1TZAA

X-ray structure of northeast structural genomics consortium target sor45
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
132
structure length
132
Chain Sequence
ALDNSIRVEVKTEYIEQQSSPEDEKYLFSYTITIINLGEQAAKLETRHWIITDANGKTSEVQGAGVVGETPTIPPNTAYQYTSGTVLDTPFGIMYGTYGMVSESGEHFNAIIKPFRLATPGLLHLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords apaG protein
publication title X-ray structure of Northeast Structural Genomics Consortium target SoR45
rcsb
source organism Shewanella oneidensis
total genus 20
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04379 DUF525 ApaG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1470 Mainly Beta Sandwich Immunoglobulin-like ApaG domain 1tzaA00
1XVSA 1XQ4A 2F1EA 5HDWA 1TZAA
chains in the Genus database with same CATH superfamily
3DI3B 4XZUB 5JNYB 2XG4B 4JRXE 4XWOD 4ZFOB 3B1TA 4RX4D 4QRPA 32C2A 4WGWB 2A9CA 1HWWA 1CU4L 4ZMQA 3KYMA 1OIOA 4XPHL 2G60H 2O93L 4YEEA 4FFYH 1T1ZA 3SO5A 1C8PA 1IFHL 2K70A 4NT6A 3GK8L 3EOAB 4M61B 5C86A 5EZLA 3KJ4B 1J8HB 2FZ3B 4TNVF 1N26A 1NGWA 5LBVA 3L5WA 5I8OL 2R8SH 1PKQB 3DURA 1EFXB 4L37A 1UD5A 3DDGA 1EEUA 4U6VL 2QPFA 4PWKA 5IT2L 3EFFB 1UZ6E 1MHEB 1R4XA 1MRFL 3LPGA 1MXDA 3PLYA 4HC1H 3BUQA 5TE6L 3W37A 2BPBA 2EO7A 2DBLL 1GYUA 5E6UB 2DMGA 5IHBA 4DGVH 2X28A 1GVIA 1NMBL 4GBXB 3QJHA 5AWNL 5K1JA 4U1KA 5FF6A 1UOWA 5D96B 2HRPL 5M7QA 1XH0A 1QO3A 3N06B 3WE1A 1OW0A 3M8OH 3MLZL 4N2FA 5HYFA 2YK1H 1KFAL 3MO1B 4P0DA 3ZDXB 4P2QE 5FXCH 1S7SB 1L5GB 5I26A 3TIEB 1FG2B 1G1YA 3A47A 1I53A 2HCZX 3K91A 1RXLA 2N56A 4JE4B 4X7TB 3OHXC 4F7TA 2WWOA 3U9WA 2UZIH 2YMOA 4U6XA 4MNQD 2NZ1A 2FUQA 5C0BA 2EDDA 3B3IB 1UA3A 5H37A 3ZK0A 3FONA 4KQ4L 3H56A 4W9EC 4PJEA 4APQB 2ZUVA 3KPTA 1CXHA 1YC7A 2QGBA 4FQHA 5CILL 4S0TD 4KROB 1GHFL 1GPOL 1XWVA 3D4CA 4NUMA 4XHJC 4UOZA 4XXWC 4OV5A 5F7YC 1CE1L 4PJIE 2XJLA 4ODWA 3LEYH 3DPBB 4JO2H 4NC1C 2D3NA 4XBGB 4IU3A 1QZNA 1HQRA 1YMMA 3PFQA 4ZOCA 3VG0H 4XRCB 3ZKSD 1ZLWK 1NCUA 1DEEA 2OMXA 5ID0A 5I1AA 3D0LA 2BIQA 4D9RE 3O0RH 1PG7X 2EICA 5E8EA 3D9AH 1S7TA 1N68A 2IPKA 4DKDC 3U0WH 4FFWC 2V5SA 4NKIL 2ZSVA 4PJXF 3VFPB 4EIBA 2EH8H 3Q2WA 5I1CL 1GGUA 1RVFH 4PSRA 3W39B 1S46A 4JKMA 3RYMA 4Y16A 4XPTH 4N87A 5F1NA 3QB7C 4WUKL 2YMXH 4FA7B 3CU1A 1A22B 3ARRA 3C2AH 1YEIL 2Y22A 2R4RL 4U1GB 2E75C 4PJIB 3P4LA 5CZKA 3U4EA 1TNNA 3H9HB 5DD0H 1MHPL 1U3ZA 2H47C 3NIFE 4AIOA 4JDTL 2ZKXA 4HHAB 4OD2B 2HP4A 4D0DB 4FLSA 3EYQD 1CS6A 4I0CC 3BJLA 4RGNE 5T1MA 4PGEA 4NO3A 3TV8A 1D3CA 4OM0H 2DEYX 3NFNB 4M1GL 1BD2E 3SE9H 3PJLA 1I7UA 1FHNA 1TKWB 3SJVE 4LCCC 1NDTA 4TSCL 4NNYA 1DZBA 3DVNA 3PGDB 2DTML 2H6PA 4N6RA 3GS0A 2IOOA 1E50A 4DN3L 1OP5K 4OB5L 2GTQA 4X80H 5F0LB 1C8QA 1LQBC 1RUKL 5DJYA 4NQXA 2QVIA 4MD4A 5F1SA 7CGTA 4HKBA 4ODTL 3QUKB 2IPUG 1IBZA 4G1MB 4Z7QF 1F2XK 1BZ9B 3MGOB 1S3KH 1J1XH 1H3PH 2A9BA 2Y1AA 4HALA 3OTTA 5J6GA 4MHHG 4O58L 4RGNB 2VIRA 4OZHB 4PH8A 2F54A 4X9IA 2PYEA 1BD2B 2GFBA 4NZ8A 1YJDC 3DVIA 3GHEH 1HH9B 4MQXD 3X3FH 3CFKB 3Q2NA 5D6CA 1KN2L 1JPSL 1P7QA 2RALA 1U8IA 3DETD 5T1LB 4DFIA 4ZTPH 4F58H 2Y5TA 1XIWD 4PJ7A 3GRBA 1TQTA 4PJ8B 3EJZD 2AV1B 4XZUA 2XG4A 3GMMB 4M1CC 1OF2A 1YYCA 2GTWB 3IXTA 4ZFOA 4IJTA 5F7KC 4HDIA 4OGAD 1JNLL 4EIGB 2O5ZH 4X9YA 5DUMH 1EJOL 2F19L 3TS8A 3F7LA 1IAIH 1JZJA 1JPGB 3O2VH 2X3AA 3GNML 1PZ3A 5HJDA 3RFRA 2LTQB 4O02L 1WFTA 3EOAA 2Q2EB 4M61A 4LLYB 4WO4B 3ZVVA 3F2LA 2FZ3A 1ES0A 4TOYL 4OZIB 1G9NH 5JW5B 4K3HA 2CKBL 4YVUA 2HZHA 4RAUA 2AABL 3DX8B 1EFXA 3IMWA 5I2IB 2IC2A 4RSYA 5IB2B 4DTGL 3O6KL 2B4CL 1MHEA 1F0LA 2V2XA 4S10A 5GHWH 43CAB 1K8IA 3RURA 5GSRA 1A7OL 2KERA 3EJSA 5D7HA 3PHOB 4JRXA 4S1QL 3Q05A 3F85A 3KZ8A 1RHHB 2QQQA 4BSWB 2NNCA 1U0QA 4GAAA 5CEXB 5HXMA 3TC9A 4D9LH 1CGYA 3PS6A 4OTXL 3MO1A 1EO5A 2Y7LA 3IRCA 4ZUSB 1S7SA 4OCXH 1G9NC 1L5GA 5J1AB 5ECGA 2DQJL 2YD6A 4PJBF 4K07A 4X7TA 4CVZA 2XQBH 4M93C 4UIKL 2VW4A 4NBYB 5LDSA 2QQLL 4O5LL 2Q2LA 3B3IA 1NANI 1JGIA 2Z64C 4AW4A 4APQA 5AVUB 3PGFL 1NC2B 4KO9A 4ODVL 1MREL 1EFQA 3MHZA 3U7WL 4AL8H 4CJ1A 3IXAA 5KBLA 5I0ZA 2NY6C 3MV7D 3EGXA 1DVFB 2IPUK 2ADFL 2ZOLA 1KYOK 2YWYA 3IT8D 5AW9B 3ES6B 4JHVA 3CSTA 3CLEL 1WISA 3CXDH 3DPBA 2X9YA 3FCTA 3FO9A 3PJNA 2ILLA 1UWGL 4X0NA 3N5AA 1OM3L 3OJMB 4J3OD 4HJ0D 3CFTA 4FTVB 3G04B 4WI7A 4OF6A 3DRTB 3B9KD 2GTZB 3QZPA 5EO9B 3V0JA 5I75C 5KS9F 4FFVD 4MNGE 1MZYA 3P0GB 1EHXA 5T5NF 4GW4B 1DVYA 2PTTB 4FHJA 3W39A 1N6QL 1G1KA 1BVNP 1AQDB 1SYSB 2XKNB 3ARWA 4YAQB 2QR0B 2F5AL 2VXVL 3UZQB 2VDOH 4NM8H 2K1MA 2WYTA 4W6WB 1JMZA 5HGGS 2OL3B 5E4EB 2WWNA 4FKKA 4P9HL 4XP4H 2W38A 2RJMA 2X6UA 4FMKA 4PJIA 2O6EA 5JPMB 1G84A 3LAFA 1PLGL 2MH4A 4HHAA 5DC0A 3ULSB 3EXLA 3P9MA 3TYGH 4RQQB 2WNKA 2PCPB 5D2NE 1F4YL 2VDLH 3GGWB 1KCSL 2ZAHA 1G7IB 3PWUA 3NFNA 3R0MA 1LMKA 4PV9B 4GT7A 5T3XH 3SGDI 1TKWA 2LFGA 2HT2D 1B0IA 4LEXL 1MFAH 1YECL 3PGDA 1JGLH 4HJGB 3WY1A 1I1RA 3U7AA 3EJPA 1W2KT 5CINH 3RVWC 3Q6GH 3O3DA 5K9OB 3SPGA 1GW0A 4K94H 4LXFA 2V17L 2DKSA 2AK4D 3SO3B 3ZDYE 3H42H 4G1MA 4X7EC 1J0IA 1BZ9A 3MGOA 3PDDA 15C8L 2XWEA 3BSZA 5F44A 1MLBA 4ZYKB 4JHAL 5D2NB 1F1GA 1SJHA 4POUB 1XL4A 3T1FA 2YKKA 4PJ5D 5ENWA 1BD2A 3MOBL 4JANA 4E0RB 4R5XA 1HH9A 3NZUA 4JGMA 3SJVA 3CFKA 4JKNA 