1TZAA

X-ray structure of northeast structural genomics consortium target sor45
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
132
structure length
132
Chain Sequence
ALDNSIRVEVKTEYIEQQSSPEDEKYLFSYTITIINLGEQAAKLETRHWIITDANGKTSEVQGAGVVGETPTIPPNTAYQYTSGTVLDTPFGIMYGTYGMVSESGEHFNAIIKPFRLATPGLLHLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of Northeast Structural Genomics Consortium target SoR45
rcsb
source organism Shewanella oneidensis
molecule tags Structural genomics, unknown function
molecule keywords apaG protein
total genus 20
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04379 DUF525 ApaG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1470 Mainly Beta Sandwich Immunoglobulin-like ApaG domain 1tzaA00
1XQ4A 1TZAA 5HDWA 2F1EA 1XVSA
chains in the Genus database with same CATH superfamily
4HHAA 3MNDA 3KPTA 1RZIB 3GJFA 3QJQB 2UWEF 1S7XB 2YEQA 3ZYIA 2BSTA 3FOLB 3U7WL 5IESL 2BP0B 3HG1D 4G9FD 3IJEA 4XN2A 5FA4A 2BRRH 2D0GA 2GFBB 5A2LH 4MNQB 4B5EA 4FG2A 4GFTB 1YN7A 1GOGA 3UADA 1RPKA 2D4FA 3NJNA 2ZKXA 3ZZLA 2X4PA 4AEHH 1LTXA 3FW6A 5B39B 3RVUC 5DU7A 3A6OA 4LPWA 1BREA 1SXZA 4LQFL 3IDJA 2VDPH 4R5XA 3MLXL 3TTSA 3TA3C 3DURB 1NAML 2EEDA 3LMJL 3O0RH 3X1EA 4LU5L 4UAOC 1MG2C 4WW2B 3F58L 4DOHB 1UACL 1WFUA 2IWGA 2Q86B 4WHDA 4XB8A 3NZ8B 5CILH 3P9LB 2VO5A 4QO1B 5I2IB 2N0KA 3LVEA 4ZMPA 1HYSC 1UCBH 5E2TH 4K8RH 2XZCL 3NK3A 3RAJH 4MNHB 3R8QA 5BS0D 3VAEA 4IGBA 5E70A 1C08B 4U1NB 3RVVD 1I8AA 4XX5A 2O5YH 4PJGB 5CEXA 2LHAA 1IAOB 3SPHA 2MRYA 3FK3A 4KJQD 5F6HJ 5FGCB 2UWEE 5IB1A 5HDLA 3T4AA 1L9MA 2OTUA 2UY7A 3GM0A 1Z9MA 2NY4B 2G60L 4OKVB 4WW2F 2EYSA 3ESUF 5D7LA 2RACA 1QFWM 3BSGA 5GGRA 5D1ZI 5I5JA 1YECL 1DVUA 1FSKB 1SYVA 2Z8VC 5D1ZC 4HLZG 3KJ6L 4NP4H 5HY9A 5BV7L 4JO4H 4M9OA 1YG9A 2JKNA 3LEYH 3DIFB 1MQKL 2MWCA 3FO9B 5AZEL 1EBAA 1BP3B 4LCUB 3VWJB 4P23A 4HAGA 1JPGA 2XQYA 2FRGP 3TO4B 1LO3L 2CUMA 2KZKA 3VWJA 1HVXA 1A8JH 2NY0D 3IDMA 4KROB 1KV7A 1EVTC 3FQ1A 1JFQH 2Z31A 1I9RH 2GY7B 2JB6A 3HAEH 2WQ8A 2WINA 4NJ9L 1E5ZA 1KIQB 3EGDA 4I3RH 3OD3A 4I3SH 2ZWNA 2L8AA 1WD9A 4M8QB 4N2BA 3RWGA 4QLWA 4WTWA 4HG4J 2EUZA 2E4FA 3ERXA 2L7EA 4MMYA 5DXWA 4P2QB 1CBVH 3L4XA 2A1WL 4PJBF 2C7FA 3PUCA 4HT1H 2YIHA 1CF8L 3DBSA 4HCGA 3U9UB 5D2LE 2YAHA 2JB5H 3WO4C 3PQYE 5CP7A 4ZFOA 1HWGB 2Z92A 1Z9NA 5EUOA 4IKKA 2G75A 1U8JA 2VXQL 4OV6F 5IV2A 4PGDA 2H45A 3FOLA 2W0FB 4MLIA 2F18A 1CYWA 2VJ8A 5SX4I 3L45A 1P4LB 4IMKA 4F7PA 5AB0A 4IW4C 5C0BD 2JXMB 4WU7A 3NJIA 3AT0A 5TFSH 1FZJB 1U91B 4J3WA 1F86A 3C75A 4Z1PA 4PJ9B 1AP2B 2DQHL 1TSHA 1E6OH 2AV1B 3MLPA 1U91A 5ILTH 5DEZA 2AXFB 1JF1A 4L48A 5TQ2L 4V1DB 3FTUA 1HINH 5KZCD 4XWOD 3HG1E 2FGWL 2GJRA 4NZRH 2NNXA 1UJ3B 4Z7QE 3GSNB 1OCCB 2WXRA 5I1AA 1I1AB 1X9QA 5KVEE 1TJHH 1I3VA 1UVQA 1SDYA 2HTLD 2W60B 4D9LH 3S9DB 3INUH 4IBSA 4F7EB 1SJHA 3DX6B 2EE2A 4PV1C 1H5BC 3CFTA 5EU7E 4A6YH 3ELAT 5LO7A 4ODHL 1QSFA 3DTXA 3PQYD 1E7VA 4DT2A 1UB5B 5D93C 5A3ID 3AU0A 1MEXH 4LMQE 3PWNB 5IHZB 4OZFH 1E27B 2YKKA 5KYYB 4EVNB 2FO4B 2ATKB 3BO8B 4EKJA 2FGWH 3G6JE 4Z7OF 4A7GF 1QLFA 3CBJB 1BFTA 1XH2A 4O5LH 4H13C 4LHUD 3RA7L 4KJPC 3BUYA 3S5ZA 3DGGA 2XWTA 1FRGH 5HYJD 4NCDA 3DX2A 1WHOA 4J23A 2APBA 2NR6D 3IVKA 5DD1H 3VWKB 1MH5B 2RQEA 4QHNB 3QI9A 3NACH 2B20A 4JN1L 2I7SA 3WDIA 2YPLE 1PJ9A 4M3JA 2XN0A 1SXCA 3D39E 2BMKA 4Z7VF 3IF1A 4P04A 2F68X 2GTWB 5EZIL 5GZNA 4YOKA 1MCJA 2XPZA 1ROCA 2G3ZA 3KYAA 1K3ZA 1IKFH 1WBZA 4X6DF 4P2OA 3SDDA 5I1JH 3EXJA 1H3PL 3VXME 4PJ7E 4KO5A 3BPOC 3EGXB 2FWLB 3D1MC 4MA3A 3UJTH 4GUOA 2IFFH 4AL8H 1AZNA 2UZIL 1H19A 1S3RA 3H1ZA 2BJML 4U1HB 3HS0A 5C1MB 5J7CC 1NANI 1A7OH 4UM8A 2V6HA 3M6DA 4YHZL 1N5AB 3WXVH 3BW9B 4HU8A 3UIZA 4AZ8A 3K0YA 2V17L 3KPPA 3D18A 3L3OB 3UO1L 4ZJ9A 3TT3H 2VSMB 3UBGA 5KANI 1LP9A 2P46B 4IHBA 1OD7A 5DJDA 4O00A 4I8DA 4ORGB 1AIFA 5BW7A 2V7HA 4PJ5A 4LSSH 1D5ZA 1HILB 5F44A 4HIHA 3BSZA 1A7OL 1EZVX 9PCYA 4L3AA 2YWYA 5HI4D 1RJZA 4Y4KA 2VYRE 2XZQH 4CC4A 3WJJC 2XIIA 4ODTL 3VWKC 2G5UA 4PVNA 2IPKA 2XPGB 5CBEA 2IWKA 4RIRA 3MBEB 3NT0A 5F89A 4R84A 5LUMA 3CX5K 3E8VA 2DJMA 3WTTA 4G80A 4WJG3 2FQDA 2R4RL 3U6RB 1OM9A 1LVEA 1QUNA 3EOTH 1BF2A 3GO1L 4NKDB 1DO6A 3VSUA 1XGQA 2K7QA 43CAA 4UU9A 1PPIA 2Z4TA 3HE7C 4DUWA 4QKXB 4M7ZB 1I1AA 2DTML 1HHKB 2N59A 3ULVH 3NFSH 1MCDA 1VFOA 3DXAD 5LXGL 3DPBA 1GOFA 3TH2T 1G7PA 2VXQA 4WHTB 4DHLA 4ZUWA 4DN3H 3BKYL 4YX2L 3LNFA 3WDHA 1QUPA 4AT6B 3ZW3A 2BY1A 1SLUA 5EBMB 4ODSL 1MHEA 2PYED 4WAFA 4KJPD 3S88L 1F5WA 4OGXH 3U9PL 4FNRA 4JO2H 3A47A 3Q6GL 5E9DE 1S7SB 3S34H 5I6LA 3BFWA 1U3ZA 5BCAA 5L4MA 3RGBA 4WU5B 4R7LA 3N91A 4JL2A 1IC5H 1NBVH 3KXFA 1NUFA 3ABZA 4V33A 5AZ2H 3UYRH 3WE1A 2NY2D 3E1F1 3EBGA 3VFWA 2YAEA 5CCKH 4OF8A 4LSRL 3K6SB 2F15A 3QJUB 8FABA 3V6FB 4JPWL 4JO4L 5EO9A 1OCZB 5D1XA 1NGXB 4PRPB 4K94L 3K2IA 4Z7VE 3BZ5A 4LIQH 1FIGL 4X6CB 1NIDA 1T20A 2D0HA 3NEEA 3EJYC 1TDQA 4B7LA 4B9KC 1AYOA 2HTLC 1CI5A 3RL2B 3LRGA 4U2ZA 3QCVH 3FT4A 1UXSB 2H3NB 1P6WA 3WO4B 5LBSL 3QNFA 5GHWL 1ETA1 3HZMA 5KWYC 2DIJA 5GGTL 1S8DB 3MRJB 4N8CH 1YEEL 2E3VA 1H3UA 4KMLB 3RI5F 3TCLB 3VH8B 5C3LD 2Q7AA 4YHIA 4S2SA 2W07B 3O6LH 5BUGA 3TCLA 3VH8A 5L2KA 3KWVA 4U05A 3VCLA 4W81A 1IBDA 2MTPA 3T0DA 1WFNA 