1TZAA

X-ray structure of northeast structural genomics consortium target sor45
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
132
structure length
132
Chain Sequence
ALDNSIRVEVKTEYIEQQSSPEDEKYLFSYTITIINLGEQAAKLETRHWIITDANGKTSEVQGAGVVGETPTIPPNTAYQYTSGTVLDTPFGIMYGTYGMVSESGEHFNAIIKPFRLATPGLLHLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords apaG protein
publication title X-ray structure of Northeast Structural Genomics Consortium target SoR45
rcsb
source organism Shewanella oneidensis
molecule tags Structural genomics, unknown function
total genus 20
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04379 DUF525 ApaG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1470 Mainly Beta Sandwich Immunoglobulin-like ApaG domain 1tzaA00
2F1EA 5HDWA 1TZAA 1XQ4A 1XVSA
chains in the Genus database with same CATH superfamily
2J1KA 3QPQC 4JN1H 4DVBA 4PV8B 1ADQA 5E6RB 1TU2B 3HG4A 4XNQB 3RPBA 2ICEC 5J9PA 4N2CA 3VG0L 3MA7B 3HZMB 2VLJE 2R1WA 2W07B 3ARGD 3BIAX 3IWVA 2WXPA 1QTYT 2WNWA 1QTPA 3MMEB 2GG1A 5D93C 2W0LA 1A4JB 1NEZA 3B1TA 4M3HA 4WI0A 5D7IA 1S7SA 3IFOB 3MI6A 3MR9B 1U8NB 3CVHH 1VGEL 2AQPA 2BNUB 2CKBL 2VLLB 2VRKA 3CNKA 4CVUA 5LG1A 3ZKMC 2Z7WA 4W9JC 1FPTH 2JNZA 3EYUL 4WCYL 5KYYA 3LRHA 5EU4B 1BQHB 3SGEI 5EDSA 5E7BA 1DQJB 1EK3A 1DUZB 1W72H 2V2XA 3CPLB 3LJ3A 5C07A 3MLWL 4TTGA 4NGHL 4FL4B 5AYQA 3SE8H 3CIAA 2K78A 4GAGH 2CM6A 1KPUB 1WC7A 5DJYA 1CDIA 2Y0SA 3HG0A 3IF1B 3UOAB 3UP6A 1E3FA 3NYKA 1NINA 4JDEB 4ODXA 4X6CF 2IH3B 2PP9A 5I1JH 1DQIA 4ZTPH 3EDKA 3UYOD 4QR7A 2J73A 3SJVD 3U1SL 3ULVL 2H6PA 4FYRA 1KIRA 2R4RL 1D5MB 1YEFH 4Y2LA 5HDLA 1B4JH 4FQLH 3N40F 4WK2B 1WT5C 3D30A 2GJ6E 2F7PA 4G71B 3L3OA 4KH2A 3HUJB 1F6FB 2V5MA 2WXGA 5I1DA 1G7IA 3X3GL 3SYPA 4LK4A 1CLYH 1EUTA 3BYTA 2YSSB 4JHVA 3JV5A 3QJHA 2H9GB 4YHLH 1I75A 5DJ0B 1HYSD 2A7BA 3NJXA 1A65A 1ACXA 1FE8L 2JJTA 2R2EA 3WNJA 1DN0A 4O9HH 5KVGE 2EVFA 3H9HA 5IEKB 1YNTB 2SEBB 2BCKA 1J0KA 4FI6A 4PGEA 4PRAB 2WGXA 3FQNA 1UTDA 5EC2A 5HHOB 4ZMNA 4P4RA 4JFQA 6PAZA 5E0QA 2C34A 1TTRA 2JJSA 3IJEA 1JGDA 1KGUA 1OAZL 1QWHA 4OCWH 1KV3A 1U8MB 5C70A 4Y1AA 3N1GC 4NO0D 4NKIL 5C0GA 2J6EH 3OKEB 4BWUA 2EVJA 2GCYA 2CBQA 4QXTB 1FIGH 1TQUA 2O5YL 2OJEA 4JZJA 2Z92A 5B1AB 5HVHB 3IS1X 3UC2A 3VSQA 3VFWA 5DMKB 3QDGB 2GTWA 2X70B 1AS6A 4KY1L 4UQCA 5IB5B 2KQNA 2YBRA 3FC8A 2BC4A 2QPSA 3Q5YA 4IS6A 4P57B 3FB5B 4HJ0C 3Q8CA 2XWJB 1TUPA 4HDIB 4WFHE 5H4YA 5FECB 3CN3A 3HG1E 1W6LA 1RUMH 1MCCA 2GAZA 1XIWC 3HIZA 2BNQA 3EHBD 3US9A 3IDGB 3ZT6A 5BS0A 3FBQA 1C5CH 1RZGB 4MA8L 4NDMA 1XZ0A 1NWPA 5IFHH 5GPRA 3ZT5A 3N1PC 4MXQD 3NFSL 1YAIA 2ZP0T 3V8CA 1NGXA 4OTXH 3QWQB 5AL0A 5D9SB 2R8SL 2NQ3A 3RUGA 2DEXX 4Z7QE 2VIRA 4WWPA 3T8XA 3WUWA 3BPOB 3BT0A 1KJMB 3LHPL 1NCDH 2VXQA 5F1NB 3NH7L 4LSSL 4H2AA 1GZHA 3KBHE 1CXFA 1I1AA 2VR3A 3V5DA 1BPVA 3HLAB 1VZHA 3N85H 3REWA 4F8TA 4G82A 5I1IH 4XC3H 4Y8DC 1A7QH 2UY6A 3GLAA 4OGXL 3CMOH 4PBDA 4J8QA 1QPXA 2D4DA 4R0LB 1FVEB 5D96C 2VDOH 1C08B 5BQ7A 4PBWD 1JNJA 4J4PA 2HWZL 3KYOA 1VSCA 1IL1A 3GI8L 2FUQA 5LHDA 4XRCA 2IFFL 2GJ6D 2PO6A 3P2BA 3Q3GA 2ZCKH 1IZKA 2HKHH 3T3PF 2C4XA 2B20A 4YPGA 3Q5OA 3MZTA 3A0OA 4LL1A 5CLTA 5EDXA 1U36A 3B2MA 1DEDA 5TQ2L 3B6SA 3OBAA 1NBZA 3F7KA 4RBPK 2IANA 1VJSA 4DP2X 3MUZ1 1II4E 1ZA3B 1R3KA 1OE1A 5IHBA 1CDBA 2KYIA 1TEYA 3V5KB 3U6XA 4HZLB 2A9NL 5JIKA 3U83A 4DJMA 5L7XL 4AEHL 2VLKA 4HGWB 3R0MA 1CU4H 2VDRL 1T21B 3RWHB 1KXHA 2DI9A 1GH7A 1PFOA 5HPMA 1N2RB 3IDJB 5E6IB 4P23B 2J8OA 2VN3A 1N0XH 3VXUE 1KT2A 1OAQH 1DO6A 2Y23A 2VMJA 4OAWB 3Q7JA 3GMNA 1I7ZA 4B9JA 1MHCA 5CGTA 3GUTA 4W4NA 1NLBL 2EDLA 3KGUA 1HHJB 2CO6B 3L6FA 3MV8B 3QI9B 4FFZA 2WBJB 2APSA 4PGZA 4R3SA 3QUYB 1A3QA 5DD5L 2DLEA 3ALXA 4X50A 1KIPB 3VE0B 2HT4D 4YXLL 4WFHD 5ESAA 1EANA 1OD7A 2IIJA 3O45B 1HINH 1W15A 1NFDA 3UTSE 1T83C 1INDL 1Q90A 2AJSL 4Y9EA 5K93A 2M8XA 3PS6A 3GUFA 3R4RA 1F56A 3MV9B 4NJ9H 1WFMA 3UTZB 1CFNB 1MCJA 1DANU 5BRZA 3QG6A 4OKDA 3FTGA 1NAMH 3QUXD 1FP5A 1TENA 2O5XL 2JQZA 3MX0A 4I1RA 5JORA 3WIIH 1E27B 5DFVD 1I8IA 2CM5A 4S1DD 1FYTB 3D0AA 1DQML 1KTDA 4ZFOA 3K6IA 4XMUA 2CBTA 2JCCB 2PW2B 3MJ9L 4P46C 1XR8A 1QBBA 3LKOB 4L8SC 1K4CA 3Q8FA 5DMGD 1JOIA 4JPKL 4OQTH 1T4KA 2P24B 1GGYA 1DEEA 2IOIA 1IARB 1NCIA 5AZ2L 5KVFL 1F8TL 2OL3A 4XNMB 2CRMA 1Z5HA 3HE6A 2YUXA 3N40P 1H5BB 4LLDA 2WKOF 4MWFB 1OPGL 4O2EB 3GXTA 3ZOAA 5CN3A 3LS4H 3EXJA 4ATTA 2V8LA 3SGJC 5DD6A 1YG9A 3RVTC 1KTLA 2B4CH 4PBVC 4WU5B 2NCEA 3OMAB 3CHOA 1RZ8A 2COVD 4OF6A 3QJRB 2V7NA 2FVNA 3CFCL 1A7PH 2X10A 2EO9A 1GRWA 4G8GB 2HMIC 4PEEA 1V7NH 1BBDH 4YSTA 2OK0H 4HEMA 1FZKA 3QNFA 4C4BA 3JWNC 4IRSC 2VXUL 5T3XL 2F54E 2UVFA 5FV2A 2RACA 3MZGB 2K4WA 2D8KA 2JJWA 2UYLB 2BIMA 3EYVA 3HMXH 2W9DH 3L1GA 3P4OB 4FNLH 4BM7A 4JE0A 3BKML 3BP5B 4MA7H 1BXAA 1CCZA 5DJ8B 1SY6H 3LKPA 4L2LA 3RTQA 4PJIB 5JZ7C 4DPCX 1KXTB 4HC1L 5CR8A 2W94A 4Y9FA 5I71C 2X4PA 1IRAY 1DVFD 3H42L 4OVUA 3TN0A 4YK4C 4G9FB 3TBTA 1KCSH 4PU2A 3LD8C 3J7HA 3V4LA 5B39G 4EEEA 4OJAA 1WEJH 3E80A 1NEPA 1P7KA 1KFAL 4UBDD 1N70A 1H3PH 3DI3B 2BIQA 1RY7B 3DUHA 3Q1SH 1NKGA 3BE1H 2PWHA 2WQ8A 3SQBA 3MO1A 2ZQKA 4UQIM 1CICD 2DS4A 3GHBL 4MAZA 3UTSD 3D69B 5F8RC 1I7RA 5GS1C 4XNZC 3KXFB 5IQOA 