2FGWL 5E70A 3BMVA 4K94C 5T1LA 4OM1H 2YPVL 2HJLB 4NAQA 4UV7L 3FDWA 5D70L 5MP6L 4DK5A 1ML0A 4YE0A 3WIFB 2CDGB 1M2OA 3GMMA 4L8SC 4DESA 2FK9A 4FQXC 2CU9A 1H9VA 4KU1A 3T4YB 2GITB 3N91A 4MA1B 1UT2A 1MIMH 1GJUA 1JVOA 1VERA 3ZDYB 3IS1X 4NNPH 4AIXA 1KIPB 1J1OH 4URKA 2Q8BL 3UGEA 3QAZC 1JPGA 4GH7B 4X9GA 5LQBL 4LCUB 1R5VA 4H0LC 4YHML 3QUYB 1IC0A 2R4SH 4LLYA 2H0FA 1RJLB 3FULA 4YL4A 2BSED 4AIZA 3U0TA 3S4SB 1OTTC 1C5BH 4U1LA 2RFXA 1G7HA 4W9DC 3DX8A 3MRKA 1SM3H 5I2IA 4PJHB 2MMXA 5IB2A 1WAAA 1XSIA 2VXUH 3OXSB 1KCRH 3FB7B 3F7PC 1WBYB 43CAA 1RK1B 2VN4A 1H3XA 1BQHA 3O2WL 2Y6TE 1RHHA 3P30L 4HLJA 4BSWA 3OMNB 2NQCA 3ZGIA 2VOTA 3TESA 1FORL 3VH8G 5CCKL 1T7YA 2HXAA 2X4RA 4XNXL 4P49A 4ELMF 3RB7A 4ZUSA 1RPUA 3S96B 4LSUH 4UAOB 1ZSDB 1MN4A 4NC1E 1KJVB 5F0MB 2FSEA 4A7QA 1QWHA 3US1A 4GFTB 4NWUH 2YPLD 1B3IA 3WY3A 1T03H 2E59A 1NC2A 1MFUA 1PIGA 4HWBA 1TLMA 1A3LL 2IXQB 3JUYA 4K23H 5SX4H 1DVFA 5E00A 4Z7IA 4Q56A 5T5FL 2B7DT 2MNJB 1RHFA 4EI6A 1VIWA 3PHAA 1NPUA 5MHSE 2PETA 2L7EA 2EC9T 2O72A 1IT9H 9CGTA 3QPXH 3MCLH 2GI0A 4KI1A 2BSSB 3DRTA 3MNWB 3LKPB 3PG2A 2JNZA 1NC4B 2W60B 3S3SA 5I0XA 4I85A 4M02A 1DQML 3EG9A 4PY7B 5KYWB 2PTTA 2NY7H 3EYSH 1VB9A 3L13A 1K85A 3LVEA 1LWRA 4PWFA 1JP5A 3NSFA 2H7WA 4NERA 1AQDA 2XKNA 3A23A 5ABZA 5HDOA 2QR0A 3JUZA 1I3VA 4AYSA 1U8KB 3IJHA 1PZAA 3T3MB 1X6NA 5AB9A 2OP4H 4M4RA 3ECVA 4NP9A 5EBWB 8FABA 1IEAB 2V9TA 2ZUQB 2ZPKL 4JO4H 1KXVA 4XMVA 5DZLA 5I8KL 4F5CE 4BSVB 5IJCC 4PJFB 4ICWA 4B27A 2EDRA 3ULSA 5C07B 5LN4A 2NUPA 1KV3A 4X5WB 4F24A 4RQQA 2PCPA 3N1PC 1A21A 2HG5B 5AW6B 4BM7A 2WLHA 3GGWA 3ML8A 2YKLL 3AG2B 2CRMA 3PWVB 3QZBA 3MLWL 4PV9A 5CN2A 3QPKA 3VD7A 4OQTA 2PCXA 5E9DE 2Q6WB 1OARL 3KLQA 4HJGA 3WLBB 4Y5XB 2EXYD 4K71C 4M9PA 2XU9A 3QI9C 2H3NB 2C3HA 2ZX5A 4Y4FC 4TPRH 5EEYA 1I85C 1XCQB 1YPZF 2JCCB 3CSBA 4L9DA 4AGLA 3UROR 1Q0XH 4FA8A 4F27A 5KW9L 2ENYA 5T3ZL 3CVHH 1A6WH 5GJSH 2J6WA 2VC2L 5AYTA 4MJ4A 4CBZA 1I8KB 3JSSA 3UTSB 2X9ZA 1N7ML 4KNQA 5IJVA 1U58B 4WY7L 5D2NA 1OOAA 2FX9H 3QDGD 4NKOA 2FEEI 4E0RA 3JTSA 2QEJA 5F3HB 3L1EA 5E95B 4V1DE 1OAZL 4E9YA 2ZCLL 3BZDA 1HHJA 3V4UL 4Q89A 2B59A 3LSOB 2OZ4H 1OPGH 2VMEA 1RMFL 3HE6D 4LSVL 5IW3A 3RPBA 2C3VA 2PWGA 1TVBA 4KJWC 1I9IH 3T4YA 5KWYC 1EDHA 2GITA 1IGYA 2F0CA 2ZXQA 4Z6AT 5ACLA 3OKEB 4XNYL 3KYNB 1KIPA 3N0AA 3H2QA 3VCLA 1L7IL 3II1A 3UAJA 2YEVB 4FP8H 1UZGA 4GOSA 2CMRL 2AANA 1ADQL 1PSKL 4CNIB 1NCBH 1TR7A 4W9KC 2YIHA 1UXMA 4W1TA 4M29A 2JKLA 3ULUF 5I5RA 4FYTA 1JYNA 3S4SA 4K3JL 4NI3A 4A7GA 2WLMA 4N1HB 5ALBL 3C5ZC 3O3BB 5H2BA 2XICA 2B1OA 4TMPA 1RK1A 3ZDZF 3QQ3B 5T33H 1RIVL 5F9OH 5AL0A 2I24N 5IJKC 2QELA 2WLLA 4YFLF 4XP6L 3I6LD 5F9AC 5CEYB 3K5SA 2GKIA 4NJAL 4C56E 4DKFH 4M7LH 5AW4B 4L8CA 4J27A 5FHAH 4FFYA 1GGBH 1RZJL 3CGTA 3E9TA 1ZSDA 4EI5B 2ZP0T 1P6FA 3BCFA 3ILQD 3MX0B 1KJVA 2D7PA 3VA6A 2RQEA 4UINL 5AYUL 4EF3A 1MCPL 2Q3AA 3U82B 3V6FB 3AS1A 1L9RA 1N5YH 1KEGL 1J5IA 2XWJB 2YD8A 3MLVH 4EN3D 3O3EB 1LO4H 2IXQA 3A6BL 4UILL 3KNBB 5ITBL 2K8MA 4M93B 3OHXA 2UY6B 5LDUA 5AVZB 3B83A 4KRMB 5FX3A 5GRXG 5DVOA 3ULVF 3OR7B 4Q6IB 2XXCB 2QGCA 1OCWH 1QFUL 3AT0A 2X6MA 2Z0BA 1FGNL 4F1SA 5E51A 4OD1L 3THML 3G5VA 4H1LA 4K7FB 2Z7ZA 2V2WB 2BY0A 5F6HJ 4TULL 5L4JA 4XE0A 2OMWA 3MNWA 4CC1A 5HY9A 2W60A 1KOAA 5KYWA 1DBJL 1UGKA 2QSVA 4PY7A 4AV4A 4AMWA 2X12A 1NAML 2SEBB 4AUUA 1FIEA 2ENSA 1UKSA 3UZEA 4TUOA 5CD5D 1U8KA 2HUHA 4ANVA 2ORBL 3WFDL 1XCTB 4TNEA 3DYPA 4I1PA 1AGEA 5EBWA 2DQGL 4MA8H 5IHZA 3TEYA 4BSVA 3GHBL 3FT2B 1I8UA 2C9RA 4X5WA 5JLZB 3PAYA 4BQ6A 3EO1B 3RWDB 1PX4A 3TN0B 3KLKA 5EZOH 5I76B 3Q2LA 4LL1A 4AUYA 1OSYA 3RWHB 1GGIL 3PWVA 2HTKD 3STLB 5HYIA 2WLNA 5I9QB 2VZOA 2Q6WA 2VN7A 2WINA 4OSUL 3LNEA 4HV8B 4Y5XA 3FU3A 1QYGH 1LTXA 4UNTA 1HX0A 4BHUA 1HE8A 1RP8A 1U2HA 3NTCL 5B38G 1V05A 2XDHA 1UOLA 2OR9H 4AUJA 4P5TD 4LCCA 3S0PA 1EXHA 1P6WA 2ZX9A 5C2BL 4J3OH 3BC9A 1CFQB 1JI1A 4YSSA 4HQQH 4KVCL 3KM2A 3FBQA 2VDOB 3L5IA 4HULB 4F5CA 3LRSA 4JFZL 3ARUA 5GS0D 1U6AH 2IH1B 3FU6A 1COBA 4LF3B 1KG0A 2FGZA 1L9NA 4GSDL 1SHSA 1T1YB 2XACC 2V2TA 2V7HB 1IX2A 4DZBB 2VDLB 5F3HA 4WWKD 2A9ML 2EDYA 1CGWA 2VWEC 3LNIA 3QZOA 5GJTL 3CMGA 4HAGA 4G8GD 4BCZA 5E9DA 1U3HB 3OAUL 1UYWL 4XODA 3T0BA 5IHLB 1MW2A 1HL5A 3OQRA 4LARL 3II3A 3LSOA 3KPQA 4P5MB 1UWYA 3G5YB 2QTEA 5E0QA 4IDJL 1FGVL 1OV8A 4NZTH 1FVCA 2P46B 5FYJU 4Q0XH 5HJ3B 5F21B 1VZGA 2P5ED 1NCWL 3BYTA 4UTAA 2QADC 3KYNA 1CLYH 1U8HA 1N9PA 4O51B 4OCNC 3V5HA 1YQ2A 4CNIA 1E65A 4YHIB 4OGQC 2Q3XA 2BSBA 3GSVB 1IM9B 1OGAE 3PL6B 1NOAA 3EFDL 4CGTA 4EE2A 3RTQD 4ZXBC 5C3IA 5HDBF 1OAXL 2HKFH 5B39G 3O3BA 3BDBA 2BDNH 5FUOL 4DEWA 1OK8A 2EH7L 2W5PA 4TS6A 2AJSH 4LEOB 4MA7H 1ZT4B 4WI5A 4IKLA 4KC3B 4LCVA 2GK2A 4DUVA 1JGEB 5DI8B 3QW9A 1A47A 3WDHA 3CG8A 3WTYA 5JDJA 1XV8A 3EJTA 4PJDE 3AM8C 1QNZH 2BRRL 5CEYA 2I9TB 3QJQB 4BE6A 1OLZA 3SDCB 5JW3H 4C4BA 4OJFH 1IM3B 4Y4KC 4JRYE 4XWGL 5D1ZC 3VD4A 3DO7A 4HUCA 4LQFL 5DUPL 3RL1B 4EI5A 3WS6C 1NGPL 2VLJB 5DT1H 2IGFL 1N2RA 1E4WH 2NR6D 3AG4B 3H54A 4HJIA 1QLEL 2N7AA 1IVLA 2Q1EA 3NJHA 3BPCA 3O9WC 2OSWA 1WFIA 3WS3A 5F7HA 3UTTD 3GSQA 1L6PA 2Y36H 3QS3A 3V6FA 3HPLA 4BZ2L 5DYFA 2XWJA 1CLOH 5JPNB 2EIKB 3F7RA 3KNBA 4XCCL 5D1QB 4A38A 2JQZA 2W95A 4PJCE 4QYOB 1U2CA 