3LNDA 2EP6A 2DLIA 1AI1H 5I1GH 1DE4A 3P3UA 5BZWB 4HIQA 4XH2A 5CBAA 1OE3A 4H8QA 1GIGL 4ZSOE 1YNLH 5IF0A 4FQ1L 4Y16A 2X2IA 5LBSH 2P5ED 3S3PA 4XMVA 1U8KB 4TOYH 4KTDL 5IMOB 4K4KA 1OAYL 5K9QI 1SMDA 2APVA 2GUOB 4N6QA 4FNLH 1AHMA 3EYUH 1TKWA 3GJFK 3LD8B 2TAAA 5LGKA 3OSVA 4GXFA 4AQ1C 3QNYA 3ULVD 5ELIA 1MAML 3G5XA 3GJFH 3JT0A 1FVCA 4MQTB 5BZXA 1QFPA 5ILTL 2BERA 4ODTH 2XFXA 4ZFOB 1K3IA 1R3JB 1DJXA 1U8IA 1YQ2A 2ICES 4NQEA 1AR1D 1FP5A 4LEEA 1IEAB 4F33B 4JY4A 1ES0B 5C3TA 4JG5A 1LO4H 4NNPH 4MMXA 1TENA 3FU9A 5F9AC 3ROLA 3AREC 1CO1A 4N85A 1I1AC 1N0LB 1AP2A 3KDMB 1OAQL 1MY5A 3TO4D 4A7GA 1AXTH 1V3JA 1DLHA 3CDYA 1IGJA 3S7GA 3T0ED 5B8CB 4WSJA 4F20A 4WHTA 1IM9B 4NBZB 4JDVA 4P57B 3QQ3A 1SXBA 2QPEB 2BIIA 2EXSA 4I1PA 3W3BA 1DLFH 3SYAA 3WENA 3PNWB 5L6YH 1D3CA 2YARA 1Q9WA 2F53B 2VDLB 4L3EB 5DRZA 1EMTL 2WKLA 1ZHNA 4IOFD 5GRVL 2CDGA 3ULVC 5FA3A 1HHGA 1XBRA 2C1PA 2WKOF 3KBEA 5E1AA 1JHKH 1WZ1L 4LU5H 2WO3B 3P77B 1DQLL 1W72A 2GJ6E 3IFPA 4M4RA 2JLPA 1DUYB 1YC7A 3Q13A 4ZO9A 1CTOA 1KB5L 3N1FC 3PIQA 1O5PA 3LZOA 4UQDA 2EYSB 4ZMYA 4BSVB 1BGXL 4NQCD 5F7BA 3MO1A 1WP6A 2UXTA 3E2HC 4HEMA 3T4AB 3ZDZF 1AD0A 1Z9SB 4QXTA 3K8LA 5CHNB 3A4EA 3QCUL 1VFMA 2R4SL 4NYLA 1CLCA 4PG9A 4RFOH 4J4PD 2D7PA 4EQ3A 3N40P 3PV7A 5D1XB 1KCLA 5C0BB 1MAMH 1UD4A 3Q8AA 4PBXA 4LGPB 3V2AR 1AO7B 1HZKA 3QJOA 2C9PA 4EO5A 2ENJA 2XX1A 3G04B 4ODWA 3TT3L 3W56A 1G7HA 3QUYD 5CD3A 1C1EH 3UYPA 2J1WA 1OSPH 4UM8B 2J21A 1FI8C 1KGIA 3DX4A 3S4SA 1AXIB 4APQD 1IU1A 1KFGA 5HYSB 1XHHA 1C5BL 1QSFD 2GQHA 3PQYA 4ONFL 2P4AB 2ATPA 3C6LD 1MI5E 4U7MA 1NDGB 2A77H 1ZLVK 5A2KH 2C9SA 3VJ6A 1MPAH 2XA3A 2XZZA 1TFPA 1AD9B 2GEEA 1LP9F 1PY9A 3K6FA 4J4PA 4LLVA 4LMQI 4PJIB 3DKHA 1X5XA 3D85D 3WFDH 1FL5B 1NCAL 3L3DA 1WUZA 1XZWA 4YSSA 5I75C 4OZHE 3BDYL 4QKTA 2APWA 5I1LB 3GMPA 5ACMA 3RVVC 1G9NH 3WTYA 1H3XA 1NAMB 2JKJA 4BEIA 4PWJA 4HS6A 1DQTA 4GQ9H 3VXMA 4WWKC 3UPAA 2J43A 3BHBA 5CJQH 5FYKD 3T08A 1HU8A 1KLFA 4WO4C 3ZX1A 2ZJSH 1E4XH 5I5RA 2VLJE 1AGBB 4BINA 2IPKB 2XPGA 5CBEB 2XVGA 1A6ZB 4DP7X 3C6LC 3FPXA 4L3ED 4Q14A 2BS71 2WXGA 3C6LA 4M93C 4G6FD 2D9QB 5AVUB 4LCIL 2VZTA 2NUTA 3OGOE 1MSPA 3GXPA 4DEUA 4NC1E 2V37A 3IDUA 1YN7B 1WFMA 1ZT4B 3L5HA 1AGCB 1UQSA 3WV0A 4RFNB 3B2UD 1A3LH 3HN3A 4PWKA 3HI1A 3V6BR 5FA4B 3IJYB 2OL3B 4Z7UE 5LVEA 3QORB 1UT2A 3QWRA 3I6KA 4R5VA 3ISWA 5C07A 1YNTA 1P7QA 4WGVB 5C2BH 3QQ3B 3RL1B 3QSKB 1OAUH 4TSAH 1PKOA 4WKZA 2VTFA 2L0DA 5IVXA 1S7WA 1DLHB 3N43F 4FZ8L 4P4KB 4UOW1 3RQ3A 3SE4A 5FO9B 2P1YA 1BIHA 3ILPB 4NHCL 3IWUA 3O4LA 1W0VB 1WAPA 4BA0A 1BD2E 2YEZA 3F6JA 5E5LA 3D25A 3EYFB 2G9KA 1KN2H 3I84A 4XVTH 4L8SB 1QBLL 2MNUA 2YMTA 1AY1L 3EO0B 3ZT7A 1FNAA 3CE1A 4X8XA 3NCYS 4FZ8H 1KCUH 2NT1A 4I5BB 3LNGA 4P99A 4XB3A 1O9WA 2WLLB 2J4WH 3W11C 1NFIB 1REIA 4ZMVA 3DVNA 4G8GA 4XPBH 3UBXB 4FQCL 4S1RH 3K71B 1MCIA 1KJVA 2QT6A 3QHFL 2W9DL 1DQJB 1DFBH 2I24N 2BLFA 4OLXH 2JKXA 1JSYA 4N2NA 2JB5L 4LSVL 5IM7B 3RRQA 1HSAB 2X9YA 4OH2A 1WPCA 1MJJA 5IJBC 1H8NA 3IJSA 3V6OE 4JKPL 4M3KB 3WJLA 3II1A 1VAHA 3GMLA 4GAYB 4UAOB 5DJZB 3V4UL 1KF9B 4PYGA 5GJTH 1Z6JT 3C8HA 4F24A 3CPLA 3WSQH 2Q6WB 1CFVL 2Y6SC 4NDMB 4CKVX 5IJDC 3SDDD 3C5JA 3VG0H 5K9JL 3R18A 1MCNA 2E8YA 2R29A 1KTLB 4LIQE 4L37B 5TE4H 5FYJD 1BLIA 3VD9A 1C16A 4IK6A 1NCUA 5JNYA 4S2SB 2DAVA 4MVBC 1FDLL 3P30H 1YDPB 2XT1B 1A0QL 3FCTB 5EU3B 1UUSA 1T5XA 4IRZH 4A2DA 3VG0L 1TJHL 3TBCA 3EDJA 4N0FB 4FL4C 3I2CH 4YDIH 3S37L 3NIGF 1G5GA 1MXDA 2WQAA 3EGSA 2VLJD 3U0PA 2GUOA 3FUKA 1CFVH 4BIKA 3V8CA 4OJAA 3U2SA 4DN4H 3LHAA 3GNML 3V9EA 1KEGL 4I0CC 4XPFH 1BMZA 2VCOA 3G6DL 5DD6B 5EMYA 4B9CA 5KSVA 4WO0A 1BVZA 5FUZL 4NQDA 2VW7A 3MBEA 4GW1B 4NQXA 5F89B 4CL7A 4YDNA 5H37H 1UCTA 2FLMA 4Y5YC 1R47A 3ARPA 4N2GA 4FFZH 1ZXKA 1G84A 5FFLA 2COQA 4YAQA 2I5YL 1NM9A 1NPJA 2W0FA 3EHBB 3K6NA 4HEME 5HD8D 2ODIA 4NJAL 1DJYA 3ARWA 3HC3H 1NA8A 4UB0H 3U46A 1XF4B 4IS6B 3VTAA 2QGCA 3GLAA 4IJ3B 3S36L 3SE3C 2F74A 2GSIA 1HS6A 3QJTB 5CMAB 3D0AA 5HGHA 3B2PA 3BWAB 4GAGL 2EEXA 4QRBA 4A66A 1Q38A 2ZSWB 1LK2A 3M45A 2GPZA 5DMKA 1P4IH 1N0LA 2CD0A 2WN2A 3E0GA 4MXQC 3GRWH 1OTTD 4Z7AA 1NGPL 4DP1X 3CFIC 4F3FA 3MJWA 4WKXA 4AIZA 2CO7B 1TTUA 4L0YA 1F4HA 4MX7B 3LSOA 2HX7A 1KWKA 3L17A 2R39A 3SDXB 3NCCB 5EBMA 1E5BA 2NOYA 2O72A 5E9NA 4MCZA 1YEFH 2ZKWA 1IC4H 4Y4FD 1PTZA 1BV8A 1PZSA 3QXAA 1I9IH 3FTGA 4H8WH 1W6LA 3LV3B 4R96B 2D03L 3ABKB 3ZR5A 2XZAH 3I9GL 4BCXA 3N3EA 1SNRA 1TUPA 1TOXA 2RHEA 1UHVA 2W81C 3N1PC 4NUPA 2EXTA 3PWJB 1KXQE 1NOLA 3DX8B 4DKAA 4XN1A 5I30L 1W9XA 3MNVB 2UZYB 3O0LA 1YUKB 4XPTH 2P24B 1MFCH 3IVKB 2Q0ZX 2VN5A 2DQJL 3BSZL 1QLEL 3FZUC 3UJJH 2X05A 1YNKH 4PV9A 1KBKA 3MMEA 3RIFK 1T1YB 4AJ0A 1BBJB 2AQPA 2X4TB 2HFEB 1GYCA 2X9ZA 3PHOA 4N0CC 3ENEA 2ADJA 3O9WA 3IFOA 1O7DE 4HX1A 3GM8A 3SPJA 1B0WA 3GSVB 3CVHL 2AQ1A 2W8CA 2WZ5A 3GGWA 1DVSA 3OAZH 1YNKL 3RTQA 5G55A 3IAQA 4BFRA 5M94B 1K4DA 1ERNA 1GR7A 5JW5A 4AYID 4CW1B 3ASWA 1C7SA 1SXNA 1BX2B 5MI0C 4BFIB 5F7AA 3QPQC 1IM3A 3RDTB 2DYPD 3WN5B 3F85A 3TCTA 1TYRA 4H1LB 3FN0H 3HE7D 3ECWA 2XTJE 5DJ2A 1E9QB 1N5AA 2DYPB 3V7AE 3HRZA 1KCUL 3PWUB 4GSQA 4NO2B 1J1PL 4KGJA 2AI0L 4RMVA 3QC6X 5CNHA 5IY5B 4IJ3C 1F3DH 5FYLE 2B16A 2VLMD 1A02N 3GBLA 1CXKA 4EDXA 1MIMH 1A0QH 4L3CB 4JZJC 