2IBZX

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EVKLQESGAGLVQPSQSLSLTCSVTGYSITSGYYWNWIRLFPGNKLEWVGYISNVGDNNYNPSLKDRLSITRDTSKNQFFLKLNSVTTEDTATYYCARSEYYSVTGYAMDYWGQGTTVTVSSAWRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ibzX00
2PXYB 4LAQH 4RRPA 3PP4L 1BEYH 4OV6F 4UIMB 4JO4L 1A3RH 2HT2C 2GJZA 5J3HD 2P8PA 4ELKB 2R0LH 4RFEB 2A77H 4OZHE 5I17B 5HYJD 5DEFA 1CIUA 4M8QA 5HYEA 4A6YH 2JJTA 2HVKB 4MNQB 3RPKA 2LVCA 5E2TH 3QHFH 2V5TA 5D2NC 3O6ML 4QHNA 4HKXB 4YHNB 1A14H 5D1XC 1YMMA 4DGIH 3X3GL 4KZDH 4FQXB 3IU3A 4P99A 5AZ2L 4LSPH 3T0EA 3MV11 1HEZB 4NFDA 3SPVA 3PL6C 1S7QA 3MREB 2AI0L 4HMDA 4FXKB 4WFHD 3RVXC 3ARFA 4BQBA 3C5ZA 4MAYD 1UZ8A 1JYVA 4Q9CA 1PD6A 3GRWL 1CE6A 1KB5A 5DR5L 4O58H 3HMXA 2AXHA 1I9RL 3MRGA 3VGDA 4WFHE 4OBRA 4XCCL 4YEFA 4HS8L 3L95A 4U1SB 5I2IA 3MJ9L 3MBEB 1H5BC 1EXUB 2KZ1B 3H2WA 5HHNA 3AUVA 2WIIB 2YSSA 5CSGA 4JM2B 3ARBA 3N9GH 4KVNH 4N9GA 2XG4A 3MLVL 3D0LB 2AV7A 3QUZC 4LVOB 4YHIA 1UJTA 1M7IB 1EMTH 3KLAA 3V2AR 2B5IC 1YYML 4TUKH 3GI8H 3VDCA 4LLVA 4M1DL 4X4ME 4J3TA 4OFIA 1QP1A 3SY0A 4YIQB 1XIWD 5CIPH 3ILQD 4PJEA 3O0RH 1L6XA 5KANG 4TNVF 3ZZ1A 2ZOLA 1KNOA 2LAGB 5KVGL 3V7MA 2A83A 1JGVH 1C5DB 4OCYL 1XGTA 4FQHA 1QHOA 2HFFB 3CXDL 1P6FA 3QDGB 5IROC 1U93A 4ALAH 4F7TA 4OV5B 2RCSL 1YEIL 3O11A 1JF6A 4JY5L 1B0GA 1X3DA 4U0QB 4PP1C 1CL7H 1NMBH 4KFZC 4XZUB 3QUKB 4BK4A 1CLYL 1GZPA 1WTLA 1JV5A 4AENB 2HFTA 2HG5A 3GSWB 4PV8B 4LLWA 4KHXH 1F11B 4XXDB 3PGDB 1K8IA 1P7QD 1R5WB 4ZNCD 3HLAA 2IBZX 4RNRA 4FABH 5C0IA 5IT2L 4L4TA 3QWRD 3QBTB 5GRVL 4WI5A 2IQAB 2J88L 4QXGL 4TTDC 5GS1A 3LIZH 1N0XL 3FO1A 3BN3B 3RVUD 2XA3A 1KC5H 2IALB 5GRJH 4NKOB 4OAWA 4Q6IA 5ISZE 2QQKL 2W9EL 2W0FB 2X70B 4YZFE 4FTVA 2VDML 4X9IA 1OP3K 4LBEB 5D6CB 2R8SL 1K4DB 3IAGC 1D5ZA 2Y6SD 3MV8A 4EUPH 5BV7L 3MR9B 3OB0H 4HZLA 2NPLX 4QRPA 3QCUH 1NFDB 5B8CA 3LS4H 2QQLH 3QQ3A 3T3PE 2EDBA 5A43C 5JDSB 4NQEB 2APTA 4ONFH 4PJHF 2VDKL 4ZFFA 5BOZG 4H88H 4LPCA 2P8LB 4WU7B 2XTJD 1YQ2A 4Y4KB 4UTAH 3GFUA 4HIJB 4A6YA 1F3DH 3QEHA 5HGAA 5EU3B 1AGCA 4XHJD 3ARGC 3W11C 3P4NA 1GRWA 3OAUL 5DS8A 5AWNL 1P69B 5GISL 2YOCA 3HFMH 5GSRA 5I1HL 5TQ2H 1KCUH 4GG6A 2XTJE 1FZKA 1JK8A 4KQ3H 5ITBH 4WFGD 3S5LG 3FONA 3BQUB 5GGRY 2YR3A 1MCPL 2NTSP 5DURD 3OB8A 2V2WA 3LV3B 4MHHI 2MQ0A 2V5MA 4NQDB 1W0YT 3ULVC 1LD9A 1CGUA 3STBA 2ICWB 4LRNH 5GRZA 4U1LB 3MYZA 4WFGE 4WGVB 3I84A 4PJAF 1NANH 1DQDL 4LQ1A 4WO4B 4N5ED 5DWUH 1Q9KB 5DXWA 4NC2B 1TVDA 1R3JB 5DSCA 4KC3B 1KN2L 5HGHB 2OJEA 3U30C 1JFQL 4GKNB 2BRRH 5AZEH 1NGZA 1EX0A 5D5MB 3AC0A 5HXMA 3GMMB 4OGXH 4Q9QL 4QWWC 3QDJB 4PRIA 1OCWH 1KLFA 2BSSA 1J86A 1IC4H 1CXKA 2Y7QB 1NFIB 3D39B 4XBGA 5EIIB 1LP9B 5D7JA 3S4SB 3OSKA 3BDBA 4OJFL 3IXTB 2IF7A 5EN2A 4PJCF 3BP7B 2BVYA 3EUUA 5CIPA 1ORSB 3E8UH 1K8DA 1KXQE 3MFFA 3RL1B 3BHBB 3DO7A 4NRYA 5GS2D 2Z31D 4XXCA 1A6TB 2ZUXA 1G9EA 1EHLH 5D7IF 2G60L 5JTWA 2ED9A 3JUYA 4QHMA 3L3OB 5KVFH 3I3BA 1OB1A 4P5TD 5DUPH 5JXEA 4OZIA 2C4FU 5IG7B 2FYYA 4W81A 5D93B 4X7EC 4H25A 4U6XB 5IVXB 1MHHB 5GGVL 3RWGA 5IVZA 4PGEA 4HUMB 5DMKA 3MRNA 3MRDA 4OLZH 2AKRA 1G7QA 4G8EB 5KW9H 1FYTD 4X5XA 2E6PA 2X4NB 3UDWC 3WFBH 4RA0C 4OCWH 1EBAA 4WCYL 4FQCH 3MRHA 4JN1H 1M7DA 5IK3B 3PQYD 1OOAA 1UENA 4MWFA 3MLUL 4OFVA 1LWRA 4Z7QF 3IFPB 1YY8B 5L2JA 2Y25A 4NWUH 4QRRA 3WLBB 5FB8B 5L9DL 1FYTE 1KCSL 2YRPA 2VN4A 3BZDA 3D9AL 4XBPB 1HH6A 3PQYE 2NXZD 2HLFC 2I5YH 5D6DC 2I27N 3S37L 2UWEF 3E1F1 2WANA 3GSXA 1KYOK 4G80B 1ZS8B 2H8PB 2O5XL 4TVPH 3VXQB 2E8ZA 4EUPA 3BKYH 2QSVA 5GJTL 4I3GA 3HRZA 3MCLH 1IT9L 1A6UL 4KRPD 2P5WA 4WHTA 5H37H 2IPTL 1GYAA 1NCNA 3JV4A 4M6MH 3RUGB 3HKFA 2DI8A 2NTFA 1QBLH 1CFVH 4AT6A 4LSSH 4I2XB 3ESVF 3LKSA 2MCG1 3VMNA 4F2MB 3I6GA 4OF6A 4PJDF 3VDBA 1AIFB 2ZUTA 1TVBA 4HMEA 5LG1A 3WFZA 1GCFA 1ZLWH 5LBSH 2HWZH 4ZTPH 32C2B 3K3QA 2AXFA 4Q9RL 4XPTL 2DQTH 5DJXA 2F53A 1G0DA 3IDNA 4EN3C 3F8UB 5DA4A 4R4ND 1G9MC 3L1OL 2GAZB 4X6EB 1BOGA 5C09A 1FZJB 4GRWF 2X4QB 3EGSA 2EEDA 5DRXB 1Q94B 1OPGH 1FZOA 4P2RE 5CWSA 1AQKL 2VXSL 3IJYA 1I7RB 3KYOB 3DMMB 4R3SA 2FECI 2R0WH 5IB4B 1TJHH 3W9EB 4OZFA 3TH4T 1RZJC 5D4QA 1CGXA 1JTTA 4YDVB 4R97B 1INEH 1X7QA 4LLQA 3JZ7A 1KIPB 2JJSC 4MAUL 4I0PD 1RUAL 4IRSD 4P23C 1CDGA 1URLA 4JPKL 3B6SA 4DN4H 3FQXA 4G6FD 4L8DB 4PGBA 3TV3H 3U7YL 3OB0K 2C4FT 3VI3E 3SCMB 4BSJA 2VE6A 5J6GA 3UCRA 4NCC1 4GQPH 2BHYA 3FQTB 5KSBB 4Y4HB 4BZ2H 4XCYB 2CDEB 1J1OL 5K59F 2FL5A 1T20A 1JRHL 1XGRA 3ARED 2WBJD 3T0XA 2WAHA 4DOHE 3SDDC 4I3SH 2ZUVA 4ZOCA 3WNKA 3PJSB 4M62H 4Z78B 1FLRL 3OXRB 3DGCR 4JHWH 3ROOA 3SKMA 3WNLA 2CK0L 4N0RA 1MCHA 1U91B 1OQOA 4MNGE 1DLHA 5A2LH 3SDXF 2YMXH 3FB7B 25C8L 4CN1A 2L7JA 1OSPH 4O2FB 4QY8B 4BQ6A 4ODTH 1FH5H 1OQXA 3A6CL 2NY5L 2Z93B 1NCAH 1P7KA 1MFEH 4QOKD 5DQDL 3O4LA 3MRCA 5EO0A 1JNHA 4Y0GA 1HHIB 3CMOH 5IB5B 4P46D 4TNVK 2BY2A 3TNNA 2L0DA 1AE6L 4O2CA 3REVA 1RZ8A 3QUYC 4HUKB 5LAXB 2FB4L 4K94H 1ZWIA 4PJHA 4PJ5B 4PPTA 1KCRH 4JKPL 5I1KL 4S2SA 5CINH 2IAND 4QF1B 3L6FB 2VDNH 3X11B 4JGJA 3E6FA 3H9SB 2D0HA 5KVEH 1GPOL 3FT2A 3U36A 5AAMA 2BFVH 3BZEB 4DZ8B 2V7HA 3ARQA 3FQNA 3MRIB 3TA3A 4KK5C 2FO4B 5C8JA 1NCCL 3D0VA 5T1LB 2X9YA 2NY1D 4WI8A 1FG9C 4PLKD 