1PCXA 1CPUA 2ZWKA 3CFTA 3UBHA 4DP9X 3MBEC 4FD0A 2ALAA 1ETJA 1T1YA 3EJRA 1VCBC 5BUPA 2JE8A 3P9MB 1A6WL 4FXGA 3ARVA 4YUEL 3UTOA 3FO1B 5JR1L 3O4OB 2WJ5A 3N55A 2I9LB 2YLHA 2AXGA 1GTFA 2C1OA 4DK6A 2VITA 1IIIA 1BVKB 4QOKE 4BZYA 1F86A 2A38A 2EYRB 4MJIB 1LXMA 4C83B 2WINB 3DHUA 4I3GA 1UHVA 1KYAA 4DGVH 3DX9B 4EXKA 4L9LA 4Y5YB 2GBTA 2BCMA 3PNRB 3ET9F 1KLGA 3LMJL 1WFOA 1YQVH 2MIZA 2XVGA 3VWJD 3GXNA 3JZYA 2WV3A 1JYVA 3B2UD 1IM9D 1KBGH 2IDSA 1ZPUA 3QFJA 4X6CE 4E9QA 2X41A 1RIHL 3AU1B 4J3XA 4W9CC 2FT7A 2Z9TA 4C57C 3QJQB 2HJLB 1DSFH 5F89B 2NT1A 3GTNA 2KHAA 4G43A 1YC8A 2WXJA 2B39A 4NQCA 1XL4A 4OF5A 2CLZB 4G7RB 4QAMB 4U1LB 4K7PX 4WHTA 1A0QL 1DN2A 1KENL 2HLEB 3VI4F 4NO5B 2C7UB 1Q72H 3KM1A 4NWTH 2OJ1A 3Q13A 1HAWA 1E4XI 1UB5B 4I0PB 4IDLA 1CFVL 2VLRE 5I1KH 5ENWA 2Y7MA 3VH8G 4XNUL 1ID2A 1O75A 2X6VA 3LV3B 3ARDD 2ATPB 3FNKA 4P06A 3QP3A 2ZPKL 4HPYH 4KV5F 5TF1H 1TCRB 1YEKL 4PY8I 4KI1A 3D1MC 2CO4A 3UAAA 1MLBB 4FQXC 4G7YL 4M3KB 4DQAA 2P44B 1FHGA 2JV6A 1G7JB 1RIUH 2VUYA 4KXZH 2CJUH 4F2FA 1H8SA 3LQAH 4KKAD 2DWEB 1I4FB 2DJSA 3WO4B 3FZUD 1KC5H 3QIUD 5I15H 4K2UH 1XF4B 1UXLA 4NZTH 5GGVL 2D03L 3DC0A 3UPRB 5IJKA 4KMTH 4R4NC 2YAPA 4QJ3B 2C3HA 1IM3A 3QH3A 3ZPDA 2XXCB 3VFOB 1ETB1 2O6CA 4JR9L 3KLHD 2BRQA 4DTGL 3UIYA 3IB4A 1UWXH 1T5WB 4JN2A 5D7LD 3DJ9A 2LOEA 3VXOA 2LLNA 4ADGA 1XF5B 5FR3A 3GPEA 3VDCA 3A5VA 4V1DE 4FCAA 4M4RA 5E99L 3S3SA 2GSIA 1VADB 4KKLC 4R4FH 4WGWB 1A25A 2XU9A 5ETUB 4XVTL 2EKJA 4LSTL 2F58L 1LJMA 4FKEA 3ASNB 4M62L 4EI5D 4UT9A 2JTDA 4DK3A 3D4CA 2NY4B 2AJUH 3LNIA 3FQTA 3P40A 5EUOE 3E2HB 4QOKD 1MIML 5LKNA 2YHGA 1ZV2A 1NMBL 1S5HA 2WNGA 4YR6B 5DEZA 1FO0A 3FOMB 4WWKD 1MCKA 4K9EH 1IAOA 1OSYA 3ARFA 4NYLB 4RMVA 3V0VB 1LDPH 1R5VA 2R0ZL 4GP5B 4L4TE 2ARWA 3F5WB 2K3HA 3VFRA 2K6WA 4PLJC 4JHZA 4P4KA 2YPLD 1VGKA 4OI9A 3BWSA 4K5OA 2B59B 1MCLA 4QHNB 5E08H 1XGPB 1SZNA 1IE5A 4UINL 2BY2A 3NCJL 1HXMA 3ZHKA 4N9GB 4DF9A 3I02A 3F83A 3F7VA 2X6BA 4L3CB 4ZI8A 1AG0A 1A1NB 1QW8A 4XP5L 3FCUB 5DRWA 1QASA 3VWKC 3OM3B 4ZS6D 3QQ4A 2Q6WB 2R83A 1J86A 4QXWA 1Z6JT 5DYOB 5GRXG 4CNIB 4YQXH 4DW2L 3OKOA 5H2BA 1JDAA 1N0LA 2VLRD 4GRLB 2Z8WC 4NQDA 1SXBA 1NAKH 5GS0C 4QHLB 4X5LA 5D1XC 4WW2C 5FUOH 3DPBB 1CK0L 4QRSA 3UTQB 1CE1L 2NW3B 4GQPH 4WU7B 3BVUA 5J1AB 1P5VA 2XNAA 3FUEA 1ZTXE 5E94A 4Q9QH 4DP4X 4XO9A 3FT3A 2LGNA 2PCFB 1J0HA 4LARH 1E2WA 3QNXA 4RZCA 4M6OH 3DYOA 4TSBL 5CAYB 3FH8A 1F18A 2PN5A 2IDTA 4WI7A 3UZQA 1ZKAA 3FN3A 1QNZL 1R3JA 4CBZA 1EV2E 3INUL 3TH4T 5F0MB 4Z7WF 3LIUA 2DV6A 3RFZC 4JHWH 1EJ8A 4U1NA 2AQSA 2XHNA 3BP4B 3IAQA 3O6FD 2WN3A 2ZNXA 5I6XB 2Y3AA 5LCVA 2G75A 3QDAA 4MJ6A 5GJTL 1G7HA 3DRQA 4V1DD 2BSSA 3GBMH 2QADC 3DYPA 4YXKH 1NMCC 4PY7A 4YSPA 3E8UL 3FFCD 3NDYE 4NPYA 5DJXB 3ZMRA 4AIZB 3BWAB 3CD4A 3DTXB 4P2OA 1E5BA 2NXYD 2NY2C 4JDVA 2E3VA 5MEQA 4WJG3 5IESL 3FHEA 3I9AA 3CCHB 1HH6B 4PMEA 1ZMYA 5CGYD 1KY7A 4MZIA 4QHKI 3K2UL 3BPNB 5EHFA 3V8OA 4Z1PA 4JFVA 4GXVL 4JQXC 3BP6B 1AGDA 5EH1A 4I77L 4NM4L 3GK8H 4XZ4A 1P5UB 2CDFA 3CG8A 2FO1A 2NY6C 1HL4A 2IWKA 4FNTA 4JG9A 4L4TD 3EJUA 5D4HA 2BO0A 2D9QB 4JQVC 4CILA 3BUYB 3U9WA 1L0QA 3QQ3B 4BHUI 1E9PB 4MZ2A 4HIHA 4X7CC 3ZLQC 2DQEL 1F45A 1MW0A 3WD5L 3H3PH 1J0YA 4LHQB 1OEZW 4OZGA 4A2LA 3MV7E 1NGQL 4M7JH 1I85A 5HJDA 2P5EB 1JF6A 2OR8A 4RAVB 4PRIA 3N43F 1FV1A 1GOGA 4KUCF 1T0NA 4M7LT 4JPWH 4JCWA 4ANVA 3AXLB 1U91A 3VVVA 3HNTL 3GTVA 4M7KH 5E0FA 1B4RA 5IQ9B 3ERXA 3NPZB 1A5FL 4E0RB 3O3BA 4Y4HD 2FEEL 5ACLA 1S7QB 4XO8A 5CILH 3GIZL 4YDZA 4AK2A 1T66D 6PCYA 4HX1A 1FNHA 2DD8L 4E9XA 2ENSA 1VIWA 2JK5A 4HKXA 4J39A 3LIZL 3AQZA 1HJBC 4HPOH 1XGUA 5EIVA 3WJMB 1OWRM 2EDNA 4EAEA 2EVIA 4KWUA 2XX1A 2LQRA 4Z7NE 4YBHA 4KGJA 3RVWC 4PW4A 1HU8A 1XH3A 4PJBE 3BD4A 3ESVF 2MKWA 1C12A 3H3KA 4XMXA 3IAGC 2H3NB 3AAZB 2ZCHL 3EIFA 4UT6H 4F9PC 3MJ8B 3WEXB 2R2HA 2G4GA 2XCMC 2HRLA 4IMLA 4OGQC 3PWPB 4PIBA 1LD9B 4M8QA 2A1WL 2PYEA 4DFHA 5D1QB 5FB8B 4JJ5A 5I2IA 1A6TA 2Z65C 1T03L 2PYFA 3QPKA 2AEWA 4E9SA 3TASA 3IMVA 3NCMA 3RDTB 4KRLB 5JQHC 4R7VA 2BVEA 1G6RB 3CFBB 3O3DA 3DO7B 1P7HL 4NN6B 1S9VA 1N18A 2TSBA 2XBZA 4ODVL 5BZWB 5C09B 3TZVD 4MJ5A 4OI7A 4C56A 3W5NA 1AO7D 2VR8A 4HWZB 3LS5H 4NQEB 5B7FA 1UD6A 4PJCA 3QO1A 4MX7A 3QPQD 4OY9A 3DUUA 2RIKA 3B9DA 3LEXA 1FNGA 1WF5A 2WLNA 3LVEA 4LLYA 5DFTA 1BJ1J 4ATWA 4LSQH 3BJLA 4NQUA 5I76B 1M7IA 4U6HA 5B3NA 4J2QA 3VMOA 3PIQA 4OB5L 1WRFA 5F7HA 1ZSDA 3ROLB 5FXCH 2G5UA 2IGFL 2NX5A 2X4RB 5ILTL 2KKQA 3WLWC 4CW1B 3MV7D 3GSQB 3QNZB 1N10A 3ZKMD 4Q89A 3MCKA 5GISH 3ZR6A 3JWOH 1Q8MA 1DYZA 3EF7A 2CRZA 3ECUA 3D8MA 5I1HH 1YNKL 4HKZB 4DT2A 4YDKH 1ZCRA 2YK1L 4PRHB 2WVTA 4CSZA 4U0RB 3OC8A 3TM6A 5HVWA 1JZ2A 4AT6B 1MWAB 4JRYE 4J3UA 4OUOA 3U0TB 3GRBA 3K72A 3A6BH 3NK3A 4P59L 4DWHA 3BD3A 4HWEL 3VI4E 5J0BA 2HJKB 2CDGB 4XHQA 2WQUA 4F93B 4WK0B 1EVTC 1EEYA 5DRNA 1HHHB 4GI9A 4JZNB 4PVMA 4YHNA 3ZE0B 5GRZA 2WBXA 4Q52A 2PCXA 4HKJB 3AS3A 2CR6A 5KSUA 3UBXB 1M1XB 2ATKA 4ZG1A 1FDLH 2BMKA 2J25A 2KUTA 3S2CA 3UJIH 4HXAL 4Z3FA 2BOBB 2R9HC 3U6RA 1PDKA 4QIRA 2ADGB 5C0JA 3OXSB 1YEEH 5DO2C 1P1ZB 4ECNA 4R9HA 3I6KA 5B1JA 4YFLI 3LKSB 2EICA 2NY3C 3UMTA 4Y2DD 3D08A 4R8WH 4X8XA 2IADB 1LP9A 1OD9A 5GZNA 3JTSA 3BPLB 2C9UA 4WEBL 1BYNA 4GQ9H 2F8OA 2FT8A 3MFFB 3WDIA 