WUBH 1QEXA 1H6EA 3BD4A 5FYKD 2GITB 3DX0A 4RSVA 5G5DA 3SE4A 2NT1A 2Q7YA 3WY1A 1A21A 3EF4A 4HIPA 3FSVA 5KBPA 2F54B 4XCCL 5TK4A 5LG6A 1T6VN 4HFWA 5DC2A 3JV0A 4LB8A 5DVLA 2IIJA 1WBXB 4HKBA 1TJMA 4JQIA 2Y0SA 4ZUTB 4PRHB 2KI6A 1H9DA 4PUBH 4OCWH 1P4LA 1DZ0A 1VFBB 3H42H 1S7RA 4JFEA 5DJ0A 4N1EA 4DH2A 2X7LA 1QBMH 1I8MA 4KZDL 2Y7QB 2BNUB 5BV7H 3DVNB 3L9RA 4DEUA 4LKXB 4HKJA 4BQ9A 4R0LA 2BFGA 4JPVH 4KAQH 3GSNL 1YNTA 4LPCA 2MQ0A 2XACC 3NJHA 3LZOA 5HHNB 2TSAA 3PV6B 3K4ZA 3GKWH 4LRNL 1T83C 1XQ4A 1Q9WA 1R47A 2FHBA 5CP3A 4D9RE 1GPOH 3NSFA 3UPRB 1E4KC 3GEWB 5C07D 1JZ4A 5BQ7A 3SDYL 3TPKA 5FECB 4MA3B 4AIZA 2VQTA 4L3ED 5F89B 3R8BB 2CD0A 4L23A 3TV3H 1KYAA 3SGDI 4FFWD 1KYOK 1XF2A 2Z91A 3HPLB 3UL4A 3QUMH 2PCYA 1VCBC 2MFNA 3D33A 3Q8AA 4TF4A 4U05A 1IKFH 2YARA 2Q3XA 2ADIB 2CHWA 2GUOA 1CF8L 5F3FA 4Z5RB 4JREC 1BVZA 5J1AB 4JFPB 1H5BC 5A7EA 3IJ9A 4XN9A 3DBXA 3G9VA 3ZUCA 1A3ZA 4XR8C 2XTJC 1N5AB 2BHFA 4BGLA 2J2ZB 1ZVSA 2MNUA 4LEXH 1IGTB 5L6YH 4A55A 3ECWA 4FZEL 1F5WA 5B3JE 5DS1A 1MCRA 3R19A 5FKAB 3TO2B 2CBQA 4JG0L 3DXAE 1S8DB 2VC2B 1HEZB 4HXAH 5LQBL 2BY0A 2CGYA 1MHEB 1LDPH 4X6EA 2E75C 2BC4A 3H0TA 3PABA 1RXLA 3HAEA 5C0BA 2ZWNA 1EAOA 2MJWA 3TJEH 3D85B 1SEBB 3UROR 2FNBA 1U8QB 2X70A 5AVTB 5H4ZA 1GTNA 1JZEA 4OZ4A 3HI5L 1RZ7H 5DO8A 1QFWI 2ORBH 5E9NA 1RULL 1CFVH 5DJ2B 1V05A 4YK4C 2CLZB 2X0UA 2RQ8A 4JKNA 2ADYA 2NX5A 3VXSB 3QNFA 3ZZ1A 3B8YA 5T3ZL 2X1QA 1A66A 3O45A 3ZT7A 1S9YB 1ND0A 3KL5A 2EDWA 4PV1C 4XMZA 1O7VA 4IRJA 1CU4L 5BS0B 4XVTL 3PJLA 4PCKA 1MCKA 2K4WA 3CGTA 1EHLL 4PGCA 5BMFL 4Z95L 5EO0A 2O72A 1D7DA 2COQA 3CLWA 5DJ6A 2J12B 5ADOH 2K70A 1T4KA 4LVNB 4RMWA 3RIKA 2BM3A 3I6LE 1DQVA 1TVBB 3U46B 4C55A 5D72L 2XWZA 4V11A 2DI9A 4L1TA 3ILDA 3CJJA 2DI7A 2W60A 5J12B 3S8WA 4OF5A 1N0XH 5D1QB 1W6LA 1EFXD 5HI3D 1P6FA 1Z5LB 3PJNA 3Q2VA 1P53A 1X4XA 3CDFA 4JY6B 4OLVH 4DOHB 1NIEA 1A7OH 4L8DA 1CB4A 1FVCB 2JKNA 4LEEA 2J8HA 3V5HA 4WNSA 1OP5H 4PGZA 4MXWH 1Y6KR 4DVBB 3VDBA 5F3BB 2MQCA 5KS9E 5IHBA 1P4IL 1A7NH 5IEHA 1SJEA 3IJYB 1Z9NA 3WFCH 2Y69B 4WIQA 1I7RB 3HC0B 3SBRA 5TF0A 4ORGB 3SYQA 5DT1L 5IFJB 3WHXB 1EHNA 4ES8A 1UWEH 5DC4B 3BKMH 3F7PC 1OXYA 3NSJA 2UYLA 2EAEA 2L0DA 1TCMA 5T3ZE 5JIQA 3VXUE 3DV4A 3J7HA 3J07A 1E4WL 1E5YA 3FW6A 1U4EA 2WQUA 1TCRA 3QUYD 4OLYH 3ZUNC 3Q3GB 2IALB 2OW6A 2XQBH 3QORA 2OMXB 2NY1B 3MLXL 2X41A 3GGWA 1P1ZB 4LKCB 4NZJA 3BVVA 1MH5A 4MCZB 5E00B 5GSVA 1NAMH 5GSRA 3LHPH 1T89C 1KBGL 3MBED 3QEGH 4OGYH 1BM3L 4PWHA 3HG2A 3ZTNH 2NR6C 1PG7H 3A4FA 4ZMXA 1N5YL 5BZWB 3ARWA 3MXWL 3EADA 1AKJA 1XF5B 4XN1A 5HHMD 2CO6A 4KJQC 4JQIL 4P5MA 4LASL 3VFRB 3LTVA 3SKJH 5TE4H 3NFSH 1T3FB 3FUFA 1G9MH 5ES4B 2EO1A 4AQAA 2XNAA 1Z66A 5EV7A 4FYTA 4X6DF 5G4OA 3SE3A 4EI5D 1EO8L 4TVPE 3B5HA 1M6OB 5E5MB 2QHLA 3BUDA 4U3CA 5HDBF 4KI5D 5D70H 5IB1B 4Z7VB 2GKIA 3RRQA 3ZY7A 1HI6B 4HUWB 1BPLB 5K9KA 2Y07L 1XO8A 4X80L 2PCXA 4ZMYA 4XNUL 5K9OB 3G6DL 1QLFB 5FA4A 1HHJB 2VE6B 5DO2D 2H26A 2I9LB 1S3KL 5BUGA 1S7XB 4TRPH 3P11L 3U7AA 3QHTC 5AW7B 3L3KB 5GS1A 3GTTA 3ZKNC 2H0PA 5H8DA 5ICXA 5IUSA 4U33A 2WXPA 4TLUA 1G1KA 5KSVA 4DGVL 5A6LA 2BWIA 3EH5B 4ZW3A 1M7DA 3GLAA 4FL4C 3CBJB 1HFUA 3WS3B 2IQ9L 1HXYB 1MCOL 4PJ7A 5I26A 5KYYB 3PGDA 1OGPA 5CZVH 3FB8B 1YLBB 3DX8A 1TKWA 1YUHA 2WINA 2NW2B 4P4KC 3DSNA 1QFUH 5EWIH 2F9BT 