3ULVF 4F9LA 5FAAA 4P57B 1QR1A 1QNZL 5AUMA 4JEGB 4OIIH 5ESAA 1U3YA 5GGQL 4EIZC 2HA1A 5BQ7B 1MIML 5JPNA 1IM3B 5DLMH 4F7PB 1N8ZA 5EBWB 2ARJQ 5FA4A 5E5RB 1N3NA 2C1OB 3RNKB 2W07A 1UWGH 3VRJA 4X7SL 2EDLA 4PJAA 5E03A 2OTUA 3QULB 2VUYA 3VG0H 5E6ZA 2ITCB 5DDHA 3JWDL 1RK1A 1DEDA 2F9BT 4IOFD 2BZDA 4B0MM 2O5ZL 3KDMA 3WO4B 4LLDB 2FBJL 5IESH 4Z9KB 3GSQB 3QEUA 2DQGH 4YHOL 1QKZL 2NY0C 4IDLA 3QUML 1EAPB 4LRIA 2YHGA 3IU4L 3DUSB 1X5LA 4PIRF 1MEXL 3K7UA 2IAMD 4BJLA 1UXSA 1KOAA 3ELAT 5KSVA 1VFAB 1H15B 4OCXL 1IKFH 5CD5D 4K55A 4XC3H 1G6RH 4YWGH 5FDWB 1CD9B 5I76A 2ESVE 5EOCL 4GRMB 2OL3H 3BUYA 2ICEB 4PJCA 2MHAB 1ZHKB 3LHPH 4FXLA 5C9JA 4S0SD 2FD6L 1FSKC 1MY7A 4YDLC 3MSPA 4ZUTA 2FIKB 3B9DA 4Q9BA 2DQFA 3BKJH 3OL2A 4GH7B 1YNLL 5GRWA 3OF6D 2FX8L 3ULUD 3EOTL 2P24B 2IG2H 4LSUL 1DN2A 4GAJL 3VE0B 5L6YH 4N68A 3HMWH 4IM8A 4BH7B 1RURH 1F58H 5BO1H 5FOBA 3U4EA 3GSRB 5CBAA 1P84K 5D2NA 5HDBF 1EUUA 3FO9B 3HG1B 5HHOA 4E41E 5D1XA 1CXIA 2C7UA 4NM4H 1YEJH 3BIKA 4IRZH 2JJWA 3DHJA 4IRJC 4UDTA 3ME0A 4L4VB 3MLTB 3CPLA 3PL6A 4HCRL 4UNVA 4AL8H 4BSWA 2GKIA 3U1SH 4LGRB 4EI6A 4MJ6A 4H8WL 4K8RL 4LKCA 2LV4A 1BBJA 1A8JH 4P2QD 4FQJH 1G7IA 4KKBD 1TVHB 1INDH 1VB9A 2AQ1A 3MA7A 1IE5A 3LKQB 3ULVH 3P9MA 5KSUB 1HCVA 1B0WA 1UKTA 4K7FB 2L7UA 3GSNH 3NZ8B 4F8TA 1U0QA 2UWEA 3PWLA 2I07A 4GMTL 2VR9A 5DHVH 4DVRH 4U7SA 1HHJA 5ADPL 3M45A 2OR8A 1H5BA 3BEWB 4XI5D 3DYPA 3O9WA 4QLRA 4KJQC 5ACLA 1BQLL 1EJOL 1DUYB 1MCEA 2I25N 3H8NA 3CFDA 1AI1L 3Q6FA 3QUZA 4FQ2H 4WUUE 3OHXA 2X4TA 5L7XH 1U92B 3F12B 4K71C 4XC1H 4KHTL 3P77B 3V5HA 1JF1B 2WUCH 3D85A 3QNZB 4TNWF 5FYJD 3V6ZA 2VSCA 2EXYD 2VAAB 2GJ6B 3WUZA 4FG6D 3QFJA 4RRPG 1HI6B 1XGUB 3CZFB 1KB9K 3DX7B 5ACZA 4X6CA 1S7RA 5I66B 4W70A 4M1GH 1QACA 2NY3D 4MNQE 2VLRA 4XAWH 5AAWA 3HAEG 1AKJB 5LXGL 1TZGL 5IROA 1DL7H 1RD6A 2IWGA 1HIMH 1N7MH 4H20L 4N5UA 4RSVA 3UJTH 1U42A 4UTBH 1WBXA 2XTLA 3O4OB 1OT1A 5F97E 1I3GL 3TO4B 2BNUA 5M95B 1EHAA 1WIUA 3SJVD 4U1JA 4AJ0A 2HRPL 4WJ5A 1YEEH 5CSZB 5C0GA 2VLKD 5IM7B 1NCDH 5JW5A 4UINL 1UKSA 3ULSA 1S3KH 3BEVA 1EVTC 3M8OH 5EUOB 4PJIA 4JFXB 5F1IA 1A4KA 4MCZB 1GGUA 2MKLC 2F8OA 1L4IA 3G04B 1OGTA 3U46B 1CD8A 4N1CA 1AQDA 1G6RA 4JG1H 2F5BH 3MRJA 1LDPL 3KPTA 2OL3A 3KPSD 1IGYA 5E94A 5EULV 2CLRB 2IH1A 5BXFA 3P73B 3GMQA 5F9JA 3CJJA 6FABL 5IB2A 3CFKB 2PO6A 4GG8A 1WWBX 4I48B 4RFOL 2RGSA 1BECA 1HDMB 2R69H 3CFEB 3OX8A 3V0WH 4TULH 4JFDB 4ELME 3QIBC 3QR2A 2P5EB 3CUPA 3HC0A 1K6QH 3SDXA 2HRLA 4OBSA 1WFTA 3ZT7A 3ZHLA 4K3JL 5FHBL 2VISB 3GHBH 3RZCB 4HWUA 1R3IL 2NZ9C 1EEQA 3CDGA 3DJ9A 3MRBB 4C56D 3NABH 5IFAL 3ZL4L 3SGKC 4ODVH 3DSNA 4DN3H 3ARGA 4OSUL 1HCFX 4XX1E 4B7LA 4ZFGL 2J6EH 4WWKA 3SE9L 1CF8L 5HDLA 4KV5E 4Z77B 5D7LD 5J12B 4Z7OE 4PJ8C 3QCTL 5KANI 4WFEE 2H45A 1CR9H 4C56E 3OG4B 3QDGE 3MMEA 1FO0A 1G9MH 1NGWA 1LHZA 1WFUA 3UTPD 4U6VL 1BQSA 5JHLH 2VDQH 1YYLL 1PG7H 5D7LE 4ESKA 4PJ7F 1KEMH 3QH3B 4P3CH 4XVSL 5FYKH 3PIQA 4FQLH 4JFYB 3GSNA 3D3VB 2NY2C 1P1ZB 4JG0H 3SO3C 1KFAH 1RZJH 1P6AB 4PRAA 5EOQH 4S0TD 5DHVA 4XWGH 3UTPE 3SGDI 3EHBD 1MVUA 1CFSA 3KPPB 5EH1A 1CQYA 4U1MA 3GMRB 4NNXA 1KXVC 4WI3A 3GUTA 4IEFB 3L9RA 4FP8L 4S11A 2CK2A 1XF5A 3BGFB 1NKRA 5TFSL 1JPTH 3B5TA 5CBEB 4NSKB 4YBQC 5F1SA 3KS0J 1YJDL 3MJ7A 1XF2A 3HNSH 4AMKH 3P30H 2R2HA 1MRDL 5B4MD 2CKBH 3U0PB 1LO3L 4X0KA 3R1GH 1BLNA 4UBDC 5T33L 1TNMA 3QWQB 1C12B 4L3CA 1OP5H 5BRZA 5HD8D 3HC4L 1N59A 3UTTA 4Y5XC 1E28B 2EIEA 1PZ5B 1HHHB 4ODWA 4OIBA 1TITA 4GAGL 4Q0XL 3SE3C 3LKNB 2X40A 4HKZA 3TC9A 3ALPA 5L88L 5E2JA 3I9GL 1CXHA 2EECA 4R4FL 2YN3A 1ZLSL 1W72B 3HZMB 4X7FC 1TTGA 3QNYB 2PW2B 2X4SA 1UB5A 3P0YL 1IGTB 4DUWA 4GKZA 4ZAKD 5AD0A 3TCLB 2YD2A 1J12A 4X80H 4NQDE 4TSCH 3G6AA 4KMLB 3QFDA 1BAFL 4NKQB 1CICB 2XICA 3L5IA 1T2QL 3P4MB 3PHQB 1CI5A 2EH7H 3IKKA 1GGTA 3SDAB 3NIDF 2JF1A 4J4PD 4YUEH 5EU6A 3LAFA 5J1AA 3TYGL 1FNEA 3O6FB 1ZGLA 1ND0A 4PBXA 3L3IA 3HE6B 3RWHA 5MEND 2IGFH 4HKBA 5D5ME 1S5HB 5ILTH 3T1FA 3BX7C 1EFXD 3AU1A 3QDJE 2O5YL 3JTTA 5ETUA 4QRQB 3LPGA 4NUJB 5SWSD 5HJ3B 5KAQG 1JP5A 2OR9H 4ZO7A 4M5YL 3IT8D 5F7DA 4PJGB 5HHMD 3I2CH 2HVJA 1RJLA 2CUIA 4PRHA 2AEQL 4AQOA 5HPMB 3T0DA 2Q76B 3BOVA 3D2UB 4ZXBB 5SWSE 2Q7YA 2J6EA 4J23A 5HHME 2WMPA 1QVOB 4J7RA 3CVHB 3MTRA 4QRUA 5C0AB 3ZKXC 3KPMA 2EZ0D 1W0WB 1A0QH 3GKWL 3BW9A 3RVVD 4P2OA 3NIGE 1XR9B 4HPYL 2EDOA 5F88A 1MJ8H 3FFCB 4M9OA 4EN3A 3UTZB 3MUJA 4OQ1A 5C0RL 1F4WH 1T7VA 3NBNA 1QLEL 2VDOH 4IHOA 4XNZC 2EKSA 4NHCH 3SDCC 1U8JA 4JRXB 4XP9H 3T1WA 4ONOA 1K5NB 1MAJA 1P4IL 4H1LB 2F58L 3MXWH 3U9UB 2FR4A 3LEYH 3QDMB 4LKXA 4P4RA 5TE6L 3VFVB 3VFTB 3HB3C 3QEGL 4JLRA 3NCEB 2JKXA 2JJSA 4GXVH 4P23A 5TDNB 4YFEA 4YO0A 3TPKA 5CEZD 3HE7D 4UT6L 4YHZH 3TBSA 2QADB 3O3EA 5E6IB 2X4RB 4LVNC 5FK9A 1YUHA 3BP6A 3BH8B 3PP4H 5DHXB 2ADIB 2LTQB 4JO4H 1R3LB 2Q7NA 1CFNB 3HI1A 5SV3A 4ENED 3UZQA 1OAYH 3MROB 2R4SH 1BJMA 3SDDA 3V5DB 3OZ9L 5ID0B 4L8CA 5J11C 2CKBA 5JOFB 3QQ4A 4KJWC 4LIQE 1FNSH 1J0YA 5MEPA 4EUPG 3MV9B 4OD3L 4QRTA 5T5FH 1KPVB 4X7TB 1OTSC 3O6MH 4HMCA 4E0RA 4I2XE 3AROA 3DXAB 2EIZA 4XCFL 5H35B 4HEPG 3X3GH 4Z7UF 4NZUL 5IMMB 1LK2A 4TNWK 1BIIA 4U49A 3O6LL 1G6VK 4EVNA 1A6ZB 4APQB 4QRSA 4JFEB 