3E6HA 2X7LB 3DUSA 2QKIA 4WFGD 5DVMA 1KBBA 4EN3B 1N6UA 2XG5A 1HYSD 3F8UB 4MQXC 4RETB 5I1LA 4AIEA 2LOEA 2Q3ZA 3HC0B 3ZYZA 3MRQA 4YHYB 4CN1A 3QCTH 1QSFE 4UI2A 1FF5A 4IHOA 4PGDB 4RGMC 2J8UF 2WBJD 4R97B 1JFHA 3MNMA 4I0PD 1WT5C 4TVPE 3B1UA 2E9JA 3HR5B 5TF0A 1MDAA 3W39B 2Z65C 5HVHC 2CA4A 3MJ7B 4DGIH 3EAKA 3E2HB 3T4AC 5ITFA 2CKBL 4DQOL 4PS4L 5F6IB 1S9XB 1WTLA 2R9HD 4FABH 4CMHC 3Q05A 2OSLB 4U1LB 3BLPX 2ICWJ 5FB8B 1IVTA 3WEOA 2ZICA 3UBXG 3UJJL 3BYTA 4LSTL 5J9PB 4GXVH 4ERSH 2GI7A 1ES0A 3E9UA 3OF6D 5KYUA 4A7VA 4GRWB 2GTZA 1NICA 4ZFGH 3GMMA 6FABL 2VKXA 3BIKB 2GG1A 4MA1B 2AANA 2ARJA 2EDXA 1P7HL 4JUTA 5E08H 1UQSB 2KC0A 4YGVA 1NUGA 3QDMB 1FC1A 2CKBB 3OR7A 1BWMA 2X41A 2WKOA 3CJJA 4KRLB 4LP8A 3BGFB 4GKSA 4M61A 4Y5VC 5DI8A 1PSKL 2G30A 4CSTA 1OB1A 5INCA 3AITA 1ZT1B 1BA9A 4CU6A 3FB5A 4LLWA 1QPPA 1TCRB 1Z32X 2J73A 1MFBH 2Y22A 4PG2C 3WS6C 4N87A 1JZ7A 3POHA 2E9BA 3GJEB 2DKUA 5E2UL 5CLWA 3UZEA 1ZA6B 5AWNH 1M71A 4ZUSA 3PDOB 3PDDA 3PIQB 1ODAA 5E94B 1S2EA 2V2XA 3V9CA 1V54B 3QDAA 4BKTC 3UCRA 1ORQA 5J3HD 3BP5A 3GI8L 4F7PB 3KCPB 1AZBA 1J0YA 4L9DA 4NO3A 3V4LA 4PGCA 2YR3A 4H8WC 2GVYA 3ZKMC 5J5EA 2EUWA 2VE6B 2NTFB 1KCWA 5T3ZL 4O9HL 2KQNA 3FQXB 2BFGA 4PP2B 1X5KA 4U1NA 1THAA 3P0VL 3MUJA 3K1KC 5MEQB 4HSQA 2UX7A 1BGXH 2JJSA 3O2DL 4LAQL 1J86A 4KKBD 3MA7A 4JFZL 4BZ1H 2J56A 3VRLF 5IOPB 4HKBA 1OK0A 2BO0A 4OZHA 1NC4A 4YMPA 1MVYA 1ZANH 3WUWB 5JW3H 4G11A 3MCLH 1X4YA 4TPRH 2GI0A 3HS0C 4LSQL 1U4EA 2B1HH 1AE6L 5SWZE 2DQMA 3GMLB 4NO2A 4N8VA 5GGTA 3FHQA 1R3HA 3TO4C 1KBGL 4NRXA 3WN5A 2RALA 4XXDB 4L8DB 1A9BB 4FI8A 3VXTB 4LP5A 3VYOA 1I7RA 1ZCRA 1DEDA 4KKZA 1IM9D 2DMKA 5DRXA 3SQOL 1B90A 1EEUA 3MRRB 1VKXA 4YL4A 3FB6A 2XOTA 2VDQB 3DOIA 3OKDB 4IDLA 1YCSA 2VXVL 4UT9A 1OCWL 1C5BH 1UYWH 4L1DA 3SN6N 4WO4B 2IH3B 4O02B 3NK4A 4YDJA 2YAFA 2ZWKA 1C9SA 1TKWB 4E42B 5HHXH 4AGQA 3C12A 5I8EA 2J25A 3IKCA 4GW5B 1AMXA 3GB7B 5DJAB 3EDDA 1F58L 1QATA 3M07A 2DQFA 5GRWA 4ZX5A 4XGZB 1OQXA 2VABA 3AWEA 3QDJD 4YHPB 1F2QA 4YLBA 5JUEL 1JGUH 4X98B 1HOCA 1T6WA 1XF4A 2F8IA 4IS6A 1NKOA 5JO5B 1CD1A 5AW3B 3V4PA 3CDFA 4DAGH 5DHVB 3NUKA 1C5CH 2DI9A 1BJ1J 3FQUA 1QRND 4R9HA 4BKLB 3R06A 2R7EA 2ZJSL 4XXWC 2J12B 1IVLA 5JQ6L 3QCUH 4I87A 3ZKXC 1DVXA 4JGMA 4NKDA 3P9MA 4XNQB 3L3KA 2A73B 3F7KA 2AXFA 1DVZA 4PY7B 1J1OL 3VXPA 1XMWA 3QZOA 1PS3A 4KNSA 2WLHA 2ZUVA 4TSBH 1BG1A 1YMMD 4QXUL 5CLXA 1T4KA 2DQEL 5CJXC 3GLZA 4N24A 1HIMH 3MGTA 1YEHL 3HHRB 5JIKA 3WELA 4AIZB 4YFLI 1T1XA 4FULA 4PBDA 1AAJA 1E90A 1PFOA 2C3VA 5F97E 4AKPA 3V6ZB 5IBUG 4POYA 3LS5H 4XN5A 1LNUB 2WY3B 3QULB 4X4ME 4A2GA 1VPOH 1XWVA 4JGUA 4LFHD 2JK5A 1ZT7B 3CFQA 3VD3A 4OCSH 5C0JA 1Y6MR 4UDUA 2WQUA 3AWGA 2NW2B 2YD7A 3GMOA 4XMWA 5AD0A 2ICWB 3NSXA 4FLQA 5C3IA 3FH7A 2WLLA 2WZ0A 3EFFA 4WW2A 2Q8AL 1OB0A 4ZK8A 4IU3A 3V4PL 5TTRA 2X6BA 4N8CL 3AG1B 5D5ME 1PY0A 2H3KA 3I74A 3I9AA 2GK0A 1DVFB 3MRGA 3VFOA 3HHSB 3QA3A 3TZVA 5F0MB 4LHUB 4FS0A 5AVYB 3EBHA 2VQ1A 5FUCE 5HHOA 1F02I 5A16B 5GS0H 1XGRA 5IM7A 4Y1AB 3MXWL 4RAVA 4PJBA 4JPWH 1GS7A 2KPNA 5IVZA 4JPKL 3CN3A 1I1FA 2HLFD 2UY6B 3MOBH 4MRBA 1L5GB 4N5UA 4QPEA 3NCJH 1J0HA 4XZUB 4ICXA 4BH7A 4YHIB 4Y7MA 2B5IC 2X1QA 5EZJB 1HH6B 5LN8A 4I77H 4IBVA 1AO7A 3A0OA 3MCG1 5IROA 1TVBA 2YRBA 1RMFL 3FYIB 4MDRA 1JGLH 4FNLL 1FRGL 2J8UE 1HYRC 1Z7JA 3BUPA 2G3XA 2R0KH 1NFDA 2QV4A 5HYJB 3IJ9A 4MASA 3BP4A 1ZHBA 1OHQA 1FN4A 4IRJA 4NT6A 3GTTA 1CF8H 2TRHA 2AJVH 1MW1A 3VYPA 4WV1B 4GMSH 3KGSA 2Q87A 2XTJC 2ZAGA 3IDXH 4LE8A 5AYUL 3UERA 5A40E 4E42A 4OZIB 1BQ5A 3ECQA 4K2UL 3RWEA 1P7KA 1FGVL 2FSEB 4Q9QH 1KJ3L 4N0FA 2P43B 4LP4A 1U95A 3HPLB 1KG0A 1X5FA 4TUJA 5AVVB 4CVXA 4MXVF 4E36A 2RQ8A 3ISRA 4M6NL 5E5MA 5F0PB 1VHPA 4ZFFB 4CC4C 1N8ZA 3N0AA 3R0NA 3L6FA 5HHVL 4HUVB 1JNLH 5DK3A 3V95A 2G9HB 4JRWA 5KANG 3RIKA 3U9UA 3VFRA 1PVHA 3FQUB 3O81A 4APQA 3SEPA 4PWFA 5EWIH 1DQDL 4HP5A 4B6ZA 4TMPA 4LF3A 1Y18B 1JZ3A 4PUBL 1HOCB 3U48A 1V10A 3D3VD 7FABL 3QUMB 2XIBA 4ZOEA 4BGDA 4UV4H 2VMFA 5I24A 4NPYA 5ID0B 2OAAA 2PXYC 1KDIA 4DFHA 5ICXB 3HB3D 3IDYC 5IHHA 2OK0L 4HQQL 2WQSA 1YYLH 4XNUH 2QQKH 3CN4A 1XH0A 4MMXB 2YA0A 1FA4A 4TVPH 3DPBB 5IQ7L 5CJ8A 2ZOOA 2X2JA 3ARGC 2XX0A 4AYSA 2IAMB 2UXVA 4G1MB 1S7QB 2CM6A 1I8KB 5HHXL 3MV7A 2Y36L 2DH2A 3UAAA 3GI8H 4AYFA 3GIZL 3CSYA 1J18A 5AVTB 2YSSA 4LDEB 3ZRFC 2CUIA 4X4XB 5C0CE 3D2UB 4JQVC 1K72A 1S3KL 5E1IA 1IGYB 3VWKD 3FBQA 4K0OA 3VXOB 1G1KA 7PCYA 1Y1UA 3WTSA 1SOKA 4ZFZA 1H8LA 1T66C 4N0CD 3D07A 1Z5LA 5E2WL 3VSTA 4ZTPH 2OR7A 2VISB 1B2WL 2XQBL 2DV6A 1FFQA 1N5YH 4HLZH 1XD1A 1YPZB 6PAZA 2A6DA 5HJ3B 2WBJA 4XCCL 4AUJA 3SODB 4JRYE 1TFHA 1S3KH 2ATKA 4W9HC 5DTFA 3SHSA 3B7TA 3ZU8A 3ML9A 3DX7B 5KVDH 4PJ9D 3VDBA 1NGWA 4IBUA 2OTWB 4LAJH 4ZO8A 3MV01 3ARDB 1DUZB 1GH7A 4KKLD 4EI6A 1H3WM 5F7FA 1U8MA 3VXNB 2WXLA 1GGBL 2Y7OA 3QUZC 4JQXC 4OD3L 3RTQB 5A3IC 4QD2E 2YAQA 4BKSC 3LH9A 1N12A 3HR6A 4RDBA 3GHEH 5DO8A 1ID2A 3T0BA 5CP3A 3G3LA 3OC5A 2KUTA 4CVUA 4FXKB 2W0KA 4O2CB 3HNSH 3MO1B 4GLRH 4ONGL 3UAJD 4Z7UB 2H26B 1HI6B 1ZTXL 5DZJA 4ECNA 3NZSA 2NNAA 2XKNA 3UTSE 1BPVA 4Y4HC 3MROB 1YEWA 4TVSa 4WUUB 4HISA 1QNZH 3LN5A 4JAMA 3V0VB 5LG1A 3MLWH 3PLYA 4P8QA 3HE7B 3U7YL 4OCMC 5I16B 1OTTC 2HA1A 4GSUA 2NY7H 4IKNA 3QJFB 5DJ8A 