4LARH 3VSTA 4B9IA 5SWZE 4AW4A 1QSED 1NUFA 1OTSC 4GJTB 4WTZG 2GT9A 1NCWL 4NFDA 4NENB 1YNKH 5DHDA 1GXEA 5LXGH 2NT0A 3QUZA 4K5MA 5F7HA 3SYCA 1JPSL 4A7GA 1UB5B 4FXKA 2B5IC 3QG6A 4M7JH 4DCQA 1XF4B 4JDEB 5EOCH 5IKCB 4H1LA 3CX5K 3MRFA 1IL1B 2Q8BH 1TFHA 2R1WB 4KROC 4KK9C 5JDSA 1G7JB 3APCA 2DQFB 4J3WA 3QJHA 4OTXL 1FLRL 2VABB 2XHNA 1OE2A 1UWXK 4BHUA 2E27H 2AXWA 2XVGA 5AKRA 2JJSC 4M93B 5I19L 4Q9BA 5B7EA 2V7HB 5I1DB 3EOAA 1W91A 2VUOA 4JFHD 5HGBB 5IUCA 1E4XL 1OF0A 5E9AA 5CWSB 1F3DH 3KVQA 3T2PA 1N26A 3NIGE 3TZVC 4B5EA 4M02A 4YSEA 2XJLA 3CFBA 3BZEB 3O6MH 2Y6SD 3PWNB 4LSSL 2R7EB 3MU3A 3GMQB 4YDVB 1DLFH 4MJIA 3CVHB 5J11B 2QFRA 5B3JF 2A5UA 1AG0A 4DP9X 1KYDA 1NMAH 5FUOH 1CGSL 4J1UA 1EEYA 3QDMB 1KEGH 4ZW5A 1JV5A 5C6PB 2X42A 2NZ9D 3GHEH 3VTTA 2CKBB 1SJHA 5D93C 2AKRA 3TEXA 2NMSA 4KQ3H 1CVSC 1U95A 3MRDA 4YSOA 1B4JL 2GCYA 3CXFA 3GHBH 4U6TA 5DUJA 4AY0A 1QFWM 2K78A 4XXWC 5TDPB 3PAZA 3KLHD 2JELH 5IMMB 1INDH 3RGVD 1JZ8A 3ARXA 1SBBA 5C0RL 1BSIA 1W0VA 4YZWA 1FRGL 3K6SA 2NNXA 2PYEA 3GYRA 4PV9A 3V4UL 2J5LB 1AE6L 3RUGB 3D39D 1T04A 3GWJA 1G7QB 3TNMA 3CIAA 1B0RA 2ENPA 4NWUH 3UP1A 3IJ8A 1PX4A 1UXSB 3BVWA 3VWKC 7FABH 5ENWB 5C7XL 5KJ4A 1R5WB 2HRPL 1FFTB 3FO1B 3NCYS 1TYRA 1UATA 2YSTA 3VU2A 5MP6L 4RMSA 5L88L 4QKTA 2NX5E 2Z8SA 4PTUB 3FB6B 3UO1L 1YEFL 1HQ4A 5DD1H 1MEXL 1A6WL 2FRGP 1YQ2A 3ZRFC 2EECA 2BIMA 5D8JL 5EUOE 3LZRA 2MQGA 3L3GA 2X1WL 1GZQA 5CN1A 4M9OA 4WSKA 4DN4L 1RP8A 2DM7A 4K2UL 4V1DA 4G83A 4IOSD 4KKRA 2E7BA 3FQNA 5CN3A 3H85A 3OHXC 5CD5D 4XVSL 1NSNH 1U3ZA 4FXTA 1WGVA 1OCRB 3ARBC 1A2YA 1QKZL 3BSGA 5KW9H 2ALWA 4HWUA 2VW7A 1YUKB 4LCCC 1U8OB 4I3RL 3MLVL 2FYYA 5FF6B 4J23A 1TZHA 1NFDE 5I74C 4FLQA 1EXUB 4NC0B 4XBGA 5FYJH 3FZUD 3RI5F 4ZMOA 1TSRA 5F93C 3RBGA 3MOAL 4PHZA 4DP2X 3BXNA 2BSSA 4HGWB 2PR4H 3AM8C 4NM4H 4OU3A 5D7SL 5AWNH 3V6ZA 2GBTA 3PQYA 4MASA 3RDTC 3V4VA 3W0WA 2A4ZA 4EVNB 5CILL 4YZFE 3BZFB 3NCWA 5IR1B 3HI1A 3D5OF 2BOCA 3K8LA 5DHYB 1T0PB 4WHTB 4R7DA 1S7WB 4YNYB 3FOMA 1HWWA 2AQPA 4NO5B 4OM0H 1I1AD 4YFLF 5IMOB 2AEQH 3O3EB 4RISL 4QRQA 1CFMA 5BV7B 4OLUH 2R39A 5T33L 3NRFA 5HGHB 1X5LA 3K6OA 1LM8V 4G8FA 3TO4D 3Q5OA 1HVXA 3OX8A 4FQXC 3N40F 1FVEB 5D2LA 4NQDE 4AMWA 4F24A 3VD2A 4EIGB 2ITCB 2HRGA 3BIAX 5ESQB 4BK5C 1QWNA 1WWBX 1NC2A 3WE6A 2VM9A 5FCSH 5CGBA 1MG2C 2FEEI 1EAPA 3GJFA 3NESA 3UABA 4EMZA 1VEOA 1C8QA 1VFUA 4GW5A 4KDVA 4OF8A 4N2AA 4RAUA 5JYMA 3ASWA 2W9DL 4FTDA 4N2BA 4Y4FD 2AQTA 5FUZH 4YSCA 1RZKC 3SCMB 3QUMB 2IPKB 4FQJH 2GHWB 4N2FA 3FT3B 5CEZE 4S1QH 3NK4A 3RTQA 1SM3H 4M7LL 4AGMA 5HGDB 3W82A 1MREL 2FE0A 4QHNB 1R3HB 5LGHL 1OAXL 5C0CB 5DRWB 3MNDA 1A3RL 1U36A 4P3DA 3WJMB 3WNOA 4I0PD 4UWQB 4Y5VA 3SKUD 4MNQD 1CXHA 3P9LB 3S5ZA 3T65A 1W0WA 2APVA 3CG8A 4NRZA 5B3SB 1P5UA 3EYUH 2P24A 4GIAA 4G6AC 4W9ZA 4LT7A 3FFCE 3VB9A 4YSTA 3H3PH 3V9FA 1TQBB 3BDYH 4IBQA 2DKUA 4CILA 4JGNA 4M03A 4AUJA 2VITB 1EMTL 4OVUA 4HEPA 4BEIA 1T5WB 3SBQA 5CN2A 2CJUH 2O6EA 1OM9A 2H6PA 1I8AA 2H3KA 4R7LA 3ULUD 1IGIL 1AFVL 1R24A 2QVKA 1A1OB 4BK4A 3QCVL 1XIWC 2CCVA 5IW1B 2IC2A 5AW0B 2O4EA 3FCGA 2W8CA 4M62H 3H2WA 4XCYA 3C5ZB 2AJXL 4HS3A 1TXKA 1RUPH 3IBEA 3UG4A 2XPZA 1R9FA 4ANKA 1R5VB 5I1JH 3ESPA 2HVKA 2LW3A 2V17H 1PJ9A 4WCYL 1YNTF 1ANUA 4QHLB 1CQYA 2IANB 4JHWL 4FP8H 3REWA 3NIGF 4I0CC 4XMKL 3IPFA 