1UATA 1F4WL 4IU3A 1I3RB 4RWHA 4O4YH 4HWBA 2EZ0C 4WFGE 2D7TL 3QQDB 5A16B 5A2AA 3NZHL 3MRBA 5CUSL 4I4WB 2BVPA 4HF5H 4NRZB 3BN3B 5SWSE 1X7QA 2AEIT 2FO4A 4JG5A 5DZJA 5C0AD 2JKTM 2HVKB 1OQOA 4A6YA 4HJ0D 1AY1H 4EIZC 3PQYA 5A6IA 2CGZA 4YC2C 3OJDB 2L04A 1HL5A 3D39D 2JLPA 1XIWD 2GJRA 3AADB 1UM4H 2E27L 3TXAA 2V5TA 3P0YH 2WVUA 4OZHA 3C6LC 3AG3B 5CZKA 2DQIL 2VRAA 5KYNA 2MRYA 5KAQF 1ZDQA 4PTUA 3V10A 1FG2A 3V6OE 4TVPL 3TJEH 3WEBA 1DCEA 3ME0B 5A2JH 4NQXA 2WZ5A 4FQQA 3ULAB 3ILPA 4I9WE 1WBYA 4JLRA 1NKOA 2W5PA 2Y7SA 1P7QD 4BZ2L 2IAMC 2KERA 1Q94A 4JRYD 4PCSA 3B5TA 3IXTA 4BCYA 4DKFH 2EUVA 2UWEA 3RY6C 4AC4A 1KN2L 4AY0A 1MAKA 4XNXL 1ULVA 2C3VB 4FFVC 4HMEA 3X11B 3GMQA 2LVCA 4BZ1A 1UKTA 8FABB 3V4VB 2F5AH 2XG4A 3F2LA 2A6JB 5IQ7L 1KPRA 5FPIA 3PHOB 3PAZA 4KFMA 2HVJA 4G6JH 5EIIB 4YFEA 4ZZKA 2GEQA 4YL9A 3L16A 1MRCH 3K6FA 3NJJA 2NY1C 2EC9T 1SUJA 5E6YA 4KJQC 5E8EA 3DO4A 3J07A 5MERA 3S88L 1JVLA 1P4IH 1YY8B 2AJXL 2EECA 4JO4H 2R4SL 4OM1L 1GYCA 3S96B 3X2QB 1BQHG 1R3LA 3N3EA 2FGWL 4M1DH 2EDTA 3G6JB 3MYJA 4Q6IC 4DP5X 5BQDA 2BP0A 2QVFB 1KCLA 4F58L 5J56B 1SLWA 2BP5M 4AYFA 2GJPA 1EXHA 4DO5A 3WKPA 1ZIBA 1YNTF 5IWLC 1OW0A 5I23A 1WVZA 4P2RE 5GS2D 5IV2A 3MLVL 4DEWA 1BEYH 2Z7YA 5CEYB 2BFVH 1OAYH 2XG5B 5I66A 3BEVB 4JHAL 5AOMA 5EB9A 4HD9A 4GW1A 4N0RA 4HJUA 1ITCA 1T80A 3DROA 2FWLB 5GGQL 1RURL 5DFWH 4D7BA 4WFGD 1ORQB 2EIKB 4LSDA 5DURD 4Y5VA 4DGIH 4QGYA 4XO4A 1A9EB 3MNMA 3NGBC 5B3SB 1J8HE 4HFUL 5ID1B 2ZXBA 4HJ1A 4XB3A 3SKJH 4ZSOA 1FZOA 5I82A 1LEIA 1AE6H 1OKEA 3PNWA 2XWDA 3KNBB 5LXGL 4OVVA 2X05A 2WHVA 4M7LH 4URTB 5F7DA 3I84A 3DMMB 4OFVA 4EIUA 1YMHA 2JKRM 2WQAA 2YA1A 4JY6A 4U1HB 1L7TH 2EC8A 4E5XB 4UILH 4PG9B 5B3JF 1TNMA 3TA3C 4GS7B 3CX2A 2Z1KA 3TF7C 35C8L 4EQ2A 5CEZE 1YYLH 1BFSA 4I9WD 1IBBA 2HFTA 2HX7A 3VB9A 4CC4C 3VX0A 1E5CA 1HHIB 3B9KB 4W9LC 3Q8AA 4Q7DA 3H56A 5JDSB 3NJLA 2AEPH 1A7BA 1USZA 1WSST 5C08A 3KYMB 4DOHB 4X8JA 3QHTC 5CGBA 2Y07H 2DEWX 3ESMA 4L8SB 3VNYA 5D72L 4E9VA 1J1OH 4UAHA 5E9DE 5T1KD 4FTDA 2XN1A 2APXA 3ULSB 2KS0A 2ZUQC 1E40A 1QI3A 1WBXA 5IMMA 1BM3L 4OM0L 5IMKA 4Y5XA 4XBEH 2IOMA 3R8QA 2FSEB 1R0AH 2O5ZH 2UZIL 3VYNA 3TO4A 5IVXA 2ETWA 3IEAA 3RVTD 3R06B 3CTTA 4L4VA 5LGJB 4TNFA 1IC5H 3F12B 3T9WA 5DEGB 3QCVL 4AQ1C 3EJYC 3ZTNL 3AGVA 1I1YB 1BD2A 2HMID 3HPJB 1H19A 4M1CD 5EU7C 5FGBC 4XMLL 3G6DH 5DGQA 3GT6A 1U41A 3GXIA 2ROYA 2BHZA 4P2RD 1TTUA 3ZKXC 1WZLA 2NY5H 3AW5A 3UAJC 3HI6L 4ZBJA 3PUUA 5ELIA 2BP8B 3B7TA 3P3UA 1JN6B 4WENB 5F2FA 1SBBA 5HYSA 5IEHB 4U1GB 4MA3B 2FLRT 3TVMC 1NIFA 4HCIA 1B3IA 3T0EB 1IC4H 1SM3H 4B3EA 3RI5K 1XSJA 4AMWA 3Q2WA 4OV6F 1MW2A 3BAWA 4GKZA 5KVDH 5L4FA 4NRYB 1F0LA 3MLRL 1SEQL 1R3IH 2MSPA 2XTSA 3AY4C 4NRXB 1UJ3A 4WO0A 5T1DL 4C4KO 4CVZB 4LLMB 5JW5B 5C1MB 3I9GH 1U33A 5CZXD 3H53A 1SMDA 3MBED 2OMWA 3KD4A 1KB5B 4NOBA 1G6RH 1INEH 2DLFL 3LQZB 3MOAL 1U58A 3EJSA 3WN6A 1MVUA 5B8CB 1PZUB 3KPRA 4K8RL 1W16A 2YAHA 4OKVA 2EIEA 5FHAL 3GJFB 3SKNA 1BVZA 3BQUC 1JTPA 2VXTH 3OKKB 1BREA 1UH2A 5CEZD 3P02A 5J6GB 2GHZA 1M71B 2PXYB 1XH1A 3BAEH 1M2VB 1M7UA 3DOSB 3P2DA 3LSOB 3HCVA 2Y1AA 2Y72A 4Q56A 3WS3B 3ZE1B 5CMAA 4KVNH 2AK1L 4NCDA 3WV0A 4WV1A 4PB0L 4KUCD 5HYJE 3B2VL 2OP4H 2FYYB 4RWYL 4LSVL 4BD4A 2PP8A 5EFIA 1CC3A 2DKUA 2ZE0A 4LCWE 5CJ5A 4APQB 1L5GA 4Z77B 2G5BB 2VJ0A 25C8H 3ARGA 4BSWB 5I8CA 1ES0A 1WGOA 3EYOB 4UU9A 4P9MH 3QG7L 1RH8A 4KAQL 3TH2T 2OKMA 3IU4L 2YKLL 1S7TB 1M05A 3LN5A 2PCPA 3LKQA 3X3GH 5GSRA 1R1CA 1MWAH 2VW6A 4YH6A 4TUKL 1NOAA 4XN8A 3G5VA 4YVNA 5CR1A 1ZLVH 4ONFH 1MCSA 4NFBA 4JFHD 4OCRH 3BUDA 4XZUA 2EDKA 1EAQA 1GAFL 3QBTB 4J8RA 4JY5L 5L2KA 3RGVB 2DQFA 2P28B 2Q5BA 1MFCL 3BWZA 3ALWA 3MTXA 3II2A 4LOUC 4N2KA 4X9YA 1AD9A 1NCCL 4LHUB 5EA0H 1ZDSA 4JHUA 2X6MA 4A2EA 4N3TA 2FE0A 3QR1A 4GB9A 3SJVA 5F3BA 1UVQB 3AREB 2G4EA 4NFDA 2XVKA 4AENB 4ZFZA 2B14A 5F6HJ 3TYFA 4X7TA 3IFPA 1EHKB 3N9GH 1QHPA 5ANME 4U49A 1CYXA 3GJEA 2A73A 1H8OA 2F19L 2H2SD 4PJIF 5DJAB 4HJGA 4G8EB 5JLZB 3U82B 4PRBB 5HY9B 2OV0A 3AXIA 2Z3FA 5GJSL 4AGQA 4AL8C 1AANA 3CUPB 5IVNA 1WAAE 1EAOA 3SDXA 1E90A 4PJ8A 1RZIA 3CZUB 1N59A 3DDGA 4E41B 5T5NF 4H8UA 2BZ7A 4KKLD 3PWUA 1ESOA 5J1SC 4R6UA 5DJCA 5F70A 2XN9E 1BVLA 1JHLL 5MI0C 2PPCA 3NFSH 5I0YA 1U8LB 1W2KT 5KSAC 3LH9A 2O26U 2HG0A 2XKSA 1WZ1L 2AERT 2OMXA 2GIXA 4NO0A 3TEYA 3CDGB 1ZA6A 4YNYB 3ZIMA 1A14H 1JNNH 3OQ3B 4IJTA 4F9LC 4LP4A 2LV4A 3DXAD 4P3DB 1PEZA 2CRIA 4L05A 3A4AA 4GW4B 1TFHA 2QQKH 4EDWL 1F42A 1WCBA 2FBJH 3LVTA 2HUHA 2ZKWA 4LPVA 4MD5A 1GC1L 3C8DA 3C5ZC 5HYJD 5FYJL 5I8EA 2XWRA 1AD0A 4N4YB 4OUUB 3W9EA 4XWGL 5T5NG 1D2PA 3RNKB 3DJSA 1MXDA 1D7BA 2DWDB 2YEZB 3L1OL 4AQ8C 2CXGA 3FCTB 4JPIA 2DTMH 3U2SB 3VDBA 3LN4B 4MNGB 1NCOA 1OV8A 3V0EA 3IMSA 1NANH 1YAZA 4QEGA 4OFDA 1JFHA 2A83A 3G04B 4TNVF 1TZGL 1AGCB 3HMWL 4QTIH 2H8PA 1KCVL 4H44C 3UYPB 3VWKB 4JFDB 3L3GA 3V4VH 1NC2B 3FS9A 3X17A 2DQGL 4ZOEA 1OLLA 4AZ8B 5AYTA 1ETA1 3HUJE 4ZUSB 3OPZL 3BOVA 3IMWA 3PWNA 4PRDA 1G9NH 4W70A 3U4KA 3HOGA 3VD4A 1OALA 4LSRL 2Y2TA 1RL1A 4WW2B 4ZYKA 1A7RL 5D7JD 1JDCA 2Y25A 1NICA 3HC4L 3IPBA 2DN7A 2UZXB 3N0PB 2PP7A 4LLWB 4YS4A 1JGVH 2X1XR 2Y2WA 4WUUE 1P4BH 1KBPA 4R5TA 2GJ6A 5D1ZI 3PGCB 2Q87A 3R7RA 4S2SA 3AC0A 2ERJB 5I9QB 3HFMH 1S8DA 4EI6B 2ZTBA 