2MQCA 3RWCB 2H41A 1C08B 5DJDB 3QUYA 5EU7E 3E6HB 4L5FL 1SHMA 3GRWH 3VXSB 2DQIL 3BP5B 1IKNC 5ICXB 4KPHH 4NUGL 3T4YA 4GO6B 4MJ5A 4NCC2 3U6RB 1TXKA 1FL6B 4XCCH 2NY5C 4HS8H 1Y0LA 3T8XB 2DAVA 2FEEI 4XGZB 5IJVA 1CT8A 2Z35A 4MD0A 4UV4L 2CQVA 3C87A 3H7BB 4X5WB 2R15A 4JANB 3WE6B 2H32H 5IR1B 3BJ91 1RUQL 1S9XA 3MLVH 1CLCA 3V6OC 1S7SA 2PTUA 3CC5B 4J1UA 1ZHBA 3F7PC 5F8QC 5J9PB 3VG9C 4M00A 2NY4C 3VH8A 5CZVL 5BS0A 1TJGH 3OG6B 3OKDA 5B3JE 3FOMA 4G8IB 4JDZB 1AHWC 2R1YB 3QHTC 4HW6A 2C3XA 2QEJA 3EYQD 2Y9RT 5FYLL 3AAZB 1OP5K 4DEPB 5ANMA 3JV5A 4PJBF 1VFUA 3G08B 1OAZL 1U3HB 2NR6C 1ZA3B 4UDUB 2BNQA 2NYYC 3RGVB 2OTWB 5KVGH 1FC1A 4L9LB 1T1WB 4AY0A 1II4E 2OSLB 1AC0A 4OCYH 3CXDH 4OZHF 2V6HA 4JE4B 2JIXA 3C9NA 2RCSH 3PE9A 1DVFC 1QSFB 1YEIH 3S34H 4BQ8A 5IBTL 3ES6A 2Y36H 2DQDH 1H3TA 5FGRA 1HH9B 2RFXB 4X4ZA 1CLYH 1UM5L 1EH9A 3CSBA 5DHYA 4ISVA 3JWDC 1T7WA 3ZDYF 5GS0L 2YEZB 5C0EA 1OD9A 4TOYL 4DK6A 2R1WA 5E4EC 5HY9A 1IGJA 4QXGH 1N0XH 3ZKSD 3SKJH 2VLJA 4Z5RB 1XF4B 1XCQA 4G5ZL 2UV3A 4L8BB 1R5IA 1TZHB 5D70L 3PHOB 2QQKH 3H3PL 2KL6A 2W9EH 5IJKC 1V8HA 5D1ZB 3V4UH 5C92A 2VITA 4J3UA 3VXRB 4UNTA 4NZRL 5BV7H 5I6XB 3DX8B 1ULVA 1D9KB 1I9EA 2Q8BL 4P4KB 3SBWA 4GQ9L 4IRJA 2VDKH 1FLTX 4G9FB 4R0LA 3GJFH 3FTGB 4IJ3C 1F6LL 4OT1H 2ZUSA 1UZ6E 1Q9LA 1T66D 1K2DA 4WI4A 1NCBH 3LS5L 1A64A 1EK3A 1BQUA 2EH8L 5A16A 4Y1AA 5CKAA 5AWNH 5H37G 2VN7A 3E0GA 1AGFB 1P4LA 4JQIH 5BMFL 5L2KA 1X5AA 4G3YL 2QSTA 4MJIA 1LEIB 3EO1B 4LLYA 5ENWB 1MJUL 4Y2DD 4H8WC 1MCPH 5CJQH 1O7SA 5F3HA 3BWUC 1DBBH 1GIGL 3GRWA 4P49A 1I8LC 4HWZA 3UJJL 4CVZA 4LF3B 1S9WB 3QZWB 2DJ4A 5HHQB 2XKSA 3O3DA 2H3NB 3E2HC 5D72L 3DRQA 3BYTA 2HKFL 3MJ9A 4Z95H 2NY7L 1C5CL 4HGWB 4LHUD 4XNQB 1KN2H 1AXSA 4JCMA 2KQNA 2ZKHL 1JFQH 1QPPA 4RBPH 4KROD 1EBPA 3RAJL 2YA0A 4MLIA 4X4XA 1HSBA 4WI6A 3UTSA 3KYNB 3M07A 3C60B 5C07B 5IMKB 3GSOB 2PETA 5EBMB 5EA0L 1UJ3C 4JHAH 3O6KL 2J1KA 1SMAA 4X6DE 1B0RB 3BDYL 3PWPD 1P4BL 2XFXA 3B8YA 3R0MA 4HIHA 3TIEB 1QFWI 2B0SH 3IF1A 4Z7WB 1NAKL 3I3EA 1UM4L 3QO0B 2DLGA 5D7IB 1JNNL 3QEQA 1U8QB 1NEZA 2CXKA 4DVBA 1MQKL 1HSAA 3VFPA 1ZA6B 4HUNB 4WV1B 5KSAD 4YXKL 2B1AL 4PTTA 2G60H 5CEYA 3BN9D 4KTDL 4Z0BL 3BAEL 3ZYIA 3QB7C 5MEQB 3BSZH 3UAJD 3G6JF 2HN7A 2PUQT 3QXUA 1K3ZA 2GEEA 3H3BC 4WDIA 1QFUL 3G5VA 5GJSL 5CGYD 1H3UA 5C0CD 4K3EL 3CU1A 1Q9OB 1IGML 4JO3H 5GGVH 1A6WH 2Y5TA 3ARYA 1CLOH 2ZUWA 4YPGA 3DVGA 4UT9H 1GSMA 1ZT1B 5LQBL 1I1YA 2BMKB 1LE9B 4MVBD 5C0CE 4NN5C 4WCYH 5CD3B 3WFCH 5D9SA 4WW1B 1G7JB 2Y07L 2ADGA 4WENB 3QIBA 4GXUN 1HOCA 4XPGH 2P7TA 5JOEA 1S7WA 1HILB 4Z7UA 2FJHA 4ZS6D 3QISA 1QA9B 1MSPA 3D9AH 1SBSL 2VL4A 2GJ6E 5TGBA 4F15B 1XEDA 4XVJL 3MRLA 1DLFL 5CJ8A 2RJMA 3SGKA 4AK1A 1CCZA 4TUOA 1CVRA 1KYOJ 4X98A 4MA3B 5ICZB 4K9EL 4N8VA 4PJ8A 3OJMB 4GBXB 1GGCH 1IT9H 3HI6H 4OFDA 1W2KT 5JPMB 1LMKA 1A6UH 3NTCL 1MHCB 5EU4B 4RGNB 1HHKB 3UBXA 3IVKA 2IPTH 4Z8FL 3QIWB 3GJFA 3ZE0F 5D96B 5IHZA 2A6DB 3OKNA 4WU5A 4YHYC 1EGJL 2EYRA 3DX9B 2O61A 3WHXB 2F8VA 5I75C 1E6JH 1RUMH 4M6NH 5C08B 5C1MB 1BM3H 3MZTA 3BZFA 2Z8RA 4GAYB 4XMPL 3KWWB 4ZO8A 3OBAA 3T0ED 4Q9RH 2BHUA 4OLYL 4XPTH 5F7UA 1DBAH 4NO3A 1ZEAL 1UH3A 3U9PH 5E00B 3RTQB 1AY1H 4F7MB 1BFOB 4MXWL 1D5MB 3ARFD 3C5ZD 3HS0A 2AJXL 3QPXH 2X10A 3UTOA 3T0EE 5GRVK 4PJBA 1QZ1A 2E9JA 2V2XA 1AQKH 2VXSH 2WM0A 5HPOA 3H6JA 5CHNB 2JELH 5C0DB 3WUWA 5EORL 2X7LB 4O51B 4BZYA 5C0FA 4HIIA 4MA8L 4OZHA 2ED7A 5ADOL 1B88A 3TVMC 4MAUH 1I9JH 1RUAH 3TWCL 4JPKH 2X4OA 3U0TB 3LOWA 3QIUC 1JHKH 2WBWB 4FQQA 4MD5B 3REWB 1GOGA 3ZE1E 3AFLA 2WWKT 3RWEA 3LY6A 3FCTB 4Y5XA 1NUNB 3VWJC 1J1OH 3GJFK 1MLBB 2G2RB 1YJDC 3Q1SL 5FGBA 3RWIA 2WSKA 2D4DA 2C3VB 2E9IA 1TCRB 1DQQB 3SE3A 3ARUA 4GLRI 1SEBB 3SHSA 1F3DJ 3UTQB 4URTB 3QUXB 1A9BB 3GSUB 5E8NA 1FFPB 1QO3A 1LO0H 1N2RB 1FVCB 5ESQB 3QXAA 4DAGL 2LU3A 3G6DL 4D94A 3Q5YA 1IGIH 3FQUA 2EXWD 3NFSL 4QXWA 4ONHA 3A6CH 4LCUB 2YK1H 2KQMA 5F89A 5DQDH 1IQDA 3TN0B 2BVOB 4HD9A 4IBLT 4YR6A 1PG7X 4P5MB 1BFTA 3KXFB 3CXHK 3LEXA 1PKQE 4IMLA 4JKPH 4Y89A 4M1CC 3A0OA 5JQHC 1MFCH 1FNHA 4NP4H 3F7VA 5IB3B 4L4TD 4X4MA 5IOPB 4CNIB 4LEOA 1SM3H 1GPOH 3PABA 4RBPK 3S97C 5K33A 4O5LL 4I1NB 4WFFE 2B7DT 3TPUB 3RY5A 3FJTA 1T0MB 1J0HA 3STZB 1QFWL 1QQDA 5SWZA 2GT9B 2J8OA 1QRKA 4PY7B 4PV9B 4L4TE 4FTVD 5FKAA 3KPQB 3IDIA 1CXFA 4YGAB 2AP2A 3X3FL 5GGQH 3ESUF 3MV8D 3VXUB 1S5IL 5IEKB 2FWOA 2EE9A 4LARH 3L3GB 2Q86A 3DLQR 5GS2H 4FQXC 5DJ8A 1YEGL 4PR5A 3K0WA 4FTVE 4YHPB 3MGOB 3DO3A 4FMFA 2FJFA 4Q97A 1JGEA 2VWEC 4R90L 3V0VB 3MV8E 4H0GA 1J0ZA 2AJ3B 2FEDD 2MSPA 2A1WL 1GGIL 2O5ZH 2X05A 3HUJB 2FBJH 2V7NA 5HGBB 1NKOA 2DJUA 1AGBB 4YHOH 1A1MA 2FATL 3QUMH 4BH8B 1J8HB 3EOBA 3IU4H 1MEXH 4HC1H 1S9VA 5I1GH 5I30H 4G6JL 2H26A 3EFFA 3Q6GL 2X4UA 1HQ4A 1T83C 2MQ3A 4QNPF 5DJAB 1ZKAA 3B2UD 5ISZA 4W6XB 2D7PA 3MBEC 1IBGH 5EOCH 3MGTA 4JM2C 3BZ4A 4XRCA 5F3BB 4XH2A 5DVNA 3NACL 1RIUL 1D3CA 1UA6L 4LEXL 3WIHH 5C0JA 3L7EB 3CCHB 5CUSL 2AK4B 2IJ0C 4LVOC 4NZTL 5DJZB 5SX4H 2VQUA 3MV7B 3H42L 5C6TL 5HYFA 2XA8L 3DVIA 4QXTA 1YNLH 1A6AB 2I9TA 4OFPA 3KVQA 3P4OB 4MB5A 4WY7H 2JK5A 2FRGP 3UJIL 3ARSA 2R23B 4PRID 3DBXB 3JWOL 4G42B 4M9PA 2VERN 2EE6A 1I3VA 1YECH 