1TNMA 3FUJA 4CW1B 4RFNB 1EZVX 1RFDL 4J3SA 1ET8A 4WV1A 1AO7A 2CDFB 2JXMA 4UQEA 3WHE1 4AVJA 1T83A 1TNNA 1YEWA 5KBNC 2B4CH 5D1XC 1E4KA 1P69B 1PGRB 3PXHA 5KYXB 1BF8A 4OLWL 5DQDL 4DP4X 1EEZA 1RMFH 3EYOB 4Y8AA 3CFDA 4X9HA 1OPGL 2J7LA 1NGQH 3MYJB 3DLQR 4AZUA 1YYML 3VFUA 4OGAD 1XF3A 4ZW8A 4QWWC 3TN0C 4X5XB 3C09B 4CU8A 1NC4A 3E9UA 1KV3A 3PP4H 3FCBA 4UQ9A 1ZJBA 4B3EA 1QNZH 3UAAA 1HDMA 3U7WH 2BP8A 2YUXA 2BVTA 1V10A 5I1GH 2DYSB 5EU6A 3D25B 4AKPA 3DTDA 4U4IA 3QQDA 1UT9A 3U6RA 4R96B 1ZPLA 5HYJB 5CJQH 3WV0A 1JUFA 4YHIA 2CU9A 4K71B 4NNYB 3MRNA 5DI8A 4PHXA 4KRMB 1P7QD 2B9BA 2N7AA 1IZKA 3NA4A 4FCAA 4ZRGA 5E9DB 1BQHG 2ZYRA 2WLZA 2Y5QA 3SQOL 1I75A 5T1KA 3DOSA 4U3SA 4UQ2A 4X6FB 3ZOAA 5B22A 2W65A 2NLJA 3FONB 1U93A 2J44A 2QDWA 1YEIL 1C16B 5FDYA 1PCSA 2R83A 1RJZA 3UTSE 3FQUB 5CJOH 3EFDH 5EOTB 4OCXH 5A2AA 1FG2B 3ZX1A 4Y2DD 1R3KA 1AP2B 4RA0C 4ZNEA 1GZHC 4PREA 4OKVA 2WB1A 4KVNH 3THML 1L9RA 3QXAA 3IVKB 3C87A 4FQPA 2RIKA 4HJGA 3QULB 2WVVB 4XNQA 3RKDD 5C09A 2FGWH 2G30A 1MW1A 4CN6A 5E6ID 4ZNCD 1XSJA 2EKJA 3Q13A 1Z0MA 3Q01A 1OKEA 2VDOL 1KTJA 4MNQE 5IBUB 1IM3D 3ARRA 4FAAB 3L1EA 1M1SA 4NC2B 3NCEB 3VFOA 5GIRA 1WA0X 5J6HA 2AK4E 2IH9A 2QZ5A 3G5WA 5CHNA 2LAGB 5GJSL 3VXOB 1XMWA 2F7RA 1KY7A 2HH0L 5F1NB 1ZTXL 1NUNB 4L29A 1HILA 2X4QB 4L3CA 1QZNA 1MFMA 2Z9TA 4M8QA 4NN6B 4QTIL 1KJ3L 5IBTH 5J89A 3O4OC 3PDGA 2WC7A 2Q87A 5GRXG 1JZDC 1MPAL 3B9VA 1SXBA 1JG9A 1BA9A 3BEWA 2UZYA 3GUTB 2JI2A 3MLUH 5A6MA 5BQDA 3M45A 3RJDA 4NPJA 4NZ8A 3P9MB 4PPTA 5FO2A 3GS7A 3QWRD 1Z5YD 4KKCC 3GRWA 4GMTH 2ARWA 2EZ0C 4QO1A 4UI2A 2B14A 4QRRD 2LLLA 4WWKD 4K0OA 4PGBB 3Q05A 3DX4A 2XTLA 5F7LB 5AVRB 2BFVH 4LLWA 5EDSA 4N9GA 5ESVA 4NQVA 5LBVA 5ECJE 3R4DA 3DIDA 1FVDA 1ZHNA 2HFEA 4GW1A 3BKJH 2BVPA 3VFGL 2PTTB 4ELDA 4RNRA 1JGDB 3WEBA 3ZIMA 1T89A 4LDEB 3AWFA 4CC0A 2M2DA 4OZFH 1EVUA 1FO0A 4WEBL 4B53A 1KIPA 5DGRA 2ZG2A 2AF2A 3AXLB 3WIFB 1QHPA 5AD0A 2NR6A 4XBMA 2AJSH 1K8DB 2J1WA 1SYSA 3OZ9L 5GZOD 5A16B 4KY1L 1MNUL 5ITFA 3N1FC 3IDGA 1JFQL 4JFTA 1AQDB 1SDYA 3LKNA 4LSVH 4J39A 3X11A 2AITA 1IM9A 1ZTXE 2XYCA 1MAMH 2C3VA 3B5GA 3WDHA 2IWFA 4Z0XB 1CS6A 2EACA 5JYLA 2JJUA 3GKZA 2G5RA 3Q2WA 1Q9KB 3OWRA 1AD0A 3SDAB 2MCPL 5F88B 2V33A 5FFGA 3WUWB 4BZ1A 5I5IA 3HRZC 1HNYA 1D9KC 5E8DL 3D9AH 3TTYA 1H15A 1UM6H 3BEVA 2GTZB 1MRDH 3PL6C 4KKAD 2A77H 4EN3B 1M2VB 3ARFD 2AEIT 3QEQB 2XKNB 3WMSA 2CBPA 4RGMB 3KBPA 3P4NB 4LU5H 5CGYD 2UVEA 3EHBD 1OZTG 3L4XA 2Q6WA 1FORH 3SE6A 4BELD 1M2OA 4W4OC 1M71A 2Y06L 3RZCB 2WO3B 2BNRD 3QJQB 1ZLWH 2EYTB 1DYZA 3OKNB 3KPOB 3MJWA 3KPRD 4QHKI 1HH9A 5JOPD 3E1ZA 2CNZA 3F5WB 1VERA 3N1QC 1H0DB 3ZYJA 4EOWL 4M4RA 3IKCB 4WDIB 2NNRA 4QYOB 3WFDH 4AQ1B 3BP7B 1U8MB 3TBWB 4AYMC 4UM9B 1B0GB 4G5AA 3CDZA 1MHCB 3HHSB 3QQ4A 3BD3A 3ULVL 4A7GF 5IROC 3CHOA 4JCLA 4PI0A 3BWSA 3UJJH 5E1AA 3ILQC 3QJTB 1AI1H 4G7QB 2FO1A 4HULB 5C08B 5AVVB 1O7DC 4YHZL 2GTWB 1YG9A 4HJIA 3M88A 5I24A 1QSFA 2EDEA 4PJ5B 5FGSA 5I18H 4QXVA 3NEEA 2LHAA 2XBZA 4B97A 3IDMB 5CJ5A 1G6RA 4WU5B 5BO1L 3U2JA 4EDWL 2NQCA 2Y1ZA 4YS4A 1Q1PA 4MMZC 2BRRH 5F6HI 4RGOH 3I02A 5JPMB 3ZKXC 3NFNB 3L95B 4P2YA 3QIWD 3D08A 3QZWA 2ROYA 1E4HA 5GGSA 3M8OL 2CAKA 4KRLB 3DOIA 2NTFA 1HIMH 3KXFD 1D7CA 2ADJB 3GMNA 4H5SA 2NZ1A 1WE5A 2FSEB 5L9DL 2ZXBA 3RWJB 3VACA 4A7TA 5GZND 1AO7E 