3L4WA 3FUMA 4G8FB 4LSPH 4WJ5A 4Y4KC 5DS8A 2P47B 1H15B 2QVKA 3JVGA 5DHDA 2VSDA 2BWQA 1EZSA 5ESQA 1AVAA 1J0JA 2PW1B 1D6VL 3TBVB 4FFYL 3P3SA 4ICXA 4NUPA 1IC0A 4JM2A 4NKDA 3V6ZA 1TVHB 1FFOB 3RVVC 5JXEC 2VJ8A 1MY5A 2XN9D 4TUUA 3QDGE 2QADB 4NBYB 1NMCB 5K33A 5KSBF 4L48A 4HJSA 3BVXA 3NPSC 4U1IA 1TVBA 3G9VA 1UT9A 3M1BB 3RWCB 1X5IA 3CDFA 2WJ7A 2UUDH 2X87A 3CZNA 1ZK9A 4KGLA 4ONOA 5D1ZB 5E1HB 5HTSA 4YVUA 3QE5A 3VXRB 2VDQB 2RJMA 1X5MA 4OCYL 3FTWA 5H8DA 1JZJA 2DQCH 2XN0A 4YHZH 1QBLH 4OQ1A 5D70H 4XB7A 1MLCB 1BMWA 4EUPA 2BWDA 2IXQA 4G8IB 3F58H 4QNPF 2DEYX 3X1NA 3ULVC 1K8DB 2NY6B 4G83A 4N2LA 3RX9A 2DQUH 5C3TA 2YXVA 3VX1A 2OI9C 3WO3B 5KJ7E 5J57B 1OTSC 5AZ2H 3KPQA 5J7CC 4ZXBB 2AAVA 5ACZB 2YPKA 3NRPA 3BSZL 3QDJB 1DQDH 1IEBB 4HKBB 4DO4A 4JUSA 4AGPA 4QY8B 4PS4L 5IOPA 5GGUA 1KCUL 1HKFA 1P6AB 1Y6MR 3FT0A 1MJUL 3MNZA 4S1QL 2HX9A 3OKDA 3QUXA 4BDVA 2E8YA 2CNYA 1OCRB 3MACL 2WSKA 4D0DB 1BX2B 3CFCH 4FNUA 2V7HB 5L88H 4NQVB 2MPAL 1KTRL 4Z7UA 1HZHL 1T1XB 3A6OA 4PAZA 4RDBA 1U8JB 2XPZA 1JTTA 2XFXB 5C0EA 3VQ1C 3FAXA 4I3SH 5I1GL 1BWMA 5K39A 5AUMB 4F1ZA 2XFGB 5E6UB 3IM1A 4OD1H 1H6EA 1SJEB 1EAPA 2BDNH 3QUKB 3D33A 1KNOB 4WUUD 5FF6B 1LO4L 2DI7A 2UY7B 2YD7A 1CIUA 3L5WB 3RWGA 2PABA 3DSNA 2R0KL 1E43A 4LBEB 2IAAC 1YPZB 3RVWD 5CCGE 4WSGA 1KJ2A 1HE8A 3DX6B 3UACA 5DYFA 1SJHA 4PSRA 3TS8A 1ZHNB 2OTPA 2YD5A 2B5IB 3WFHB 1OZUA 2VN7A 3Q5TA 4B0MB 3BUPA 3JWDL 2ZYIA 3GLEA 4MCYA 1AQKH 2K9UA 3T2LA 3O2WH 4PJ5B 2A4EA 3M8OL 2QPDB 1ZGLB 4JMXA 4ODUA 3V6FA 5FIEA 2HTKC 5FK9A 1U8OA 5LGHL 5AB9A 3QA3A 4CMHC 1OF2A 1VFAA 3GPSA 3O3AA 3D2UB 4JFYB 3QJTB 3WKMH 1DVFA 1BYPA 5GHWH 2WP3T 3ZYOA 4DSYA 1W0WA 4KRNA 4HCRA 3DI2B 4XPBL 3SCMC 3QZOA 3MV9E 4LPCA 4DGYL 3ZDXE 4AI7A 4Y89A 1TT6A 5KZCB 5LJYH 1J5CA 4O58L 1KB5H 3KWXA 4EQ3A 1NDTA 1S7XB 3KVQA 4GAYA 3ULUL 3LEYL 4NSKB 1B0GA 4UAOC 1E9QB 3VFPB 1P2CB 2A6IA 2VKXA 1QMUA 3NSYA 3GJFH 1JNLL 1PBYA 2W80C 1P9MC 5IGXH 2X4QB 3BIKA 5LAPA 2XBTA 4JFOA 1FYTE 2LE9A 4PH8A 1U3YA 3FQXA 1IAKA 2XY2A 3WN5C 1ASPA 2JCCE 5D7EA 1JPFA 1CDHA 3EG9B 3RWEB 4EOWL 1IGYA 3RX8A 3J8F7 2BRRH 3O6KH 3RKPA 1A64A 2FT6A 5TE7H 1TJHL 1UWEL 4KKPA 1P53A 3KWWB 1KCRL 4RIRB 1KMGA 1MAML 5K69A 3BVWA 2XWTA 1URIA 5FDYA 5AAWA 4ZUVA 5EU5B 4F15B 4AYBA 3MRDB 4KTGA 1RK0B 3WKYA 2FQFA 2IQAA 3TEWA 4XNUH 4UOW1 1CR9H 3VWJA 4XOCA 3OGCA 4JFZH 3KPPA 2PPEA 4LESA 3WFCH 1IM9A 1LHZA 1L3WA 2ZPKH 5L4MA 1RUQL 3P3TA 3IJHB 4XVJH 3SE4C 4G8GE 2VR9A 4MQ7B 1GHFL 1YHPA 3F00A 4KPHH 3WU1A 1X9QA 3AT8A 1CGSL 2NXZB 1D5ZA 2W92A 2K1MA 3DSFL 4NLHA 1PG7H 2ZXDA 2JB5H 1JV2B 4KX7A 3CSFA 4R96A 5AW3B 4M48L 5AQ0A 1UCBH 4JANB 1JWMB 4I87A 3X13B 2DIJA 4HCFA 4P23D 5DD0L 2MH4A 2MCMA 3GSNB 4EZKA 1JD9A 1JPTH 5DO2D 3NJGA 4JB9H 3TBSA 5KVGL 1LO5B 4Y19A 4XCNA 1SHXA 4G9FE 4WI3A 4X5RA 4DVRL 4D94A 5TH2B 2NY3D 1BBJB 2VR7A 1X4XA 1TJIH 1JUFB 3MRHB 2ICWA 4XE5B 5C92A 2WBJD 4IEFA 3RL2A 1IAMA 3QWNA 4XVTH 3ARDA 3VXQA 5D2NE 1J05B 5DJDA 1DR9A 2NZIA 2FJGB 2EYTB 2F58H 2J1WA 4KDTA 4MDJA 3KJ4B 3P0VH 3QXDA 4Y4FB 1XF2B 3ARWA 5DWUH 1FJ1A 4S0TD 3FB8B 3H9YA 1MIMH 3QIUA 4OD2A 2AEQL 1J5DA 3EJPA 4DN4H 3BGFC 3TBYB 3QDMB 3OD3A 1KIQA 4WFFE 3CZFB 2PTUA 1X4ZA 2R0ZH 3K6SA 3Q1EA 5IT2L 3BO8B 3D0LB 1F6LL 1P4LB 3ZHDA 5ISZD 2XPYA 3T0XA 3C6EA 5D7LA 1CDJA 2WQRA 3MRLA 4HBQA 5ADOL 3M6DA 1OVZA 4JVWA 5JHDB 4FTVA 2Z31C 3VXMD 4OFYD 3FSWA 3KLDA 4JDTL 4MJIE 2L7EA 3O4LD 4XP6H 4YJZL 2FR4B 4N24A 4MSWA 1KEGH 1T7ZA 5FUZL 1DE4A 3BDYL 4EI5A 3OB0H 4I2XB 4NUQA 4AV0A 1AOHA 3T1FB 1G7MB 1EEQA 3QXUA 2X1WL 2WIIA 4BINA 4DIXA 4DQOH 4QOKA 2PCYA 2VC2B 3KWUA 4ETQA 4WWKA 4PLKC 3SO5A 3I2CL 4FFVD 4A7VA 4U05A 2CHZA 1ZT7A 1H3UA 4BKSC 3WY4A 3N2JA 2Q8BL 4KJWC 2V2TA 4JPVL 1I9RH 1UURA 2LFGA 3VXNB 2YPLA 3E1F1 3GDCA 5E8DH 1F6AA 2WLLB 2K6ZA 2I07B 2VO5A 4GUCA 4R7XA 1HSBB 1NWOA 5KOMC 4GIPD 1JPST 4NC0B 3WCYA 3FT2B 1NCBL 2R0LH 4K7FA 2NY1D 2ZX8A 2YAOA 1RULH 2PR4L 1ZT4B 3TNMB 4P3WA 3ZE0F 5JW3H 4FAAB 2XZCH 3DIFB 4X5XB 1DBBH 3LH8A 3NUKA 3R4DA 5CLZA 5EO9B 1XGYH 2R1YB 5DVMA 4FX5A 5JIIA 2VLRA 2OR9H 1DQLH 3EUUA 1JNHA 3U30B 4U3SB 4FQHA 2VZ3A 4HSCX 1N68A 1IGTA 2FLBT 2FRGP 3Q0HA 4LFHD 2HPTA 2OSLB 3FSZA 3VB8A 4M8RA 5DDHA 2FIKA 4UQ9A 1LEGB 1ED3B 4NX0A 3CXHK 1WH0A 2FQDA 4FYQA 3PL6B 5I0XA 3JV6A 1FG9C 3F6IA 2HG5A 2A6DA 4FEMA 2R29A 2IBZY 1K6QL 1Z3GL 2FJSA 2GUOB 4I77H 4NM4H 4N2DA 5B1KA 4QWWC 1T6VN 2ARJA 3U36B 3CBRA 4FF9A 3QZLA 4WFFD 1IQDB 3NGBB 3OZ9H 2IWFA 2Z35A 4YHKL 3CFEA 5LGYA 3UBXG 3WFBL 3WNOA 2DBJA 3O6FA 3R0NA 2VR4A 2HJFB 3ZDZF 1OGAE 1RUAL 1IEAA 4V1DA 1YN6A 5EN2A 4QNPE 3RDJA 4JRXA 3FONB 3PXLA 1XHHA 3VSTA 3WD5H 3W37A 3HN8A 3FFCA 4UDUB 1A7NH 2TSAA 3FCSB 2AVGA 3TA3B 4HCGA 2VDQH 5INDB 4F91B 5EEYA 2AXFA 4YFLF 5E5UB 3CFJB 4WTZG 1OPOA 5EUOA 2YN5A 5L4IA 5CJXA 3T71A 4L37B 4JVPA 3NA9H 1XF3B 3K2KA 3BRGC 4NLAA 2B7DT 5CM1A 4W6XB 4YDLB 2A9DA 4L4TA 4TSAL 2I5YH 2N0MA 4ELKA 2QZ5A 4Q2ZA 5C0BB 1AHKA 3H7BB 3IBOA 2G3NA 2GQHA 1N67A 3ASOB 3QCUH 4J5VA 2DD8H 1CT8B 2V3DA 3EAKA 5CP3A 4PR5A 5F3FA 5HI3C 2EDXA 3ML9A 5F9WC 1FFNA 4F7MB 4UM8A 4F7EB 4YHML 2AMUA 4PW3A 1TSHA 2YPVA 1K4DB 3B2DC 3PGFH 3VRIA 3OLGA 1BF8A 1EHNA 3T2PA 2R15A 2IPUK 4F57L 3GSVB 4D3CH 5KS9B 5LQBL 2WVVB 4XXDB 4WEEA 1G7LB 3ELAT 3TEUA 3UBGA 1JWUB 