2MQ3A 5D7LD 5J56B 5IGXL 3OR7A 4Q6IA 2IQAA 1OP9A 1Z66A 3LS4H 3L3DB 4LSRH 1N4XH 4C56A 1FZOA 3IPEA 4K7FA 2RHEA 2XBZA 4GKOA 4JRYB 4M5YH 2V2WA 3ULUL 2A73A 4G8EB 1BZQK 1M71B 1MI5E 3WELA 5LBSH 1U3YA 2VTFA 4LP4A 4A7TA 4YHLL 2EDOA 2GHWB 5F9DC 4U3HA 5BV7B 2SEBA 3VFVB 2EEAA 1MRDH 3FO0H 4NFDA 2X41A 3K2UL 1KBGL 1XCTA 1PBYA 3CSGA 3MXVL 4MCYA 3WCYA 1RSYA 3IEAA 4KO5A 5DEFB 5CHNB 2EUZA 2XV0A 1DFBL 3MJ9L 1BX2A 3Q06A 3W9DB 3FT2A 3AQYA 1H19A 2ATAA 2WO2B 3CPLB 1GYAA 1ETB1 3EO1A 3RWDA 3WEAA 5I76A 3OKYA 5HYJD 1HQ4B 5A2LH 3STLA 5I6KA 1JXKA 2APBA 1HYRC 1DBBH 1JXDA 2XN0A 3RFZB 3K0YA 5DFVD 3CCHB 1TLKA 4HKXA 1X9RA 3LZFH 5CJ8A 5JHDE 3VH8B 4EI0A 2GY5A 2P52A 2ENQA 4H2AA 4ZUTB 3TBCA 4HGMA 3VSTA 3ULVL 3U7YL 3QNYB 4LESA 1ZIBA 1CFQA 1L9PA 1UWEL 1X5HA 3G5XB 1CO1A 1Z9LA 5JXED 3X3GH 1D5MB 1MCWM 1JZ5A 1XGZA 1BFTA 2XTJD 2IH1A 2B4CC 2XQYG 4Y4FB 2IFGA 3WO4B 3ARBD 4LF3A 3D5OF 2YWZA 4G5ZL 4TF4A 4YNYB 8CGTA 4MNQB 2QSQA 3BKJH 4IRSD 3CC1A 1NMCB 4XMUA 4MRCA 5DU7A 2OMNA 3BE1H 4LIQL 3U1SH 3RVTD 4PLOB 4YHKH 1CDJA 1ZTXE 1D7CA 3EOBB 3O4OC 1U3HA 2OCCB 3OPZH 4G6JH 4OLWH 4UTCA 4UB0H 5TPWL 4P5MA 3G5YA 2E4TA 5JTWA 5JHDB 4PRBB 2BNQE 1E9PB 4FLOA 1DUZB 2HPTA 2F9BT 2J2ZB 3A24A 4JO5A 2N1TE 4RNRA 5J57B 4B3VA 1WC7B 3MDJA 2CO3A 3QIBD 1NANH 4JKKA 3CXHK 3AB0C 4L29A 5EEVA 3J2PA 1P69B 3UMTA 2L7JA 4L8SA 3CVHB 3BKML 1LO3L 4YHIA 4HFWA 1FNGB 1H3VA 2RD0A 3GSVA 5HHOE 3KHQA 1IM9A 1S9XB 2EE3A 2P4AB 3IGFA 1O7DC 5EBGA 5EO0B 3OKMB 3PL6A 4OJEH 4XMZA 4JREB 4KKAC 4AJWA 3LEVL 4HA1A 4QXTB 1KTLB 3QEQE 1BFVH 4ZRGA 3UH8A 2PNDA 2X89D 1F5WA 3JWDH 1WV7T 1VSCA 4RZCA 3QVAA 2W65B 3QHZH 4YXLH 4QXGL 1R3IH 4WZ9A 4N24A 1Z3GH 2EIBA 1KB3A 1Q9WA 4ZDHB 2I9TA 4K5PA 3SDCA 4A7SA 3P9WB 5AZEL 3DDFA 3EYOB 3ROLB 1U8JB 2X4QB 5D7SH 1E5AA 3ARFD 4XCEB 2IFFL 3FQNB 3PQYE 4JN2B 4LO9A 2MHAB 2X1WL 3ESMA 3LPWA 4LL9A 5EWIL 3RL1A 1DO6A 4DP6X 1CYGA 4P9HC 2K9FB 2NNAA 3OAYH 4TNVK 4TUJA 1OGAA 3GMNB 3JWDC 3FL7A 4RMBA 5FYJL 1OTSC 3NJGA 1I3GH 4FF9A 4NUPA 3QZMA 3D2UD 1MFCL 3QEQB 3IYLW 3SDAD 5JPNA 4XXDA 3ROOB 3E1F1 4ZZFA 4JMXA 3WDIA 2O5YL 1SFDA 4WQOA 5CP7B 4AYGA 4X8JB 3AU0A 1BOGB 2CLZA 2YD3A 4YGVB 4XVTL 4PJDA 2Z9TA 3L3DA 5AOIA 1E2VA 2Q86B 1CFVH 4FE9A 2WN3A 3IFOB 4BRVA 4Z5RB 3LZPA 4GEJA 3LH9A 1RU9L 4JRYA 5E9NA 4O2FA 1EDYA 4G8IA 4M5ZH 5JOPE 4UOQA 3KBFA 3NPSC 4PVLA 3II2A 3PV7A 3VU1A 1XIWB 1JWUB 3I85A 3KYAA 2F7RA 5KVMC 3DGCR 3IDMA 3VFVA 2C1OB 1FO0L 2B77A 1WICA 4RX4A 4DP7X 4PJCA 3C8DA 3MRNA 4QWWC 3V0DA 1WS8A 5CHNA 4C47A 5CGMA 1SNRA 2EILB 1VDGA 2ZG3A 3HB3D 1IQWL 3EIFA 4TKWA 3W9DA 1C1EL 1T0OA 4N1EA 4P8QA 1FL6B 4BUHA 4Z23A 5KAQF 1JPTL 2BJMH 1CGTA 3NZSA 3CPLA 1KTCA 2D4DA 4X50A 4Y7MA 4NKMA 3HNVH 3Q8AA 1UXWB 1FP5A 4KTGA 4LSQL 1HQ4A 3L8QA 4RH4A 4WV1B 5LXGH 1MI5A 2YXFA 2DQDH 2WP3O 4GI6A 2HMIC 2MSPA 5AW0B 1BG9A 7FABH 3RFZA 3T0AA 3QUXB 3VVWA 3CCHA 3MV11 4XP1H 4I9WE 1A64A 2Y6SC 3PPSA 1XGYL 3VH8A 3CVDA 3OSKA 5IVXF 4G2AA 3ZKMD 5DMIH 5IJDC 5KTEL 3WE6B 5ESAB 3UG3A 5FYKL 1A1NB 3PWNB 2VISB 2VWEE 3NGBC 3QNYA 1P84J 2CG9X 2HVJB 3O4LE 1KNOB 4YSOA 2CO7B 3D09A 3G5XA 3MPCA 3BPNB 1D5MA 3V6ZA 2DPKA 1NGQH 2BS71 3STZB 4YXKL 1XEDA 2KPNA 2BHUA 3KLHD 4ZTOH 4NQED 2HWZL 1IGFH 4Y4FA 5JIPA 1I85A 3QSKB 1ILSA 4OCRL 4YNYA 1KLFB 2Z93B 4GAYB 1PYWB 4GP5B 3KVDD 5B1BB 1KF9B 3GRWH 4NKQB 4AM0B 1Z9OA 3U0PB 1OQXA 2ED9A 4KAQH 2BVOB 12E8L 4M6OL 5GGTA 2DMKA 2M83A 4YJZL 1VFMA 3MV7B 1YY8B 4NENB 4UOW1 3BW9B 4I4WA 1RSFA 1OAUL 3O41B 5JHDA 4PRBA 1E9PA 3TV3L 4NO0B 1WIUA 4RGMB 2XY2A 1TJHH 3CIAA 4NX0A 1YEHL 2F74B 5C0CD 3SE8H 1WC7A 4PRNA 1ZLUH 1M53A 1J11A 4DQOH 1DLFL 4D3CL 1XZWA 3BOVA 3CVHA 4JFVA 1KGYE 5IF0B 4Z7WF 2ZUXA 5CEZD 1FNGA 4ZT1A 3FO2B 2XXFA 3MKGA 4J12A 5EO0A 5F6HI 1LP9F 3OKMA 5AZ2L 2CHDA 2XBDA 3WEBA 2HRGA 1JTPA 4F15C 1HAWA 1A6UH 1K6QH 1QSFD 4PP1D 4IBLT 5E8PB 4G71B 5C71A 2LGNA 2W65A 5GS0H 2B5IC 4TM9A 4IMKA 3OKLB 3WFBL 1FL3B 4P99A 2OR8A 2OZ4A 3TJPA 2YD9A 3C5ZA 3P2DA 1RY7B 2DL2A 1HOEA 4L3ED 2V6HA 1QPKA 2E7BA 4IK7A 3CC5A 5DJ8B 3ROLA 1J0JA 2B08A 1U8JA 4KO6A 2DN7A 4FZ8L 4Y88A 3FQNA 3SQOH 4JN2A 3ZYOA 2MHAA 3QWRA 4IOFC 2R83A 5B38B 3C2SA 5E4AA 3DGDA 4BH8A 1HEHC 3QQ9C 1BAFL 2I07B 3TNNA 5HHOA 5I73B 1J10A 3GMNA 4X99B 5C0AE 1EHLL 4BFNA 3FT0A 3QEQA 4K0OA 3ROOA 3N6YA 4YO0B 4Z7OB 2AK4B 2IIJA 1JIBA 2K6YA 4B9FA 5KSVA 5CP7A 2VO8A 4X8JA 1WVZA 2ODIA 5GS1B 4P06A 3O9WB 4WJ5B 4ODHH 3V0VB 3ZKND 4JFED 4YGVA 2X0VA 1SF3A 4KUZL 3FRUB 2YOCA 4OY9A 3IFOA 4Z5RA 1XB3A 4N0CD 4PJ5B 5CR8A 1AACA 3B2UD 3PQYA 4F8OA 2ZUSA 1JFQL 3AUWB 3CHSA 4P23C 4XMLL 4F57L 5DUBB 1FZMB 4WU7B 3VGDA 3A0OA 3VB8A 3HPJB 5DTFB 4GMTL 4H88H 2VT0A 4FLHA 4HJUA 1MPAL 1UENA 2WQUA 2R56L 5K59F 1JWUA 2QSCH 1XB6A 5BV7L 1R3KB 1J0KA 3HOGA 4EOWH 2EC9U 2C1OA 2V9UA 4HJEA 2FHBA 4PTTB 2WYIA 2X4UB 1QBML 3TL5A 4DN4H 1LLAA 2F1EA 2DV6A 2XJKA 2I25N 3GI9L 3JYCA 5E2JA 1CBVH 1KIUB 2WANA 3OAZK 2J8HA 3IWUA 4OUUB 4HOWA 4BELD 5IKCB 3CSYA 4ZMPA 1FL6A 1MFNA 1GW6A 1AXTH 1C5CL 1P53A 1GL4B 4JQIH 5B39B 1VGKA 3LPPA 1UXWA 1PKOA 3S35X 1GSKA 3NESA 2FX8L 4L1HA 1CBJA 5TF1H 1ZY9A 3WDJA 4PVNA 5FFOA 1QWUA 1JNNL 3BDXA 5FFLA 1MAMH 3QUXA 3DSNB 1TMCB 4NUGH 1DBML 2ICCA 4QTIL 4UT6A 4PGZA 3QG7L 4E9RA 2GW5A 3D12B 5EORH 3DTXB 3MZTA 2H5UA 2WNXA 4JDVB 