1BG9A 4YSOA 4HD9A 3SKOB 1ZSDB 4ZX4A 2YBRB 5FUOL 4G8IA 3SJVE 1YEFL 1HAUA 2FQGA 1P2CA 1GGIL 5HHMB 2XQYG 5F88B 1H6FA 1QNZL 1M9SA 1F4WL 1TF4A 3C5ZA 3HG5A 2W0PA 5ANME 1FV1A 4FEIA 4H5SA 4EN2A 5KBNC 1Y0LB 4FQJH 2X4SB 4LOVA 5JYLA 5JOPD 4P5TD 1RFDL 4DZBA 5MEOA 3VXUA 4LCVA 5H8DA 3SIKA 3WY4A 1RJZB 4AM0B 3HAEG 1PG7H 1VEMA 4X9IA 3FYEB 2EEAA 2FO8A 4TTDC 4PJ5E 2AMUA 1FG2A 4HJSA 3X14A 3QWRD 4YSUA 4YXKH 2P5PA 5L4JA 5BO0D 1S7VB 4DUVA 1V27A 1NCWL 1I8LC 1WZAA 3F5WB 1PL3A 2B4CL 1S7XA 2ZXDA 1UWFA 1MI5A 1OAJA 1OE1A 2K7PA 3GSOB 3PG2A 4ZXBC 5KVFE 3DNKA 1QA9A 4LLUB 3EYUL 2K8MA 4Y5YB 1DVYA 4KMTH 4NC1C 3U0WH 1T66D 1N26A 4JY5H 4OUUB 3AS3A 4JM2C 3L1GA 2H1XA 1CJYA 1T5WA 4PRAB 3N0PB 1QLRB 4ILDA 5DJXB 2EIBA 5C0BE 5TD4A 4YPGA 1RZKH 1FFTB 5IW1A 2WYHA 5EC2A 3LRSB 1THCA 4AE0A 2O5XL 4AQEA 3VQMA 3IAGC 3IGAA 3NOIA 1NQBA 3UYOD 4OLYH 3NVQA 2Y6SD 4MXVE 5AVRB 4BRVA 1E8YA 3KWWB 3LKOA 4QRUB 3TFBA 3FN3A 4ODHH 2BVOA 3N42F 4JRYB 4AW4A 4F7CA 1LDSA 3HZVB 3TYFA 5E9DA 1IGCH 1KTDB 2VM4A 2V3DA 4JDEB 3QWOA 5C0ND 2NW2A 3GMOB 2BVQB 4DO6A 3CDZB 4ONHB 1N6QH 2GC7C 4U0QB 4YXLL 2V5RA 3KYNA 5AW7B 4AGLA 3X13B 4EN3D 1IEBA 5E8NB 5C0CB 5SX5H 1JF6A 3ZTCC 2CJSA 4JFQA 3AS0A 1UA7A 1QHOA 1MELA 1SM3L 4DKFL 2ESVB 1Z0NA 1FZMB 5ACZB 5CU9A 4MD5A 2I60H 1IV8A 3LYRA 4L2YA 2V2XB 3VFOB 1XGZA 4B0MB 1AD0B 1IIIA 2JELL 3L3GB 4QXTB 3GC3A 4TQPA 3R7QA 2WBJB 2PYFB 3T9WA 3D4ZA 5KVGE 4LBEB 1R6VA 4BSVA 4KK6D 1J0KA 3CH1A 1A6UL 1WH0A 1EEZB 2FO4A 3VXSD 2ZX8A 1VACB 5CU5A 3N1MC 4P5RA 1P53A 3L7FB 4OR1A 4WI3A 1IKFL 4BE6A 2AK1L 2MNJB 3ZMEA 5F0JB 1ZLVH 3S48A 5AENA 2NLJB 5ESQB 2FIKB 3ZTNH 1B4TA 4G8GE 2NTSP 2VR5A 3NCBB 3GMNB 5LCVL 3QHZH 4XXCA 1V55B 1I7TA 3DSNA 2BMKB 2VKWA 3KYOB 2OMXB 1P1ZA 3RX5A 4N9GA 1Q0YL 1RI8A 3FUJA 1INQA 3MKGA 4ATTA 2FX7H 4KUCD 4CKQA 4DGWC 1VB9A 4IU2A 1CE6B 1DJIA 1RVFH 1FSKC 1YEDA 2BCKB 3ATFA 2A4ZA 3IXTA 5AW1B 2P5WE 2WK2A 3GDCA 1UT9A 2KZ1B 5I1DA 5JW4R 4QHMA 3IJHA 32C2A 3NN8A 4M6NH 4QCIA 1JN6B 4YHZH 2VB5A 1BQHG 5DJYA 3GSUA 2Y7MA 3BUBA 4Y16B 5MEOB 2KH2B 1EO5A 1W8OA 2A4CA 1NIAA 2H7WA 4L1LA 1KXTA 2VQ4A 3TA4D 2X1XR 4WFHD 1T5XB 3MACH 4A1RA 2IBZX 4KROC 2Z8SA 3ZKMD 2F53E 3BIAX 1R0AL 5TPWH 3UABA 1DL7H 4AJWA 3JWOC 3IB4A 2AHIA 3VFGL 5IQ7H 4G7SB 2VXSH 3LTVA 1TLMA 1D6VH 4G80B 4KQ0A 5KEZA 1M05B 4XNMA 3EH4B 1Y6KR 3C6LB 2VDMB 2EKSA 1Q9OB 5EA0L 4F3FB 5F9OH 1UM6L 4JY4B 5LQBL 4Y4FA 4FKEA 1DSFH 5SWSA 3QYMA 4ELKB 1NCWH 2RFXA 5K1NA 1RQ5A 2BIMA 3BAJA 4LARH 4G7VH 4PY7A 5ESAB 3S3SA 3B8SA 3HZYA 4H0IA 1JRHL 3A4DA 2AJXH 2Y06H 5H35B 2CGRH 3WMPA 1UWXK 4LOFA 5BRZA 1MI5B 3PP3H 2AC0A 3F05A 1JNHB 3PP4H 5F1NA 2OMNA 2Q76A 3NJFA 1QSEB 3R8BB 2CDEA 1XGQB 3QUYC 1IAKA 2OULB 2HFFB 4QRRA 5EIIG 4RNRB 2W94A 4WI8A 3QYCA 3EFDL 4HH9A 3VSQA 4PJDB 3CZEA 2VDRB 4X5QA 2WYTA 3B6SA 3H6JA 1TTGA 3V10A 4FQIL 4JVPA 1NCGA 4P4KD 1OE2A 2DICA 2FTAA 3TM6A 4OF7A 2Z93A 1XL6A 2VITA 3E8UL 3COOA 2CK0L 4FI7A 2PWHA 4UNUA 1VGEL 5AOZA 1AACA 1A8ZA 4XCNA 2V5YA 2NUPB 4OJFL 3FXIC 3D9AL 3WKQA 1XXFC 1S9WB 2NY0B 4PQXA 4P46B 4ABUA 2GBVA 4MLSA 3H2WA 4JFQB 4E9VA 1BOYA 2ICCA 5F1KC 4N0UB 5EO9B 4PRDB 4X9HA 4YDZA 3RKDD 2F7IA 1WIOA 1UOWA 3DHUA 1JZHA 3O3EA 1FL6A 4XNXL 4U3SA 2M1KA 4JFVA 2XA8H 2PCYA 5AAWA 1UXSA 4H20L 1LQSR 3UC2A 4HW6A 4FFYH 1VF5C 4J8RB 3MXWH 1J9CT 1QAWA 4PVMA 3P0GB 4N8VB 4DWHA 3DMMB 1G9MC 1WCQA 2JH2A 4V11A 4ES9A 1YUHA 4IMLA 3ARVA 2NX5B 3IFLL 3WUWA 4JM2D 2P5WB 2K9FB 5HVHB 5FEBA 3B3IB 3FH8A 4N90D 2ZX7A 2NNAB 2XKNB 1HHIA 4IBZA 4K7PX 4S1RL 3P73A 3H54A 4Z7WE 2BWDA 2ZG2A 3EKCA 4AMWA 1JAEA 2O61B 4Q97A 3KLQA 1DDHA 4LOUD 1RPQA 4TRPH 2XACC 1N70A 5E6IA 2XETA 4NJ9H 4GG8B 4JFOA 4ZOAA 2UVEA 1KZQA 2EIDA 1X3DA 3UXFA 1FPTL 3WI9A 1UD8A 3UTTB 4NPJA 3LOWA 1NLBL 1NBCA 2CNYA 2XU9A 4JRXA 1BZ7A 1L3NA 1G6RH 3ARZA 3QDJE 4LRNL 3VW3H 4RRPA 2IH1A 3PGFL 4QTIH 3BLBA 3DV4A 4I4WA 2MH4A 4NQXB 3WD5H 1BF5A 2WOYA 3E6HB 3SYPA 3KR3H 4HIIA 3QRGL 2Y2TA 4CVXB 4LNRA 4KBPA 5AYUH 3AAZB 5D7JD 3LS4L 1RU9H 2BP3A 1BLNA 3FRPB 3IJ8A 4JGJA 3QFJE 4P05A 5DLLA 3QUYB 4DZBB 1CN4A 4XCFL 1A6VH 3RWGB 3ARFB 4MJ5A 3EXLA 5IMKA 5SWSE 3JTTB 3GSRB 2IG2H 4DGYH 1M05A 3K72B 1BIIA 2OPCA 4XNMB 4DQOH 1DJWA 4JREC 2ZE0A 3FPYA 1MIEH 1O9VA 4HS6B 4FJZA 2G75B 3GSWA 4AGNA 5FAAA 3RURA 3BUDA 4QMEA 4CN4A 1FG2B 4M7KH 4BK8A 1JDCA 4FNTA 2AZAA 2HJFB 3KD4A 3LQAH 5I1EH 1SVCP 4XMLH 4AW7A 2J7LA 3CFCL 4M6OH 3MOBL 4MSWA 1WC7B 1XXDC 4PRHE 5GSVA 4ZDHB 2CO1A 4HMCA 1JERA 2NSXA 4PJEB 4MJ2A 2C4XA 2BSRB 3KJ4C 1AQDA 1TZIB 3PXJA 4Y4HD 1PDKB 3RWFA 1P4BH 1TXKA 4U1MB 4R5TA 1HWHB 3QH3A 5I9QC 2CKNA 4BV1A 5MP6L 2AEPH 4MXQD 4B9JA 4QJ4B 1S7UA 1EJ6A 2FD6L 1NH6A 5HI3C 1CLOH 1E9PA 4FNSA 4CC0A 1ZVYA 1KJMB 4PJAE 5BOJA 4KZEL 4X7SH 4HZLA 3HLKA 4JY6B 1L9SA 4H8VA 1WBXA 3MRFA 3EYSL 4QAMB 4AYFB 1FC2D 1ZMYA 4X0KA 5FW6A 3KGTA 3VFTA 1G7JB 2EADA 5IFJA 1HHGB 1WG3A 3LNEA 1OF2A 1UVQB 1QX1A 1U8MB 2QTVA 4WCYH 1EAJA 4D2NA 4NO3B 1EFXA 4JG1L 3KVPA 4DGUA 3L2NA 4K15A 2DTSA 3CK0H 1ADWA 2COVD 3L95A 5F7MC 4LPYA 2WJ7A 2R69H 1E4KA 3MRCA 4HUXB 5B38A 4OJDH 5TJWK 5DJ6B 5AB1A 4P2YA 2H26A 2WC7A 1KMGA 1LO5A 4H88L 5KG9B 2ZQKA 2JJTA 2DQ6A 3ARBC 1NIEA 3ZK0A 1ILSA 1RUPH 4JB9L 1RJCA 3J07A 5HHNA 2H2SC 1NIBA 2X44D 2HPTA 4K5MA 1K6QH 2CLVB 3IGLA 2C9VA 2C1OB 1MJ7L 