1AP2A 5DD1H 4GBXC 4LCYA 2WW8A 5IIEA 1CDUA 3M17B 1CYWA 1Z5LB 1GY1A 3R18A 1EEUA 3BXNB 4OD3H 3ORJA 3EW3B 3SQOH 3WJLA 3SYCA 1MW1A 4NNYB 1BW8A 3HB3C 3G6JF 3HC0B 3L7EB 3L3HB 4X9FA 4Y4HA 3SKOB 2QELA 3GSWB 1QACA 1XAUA 2VO8A 4BHUA 1JGLL 3MREB 2NYZA 1N6VA 4JJOA 5A3IC 1BQRA 1OK8A 3FTYA 5EU6A 4HGMA 4B5ZA 4LF3A 4BFIA 32C2B 4MB3A 1F97A 4HHAB 4NQQA 3DKHA 5CSGA 3N44B 3QPXH 4U33A 1NSNL 4X98B 5EIIG 1F58H 4HUUA 4GG8A 1IX2A 3QDHA 1JXGA 1NPUA 4NNPH 2DDQH 3ZDYB 5B4MC 4PJDB 4UB0H 4D9LH 2HFEA 4R2GB 2Z4QA 4PJEB 3D6GA 1B2WL 2WYHA 1OGAD 4PGCA 5CFHA 4OLXH 1BGXH 2YRPA 4U1JB 3HE6C 3WIAA 2IDQA 4O5LH 1TZAA 2GSGA 2BHYA 3RGHA 3COOA 4IRJC 5I1AB 4QJ4B 2V33A 3FPXA 1MPAH 4H2CA 3FT9A 5FO9A 2HFFA 3B4NA 4PGBA 3QNYA 2P8MA 4JQIL 2F08A 2COQA 3WGVB 4HGKC 3TZVA 1LYQA 5B7EA 2DMHA 1MHEA 3VMPA 5ICYA 1AO7A 4U4IA 4Z76A 2ZWNA 3CMGA 4C4KT 2OJZH 5HYEA 1QKZL 3HS0B 2PTTB 3G3LA 4ES8A 4P59H 2XKNA 1BZ9B 4NKMA 4NP4H 4AQEB 1BZDA 2ICEA 4FJYA 3ZTEA 4J3TA 4E9RA 3CSYA 2P5EE 3ZTDC 2E4TA 5IG7A 2P43B 3VW3L 2CGRH 1RZKC 3T2QA 3EO1B 3X12B 3V55A 5F1IB 2VDKL 2ZUSA 3QR0A 2CRYA 4ZPVB 3MV7A 4E5XG 3PWJB 4LNRB 2EDJA 1N7MH 5GGRA 2Z7ZA 3SDCC 2VERA 4LLVA 3SDYH 3ESNA 2EIZA 2DYPB 4MXVE 3W56A 2KT6A 4NHCH 5SV3A 3VFVB 4LXFA 5E00B 2DLGA 5D5MA 4Z7VE 1TPXC 4ANKA 3P4LA 5FAAA 2KL6A 1EMTH 4JM0A 4MYWB 5KW9H 3G5ZB 3BWUC 2DQ6A 2X3AA 3LKRA 2RFXB 3M45A 2BY1A 1U8QA 4Y0GA 4KTEH 1JK8B 2XQYG 4MHHI 1A6UH 2X2HA 3IGAA 4GYBA 3VMNA 3OKLB 4I18C 4MMZC 4X4YB 1BFVH 3CC5B 1QFWL 3KS0J 4KQ3L 1WT5A 4AW4A 1U3HC 5KVDE 1OB1B 1NLDH 3GSNH 1MJ8H 3MNWB 4DP7X 4DEPB 1U2YA 4L23A 4UT7H 4K23H 4QRQB 4NQSB 5D1QE 3QRFM 3UTTB 4PJBA 4H26B 2R29L 4IIQC 1YEJH 2ZF8A 3PRZA 4N20A 3UIZA 3WFEL 3V4UH 2HVBA 2V5RA 1KLFA 4WWOA 1QVOB 2FECI 3AS0A 3CQFA 1X9UA 2WYZA 5TE6L 5L8JB 1JAEA 3GYRA 3MRCB 4RGNC 2EH8H 2WCSA 4ZUWB 4MLIA 2E27H 3KPLA 1RMFL 1A4KA 2BNRA 2ZKHH 2AI0H 4NQEE 2R27A 3NSJA 4NO3A 2D2CC 2XTJC 2ICES 2X2YA 2X88A 2JIXB 5EORL 4NZ8A 1ML0A 1MNUL 1XGTA 4HIEA 2QT6A 4XPGH 4HUVB 3KR3H 4FYTA 2EE0A 3NSFA 2VWEE 2ICWJ 2P46B 4GQRA 3SYOA 3GM8A 2B1HL 1JPSH 1XWVA 1IGFH 5T3ZD 4LO9A 3DVNB 1MF2H 1PLGL 2I26N 3NFPB 4AEFA 3IE9A 5C0AA 3FDWA 4LCIL 5IK3B 2FNBA 5K9JH 1YO4A 2FBOJ 2KZKA 4FYSA 2G5RA 2CUMA 1O0VA 4XPTH 1G7QB 3ZE1F 4F37K 3D39A 3GMRB 1XIWA 2E47A 3VG9C 5BNXD 4QUOA 3HKZA 5JMRA 5DJZA 2O1AA 4KQ4L 4BCZA 1B90A 2CDEA 4PRHE 4XNYL 4JKPL 1SDDB 5DD3H 3CSGA 3C2SA 5DRZA 3VTAA 1GVIA 2WXKA 3T09A 1U8KA 2DL9A 2VC2H 2ENYA 2Y24A 5HYFA 1GKOA 3FB6B 3EH4B 1NFKA 1MQKH 3SOBH 1KGJA 4WUKL 1QZ1A 1HOCA 2H3XC 1T7WA 2R4SH 1RQ5A 2P5WB 3FW6A 3QC6X 1MFUA 4UOZA 5F7YC 4YHIB 5KVEH 3MRPA 4XCCH 4HU8A 2FX9H 4JRYA 1FBIH 2OULB 4XPAH 1S9XB 1ERNA 3GSRA 5DC2A 4QAWA 4QYOA 5F97E 3BFOA 5DHYA 3S98A 3VD5A 1A6VL 1NJ9B 2KC0A 2MNWA 2X4TA 1UXSB 3NJMA 3QAZB 1H8NA 2BSBA 2Y5TB 3NTCL 1ZTXL 5B38B 4HD5A 2YBGA 1AGFA 3PDDA 3QEQD 4QRFA 1Q9OB 5DZVA 5FGRA 5D1QD 3VXPA 5JXAL 4Y4KD 2OQJA 5GS3A 4FERA 4MCZA 1ET8A 2OMZA 2F53E 4MKMA 1F11A 1SEBA 4PJAB 4YAQA 1S78C 4RNRA 4F3FA 3IWUA 1TZIB 4A7QA 4X6DE 2LLGA 5AAMA 3W0WB 2TRHA 1YMMB 4PGDA 5I0VA 4G80B 3OHXA 3IGLA 2CE6A 1PY9A 4WNJA 3RVVD 4WO4D 5IHLB 2Y36H 2N59A 1BXXA 3ESOA 4JG1L 4ZX3A 5HI4C 1YY9C 2EEAA 1DQQB 2GJZA 3BUBA 4LHUG 2VZVA 1HCZA 1IGCL 3DJZA 3IETA 4XC1H 4L29A 5C0ND 2IOOA 4BKLA 5DUMH 4K5PA 4BE5A 3BVDB 3FFDB 3US1A 2ED6A 1ZLUK 3S36H 5F9OH 4Q6YA 1A1MA 4FMFA 4HIJB 2P1YA 3PGDB 3ZL4L 1CF1A 1BAGA 2P9RA 3FTXA 1TETL 2K7PA 3KPMB 1JRHL 5E2WH 1ZEAH 4WDIB 1FRGL 2XZAH 5JOEA 3DGDA 1M7XA 5EBGA 3DVIA 3QZPA 2DQDH 2WM0A 5EOCH 3EO0B 4IHOB 5D72H 1DFXA 1U8HA 4GAAA 1T83A 2N3JA 4Y88A 3ILQC 1QFPA 5GZOC 4X8CA 1LLAA 4WW1A 3BESR 4PRHD 3QUMB 2OMVB 5DQ9A 1PG7X 1BIIA 2FQEA 1B0RA 4OM0H 5DK0B 1W0VA 1M3IA 1X5ZA 2RQ8A 2N1TE 1LDSA 2ZKXA 5JPNB 3RX7A 3CHXA 2UZIH 1MJ7H 1ZPLA 2BSTB 4PTTB 1UB6A 2H32A 1ZVSA 3M7OA 4JL2A 4H1LA 3PAUA 4B7LA 1WZMA 2FCBA 4WK4B 4A2MA 4U1SB 2NZ9C 4JO1L 4U6VL 3AGWA 3JQOB 3MJGX 2OMTB 4XMLH 4YGAB 4HETA 3IDNB 3SDAB 1SVBA 3FKUS 2KPNA 5I0ZA 2ZOKB 5AYUL 4JM4L 3GZOA 2GPZA 4P2OC 5T1KA 3OXRB 5DO8A 4G6FD 4HP5A 4U1MA 4A37A 1FGNH 2YQBA 3G6JE 3GMMB 4WW2F 2FJFB 2QDVA 3B7YA 5IHHA 1KBBA 2DQTL 3SE9L 1E9OA 3GXMA 5FA4B 1ZS2A 3F7YA 3L3JB 3QRLA 1NCHA 2VDNL 2WANA 2F53D 3QHFH 4ZFFA 1JMXA 4RGOL 1HILA 3O6ML 2OZ4L 3QEUB 4FP8H 2ZWYA 4K7PL 4JCLA 1JSYA 4KHTH 3V5HA 4XCYA 4AYID 3WY3A 3ZDWA 1G7PA 5KYUA 4G6KH 4IRSA 1RJCA 2XZZA 3MOQA 4ALAL 1ACYH 4ENZA 1TZOA 5TFSH 3RPIA 5ALBH 2K9FB 1HWHB 1RU9L 1TQBB 1LK2A 4OCXL 4ZD3L 4MMXA 5MEPA 1AXSA 2VMEA 2YN3A 3TNNA 2JQMA 2AV7A 2F68X 1R5IB 2KDYA 3MUGA 5HGAA 3HR6A 3HI5L 3MODL 3KHQA 3PWLA 1AI1H 1KJ3L 4BH8A 4X6FB 5AEAA 2G2RA 1RFDL 2P5PA 2Z0UA 3NA4A 3SCMB 1HDMB 4N1EA 3SPGA 5KBMA 4BK4A 4J3WA 4XVUD 4CC1A 4W93A 2R0WL 2GITA 1Q9WB 5CSZB 1GYAA 1B0IA 1F1DA 1TZHA 1FSKC 2EAEA 2HT3C 3GRWH 3GF8A 4MXWH 2BW5A 4QF1B 2BY0A 2N7AA 2WUBL 4P2QB 4GUOA 1DBJL 3MBEA 1F90H 3NT0A 1RSYA 5FO8A 4ZQKA 3A67H 4BFNA 1ZK5A 2DLHA 3HNVH 4RAUA 4PGJA 1TR7A 3D85A 3MRJB 1M42A 2JKIS 2MWCA 4H88H 1MEXH 4LP8A 4DOHE 3GSUA 5LB1A 1JZEA 4RISL 4HK0A 4MJ2A 4TUKH 5HGDB 2MHAB 1YNLL 4DO6A 4HOZA 5I1LB 3BZDA 5JHLH 3LZFL 2OW6A 3STLB 4KZEL 3A47A 3GXDA 1F13A 4POUB 3T2NH 2Q3ZA 1NL0L 1QSEB 4GAJL 2R39A 2D3NA 