4WWID 3WE6A 1A1NA 1MJ8H 3PWNA 5FV2A 3DX9A 4XC1H 4MFHA 4KXZH 2EO9A 2CO7A 3UJIH 3F01A 3DK0A 4JFXB 4NBXB 1T20B 3STZA 2FSDA 2ZXCA 3KPRD 4JM4L 4WW1B 2VMCA 3R1GH 4A66A 4AG4L 1A7RL 2JMRA 3JV4B 2H0PA 4V2BA 1UD3A 1D7BA 2UXTA 3ZR5A 5LWYH 2VL5B 5FDYA 2Z93A 4GAYA 4LQ1A 5FO7B 1D5XB 2MFNA 4K7PY 2YPLB 2GUOA 3PJSB 2E9BA 3W81A 1N59B 4AM0A 1AVAA 3U0PA 2CDFB 1T2QL 3DHMA 4Z8FH 4K7PX 4UM8A 2WXIA 2W80C 3MMEA 2JWYA 1NWPA 3MV7A 3N55A 1YY8A 2EEBA 1T2XA 3IK2A 3BW9A 1E6OH 1VZIA 3O41A 3QORD 2J1ZA 4AT6B 4NO0A 4Q9QL 4MJ5A 5GGRY 3O4LA 2BCMA 1BA9A 2F74A 1IC5L 4AYDC 3KWTA 5IMMA 1JI2A 3DJ9A 4KMLB 2YXVA 3RJQB 4DP5X 5KVGL 3CSFA 3MRHA 2VUYA 3E0GA 4LU5L 4Z3JA 2ZYSA 2Q7YB 1CWVA 4P2RE 4KI5F 5IF0A 1JK9A 4JJ5B 4LCYB 4ZMLA 2VSKB 1NLBH 4GRLD 5G2NA 1OSPH 5CZRA 1P0SE 4NQDE 5DR5H 4AGQA 4NIYE 4M43H 1PG7L 2VM3A 3FT4A 4C55A 2JI1A 3VRIB 4XPAL 1S7QB 2DWSA 1ZHBB 4DJMA 4YHOH 2F8OA 4X98B 1IIIA 4HPHA 5F88B 1RJYB 2EVJA 1OANA 1JD9A 1JHKL 1ZWIB 2C1PA 4FZEL 3U4BH 4NQCE 1BYPA 2NCEA 2WK2A 3L16A 1E0OB 3OLEA 3ET9F 4XNUL 3W11C 3WKPA 3TCXA 1YYLL 5D5MF 5B38A 2QV4A 1V10A 2JIXD 1PCSA 3Q1SL 1C16B 3SBQA 3AM8A 1QBLL 3D2TA 3SBRA 1CFSB 1BM7A 5CZXD 2Z91B 4UM9D 5F8QC 4WEEA 3NN8B 3BUBA 1WZKA 1ZJAA 5D1ZA 4FQ2L 4IDLA 3RVVC 3T8XA 4HCFA 4TSBH 3VD0A 2ADGB 4OJAA 4YO0A 3WS6A 5C8JB 1F18A 4JM2D 3C5JB 4FI8A 4XN5A 1AANA 3L9EA 5ETUB 2IAND 3VGHA 5D7IE 4R7VA 1W0VB 4MJHA 5GS1A 2J20A 3O9WA 4WJ5A 4NI6A 1CE6A 3V0EA 1S7UB 1RIUL 1EMTH 4NPJA 2CALA 3MLYH 3MNVB 3BKCL 4N2EA 3BMWA 3H85A 1JF5A 3FRUA 5HI3D 5HGBB 4Y5VB 4JG0L 4MXQC 2XI9A 3QDGB 1QSEE 1MFDH 4MQSB 1KIQA 1U8NB 1WO2A 2OSXA 4W9IC 4DEPB 5D9SA 4PJ5A 4H8WH 5TQ2L 4YQXL 3BSGA 4PJXE 1KJ2H 3K6DA 1FZMA 4WU7A 3RWFB 2OYKA 3LTVA 3HPJA 2DWEB 2R69L 5DTFA 5C2UB 2FTAA 5C0AA 2OULB 2VKXA 3HE6B 3UJJH 4DO6A 3MLUL 3VXTB 2OMZA 4PTTA 1INDL 2NY2D 4WLCA 2VQ1B 3L3HB 3AABA 3FB5B 1KIUA 1ACYH 2AQRA 5CCHE 1LO5B 3MJ8A 1JERA 1GOGA 2R27A 3Q44A 2OSLA 4IJ3B 4OUUA 4PB9H 5CMAB 1ACZA 4HIEA 1E6JH 1MY5A 3NK3A 4RESB 5A7BA 3CZJA 4GSRA 5B39A 4EXPX 3HLAB 1VHPA 1X9UA 2X3CA 2VXQL 2BFVL 4ENEC 3OX8B 3CV5A 2NUTA 4EVNB 4UOJA 2H1XA 3BUIA 1LO0H 2GJZB 1N70A 4X7SH 2FATL 3BAYA 1MEXL 5CF3A 5LBSA 3DSNA 2HT4D 1CTMA 3NYKA 1FUNA 3WSQH 2LW3A 3E8UL 4P2OD 1LQSR 4JDVA 4DP4X 1OP4A 1UZ8A 1QR4A 2PN5A 3KLAA 3SDDC 3LS5L 4KRPD 5AD0A 1OQOA 4FQ1H 1NUDA 5D55A 2V4LA 3U9PL 2OM5A 3GSWB 4WW1A 2VR6A 4NKDB 1HVXA 1X5KA 3B2VH 4AZ8A 3JV4A 3QC6X 4QGYA 4UQ2B 3FSZA 5FO7A 1OE3A 4P4KD 4U1JA 1EVTC 4LSSL 1GMEA 2AITA 3HZMA 4NLAA 3PJSA 1ILUA 1ZSHA 3O2DL 2Q76B 3N44F 1YG9A 1ZA3B 2CDFA 4EN3B 1J9CT 2BX5A 3L3GA 4UZGA 3ZTEA 4ZO7A 3CX2A 3O8XD 4HHWA 1CT8B 1NDGB 5D8JL 3LQAL 2GBVA 5E6IC 4Z18A 2CAKA 4C57C 2WUBL 5SX5K 3K5RA 1DVXA 1YY9D 3LY6A 1ZLVK 3X2QB 5F9WC 5BUGA 3CFIC 4JHWH 2IBZX 1TUPA 3WGUB 5J12C 3OZ9H 1S9WB 5ITFB 4LCYA 2FD6L 3N41B 4DP1X 7PAZA 4LE8A 3OZKA 4YHYB 4I77H 1HL9A 4ZK8A 2R9HC 35C8L 3CNKA 3Q3GA 5D2LB 1N10A 4XVUD 4RMQA 2Q7AA 1XFPA 1CGVA 2PPCA 1IKFL 4R5VA 1AKJD 2AQSA 3FQUB 4GPVA 5CJ5A 4R90H 1HN1A 4YVNA 4PJ6A 4AMXA 3UO1H 4LKXB 1ZHBA 4JFFD 4WKZA 5F88A 2G4GA 4BFJA 1RJYA 3ZTDC 2WNGA 3VE0A 1ZWIA 3OMIB 2ROXA 2ZKMX 3KDMA 3CQQA 3VUAA 2YS4A 5GXBB 2QHRH 2GT9B 3LQZB 2VITA 2PCYA 2HLFD 3BESR 1A8JH 4L1BA 4F7KA 1FSKC 4IBTA 1IBGL 1CFSA 1QA9B 1F90H 1VCBC 2IAAC 2AJVL 3NN8A 2WZ0A 4FG0A 3SGEI 1GGCL 4AI7A 3KVPA 5HGDB 4P5TB 3RIAF 2WLJA 2ADGA 3IMRA 5C8JA 4R0LC 2YBGA 2ITCB 3T1WA 3OKDB 4QNPE 2XQYA 5ETUA 1NSNL 3IETA 2VMFA 1YMHB 5T3ZE 3IKCA 2A0LC 1S7XB 1B0RB 5CEZH 4D2NA 4MCNA 5I18L 3GINA 4E42B 4J28A 1UG9A 1JVLA 5KS9E 4BK4A 5AB2A 2D9CA 1IJNA 2X44D 2XV6B 2AQNA 1T7ZA 5BVPH 1VF5C 2ESVE 2OMVA 4FNLH 1OSEA 2WB1A 3LNHA 4WWKB 3NZ8A 3BUYA 4TLTA 3MUJA 3S88H 2NW3B 3ZE0E 4C4KO 1GOHA 5I30H 2DWEA 3B4NA 1RUPH 5J11C 2WKOF 1WTLA 5CM1A 2IOMA 5GGVY 4FQJL 3GSNH 1IC7H 1BDYA 2X42A 1CR9H 4JZOB 4YS4A 3V9FA 4EMZA 2P3YA 4L5FL 2VQ1A 2WMPA 3FB5A 3LKNB 3TVMC 5LUMA 1U9KA 2VZ1A 3MGTB 5D7IA 3UEQA 4M3HA 3CDZB 5TDPA 3VXNB 2Z31C 3X1NA 2F1AA 4YBQC 4OCWL 1II4E 5KZCD 2JJWA 3UC0H 3AWEA 4C83B 3V4VH 1YRKA 3T2LA 3HLAA 3VXSD 3BJ91 4M5SA 2QFPA 3LNFA 1JS4A 4JDEB 4CL7A 2J1WA 1MCQA 3Q6FB 3RTQB 2X1QA 3U6XA 3BPLC 4AGPA 4QOKD 3WHXA 1RKRA 1AZVA 4CGUB 1ASQA 4ZFFB 3T0ED 3CZSA 2GJZA 1LDPH 3WXWL 5C0EB 1AHMA 4UWQB 4WFGE 3U1PA 1KTDB 2ATPB 2JJTC 3TZVC 2OMTA 4M7JL 1UJTA 3QH3B 1DL7L 1QEWB 4M62L 2Q87A 3MRMB 2E9GA 3MUUA 3SSGA 3U4AA 3HG0A 3KL5A 1T6BX 1VEOA 1MCOL 3ESVF 5IFHH 4PRHD 1RURH 5KSAD 3GSWA 2XWBB 4A63A 1YEGL 3INUH 4WVRA 1ODUA 1EVUA 5HYQB 4S2SB 2LU5A 1TQBC 3CHQA 4UQ2A 3VFOB 4QF1B 3VSQA 5DDHA 4KKNA 3ZZLA 5F1IB 4CU7A 3AG3B 4XN7A 1SUHA 2IF7A 2R29H 5EO1A 3UTTB 2Q76A 3ZT5A 4H8HA 4DP8X 4HXBH 5H35B 1WHPA 4L0YA 1OAKH 3GJFK 4UQBA 5CBEB 1FFQA 5EC1B 5I5IA 2PTUA 4JRFA 2XX1A 2FJUB 4UZSA 1X5FA 1ETA1 3DX3A 1CT8A 3UTPE 5D7LB 4TSAL 3LPFA 3LEXA 4HAKA 4HLEA 5E2VL 4K55A 2HJFB 1NIAA 1P6AB 3VMOA 2CK0L 2Y07L 1RUML 2ERJB 5GGSY 3QQDB 3SPVB 4W4OC 4ZFZA 1HI6B 4TQEL 2JELL 4WUUD 2WXHA 2A2QT 1EJ8A 2E7DA 3P11L 2VDRH 5L2JB 1ADWA 3FQWB 1S9WA 5EUOE 1NFDE 3WHE0 5ITFA 4YDKH 4NWTH 4K8RL 4ERSH 4G6MH 4P3CL 3L4UA 1TTCA 3P1VA 5ANMB 3C6SA 2ETWA 2XZQL 2WTOA 3P4MB 5D2LA 3VVVA 3GRWA 4JFOA 4XNQB 2ZSWA 3S8GB 4LKXA 