2VIRB 2PTTA 2PW1B 3I02B 2D7OA 2FGWL 5DEGA 1P84J 4U3HA 3NPZB 1FRGH 4EIGB 4R96B 3QJHB 4OLXL 4D0BA 5DMIL 4HCRH 2H2PD 4HXBH 4PRIE 3VWKB 1JZ6A 5IFJA 4DCQA 1F00I 3BKCH 4RWYH 4H8WH 4K8RH 1FV1B 2EDFA 3FFCE 5TH2A 5D2LE 2I60L 5IBUB 5IW6B 2XQBL 3CD4A 3B9KB 4ZUWA 5CJ5A 1IKNA 3WJJA 5D71L 3IDUA 4ETQA 5JO5A 4ZSOB 4RIRB 1Q0XH 5JXED 3PGCA 1ETZA 4O00A 4BKLA 5EWIL 3QDME 5ADPH 2VR4A 2A38A 1V3KA 3FB6A 1UWXH 3NFPA 4PJXF 2GITA 1EJOH 4OZ4B 5FM5M 1B4JH 1IEBB 1AI1H 5DMGD 4OZIE 4G7VL 2DQHL 4KK8C 5LCVL 4PRBA 2ZOKA 4NO5B 3HNTL 3O45B 3AS0A 4NQVB 4KHTH 4WRLA 4HJJH 4XB8A 1NL0L 4OCMC 3MLSH 2X89A 4KDVA 2XXCB 4QRRD 1Q9WA 1ZANH 4KZEH 1HYSC 2FX7H 2C3WA 3D6GA 5EZLB 3G5ZB 4Q58C 5LGHL 4NKIH 1I7ZB 5BZWA 3FHQA 1KJMB 4P9HL 2YKLL 4CW1A 3O8XB 4RMWA 4Y4KC 2VQ1A 5FCUH 2J8HA 1HE7A 5C70A 1KB9J 3MV9E 1NDMB 2A73B 3TT1L 2J8UF 2XKNA 1EEUA 1DVFA 4WHYH 2Z31A 2P5WD 3A6BL 1A4JB 5I1EL 3PDOB 3LSOB 5DJ2B 1I3GH 2DL9A 4NFCA 1F3JA 4HF5L 1BMGA 1NGYB 3CDYA 4CVXA 4PP2B 3GB7A 2HRPH 3CFBA 3TM6A 4JFEE 5LWYL 4JY6B 5FCSH 1XGQB 3MO1B 1MNUL 1IL1A 1QBBA 1LEGB 4UINH 2P5WE 4UT7L 2DYPB 1KTDB 1OTUC 1U2CA 3QUMA 3I75B 5HI5C 1EZVX 4WO4C 3BGAA 3TJHC 4LDOB 5C09D 4G8GB 2H9GA 1LDPH 3C8KA 4F8QA 4NO0A 3VD7A 4JAMA 5IJKA 5GS0C 2AJZB 4LVEA 3VW3H 5KN5A 2QQQA 6FABH 4CDHA 3WIHA 1JPSH 3X17A 3D69A 1NBYA 2CO7B 3C6SA 2AGJH 4L29B 3OR7B 3NCMA 5C09E 1MPAH 1CK0H 3TYFB 2KDGA 4KKLD 4OZGB 2CMRH 2OM5A 3VH8G 2XN9B 5FHBH 1MJJB 1OL0A 5DMJB 2FSEB 4YDJA 3ZL4H 5IFAH 1W72L 1BX2A 5A3ID 4ZFGH 3CFCH 5DA0B 2WBKA 1R6VA 1EIBA 3VD9A 2NX5B 1UKQA 2FDBP 4U05A 5C3TA 3IS0X 1DE4B 2EDYA 1S7UA 1KENL 3GJEA 4HCRA 5EZOL 5FEBA 4E42A 5DUBA 1NBZB 4XP5L 1WAAF 5F6HJ 1MY5A 1QSFE 4ZQKA 5A2KH 4NRXB 5E1HB 3QXWA 5F71A 3EAKA 4U6VH 4P2RA 2JB6B 4LSVL 3HAEB 4IOSD 2A9NL 4XNUH 3WS3A 3N50A 3VXMD 1T0PB 4XVSH 4EDXA 2ZJSL 3LN5A 1B9ZA 4B5EA 1DR9A 3VJ6B 1Y6NR 5IVOA 1HNFA 4S1QL 1PKOA 1G7HA 4XVUD 4QHNB 5C2BL 3O4LD 5IV2A 1YMMB 1GVIA 2ZCHL 1XF3A 3VXME 5HHXL 1CU4L 2FJGA 2YUWA 5I16A 1KJVA 5E2WL 1A7OL 2XPGA 5TFSH 1OM3L 43C9B 4TVSa 4OM0L 1LQSR 3H9ZA 3HPJA 5C3LD 1UZ8B 1A1OA 1RZIA 4I0PA 4IRSA 4N0FB 1PVHA 1S7VA 2OJZL 3GBNL 2RQ8A 4W4NA 1U8MB 3CVHL 1F4XL 3VFGH 3MLYL 3S36L 3TA3D 1U8PB 4PJHE 1KEGL 1VGEL 4HS6B 4JM2F 4EI5B 4L4JA 1MRDH 5IKCA 4BSVA 4ZOBA 1Z3GL 5T33H 2R29L 2X09A 4G6ML 5HHNB 2WBJA 1FVDB 4F33B 2YSSB 3ARBB 3HC4H 2SEBA 4UIKL 1FORL 1U8NA 2DLFH 4OLVL 4TVPD 1OGAD 3FRUA 3NN8A 2AV7B 4JM4H 1F4YH 1JVKA 4GAGH 1Q38A 1I8MB 3SGJC 4Q0XH 4D3CL 2E6JA 3BKMH 3X12A 4PRNA 5L88H 2A9ML 3DI3B 4TVPE 1OGAE 1OTTD 5EU7C 2Z91A 5J89A 4JRYB 4R4FH 3WFDL 4OLUH 3O3AB 4PTUB 4HK3J 4KK9D 4P3DB 2ZOLB 3MLXH 1BFSA 3P0YH 1PYWB 5FM8A 4PJAE 1I8IB 2GUOB 5JMRA 3DMMC 1SYSB 1J7VR 2A83B 1BAFH 2D31B 4XVTL 3EFDH 5DD6A 2KBGA 2Y72A 2MCPL 3NCBB 4R97C 5I8EB 4D0DB 1NAMH 4PG9B 5EOTA 1U8OA 3DUHA 3TYGH 5T3XL 2NW3A 5J57B 1YPZB 1VGKB 4L3EA 3U83A 3SCMC 1LK3H 5IVNA 1DTUA 5CJOL 4YHLL 5I1LB 3K2MC 4CGTA 3TZVB 1CDUA 4KK6C 5C07E 1IEAA 2YXFA 4AIXA 4BFIB 2O5YH 4Y4HC 2HT2D 1K8IB 4PJCE 3D5OF 2DDQL 4M5YH 1VEMA 5I1AB 4LCWB 1F90L 5BVJA 1JN6B 4MB3A 1RFDL 5JW4N 4H5SA 1VA9A 1NLDH 2AEQH 3GI9L 4JY4A 5C2UB 4JJ5A 3D87B 2GCYB 4U3CA 2BC4B 5J3HC 4Q6IB 5D7IE 1DQLL 5HHOD 4MDIA 3HN3A 4ODHL 1XF1A 1SJEB 2YA2A 5D1XD 5LGJB 1NFDF 1EEZA 1GC1H 4RDQF 1HHGA 4V1DB 1P2CA 4K9EC 3SKOB 3VCLA 4MQ7B 5CZXC 4F80A 3LQAC 4GW1A 5FHAL 4CADA 4AH2A 1NEZG 3PL6D 1PX3A 4XWOC 2MJWA 3IDYB 4QRPB 1DDHB 3RVXD 3MJ8A 2ESVA 2XYCA 2P47B 5D2NE 5HHOE 1S7XA 5BZDA 5SWQB 3FT4A 1FGVL 1T5XA 1PLGL 1OWRM 3OJDA 4Y16B 4PGJA 1P4IH 3LKOA 4HUWA 1AGCB 3IDMA 4M43L 2R0ZH 4Z7QE 4MAYC 1SEQL 5GIRB 2Q87A 1DBML 5TE6H 1RK0B 3O9WD 3PWNB 2J8UA 2DIAA 4PGDA 1L0QA 5DD3L 1MVFA 5DD0L 5MHSD 1NGXB 4NQCD 4UT6H 3MRQB 2UWEE 3QUZD 4I13B 1HINH 1OW0C 2B2XL 4E41A 4POZC 4DUXA 5L0QB 1BD2A 3KR3H 4MX7A 1S9YA 3FB5A 2P46B 1A7RL 5A2IH 1SYVA 3EOAA 1GAFL 5FA3A 5MHSE 1WC7A 5FUCE 4NQCE 4RMRA 3QFJD 4N1HB 1PSKH 2X4PA 4K3DH 3OKEB 5D5MF 2YPVL 3D25B 4FZ8L 4LASL 2P42B 4J8RB 4N8VG 1BFVH 5GZOC 1IC7L 3GM8A 4PJDE 2OJEB 3I6LD 2DWDA 2VLRD 1LP9F 3ILQC 1KGCD 1CGSL 3WO4C 3UBXG 4M48H 1EJ6A 5J7CC 3MODL 2XY2A 2Q8AL 3QFJE 4XHQA 2BSSB 2LE9A 5C08E 2XY1A 5D7JB 4PP1D 1EPFA 2VDLL 1P5UA 2EYTB 4D8PB 4MD4A 3I6LE 3SE4C 3SN6N 4OUUA 1KGCE 4GRWE 1K8DB 4WUUA 1FHGA 4M03A 4OGYL 3U2SB 1ZGLM 4G43A 3K4DA 4NRYB 1CDBA 1Y18A 2VXVL 2DJSA 8FABA 5A1AA 1YDPB 2PXYA 4TTDD 1Z9LA 1O5DT 5IVXF 4PY8I 1K85A 4QEGA 2NY2B 4OB5L 4ELKA 3IFOB 3WUWG 2UVFA 1RUQH 4RFEA 2HFEA 3TBVA 4H25B 4Z7VB 5I17A 5IVZB 4MNQA 2HVKA 3V6BR 1SJHB 2EDNA 4XPBL 5K59E 3FO2B 5CZVH 5ESVA 1B3JA 2GK0B 2AKRB 1G7QB 4OFYD 3H0TA 4HKXA 4ZUVB 4MCYB 4WW2C 5BVPL 2EIDA 2V17H 3F58L 3MRHB 4FQXA 3R8QA 4PJ9B 3VGFA 4MWFB 1HEZA 1OAKL 1C16B 2DI7A 1OAZH 5C7XL 1C7TA 3O2DL 3AS3A 4LQFH 3MREA 4FXKA 3MXVL 2DLIA 2AEPL 1JTOA 3ARGD 3IB4A 4TQEH 2MKWA 3SDXE 2ARWA 1ZLUK 1JZ3A 2OZ4L 1VESA 3MNVA 2HLAB 3SGEH 1OAUL 1TETL 4U1SA 4HEME 3RUGF 4D9RD 1TTFA 1UM5H 1CZ8H 3MBEA 1EXUA 3HCVB 4ONGL 1MCOH 4JM2A 2D03H 1DZBA 1KIQB 3LB6C 3QG6B 3ULVD 3C5JB 2EC9U 3D0LA 3INUH 1JL8A 4HBCL 1QEWB 4AT6B 1AXTL 3LKSB 2YBRB 4TOYH 1JZ7A 2E27H 4ELMA 4D9RE 