3IU3B 3WHXA 4XTRC 1L9RA 2DWXA 3CUPA 2F5BH 2WTOA 3ZIMA 3NESA 1TQTA 4IIQB 3B5HA 5E7FA 2WXIA 3CFEA 1XEDA 4HXAH 1KY7A 3DO7A 1SOXA 4N3UA 5CIPB 5A2JH 1T4WA 4GRLC 4XBEH 4GINA 4K71B 3BGFC 4Y5VB 1LILA 3IFNH 1FNHA 4B41A 3FO2B 2OV0A 1A6TB 1K4CA 5JIHA 1IGML 3FU8A 1ZVSA 3G6AA 3HE6A 4ODSH 3O3DA 2W9EH 3L9RA 3SKMA 3U2IA 3UO1H 2NY7L 4U31A 4YHML 3KMDA 3VM5A 4N1HB 2PUQT 4GRMA 5FW7A 4GFXA 3AY2A 4QCIB 4QHMB 3MLWL 4RX4D 3FZUD 1MAKA 3KS0H 1PG7X 2YPLA 2BRQA 2R1XB 4TQ8A 2IDCA 2BK8A 3SPIA 5E51A 4PU2A 4EIGB 5EEVA 1QTYT 3ETBF 3KPSD 3VI4A 1TZAA 3DJ9A 4CRPA 2VXVH 5D71L 1P5UA 5KTEL 2YSTA 3LPWA 3NTCL 4TNFA 3MODL 3VRJA 3RY6A 5FO8A 1ZY9A 4P5TA 1SFDA 1BBDH 5FHAH 2FJGA 4RMUA 3WFHA 2D73A 3ES6A 4N2FA 4OF5A 3FUMA 2VDPB 3QQ4B 4R97C 4CN6A 5MHSE 4WFHE 4HULB 5D96B 5G5DA 1JVOA 3T6ZA 4JFPB 1MWAL 2VIRB 2Y07L 2GUYA 4F7MA 2FX8H 3ARFA 4MJ5B 5D5MF 4LHJB 3SE8L 1LD9B 1MDTA 2E7DA 3OB8A 2C3GA 1JL8A 2Z0BA 3NP4A 3MGTB 3WLWC 1VA9A 5JZ7D 4RWHA 5AFAA 4J6IA 1BAFH 2ZNWA 4L0PB 5GJSL 4K7FB 5ENWB 2VR8A 4MQ7A 3EJTA 5C9JA 1TETH 4KUZL 2HAZA 4PJXA 4JFED 4KI5F 5IVNA 3UAJA 2DMCA 3BWAA 2QQNH 3NSJA 4E9YA 3TESA 2Y0SA 2ITCB 2V5SA 3NJMA 1ITBB 1L3WA 4BZ2L 5DUPH 2XWJB 1CFNB 4ADGA 2NY4C 1ZT7A 3TN0C 2YPVL 1F4AA 3CDZA 1I75A 2YMOA 2DIEA 5AZ2L 3UYRL 1IAIM 4KOCA 4TKWA 4FQ1H 3KL5A 2WZAA 3QIWB 3LQZB 5D6CA 3MCKB 1WBXB 2NNCA 4KFMA 5AKTA 1WGOA 4OCRH 2H0FA 5EC1A 4E9QA 1C5DB 2OFQA 2WPGA 3LEYL 3B2VH 3FULA 3O6ML 4FQ2L 2XICA 1JF5A 2E6JA 4QLRA 1ACYL 1EERB 1G6VK 1Q4NX 2Z6FA 3IDJB 3MRCB 3MR9B 1DVFA 4TUUA 5BRQA 3CVDA 4JFXB 5FO9A 1F4YL 2QSTA 3IT8D 3MNWB 5DK0B 4EZKA 2DQCH 4Z5RB 3IM1A 3ARBD 1E30A 2AEQL 1X4XA 3CLFL 4Q4EA 2ZX9A 5CEXB 4NN6B 4GQQA 2I27N 2F54D 4XZUA 2EABA 5GS0L 1LWRA 2FIKA 5D7IF 3VXRD 1CICD 3QFDA 3FO1B 1LMKA 2CXKA 2FVNA 4G6JH 2VQ1B 5HHOB 3FFOA 1WZKA 1SYVB 4D94A 2FX9L 1EXUB 4WFED 3RL2A 2OMZA 3KVDD 1AS7A 3G5ZB 4WWKB 1T20B 5GGVY 1RZJH 3IJSB 5KVDL 1Q8MA 2YS4A 1RIVH 1VFBB 4TL4A 3ZSSA 4CADA 5HHOE 2NY1D 1OL0A 2IOMA 4HH8A 4WNSA 3WJLC 3QEUA 4PJBE 4N0YL 1YYMH 4WY7L 5I6PA 1N0XH 3LNHA 3P2BA 1AXSA 3J7HA 4PRID 4RGOH 1F6FB 1RU9L 1UUNA 3WE6B 4TSCL 1P84K 2Z3FA 4J28A 5KVFH 3US9A 4XODA 3IMSA 4X9YA 3UTTA 1U8NA 5IMLA 4AENB 1KXTB 5KJ7E 4Z3TA 4QYAA 5GJTL 5CKAA 2YEVB 1VJSA 4N1EA 3RWEB 2B08A 4JHWL 3VJ6B 3VU2A 1S7RA 4HKXB 3PHSA 1E65A 4XGZA 4RBPH 5FOBA 3LKSA 1IAIH 4BQ8A 5ICXA 5DJAA 1SN5A 3AFLA 5FOBB 1HAWA 3SD2A 5AKVA 3QDGE 5CEZL 1AOHA 4D0CB 1ZXQA 4XX1E 4TYUA 4D9QE 3LPFA 1P4LA 3VB8A 1JWMA 3MYZA 2DQTH 4GAGH 3SZKC 2FBJL 3VRJB 2OCJA 2PO6B 3SGEH 2XBZA 3E6FA 1PYWB 3GPEA 4GP5B 3ZL4L 1G9NC 2HJFA 1OGAA 2VDKL 5HDBE 4QJ5B 4LL1A 3RU8L 3CPUA 4MMZA 5D7HA 2QV2A 4Z76A 1FL3B 2NX5D 3GRBA 3WHE1 1Z3GH 2QMJA 3DJTA 3BH9A 2FH8A 3HG1B 4A63A 2W91A 4JRXE 1IAIL 5INDB 4JFYB 3OKEA 4GIPD 1ET8A 3ZL4H 4PP1C 3QZWA 2ENYA 4AQZA 2WSPA 3FQRA 4HSAC 4HWUA 2G2RB 3BH4A 4K07A 1B9KA 3RZCC 4E9XA 1GHFL 3RZCA 3S5LB 3T4YB 3JBG7 4I3RL 4I3SL 3OGCA 4AZUA 1T7VA 4KKBC 5TE7H 3WKMH 5EN2A 2Q1EA 4CVZA 4RGNC 1TJGH 5BS0E 5T1MA 4UDUB 5FW8A 3ZL2A 4K3JH 1SYSA 2C26A 3C8DA 5H94A 1NKRA 1ND0B 1KN4H 1X5LA 2XWBB 3KBPA 3MLVL 4DPAX 1IBGH 2XN2A 1MN4A 2QPSA 4Q52A 5F8QC 3BZ4B 2AJYL 4OIBA 1IZKA 2XVBA 4TLSA 4EIBA 1B3IA 4NP4L 1MY7A 3BDXA 3GYRA 5EORH 2YMXH 5GRUL 4KUZH 1HXYA 4RAVB 5TE6H 3HC2A 2R4SH 1BXVA 3D34A 1KZYA 2UZYA 1G0DA 1QLFB 4P2AA 3SQRA 4E5XB 3E1ZA 4KITB 2OTUB 1IBBA 1XB6A 2NYYD 1IBFA 3WEMA 3X2QB 3BZEB 3W0WD 4UIMB 5D7IB 3LIZA 1AGDA 3QHFH 5HHPA 3W0WB 5FM5M 2NMSA 4U1SB 1JMZA 2OR8A 3ZZSA 5L7XL 2A6KA 3RUGA 1I8MA 1GRWA 1Z9PA 4M8RA 3B2DC 3V0JA 4G8EB 4ODUA 2Y4SA 5J56B 3QT2A 2AQ3A 5EU6A 1HH9A 4L3CA 3VFVA 2ID5A 5CIPH 3P73B 4MNGE 3AT9A 2WCPA 3HPLA 5L4FA 1AG6A 4KNTA 2IWFA 4DUXA 1GXEA 4TRPL 2EXWD 4XP5L 2VLKD 4OV5B 2WSDA 4M6AA 4G6FB 2WO4A 3B7UX 4XO4A 3RNQA 1NPUA 4KGLA 6PCYA 4L8CB 4TNGA 2A38A 5DJYB 2BIPA 3HE6D 5JORA 3LKSB 2WLYA 4JZOB 3EF7A 3X11B 5K9JH 1A6AB 4M1CD 5CJ5A 2B3RA 3P4NA 1S9VA 1JGLL 4PW9A 2CDFA 3LXAA 3MV9D 1CU4L 1BZ9A 2J2ZA 3IU4L 2NY3C 2PCFB 3O6LL 1W8NA 4WGWB 3TIEA 5T1KA 4IHOB 4NXKA 3G5XB 1LP9B 3K6OA 5AYQA 4UOZA 2DQHH 2JNZA 2R2CA 4UQAA 2XTSA 3TIEB 2VOTA 3T8VA 1FZOB 5FK9A 1RZ8B 1XF3B 2A9CA 5TFSL 2ERJB 5J9PA 1VADA 1QKZL 5CZKA 4CMHB 2KPWA 3GXDA 2RFXB 3RWIB 2D7NA 1GYAA 3HBQA 4NQVA 2AKRB 5JHLA 2SEBA 5D5MB 3T0AA 1RZGA 1XGYL 1U8CB 5D9SB 3ZKXB 3QIBB 5IOKA 4MB4A 4BK4A 4IOSA 1YN6A 3LZPA 4W9JC 1DEEB 2PXYA 5EU6E 4F33A 3QUXD 3WTXA 1IC7L 4L9LB 3FQWB 4JM2B 3TASA 2L7JA 4PMFA 1DQDH 2DMBA 3TL5A 3MXVH 3D4CA 3MBXH 1E42A 4H26A 4XTRD 3TNMA 1UA6L 5A7BA 2CO2A 3DX9A 1QW8A 1C8PA 4ZXBB 2NRDA 4NZUL 3JWNG 1GC1H 1MHCB 4ZXBD 3SBPA 3HG4A 3L2LA 4XHJD 3DGDA 2EC8A 1PAMA 2JFCA 5SWSD 2PW1B 2FR4A 4A2HA 1KENL 2FEDD 1FVDA 1YPZF 1KC5L 4YXLH 3QFJD 4NSKB 4CNIA 4F7CB 1ZA6A 3H53A 3O2WL 1KB3A 1GOHA 3FFCA 3UL4A 1M56B 2B0SL 1ZEAH 3H2PA 2E5EA 4DTGH 3Q43A 5GXBB 3MR9A 1EJOH 4Q9RH 1JD9A 3LN9A 4FFYL 4R7NA 1A6PA 1MRDL 1W72B 5F72S 4ZFQA 2BOBB 1Q0YH 3LCYA 4KI5E 2BRRL 4QTFA 1JZ8A 1CLVA 4M7LH 3ARDD 1NIFA 1SOQA 2GJZA 3NIFF 3RGVA 1JJUA 4ZOBA 4EN3C 1NFIA 3CLEH 4MAYC 5DMYA 1HX0A 1YEKH 5I1JL 3BAIA 4E9WA 2IWEA 3VD4A 2G60H 2HFEA 1ONQA 4XPTL 2JJUA 4FG6D 4Y1AA 2X4NA 2HFGH 1JYVA 5FKAB 4LSDA 4OCXL 4PCKA 