3WTVA 5G55A 1MFCH 4ZDHB 1FORL 1MHPL 2H2PC 2IDCA 2R2CA 3HAEB 4F5CE 5J13C 4RSVA 5T1LD 3EFFB 1IT9H 1WFUA 2F2HA 2OCJA 4OCSH 4HPHA 2CIIA 4J3OC 1EO5A 2JVUA 4KBPA 4K3HA 3RJDA 5HHVL 1Q0EA 1GZQA 5IB1A 4PJ9C 1GA2A 1LMKA 3SEPA 3BDXA 3O9WB 5JTWA 2FZ3B 3O11A 4XVSH 1QFUH 1YPZF 3P0GB 1UYWL 3VRJB 3CVIH 4LLAA 3VFUA 3G08B 3IJ9A 1O6SA 3CDZB 4WHYH 3MLZL 4HIIA 1HXKA 2OMNA 2Y7LA 4DVBB 4Q4IA 4B41A 4DUXA 4F24A 1Q9KA 4ONGL 4HK3J 5T8IA 4PJ7A 2WOBA 2EUZA 2NY0C 4D0CB 2RR3A 2ZD0A 1Q4NX 3L2LA 1O5PA 3L95A 3MYZA 1S7VA 1NEZB 1W8OA 4LLQB 4WI0B 4ISVA 2KMWA 1S7SB 5D7IB 4FQXA 4IRZL 1WFNA 2EXYC 2C8NA 2V2XB 3EGDA 4XMPH 5CD5D 5C07B 1QATA 3RURA 4PG2C 4XNDA 5EEXA 2APVA 5IHWA 1WC7B 4JN1L 5DJYB 1JK9A 2X0WA 5K9KB 2E8ZA 1OANA 2NNFA 1WICA 1FFPA 3MRKA 1ZLSH 3RZCC 1L9TA 2H6PB 4CMMA 1KIRB 3IMRA 3ZE1E 4Z8FH 1FC1A 3CVHL 4O02A 3L3OB 2QQLH 4ENEC 1EDQA 3PV6A 5JO5A 1FPTL 5K1NA 3PJNA 5D7HA 3WXWL 5I1DB 5I75C 4ELME 1G7IB 1TKWA 1QUNB 1Y0LA 3Q06A 1C16A 3SKNB 5B7MA 3H9ZA 1W72L 1I7UA 3P9WB 3QJHB 3DXAA 1JD7A 2R2EB 3U4EA 1DN0B 3SE8L 4URKA 4GAGL 3H9HB 4FOMA 3BEWA 2BCKB 5JYMA 5IB2A 1N8ZA 3KEHA 3PABB 4LRIC 3SGKC 3UGEA 2B9BA 5B1JC 2OR7A 4PGEB 4ZTPL 2EDOA 3PJSA 4JFQB 4P4RB 5TDNA 4KJWD 4K94C 3GO1H 4HS3A 2F7OA 1QA9A 3LDBB 1JGDB 5HJ3A 5EBLB 2CMRH 1YEFL 4EN2A 1B4JL 2I7OA 4WKXA 4Y1AB 4N0CC 3QXVA 5C0GB 2DH3A 3KYNA 3T5WA 4F27A 2GCYB 5IHUH 1RI8A 1LE5A 2OJEB 4JZJB 2Z92B 3DJTA 3LRSA 3VGEA 2KZWA 4YHLL 1RK1A 2W91A 3CLFH 3SBRA 2MQGA 2GTWB 2NDGA 4O9HL 2J1XA 2YBRB 5AVXB 2BC4B 4N2BA 4IS6B 5CU5A 2CJSA 1UCTA 1WFIA 5I74C 4H40A 3LNGA 2GAZB 4K8RC 2BNQB 1SY6A 4TQIA 1CWVA 1MFMA 4P9HL 4OCWL 4NDMB 1XZ0B 3LRKA 3RQ3A 2WOYA 3IDMB 1N26A 2J6EL 4KZDH 5D7JA 3Q6GH 5KYWA 3RUGB 1FIGL 2VIRB 3T8XB 2V9UA 3WUWB 3MC0A 3TURA 4ZMYA 1F02I 3RIKA 2FL5A 4E41E 1L0YA 4QWWD 5C0CD 1I1AB 3VSUA 1RHHA 3Q43A 4OCYH 3V5DB 3NCEB 2P80D 4RDQF 2YGNA 2Z7UA 3RFZA 4AV5A 1UC6A 4X4ME 3REWB 5C6PB 1WAAA 3CHQA 1RUML 2FQGA 3FMGH 1NFIA 2XQYK 2Z34A 2UY6B 2PXYD 5LLIC 2CLVA 1C5CL 2ESVB 2J43A 5IFHL 3KYKH 3JYCA 2BVQA 1NGWA 1UZ8A 1WIPA 1Z7JA 3AWEA 3KYOB 2XN9A 1IL1B 4OTXL 4LU5H 4XRCB 5ICXA 1XSKA 2PO6B 2WXMA 2Y69B 1L9NA 1ZLWH 3ATEA 4WI6A 5EPMA 4YPGB 1UZ6E 1CL7H 1NCDL 3I9IA 1TU2A 4OGYH 3WS6A 7PCYA 1GPOH 4HBCH 4ABVA 5IM7A 1NBZB 3MA7A 5HDQH 4MQXC 4LEOA 1T22A 3FAWA 2ROXA 4PREA 3WTSA 4YHYB 3MBWA 3FPYA 4QRAA 4MNGE 1OGPA 2AXJA 4ODHH 4RDQG 1R3KB 1NGYA 3RKDC 3RU8H 1I8AA 2DQJH 3N85L 3SKMA 2IBBA 1HZHH 1XEDA 5I1IL 4XC3L 3QUMH 1U8NA 1OW0C 3CMOL 2C9XA 2VLKB 4TV3A 2BX5A 2FLMA 3D4YA 2VDOL 4JQVA 1EXUA 5EU4A 1OT2A 2IPTH 2E6JA 4M1GH 1DQJA 4JFDE 1QRNA 5HPMB 2FYVA 3CPLA 4TL4A 3WIHA 5AVZB 2F74A 1ECZA 1E4WH 2HKHL 4N0YH 2DMBA 1OP4A 3MA9H 1KPUA 5GRVL 4CC0A 1J10A 3BKCH 3PP3H 3C09C 2GY7B 3GMNB 1MHCB 4HALA 4AJWA 3GUTB 1GYUA 1T2QH 5C6TH 3L6FB 2HN7A 1B9ZA 2IMMA 3GIVA 1Z9PA 4R3SB 4MZRA 3OMNB 4OZIB 3ARED 4N2NA 4GBXD 4HLJA 1D5MA 3ASWA 3E7JA 2X5PA 4UTBL 1NFDB 2VT0A 4AVHA 3BPCA 1CU4L 3HUJA 1E42A 3EKCA 2B3IA 2EADA 5G2NA 3NJIA 3B3BA 3HB3D 4ABQA 3BQVA 5FUCC 5HJGA 1N0XL 3VFMA 3A4DA 5BRZB 4WUUA 2SEBA 1OAQL 2A9MH 2WY3B 3QIBB 1ZGLP 1QYGL 2DKMA 3D25A 3FTGB 3BVTA 7TAAA 5FFLA 2O6FA 1HYRC 2QTEA 3L3IB 3MX0B 4E41D 5M95B 2JQAA 5FLVA 1GC1C 4XPBH 3WEAA 4MD4A 4NN7B 2CJ3A 1KTDB 4HUKB 4FMVA 3ATAA 1RZFH 5B4MD 5KN5A 1WO2A 3CZJA 3MAWA 4OU3A 3FXIC 1RPUA 1XR8B 5CCJA 1HINL 1HQRB 1K4CB 4GQZA 4YSAA 3U48A 3HRPA 2G30A 4QXTA 1T4KB 4TVUA 1J7VR 2EDBA 2ZOOA 3ZR5A 2YSTA 4NJ9L 3VXRE 4IRJD 1KXQA 5DMKA 5EO1B 3TWCL 5IB5A 2JXMA 4DK5A 4LLDB 4F8QA 4IKNA 1EGJA 4KOBA 4P57A 4Q97A 1D9KB 4RMTA 4EOWH 1NAML 4Q9BA 5DD6B 1G1OA 1MCPH 1ZHLA 5LBSH 3QXAB 3I3EA 3WIIL 1G0XA 1RZ8B 2KLTA 2JI2A 3T6WA 2V7NB 3UG4A 4N86A 1ZE3C 3EH1A 4H8WH 4NEHB 3QDJE 2C4FT 1L9MA 1F41A 1FZKB 5D9SA 4OQTL 3MLYH 4X6BB 4FTVB 3EYVB 1JZ8A 4LIQH 4TUOA 2GB2A 2I24N 4RFEB 1NGZA 5ESVB 1CDGA 4JFDD 3OTTA 3EOAA 3ZKNC 4MAUH 1AS8A 1KN4H 3LKPB 1NC2D 1WIOA 3RTQB 2FX7H 2Q3AA 3GRGA 4K55A 2X4PB 4CL7A 4FLQA 1GHFH 2N4IA 3LS4L 3LY6A 5LAXA 2CHNA 3TN0B 3TBTB 2B4CL 5ECJE 1TQCC 3CLEH 1HS6A 1MFAH 1OAXH 3QIWC 3RILA 1XAKA 3QJOA 1FVEA 3K1DA 2PWEA 1P7KB 1A7PL 3ABZA 1V7NL 1BBDL 3HAEH 2OK0L 2QSCL 1YEIH 1IKFH 4DGWC 1XBDA 3SQBB 5FKAA 4ERSH 3MO1B 4OJDH 3FO0H 2O72A 1YPZE 1R6VA 3HMXL 1I7RB 4RA0C 2W9DL 3RVUC 4FNLL 1RKRA 2HP4A 5SWQA 3DX7A 4Z7IA 2CO7A 4OIBA 4MA7L 1QI4A 4N8PA 1SY6L 3NABH 4Z0BL 3L81A 3S3BB 2X1PA 5BVPH 3S36X 4FXGB 1AXTH 4KROC 3MUY1 5ANHA 1O6VA 4YDNA 3IYLW 1LWRA 2UVEA 1U3HD 1KCSL 5LDUA 1E5AA 4YGVA 4Z3IA 5G4OA 3U9UB 4B95C 4NENA 2AXGB 1HAUA 4HZLA 1J11A 3HRZC 3S97C 1WEJL 2XXFA 3IK2A 4XOBA 1ADQH 1H3PL 3Q1SL 2MQCA 4QRRD 3TBWA 2AANA 2QLVB 1N2RA 4IU2A 4L9LB 3H9SB 4AEIH 3N44F 4GI8A 1KLGB 4KTYA 4K5MA 3P77A 4UZUA 2VABA 2LU4A 1ILUA 3BHBA 4M6AA 5CJOH 3FYIB 4OAWA 2KDGA 4PJDF 4A7UA 3VXRD 4PJEF 3CX5K 1V7MH 2J1YA 5IFAH 4WWID 3BLKA 4AE1A 2MKLC 2WBJA 2QVIA 3TIEA 5LUMA 5BRPA 4HFWA 3C5XA 1ORSA 4G43B 3P54A 4JDZA 4M8VA 1LNUB 4NQCB 4O00A 1JTOA 4LCVA 4WHTB 4WI9A 2P8LA 2AC0A 3SO3B 4B50A 1XZWA 1X5AA 3UO1H 5I5RA 3LEVL 4DGVL 4KNTA 1F2XK 3O6LH 2EDYA 5MENE 1MFBH 1YQVL 2O6PA 2YWZA 4X5PA 4P2CG 1EO8H 5EO0A 2XWXA 3CFKA 1WAEA 5ENWB 1FLRH 1OP5H 5ISZA 3T3PB 1CXHA 4JPVH 3BZFA 3CLWA 