1TVBB 1G9NC 3BISA 5EG6C 1MRCL 4WVRA 2AXFB 5GSVB 4N0UB 3BRFA 4IOIA 1MFBL 3CFIC 3ULVE 4YIQA 3H9HB 1ITBB 3GDBA 2F53B 3H3PH 3IDNB 1PEWA 1JWMB 1HXYB 3QXTA 4JJHA 4N5EC 4EXPX 4QWWD 1SJVA 5HI4C 1BOGB 1S9KC 5CGMA 1FZMB 3I50L 1CFQB 4NZRH 3PV7A 1SBBA 5JW4M 3KPOB 1C5DA 4HWBH 3IFNL 2HFFA 3VXUE 4C56A 4R3SB 3QDGA 4OV5A 4GQ9H 3B5HA 3K80A 3O4OC 3WYRA 3GIZL 4HBQA 1DBKL 4LLQB 1IQWL 2IFFH 3C08H 5BRZD 3KGRA 5B3JF 4XZUA 3LS5H 3QUKA 5I8CB 4NQXB 5C0BD 3UTTD 5KSBF 3B6SB 4AENA 1MCLA 4PGBB 2EH8H 1X5FA 1OAXH 1H0DB 4PV8A 2DM4A 4Q7DA 2ZSWA 1F11A 4XXDA 3V8OA 3C6LB 1R5WA 5HVGB 4R2GB 3VFSB 1RUPL 3O81A 3FRPA 3VFUB 4LSDA 5BRZE 2FL5B 3MBXH 2IQAA 1JWUB 2AJUL 5C0BE 3UTTE 5I19H 1MJUH 3VD5A 1WT5C 4I4WB 1DN0B 2EDXA 2PYED 3QRGL 3ECBB 2IALA 3EJYD 4NKOA 2ADJA 2AK1H 1T22A 2DI9A 2W0FA 3EO9L 2X70A 1J8KA 4YBLB 5AG9A 2HJFB 4LBEA 5D6CA 1ACYH 1K4DA 2DWEA 5D72H 1U9KA 4H26A 2YRLA 3MR9A 2AS5M 3LN9A 2PYEE 3UPCA 1QSEB 2NY7H 4LIQH 5JDSA 2XZAL 4NQEA 5EZIL 1I85C 5EU6D 1JGLH 4ODSL 3MRCB 3RAJH 1CGTA 5K9KA 2G9HA 3RQ3A 2HLFD 2P8LA 3RZCC 4WU7A 1FNGB 3C5SB 5I1CL 3TNNB 3T2QA 4Y4KA 4HIJA 5HDBE 3REVB 1RZ8B 5EU3A 4F37F 3O6KH 2IADB 1EDQA 4X8XA 2NXZC 4J3XA 5J12C 3U0WL 3SDYH 4CMMA 1NAKH 4PRHD 1UM4H 3BO8B 3QDAA 2DF3A 5KBNC 1KIRB 2ORBL 4ZUSB 1JNNH 4P9HC 3BQUA 3B2VH 3D0VB 2LAAA 1X4YA 1JHTB 2FZ3A 3LV3A 1CTOA 3MRMB 3QAZB 3BAEH 4NQDA 1QFUH 5E5MB 4EN3D 4WO4A 4ZSOE 5TJWK 2BNRB 5FA4B 4JDVB 1NC4B 1Q9KA 4MHHG 2OI9B 5E0QA 4TSAL 3WEXA 5HGHA 2APBA 1AP2B 1JPGB 2OTUB 4GKNA 5LQBH 1TCMA 5TDPA 3SE8L 5D5MA 3LD8B 3GMMA 5DDHB 2ERJB 3QDJA 1JGDA 4RAUB 3BGMB 1RK1B 3V0AC 2AABH 1HWGB 2P49B 4EQ3A 3QEUB 2Y7QA 4FFZL 1NFIA 5BW7C 3D39A 4P3WA 5EIIA 1LP9A 3S4SA 3WSQH 3IXTA 1UXSB 4P23D 2QKIB 1IAOB 2KH2B 3ARTA 4YHKL 1EFXA 1U6AL 2BRQA 3ARWA 4OF3A 5SWSA 3RL1A 1MELA 3BHBA 4XVJH 3PUCA 1RJZA 4ODUA 1A6TA 1VCAA 5GGSB 5ACMA 2PR4L 3BUYB 4HGKC 4MA1B 4N1EA 2QHRH 5C9JB 4HZAA 3RWDB 2XZQL 3RVWC 5DRZB 2NY4B 5DRNB 3SDDD 3BIBX 3L3OA 4OCLC 4CVWA 1D6EB 3NTCH 1JI2A 3OKMA 4GT7A 4Z8FH 1I7UA 1UB6A 3V4PL 4X6FB 1F5WA 2W9LA 4U6XA 5IVXA 4HPOL 1MHHA 3FN3A 3ZT6A 3VGBA 3RU8L 3HTLX 5JHDB 1Q0YL 4G8EA 4OM1L 1MJ7L 3MLZL 5I1JH 3NIFF 5INDB 2X4NA 5FOBB 5GGRA 1KPUB 1ZEAH 5DFTA 2Y4SA 3IFPA 4LCIL 4HHAB 4NNPL 2C7UB 1YY8A 4YXLH 3IDGB 4EJ1C 3BPCA 3WLBA 1H3GA 3VXPB 3MA9L 3QUYD 2AJXH 3SDAC 5CLWA 2QLVB 2FH8A 4YX2L 4MJ6B 4LKCB 1BBJB 3O6FC 4OQTL 3SO5A 3HE6C 4LPYA 5J13C 5EORH 4G80A 2BSED 1ZS8A 2H8PA 3VXQA 2GTZA 3SOBL 3P9MB 2DQEL 4LCYB 4KK5D 4F57L 3FB8B 3EZ8A 2GW5A 1FE8L 2W65A 4MA8H 5ADOH 3NMEA 4NBYB 1ZOXA 3TWCH 4C54A 2HKHH 1TPXB 1RZKC 4C83A 4OZGE 5JIPA 3NCJL 2XN9E 5KZCD 4XPAL 3MACH 2VO5A 4I2XA 1J9CT 1MUJB 2IQ9L 2XACC 1ZLVH 3TFKC 4F2MA 4ZXBC 1AIFA 3CFDB 2EDWA 3LZFL 5IQ9B 3NCYS 3Q1SH 4ZNEA 3OHXB 3W0WD 32C2A 3R06B 3SGJA 4LSRH 3GIVB 4UOW1 3D85B 5TQ0L 1N6UA 1YMHB 3LH2L 2BNQD 3P9WB 2WQ8A 5IFHL 1G7MB 4PJ7E 1FZJA 3DVNB 3W0WE 3GBML 5DRXA 2NY0D 1Q94A 2ZG1A 3G6DH 5ANME 2JIXD 5ACZB 3GM0A 4CU6A 3OXSB 1GH7A 1DBJH 1I7RA 4XPHL 3KYOA 3MYJA 4KVCL 5IB4A 3W9EA 3TNMB 1SY6H 4G9DB 2UUDK 2CH8A 4PLOB 35C8L 4YDVA 1KIPA 4KI1A 3U48A 4PB0L 5FF6B 1AGEA 3CSYB 4L8DA 5FM5O 1JE6A 3B4NA 4U1JB 1JGUH 4HQQL 3SCMA 4QCIB 5EUOF 2QADC 1RZ7L 5E6IC 3PDDA 2DKUA 5ITFB 4Y4HA 3ZSTA 5JW5B 2HJKB 4XCYA 1A3LL 2CDEA 2LTQC 1CVSC 4O5LH 2VLJD 3SQOH 3RDTB 5GGTH 2YUZA 1CD1B 4J3WA 1QFWH 1UWEL 3S3PA 1OGTB 4HT1L 3PJSA 1TQBB 5FM4A 5KTEL 3OXRA 4TN9A 3F5WB 3MRJB 3ULUC 1BVZA 2OL3B 5FGCB 3GGWB 5E94B 1S5IH 4J6RL 2CDGB 1U91A 1MF2L 3N1QC 5IB2B 3IDXL 1RMFL 4GSDL 2PO6B 4IRJD 4KI5C 1UJ3B 3WHE0 1YEGH 4O2FA 4QY8A 1ZSDB 2N56A 2Z93A 4FQ1L 3VXNB 2ZCLH 3QQNA 3SKNB 2ZUUA 1HHIA 4APQC 5IB5A 3CUPB 3HC0B 4X4YB 2V5YA 1EGJA 5T1KB 5LAXA 4JRYE 4YH6A 5EPMB 4Y1AD 2FATH 5F7HA 1G0XA 5L2KD 1GOFA 1BWMA 2JCCB 4MJID 3KPRB 4G6JH 2BOCB 3L6FA 1OVZA 3T65B 3X11A 4WWKB 1KBGL 3AXLB 3H9SA 1WICA 3HPLB 1B2WL 1AR1C 5E9DB 3BZEA 3NIDE 1KJ2H 5DJ0B 4DZ8A 4PGCA 1X5XA 3FOLB 3S7GA 3PWJB 3ALWA 4LNRA 5I1IL 5T1LA 4RISL 3MMEB 1J1XH 4MJIE 2B4CC 5D1QB 1QRND 1RIUH 4U1IB 1OW0A 1UA6H 1X5YA 3DYOA 4LEXH 4DKEH 1UXWB 4NZTH 1YPZE 1FFOB 3P0VL 3H42H 5C6TH 5BQ7A 2XA8H 3QO1B 1IM3A 4W6YB 5EBWA 4NN5B 1RPQA 3GSNB 1OARH 1WZ1L 2C1OA 5JQ6L 3KYKH 2EYSA 1QRNE 4DEPC 5IHUL 4PRAB 1FVEB 4OD1L 4M7LH 3UTSD 1U3HC 4UAOB 3UJIH 4EEEA 3QULA 3JWOH 2BHZA 2VDPL 5GRUH 3RGVC 2ITCA 3GUTB 4L9LC 5F6IB 1XF5B 3GNML 4LLDA 3GSQA 1P53A 1IM9D 4LMQI 1WWWX 2A6IB 2FGWH 3DX6A 5CJBA 3KJ4C 3WDHA 1EAPA 1F6AA 1JMZA 4UB0L 3W39B 3DUSA 4FFVC 4OLXH 3M17B 5DMIH 3UTSE 3W9DB 4B7IA 4LMQE 4V1DE 4P59H 4CAGA 4N8CL 3MJ7B 1H15A 3X13B 3EDJA 3QEQD 3SE4A 5J6HB 5EC1B 3T3MF 1TDQA 4EOWL 5E2UL 5FDWA 1BVKB 2WP3O 2I60H 4X0KB 4GRMA 2ICEA 2MHAA 1RU9L 1ZHKA 2XQBH 4F37K 2CO6B 3KLDA 4L3CB 3S3JA 1VEOA 5D71H 1JYXA 4Y2DA 4M93B 3UO1L 2HFGL 1N59B 2FIKA 4OF7A 1KCKA 1KB5H 2Z8SA 5JIIA 5EWIH 4ODWB 1FFQA 3HMXH 5CILH 1OAQL 3X14B 4NNYB 1ZT7A 1ZVSB 2E7HA 1J5OL 1I1AB 3LPWA 1VHPA 4XAKD 1MHEB 1RZFL 1U58B 4RZCB 1RUKL 5D1ZC 5DJYB 2F5AL 4JFHD 2DQHH 2OCFD 5HYSB 5LCVH 2R2BB 4GUPA 3T4AB 3BRGC 4BH7A 1YQVL 4E9LA 5E2VH 1JHLL 3GSRA 1NL0H 1PFCA 3FO9A 1FIGL 3KJ6H 