4PJEF 5ALCL 2WXKA 5GGRB 3DO4A 2CRIA 2X09A 4IRZL 1M3IA 1VACB 3HMXH 3LIZH 1PNDA 1ZT1B 3ZZQA 1T21B 2QMJA 1AYRA 2CHNA 4U3SB 2GJJA 1CTOA 2BERA 3LQZA 5A3ID 1GJIA 5T1JA 3L3OB 4NZJA 4R7DB 1NFDB 1UACH 2P7TB 1BJMA 3UOAB 1F6AA 2P5WD 1ORSB 4OR1A 5TGBB 1CXKA 3IDNB 4A67A 4LPCA 5HGDA 1IE5A 3BO8B 2ITCA 1HWGB 5E08H 3OKDA 3BPOC 2F58L 3S98A 2DLHA 3QIUD 2XFXA 2XTJB 1S7XA 2BP0B 2HSIA 3MNZB 5TQ0L 1SEBB 1EHNA 4J4PC 3HLKA 2VCOA 1TYJA 4EDWH 4E42A 5CGYD 2A6JB 3WJLC 4YK4B 3VI4B 3SGJA 3OF6D 4KV5E 3WN5B 3T6XA 1I9JH 5IEKB 2R2CA 3VW3L 3H9SE 3APMA 4MX7B 4WWKA 4M8RA 4QXVA 3FCBA 2G0LA 3JBG7 2W0KA 4HXAH 2NW3A 2CE6A 5JR1L 2J5LB 1S78C 3JVGC 2YRZA 4UTBH 4B9PA 4EZLA 1HSBB 1UWXK 2ZX6A 3N85L 1E5UI 1KCUH 4WAFA 2YQ3A 4BRJA 4TVUA 2TSAA 5BQDA 4DAGL 3S8WA 4AQEB 4JZOA 4P23A 4HUNB 2Z7WA 4L1DA 4Y19E 3SOBH 3LKNA 2J73A 2X70A 3N42B 3VXNA 3EUDA 3CDZA 3L7EB 5IB4B 1Q1JL 4DVBB 3QIBB 4K9EL 5CLYA 1KELL 1CK0L 3WFCH 3VGGA 2JKWA 4MMXB 3S5YA 3VGAC 4LLQA 5LCVL 4FXGB 4ZAKD 1FCCA 1CN4A 1T66C 4ZTEA 3TCTA 2R51A 4NFBA 3LDBC 3OC8A 4ADGA 3MV8D 3E2HC 4JDEA 3H9SB 1UA6H 5DJDB 4GSUA 2K0RA 3Q6FA 4GRWF 4GQRA 3NOIA 4DKEH 3V52H 4ZFFA 4M6ML 2PXYD 1AI1H 5I71C 1KJ2B 3IDUA 5C0EA 2X40A 2H26B 2ZKHL 4KNSA 3QH3A 1QEWA 1U8QA 3UO8B 3QCVL 4DFHA 4PJ7F 3QUZC 1L3NA 1RZFL 4H8VA 1SMDA 3ARFB 2ZT9C 5HYQA 4XNBA 1DLHA 1IILE 2V7NB 2NR6A 4I9XA 4HZ1A 2Z4QA 5DRZB 3VFOA 4QF1A 1PJ9A 2BO0A 1D9KD 2P8PA 3BAIA 4FQQA 4K5MA 5F1IA 2D7OA 3JZYA 2WQSA 1O7VA 4JQIA 1SDAB 4ONFL 3SDAB 5H35A 2IH9A 2Y7SA 3FTGB 5I66A 2BY1A 3AXHA 1V7MH 2C34A 2GIXA 2MWCA 1YEEL 2E8ZA 1NLDL 1ACCA 4LCWD 5C0DA 1KXQE 1N0XH 2VLME 1Q72L 2HJFA 4LGPB 5I82A 4OLVL 3C6LC 4YBHA 1DP0A 1R0AL 4NCDA 1N0LA 4HT1L 3QQDA 3SPVA 1L9TA 1HI6A 2WVVB 2HAZA 2DBJA 2AQ1A 2YD1A 5L2JA 4H8UA 3FQWA 1NICA 1TQWA 3KH4A 3QDJE 2YEZA 1XGUB 4POYA 3UL4A 5I19H 5DSCB 2C5DC 4Z95H 3IGAB 3ZDXF 4XMPH 1TCRB 2O5XL 4WFFE 1Z5LB 1AXIB 3D0AA 1YEKH 1NGXB 5ANMA 1WFNA 2GYSA 5KSBE 1I3RA 1ZE3C 4A6YH 4QRTB 2B8OT 3NJIA 3P4MA 4HS8H 4XNQA 3R7RA 1H8NA 2LE9A 3S36H 4U0QB 1YYML 4L48A 3L1OH 4N85A 3HB3B 1BFSA 4R4BB 1DDTA 1P4UA 3IBEA 4G11A 2ZUWA 5EG6C 1M57B 1UZ6F 3BUTA 4L8DB 1ZT1A 1AJ7L 1I75A 2CM5A 5BV7C 1ZANL 1LNUB 4WK2B 1MUJB 3GUFA 4NP4L 4G9FD 4ODSH 3DJZA 5CIPH 5AVRB 3QWOB 5CR1A 2Q10A 1A6TA 2Z35B 3GMQB 3QDJB 3Q9PA 1NFDA 4R7DA 5EUOA 1EDQA 2P7TA 1IFHH 1D5IL 4O00A 4CN1A 1I31A 4BQ9A 1FE8L 4JO1H 1ORSA 1WH0A 2AF2A 3BN3B 3IDNA 3QFJD 3DHJA 4PS7A 1X7TA 2DJMA 2O5NA 2FUTA 1UCBL 4Q9BA 4QXWA 3EJCA 1SY6A 3T6QC 1M9WA 3MCKB 3FUDA 1TJMA 4FNQA 3NH7L 1QRND 5E2WH 3PP4H 4N2CA 1MRFH 4BBWA 4G42A 5TE6H 2BP0A 1IL1B 3MNZA 5SWSD 1YHPA 1SEBA 2Y4SA 4F7EB 3AITA 4NN6C 5I1EL 4CVZB 1OAQL 1NMBH 1R47A 4KZEH 1UADC 4PJIF 2LABA 2HRPH 2ZOWA 2NY5L 3FOLB 3PAUA 4GIAA 5FCUL 5IEKA 3MACL 1IARB 4ZMOA 3K4DA 1NKOA 4MX7A 3U2IA 2QVFB 4LIQE 4R2GC 4MZ3A 3QXAB 3DO3A 4WW2B 1UFGA 2HYMA 3MA9H 4GMSH 4ALAL 3QO1A 3O6LL 1A5FH 5K9KA 5I16A 3IKKA 4OZFH 3SIKA 4XO8A 3WG7B 1CL7L 3D4ZA 2E76C 4PLJD 1BXAA 1P7HL 5A1AA 2BWIA 4L3EE 4W81A 3HZKB 5TJWK 5EC2B 1ED3B 1GHFH 3L7EA 2IH8A 5C0CB 4DVBA 5IIEA 2VJ0A 1SN0A 4HEME 5AW8B 3EW3B 3FT1A 1HZKA 2ZF8A 1MCCA 1CE1H 2VZ3A 1YLBB 4LAQH 5KYXB 1W0YT 4FXGA 4U1SA 1EEYA 1HC1A 5JMOC 4PR5B 3NIFF 3ETBF 3H9SA 5DJDA 1H3GA 1BVKB 4FULA 1DQDH 1OP3K 5I28A 2E7LC 2X89A 3TTSA 3H6JA 1KJ2A 4OGXL 1Z9MA 2IDFA 3IJEA 3E6FA 4LRNH 3Q1EA 4XB3A 3QDME 1O6VA 2NY0C 1MLCB 3N9GL 1MCFA 4HBCH 3L4VA 4JFEE 4XO5A 3GSNB 4WI3A 5IESL 1T7XA 4FNSA 4Y19A 2ZUYA 4IBWA 4L3EB 2VH5H 4MDRA 5EBMA 5BXFB 2CCVA 1YEIH 3BAKA 5J13C 3TBWA 2GUYA 4AJYV 4ZS7H 1QATA 1UT9A 1MHPH 2D31B 2V7NA 3ZTJG 5DRZA 3SDDA 5DF0A 4M6NL 4YSUA 4FNUA 4KMTL 1A4CA 5I1JL 1JTTA 4PG2C 4Y9BA 4LSPL 5DMGC 3V4VB 3EJUA 4OFPA 3W38A 1AO7E 3REWB 4HUXB 4M1GH 4AQ8C 1IGCH 4PCYA 4XPGL 3WLWD 3IDIB 3M88A 3Q8EA 4TSCH 5H94A 4PS8A 1O5DT 1MNUH 4CMMB 4KTEL 1PU0A 3NUKA 3RWGA 4GKZB 1HIMH 3NJJA 4WTWA 3SZ6A 1WAAF 3PWJB 3HHMA 4JFEB 5BRQA 3FF8A 4G6KL 3UACA 3ULVC 2I27N 1WA1X 4DN3H 4OB5H 1FQ9C 2AW2A 4CSTA 2WVVA 3QGVA 3HE7D 1Z1WA 4BINA 1B6DA 3TO4C 4M6AA 3JTBA 2EE0A 3TO2B 1HE7A 1SJMA 3D52A 5DS1A 2XV3A 3PAVA 1XGUA 4XVJL 5ERWB 1BLNB 2FQGA 4KJPC 5DSCA 1BAGA 3HCVB 1E3XA 3IGAA 5HHVH 1JRHL 1TCRA 1Z5LA 4YSQA 1NGXA 4BZ2A 4Z3HA 2K9UA 4KJQC 3HC2A 2X9XA 4CJ0A 3S3PA 2ZG1A 5E99H 4U33A 4PFEA 4OVUA 1OT1A 3WEMA 1GYWA 4NQTA 1KXQA 2OMUA 3KPRE 3MRDB 3FUMA 3WFZA 4QY8B 5KANI 1DSFL 1S5HB 3E80A 4N28A 2EDLA 4ZFOL 4IRJD 2I85A 3ZIYA 3WNNA 5BS0E 2X2YA 3ATBA 4HZLA 3TNMA 1LNUA 1BWMA 5JORB 2F19H 2JE8A 4ACPA 2A9NL 3QWOA 25C8H 1YN6A 3ZX1A 4M7LT 2E9IA 3D05A 2Z35A 3KR3L 3GMQA 2HKAA 2VLLB 3QDJA 3I9GH 1R24B 1X9QA 1YO4A 3GNMH 4ETYA 3N2JA 5IW1B 2VDRB 1DVSA 5L4IA 3S2AA 1NCOA 2F7QA 3FCGA 4XCYB 3RZCD 1WIOA 1AXSB 4P57B 5T1DH 1T4KB 4TOYH 5KSBA 3IJYA 4BKSC 5FYKE 2CKBH 4HJJH 5IQLA 3V10A 3CFCH 4WEBL 5CFAA 2XTLA 3BQUD 1NOFA 2W94A 4DTGH 1HYSC 5SV4A 3QQ4B 5IMLA 4IGBD 1UD2A 2B15A 4MDJB 5BJTB 3QEHB 3ZL4L 1IL1A 3KPRB 4F7EA 4TVPD 4NHCL 3ZUCA 2CR6A 4IMLB 5JIKA 2FB4L 1I9RL 4NRYB 4QEGA 4R0LA 2X05A 4P9ML 1QFPA 1XZ0B 5JW4M 2XA8L 3FOLA 4JJHA 3LN9A 4TTDD 3MRCA 3UJTH 4NCC1 3OB0K 2VDKH 3GDCA 3QXAA 2AJ3B 4UBDD 2DQJH 4M8VA 4LLWB 1XAUA 4UIKH 3RHWF 3CN3A 1AE6L 3GZKA 