4WUUB 2XZCH 1QVOA 4OJDH 3TZVA 4ZTEA 5T1LA 4NQCD 4ELMA 3ZE2E 4PSPA 4UF7C 5TDOB 4OF6A 5DTFB 3CN1A 3QFGA 4MD5B 4WI7A 5HI4C 4E36A 2JCCE 1ZAGA 4KPHL 3V4PH 8CGTA 2VRKA 4PVBA 5DVMA 2XXGA 4HEMA 3PHOB 4HJ0C 4FFVC 4XCCH 1K4DB 4J7RA 2G3XA 2MSPA 3OJMB 3KYNB 3Q1EA 2CKNA 5EO1B 3ULVE 4Q6YA 2OJEA 4N1HB 3SDXB 4QRPA 3B4NA 4TVSa 3O0RL 4TUJB 4PWIA 3V6OE 3LPPA 3NJKA 5CEYB 3CVIL 3RWFA 4WRLA 3QDGD 2BSEA 2VUKA 5J3HD 2X4PB 4XXWA 1YPZE 5E8OB 3L9EA 2ZOLB 5DA0B 5FYJU 1MXGA 2D3VA 3C6LB 4KZDH 3RIFK 3QQ3A 4R7NB 1DVFC 2H3NB 3PDDA 2C34A 5JORB 2C9SA 3L1OL 5KG9B 4PWGA 5F7DA 3V0WL 4GRWE 4JAMB 3PLYA 3GSNH 3AREC 1G0YR 1N8OE 1UG9A 5E6UB 1FWXA 3ZKMD 1PSKL 1A47A 3RFZC 3VXRA 4LRNH 1OGAD 2WWMD 4HETA 3V0VA 1ZHLA 3SDYH 4NYLA 5DEFB 4XH2A 1N59A 4IGBB 3VSUA 5JHDD 4XB7A 4PS4L 3NJVA 1PLBA 3KDPB 3L08A 1E5ZA 2IH1B 5C0JB 3BGFB 5C09E 3WJJC 3N43F 5DYOB 3NFPB 4L9LC 3HZKB 3SYPA 4YDMA 4ZO6A 3TIEB 3T04D 4TLSA 2VH5L 1CF8H 4CGTA 4JM2D 1EWHA 2Y36L 2HT2C 3E3QE 3KGUA 3OHXA 2QELA 3FQRB 3UYRH 2VLKB 3O2DA 3ARBA 3VQ1C 5I6OA 3IXTB 1JHKL 4NQSB 1DSYA 3NZHL 3CSYB 1F6LL 1Z7JA 3QXDB 4Y4KC 3KPMA 2YAEA 2WZ5A 1NPJA 4FZEH 3KLQA 4GAAA 5CSZB 3QZNA 1A7BA 4XVJL 4JG0H 4PJBA 5LQBH 1CLOL 2XETA 3AABA 3BAXA 5HYSB 1Z9SA 4NUJB 4Z9KB 4UT7H 3VGHA 3AM8A 3UG5A 4BZ1L 4Y5XA 3P30L 1GY1A 4KTGA 4CUCA 3RDTA 2FR4A 3OKLB 4APXB 4UNVA 3VRJA 5E0QA 3MV7D 1KBVA 2ISDA 2X1OA 4LVOC 1RULH 2Y3AA 4P2QD 2V2XA 4D0BA 2BCKB 2H9GB 5CJBA 3ARDA 3KPSB 2EVIA 5T3ZH 3RWIA 5D2LF 4HD5A 1JXGA 2UX6A 5FDWB 4XNDA 4N90E 3RDJA 3NPSB 2YJLA 3A4EA 1CU4H 4NCDA 4XVTH 1Q1JL 5D7HA 2YPLB 3JV4A 2X4UA 4IOFC 4ZT1A 3BKYL 3NJIA 4Z95H 1YEGL 5BMFH 2X0WA 1WCBA 5CZKA 3IE4A 1XBRA 1U91A 4FGMA 3ASOB 4KVCL 3TF4A 1MDTA 3WS6A 3VH8A 4LHUD 3UGEA 1JXFA 3CD4A 4RFEA 1U8KB 2ZKYA 5F96L 5FB8B 1FIEA 5DK0A 4XMPL 4DKEL 5JMRA 1BMZA 3S4SA 1S7VA 2UUDH 5CD3A 2O30A 3S9DB 4N2OA 2VDQH 3WLWC 1KFGA 4X7FC 1WZLA 5C3IA 2DQMA 1BECA 3D0VB 1I3UA 4ZYKB 3KLAB 3CN2A 1G6RL 3Q43A 1BXUA 3KPPA 2VMEA 2I07B 3VD7A 3WFBL 4TVPH 1AS8A 5EEYA 4IBVA 4KNQA 2MOGA 5I6XC 1L9PA 5FHBL 2B77A 2NY7L 1WAPA 4MX7A 3BP4A 4I1NB 4WFHE 4UZSA 4Y2OA 1P4IH 2FJHB 3IU4L 3MOQA 2FHFA 4IKKA 5CCGE 3QSKB 3QUXB 5DT1H 3WNKA 1U8LA 3CFEB 3S3PA 1JWSA 2GBUA 4MXVF 2IAMB 5FLUA 3BPLB 4R2GB 4X7SH 5HHPA 2ZP9A 4N3TA 1E4WH 2XQYA 1PG7X 4QAMB 1BFSA 5D96B 1FC1A 3T6XA 3UTTB 4A7VA 3LXUX 4ENED 4X6CE 2VXTL 5KAQF 5KEZA 3ABGA 1KBGH 1UWGL 1XIWA 4NO0B 4F2MA 1UM5L 1JPGA 4JX0A 1BM3H 5BRZA 2H8PB 4D2NA 5DS2A 3DX2A 3CBRA 3EFFA 4UQBA 5EC2A 3QR2A 4HWZA 5H37H 3PF2A 4XX1G 3EJCA 2H6OA 1U92A 4KI1A 1N5YH 4N0UE 3RG1C 3O3AA 1TETL 3T9WA 3MXWH 1MCSA 4JRLA 5J5EA 3FT1A 3GTNA 4JQIH 3KWVA 2NOYA 2ZZUT 4LASH 1YY8A 1IEAA 2YGVA 1MCCA 4G6ML 3SZ6A 2WYTA 3WO4C 5I9QC 1YY9C 2VDML 4ECNA 1SYVB 1ZHKA 3EXJA 4OFQA 5HGAB 3LKOB 1Y18B 2C3GA 2B7DT 4PLJD 1EO8H 1CDJA 2P5WD 3NK3A 2DMGA 1U8JB 2W92A 1N4XL 3LD8C 1SPDA 4ZK8A 1GVIA 4G8AC 3O8XD 3UZEC 2BIOA 3BP5A 3IJ7A 4POZD 2Y07H 4WU7B 3K91A 4LDOB 2BOBA 2JCCF 3K1KC 4XNUH 3KH3A 1EXGA 3G6DH 2WSPA 1U2YA 1S3KH 2EYRB 5CP3H 3BIKA 4OW6A 2J6WA 3P11H 2NYZA 3O41A 3S2CA 3UFIA 3ULVF 3MA7A 1CLZL 4D0DA 4ELME 4GIOA 4AJWA 3O6LL 1FBIL 3BLKA 3FU0A 3QQ9D 4MDJB 1SJVA 2IQ9H 4U6XB 4ZS6D 1MCOH 5JQHC 5DK2A 1BMGA 1LNUB 4F3FA 4YO0B 3VXTA 1TR7A 2FLRT 2PKDA 2DTSA 2DM2A 2EO9A 