2O6CA

Structure of selenomethionyl rtp34 from treponema pallidum
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
158
structure length
158
Chain Sequence
FDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Tp34 (TP0971) lipoprotein of treponema pallidum: implications of its metal-bound state and affinity for human lactoferrin.
pubmed doi rcsb
source organism Treponema pallidum
molecule tags Membrane protein, protein binding
molecule keywords 34 kDa membrane antigen
total genus 28
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10634 Iron_transport Fe2+ transport protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o6cA00
2O6EA 3NRQA 5I0XA 3NRPA 5I0WA 2O6DA 2O6FA 3PJLA 3LZPA 3LZQA 5I0YA 2O6CA 5I0VA 3LZOA 3PJNA 3LZNA 3LZRA 3LZLA
chains in the Genus database with same CATH superfamily
4YHLH 4GQZA 3SPVA 1BFVH 1O7DE 4XTRC 4Y4HB 2JCCF 5AZUA 4M7JL 1A7QH 5A2JH 5IEHA 1QTYT 4DQAA 3LS4L 2ZX5A 3UAFA 3VFSB 5ICYA 4HDIA 3G7TA 3OGCB 5T33H 1ES0B 4V2BA 4F2EA 2Q20A 2FBOJ 4XXDA 5IT2H 1GGYA 4LMQI 4FFVD 5CEXA 1K72A 3ILPB 1UOVA 3QB7C 2IH1A 1X44A 4LOUD 2AV7A 2UUDH 2VAAB 2CGRL 3JT2A 2WLMA 2J56A 3DTXB 2LFGA 5KUMA 4LT7A 4JFYA 3PGDA 1G0XA 1EDYA 1AGDA 1YYML 5IHLB 3W57A 1MW3A 1RZ7H 2GJPA 1G9HA 1BJ1J 1B0RB 1XCQA 5F8RC 2FJFA 4QHLB 3S37X 3BW9B 2NCMA 3S5LG 1ITCA 4P3DB 4XVTH 4HFUH 4XI5C 1OPGH 2VZ1A 2BNQA 3ZN6A 4PWHA 1IM3D 5HHXL 3VFOA 2VLKA 1UCTA 3IJ9A 4FQHB 1I8AA 5ENWA 5ITBL 1H3PL 4OZFB 3GBLA 4AM0A 3T6QC 2W60B 3QQ3A 3QA3A 4JFOA 3AREA 1YY8A 4R4BB 1YSOA 5KS9A 2VQUA 3GF8A 4F3FA 1X4ZA 1IAII 1MFCL 4OJCA 4X0NA 3RIKA 5I1JL 4ZUTA 3PL6B 5DEGB 4X4MA 1F2XK 3H7BB 1IKNC 2GY7B 5BO1H 5EF1A 1SJHB 5T3XH 3CH1B 4AUYA 2D7TH 1AGCA 2YD7A 2WUCH 1WE5A 4N2FA 4KDTC 3BEVA 4M7ZC 3PF2A 5F9OH 2HKHL 1BIHA 2BCKA 4MVBC 3MRPA 4GAAA 1N6QH 5KJ7E 3DX9A 4UU9B 1Q1JH 3DX7B 3FH7A 4DCQB 3GMNA 4IK7A 