5IW6B 3MV9D 2FLRT 3UGUA 4WGKA 4U7SA 3NCYS 4ZX4A 4BGDA 3KGUA 4XC3H 2XWXA 5FA4B 3APDA 2DQIL 4ZPTA 3MRFB 3RB5A 1RJCA 5C0CA 2WWKO 4AYFB 2WXOA 3RL2B 2WXMA 1KJMB 3KM1A 3IAQA 3RGHA 5KYXA 1D5BB 3VFWA 1WUNT 2UUDK 3U6XS 3B9EA 5AW7B 4GRLB 4PR5A 5BOZG 5LJYH 3TVMA 4FOMA 4RMTA 1WAPA 3ARED 2LLGA 2L7UA 3LQAC 4PD4J 4L0PB 4U4IA 5DK2B 1INEL 1H6UA 3MXWL 2UX7A 1T2JA 3NIGB 3EH3B 5D1XC 1J48A 1EXUA 2IANE 3G6AB 3REVB 3R06B 1DQJB 4FYSA 4PHXA 1CPUA 4KKBD 1IC1A 3G6DL 4FQPA 3KAAA 5KVEE 4L3EA 2ZCKL 3OVUB 2VXVH 3LZOA 1NTDA 4NAJA 3RWCA 1URZA 4HEMA 1AKPA 3DYMA 1SBSH 1FLRL 4GAJH 2DM2A 3SKJL 3TZVA 2B1HL 3BGFB 1NZRA 5F7MC 1A6ZB 3VFNA 2FYYB 5C7XH 3WD5H 2X4SB 2JIXB 2AEWA 2D31A 3NVQA 4OCSH 3BP5B 3K4AA 3ZDYF 4S1DC 1Q9OA 4UT7H 1H0DB 5DQDL 1LK3L 5FDWB 1XR9B 3V4VA 4UM9B 4KY1L 4XOBA 5DQJB 2CLVB 3RWJB 4NJ9L 3AGVA 2CO4A 2YO3A 1MH5A 3IDIA 1GAFL 1H3UA 4KK6C 4JM2B 1TZGL 4LEXH 2IANB 1YECH 1AHWB 4PWGA 2YA2A 3QDMA 5HDWA 4A7GF 3T4AC 4LVEA 1DJGA 4WSKA 4JFEA 4KPHH 4KK9D 2FYVA 4IYKA 2PW2B 1MJJB 3N1GC 4JNXA 3B1UA 4TUKL 4E9TA 2Q0ZX 2Y06L 1VFAA 5MERB 1O9VA 1MDTA 1E28B 2JKNA 2VZUA 1GZHC 4LLDB 4P5RA 3ATAA 5DHMC 3BSHA 3F7KA 3T77A 4D0CB 3SEPA 1QFWL 2DIBA 3BSZL 5ERWA 3T04D 1FPTL 1T7VA 3C6LB 4TNGA 4UU9A 4WU5B 1S7VB 2E9JA 4W4OA 3QCTH 4AKPA 2ZCZA 4I18B 1KC5H 3FZUD 3BEWB 5FM5M 1O6SB 4B53A 2WAQA 1DBAH 2YUVA 2UYLB 2NY2B 1LEGB 1QW8A 3VDAA 1M6OB 2VR8A 2XTSA 3LKSB 2BY3A 4KI5C 3QRGL 2BZCA 4MJ6B 2C26A 3HUJB 4FL4B 4YZFE 3ZT6A 4N8PA 5AAPA 2QGEA 2E56A 2AEQL 3FH7A 2ZUUA 2EQDA 3MRDA 3EF4A 1BQRA 1NUGA 4QY8A 4PREA 5MP6H 2WQAA 4G7YL 4DWHA 3J27A 4D9QE 1S5HA 3MODH 4QAMB 5IHUL 2ED7A 3HG3A 4AEHH 3RWIB 1JV2B 1XR8B 4PJAE 4HJTA 3MCYA 5B8CB 5C0IA 3QBTB 3KE0A 1B9KA 2Q8BH 4EZKA 1SMAA 1XTMA 2VLLA 5LQBH 1MOEA 1R24A 4QI3A 3OLGA 2WBXA 4XCYA 1SYVB 1SDDA 4FG6C 3P02A 4P2OB 2P42B 4X9HA 1NWOA 1YEFL 2QQNL 4KRPB 4U1HB 1OGTB 1L9MA 4A6YB 4D8PB 4XOCA 3ULUD 1BPVA 3FQXB 5BJTA 5BOPA 2VL4A 3QEHA 4NQSB 1EERB 1GR7A 2ED6A 3KPRA 4XAKE 3IFNL 5JA9A 3HN3A 2Y7QB 2HKHL 3K2MC 3O2WH 1SHXA 3P30H 4JFQA 1O9WA 5IHHA 2DICA 4NRYA 3MNMA 3P4OB 3CFJB 4HKZA 4P4KB 1DANU 2MCPH 4P05A 4KK8C 3LIZA 4PJAB 3EJYD 3C87A 3MBEC 3BP6A 4YC2B 1OT2A 5I5MA 5IEHB 2AJ3A 1JPST 3EHBD 4J4PA 5CIPB 3RLSA 3MVSA 4GUPB 1G7JB 3WJLA 3IBOA 4M7ZB 1WZMA 4MAZA 4XB7A 4PV1C 1SJEB 2DQTL 5IW6A 3O8XB 5FUZL 4YHZL 1XMWA 3TPUB 4UUJA 2NQ3A 1A66A 4G5AA 3R18A 1KENL 1VADA 1ZLEA 2DM7A 5FA4A 4HWBL 2VDQH 4E9SA 1BECA 5I6OA 4PJ9C 4AYFA 3P2TA 1JZIA 3RL2A 5KVGE 1M2VB 1KJMA 5A43C 4HUWB 5T5FH 1DDHA 4JPVL 1KEMH 1XXFC 3K8MA 5D93C 3I74A 4I3RL 4RWYL 2LLNA 2NT0A 4YXHL 4GRLA 3UG4A 5AQ0A 3H9ZA 3UTZA 3VFMB 1OB1B 5DK2A 1NIDA 3ABMB 4KX9A 1URIA 1BVOA 3APFA 2EJ1A 2O6CA 5IVXE 5KSUB 4GLRI 4AQ1B 1GC1L 1R75A 1MHCB 3IWVA 1XBDA 4GXVL 3REVA 3R06A 2BIOA 2W59A 4L4TD 5AEAA 3QJZA 4UTBA 1DQJA 4JFFB 3HR5B 1KPUB 5I1GL 5I1IH 4PRAB 5CFHA 2F7IA 1MHHB 4NAMA 4XMKL 4OZFB 3U79A 3VWJC 3NEXA 1U42A 3WTUA 2FE0A 3TJHC 2WXPA 3HAEG 1BM3H 4HKJA 3BP4A 1A6ZA 1FDLL 2FYYA 1WBZB 2JIXA 1GZPB 1NCDL 3BP5A 3JWNC 4JPWL 3RKDD 3T65A 2JH2A 2JB5L 5GQBA 5D7JC 1H0DA 4ZQKA 3LRKA 2EIDA 1XR9A 4NHUA 5ADPL 5DQJA 4PRPE 2M8XA 3RWJA 2CHWA 1X4XA 2Y2WA 3VDBA 5D7KD 3EDEA 3V5DB 4P46C 3W0WE 2X2IA 3KS0J 4XVSL 4YDLC 3R0NA 4UV4L 2K4WA 1OT4A 4GRMB 4OQTL 4WK0B 2IANA 5MENE 1AHWA 1OARH 3NJXA 1F58L 4X4ME 3SKMA 1T3FB 4JK0D 1GIGH 4MAYD 4NOBA 3RGVD 2L04A 4Y1TA 5BO1H 1JGUL 4BDVB 1TXKA 2NZ9D 3GT6A 3RVXC 1HKLL 5ADOL 2PWFA 2Z8RA 3U2SB 5B4MC 3HFML 5IBTL 1E28A 2NY3C 4D0CA 1QASA 1T0MB 1R34A 4QOKE 2ATKA 2VC2H 1NKRA 3T0EE 1BEXA 2X9WA 4R4ND 2FJSA 1CI5A 3C6LA 1N7MH 3QZLA 3U46A 4KHTL 1JSYA 5HJGA 2MPVA 4A04A 3HAEH 4K3EL 1TZHA 1QVOB 4X6DB 1GCFA 4CILA 1HXMA 3BEWA 1O6SA 1EK3A 2BNUB 1LEGA 1XSOA 2UYLA 1M6OA 1TYRA 3LKSA 5IB3B 1OAZH 4UQ3B 2ZCLH 4MJ6A 4KVNL 3HUJA 3NJLA 4YHPB 1KJ3L 5DZNA 4Z0BH 3V4UH 1L0XA 1RMFH 4LSVH 5KZCB 1MW0A 1T0PB 1ONQA 2OBGA 1E9QB 4LPTA 5FYJD 5F0PB 1Z7JA 2BP8B 4LP5A 1RERA 1R5IB 4TNFA 2X4NB 3QNZB 5GPRA 3VXSB 4DW2H 5CCGE 1JV2A 2ZWYA 3NEEA 1S7WA 3NIDB 5SWZD 5B8CA 3FTVA 1A3RL 1X6LA 4RSVA 4FQLH 4QOKB 1UJ3C 3T0EB 1JZ4A 5DO2D 2JKSA 1ADQH 1PSKH 4OLYL 1WZ1H 1G9MC 3UDWC 4Z76B 1V3MA 4LPXA 4Y2DC 3RBGA 3S35L 4GYBA 4OZ4A 4CKVX 2VUKA 4MB5A 5F9JB 5ALBH 2J4WL 1IQDA 4ABWA 5FAAA 4U1HA 4D8PA 1OGTA 1VRSA 2AVGA 3I2CL 3FQXA 4LDLB 4QUOA 1GYCA 1J5HA 5KSAB 1KGCE 4R3SB 4V1DA 1KCVL 4NM4L 1ROWA 1AQKH 2WYZA 2XZCL 1RIVH 1X5ZA 4KWUA 2OJZL 2Y7QA 4CN6A 3V0AC 4QHPA 2AQTA 4WNJA 1DUYB 3HG1D 3P4OA 3X14B 1XBRA 1WP6A 4P4KA 3W5MA 2AJXH 4Y4HC 2DJ4A 2NZIA 4PJAA 4DHLA 4X4YB 2DQMA 4LRIA 5K59E 3VQ2C 1X5GA 5IEHA 2G60L 4N2DA 4HF5L 4FFYL 3I02A 2FWUA 1RZJH 1M6UA 1I7RB 4Z9KB 1E67A 5ILTH 1XHHA 3O8XA 4G8AC 3RIAK 5CJBA 5AYUH 1QD0A 3TPUA 2Z1PA 4PM1A 1JYXA 2JKTM 5GZND 1KEGH 4GINA 1WJ3A 1YEDB 2W0LA 2R8SL 2CKBB 4UILH 5G5DA 2WQVA 5D1XE 4WUUB 2Z6FA 2ZKYA 4KKPA 4HUWA 3FUNA 2X4OB 2EDXA 1MVYA 3F04A 3ZE1B 1WBXB 1Y6NR 4Q58C 4QRRE 3AQDA 2DI8A 2O61A 2YAEA 2GJ6E 1A4BA 1NGYB 5KVDE 3E8VA 4DGVL 5HD8D 4HUVB 1WLHA 1SBBA 3THMH 3KBPA 4I0PC 1HCVA 4OFYD 3M8OL 5C09E 4ZSOB 4TULH 5KSUA 1P5UC 4AQ1A 2VDKB 2K45A 2XV2A 4MS6A 5TK4A 3IAGC 4TVPH 4Y1AE 2WIIB 1HHIB 2CGRH 3PAZA 2L7QA 1KPUA 1MJ7L 