1GOFA 3KJ6L 4PJ6A 4W9HC 4J27A 3VG9B 3WKQA 4BCXA 1MCDA 3VXMA 4OFYA 1DSFL 1SJVA 3AMLA 3I9PA 3FB7B 3O4LA 3WJJA 2PR4H 1D5XA 4YO0A 3VTMA 4BQCA 1HYSC 2D3VA 1IM3B 3BAIA 4EDXA 3QH3B 4HSQA 1Q72L 2XWCA 3SPJA 1A66A 5BV7B 1S7UA 2WO4A 4P5KA 5TK4A 3D06A 1OGTA 5EZPA 5I1KL 3VXOB 1PD1A 5TJWK 3RY6A 3DBSA 3CQQA 1XX9C 1PSKH 1CBVH 4FLOA 4I89A 4HPYL 2GSIB 3HZVA 2BM3A 5E4AA 4CA4A 3W82A 4KI5C 2ZWLT 1CG9A 1DUYA 1L9RA 5K59E 3X3FH 1RIUL 3EYFA 4FXKC 2CJUL 4AIOA 3GINA 3LQAL 1WITA 3VYPA 2G2PA 1KC5L 3QULA 5I15L 3VD3A 4K2UL 4NZTL 4GY4A 3VU1A 3L3KA 5HPOA 3FQTB 4KMTL 1PMYA 4KNSA 4PVLA 1K6QH 2R69A 1S5HB 4L0YA 1FO0B 4F92B 2LFEA 5K9OA 2V8MA 4KK6D 1IAOB 5LBVA 1S78D 3ARFB 1R5VB 1R4XA 1KXTA 2BERA 2OS7A 4Q6IA 3WL9A 3VFRB 4P4KB 3KBFA 3MRNA 1VGKB 2IH9A 4R4FL 4UQ2A 2VMCA 1I8LC 4YSDA 5IWLA 3P73A 3T0BA 2AK4A 2DYRB 1YY9D 1KTCA 5KZCD 3G9AB 2VXQH 3OLIA 1HXMB 1GL4B 5D2NA 3I02B 4WHYG 3F7VB 2XQ0A 2WD0A 1KBVA 3IN2A 3OR7A 2AJUL 1E4KA 3MRRB 4WQOA 2MJWA 5JHDE 3K91A 1QBML 1UM6H 3QQ4B 4K9EL 1KEMH 4GUQA 1LDPL 1EZVY 2L3BA 5H2BB 2H47C 5MEND 1N0LB 1JHTB 4BFOA 2NLJA 4NQDB 2XKUA 4PVBA 1J12A 1MN4A 1IMHC 1QRKA 5HVGB 5HHNA 2ATAA 4I2XE 3ILQD 4FZEL 1WCQA 4QRSB 5GZOD 4L3AA 4TNWF 4K15A 5DI8A 5E08L 1I9JH 1BVKA 1KLUA 1P5VB 2XNAB 5CIPB 1A7OH 5E94B 4YZWA 5AZEL 3EADA 3FT3B 1E6JH 2G0LA 3U9PH 3QNXB 3IVKB 2FTAA 3DX9A 4ILDA 5FCUH 4D9RE 1K8IA 3T04D 4U3CA 3UZQB 1R3JB 2LU5A 3FUJA 1OP3K 4CC4A 3JVGC 2APTA 4KRPB 2NZ9D 4ZAKD 4YQXL 4U1NB 4ZW8A 4BFBD 1OL0A 2PWFA 4KO9A 2NXZD 1NAKL 2VQUA 2WSPA 3FH5A 2G75B 4MJ6B 4AGOA 1G7HB 3DRQB 2BSSB 2CLZA 1IBHA 2YR3A 3Q8EA 4QMEA 5DVNA 3UL4A 4BRJA 3L2MA 4NPYB 1AFVH 1YN7A 4Q9QL 4A7SA 3BSHA 1FL3B 3FRPA 4YDIH 4LARL 1JGLH 1J1PH 4NO5A 5EZJA 4JDVB 4M6OL 1IFRA 4FFZH 4BFGA 2GUYA 3EH3B 4MQTB 5JQIB 5AVSB 2NY7H 2BZCA 2B15A 3GLZA 3AB0C 4XP9H 4AQ1A 4D0BB 2ATPA 2CDFB 1CZ8H 4JHWL 4OIFA 4PUBH 5HDBE 3JTTA 1U2HA 4HIXH 3CHRA 5FGBA 2X0UA 3TTYA 4X6EA 1G9MH 2DWEA 1I4FA 3GBML 2JSFA 4ZTOH 4PJAF 4YXKL 1AKJD 3NOIA 1XV8A 3UAJA 1CD9B 4F80A 3NCCB 3RNQA 3HPLA 1PW3A 4LCCC 4OZGB 5HI5D 2JKXA 3TVMA 1AHWC 4JQIH 3D48R 3QUXC 5IMLA 4AUYA 5T5FA 1X5HA 5D2LE 4MD0A 1XSOA 5DFVC 5JHDD 4PRIB 4S1DC 1FV1B 3GK8L 1JXKA 1T0NB 1PTZA 1VADA 4NUMA 5B38G 4YIQA 3MOBH 4OZFA 5ETUA 1U91B 5DRXB 1QKZH 2WVSA 5JNYA 3D05A 2WTOA 1PYWA 3HBPA 4IKJA 1OGAA 3O3BB 4OJYA 2YWYA 4HX1B 1P69B 3H3PL 3RWFA 2JK5B 3FOMA 4HKXB 5DVLA 5ADPH 4PRNA 2J56A 3F7LA 5JW4Q 2UXTA 3V4PA 1XGUB 4FLSA 4NYLA 4BUGA 3KDPB 4D9RD 1C5BH 3AMKA 4DN3H 4M7JL 2QGCA 1TJXA 3WNKA 2R56H 1MZZA 1P4UA 4A66A 1RPQA 2LU7A 3E9UA 4MA1B 1XH3B 1VKXA 5C0BE 4WFEE 5E4EC 3I3BA 4JPWL 3MLTB 5F88B 3D87B 1C12B 2B59A 3O2DA 3K80A 1OSEA 1XGPA 3GXPA 1V8HA 1SJMA 4UTAA 3FCGA 4M7KL 3A24A 2R2HB 1JPEA 4IMLB 4LVNC 4M8QB 2ADFL 2WXIA 1RZKH 1A1NA 2PYEB 1FNAA 5BVJA 5KWYC 3N1QC 5CILL 4YLCA 5MP6L 4JJ5B 4PW9A 2XXGA 3SBWC 3SZ6A 4MTMA 5I2IB 1MCWM 5KS9E 2PYFB 1XTLA 3F7QA 4J3OD 4NZRL 1BJ1H 3ZYZA 4HPOL 2WXRA 4DKEH 1N4XH 1VHPA 4KQ3H 3O3DB 1YEWA 1XVSA 3D3VE 1S9VB 4GSDH 3EGSA 3GMOA 4PJ9D 3I74A 4MJ5B 2PWDA 4C56B 2E9WA 4HS8H 5KBNC 2C5DC 4FDWA 1DL7H 1JV5B 1MWOA 1TTAA 5HJBA 3DBXA 1L0PA 3ALPA 4UBDC 4PJCB 1MFVA 1XGZA 2VE6A 1UH3A 5F6HI 1SPDA 3QO1B 4MX7B 3BFWA 4UT6L 2CH8A 3UYRH 4XMTA 3O3EA 2PCFA 1CICC 3LEXB 3KL5A 1FNGB 5IW1B 4IGBD 3FO2A 5BS0B 1M7IB 1QP1A 3CWGA 2WWKO 4U6HB 4F8PA 4TLUA 1JZDC 1NGPH 3FSAA 2E7LA 1UG9A 3PIQB 4FE9A 1NIDA 4KU1A 4XN7A 1ZSDB 2ED7A 3ZDYE 4PYGA 2NX5B 3C8HA 2G3XA 2PR9A 2Y3NA 5C3LD 5DEJA 4N1CA 3MCKB 2EXYD 1X5YA 1E67A 4LKXA 1E2VA 4JEGB 3TA4D 1LL1A 3HG5A 2FSDA 3LS5L 3HS8A 2NPLX 5EEWA 2GBAA 3VD1A 1FNSH 2X2UA 2F1EA 2G60L 2GBVA 1XR9A 3DTXA 4KX8A 2H41A 2ARJQ 4LSQL 1YVLA 3U79A 3VWJC 4G1EA 2AAAA 2AXWA 1FCCA 1LQBC 3B2UC 3RZCD 1EEYB 5F21B 3IMTA 4WGVB 5DRNB 4KQ4H 1CUOA 15C8H 4RGMB 4YHNB 3U7AA 2ID5A 4L3EA 3WMPA 4UOJA 4HV8A 1RHFA 1TLMA 4PBXA 3VI3A 5GISL 4RMQA 1LK3H 5I1HL 2UV3A 4NOFA 2ATKB 2EE3A 4JG0H 5I75B 1X6LA 2BMKB 3E6HA 4WFED 3QCTH 3CVCA 1Z9LA 3UZVA 3U6RB 2EIDA 5DA4A 1PDKB 1RPKA 1KZQA 2F6AA 3B8YA 5GRWA 3RWIA 3A6BL 2D0FA 1DQKA 5C0JB 2ZP9A 2D7QA 2WZPD 1QSVA 3I6KB 4PJGA 5JIMA 4W68A 1OHZA 4KY2A 3RB5A 4AQ8A 4RAVA 3JTSB 3WG7B 5K1JA 1QWUA 4KDTC 3U0WH 4IU3B 1MUJB 2CGYA 4KKAC 3D3VD 3RIAF 1MCRA 2XICA 3C5SB 5JMOC 4HZAA 5BV7H 1FDLL 3IPEA 3MRBB 4NN5C 3UJIL 4C54A 3KL0A 5JXAH 5C2UB 2EVHA 3B37A 2FO4B 3KLHC 1HHKA 3BKYH 2Y5EA 5FKPA 1B2YA 4Q14A 4A6YB 1YEEL 2LTQC 3PQYB 3U4BH 1K3IA 5GRJH 4Z7VA 5HHPA 3U1PA 1AQHA 1XGQA 1QSFE 2FWOA 4R8WL 4LL9A 4OZHB 2VSCA 1Z9SA 3WE1A 4GQ9L 4UT9H 5FUCE 4XCEA 4J1UB 4DAGH 5LWYH 1S6NA 1T0OA 4P99A 4WY7L 4AXWA 4H4NA 4O4YL 4PTUB 3HAEG 5BW7A 1FG2B 2H3NA 2RB8A 1V3LA 4JL1A 1FO0H 5LO7A 4IDJH 2GY5A 3A22A 3WEXA 1JMZA 9PCYA 4NQXB 5D7IF 3BC9A 4FQQB 1DCLA 3ILPB 4HF5L 1QFOA 1F3RB 3QEQA 5FYJE 3NFNA 1R5WA 2XWBA 3KCPA 3ZL4H 2DLIA 2L7UA 4XP1H 4LKCA 4Y4KA 2ORBH 1AY1L 1Q94B 2IWEA 3IXTB 2UWEB 1OAUH 3MGTB 1DJIA 4TULH 1CVRA 3DETD 1UM4L 3UC0H 3DWTA 1F3DJ 2XG4B 1T7XA 3P0YL 4IW4C 1KPRB 2HLAA 1MI5E 2YOAA 5JXEA 4WO4A 4IOSD 5F6IC 2CPCA 2CKBA 3N43B 4LMQE 2EINB 3UERA 1WZKA 2HVJB 4KTDH 1I9IH 3TJEL 3LRMA 1RAMA 4OLZH 1F4HA 1PZAA 1NCAH 1NEZG 3UABA 3MRIA 5EEVA 4YSRA 3RHWF 4MQXD 1QPPA 5BOJA 