1HYRC 5I8CB 5EU6A 3FTZA 4OD1H 4F7CA 4HXBH 2Y5TB 1YMMA 3EOAB 4IM8A 1XXFC 3AAZA 3CDGB 2MQ3A 3F01A 1TQTA 3PDOB 1IC0A 1KOAA 4Y4KB 3LXAA 4HJ0D 5B1JC 5IB1A 4FFYH 2XT1B 4GI6A 3RVUD 1F3DH 4QJ5B 4XP4L 4JFPB 3SDAC 5FYKH 1NAMA 1G0YR 3MUJA 1TUPA 3RI5K 5KSBA 1MI5D 5FM5O 5BS0E 1NINA 3V0WL 3D4CA 3MQIA 4WFGE 3RWGA 3VXPB 1MI5E 1AFVL 1P4BL 2PXYA 4RDQF 4X99B 3RJOA 4B50A 3O3DB 4DEWA 3SKNB 4QXTA 1J5DA 2YUZA 1J9SA 5KSBB 2AW2A 1BP3B 2X1OA 5GGTA 4WTZG 2CK0L 2E4FA 5HHOB 4ODXA 4CVZB 4OZIA 1C1EH 1UM4L 4JVUA 2XTJC 3MO1B 5CJXA 1Z9OA 1HL5A 2MPAH 2BIPA 2FR4B 1MFAH 3QXVA 3MUGA 3G6JE 1S9XA 1X5FA 1ODAA 5T1KB 4DPCX 4M5TA 3MJ6A 4EMZA 1Z0MA 3VCLB 1A7RH 4GKZB 1V27A 5A40E 1NMAL 1G7JB 2J6WA 4YSOA 2CBMA 1R3IH 1IM9B 3T4AC 1G7IB 5EZPA 3GLZA 4IEFB 1P84J 4NO5A 2NUTB 3NAAH 2GT9A 3WN5C 3TIDA 2WUBH 4ODSH 5LGKA 3UDWA 4EDXB 4F27A 4GG6E 4XWOD 4KPHL 2F8IA 3ZE1B 5I16A 1FIGL 4B9JA 3P9MB 1X4XA 5C8JA 3UBXB 4TM9A 3DX3A 4LQFH 1EA9C 1QFPA 2DY2A 3AM8A 3QXUA 4J28A 2NXZB 5IMKA 1DQQB 3ALWA 3QWOB 3EW3B 3R8BB 3QJUB 4YSQA 2UWEB 4BH7A 3BGMB 2VDNL 3HVNA 3KPOA 4P46D 4WFHD 1KC5L 4R5XA 4JK0D 4NQCA 2W65B 4JPVL 3SD2A 4JFYB 1YRKA 3NSCA 2GSMB 4XO8A 4JFDE 2X6CA 5FDWA 4X80H 3QEUA 4PLNC 3OXSB 1GGUA 4BWWA 2V5SA 3BW9A 5KSAB 3ATAA 1YEHL 1CN4A 2X4SA 1U2YA 2FJGA 5IF0B 1TMCB 2J20A 5L9DH 3MYJB 4FLSA 4AQ8A 4XP1H 3G9AB 4AMKL 4AYDC 3DHMA 4GUOA 3HG5A 1MWAL 3D2TA 4UDUA 5SX4I 3DLQR 4J4PC 1A6VH 2OQJA 2YC1B 4Y4HA 2HP4A 2DH2A 4PY8J 1Z66A 2Y06L 3IFPB 3TN0D 4Z3JA 5I71B 4HJGA 3F7VA 2GW5A 4TVPE 3GIVA 2GBVA 3AITA 3U2SB 1FZOB 1WVZA 2DI9A 4KO7A 4P5TA 2XZZA 3W81A 3CWGA 4X6DF 4NWUH 4ZDHA 2AQRA 5I6KA 4U2YA 2ICES 4AJ0A 1NUNB 5E6RB 5GXBB 4HUCA 4LSUL 1JXKA 2UX7A 2F8OA 5A43C 1ECZA 5CKGA 1OOWA 4Z7OE 3TA3B 2IH8A 3FBKA 5BRZD 3PL6D 1D5ZB 1MWAA 2FQEA 3WFHB 3TS8A 5JQHC 2AK1L 4XCCL 1XR8B 3MC0A 1NIDA 3HR6A 2YD5A 3I02A 5IEKA 1E6OH 2LU4A 2WN2A 5LG6A 5ACZB 1BX2A 