3A4AA 3HE7D 3FF7A 5J13B 2JQAA 3JVGC 4L4TE 1AC6A 4G9FD 2NNAB 5D2NE 1OF2B 1HEHC 3QE5A 4J4PD 1NCWH 1KCSL 1NIFA 3MRCB 1W80A 4DO6A 5JMOC 1VGEL 3NIDB 5C0AB 5KOVC 2VDKL 3GSRA 4QHKJ 1JV2B 3LVEA 1JPSH 4JFDB 4PYHA 4RDBA 4ZQKB 2CRIA 4U2YA 5CEXB 1HL9A 2Y25A 3T8VA 1IE5A 5EF2A 3DHPA 4GP4B 4WAFA 3U0TA 3JWDC 1M7XA 1WDAA 3MROB 1GGBL 4UIMA 3HAEH 4LNVA 4B9PA 4I2XB 4OTXH 1FLRH 3GUFA 4L5FE 4N8VA 3QUGA 4D9QD 3UTOA 3EOYG 1A1NB 4Y7MA 1JOIA 5I19H 4MZ3A 3C2SA 2HVJB 1YEDB 5BRQA 2ESVB 1G9HA 4UB0L 3GRBA 1E4XH 1ONQB 4RGNE 1J18A 4F57L 1G7LA 1I8KA 5F6HJ 4F7MA 1QA9A 5IIEB 1DJZA 5C0EB 4LSSH 3QC6X 3QJSB 5DS8A 3C5XA 4FFTA 1YMMA 4W9JC 4LCWD 4TTDD 2WNKA 3KWWA 3R8QA 2Q2EB 4EI6B 4NP4L 3TXAA 2QFPA 2OI9B 4CVWA 5EU3B 4KKBD 1PZDA 3UTZA 1QYGL 3QHFL 4X6DB 2NDGA 3NCJL 1CGSH 4OZHE 5IMLB 5HDBB 5J9PA 2YQ2A 2QZQA 1MXDA 2R0KL 3OJVC 2UZXA 25C8L 3OKMB 4KMTH 4ADGA 3MMEB 2LAAA 1RZKL 2WZ0A 4HX1A 5EO9B 3H9SA 1B4JH 4GG8B 4PJCE 5TF1L 1A6TA 1RK1B 3KD4A 4PP2A 2ZUWA 4JZNA 1AS6A 3JYBA 1A5FL 3OF6A 2AFNA 3ZKQD 1ED3B 1KBPA 4KK5D 3B8SA 3DA0A 1X5JA 1JGUL 1FRGH 1VACA 4PBDA 1T22A 5EEVA 3C6SA 2J8UA 3V4UH 1AE6H 5JZ7C 1OAQL 1EDYA 3AWGA 4YFLI 3EJTA 3L5JA 4NT6A 3CZKA 2R1XA 4H8WC 4O5LL 1BLNB 1UH4A 4JB9L 4JFXA 2HRPH 5DDHA 5AUMB 5C7XH 2VN7A 2CDGB 3D48R 5DFVD 4F37F 4P2RA 3QRLA 1BYOA 1KIUB 4LE8A 5GGSY 3FQ1A 5MP6H 1DQLL 2XV3A 5F0MB 5L88H 1EVTC 5MEOA 2C7UA 4UYPA 3UO1H 4ABWA 4M7ZC 5JO5A 1PLCA 1MEXH 1A6WH 5KBDA 3EO0B 5HDWA 2J21A 5D8JH 1QBLL 4DN4H 1O75A 1JPFA 1R1CA 3F8UB 4KUZL 1IAKB 4FNLL 1K2DB 4G9DA 4JPIA 4S2SA 3ZPDA 3HBPA 2EE3A 2XG5A 4JRXA 4GKNB 2RMNA 3MV8A 3K5RA 1QKZH 1GS8A 5CU9A 4BSVA 1KG0B 4F7TB 2KPWA 4I3RH 3LXAA 3U6XS 43CAA 4O58L 3MLVH 3MRPB 2EC8A 4G7VL 4NDMB 4K55A 4Z18A 3TPUA 3V4PB 4F1ZA 1KIRA 3G5XA 3HMXH 3L3DA 3VWJB 2ZAGA 4AGPA 4I4WB 2HT4C 4NQUA 3MN8A 4B3VA 4X8GA 3K81A 2ZF9A 3CLEL 4LBAA 3G5VB 2VCOA 3RVTC 5D7SH 4P2OD 2EIJB 5F9OL 4M6ML 2KLRA 1LMIA 1XGRA 4XP6L 3GPSA 5CILH 3W9EA 5FPIA 1ZLSL 2YEVB 4EUPA 4C83B 2IBZY 3DXAB 2CRYA 3OSKA 1I1RA 4BQ6A 1CUOA 4A1RA 4JVWA 2SEBB 3HCVA 4FABH 4Y16B 3AQYA 3KL3A 4GAFB 1EZUA 4OFKA 4RISH 2F53A 5FO7A 5TE6L 1LO3L 3D50A 1LO5A 2FZ3A 4JY4B 4LLVA 5DCCA 5T33H 2W0KA 4FYSA 4AITA 1RHHA 2HLAB 4BFGA 3NVQA 2J25A 1DBBL 5D1QC 1QSVA 4EO5A 1F4WH 5K9JL 1K5NB 4EDXA 3GC3A 3GSNB 5LDUA 1ID2A 2YLHA 5JQIB 4U1HA 3S96A 3MZGB 4JO4H 1DQJB 5ICYA 3ZHLA 4OV6F 2DQDL 1KPRB 4DFIA 4AEIL 3VFTA 5BRZE 1J5HA 2FH6A 3CVBA 3B43A 3BLPX 2NQ3A 1AR1B 3B7SA 3PWJA 3NN8A 1NGPL 4QXGL 1RZQA 2APTA 2XG4A 4K5OA 4TULL 2ZG3A 2ATPA 4XNYL 4CMMA 3KDMA 3BP6A 4OY9A 4WFGE 2OL3L 2OCFD 2ZSVB 4WWID 3CDGA 5AW4B 2OS7A 2VDLL 4M7LH 4MMZA 5K9QI 4UAOB 3LS5L 4MB3A 1OB1B 4PJ9A 2C9VA 3MNWA 4GKSA 3DO3A 1MREH 1WFNA 4X7DC 2HKHL 2QLVB 2YGQA 4G1MA 5LGHH 3SDDB 3TH3T 1E6JL 4S0TD 1OAXH 4TNVF 3RURA 1A3RH 1RUKL 4WI0B 2NY1C 1FZMB 3IJEB 3O2VL 1CJYA 4WEEA 2L3BA 4ELMF 3WEMA 2V6HA 5B1JA 3SD2A 4ZOEA 5IHUH 3SKNB 2BWQA 2XIBA 4J3OD 2MOVA 2A83B 1F11A 4LNRB 4WI5A 3WCYA 4ANWA 1D2PA 5FHAL 3T4AC 3V8CA 5BNXD 3FUEA 4X4ZA 5DUBA 2QR0A 5BO0D 5KS9B 4KQ0A 1EMTH 4P23A 4N20A 5MEND 2PWFA 4JFED 1I7ZA 1BIIB 2AV1B 1E9QB 2C1PA 5ABAA 4O2CB 2LVEA 3GMPA 2EXYC 4PRNB 1AFVH 2Q76A 2KDYA 2PCPA 3QCVH 3HUJE 3WEAA 5M7QA 1AGBA 1NFIB 4YHOL 4GKZB 3VXUB 1L7TL 2P42B 2WKLA 2NXZC 3HHMA 