2APVA 2IH3B 3QIBD 4GJTB 4Y4FB 5GRXG 2F54B 1D9KC 3U79A 4XAKE 5GGTA 3OAYK 4P4KC 5H94B 1ZLVK 4L4VA 3MLTA 4JFHE 4NHUB 4GLRH 2NZ9D 1E6OH 2ADFH 1C1EL 4M7ZB 1OP3H 3WKML 7FABL 3TVMB 5F1NB 1GXEA 2VZSA 2W38A 2E7LC 4OLEA 5DFVC 1CD0A 1TVHA 1WWAX 3QIUB 1ZGLB 3LKQA 4PJ8D 4PJGF 4TRPL 1Y6KR 4HKBB 3MRPA 4JREB 5C0NC 3T1FB 2QL1A 3A6BH 3L3HA 4F58L 5I15L 3JTTB 5KSAA 4KU1A 3ZYOA 3BEWA 1V3MA 1WIOA 1KULA 2ED8A 2NY6B 4Y2OA 5JR1L 1MNUH 5DVKA 4WEBL 2GJJA 4UT7H 5I9QB 1NQBA 2YUXA 4W4OC 5D7SH 3ZE2F 2DMCA 3F12A 5EU5B 2K1MA 3P77A 1YNKH 1JF1A 1RJYB 4R26H 4TPRL 2MNUA 4O2EA 3BMVA 2VAAA 3O2WH 4P2OB 2F19L 2GJ6A 2WUBL 2WLYA 5F88B 5E99L 3UYPA 1T1YB 4FNLL 1ZTXH 3B83A 1QLFB 1XGUA 2IFGA 3CZFA 3C60C 3DX7A 5EFIA 2EKSB 1TJIH 5I66A 4Z7VE 4YBQD 3KG5A 1EV2E 2OMNA 5F7YC 1AKJA 2BCKB 4PJBE 2FR4B 3UPRB 4XNYH 2MPAL 1AO7B 1JWSB 4UBDD 3V9FA 2XWJB 4HDIB 3DUUB 3QPQC 3TO4A 4JLRB 3VFRB 2QSQA 3C09C 1W72H 3V8CA 2J7LA 2GYSA 3MX0A 5IM7A 1JJUA 4WV1C 3QJFA 4XPFH 4PGZA 4NO2B 1U95B 3QXVA 1R5VB 3VDAA 2HT3C 4LOUC 1YUHB 3BP6B 1KCVL 5EC2B 4U2YA 3LDBB 4LLMB 1KENH 2UYLB 3ET9F 1XGPB 4JFXA 1ED3B 1KPRB 4XP5H 3HZKB 4MCZA 5I71B 2DQCH 3G04A 1WT5A 3GKZA 3U46A 3QHZL 5FUOH 4FQIL 1A6PA 2CKBB 3ZDYE 5FV2A 1V3JA 2A9NH 2DKSA 4LAJH 2DBLL 3HZVB 5FV1L 5HI3C 4JO1H 2CLRA 4KI5F 1MFDL 3P73A 4QRTB 3B3IB 5LJYH 3CFKA 4S1QH 4YJZL 4I48A 3PDGA 1I9IL 5C2BH 3CFEA 4DJMA 5IBLC 5EOCJ 4JFDA 1LK2B 1A47A 3FMGL 1BIIB 4ZAKC 3QNXB 1YA5A 4QHKI 3FT3B 3WIIL 2VISA 5CP3H 3RZCA 1A7OH 1L7IL 4CJ1A 4M8VA 5TDOB 4YBHA 3MRBA 1OM3H 4F15C 4OM0H 1R3KB 3RY6A 4U1NB 5KG9B 1ONQA 1UACH 1EUTA 3LRGA 2CJUL 2OJZH 5FUCC 3GBNH 2Z8VC 1BWWA 1F4XH 3T4YB 4MJ5B 5HVHB 5E1AB 4GBXC 5SWZD 4XX1G 4LAQL 3CDCA 4NN7B 2F74B 3MOAH 4YE4H 4U6YB 3TJEL 4DUVA 4RGNC 1Z3GH 5FFLA 3T77B 3QIWC 1A3RL 2R29H 5IJVB 3S88H 5D96C 2XZCH 3O41A 3OJ2C 1FGNL 1PX4A 5E95B 1WVZA 1IRAY 4UIKH 1FORH 1BZQK 2R0LL 2XG5A 3LEVL 5JW3L 2G5BA 4RGMC 4DTGL 1S7SB 5SWZE 3QH3A 3HHRB 1E4WL 3VH8B 4M02A 1L6ZA 3MRKB 2ILLA 3QHFL 5BS0B 1P1ZA 3MCKB 3CH8A 1R0AL 4DGIL 2A9MH 3RTQC 4KZDL 2FHCA 3GMRA 3BD4A 4KXZI 3SDCD 4HJGA 1PKQA 1T0NB 4MMXC 5E8DL 3MUZ1 5K9QI 3FRPG 4HSQA 1NGPL 3KYMB 5DD5H 4GKSB 1A7PL 5CBEA 1JI1A 4NSKA 5BW7A 4UOJA 2FX9L 4UOW0 4XCNA 3HB3D 3DV6B 4QTHB 2MCPH 5ISZD 3S6CA 2NZIA 3STLB 4PD4K 3OKLB 1WBYB 3D48R 1QSEE 1F8TL 3ETBF 1ERNA 4K23H 1C12A 4YHLH 3RKDC 3N9GL 4RDQG 1E28A 1ZMYA 1KCLA 4JPWL 1PZ5A 4JFOB 5C0EB 2Z92B 3RP1A 2R1WB 4XTRD 1EMTL 4KJWD 1IGJB 1F90H 1RFDH 3GI9H 2D9CA 3QUXC 1XCQB 5TE7H 1W72A 3HZMA 1DQLH 5IMOB 3O0RL 4ODHH 3QNYA 3G6JE 2DL2A 3QP3A 1N6QH 1IGTA 3OR6B 3ZTNL 3LQZB 3TCLA 3BPOC 3PGFH 3S96B 1A3QA 4EDWL 1JRHI 2CLZB 1X5HA 4AEFA 3TN0C 2W60B 1CICA 2GY7B 3P4MA 3PHQA 4MJ4A 3WXWL 4XCEB 4GRLB 3SDAA 1EEYB 1IVLA 1FGVH 1PLGH 2DLHA 1CL7L 4CVUA 1CLZL 2GFBB 3O6FA 3KPNB 3HE6A 4M43H 1JUFB 2NCMA 1SEQH 1S5HA 4AYFA 2FHBA 1ZHNA 1ZXQA 4YDIH 4KHXL 4NUJA 3THML 5HJ3A 3RWFB 4PJGA 4OZFH 5DRWA 5DD0H 2CIKB 5IWLC 5I73C 1KTRL 3LIZL 5CP3A 1L0YA 2B2XH 4Y19D 2B1HH 4PRPB 3S4SG 1IAII 2Q76A 5GGUA 5GRJL 3D2UA 1A7RH 2X89D 3P11L 1I1CA 1QTYT 9CGTA 5GZNC 2MTPA 4PLJC 1QVOA 5C0AA 3CVHA 4GW4B 4HKJB 5F9WB 4UQ3B 1WQVT 3QWOB 4LP4A 3V6OE 3O3DB 3ZE0E 4Y19E 1S8DB 3DRQB 1XR9A 2NR6D 3FFCA 2YPVH 5JMOC 4FZ8H 4LASH 3UTZA 3HNVL 3LS4L 2QQLL 5CS7A 5D2LA 4MB4A 4CUCA 3EYQC 1T3FB 2H32B 4WHCA 2NNAB 2YPLD 4JRXA 4X9FA 3ARDB 2ICES 5GPRA 3OV6A 4LDLB 4ZD3L 1V7NH 1OD7A 2GQHA 2PTVA 3RGHA 1BVLB 1K5NA 3RBSA 1DVFD 4H1LA 5IB1A 5JHDE 1DSFH 4Z7WF 2VRAA 3U9UA 3MLWL 1A9EB 3QDMA 4I3RL 4J3SA 2VDLH 5BCAA 3VFVA 3VFTA 4HIHB 4QHUB 4WEUD 2YPLE 4HK0B 3MPCA 5TQ2L 1H9VA 3ILPB 5TDNA 5I0DA 1TIUA 4KQ3L 5ITBL 5DZLA 1ORQB 3CSGA 3QRFM 1OLZA 4JQXC 4KUZH 1NEZB 2VXVH 4DVBB 3PG2A 5E6IA 2X4RA 4JPIB 3BH8A 4X8JB 2NXYB 1J87A 1R3LA 2DMKA 1CFNA 1JNLL 3MROA 1AJ7L 3J7HA 3IFLL 3P40A 4YNYA 3G5VB 4OB5H 2Y06H 4NO0D 5ID0A 1NSNL 4LGPB 5JOFA 3R4DA 4NBXB 2K3TA 5TE4L 2P43B 2HTLC 4DKFL 3MV9A 4D9QD 4MNHB 3Q3GB 1T89A 1KT2A 1KPVA 4XPBH 3T2PA 1M71A 2W91A 3LKRB 2BRRL 3ARRA 2BVQA 4PG2C 4GKOA 2NW2B 3VGAB 1T7YA 5SX4I 5DZNA 3F58H 3MNZB 3V7AE 5D9SB 4D9QE 1RSFA 3UZEA 3ZYJA 1NC2B 1A6ZA 1I8KA 3O2DH 3VWKC 4APQA 4JFEA 5DZOA 1K3IA 4Y5YB 5DFWH 3RWCA 2AEPH 4ZPVB 5DJDA 4O02L 3K46A 1MI5D 4ZODA 3VXSA 1KG0B 3B9KC 1KELH 4LSTL 3BP5A 5ICXA 4O4YH 3VGHA 4DZBB 1BQHA 1CGVA 3U6RA 1EHLL 5JXAL 1TETH 4X98B 4A2LA 3T8XA 4JDTH 1HN1A 1MI5E 4K8RD 1D6VL 1F2XK 2BJML 3QI9B 4P2RD 3H7BA 4X5WA 5KVFL 3ZMRA 3UBXB 4JANA 5DUPL 5IR1A 1VSCA 1TQCB 3DSFL 2G75B 1QBMH 2ZSVB 3OPZL 5DK2B 4RMTA 4HBCH 1U8HB 4JFFB 4BUGA 5J9PA 1UCBH 2BOBB 4OLZL 3H3KA 4Y5VB 5MP6H 4HLZH 1VADB 4HJ0C 4G8IA 4JDZA 5TF1L 2R1YA 4OCWL 3AAZA 3CLEH 3LRSB 3G08A 1IARB 1IGCL 2WQRA 1EHNA 4NWUL 1ZA3A 4UDUA 4ZDHA 3HS0B 3RGVA 3O8XC 3I50H 5F7EL 3UMTA 1T1WA 2OSLA 1A2YB 4ZTOH 4R7DB 4YHMH 3Q2CA 2V2XB 2BSRB 5FGCE 3WLWC 1QSFA 1IEHA 2DTML 3GIZH 4IMKC 2VLLA 2VZVA 4KUCF 4P0DA 1IQWH 2RFXA 3OGCB 3QXDB 3FQRB 1ZVYA 1MLCA 4XMKH 1FC2D 2X4OB 2QR0B 1AD0B 4KDTA 3CFJB 5JLZA 2YEZA 3HI5L 4EBQH 4QYOB 4LSSL 1YZZA 3MGAA 1RUPH 3UYRL 4QNPE 2A6JA 1T1XB 3VXMA 2R2EB 5HYJB 2HWZL 3TEUA 5DGRA 4ZTPL 1CXEA 