4PRAA 1NAMH 2UZIL 3UYPB 4HIXH 5KYYB 4PJGB 3N1FC 4N22A 4RGOL 3MRIB 5D1XB 1SLUA 2B16A 3K7UA 4XBPB 3L5JA 2EDWA 1FZJB 3WTTA 3OJDA 2DQGH 4N5ED 2YA1A 2XYCA 3P9LB 1WBZA 2LLLA 5DLMH 1AP2A 1FFPA 1RZ7H 3SYCA 1X3DA 1FRGL 3DIFB 1KTJA 5HHPB 3LEYL 1LL1A 2OSYA 2W1NA 4HCIA 3IJSB 2P5WB 3WJJA 3GMRA 3VG0L 1SHWA 2WVUA 4G6FD 3T6ZA 2PWDA 2VM4A 1QZ1A 3GSXA 8PAZA 2OTPA 5TFSL 1J1PH 3C9NB 2FWSA 4DPAX 3D07A 3JVFC 4GRMA 3BVNB 6FABH 2J6EH 4OSUH 5A6IA 3D9AL 2OQJA 1T3FA 4M1DL 4WKXA 3QIUB 4PG2A 4JKPL 3NTCH 3TLRA 2KBGA 2ZICA 2JKJA 4BDVA 2EH8L 4AQ8A 2KDGA 2CHXA 1YNKH 4LPVA 5H4YA 4WEUD 3SYAA 1AS6A 4B5EA 3TIDB 3U2SA 4KI5E 1CFNB 3GF8A 4POZC 1KZQA 3S7GA 2YMXL 5DD5L 2MCMA 5G4OA 5HGHB 5I1HL 1T0MA 3C2AL 2FIKB 4NPYB 3R8QA 3DHPA 4AVIA 5IB1B 3WI9A 5DD0L 4N8CL 3AROA 4ODUB 1UM5H 2NXZD 4X6DA 2EC8A 5E03A 3TO4A 2RQ8A 4HWEH 2YXMA 1MSPA 3FB8B 4RFOH 5FIEA 4OM0L 5GJTH 2NY5C 3SE9L 5JW4N 4UQ3A 1OW0C 3UZVB 3OAUH 4X4MA 3IAPA 2J5WA 4OU3A 2HRLA 3F05A 4FNRA 4O9HL 4MD0B 4HS6B 4IDJH 1E9QA 3GXUB 3X1EA 1YJDL 3D4YA 3SD2A 2BP8A 3B7TA 1CFTB 1ZD6A 1R5IA 3JWOH 4KK5C 4ZAKB 3O11B 4ALAC 3MBXL 3L3IB 2X4NA 4DOHE 1AGFB 1NCWH 3FOMB 3OGOE 4X80L 4UTAL 3ZU8A 1F8TH 3DHUA 4PJDF 5JOEA 4QOKA 1UHVA 3DPDA 4ENZA 3ELAT 4E41E 3T0EA 2RR3A 2D3LA 2PXYB 4U6HB 2J8UE 1CB4A 1YNTB 4GO8A 4Z76A 4HEPG 1H3PL 3RX7A 3IFPB 5CO1A 4MJID 3CZKA 2IAMC 3DMMD 5A2BA 1OAXH 3FB6B 2DQCH 3GHEL 4KKZA 3X3FL 1XGQB 3DYOA 5KSAA 4KDTC 4R3SA 2EE2A 4JVWA 5BQ7B 4WTQA 5IBLD 5F7WC 4ZTPL 2P28B 2OW6A 2XPYA 4PJCF 1JOIA 5F96H 1DUYA 3X14A 2BRRH 4NGHH 2FCBA 1DSWA 1D9KB 3MRRB 3MROA 1JV5B 3G7TA 4RMVA 5BRZD 5I1DA 5JZ7D 4X4YA 5I0DA 6PAZA 2Y0SA 4NNXB 3L5XL 4LQFH 4E41B 1H5BC 2AQ2A 2YD7A 1JGVL 2LHAA 1IAIL 1TFPA 1X7SA 2PMZA 1ODAA 2IGFH 2NX5D 2DH2A 2C3XA 1QLEH 5FK9A 3L4YA 5E1AB 3NCWA 4LCWB 1SMOA 5J3HC 5FKAB 2PO6D 3FSVA 3RE0A 1N6UA 5AKTA 3SOTA 4XPFH 1G9NL 2CPUA 4YSEA 3CDCA 2J8OA 4HD9A 4N2LA 4ZMAT 4ZX3A 3FSOA 2R59A 4PCSA 3S34L 2DIJA 2GAZB 4JRWA 2XN9D 4A68A 4HU8A 2X4OA 1OCOB 3FYIB 1WBXA 3BT2L 5KANG 1B4RA 5GHWL 5CS7A 1NDMA 5FB8B 1J9TA 4HJSA 4U6YB 5I1KH 5DWUL 5MEOA 4HUVA 4XT1C 3NSXA 4HWZB 3KPSD 2OKMA 4D9LL 3ULUH 2ID5A 4U7MA 2IV9A 4ZSOA 1EZVY 3PP3K 3JWNE 4X4XB 1K9TA 2RACA 3U6RB 2WIIA 1HHIA 4YHLH 4MWFB 1IGJA 5C0JA 2GJPA 3IDYB 4K9JA 1KB9K 2ICEB 2H1PH 5KYYA 2R0WL 4PJGA 2VRKA 3BFOA 2A74B 3K2UH 5D1XA 4PGCB 4WHTB 2VDQB 3MXVH 4MVBC 1ZRUA 4AL8L 3EBGA 4BZYA 3EOYG 3M7OA 4XBPA 4G9FB 2BZDA 3DC0A 2EYTB 3KWXA 4HSAC 1WITA 3P9LA 4X4ZA 4QRRA 2AJYL 2GJ6A 1DR9A 4QHMB 3DIFA 3V2AR 4G7VL 3CXDL 3AFLA 4U3XA 3IJSA 2Y3AA 1IU1A 3D25B 3QFJB 4DSYA 4ZO6A 3CFUA 4HW6A 3C8HA 3C9NA 3DTUB 3GBNH 3LXAA 2YLHA 3B6SB 3BVNA 4Z77B 1LK2B 1JHTA 2I5YL 4Y1AA 1QRNB 2H3KA 5D4JA 2NDFA 3QIUA 4OGYH 4FGMA 3NAAL 2ROYA 2VAAB 3BWAA 5SWSB 3VFUB 3V4LA 2BSTB 2X3BA 5DJAB 3DXAE 3KJ4C 3TIDA 4JX0A 4UQCA 3VAEA 1CFNA 1PVHA 3B5HA 4J8QA 1UWEH 4FG4A 1J12A 2R23B 2VLKE 5EF1A 4NM8L 1DTUA 3T4AA 2D7NA 2FIKA 4H25B 1E4JA 4NPYA 4XP4L 2KDYA 1ZDSA 1F86A 1TQUA 1L6ZA 4OCMC 5AOMA 5AG9A 5ISZE 4J2XA 1KBVA 2R7EB 3FSAA 3NFSH 2ZE0A 3TYGL 3B8YA 4ODUA 4FKEA 5HI5C 1THCA 1QBBA 1B4JH 4GBXC 3AXIA 5DA0B 4GI8A 5D96C 5DVKA 3QXDB 5AVWB 5T3XL 3TT3H 5J0BA 2P8LA 2RB8A 1MFAL 2BOCA 2HJKA 1JGLL 4MD0A 4MCZA 3D1MC 4HS6A 1H3TA 1F11B 5KJRL 2DS4A 4B96A 2V37A 3O11A 4JPKL 1F00I 3Q6GL 4RRPM 2WBJD 1AGFA 4TN9A 1IIKA 4K94L 3EDFA 3O6FC 1UATA 3QQNA 3ARDD 4PBXA 4KROC 3VXUD 4B9JA 2WZPA 3H42L 2PXYA 3OSVA 4G8FB 4U6HA 2LOEA 3QNFA 4JFUA 3CX5J 1YNTA 4ATTA 3BKMH 5ISZB 1LO3H 3SN6N 3TEWA 3IFPA 5L6YH 4AOFA 3UP6A 4UDUB 3VWKD 3X1BA 2D2CC 3HAEB 4O2EB 4QRBA 5MEQB 2MJWA 2XC8A 2J1XA 1XGQA 1OZUA 4OLZH 5DHYB 5HI4C 3ZJAA 5KVFH 2DDQL 1KTBA 4QXGH 1GCYA 1M7IA 3HG5A 3UBXI 4LVHB 2EDHA 2DB8A 2Q7NA 1G6RA 2FDBP 3D48R 2X6CA 1WD9A 1JV5A 1F4WH 1BREA 5DMKA 3QRBA 4ZQTA 2DM3A 4XAWH 4NNXA 1MIML 3WNLA 2IFFH 5IP4A 4E41A 4NNPL 5EWIH 1J1OL 1FVEA 2J8UA 5AFAA 4GKLA 1CD1B 4ADIA 2Y7OA 1JAEA 2YUXA 1SEQH 4G6AC 4U1GC 4MZRA 4F8TA 5E1AA 1EQWA 5FYJH 3KGTA 3DVFA 2R4SL 3NJFA 5FKAA 4L8BB 1MIEL 5SV3A 4J2QA 4OCYH 4AQAB 1C5BL 1F3JB 2AFNA 2VMDA 3SE4A 3TBTB 5A2CA 1U4FA 5T1KD 5KBKA 4CDHA 4N4YB 4U1MB 4WNQB 2VXUL 4ICXA 4X6BB 1JWMB 3HE7B 1VKXB 1KCRL 3CFBB 3RGBA 4U49A 1G0DA 5A7EA 2D2OA 4X6CB 2BVEA 5EZIH 3LN4A 3MYJA 5FB8A 5K1NA 4U6YA 2CO1A 3K1KC 5I8CB 5SX4I 2BCKA 4PJ9A 4WI0B 2VSMB 3LRHA 3PWLB 5ANHA 2I7SA 1RU9H 3PFUA 1UVQB 4DVRH 1TSHA 1U30A 3T9WA 2C9QA 4LEBA 1QQDA 4LSUL 4X4XA 3B5GA 2ARWA 2BINA 1A8ZA 3AS3A 2DKUA 4MWFA 5DJ0A 3U6RA 3OJVC 1MFMA 4PI0A 4I0PB 2JLLA 1JWSA 1OTUC 4ZODA 5CU5A 1FO0H 2APWA 2X6AA 4ZD3H 2P24B 4BA8A 4IRJB 3WMQA 43C9B 2WKLA 2A74A 3CPUA 4PGCA 4WHTA 2EXSA 3QEGL 1TPXB 5AZUA 1N5AB 3ZHLA 4AEEA 4ELKA 3BAEL 5JIHA 2EYTA 4K23L 1IQWH 1R1CA 4ZZKA 1Z0NA 1XF3B 1DFXA 2HUEA 4KXBA 3CVCA 1GMIA 3Q8FA 4M5TA 3MRJB 5DJ2A 4FEMA 4PJ8C 1HXKA 4IBSA 3AWFA 2Q8AL 2FECI 5BMFL 4R7NB 4FTDA 1NBCA 3MV9E 3QFJA 4XX1G 4E9WA 3GS7A 1A9BB 2FT8A 1YSOA 4LSQH 5GZOD 4OLXL 1IT9L 4DPRA 1ZJBA 3QPXL 2AS5M 3ARGD 1BVLB 4Z77A 4IGBB 5HHME 1YQVH 3LD8B 5C0RH 5GISH 4DH2A 2VAAA 1IGTA 4JFDD 2LTQC 3VFUA 2VMJA 1I7TB 5FC9A 1XGYH 3VFGH 1ZT7A 2QDVA 3V6BR 2DQHH 4WO4C 5DJAA 2NY7L 3EYSL 3KPNA 2XWCA 5L2KE 2WXRA 1U93A 