1KLUA 1ZD6A 3FQWB 4JKMA 2AJXH 1OGTB 3EO1A 1OP9A 4YAQB 2X4TA 2YC1A 3HVNA 4TS6A 3ULSA 2WBJB 5I8OL 5FYKU 3IDIA 1E4XI 4N2KA 2WNWA 4WCYH 2CLVB 4W9HC 2AVFA 1QLEL 2CCWA 1AJ7L 3GIVA 4W9IC 4L0YA 4JHWH 1HHGA 1A6AB 3V5DB 4C4BA 2CK2A 1T1XB 1MSPA 2CO7A 2A9NL 4YC2B 4XMKH 3AREA 3VGAB 1RFDH 2Y7SA 2F1AA 1RIUL 2JQMA 4NJ9L 2VDQB 4NKMA 1CDBA 4ODHH 4XTRD 3M86A 5C0GA 3CZNA 3ARQA 1TO5A 3O3BA 2DLIA 4RLDA 4Y7OC 3PWUB 5HI3C 4UTAL 4OLWH 5DQDH 3UC2A 2OMUB 2A0LD 3MREB 4U49A 1OVZA 4WI6A 4OGXL 1OPGH 1XV8A 4HV8B 5EU7E 3FTVA 1DQKA 1L0PA 2VJ0A 3ARVA 3IFOB 1X6LA 2G2RA 3PWPE 3WJJA 1YYMH 1MAKA 4NO3B 3BO8A 1X3DA 1UJ3B 4TNGA 1QFPA 4F15B 3D18A 2CLRB 2Y2WA 1W9XA 3ZDYE 1SJMA 5DLML 5SWSA 4ZUSA 1GKOA 3KCPA 3KYAA 4G6FB 4Y4KA 3F84A 2OSWA 3FC8A 1U8IA 2H32A 2QQNL 2ZCKH 4Y5YB 2RB8A 3ECBA 2C4FU 2B15A 3V0DA 2HJLA 2PCFA 3DROA 1JYVA 4Q8BA 2Q7NA 1H3PL 5DC9B 2DWYA 3QO1B 3WLBA 2UWEE 3SQOH 3C5JB 3LEYL 4KDTA 5TTRA 4I1PA 1LE5A 4X4XB 3PNWB 4XNZB 1AZUA 4TNFA 1CXIA 2D7TL 4IRJD 5SWZB 1LEKB 2DY2A 2EVFA 3B9KB 2VSMB 1YEIH 3NABL 2K4AA 1TU2B 2KUTA 4KZ0A 1V5JA 5J11C 2APXA 5JOFB 3QJUB 2XWTA 1E3XA 4JDVB 1DVZA 4NIYE 3V7AG 3IJHA 2BIQA 3RY6C 4IOIA 4ALAL 4UU9B 3THMH 2MHAA 3BRDA 4DP1X 1ZV9A 4CU6A 4IIZA 3GXNA 3GSVA 5GGVL 3I9GL 2IPUK 2E76C 1UOKA 2Z1PA 2VXVL 3QDAA 3T77A 4JFFD 3U4AA 1P7KA 1TJHL 2PMZA 4NOFA 4F7CB 4CVZB 2VDNL 2DWDA 2HVBA 3CWGA 5H35A 4HH9A 3BW9B 4HSQA 4P5TB 1NEUA 2VDOH 2XBDA 4KJPC 2DMBA 3OKDB 1A6VL 1OD9A 2X6BA 2WXGA 1E30A 3NIGB 4NBZB 3GQFA 4Y19E 2J5LC 1KXTB 5DO2C 3MJGX 4OJAA 4WO4B 5EFIA 5BQ7B 4AIZB 5GJSH 5TH2A 2BVYA 4M1CC 5C3LD 5TGBA 2HH0H 3EYQD 4NBYB 1LK3L 8FABB 3K8KA 1ZTXH 3LNIA 3VGEA 4QTIH 1XF2B 1KJ3H 3ZDZE 4YL9A 5J8OA 4Z7OF 1MPAH 1DUYA 4E41A 1SY6A 3KGRA 2EDYA 2ZKHL 5CBAA 4JHUA 5I8CB 2ZP8A 4W4NA 2J3SA 3QORD 1FL3A 1AGDA 4F2EA 4JL2A 5T1MA 3QPQC 4O51B 3OGCB 3P0GB 4HP5A 5CNHA 4YVUA 3KR3L 5CXPA 4MYPA 1A6UL 3WE1A 3JWNC 1FPTL 4G1EB 5FV2A 5L8KB 1KWGA 3AG3B 4M56A 1S46A 1AKJD 5AW9B 3QRBA 1ZSDB 2P4AB 4L05A 2OMTB 4GXUN 1DQTA 4JKLA 3VFGH 1G94A 4PJIE 1CFTA 1MRCH 2WO4A 3GMOB 4FN0A 3H4HA 5LBGA 3D52A 2ZQKA 3F12B 3E6HA 4WEBH 1MUJA 4G7RB 3NJNA 1ZPUA 4OF3A 1I85C 1UXWA 1MHHB 2YQBA 1X4ZA 4GUQA 4U6YB 3OZ9H 4UM8A 1XMEB 1QQDA 4XPHL 1ZY9A 4KY1H 1PY9A 3TFBA 5DFTA 4P99A 1DLHB 4BHUI 4E9VA 4LPWA 4RAVA 5EUOB 1TVDA 4L8CA 1UXMA 4OI7A 4LHQB 1M1XA 5IHZB 5F9DC 3FXIC 1YN7B 2Z1KA 2MCPH 4MCYA 3F7VA 2IOIA 5BV7C 5GS2H 4OIIL 1T4KB 2ENYA 1KTDB 2ZKXA 5C6TL 2MNJB 3DV6B 4M5ZL 2IVFC 4YHPB 5DEZA 5E8DH 3BVXA 5DMJB 3RJQB 1F13A 2JB5L 4UINL 3UZEA 4AWJC 1ZS8A 4M8VA 5ANME 3TJPA 4ZI8A 4TPRL 1C5DA 4ODBD 1NFDB 1OTTC 1CGXA 1NWPA 5DHVH 4DGIL 3O9WB 3WXWL 1SLVA 5L8JB 2WXQA 1S78C 3N55A 2Y06H 4JFOB 2N01B 2ZX6A 3FU3A 3FN9A 1V3MA 4WI9A 3QUZD 4LSRH 3MFGB 5D6CA 3DX3A 4K5PA 3BVNB 3SCMC 4PMFA 4EOWH 2VLJE 5ETUA 2R2CA 5FYLD 1L0QA 1EUTA 4AIXA 1CDYA 1FFRA 3BYTA 4K73A 2NUTB 5BZDB 3JVGA 5I76B 3ULVH 3QFJE 5T5FL 2R2BA 3LEXB 2DEWX 5IB4B 1M42A 2B2XL 3IN2A 4GY4A 1WD9A 4YHZH 5DVPA 5AB1A 2MTAA 3MV9A 2VRAA 1V55B 4WTXA 4NQDB 1UB6B 3DETD 4JFFE 4PJAE 1WK0A 2JK5A 2GAZB 3GGWB 1J5OL 1TTBA 4JZJC 4EDWH 3ECQA 5GSVB 3QJFB 5BO1H 3PFUA 2VLMD 4HFUL 5EZJA 1TQBC 5FWQA 3S37X 2HFGL 1F97A 4I5BB 2V5SA 1YDPB 1NPNA 2Z4QA 3RVVD 2BS9A 3CQQA 4MJID 2WJ7A 1HL4A 2J73A 1X9LA 1R3JA 