1FJ1B 4Z5RA 1LE5B 1XF4A 2DQTL 3EYSL 3QRGH 4L8BA 1TZHA 1EVUA 2CLVB 5H8DA 3PHOA 3EO9H 1QO3B 2AAVA 1IAIL 1OPGL 4JFZL 3DX8A 3FQUB 4BZ1L 5CP7A 2XZAH 5EZIH 4MAYB 4N0YL 5FIEA 4HUVB 4P4KA 5F89B 5IEHB 4YFLI 1ZT4B 4L3ED 4OCRH 5I1CH 3WN5B 4WHDA 3HA0A 4KKAC 4YR6B 3MC0A 1J0JA 1T4KB 3WIFA 4ZS6C 1SJXA 3QQ9D 3TV3L 4IMLB 3WL9B 2AQ2A 3U0WH 5JZ7C 1AGFA 3H9YA 5T3ZE 1MAML 4L3EE 4BZ2L 1LEIA 1OGAA 3EO1A 2MWCA 4GRWH 1RAMA 4WTZG 3O2DA 4DQOL 1A1NB 4I3SL 4DGYH 3FZUC 1VKXB 3MLRL 5FKAB 1OY3B 5E8EB 2CUHA 2BSTA 2OZ4A 4AIZA 4JHWL 4W4OA 4LF3A 3I6KB 1XIWB 1ITCA 3QZWA 4S1RH 5HHQA 12E8L 2H3NA 3EW3B 2FWOB 1WFNA 3E3QC 3JBG7 2CXGA 2ESVD 3OTTA 2YMXL 1MCNA 4U0RC 1KN4H 1OSPL 4PJXE 4YAQA 1FH5L 4HGWA 4XNQA 3HUJF 4R7NA 4TSAH 4NM8L 5EIVA 1NCAL 3T0AA 2FJFB 2D2OA 5DK3A 1J05A 3UPAA 3CMOL 5T1DH 4BFEA 1U3JA 3KYNA 4UU9B 5IMKA 5C07A 3GSOA 2V7NB 3QSKB 4FFZH 4K94L 5E56A 3OKKA 5CSBA 1B0RA 1KCRL 3EOBB 4KMTL 1AXIB 2DQUH 3TIEA 1S9VB 4EI5C 2VDNL 4Z7WA 2F54E 4YHKH 4LHUG 4ZOAA 5KVEL 4GOSA 2Y5EA 2BFVL 1M6OB 3QO0A 5D7IA 4EXKA 1P7QB 4E41D 2E7CA 1BD2D 2PR4H 3ARBC 4XRCB 3VWJD 1ZA6A 2J8UE 2JLLA 4UQ2B 2UZIH 1N64L 5KJRL 4Q2ZB 2XZQH 5MEQA 4YQXH 4NKMB 2E9WA 1CN4A 3MCG1 3UEZA 3WD5L 4FQPA 1BD2E 4WW2B 1Q9OA 2E7MA 2VL5A 5DLML 3V4PH 2X1OA 4HPOH 3PV6B 1UWGL 4JB9L 2ICWJ 1FO0H 1ZT1A 1Q0YH 2BMKA 5CKGA 1LE9A 5HYIA 1JPFB 3ROLB 3MLZH 2HYMA 3VG0L 2D7TL 1U8KB 1NGQL 1M05B 4WW1A 2DQGL 2ZUQB 1G7JA 1GHFH 2XTJB 2X44D 1WWCA 3MA9H 1KJ3L 2QV2A 1HILA 4WUUD 1UVQB 4YX2H 1IKFL 4M1CD 4XC3L 2C3GA 4YWGL 2UY7A 5TH2B 2V2TB 2PXYD 4IIQB 2CRIA 2C3HA 3LHPL 3DVFA 3TZVC 1BGXH 1X5ZA 4XMLL 3SOBH 4NQCA 4MA3A 2DQEH 2FLBT 2OXHA 1KLUB 5ICZA 1N26A 4F57H 1FE8H 1TLKA 4GBXA 3T0VA 3U4BL 2CSPA 4K07A 5JPMA 5DURB 1MHCA 5EU4A 1HHKA 1PDKA 3DGGB 3QIWA 4PJDA 1AO7E 2A6DA 4K3GA 3S3SA 4F7CB 3ABZA 4MNQD 3DV4B 3FB6B 4CMHB 4XPAH 3OJVC 2BVEA 5IHLB 4Q6IC 4OKVA 2AQ3A 3WHXA 5C08A 4MQTB 3LZFH 3ZDXF 3HMWL 4GAYA 4FQXD 3KWWA 5ERWB 4M7JH 2F15A 2BVUA 4S1DC 1WAAE 1A7QL 3B9AA 3CGTA 1BZ9B 2AJSH 1IFHL 5E00A 5TQ0H 1Q9WB 3IDYC 4F7MA 1BFOA 2WINB 1D5MA 2VXTL 3OAZK 3WJLC 4RMUA 5BZWB 3CZJA 1CFTB 1FL5A 3U1SL 2ZG3A 1G1YA 4LNVA 3RNQA 5B38A 4Y16C 2VWEE 5CHNA 1MCCA 4XPHH 5C0DA 5CAYB 1INDL 3ZYZA 2DB8A 2X7LA 4XNMA 1D5IH 4O51A 1NDGB 2ARJB 3MBED 2Z31B 4L9DA 4OKDA 4JM2D 1PQZB 3U0TA 1T2JA 4JZNB 4DVRL 2MMXA 4YDKH 3P9LB 4HQQH 2R1XB 1XH3B 3REWA 3CFBB 4WTXA 5L0QC 4P5TB 4PB9L 3FCTA 3ZDZF 4QT5A 5T3ZL 1A3LH 1DQJB 3QUMB 4FQ2L 3K74B 4G6KH 2G2RA 1L7TL 2C3VA 1TCRA 4NQSB 3EYFA 5L7XL 1DQQA 4JN2A 1UWEH 43CAB 2HMIC 1SEBA 2YD3A 1FYTB 4OFYA 3UTQA 5DVOA 4HT1H 1XR8B 5KTEH 3QUXA 1A9BA 4FOMA 2ATKA 4PUBL 1JPST 1J1PH 3GSUA 1FFPA 3FAXA 4I5BB 4EQ2A 3PQYB 4MGXA 3W5NA 5ESQA 4WFED 1VEPA 2K9UA 3RRQA 1LILA 4K7PL 1ZAGA 1EAJA 4S10A 5F96L 3QDGD 4GSDH 1T7ZA 4OZGF 2BX5A 5TPWL 3D69B 2D9QB 4U33A 4M1GL 3KLHC 2Q6WB 2HH0L 4FQ1H 4LCUA 3F6LA 5D7JC 2NXZB 3GSVA 2BVOA 1HIML 1N7ML 3UJTL 4UTBL 4GW5B 4N9OB 3KXFA 3L3KB 1BBDH 4KTEH 3CX2A 2Q3AA 2X1PA 3TBWA 5JNYB 4N0CC 4XT1C 4KRPB 5IB3A 4BYHA 5IOPA 4CNIA 1B2WH 1S3KL 3MZGB 3TPUA 3AMLA 1M7XA 1T0MA 5IW3A 3STZA 5I1IH 5IWLA 4E42B 4RISH 3ISWA 5F70A 4PV9A 1I1RA 4KK8D 1UT9A 2H1PH 3KPQA 4OQTA 3RI5F 4JG1L 1NUDA 4KRLB 3WS3B 3JV6B 4G8FB 4ODBD 3VXUA 5IEKA 4OTXH 2VYRE 1HYSD 4NQED 1KLGB 1WZ1H 4TUJA 2CDFB 4PJ9C 4FFYL 5IHUH 2R69L 4YHPA 4MJ2A 3MGOA 4QXUH 4OD1H 4TULL 3WNMA 1MH5B 1XF3B 4OI8A 3V0VA 4Y4KD 3F7YB 1WTGT 2VDPH 2AJ3A 2AXGB 4HS3B 1NFDE 4DW2L 1WCBB 5JDJA 1Z5LA 1Z0MA 3V52L 4HLJA 3GNMH 4NQEE 3HUJA 4I77L 3UXFA 4LLUA 3NABL 4BH8A 1J8HA 1EO8L 1XT5A 3BH9B 3HPJB 5FYLD 1VACB 4ODVL 4M7KH 3BI9X 5C0BA 4I0PB 4IRSB 3AMKA 1MREH 4NOBA 5JUEL 3WBDA 4G6FB 4DOHB 1HQRB 3BQUD 4WI2A 2P8MB 5DJAA 4AM0B 1MRFL 4MLSA 4EOWH 2HJLB 4HGMA 3VFMB 5FUZL 4X7DC 4PS4H 5EO1A 5FYLE 1RU9H 3MJGX 1OTUD 4NQDD 5F3BA 3AREB 2WBJB 3UO1H 4XP6H 1L9MA 5MI0C 4MNGB 2VDQL 3CCHA 1PG7L 2AK4A 2XNAB 5DJZA 5HI5D 1G7LA 2PYEA 4WO4D 3MV7A 3TJHD 2YD7A 1KEML 1FFRA 2ICWI 4RGOH 2YPKB 5FYKL 1A6AA 3PF2A 3UDWA 4KKNA 3SGEI 4HUXB 3P4OA 3VXOB 2AV1A 4JG0L 4M4RA 1KFAL 2CR3A 3X12B 4PRNB 3VMPA 4I8DA 5EOQL 2AVGA 2GSIB 5GS0D 1RZFH 4KKCC 2OLDA 4XWGL 1RUKH 2XQYK 3QDJD 3W82A 3DBXA 3Q5OA 3NAAL 2VIRA 3D39D 4QOKB 2PW1A 4PRPE 4PG2A 1FIGH 3GHEL 4KGLA 5B39B 1JPTL 4P46B 5D6DA 3IJSA 1RIVL 3PP3H 5J13B 3BFOA 4R96A 3QJHA 1E27B 4V2CB 3HZYB 3KHQA 3T2OA 1FN4B 1YPZF 3VWKA 4AMKL 3P30L 3D39E 3WKMH 3MRRB 1FV1A 4OLWH 1LP9E 4G7YL 2IANB 4OGAC 1V5JA 1HYRC 1CG9A 3B9KA 4TRPH 2WWMD 5IMLA 3C6LC 4ZSOA 4RIRA 3OKOA 4R2GC 5I15H 4F58H 5M7QA 1IAMA 1HZHL 1IEAB 2NY1B 5JORB 1AGDA 5I1DB 2GTWB 1N4XL 4NJAL 2DM3A 4HWEL 5BVJB 5JR1H 4P5KA 5INCB 4OZ4A 4H5SB 4WEBH 1BZ7B 2VXQL 1IEBA 4MQXC 5F7LB 4YBLC 2XRAH 3ARXA 4ORGB 4LPUA 4NO5A 5IVXE 5CMAB 5FO7B 3RY4A 5J0BA 3CNKA 1I75A 5C6PB 3IETB 1HHGB 1YC8A 4TPRH 3LKPB 4AH2B 2IC2A 2WUBH 5EZLA 3G5ZA 5E99H 3DHMA 4XVUC 1I7ZA 2W1NA 1I1FB 2I9LB 4FNLH 2FIRT 2VR5A 4F3FA 3DURB 1KJMA 5BZDB 5E08L 2IAMB 3TIDB 4ODXB 3O8XA 1QYGL 1T5XB 2J4WH 2DRUA 1J11A 4X9BA 1MCBA 1NDMA 2Z9TA 3VI4F 5MEOA 2JB5H 3VRIB 1MIEL 3K8LA 2MPAH 3SQBA 2DMBA 3LSOA 3QG7L 4IMKA 1R3HB 2OQJB 