1VFAA 4HU2A 1XFPA 3ILQC 2XXGA 5FYLD 5JQHC 2EE9A 5D7LB 3CIAA 2Y6TE 2LR4A 5JOEA 3MLSH 1BW8A 1RUPL 1TQCC 4MS8C 2V9TA 4M6MH 4Y4HB 4YDIL 5L88H 4IKJA 3WDJA 1O7SA 2P8PB 3BP6A 1WZMA 3WD5L 3RY5A 2ROYA 4N2IA 1KIUA 1XGUA 4PGEB 4H0LC 3KYOA 1M1XA 2A6IA 3A6BH 3R1GL 1FO0A 4AQOA 1RURH 4F2FA 5IG7A 3OKMB 3ZXAC 4R4BA 3OJDA 4OCYL 1CGXA 1GIGH 2WIIA 3HFMH 4QOKA 4WWOA 4J5VA 4QRRE 3T09A 3SCMB 1AANA 5DC4B 4F37K 4ZFFA 1NCOA 4N22A 3X11A 5ALBL 2IADB 1SN0A 1RURL 1USZA 1X5GA 1XB3A 3DRQA 2O5ZL 3B56A 2EDJA 1EXHA 1U95B 3WXVL 3SYQA 1AD9A 4CA4A 1NL0H 4E9TA 3O8XB 2O1AA 4A55A 3RWDA 4NQDB 1NCBL 3OAYH 4LNRB 5BZDB 2C9QA 3EOAB 1U8KA 3NABL 3M7OA 4NQVB 4NQDD 2F2HA 1JZDC 3ZDWA 3U1SL 4APXB 4WU7B 2D7OA 1D2OA 1CGYA 3ATBA 2WXQA 3HR5A 4XVSL 1SQ2N 3U0TA 4LCYA 3II3A 1T89A 1T89C 3S37X 1WLHA 1UGKA 2H6PA 2NY2C 3I6LD 4PJXE 3CVIL 4BKLA 4JPQA 3CWGA 4YE4L 4OCWL 2WXNA 2WP3O 1HHJA 4G8FA 2LU5A 3O6FA 4JM4H 4JN1H 4MD0A 1MFEH 1TZ8A 4PTUB 5D93B 1GTFA 2MEJB 4IRZA 4PWEA 4OJFH 3H9HB 4HPYH 3STBA 3UEZA 1W72H 3UTQA 2F58L 1BD2B 1A6VL 2IANE 3TYGH 2E7LA 4P4KA 4E41E 5ANMB 3FUNA 1HKLH 4TUKL 3T71A 4R83A 4B9FA 3F12B 4FQIH 4W4OC 3TOPA 4JEGB 4B9PA 4EVNA 2I25N 2J6EH 4KI5D 1DFXA 1DUYA 4BFBD 3D2UA 4NQTA 4A6YL 3K8KA 4JCWA 5C0JB 2HT3D 3BKYH 3P3TA 4YX2H 4RISL 4NWUL 4N0UA 3KYNB 1MCOL 3CX5J 5BO1L 1OF2B 2CDGB 4XZ4A 1S9WA 3TNNA 3ULSA 1I82A 4YXHH 3PABB 4F9LA 1SJEA 4UDTB 4MXWH 3H9YA 4K23L 1XCTA 4JFTA 4KDWA 3UG4A 2B14A 5GS0D 2UXFA 1MJJB 3ARQA 2IPUK 3FFCD 1OP4A 5G4MA 5DHEA 5TDOA 1SQMA 2D2CC 3GUTB 2QHRL 4Z7UA 1YEKL 4GKZA 5AB2A 2UY7B 4IYKA 2PYEB 4OLVH 3HZKB 1AQ8A 3WIFB 4JQXA 1OTSD 1ZWIA 5AVXB 3WFEL 2HH0H 3OXSA 2ZUQB 3ZDYF 3P0VH 3BEVB 2I07A 5E6UB 5DJCA 3SDDC 5HYQB 4LRIC 5I71C 3STLA 1P7QD 3ARGB 2IAAC 2EH7H 1A7PL 1IGFL 1IIKA 3DBXB 5KS9F 1ZOXA 5EOQH 3TBSB 2L4OA 4D8PA 2WIIB 1Q94B 2YC1B 2C4FU 3RKDC 5JHBA 3EOYG 3W0WE 2OYPA 3HE7A 1QEWB 4X99B 1FO0B 2BJMH 4ONFH 4G82A 1T7ZA 1A6WH 2YWZA 4LPXA 5JORB 4FFYA 4UQ9A 5LAXA 3TH3T 1BEYH 1L6PA 4P46C 1FCCA 1DANT 3NG5A 3EO1A 2VN4A 4X9BA 5FFOA 5K39B 3R7RA 4G43B 4WV1C 4N0YH 4WY7H 3EYQC 3EGDB 3QG7H 3QORC 3KCWA 2O93L 1YEEH 3O3BA 4PGBA 4E0RA 5F3FA 1I85C 3CN2A 5I8OH 1AKPA 5BW7C 4M1CC 1BZQK 1TU2B 1W80A 4XN8A 4GEIA 4CSSA 4HK3J 4QHKI 1M57B 1G9EA 2JF1A 2D8KA 1H3PH 4J3OD 5DHVA 5DGQA 6FABH 5E8OA 3QIWD 2QR0B 4ZYKA 1IL1B 1XGYH 1NCDL 2A6JB 3MTRA 1CGSL 5FV2A 2CSPA 4HLJA 3U0TB 2R0ZL 2H41A 1SEBA 2DM3A 4OZFB 2X70A 4F7TA 4K23H 3M1OA 2BDNL 2V2WB 1ET5A 4LEXH 5ADPH 1FORL 5BJTA 2AAAA 2OK0H 4PJ9A 1MF2L 1ZLWK 1T1ZA 5ITFB 2XKSA 2XTJD 2FK9A 3WFCH 3QFJA 4MB1A 1NCDH 1E40A 1RXLA 4PB0L 2AJ3A 2JJWA 2JXMA 2R56L 3HI6L 3ZMRA 3OF6A 5C7XL 1VDGA 3CC5A 2J72A 1EHLL 1ECYA 1J8SA 3BWUF 5SV4A 3ZRSA 1C12A 3OKLB 5ERWB 1CYXA 2QVFB 5D6DA 3UTOA 1BJMA 1CMOA 3B9KA 1I9JL 4OFIA 4R26H 3U82B 4G59C 2HRPH 3SSGA 1OT1A 1DQIA 4LRIA 4JY6A 4WTXA 1PLGL 3THML 3M7FB 3Q6FA 5L8KB 1GA2A 2DQDH 5E00A 2VMDA 3DX7A 1TNMA 4F9PA 3D25B 3EYFA 2ZOKA 4BK5C 4HFUH 2D3LA 3S34L 5F93C 2JKTM 4G72B 4RDQG 2B1AH 1KACB 1IKNC 4X7EC 2ZWSA 1BAGA 3KBFA 3FH5A 4N0RA 1BFOB 3WGVB 3NJXA 4ZFZB 3VXRE 5IHUL 3I3DA 5C70A 5JPNC 5KYYA 3NSDA 3OB0H 4U0RC 1M1SA 1N2RB 1OGAE 3BN9D 4PJHF 1EV2E 2MQGA 2PYEE 4WIQA 3KPMB 3IRPX 1H3GA 3PJSA 2EVHA 3GUFA 1R24B 4OAWB 3NIFB 4XO3A 5CO1A 4P3DB 1KBGH 4JRYD 1LWHA 3RGVB 5AAMA 2ZOLA 4HUWA 2QJDA 3DIFA 3FO9A 5KVEL 3RGVD 3M1BA 4WENB 1Z5HA 2CCVA 2EXWC 4NQQA 1ZIAA 4X9FA 4PR5B 2N0MA 1A1NA 1YMMA 3AQYA 1HXKA 3DMMD 5DLML 3UBFA 2PWEA 1JG9A 2R2EA 2ZKYA 2Z34A 3NH7L 3QEHB 4GMTH 4JUSA 3RZCD 4ZUUB 1DCLA 4Z78B 4AEEA 4LLQA 2GJPA 2R2EB 4OT1H 1YEDB 25C8H 3HFML 2WWMC 4OI8A 1JPFB 2DDQL 4N9GB 3ZQWA 2AP2A 3VXMD 5C0EB 2PWGA 3BKMH 3RUGF 3FCTA 4QNPE 5FUOH 4ZNCD 3UDWC 4RQQA 2PCFA 5AZEH 2AEIT 5GZNC 1TU2A 1N67A 1A47A 3U6XA 1SN2A 4PCTA 2ETWA 2QZQA 4BFKA 4Z6AT 4ADIA 4UF7C 4L5FE 5I6NA 3SPCA 3HMWH 4JANA 1HEJC 2QFRA 3EOAA 3U7YH 3EYVB 4X2UA 4G7VL 3IKCB 4FOMA 4HBCL 2MMXA 5K39A 5K9QG 1XR8A 2YPKB 4AMKH 2GIMA 1SDDB 1RIVL 2JI2A 1TQSA 3GZOA 4HCRH 4KJQC 5IMOA 2FT6A 3N50A 5MERA 1UEMA 5A7EA 3ULVL 1MFAH 4APQB 3G9AB 3O2DA 4XX1G 1MWAH 2EO9A 3B2MA 3HCVA 2F08A 2B15A 2A73A 2ZCHH 1BZ8A 4IKIA 3UCQA 4Z3IA 3WFHB 5HVWA 2R0ZH 2WXHA 3NJLA 3D09A 4RSVA 4GSDL 4J27A 5C0DB 1KYDA 5EEXA 3I85A 2Z64C 1XZ0A 3QDME 2DYSB 3ZUCA 4WJ5A 3DX9B 3P3SA 3BQVA 2VUYA 3UGEA 1LK3L 4PUBH 4PJ8C 5HHQB 1QLEH 3CSPA 5IB5B 4L5FH 1TCMA 5I76B 4JHAH 1MCKA 1JOIA 3LMJH 3O0RL 5DMGC 3KW8A 1TEFA 3KPQA 3O2VL 2UUDH 5AL0A 4YLCA 1F42A 1W0WA 1CTMA 3RB5A 4MWFA 2AJ3B 1SBBA 5CN2A 1L7IH 5CUSL 5CILL 4GG6E 1S7UB 4AYGA 1I8IA 2MFNA 4MWFB 3VGFA 1AYRA 4R8WH 4DN4L 1T5WB 3X3GH 4G9DB 1GAFL 3NCEB 2FWSA 2LU7A 2R0LL 3P77A 4BE5A 2VDNB 1S7WB 2F5AL 2WP3T 1DJGA 3GBML 3V0FA 4U6XA 2E4TA 2H0JA 4LLWB 4PLJD 3VGAB 2J1KA 2AF2A 5MHSD 2AK4A 5J6GB 1I8UA 3PWNA 5IFJB 5C86A 4X80L 1S78D 5D1QC 4L3EA 1S5HB 1RUQL 1XTLA 5CGMA 3Q01A 3PPEA 4PGCB 3ZYJA 4CDGC 3V6FA 4C56E 1GMEA 5T1JA 1AZUA 3DX0A 4WHCA 5LG6A 1N2RA 1CT8B 3GHBL 1KYUA 2AJSL 2VLRA 5HHNB 2NUPA 1UXMA 3FT3A 3W9EB 4Q8BA 4IIZA 3SDXF 3BXNB 1H6UA 4OZIF 4OLVL 3INOA 5LBSA 1BBJA 5C0RL 1LO5B 5KG9A 3TWCL 5LBVA 3K2UL 6TAAA 2H47C 3MRKB 4E68A 3RPIA 3TF4A 3N9GL 4FZEH 4HXBH 5HPMA 3VACA 5CJQL 2PW2B 