3ARPA 3M8OH 2GJZB 2BIHA 4NUGH 2GITA 1OCZB 2Y4SA 3TT3L 4EZLA 2HT3D 4LOFA 5I1EL 1SN5A 1G0DA 2F54A 1TQTA 2N1KA 4WI2A 1HK6A 2DJSA 1SDDB 5L9DH 1CFNB 1MWAL 1WBXA 4I8DA 4M48L 2EDDA 2VM3A 1PD1A 3AADB 1JXKA 2X4OB 4NOBA 5A2BA 1J9CT 3I2CL 3C5ZC 3FZUC 3NCCB 1QR4A 4PRHA 4ZUTA 1UXLA 2RALA 3MUZ1 3UGXA 4ZMPA 1PKQE 3N1GC 1VFBA 4HPHA 4NEHB 5EF3A 4KPHH 2EDBA 3BH9B 2P1YA 2Y7QA 3CZSA 1RJYB 2FWLB 3DVNA 2CGRL 1WWCA 4LKXA 1R3IL 2PYED 1UD5A 5TDNB 3FFCB 1VEMA 2UWEF 1IGCL 2AQRA 5H4YA 1EJFA 2GC7C 3FN3A 3CXHJ 4RFNC 3MUJA 1PZCA 1SXSA 4DP6X 3O0RH 3OAZH 5HHNA 1RURL 3CVIH 4N2HA 4POUB 3N41B 4Z7QE 4G80A 2WWNA 3DGDA 4KXZH 4HPOL 1OWWA 1GYAA 3UPRA 3OHMB 2J8UF 4MXQD 5FECA 4MA3A 4GEIA 4LVHC 5F89A 4NS0A 1S9VB 5GS0D 1SY6L 4Z77B 4R4BA 4NN7C 4AOFA 2RTTA 3FF8A 3HPLA 3L1OH 1JZFA 1NM4A 3STZA 2FIRT 5EUKB 3V0WH 3SDCB 2W88A 2ADIA 4V1DD 3C09C 2AXJA 4Z5RA 1BFTA 1PSKH 5J1AA 1YAIA 5IW6B 1RL1A 4JFPA 2IWEA 2E7LC 1BW8A 1ECZA 3RVXC 3WTUA 2J55A 1N5AA 3K6IA 4ZD3L 4ONGL 4NZFA 1IGTA 2R0LL 4EZMA 1AGEB 3VXNB 3PJSB 4PS4H 4N0FB 3TO2A 4G59C 4K71C 4KFZC 4FOMA 1S8DA 1HEZA 1CK0L 1NCOA 1MHEA 4KXBA 2ZP0T 5L2JA 3D85A 1SEBA 2Y36H 3AY2A 1AS7A 4H0IA 3WTVA 1U8QA 2CUHA 1T0NB 1XGYL 2NY3D 2WUCL 3PQYD 3W0WD 1JHKH 3NZHH 1USZA 3LXBA 2OM5A 3NMEA 4GAJL 5A2KH 1C9SA 5C0DB 4WHDA 5DJ2A 2CLZA 1M3IA 3VXSA 4QRUB 1N9PA 3JV6B 5LJYH 4GSRA 1HWHB 4XVJH 1JVOA 1U33A 1CLOH 1G9MC 2WLMA 1T7XA 1XXFC 2ZWYA 1S9YA 2PP8A 3U9UB 1RD6A 4WFFD 2NY4D 5BS0A 3QEUB 5MI0B 4E41E 2DWTA 4BZ1H 4X9YA 3P30H 3ZE1F 3ZTCC 3T6QC 3U82B 2CQVA 5HHOD 3S5LB 2R0ZL 3KW7A 1SJHB 3V2AR 2YFNA 2MPVA 4MFHA 1NC2D 4TQEL 3G6AA 1TVBA 3U46A 3TBTB 4JQXC 4AGLA 5B38B 3CQFA 3FN0L 1WGOA 4RMBA 1ICTA 3WKPA 1MCWW 3KLDA 4GRLB 5E4AA 3SPGA 4KNTA 2OMBA 5LDSA 3OJDA 3FRUB 2A74C 3V0FA 2M83A 3LPOA 3UTSB 1Z5LA 5DJYB 1Q1JH 4L9DA 4EIBA 4KK8C 3RTQD 2AQNA 5D7LE 3BKYH 1FVCA 1YEGH 3O4LE 2X05A 1KGCD 4MAUH 3ZXAC 3P02A 1UVQB 4KVCH 4DVBA 1UKTA 1TO4A 5F3BA 2HTLC 4ANXA 1QW9A 4LOVA 5HD8C 1U8NB 1JP5A 2Y7NA 3IJYA 4FG4A 4HKXB 5GGUB 3RIAF 5F96H 4OB5H 1IBDA 4XMPH 4DKEH 1I7RA 3HC0A 1CMOA 5EZPA 4ORGA 2K0RA 1WBZB 5IFJA 1BZQK 4X2UA 3WHXA 4HUNB 1GRWA 2VJXA 3PPEA 4MNQB 4FQ1L 4MQSB 1GAFL 1KELL 1MY5A 3E7JA 1G6RH 4M7KL 1J9SA 4IBYA 1QI3A 3Q3GA 2EABA 2IALA 4N0RA 4HCRA 3WFBH 4FULA 3VDCA 2AK4B 1PYWB 2OMXA 1E5CA 5CKAA 5KSAB 5FHBH 4LKCA 1P1ZA 2IF7A 2NY7H 1WUNT 3FQXB 1OP5K 4MCZA 5E00A 1HJCA 3IU4H 4U6HB 1PY0A 4WK4B 4PJGE 1BYPA 4NQEE 2WXMA 3TA4D 2RBLA 3TTSA 1FH2A 1Q94B 4LL1A 5BZWA 1XF5A 5CR8A 3ES6B 2GI0A 4JE0A 1P84K 2KH2B 4JANB 3T0AA 1RK7A 4BH8B 3WELA 2VL5B 3VFRA 4O00A 3D0AA 1BOGB 4YHYB 1TTFA 4R5XA 5GS2D 3A6OA 5B4MC 1OSPL 2VXTH 2F8IA 4YHNB 1UM5H 1Y1DA 4PJAF 3WXVL 3ZR6A 1M6OA 5E5MA 2CHXA 4R7DB 3MLSL 3LJ3A 5IB1A 3UDWC 4Z7VA 1DJXA 1HI6A 3IBOA 4HUWA 1ZK9A 1TETH 2OKMA 4RGMC 5F9JB 5K9OA 1QLFA 1HHJA 2VE6A 2I9LA 4AE1A 4G6MH 3KL0A 1S7XA 5E6IC 3HI6H 4W9FC 1QAWA 3L3KA 3RZCC 1J8KA 4LESA 3D87B 2VDMH 2ZUYA 3WNIA 2QSQA 5IFHL 2QKSA 3PHQB 1II4E 1LO4H 2X3CA 4M6OL 4HG4K 3OKKB 1HKLL 2TSBA 1SFHA 32C2B 3WS3A 1MCHA 2X89A 4FLRA 1HXYA 1MZZA 5KYYA 4DJMA 1N4XH 4AQ1C 1NC4D 4AM0B 1CG9B 2CM6A 2YMTA 4OCYL 2GG1A 3FB8A 4EZJA 2OR9L 3NRQA 2NW2A 1DVSA 2D73A 4C4UA 2XJKA 2XTJD 4DO5A 4GUOA 2AANA 4NENA 2K6ZA 5IEKB 2Z65C 4L8SC 1WFTA 2O5YH 9CGTA 