4ORZC 4M61B 4PP2A 4U1KB 1G84A 4RX4D 2PYFA 1UFUA 1IZJA 2CKNA 1XGQA 4TSBL 3EJZC 1L0XA 3MO1A 4HAGA 4F9LC 5E4IA 1LEGA 3N0PB 4L1DA 5E6YA 3QAZC 1KTDA 4NYLA 1KCVH 1XCTA 1RY7B 4MX7B 2LU4A 1S9YB 1I4FB 3RUGE 2VB5A 1IGFL 3I75A 3EOAB 5CCKL 2R56L 5FA3B 5FECA 1NPUA 1WC7B 1KUMA 3QA3B 5AZ2H 5I18L 4FQIH 2OP4L 4G8GA 2OI9C 5KAQF 4ZNEE 3GMLB 1BQHG 1FL3A 2X4PB 2DBLH 3C2AL 2AI0H 4ZO9A 2ENSA 2VDOL 3LD8C 3DMMD 2ERJC 2ZZUT 4XP9L 4KK9C 4JFFE 4L29A 3OR7A 3O3UN 3RBGA 4RMSA 5DR5H 4LRIC 1I9RH 3TYFA 2H2SD 5HDOA 4P2QB 3LEYL 5SV4A 3L3JB 1GJIA 4OZGA 1QFWM 5DTFA 2XN9A 5ALBL 3MJ9H 1MJJA 5DQ9A 1L7IH 3SCMD 4WIQA 2FSEA 4M3KB 4GXVL 4KK6D 4Y4HD 1WEJL 2E8YA 4MA1C 2FHFA 4OZFG 3BESR 4YHZL 3V5KA 1W0VB 2NX5A 2VUOA 5C9KA 4MSWB 1DE4A 3TJEH 1YYMH 4Z7VF 1NBZA 4M1DH 4NRXA 1OAYL 4PJ7A 5KSBE 3FO0L 2R4SL 1FGNH 3W0WA 1NAMB 3ARZA 2JB6A 1ZE3C 2HFEB 3HAEA 3LEVH 5JW3H 3TBVB 1FNSL 4DTGH 1T1ZA 1OHQA 4LDEB 4L3AA 1RHHA 3VD4A 5CZXD 3PWVA 1E4WH 5T5FL 3S9DB 2XWBB 3VJ6A 5ESVB 4XWOD 2GIYA 2VMFA 5IGXL 3H0TB 1PBYA 1R0AH 3KJ4B 2YZ8A 4JRWA 1WLHA 4HFWA 5HYJE 4EZMA 2NY3B 1W8NA 4JY5H 5E8DH 4PJ5D 1NGPH 2DIJA 2HTKC 1NJ9B 2DM2A 1RZGB 4NC0B 43C9A 4YXHL 1A7PH 3TLRA 3H9SD 4N0FA 2FX9H 3EYVB 3DRTB 3HC3L 3SJVB 3EO0B 1HXMB 1U8MA 4KPHL 3PWUB 3MNVB 1U8PA 2PN5A 5KOVC 4PJ5E 1WZKA 4HS6A 4EI5A 5IT2H 2OBGA 2VLKB 5T1LD 4PD4J 2J88H 1F8TH 1NUFA 4GFTB 1TPXC 3KPLB 4HWNA 4POZD 3H9SE 1FVDA 3O9WC 5DF0A 1I3RB 3PP3K 4F33A 3SKUD 5DJ6B 4K94C 2RIKA 2W92A 2RHEA 4JPWH 3PXHA 2VDMH 1YNTA 3ZHDA 2R8SH 1I8MA 4ELMB 4KRNA 2C26A 4CDGC 3KPSB 1TJGL 2VZ3A 5MERB 1MCJA 4GS7C 1S7TA 4C4KO 1CDJA 4IOIB 4PRDB 5GZOD 4JRYA 1U8LB 3O3AA 4PTUA 3RI5K 4P3DA 5E8OB 1LEKB 1PYWA 4JZJB 2NLJB 3ZTNH 1I8IA 2GUOA 3JUZA 1SYSA 1WK0A 1UH4A 3B5GA 3DOSA 5EZJB 4EDWH 5C86A 4XP4L 2D31A 1WIPA 3OAUH 5IP4A 2BY3A 1KXTB 4NN6B 5GISH 4HG4K 4C56B 3WXWH 5I1HH 5I8EA 2OR7A 3S34L 4D0DA 1UC6A 3RX5A 4BFBD 4PG9A 3MUY1 3QZWG 2Y36L 2DQDL 4C55A 5D7LB 1CLZH 1YPZA 1VGKA 1T80A 2A74B 5EUKA 1YEHL 2GHWB 5I1LA 3TZVA 4FA8A 2O93L 4OI7A 2H6PB 1T6VN 1T21B 1XMWA 4WNQB 4BFIA 2ZSWB 1QRNA 3THMH 2HT4C 3ZT5A 1XFPA 1BOYA 3RDTC 3CX5K 2C1PB 1DQDH 5I1AA 4LCWA 1JN6A 5DUML 2VH5L 5HGDB 2VABB 3SKJL 1TQBC 1WITA 4HLZG 2GCYA 2BC4A 5ICYA 2ADJB 1T22B 3HG1D 1B4RA 1NBVL 1SJEA 3P11H 5LGJA 3DROB 2WLZA 3V4UL 4Q9QH 4V1DA 4BM7A 3SKOA 4MQ7A 1WJ3A 2PO6C 3CDFA 2DWEB 4L4VD 4H26B 4X5LA 4NWTL 5FO8A 4FS0A 1FQ9C 3WKNA 1DDHA 1IM9A 3HNVH 4ZYKB 1JZ8A 4OJFH 1ROWA 4PJFB 3WJLA 3HG1E 5SWQA 4NPYB 1YEDB 5K9KB 3V4VL 2G9HB 1KTLA 3NIFE 4OT1L 4ZD3H 4NRZB 4L4VE 3C09B 3LN4B 4Y16A 1NCBL 2VZUA 4OD2B 2OS7A 1WBZA 3MLWH 4I3RH 5GIRA 3GMPB 3G5XB 4WWKC 4XNXL 4H0IA 1CDCA 4FMKA 1RK0A 4JQIL 5A2JH 4M6AA 4CMMB 3PWNA 2W0KA 2PCPB 3LB6D 3MNWB 1LNUA 2JE8A 4D0CA 1NGXA 3IAPA 1E4XI 1F6FB 3VXTB 3MRQA 5J06A 5D1QC 2GI7A 5CEXB 5CJQL 4JZOA 2B20A 2FZ3B 3IXAB 1DBBL 3RWJA 3GBLA 2IBZY 4JR9L 1KV3A 4LP5A 3TO2A 1OP9A 2EEBA 1JNLH 1AJ7H 3IFLH 2N7AA 2GJ6D 1FDLL 3VFNB 1NSNH 3MLUH 3S5LB 4JFQB 3OKEA 5TE4H 3T0BA 2VC2L 3D25A 2FLRT 1UQSB 4Z95L 4ZUUB 5HI4D 4UAOC 4ZAKB 4DKFH 5L9DH 4J8RA 4U4BA 1KCSH 3WEXB 2AW2A 4I18B 5F6IC 1DANU 5TDPB 1AD9B 1AKJD 4NDMB 5HYQB 1FG2B 1T5WB 2R2CA 3S37H 1JGDB 4M3JA 4KJYB 2O5XH 4JHAL 5GJTH 3TO4D 4MXQC 4N90D 2EYTA 4D8PA 3LQAL 2B0SL 5MENB 2APWA 2VDRL 4O02H 3L7FB 3ZKND 1NFKA 1EFXB 4KXZH 3EYOA 3BD5A 5SWSB 2EDDA 4JFPA 4CL7A 4LSTH 3U2SA 2GSGB 1RJZB 4ODUB 4DK3A 2CPCA 4N90E 4M93C 5HHMB 1U8IB 3F7RA 4RGMB 1YDPA 1LO5B 3IRZA 5JXAH 4MS8C 4LPTA 2Z4QB 1TZIB 3BSZL 5ID1A 1D6VH 2BJMH 5B38G 3IFOA 3OKMB 1I7UB 2XV6B 3DSFH 1I1AC 4OF5A 1UB6B 4JO3L 4NCDA 2OTPA 3B9VA 3OPZH 4Z7VA 5EUOE 3L1OH 1CBVL 1A6WL 1SJHA 2W9DL 4FFWC 5EIQA 1CLOL 3FO2A 3QCVL 4UT9L 1B6UA 3EJYC 2GK0A 1IAKA 5F1KC 2YC1A 3MUGB 2D0FA 4JFDD 2EDQA 4ZUVA 4MCYA 5TF1H 4Y4FC 2P5ED 3WFCL 4PJ9A 2DOCA 5GGRB 1HNGA 1VERA 2IBGA 3T2NL 1C16A 1IGCH 3RZCD 3BPCB 1EA9C 4XPGL 4M7ZC 3FAWA 4JFDE 5BJTA 2IBBA 5F7EH 2P5EE 1UH2A 3B9EA 3U7YH 4CBPA 3BXNA 4NBZB 3WFEL 3CH1B 3L3DB 3AVEA 1KF9B 2HLAA 4JREC 2DTMH 2GTZB 3HE7B 4K2UL 2AEIT 1X4XA 4NKDB 1JRHH 3RJQB 5E7BA 2W65B 1GGCL 3HI6L 5E8PB 2QJDA 1Z6JT 3HCVA 5DJCB 4BQ9A 3LRHA 1INQB 4Q6YA 2NY6C 1KIQA 3MJ6A 5K9OB 4C83B 3QG6A 1G7PB 4PREA 2E6QA 3C5JA 3HI5H 1FLRH 4ZFZB 5I9QC 5EBLA 1QEWA 3V79C 3W81A 2OMBA 3D3VD 4E5XB 4LCCB 2YD1A 2YBRA 5IW1B 3UYRH 1E6JL 1RUML 2CK0H 4M6NL 1BM3L 3FFDB 2DD8L 1DANT 25C8H 3TBTA 4Z0XB 5GSVA 3BPOB 4N0UA 1N5AB 1DUZB 2NY5H 1DBAL 3EYSH 4P2OC 5FKPB 4AG4L 3H9HA 3U9PL 1JWMA 1AY1L 1HXYA 3D3VE 1K9TA 3DETC 3F65A 4X6CF 3V6FA 2A0LD 1TTUA 1ADQL 2ITDB 1GZQB 1AE6H 1UGNA 5CJXC 3QPXL 1IAIH 1FZMA 5DO2C 4WFFD 2EDKA 1CFQA 2FB4H 4JFZH 3GK8L 3KPOA 4MDJB 2JELL 4BZ1H 3MYJB 5I1KH 1EERB 4N0YH 1B6DA 4QTIL 3BJLA 2XQYG 4R4BB 5I8CA 4NQXA 1I9JL 1NCCH 5I73B 1AGEB 3S35L 1H0DA 1JHKL 1QNZH 3RVWD 3VMOA 4PJIF 3C6LA 2V5SA 3VFSA 1MAMH 1JYWA 5IF0A 4A2MA 3LDBC 8CGTA 3VFUA 2DIBA 1MIMH 3NPSC 3T3ME 1JWUA 5DC9B 3BPLB 4DQOH 4YK4B 5I71C 2YD9A 4I4WA 5FO9B 1DN0A 4X7SH 3ECBA 3MLRH 1E4XL 5DC0A 3TT3L 2HJFA 4OFKA 1LO0L 3JWDH 3SDCA 1WFOA 12E8H 4ZPTA 3N1PC 1K4CB 1G0YR 1D5XA 3NFNB 1F97A 1SVZA 1CICD 2CRMA 1QKZ