1NAMB 2PW1B 1M7DB 3UBGA 2EO1A 1JTOA 2R23A 1HZLA 2XKUA 3FT3A 1FJ1A 2AQPA 2EXWC 3ILEA 1N64H 2FJHB 4ZS6D 2C3WA 1SXCA 3A4FA 3MV9B 4ELMB 3PNWB 1I9EA 4PJEE 2ZOTA 4FD0A 1KT2A 5JXAL 1QHOA 4XMXA 3GTNA 1YEJH 2PYFA 5GGTL 12E8H 4AENB 2NSQA 3S6CA 2NYYC 4OKVA 3LH8A 1Q9KB 3TFKC 4IEFB 1OAUH 1F11A 3P0YH 4JHUA 3DXAA 1I7ZA 4FFZH 4HMEA 4TPRL 2PWHA 5CJOH 4PRIE 3AREB 3QT2A 4HU2A 4XN2A 3D85D 5HPMB 4KXAA 2QPSA 1SF5A 5F89B 3K6SB 3OC5A 4G8FA 3TWCH 3CVHL 1A6WL 1JDDA 5ISZA 2P80D 4H20L 2FWOB 1DVFC 1SN2A 4RFNB 3V0FA 2I26N 2WQWA 3T0XA 4WFEE 3HS0B 2B3IA 5AZ2H 2FX9L 1RZIA 3UPRB 1KXTA 1S5IL 3HAEA 3NRQA 2AEOA 3IVKB 5J5EA 1ZTXL 3RDTD 2HN7B 5MEQA 2AI0H 4HETA 4IKJA 5IM7B 4NIKB 5DHYA 4U1IB 5TH2A 2BM3A 5AG8A 2Y25A 3GIZL 2IAMB 3RA7L 5EB9A 5A2AA 2OZ4L 1OPGL 4S11A 4HUUA 1NJ9B 3NRFA 3GUTB 4GLRH 2CGZA 4WTXA 3H7BB 2GEQA 4RRPG 1I9IL 3PY9A 1L9QA 4LASL 3QFGA 4YSCA 4MYPA 1NBYA 4X8XA 1L7TH 2M2DA 4W9CC 4PLKD 2DQEL 4OD3H 4RZKA 4YDIL 5E4EC 2B2XH 5F6IC 4YWGH 1BAFH 4FP8L 4HUMB 3TA3D 4L4VE 5JPMC 1SJVA 2VLRD 4FJZA 4ONHB 3EYFB 1KXVC 1NCBL 1Z9SB 1HINL 3B9DA 3N1QC 1PS3A 2H45A 2ZOKB 2KLRA 3EADA 4PMEA 1F3JA 3TBTA 1H5BB 4QLWA 4PGBA 3O3AA 4FADA 1NEZB 5EOQL 4U1MA 2TSBA 4C58B 1USZA 1JWMA 3HE7A 4X6BA 1VKXA 3MJGX 1KTKE 3CFBA 2P43B 1IO4C 3GKWH 1MJUH 4JGUA 4X6CA 5DQ9A 3ZBMA 4X6EA 5EU6E 2EXTA 3DJRA 1CMOA 5GRVK 4BFGA 2BSCA 3Q5YA 4P59L 3WFHB 5EFIB 1PX8A 4HH8A 3K71B 5DMJB 1JZ3A 1JFQH 4H0HB 4CMHB 3ORJA 3RHWK 4M7LL 4XMLH 3SO3C 5FHAL 2F53D 4KTDH 1W0WB 1KIRB 3PDOB 4IU2B 2V8LA 2OTUB 4PJ7E 3MJ7B 1MPAH 1K4DA 2BS9A 1ZMYA 4I0PA 3F5WB 1QLEB 1K8DB 2I60H 2EDQA 4YR6A 5D2NC 4JZJB 5GS3A 43C9A 1N5YL 2CRYA 3MLVL 2XG5B 1LO4L 2VE6B 1MVUA 2DLFH 4MAUH 1UB6A 4QTFA 3BKYH 1JN6B 3CQFA 2JXMB 3T3PE 5KOMC 3SQBB 3BI9X 3NABL 3WAKA 1C5CH 1OCWL 1J8HE 2VGLM 4KZCA 5D7EA 4R7NA 4HCGA 2FEDC 1A9BA 1PKQE 2FX8H 1P1ZA 1KV7A 1FBIH 3UAFA 5C0GB 4R26H 3ALWA 4GKSA 1H8LA 4MA1C 2OXGB 3UADA 4MD5A 4PHZA 2J21A 1B88A 1E90A 1JNNH 2GCYB 2FJFB 3UAJC 4HMDA 4UT6L 3S36X 1FYTE 1DBMH 1OK0A 1A4KB 5E8DH 1I7TA 1I1YA 4K8RD 1VPOL 3QUYC 4NZRH 4IBUA 1CF8H 1ITCA 2PW1A 1M7DA 4X5PA 4GKNB 1U8PB 4GUQA 4N0YH 1EBPA 2FNWA 3ZDXE 1IGML 3FN3A 4IS6B 3QAQA 2MOQA 1NA8A 2B1AL 4K3DL 4JM4H 1YC8A 2XPGB 3SDXE 3T3PB 4AG4H 5EZJB 5D7JD 2C9XA 2AEPL 1OGPA 1UURA 2R0KH 4L4TE 1J86A 3MV9A 1WA2X 3L17A 4NRXA 1X5XA 3PNWA 1Y0LB 3RIFF 4R97B 4TVSa 1WE5A 2APFA 1HHHB 1GSMA 2X10A 4Y8AA 3L45A 5AVQB 5DRWB 4I3SL 5FCSH 3ZHNA 1T1XB 3TJEL 1PFOA 4AENA 4KY2A 1EIBA 4N0FB 1FYTB 3ZY7A 4IEFA 4UAOC 5E5UB 2QT6A 5EBLB 5L2KA 2YGVA 4FKHA 2DWTA 2QGDA 4RBPK 4CKQA 2OR9L 4Q9QH 3FU7B 2CA3A 5LLIC 2GI7A 4U1NB 4XPBH 4PIRF 3DLQR 4Q52A 5AOZA 1Z32X 2VQUA 4FXKC 1PCXA 1QI5A 4HQQL 1DVUA 3SDXB 3K6SA 4LU5H 4OW6A 1V3KA 2BS8A 2FWOA 4JY5H 1OEZW 4L4TB 5L4MA 4KKCC 4XHQA 3VXPB 4YSAA 2E0PA 3HS0A 4L3CB 3O6FB 3UPRA 2ZXBA 3BN9D 2ZNXA 1G1CA 3ZE2E 4JPSA 1XH1A 3U9UA 2NY4D 2X53A 3N1MC 4XPAH 5CN1A 3H3PH 3DBSA 4YUEH 3HZYB 1NAKH 3OM3B 3X11B 2IAMA 4BWWA 5KVFE 5I0VA 4YFDB 5D7IF 3H7BA 1BIHA 4PRIA 4NZTL 2IDCA 5GSVA 4KDTA 1CDCA 1CICD 3GI8L 5FFGA 3UZEC 3QYCA 5I1LB 3AU1A 3GSRB 1TEGA 1MWAA 3Q1SH 1IJ9A 2ZUQC 4ONHA 5ICZB 3EYFA 4MAYB 3RGVB 2Y69B 1PY4A 2CUAA 2KKQA 3BIKA 1HESA 4FQ2H 4Q4EA 1H5BA 3FU8A 5E0FA 3ZE2B 2LV4A 4DPCX 5C0NC 4P5KA 5TDOB 4LOUC 2BDNL 1BWWA 2Z92B 3NZHH 1KN4H 1QSZA 3FFCD 1RIUH 1SJXA 1QG3A 4KBPA 4Y5XC 4RDQG 5EHFA 2VO5A 5LGYA 2WP3T 1RLWA 2HX8A 2QZ5A 4OZHE 5L7XH 5EFIA 1E9OA 4PVBA 4AE0A 3VQMA 1DJWA 4OJFL 1C5DB 4B0MM 1Z6JT 1TU2B 4FHKA 4YQXH 2Y7MA 1B90A 4OF0A 3GWJA 4L4VA 3FUFA 5DT1L 2AKRB 1WCBB 1E4WL 2H2SC 2QTVA 3AXLB 5DFAA 1F02I 3C60D 4X42A 1INDH 3OL2A 2IVFC 4KKRA 5DC9B 3HG1E 4OCLC 4YSTA 1EJ6A 1CLOL 1NIBA 5E5RB 3O0LA 5C3LD 1J05B 1PDKB 5SWZB 2FBJH 4HEPA 5GGQH 5EU6A 2YUZA 2WSDA 3LS4L 5EU3B 4YDJA 2W0FB 1A7QH 1ET8A 4IBQA 1QEXA 2G9HA 4LSRL 2GIMA 1AZUA 1N4XL 3QA3B 2CK2A 5AW1B 5DURD 5C0GA 3QPQC 3PV6A 3N41F 4MSWB 1WAAE 2O4EA 4M5YL 1A65A 2EYRB 2GCYA 1MEXH 5LBSL 3MOAL 2WVTA 3TH4T 5D2LF 3GEFA 5JNYA 1A4KA 4JM0A 5HP5A 3GTTA 3OLIA 3VYNA 1Y6KR 1LE5B 2IMNA 1A2YB 3HG1B 2GSIB 3LS5H 1FO0B 3ESOA 4OJYA 2G2RB 4R7LA 5CP3H 5FV1L 3LJ3A 1F4AA 1RZGB 5C08D 3NA9H 3GJEB 4XP9L 5KUKA 1K5NB 3DRQB 4OF3A 2VW7A 3BFWA 2EIMB 1M05B 2NMSA 2P8MB 4ISVB 1YNLH 1J8HA 2LVEA 1BZ7B 5AOLA 3UG5A 1D5RA 2HT3D 5AW3B 2CR0A 1Y0LA 1PKQA 4QRPD 3O2DH 1NBQA 5DRWA 1T1XA 5FW7A 4K3GA 3EFFA 1F3DJ 1GRWA 3DROB 4N0FA 2F8XC 1DBBL 1KCBA 1FYTA 1UWFA 3INOA 3NK4A 4EI5C 2B39A 1BXXA 4XX1E 5D8JH 3DTDA 4GBXA 5EBLA 2WJ7A 3HMWH 3PDGA 4EJ1C 4JL2A 2KI6A 1B9ZA 1Y6MR 5CUSL 2WUBH 4JVUA 4U1NA 4FTVE 3TIEA 1FG2A 3JV0A 4WWPA 2G3XA 3SDXA 3X3GL 2CJ3A 5AVSB 1M1XB 2P9RA 2FD6H 2YEQA 4L4TA 5FECB 4HJ1A 3VXPA 4Q6IC 4L3CA 1ROCA 4X8CA 4D0BB 3O6FA 1JF1B 3KWVA 1WG3A 2JTYA 3BKJL 3JTTB 3DKHA 5DS2A 2FAUA 5JHLH 5DGRA 1A4JB 4PP2B 4YHKL 2DLEA 1TETL 2HFTA 1WDAA 4AM0Q 4OLWL 3BH9B 4UB0L 4LSDA 3X11A 4QNPF 1VENA 2R1XB 4XBGA 5IQNA 5C0BD 3VRJB 5B7EA 2JV6A 2OV0A 4K5OA 3CLFL 4XRCA 3UC2A 1F4XH 1PLAA 1ULVA 1X5IA 2MNWA 4G6FB 1KYOJ 4F80A 1XSJA 1A7NH 3GLEA 3N43B 1VZHA 3GSRA 3MSPA 2UXVA 2VXTH 1NBZB 1FAKT 4AL8C 2Z8VC 5IOPB 3VFPA 3HKZA 5ICZA 3LKOB 4MAYA 3RGVA 2Q20A 3ZE0F 2N1KA 3TWYA 1MY7A 1YMMD