3LJ3A 1AMYA 4GKOA 1V7NL 2F1AA 5EPMA 2HN7A 1ADQA 1QFWH 4OIIL 2JJTC 5BXFB 5CCJA 5I8KL 1A1OB 3VGGA 3AY4A 1HXMB 4LT7A 2NYKA 5FGBA 1ACXA 4HJJH 2IBZY 2ALAA 3OKMA 3HI5H 4HJGA 3QG7L 1B6DA 5D4JA 1E8ZA 3SPGA 5B1JC 2BIHA 4NUQA 3UROR 4N90E 2YGOA 4YHLH 4MTMA 2X2YA 3PV6A 2CR0A 4JZNA 4CU7A 2D3NA 5F96H 2R1XA 2JKWA 3HTLX 4NZUH 4XP1H 3REWA 1IC0A 3T0EE 4ZS7H 3O2VH 4ZTEA 3IJ7A 3W2DH 3WIIH 3KBHE 5J06A 2Y7QB 3AROA 3WIHA 2VZUA 4X83A 1NBQA 2QPUA 5E6IC 4QY8B 3MHZA 5LCVH 1L9QA 4RMWA 4DFIA 4M8QA 2J88H 1BZ7B 2EYTA 2DWSA 4YPJA 8CGTA 1X5ZA 1ZD6A 2CR3A 4JANB 4O02A 2NCMA 5DUBA 1SDAB 2VT0A 1AZRA 3MFFA 3ZE1E 1CD8A 4JPVL 1D5ZB 1HL9A 4AVHA 4BH8A 4E41A 4QTHB 3CCHA 1A4KB 1ZS8B 2ZCZA 5EUOB 4NN6C 4E9SA 5KAQG 5FYKU 1GHFH 3CCHB 3F62A 5GPRA 2DQFB 4QRPE 2N56A 1QBML 2NUTB 3QNYB 4GRWE 3GTNA 2VC2B 3D2TA 2O26U 5C07D 3SY0A 2EC9T 4Y5XB 5AAPA 1I7UB 3SCMC 3QE5A 2OBGA 3FC8A 4R0LA 4EEEA 2N7BA 5SV3A 4MAUH 4Z3GA 4JHBA 4OLXL 3BSHA 2JMRA 3OAUH 4B9IA 3NFNA 3W57A 4K55A 1V5JA 2HYMA 2VZ1A 3HRPA 4R3SB 1HCZA 1C7TA 1K8IA 2NZIA 1JS4A 4OM0L 3UX9B 1KGWA 1AHKA 4O51A 4M48L 2E47A 5E5UB 1FH2A 3QQDA 2YMXL 4G5AA 4Q4IA 2DM7A 1J0JA 3MV7B 2IJ0C 2PPFA 4HCRA 3W5NA 2ADYA 2JSFA 4A68A 2XWBA 5FWRA 4BFGA 4Z7QF 5K1JA 5L2KE 1Q9LB 1SYSB 2JIXD 3D08A 3GINA 3ZHNA 4HZLB 3PWLA 1UACH 4OGZA 1I8IB 3H2QA 3TBVA 3WG7B 2Z93B 1OWWA 4NQED 4BWTA 1CXLA 1X6LA 5T3XD 4X7TA 1OAZL 1AHWA 1NAMH 4XPHH 3GRGA 3B6SB 2HJLB 3NP3A 4P9HH 3D48R 5KSAC 2CJ3A 4K7PL 3N85H 1WAAA 3PWJA 3FTWA 1QYGH 4AH2B 4Y8DC 4KK6C 1URLA 4ES8A 3BZ4A 4BUHA 4XMKH 1MCRA 2CLRB 2QVIA 2R51A 5ACZA 1VCAA 3QS2A 2WLZA 1PZ2A 4JREB 4HEPG 4W93A 2JVUA 3DOHA 4KPHH 5E1HB 1OP3H 8FABB 4XNXH 3O9WC 3TWCH 5D2LF 1AGEB 1I4FA 2L3BA 3HN5A 3ZUNC 4UQEA 2DM4A 3HJEA 3H9ZA 4H4NA 5GGUA 1GMIA 4KI1A 2QHRH 2OJEB 4QI3A 1ED3A 1FNLA 4MHHG 2A9NH 3ARBA 4WLCA 2P8PA 1GSKA 2DS4A 5IEHA 4XCYA 2EUXA 2V17H 3VQ1C 4YSTA 1EJOL 2WXMA 3BPOB 2NT0A 4X80H 3VFSA 1HH9B 2JI1A 3VFVB 1K2DB 1NCCL 4OTXH 4X99A 5HDOA 2HVKB 4HVBA 1ITCA 1UKSA 5DYOA 1NL0L 2XBTA 3TBSA 1AHWC 5HD8C 35C8L 2LFGA 2CCLA 2PCXA 2MPAH 5CGYD 1BFVL 1QNIA 1WF5A 3MFFB 3L5XH 2J57A 4XP9L 4XPGH 3X1NA 2NZ1A 2H9GB 1XB8A 3MRQB 3O9WD 2E75C 3MREB 3FTYA 3MUGB 1EAPB 1T0MA 2HXAA 5HGAA 4N68A 1U8LB 1F3RB 1CI3M 2FATL 4BQBA 2QMKA 3TTYA 3VFNA 1LEIA 4HEPA 4P2OC 3T2QA 4NX0A 1WT5A 3CZKA 5KOVC 1ZRUA 1MREH 3RWDB 4EAEA 3GO1H 3NPSC 3FHEA 3ML8A 4R7VA 3FSZA 5T8IA 1DANU 3BQUD 4BQCA 4KAQH 5DFVC 3WS3A 2J5LC 2EDOA 4K94H 1U8PA 2ZT9C 3T8XA 5L2JA 1AQKL 1O75A 4GBXB 1JVLA 2JIXB 1P84J 3BP7B 4JJ5B 3DVFA 3FB7A 4YDKL 4BDVA 5FGCE 3V4VL 1U93B 2DWYA 3CZFB 3I3EA 1OAKH 3I6GB 5GGQH 2ITCA 4BHUA 3MBEC 1CDJA 2VDOH 5JHLH 3P4MA 4RFNC 1ZGLB 4GRWF 2DLEA 5CSGA 4QHLB 3K80A 3NCXA 5IUSA 1T0OA 2E86A 5ID1B 3GF8A 3ASOB 3MOQA 4R4FH 3STZB 3TCXA 5E7BA 2F5AH 3S5LA 5FUZH 3NRQA 1ZKAA 2YQBA 3ISYA 2PO6D 4K9JA 4NGHL 1E27A 3PWPE 3Q6FB 1T7XA 4Y2OA 1DLFL 4UANA 3I9IA 5L6YL 3NIGE 2XKUA 4YQXL 1I9JH 4R26L 3TNNB 1MW0A 1L0YA 2AK4B 5J6GA 1D9KD 4K3GA 2BSEA 4OLEA 1C08A 4ZS6D 3BE1L 4Z7WF 3Q3GB 4A7SA 4Z5RA 2X42A 1AE6H 2ADJB 1N19A 4FEMA 1B88A 2IQ9L 3M17A 4JFXA 4O58L 4OU3A 4AITA 1P6AB 1NGWB 2MHAB 3BVVA 3JWNH 3TZVB 5I5IA 3CH1B 2P24A 1V7NH 5J11B 4WUUE 4QF1A 5K9KA 4JKMA 3DPDA 4UAHA 4P9HC 2P5EB 1YYCA 1CGSH 3HMXA 3U4BH 1G1CA 3CDCA 4KZCA 5JLZB 1HSAA 1WK0A 3FJTA 1JGDB 1MJ7H 2M8XA 5DURB 3S4SG 1ED3B 1I3GL 2E56A 4NCC2 2Q2EB 3DXAE 4Y5VA 1IRAY 2CRYA 3OHXA 4H2AA 4E5XG 5DURD 5B4MC 2O5ZH 1PIFA 4J1UB 2QPDB 1MHHA 1PZ5B 2CIIA 1X7QA 1C16B 2ADGB 2X9XA 5GGRY 1I8MB 3HS8A 1H8SA 4LLDA 3C60B 1PNDA 2IG2L 2WWOA 3O11B 4DGYL 1MJUL 5EDSA 4TOYL 1CXEA 3FRUA 2VDQH 4GMSL 3UTSD 3VXTA 2IMNA 4AQAA 5DVKA 3NJGA 4HKJB 4I0PA 2N7AA 3NSFA 1CDBA 3ZJAA 1YJDL 4QDGA 1NDGA 1M9WA 2DDQH 4WO4D 4ZD3L 3MV11 4KJYB 2ZYSA 4L05A 4RGMB 4AG4H 1KIQA 1RSFA 5CEYA 3WNOA 3HC4H 5GZOA 1V7MH 1UFUA 5F88A 4ZQKB 1BXXA 3RI5K 5KVGL 4J3OG 3AXHA 1OGSA 1JXFA 4JRFA 4ZMWA 1NGYB 5CZXC 3CVCA 2H9GA 5F21B 1S9YA 4QWWC 2ZYRA 5GGTH 1MCEA 3OJVC 4JPKH 5IREA 3TEUA 5IV2B 2Y07H 4N5ED 2LVEA 3JUYA 3A6CH 5GRJH 5D7IE 2XYCA 1QUNB 3C09C 3F7QA 5KW9H 2HUEA 3ZL1A 1UOKA 5LQBH 1NBYA 1ZGLM 3NABH 4UWQB 2PO6C 2Z4QB 2WMPA 4HLEA 4UV7H 3H55A 2Y5QA 3OAUL 3BRFA 2FAUA 2NCEA 5IJKC 4JLRA 1BAWA 2O6CA 2VAJA 1F8TL 2ZCHL 3CFDB 4RIRB 3AS2A 3ZDXF 4Y2DB 2GJ6A 4OD2A 4QRPB 5E03A 5D71H 2DB8A 4PB9H 1OP5H 1M3IA 5HGDA 3STZA 1JXGA 3LRKA 4MNGB 2IXQB 2BS9A 4BRJA 5EBWA 2FWUA 3L4VA 1MIEL 3AREB 3KWUA 1JTTA 5CJXA 3VFUB 2W9LA 3BEWA 3GK8L 3ARED 3OKEB 4LCCA 1U93A 2X1WL 1KIRB 3BIBX 3CZFA 2E74C 5DI8B 3MRPA 5KSBE 1MVUA 3HNVL 1ZLUK 3SE9H 4Z3FA 3I9GH 4G9FE 4PV8A 4LCCB 3FMGH 4JRXD 4K8RC 2AK4E 5FM8A 3RKPA 3D9AH 4G3YH 2DWDA 4HIPA 4OZGB 3S35X 2J6EL 5CGBA 2H1PL 4A2FA 5F1NB 1E5UI 1LE9B 3QUMH 5D7KE 4S1DC 3HKFA 4LDCA 1B2YA 4NFCA 3HNVH 3O41B 1INEH 2HJLA 3F83A 4G9DA 4DGVL 1MJ8H 5JHDA 4FTVA 1X6NA 2A9DA 3CFBB 4F2ME 1P1VA 3P02A 2YD1A 4LL9A 4YE0A 5ACLA 5C6PB 2YEZB 2R56H 3HI6H 2XY1A 4EIUA 4M4RB 2EACA 1E3XA 5BV7H 3Q9PA 3ZE2B 1CUOA 2F0CA 4M43H 4NO5A 4P59L 3ZTDC 4XVUD 1BEXA 1SFHA 5IB1B 2VDOL 4P2RA 1ZA3B 2EECA 4WSGA 4PYHA 3CVHH 5E08L 4NWTH 3BVTA 5T3XE 1S5IH 3UTSB 3DVNB 4G8GB 1FJ1B 2LT9A 4PJ7A 4LZKA 1AR2A 1FL6B 4KI5C 3TJEL 