1UFUA 3QGVA 4JHAL 4WFFE 4AVHA 1CLZH 5EF0A 4F7KA 3I9PA 1J9TA 1XF4A 2IAAC 3O6LH 4JDEA 5A6IA 1FBIH 5IKCA 4YXLL 3GPEA 2O6FA 1IL1A 4KXZI 5T1KD 2KL6A 2BHZA 1G7JA 3TJHD 2ARJB 1P7QB 4BE6A 2IFFL 3FAXA 1PFOA 2DQFA 4JCWA 4XNMA 5JPMC 4FYQA 2VABA 4FG2A 4DF9A 4W68A 3P3TA 4DZBB 4JPSA 1T20B 2X9XA 4HUUA 2QTVA 4AXWB 1VGEH 1QD0A 4MLIA 5I1DA 4PP1C 4H2CA 2VDKH 1DDHB 1RZIB 5HGBA 1TPXC 4IMKA 1ZOXA 1YRKA 2Q5BA 5CWSA 4NERA 4NB7A 4X5RA 5GGRB 4AKOA 5KZCD 1KGCE 2N4IA 5CLWA 1NJ9B 3BZEA 2R7EA 3DSFH 1KWKA 2HKAA 1GGBH 3GMQA 3T8MA 5E1IA 3NTCL 4YDVA 4AEFA 4AEHL 4UOW0 3CVHA 3MRMB 4WK2B 1BXXA 2C26A 2APWA 2P44B 3VD0A 2LLGA 4JJOA 1OL0A 2A6IB 5AW8B 1J0JA 2ZWZA 3RY6A 4X4ME 5ICUA 2XV6B 3QDMA 4YBHA 3B56A 4ELKB 4UB0H 2HVKB 1IM3B 4TSBL 2CKBA 3NCMA 1F2QA 2QVMA 3ZDXE 5E5LA 1IE4A 1CLYL 2P8MB 2AV7B 3II2A 5ECGA 4WJ5B 4XHJC 5TDPA 4FTVD 1PL3A 5DMKB 2UXFA 4NP4H 3HC2A 5BVJB 1PZSA 3F3HA 4KKNA 3TYFB 2OAAA 3OWEA 1AO7B 1QYGH 2X4SB 3ARFC 3QHFH 4MNGE 5DHVB 5F71A 3NCJH 1T6WA 2DM4A 2YAHA 1ILUA 3AB0B 3D2TA 3RUGA 2YUWA 4OLXL 2FECL 2UXVA 1G7QA 1RK0B 5D5ME 3ZE2B 2XXMB 2CO3A 2R0KH 3A22A 2DZEA 1UXSA 4RMVA 25C8H 5E1QA 5ENWA 3VGBA 2JCCB 1R5WA 2E7DA 1RZKH 4AGNA 1JF6A 3FO1A 5TF1H 2Q86B 1HCVA 1A7PL 3NSYA 4JM4L 2GVYA 4URKA 1CCZA 1U8HA 4PTUA 3PY9A 3FB6A 1A5FH 4ZUWB 2YMOA 4XX5A 5T5NF 5IMKB 3ML9A 4ODTL 5AZEL 1EO5A 3CU7A 3STLB 1JGUH 4HCRL 2CM5A 2ZUQC 3VE0B 1OWRM 3LKRB 1OAQH 4UOQA 4HAFA 1YPZB 5DHEA 4MQ7B 2KERA 4K7FB 4O5LH 5L2KE 1XZ0B 2A9BA 5GS3A 2NR6D 4JB9H 3SPCA 1B0WA 3NH7L 3TF7C 4JRYD 3ZTJG 4GFXA 1DQLH 3MCKB 4KJQD 1PQZB 2BH0A 4P5SA 2EIBA 3LH2L 1H3TA 1U8OA 1BVLB 1JTPA 4OT1L 1JNJA 1CFBA 5FF6A 4GRWB 1IM9D 4MTMA 4PSRA 1EXUA 2X40A 3CC1A 2P80D 2VKWA 3F64A 5F97E 1A6ZB 4ADJA 1QBLH 3Q5TA 4AYBA 1I85A 3MR9B 1P6AB 2L7EA 5IBLD 4IRSB 4KUZH 4QOKE 2DLTA 4HGWA 4FNLH 1ASPA 4ETYA 1CWVA 4TKWA 4XWGL 5GZNC 1BZOA 4EVNA 1UD6A 1WAEA 2DIAA 3BZFA 4DPCX 5DZ9A 5IR1A 5ID0A 3FU7B 1EJ8A 4NN5B 3VQMA 3M7FB 4PQXA 4WHTA 4FXLA 1S7WA 2QPUA 3DTXB 4O58H 2IXQB 4NO5A 5IMOA 1ZTMA 4G7VH 5INDB 2P8LB 3O3EA 3S36X 4N25A 3GBEA 5HGHA 4MBRA 3K0YA 3NPSC 1QX1A 2QSCL 1W8OA 3CLEH 4RZCB 2Q3AA 2P47B 5F9OH 4LSPL 4M6MH 4XP6H 1Q4NX 1ZWIB 2ITCA 2GK0B 5ESQA 1WS7A 1IKOP 3UIYA 4P4KD 1KULA 5AZ2L 2XWXA 4PVNA 1VADB 1EHKB 1EFQA 2B4CC 1OAJA 2HAZA 2CJSA 1J1OL 5TE6H 3G6JE 1IT9L 1LO3H 1J5IA 2FIKB 3ZE0E 1UACL 1QSFD 1N64L 3KMDA 3SCMA 3QUMA 2IPKA 4DN3L 1DBBH 3FT3A 1AHMA 5K9JH 4B9FA 3AVEA 1QFWL 4FHJA 2HRHA 2NW3B 4KROD 4KK9D 4O2EB 5CINL 3HR6A 5HGDA 1JVLA 4F33A 2E56A 5AYUL 4QNPF 1R3HA 1FNHA 1F86A 4M61B 4XNBA 3S8FB 2DQDH 5EDXA 1HAUA 1SMDA 1TT6A 5DRWA 5C0CA 4YE4L 2W81C 1TTRA 4F58L 1EZSA 4Z76B 4AEIH 1ACXA 4B9JA 2GBVA 2WWMC 3FQTA 2BJML 2CZNA 3P9LA 3DO4A 4OSUL 1G4MA 3QUXC 1LILA 1NGPH 4QXGH 4TULH 4XNYH 1X5MA 3VG9C 3TZVD 4FTVE 2OL3H 3ABZA 2VDLH 3BPLC 4R2GC 2B0SL 5IF0B 4JPWL 2YD8A 3LS5H 2BDNL 3QCUL 2VITA 4BA8A 2DTML 5IVOA 2HKHH 4PWKA 5GQBA 2EH8L 4GRMB 5IT2L 1T5WA 2COVD 1E6JH 5D96C 5AD0B 3JT0A 4RRPG 4RDQG 1RUKH 3L45A 3T0EE 2WXKA 3CVHL 5ITFB 3O2VH 4X9IA 1LO2L 1XR9B 5F2FA 3QP3A 2QQKL 2WIMA 4JDZB 4YWGL 4AYID 3X11B 2DAVA 5C9JB 3V9CA 5AVSB 2Z35B 2RGSA 5T3XD 4QRPD 4ABVA 5HJDA 5FHAH 3C5ZA 3V6FB 5C8JA 1ZRUA 2D4FA 5CCHE 3D3VE 2CKBL 2BSED 4XGZB 3MRQB 5DRNB 1FGNL 1R5VA 3KM2A 3K0WA