2A99A 4HPOH 4Y16D 3UX9B 1F6LL 1CT8A 2QPDB 2XVBA 5E8DL 4BZ1H 2PXYB 4NBYB 2C9AA 2PW1A 1SQ2N 3D87B 5GRVK 5EZLB 3VSUA 3MRJA 3MJGX 1J8HA 2E7DA 5E8PA 1Q38A 2CBPA 2WZPA 3T2QA 5D2NE 1AGBB 1WFUA 2NUPA 3BAKA 4WWKD 5GJTH 3V4UH 3I84A 1EMTH 3MV7B 5C07E 2BOCB 4WW1A 1QLFB 3KPSA 1Z7JA 2J2ZB 3OLEA 4LF3A 3EDKA 4PJ7E 3UZQB 3H9SB 3IKKA 4XP4H 4HJJH 4MXQD 3IYLW 4XVUD 2HJKA 2IXQA 2VZ3A 4EBQL 3SDDC 2DJSA 3KLHD 3C60B 3VMPA 3LEYH 1QBLL 5CILL 1WFNA 3ECQA 3O8XA 1G84A 1UZ8B 3RWJA 1JPGA 1G1YA 5LGJA 3KPNA 1IEAB 1B2WH 1AFVH 2A83B 1KYAA 1HINL 3FBQA 4R0LB 3MZGB 2HKAA 5MHSE 1EO5A 3F7PC 4E0RA 1R0AH 1J87A 3M8OL 2XZAL 1KYOJ 3VXSB 1B9KA 1NIEA 1MCWM 2I85A 3F3HA 4WUUD 3IDGA 4H25A 5E99L 3HPJB 1IO4C 1MDAA 4NO0D 5ICXB 5JQ6L 2I60L 1GZPA 4PRBB 3DIDA 4MNGE 3KH3A 1WCQA 3GBNL 3GMMB 4HWBH 2XRAH 1NDTA 1WJ3A 4O58L 3WOVA 4XNDA 4CNIB 4YE4L 4WUKH 2OJEA 1PLAA 5G5DB 2X1WL 1XGQB 1CDCA 3MMEA 1BLNA 1MY5A 4GI9A 1A02N 4YZFE 4D9LL 1LILA 4M6NL 1GSMA 3FUHA 5LCVH 1WZ1L 3EYSH 3FJTA 5D4JA 2QFPA 5HJBA 2H6PA 1P4IH 3B9KD 4I0PC 2X0VA 3ZL1A 3GXIA 4K7PY 1BZQK 2NNRA 4Q6KA 4I9WD 2F58H 5TDOB 1ED3B 3NFSH 4TNEA 2CZNA 4HZLA 5AYTA 1FLRL 3N91A 5DD0L 1ROWA 4P3WA 3BD3A 3WTVA 1SF5A 4UT6L 5DCCA 1ZXQA 4J3VA 1G9MH 3II3A 4XCEA 1E30A 1MXDA 1U93A 2ZOTA 1NAKL 2O30A 4YE0A 1EEQA 1OW0C 2Z8WC 3LQMA 4JQIL 5JNYB 4MXWH 3MBWA 2WTPA 2YPLA 5AAPA 5J11B 3GQFA 5J6HB 2RACA 2KLTA 4ISVB 3OQ3B 5DYFA 2XFXB 4ODHH 4P9MH 5JIDA 1NCBH 2FJFB 2VQ4A 5KYUB 4XC3H 1MRCL 1U92A 2EIDA 5I0VA 5A16B 5DYOB 1J1OH 5FAAA 5TE6H 4ACTA 5DLMH 3X11B 4MX7A 1NCWL 2XWJB 1UWYA 2CUAA 4WU5A 1B4JL 3EO0B 1VADA 4ZPTA 3CD4A 2IQ9H 4MQSB 1XB3A 3RZCD 3Q2CA 1G9EA 2IGFH 4FGMA 2Z1KA 1SHXA 5GSVB 3WTXA 2IQAA 3KJ4B 1JXFA 4X9IA 3GI8H 3CQPA 3G5XB 4JY4A 2DRUA 5JPMC 3FQUB 2DQ6A 4DGVL 4FXLA 1KV3A 5EF0A 4LOEA 1LO2H 1GHFL 4PJEF 3MA9L 5EU6B 3AT8A 1L0XA 4TNVF 4IJ3C 1Q8MA 4LLYA 3SN6N 3SZKC 4RAUB 2ZUYA 