4BHUI 1KWGA 1XF2B 3IPFA 1J05A 3CFKB 1NCJA 2P52A 4NXSA 2J4WL 1VZHA 3BMVA 1MHHB 1PZ5A 2CIIB 2AERT 3CXFA 3JVGA 3QCVL 3HFFA 2ZXQA 5B3JF 3U1PA 2XIDA 1O7DC 2M2DA 5LNGA 3G08B 1J8HD 2B9BA 2OMBA 5LJYH 4FQQB 3V5DA 3RG1C 3BGMB 2BS8A 1R1CA 3VFSB 4PRIE 5IJCC 2PLTA 5F3BB 2CO4A 3D87B 5JLZA 3TO2B 3D3VA 2W65A 3BKCL 5IEHB 4POZD 2DQUL 2BCMA 4UT9L 1YUHB 4IMLB 1QRKA 4WHYG 5KZCB 5CR1A 2E6QA 5LCVA 3T0EC 1WS7A 5DD0L 4UQIM 1BM3L 2BY3A 3CSTA 3V0IA 3G6JA 4GB9A 4ODUB 3PWPA 3DV4B 4PD4J 4LLDB 3MRRA 5DR5L 3ARXA 5EBGA 2ZPKL 5CBAB 4ZOCA 3MI6A 1EAPA 1T0MB 4FQPA 4L1BA 5A2BA 1ZLDA 2WJ5A 4P9ML 2SODB 3WIIL 1OM3L 5TE4L 4QXWA 2AVGA 1F18A 5GGVL 3QDGD 3RVXD 2UWEB 5IMKB 1J8HA 4AIOA 4Y9CA 4RLDA 4APXA 3P4NB 4GMTL 3VXSA 3TFKC 5AW5B 4ELME 1OAKL 5GGQL 2BNQE 5BZDA 5TDNB 1ZK9A 3EIFA 5I8EB 4UQBA 2Q7YA 1Q9OA 1LE5A 4DERA 2WVVA 1II4E 1ZV9A 2EJ1A 4QHUB 1GGTA 1O5DT 3HOGA 4HDIA 2IBGA 4FJYA 1U92A 5AUMB 5JA9A 1HKFA 4O2FB 2BDNH 1OLZA 2DWEB 2WWNA 4NJAH 1KCKA 4NRZA 3KEHA 4LSVH 5AG8A 2N4IA 3MA9L 2OMUB 1U3HB 1NJ9B 3NPSB 4FFZL 4LVNB 4XHQA 3V0GA 4I48B 4HXBL 1ZJAA 5BQ7A 3WXWL 1PX4A 2X4UA 5J12C 5EIQA 2ZSVB 5EB9A 1MVUB 4AK1A 4BDVB 1X5MA 2IDSA 1ACZA 1BQHA 2X4UB 3QNXB 3PGCB 2K3TA 5CEZH 3O6FB 3BVUA 4EI5A 1JHTA 5FC9A 4BZ2A 3MCYA 1F45A 2D7TL 3F12A 3BFOA 4HCRL 5EBWB 2C3VB 4OD1L 3O41A 4M5ZL 4QR7A 4WF7A 3T2NL 4P2QE 1AHWB 4YHLL 4N2CA 4OLWL 4B0MM 3DO4A 5FHBL 1VFUA 2EIMB 1G7IA 1BQLL 2ZXGA 4Z18A 3WOVA 4GQZA 2KLRA 5B39A 2CBPA 4RZKA 4PV8B 4KRPB 1I7ZB 3TF7C 3W11D 3SE6A 4HHGA 5IFHH 3EFOB 15C8H 1UWEH 4ZMQA 2C1PB 5A6LA 2VC2L 3FQXA 4PP2A 1OSYA 1I3GH 4AKQA 4HX1B 1C1EL 3V4UH 1KJ2H 1FQ9C 5DZOA 3NZUA 4F2MB 5SWQB 3SKNA 4R7NB 4YH6A 1MRCL 3ZHKA 4Y1SA 1MCCA 4I9XA 4NWTL 4EXKA 5K1VA 2EDWA 2LU4A 4FGMA 3DGGB 4UYQA 4WTQA 3V52H 5JDJA 4N20A 3SE4C 1KGCE 4XHJC 3QEQD 1SXSA 3CZJA 3OC8A 4ETQA 3EH1A 3MLRH 4PWIA 1YMHA 2BIQA 3N41B 1KIPA 4HBQA 4LPVA 3LHPH 3BGMA 3M1BB 4XNDA 2I7OA 2NNFA 2WVSA 3UTTE 3BDYH 1KEMH 3SJVB 3S3DB 3FB8A 2K9UA 3DK0A 4KWUA 5J1AB 3KG5A 3CHSA 2HVKA 1MCSA 4MAYD 5IG7B 2VNCA 2O61A 4JFWA 5E5MB 2XV3A 4JZOA 3QEUB 3VDAA 2VLLA 4ANVA 2YRLA 4NQCE 2FSEA 4MCNA 3SGEI 1YMME 5KJRL 4OV5A 4MMYB 2ZWZA 2PXYD 4PRNA 1OOAA 3FCSB 1FGVH 5IJVB 4K5LA 2YPKA 2PTTB 1WWAX 4K73A 4XNZB 4F8OA 3OLIA 4HFWB 1OCRB 3MYJB 4WO4A 3QEQA 4MZRA 5FOJA 4XVUC 3GMQB 1L9TA 5FLVA 1DJSA 2WANA 4PJ5B 2VM9A 1R5VA 9CGTA 4NKOB 3CTTA 4HS3B 3MC0A 2XWDA 3UACA 1RIUH 1F00I 3QZPA 3HPJA 1CFSA 1XIWD 4HUUA 4B3VA 4RH4A 5I66A 4R7DA 4FHBD 2XQ0A 1DQQB 1P5UB 1BWWA 4TLTA 2K6WA 2QPFA 4FI6A 3B7YA 4X98A 5IBTL 1PKQB 2BFVL 4MAYA 1H5BA 5DS1A 2QADD 4KPHL 1MW3A 4N1CA 4AYMC 5EO0A 1XSJA 4DVRH 4ZQTA 1J5HA 1JI1A 1U8CA 4CJ1A 3S3JA 1QSEE 3MRMB 4HF5L 1AQKH 2VN6A 5CN3A 4XCFH 4ZW7A 4FQLH 4KNQA 1F56A 4J3XA 3SKUD 4K8RL 1N7MH 3KPQB 4HUNB 5HI3D 5I17B 5ID1A 4JPVH 1JHTB 4K3DH 5HHVH 1FHGA 5IROD 1OP9A 4OZGA 4TLUA 3CQQA 1R3LA 4JKKA 4YK4C 3IMTA 4HJ1A 2ITFA 2GKIA 1WCBB 4L4TE 4NO0A 2YUXA 3QDMA 1CPUA 3NZHH 1KBWA 2PPDA 1LHZA 1MCPL 3FCUB 4Y2OB 3BP5B 3DX6A 4N9OB 2MPVA 4NUGH 2KLSA 4JQIA 1QBLH 3IMRA 2Y1VA 4ZBJA 1FUNA 4ODVH 1IB5A 2C4FT 3P54A 4X5RA 2KT6A 1O0VA 5GS3A 3EYSH 2NNRA 5EZLA 3GJEA 4K3DL 1MZYA 1FVDB 4G6JL 4HUXA 1A4JB 2OZNA 4K94C 4Z7UF 3WXWH 2ESVA 5T33L 4UTAL 5D7KD 1CLYH 1KLGA 4UM9A 2GHWB 1ULVA 4QRQB 5HGBA 5EOQL 2WWKT 3MPCA 4LARL 4HOZA 3L1EA 3NCJL 4PJ7F 3GHBH 5L8LB 4H20H 2D9CA 1S78C 1J9RA 1IAOA 1MFNA 4TNVK 1JUFA 3C5SA 3RBGA 3WKPA 1XR9B 2DIAA 2W9DH 4NM8L 4CC1A 3RWHA 5GIRB 2Q8BH 1H9VA 4HJGB 4UINL 4OZFG 1UWGH 4JO3L 3RVXC 1AS8A 3A67L 2B59B 4ONGH 3E38A 3OKNB 5TE6L 1IT9L 1KIPB 1FNSL 4QHNA 4D7BA 1RERA 3HZKA 5KBDA 3DHMA 1HT6A 1K2DA 1TJIL 5DYFA 3KLLA 4L3EE 3QDHA 1KT2B 1R5WA 1OAYH 5JMRA 5E4OA 3L9RB 3SKMB 5AVQB 1U8HA 3TJHC 4L3FA 3G6JF 5LAXB 4POZC 4Z7OE 4ONOA 1MJUH 4HIXL 3T6XA 1E2WA 3WNMA 3QR1A 2JCWA 3O11A 4P3CL 5IZ7A 1MFMA 2VJXA 3RHWK 5K5YA 1IFHL 1NM4A 4QNPF 2GHZA 3WCYA 3LKPA 4KXZI 1CGWA 5EOTA 5EOCJ 5KSBF 1D9KA 2ZKMX 5EIVA 1QD0A 3EJSA 3NJKA 5DHMC 4E0RB 5DJDB 4KO7A 4FG4A 4Z7VB 1OARL 3D12B 4KY2A 1IKNA 5EF2A 4YDLC 2X4OA 4G43A 4KV5F 3L3OA 3WFCL 2Y5EA 4QY8A 1JRHH 4W9ZA 4RMTA 3MJ9L 5CEZD 1PZUB 3MZTA 4XWGH 5DMIL 5T5FH 1Y0LA 1IFRA 1MRFL 3MJ8A 4HIIB 5C6TL 2GJ6B 4UQ2A 1TIUA 3TA3B 3MRMA 3MJ7A 3G5VB 2BWQA 1L0QA 2MQCA 1TTCA 2DN7A 3TJHD 3FOMB 3KJ6H 5GGSA 4U6HB 1C5CL 4X8JA 5EH1A 4Z76B 4OCWH 5DHYB 4ZZFA 4JPIA 4Q9BA 4Z0BH 3TC9A 4DSYA 1AR1C 1C12B 4U4IA 5AOKA 2J55A 1QO3A 2BSBA 3O4LE 3E80A 1YEGL 4QIRA 4XT1C 3QULA 1UATA 4CMMA 1LO0H 3OMAB 5IHUH 3SO3B 4R7XA 3ECBB 2NYZA 1BVNT 1KB5H 4D0BA 1E9PB 1TZHA 2EEFA 3AREA 5CWSB 4M8VA 3UIYA 1Z5YD 3Q6GH 2PNDA 4FTVB 4P2RE 4YLQT 4EZLA 2YUZA 3OKKB 1C5DA 3QH3B 5DEGB 3V0EA 2DLFH 2E8ZA 4NSKA 4UT6H 4CNIB 5T3ZD 4TXVB 1EUTA 2G5RA 2YAMA 3N6YA 4HXAL 4JHZA 3VB9A 5IHZA 5DFTA 2DWDB 5AD0B 4KHTH 3L16A 3IFPB 1RPUA 3FSWA 4IGBB 4HIXH 4KU1A 3DTXB 1O6VA 4HJUA 1DUZA 1DQJA 5JHDD 1ZTXH 2DD8L 2D7QA 2IALA 2OX5B 4AL8L 3ATEA 1U8OA 1JPSH 3EJPA 5J3HC 3EJRA 4EUPB 4EBQL 1L5GA 3MGOB 2VSDA 5DEFB 4OFVA 3GWJA 3K91A 3U7AA 1SJMA 3T0WA 2F7RA 1SPDA 1ZIBA 1EDYA 2P8LA 1D5RA 4KQ4L 3UPRA 3RVUD 3UBXI 2EILB 2FZ3A 2ZUXA 2VL5B 3MRGB 5K9KB 4GO9A 4U1JB 5E2VH 1PQZA 4G6AC 2VXSL 1U2YA 4JFUA 4BELD