5E8EB 1EJOH 5MERB 4ZPTA 4TLTA 3DGGB 3WELA 1OY3B 1R3LB 4GUPA 4JO1H 1FVCB 4DKFL 4UQ3B 4U6VH 4WRLA 4KNQA 1IB5A 2VKWA 3MYJB 4LHJB 4Y7OC 4CW1A 1HCVA 2BP0B 4UQDA 5CIPH 4ZT1A 2VW4A 2F5AL 4AYFB 6FABL 5IV2B 1EDYA 1YJDH 2MFNA 5F7BA 2DYPD 4OV5A 2W9EH 1ODUA 2EE9A 1UD2A 1X5JA 4GW1B 4D8OA 1EHXA 3DROB 3DX0A 1MRCL 2YRLA 3KLLA 3VGGA 3IJYA 3MBXH 3ISYA 4Y5VB 3TC9A 3PHQA 1P4IL 1UH4A 3MJ6A 4JO4L 2CSPA 2VDLB 1HHHA 1FZOB 4RGOH 1LEIB 4M1DL 2E9IA 3NZ8A 2CR0A 3DTUB 5JIQA 3CN1A 1EVUA 4BH7A 2J8UA 1QSFD 3L5HA 5F7DB 5CU9A 3VGAC 1NFAA 4QYAA 1BA9A 4XBMA 1BEYL 1YMHB 5D4JA 3UBXA 2BFVL 1OAYL 4YWGH 1IIKA 3BT2H 4OCXH 3VDAA 2NXYC 3TV3H 2MCG1 4LCUB 2Y6TE 5GGSY 3IT8D 4FQJH 3H2PA 2D0GA 2WB1A 3W0WE 1YMME 5CCHE 4DGIL 2YD2A 1BM7A 5FYJD 1JZ5A 3RUGF 2A74C 2YGVA 2E5EA 2X9ZA 5F7FA 3SKJL 1HT6A 1UD8A 1AE6L 4MAYC 5C08B 3NMEA 2F53A 4X8JB 5I19H 4M7LL 4X6DA 2E56A 3NIGE 1VAHA 1F00I 4EO5A 2CQVA 4G6AD 1MI5D 1Y07A 2A77H 1L7TL 1WBXB 5IMMB 4R26H 4Y5XB 3Q48A 3TO4B 5IVXB 1ZRUA 4Z3JA 4L4VB 1YYLL 3OJDA 1YNLH 3U2IA 1M7DA 4H0LC 1RCYA 4QO1A 3WHE1 2FEJA 2XRAH 4L8DA 2V37A 4POZC 5FHBH 1P6WA 3WUWG 2AEPL 2Y9RT 2QGEA 4UV7L 2RA1A 4OFKA 2WBWB 2YD6A 3D52A 5L0QB 1FORH 3WJLC 1J1OL 3PFQA 2H45A 2YXFA 2W0KA 3ZKND 3ME0A 5BUAA 2IALB 1P9MA 3EFOA 3TGXA 1IFGA 5HYSB 5IB4A 1R0AL 3WN5A 2O5ZL 4B96A 2JB6B 4K71B 5CLYA 1UENA 2GK0A 4OLWH 2FAUA 1MCBA 2DQHL 3IAPA 5EN3A 5IQNA 1IC5L 1UGNA 4Y16C 1TQCB 4JFSA 4FHKA 4GKZB 2A6JA 5CHNA 5HHQA 4FG6C 5FX3A 1IGIH 2H7WA 4NNXA 1WA0X 3FU7A 4QXUH 3TCXA 3UTPE 2X7LA 3ZZQA 1CLOH 1UJ3B 4U31A 1VEPA 3RVUD 4DZBA 2NY5L 4QTHA 3H0TA 2G2NA 1GY2A 2OMWB 2PETA 4BEIA 1D6EA 3Q44A 1OSZA 5I73C 4KI5E 2ZOLA 5T1LA 3KPRB 1NFDF 4OKVB 3S96A 5LVEA 1T7VA 2EO1A 4X9BA 4Q74A 4PJHE 3W0WD 5GRUH 1YMMD 1SM3L 3PWVA 4B9YA 3S3DB 1T4WA 2FH8A 3FQRA 1IEHA 2A4ZA 1PZBA 2HH0H 4JPQA 4XX1G 5KVDL 3ULUE 2W59A 3HCVB 4BXVA 3TO2A 5FYKH 4OF0A 3B5GA 4HU2A 1VFOA 5CMAB 1R17A 1R3IL 3MV01 4NT6A 4U3XA 4WV1B 5D7SH 1YYMH 3OG6B 1JHKH 1Q0XH 2WXNA 3I9GL 4NXSA 5FYJU 1QOKA 3L48A 4XN9A 2OA9A 3SY0A 2XPGA 3AUWB 5EFIB 1QLEB 3LZLA 1G6RL 3KBEA 4QRPD 2WLJA 1INEL 4WTQA 4DZ8A 1F4YH 1L5GB 5F44A 3ARGB 5HGHA 5I8CB 4MMYA 5KANI 1ES0B 1A9EA 4QKTA 1UD5A 4ODWA 3APDA 3MKKA 1J1XH 5CBEA 2JKJA 1M05B 3LN5B 2PCPB 2VXTL 3LKQB 5E8OA 2X2IA 3WXWH 1TCMA 5DT1H 4N8VA 3SDDC 2MQ0A 3BAEL 3M88A 3G5VB 3MJ9A 4LOEA 4P2QE 3WEOA 4MVBD 5ICUA 4OCMC 3L9BA 4K3DH 3TJHD 4KVNL 4M7ZC 1TIUA 3WSQH 1OTTC 4U1HA 4XZUB 3UG3A 2DWXA 4LIQE 3OVUB 4J8RB 2OP4L 5L2KB 2DQFB 2YAEA 3RY5A 4KK5D 2HPOA 1AD9B 3VFSA 4N90E 4HIQA 3K4AA 25C8L 1IAIM 3B2XA 2Z31A 4P9ML 3GMPA 2QKSA 3QB7C 1JCVA 3SJVB 4F7CA 5F3BB 4QHUA 5DLMH 3ZX1A 4ZFZB 1QSEE 3SQRA 5JDSA 3TYFB 3FT4B 4X7TB 1IAII 3IFPB 3U1QA 1CF8H 2XTLA 1J9SA 4UM9D 3GJEB 1MWAL 2A73B 2F9BT 2JI1A 5L9DL 4HJGB 1TSRA 4ONFL 5HGBA 2YUZA 4OCRL 1MSPA 1B0WA 3ULSA 4G6MH 1FH2A 3S48A 2JJVA 4HWNA 3UTPD 4AJYV 4ALAC 4K94H 4ANXA 1L7IH 2OXGA 1TQSA 4MNQD 1XD1A 2WQVA 4R5XA 3NEEA 4P49A 1HH9A 1RZIB 1YDPA 4PJ8B 5DK2A 3RYMA 5EA0L 3HZKA 3WIFA 2EABA 2A6KB 4HWBH 3IXAA 4Y2DC 2Q8AH 4P9HH 4HC1A 3PWUB 5FO7A 5DJCB 4KI5D 3BH8A 1BVLB 1F4AA 1FZJA 4FA6A 1A21A 1UM5H 4AIEA 3GB7A 4QTFA 3ZHLA 4RVBA 3N9GL 4NO0B 3T4AB 2OMXB 3BWUF 4NB7A 4E68A 1ZA6B 1R24A 2MTPA 2J44A 4KMLB 1RD6A 4X7SH 3KDMA 4A6YH 4YN3A 3QJXA 3ULUD 2J72A 1WCBB 3V95A 2EDQA 1ZLWK 4P3CH 1OE3A 1WK0A 5D7IE 4MD5B 1GGCL 2BP8A 5J6SA 3V0JA 1BP3B 5T1JA 5IEHA 2N7BA 3HHMA 4MA3A 4FCHA 4BIKA 2VLJD 1AD0B 1E5ZA 1V5JA 4AKQA 2V6HA 3T0WA 5DEFB 1HL9A 3TCTA 1THAA 3L08A 5E1IA 3EHBB 4JPIB 3S4SA 2X4OB 3IMUA 3CXDH 2NNRA 4M8UA 1S5IH 2FK9A 4JS7A 3M7FB 1A14L 1JNNL 2GI7A 2H8PB 2NZ1A 4CSSA 1CXEA 1ONQA 4LLMA 5DS2A 1QLFA 4AQAB 2QQKL 4P2QD 2HSIA 2FBJL 3FTZA 2X4NA 3EJJX 3HBGA 3KEDA 4BZ1H 2OX5A 3L3GB 5J11C 5C0CA 3OWEA 1YEDA 1CS6A 4MNHA 4D9QE 2P80A 1VZIA 1EFXD 5LN4A 1X6NA 3PWNB 4PRDB 4ESKA 4N90D 4PCTA 4FS0A 1CD1A 2DTML 4M9PA 5IFJA 4ZYKB 4FNPA 3ZE2F 1BJMA 3G5YB 3QARA 2XI9A 1QSED 3RVXC 3NAAH 3WS3A 5DHEA 5CINH 3NK4A 4K4KA 1YEHH 4LVOB 4J12A 2X53A 4QTIL 1SFHA 1XB6A 2GJ6B 4EBQH 3NRFA 2J5LB 3D34A 4S2SB 2Y7QA 3NDZE 4ELMA 1DANT 2QMJA 1AAJA 1S8DB 4Z7OF 2XT1B 3K46A 5D6CA 3HE7B 5DS8B 3V4VL 1U4EA 2E7HA 2UZYB 4Y1AE 4BSWA 5KTEH 1MDAA 3CH1A 4NJAH 3BMVA 5AAMC 3OHXC 4UTBH 1V10A 5ESQB 3R1GH 1G9NL 1S7TA 2P8PB 3IRZA 3GSXA 4BSJA 1E2ZA 2ZYRA 3WHXA 5E1AA 4JM2B 4NKDB 3V6ZB 2BPBA 3O9WD 3B7RL 4NWUH 4PJFA 3CN0A 2YD4A 4RH4A 2V17L 1RUKH 1JGVL 5FV1L 2J2ZB 1P4BL 3OWRA 5IBTH 3EYSH 2JKLA 4U1IB 1QYGH 3TWYA 2VOTA 1TVBB 2VDLH 4NCC1 2XIIA 2W60A 4XNAA 3HFML 2YFOA 4UOW0 5FM4A 4PQXA 3S8FB 4LSPL 4YEEA 1NUGA 2W38A 2VMDA 2CXKA 3THMH 4LEXH 4XMKH 4FG2A 4Z0XA 3S34H 3HG1D 3AREA 5AW1B 3RUGE 4GBXA 4EUPB 2IXQB 4AOFA 3VRLE 3FL7A 1KTKE 2AEOA 4MFHA 1ASQA 4PRPB 2CPUA 2NNXA 3KPQB 2IPKA 3TWCH 3W57A 2YPKB 5JLZA 5A1AA 5F0LB 1X5KA 5DR5H 4FA7B 2XSKA 3V6OC 4WLCA 5F3HA 4UIMA 4UZGA 4FG4A 4M43H 2YGPA 3MNZB 4POYA 1CLZH 3QUXB 2ESVE 4BDVB 1N5AA 3F64A 1H3XA 1MZYA 3DURA 3GS4A 3TIDA 4YHZL 2DQCL 4RFOH 2NYYD 1QBLL 3BP7A 3OC5A 5D70L 1CYGA 2E9GA 1HI6A 3MRQA 4Z7UB 4EN3C 4R97C 3F58L 2FD6H 4X4MA 2EO7A 5C0EB 1DVUA 2DQUL 3SPVA 4E42A 4JO3L 2DJ4A 1T1WA 3HN5A 5K39B 4KXCA 3RWJA 2Z93A 1RV6X 2OXHA 1EHAA