3BXNA 3CQQA 2J2ZA 4UQ2B 4ABQA 1DVTA 1QZ1A 4OZFG 4PGBA 1MVUA 3A21A 4QD2E 3LKSA 5GZOC 4FRWA 2DW5A 2V2TB 1RZIB 2IV9A 4K5NA 1A1OB 1LE9A 3RX7A 1AZRA 4J8RA 2BNQE 1J9RA 1LL1A 1ZA6A 1RHHB 3K0YA 3I02B 3ZGHA 1MREL 3S36X 1YMHA 3GSNH 3SOBL 5CP3A 3MBXL 2WQ8A 2OYKA 3KLLA 1ZHBA 4YBLC 1KB5H 4UNUA 4OCXL 3WS6A 2JIXB 4N1HB 5I71C 1MOEA 2GBTA 4AGQA 3ISWA 4ZS6C 1F3DJ 3KPRD 3LH2H 3NPZB 4F8NA 1OTUD 3DUUB 4JQVA 4HAGA 5DS8A 1A0QL 2BX5A 5ESVA 1YO4A 1IGCL 2XQ0A 3HC3H 3ULSB 1EHNA 3P0GB 3TURA 1HHJB 1SMOA 2V5RA 3N1MC 4JQVC 2IWGA 5EEWA 1MFAL 1N64H 2ZWNA 3MRHB 4I48B 2X3CA 4P23A 5H2BA 4QOKA 4AEEA 4U3HA 12E8H 3PS6A 1GKOA 4W9CC 2I27N 1NSNL 4WDIB 1JGIA 2B4CL 4KKBC 4X9GA 4WWPA 1PQZA 1ZHNA 3IJHA 4MMZA 1Z3GL 3IU3A 2H9GA 2ICWB 3RU8H 3WMQA 4RGOH 3FSAA 4WI4A 1IAOB 1BZ9A 1GOHA 3CVDA 4O51B 2UZPA 4XBMA 2NZ9C 3Q8AA 2EJ1A 1DVSA 5D7LE 3BQUA 4RLDA 1BQHA 3RY6C 1OP5K 3UTQB 2ZT9C 3QGVA 2OCFD 3JWNC 5T3XE 1ZLUK 3DIFB 2WZ0A 1XF2B 4MD4B 3S4SG 2IFGA 3ZSTA 3IKCB 1PLCA 2A6IB 5LG1A 2YAPA 1S3KL 5ID0A 5JHLA 1L0QA 1YEKL 1XF2A 1S9WA 3ARGD 3BUBA 1E9OB 6TAAA 3H9SE 1S7TA 2JJSC 2YWYA 3HOGA 1EXGA 1QA9B 4JPVH 1KC5H 4NKOA 5MEOB 1CIUA 4RWYL 3FMGH 1KNOB 2AJ3A 3PHOB 5DMGD 2Y07L 4ZMVA 1ZT4B 2HT2C 4PJFB 3MX0B 1IGFL 3A6CH 3E2HB 3TWCH 4TQHA 1YNTA 4DZ8A 3I6KB 1KTKE 1KLGB 2EACA 3FK3A 1A6TA 4QF1B 4M6ML 3D7PA 4R5VA 3VXSD 3D08A 3ESOA 4Z95H 5F7BA 4DK3A 1RPQA 4TSBH 5EULV 1M71A 1AQDB 3FH5A 1NWOA 3M45A 4XMKL 1ET8A 5C0FB 1DCEA 1KLGA 3SGEH 3POHA 5BV7H 3OKOA 4AQEB 4GP8B 1KCSL 1YQVL 2WLIA 4XTRD 1F5WA 1CFVH 3C5ZA 4LNRB 1DO6A 2Y25A 2CD0A 3VXUD 1ZWIB 2WIIA 2FCBA 2Y7SA 1ZLSH 3ZR5A 4AGLA 2QT6A 1MRCH 3JYCA 3P77A 3X1GA 3HC4L 3NPSB 5C09B 3OJMB 3VB8A 1U41A 1AKJB 2IBGA 1YEIH 1WT5A 4K8RD 4KRMB 1PEZA 4EDWL 2VL5A 3CFDA 3TCLB 1BJ8A 2CGZA 3VGFA 4ZD3L 2ZUTA 3STLA 5CJQH 3RX9A 1KY7A 3T65A 2ZCKH 1MQ8A 3DSFH 2KPNA 1HHGB 5DJDB 3P4OB 2NTSP 3VGDA 4KROD 4TUKH 1T0NB 4NS0A 4NQDA 4WWID 2UZIH 4MJIB 1DZ0A 5IR1A 4E41B 4Q0XL 3D48R 1XF3B 4MQ7B 5I1DB 2DF3A 4M7LT 5JHDD 1FCCA 4KJPD 1RAMA 3IMSA 2DQGH 2YRLA 4QHKI 4JPSA 3A5VA 4CGUB 5FM4A 4OQTH 3H6JA 1SEBB 3BWUC 4DN4H 1FRGL 4JGJA 5DQ9B 3OKEA 4PBDA 1E4WL 3RI5F 1ORQA 3E7JA 3ROOA 4LSPH 4Z78A 2PCYA 3UTTE 4OGYL 2WBJB 1R3LB 4JFQB 5B3JF 3MZTA 2CNZA 3K1DA 3HFFA 1W8NA 1TTAA 4LLWA 4NT6A 3VWJB 4N2KA 4XMUA 3OXRA 1PCXA 1D6EA 4G5ZL 2EXWD 5DS1A 1GZQB 4F15B 1WEJL 4QOKB 3MV9A 3ZZ1A 3KGTA 3DHJA 3IDMA 1BBJB 2G75A 1CL7H 2H8PB 3AQXA 4GT0A 3HG1A 1NCAH 4JR9L 2F08A 3K1KC 4NC2B 3AMLA 2W07A 1YN7A 3GK8H 4A2MA 5DGQA 1KACB 4HOZA 3GDCA 4D9RD 4DOHE 3L1GA 3BX7C 2FX8L 2ROXA 4HX1B 5C7XL 4KJQD 3Q8CA 2X42A 3ZKXC 1IAMA 1PKQB 3VRLF 4OFYD 3MU3A 3K2UL 3RDTB 1E8YA 2XWTB 5JIQA 3L6FA 3FO0H 1QTPA 2GFBA 3D5OF 2C1OB 3DVGB 3MRCB 4FNRA 1QPKA 2IAND 4KH9A 3ZE0E 1S7VB 5L2KA 2FO8A 4FEMA 3BEWB 3L3HB 1X9UA 2IWKA 4ODUA 1YN7B 3RNQA 5E6UB 4PS4H 1XGUA 1OCOB 5GZND 4I0PB 3BXNB 3EJZC 2ZP0T 4PJ7A 2BSSB 5T3XD 1YPZA 4M6AA 4AV5A 4PJ5E 3KS0J 1OCCB 5D2LE 5HI4D 3NFPA 3VH8B 3KD4A 1D5RA 4GW5B 1TVDA 5J3HC 25C8H 1PQZB 1ZHNB 1CFSB 1FFQA 1A4KA 3C5JA 3QHZL 5J8OA 1I9JH 4O2FA 4QWWD 2WIMA 2YKLH 2WKGA 2XIBA 4I89A 4PCTA 1Z1WA 3NSFA 4LFHD 5IW1A 2VE6B 3RX8A 4OLYL 1YUKB 1S9XB 4PLOB 2P5WA 4R8WH 1GMEA 5F7EH 1G9ML 4OZIF 2WMPA 2VH5H 4NRXB 3TT1L 1CDBA 4YSRA 2P5WD 3FHAA 2OPCA 2H26A 2AKRB 1PG7H 2YO3A 4ODXB 4CVZA 4OZIB 2HMID 1E5YA 4TVUA 2Q2LA 1YG9A 2R0WL 4Y2NA 3OB0H 4ZFGH 1RK1B 4I3RL 4YHNA 1NANH 1TKWA 1MRFH 2CLVA 1H8SA 1KJVA 4P57B 3TEUA 3P54A 3FB7B 5FUOL 5ES4B 4JJHA 5T3ZD 5I0XA 5JYMA 2DMHA 4MLSA 1XHHA 2DS4A 2VE6A 5SX5K 3FN3A 2FWLB 5FKPA 4G6AD 5TK2A 1UJ3C 4HF5H 1XF5A 1IBDA 4NZTH 4LSTH 4JDVB 4R5TA 1NFKA 4XNBA 2OP4H 5IG7A 3CDYA 3S88L 3VFMB 1XT5A 1ND0B 4XPAH 1KTCA 4TQPA 1R5IB 5ETUB 3I3DA 5DUML 4JN2B 1AKJD 4GLRI 3LNGA 1X6NA 3FNKA 5CN2A 5J3HD 2GJZA 2E27L 1NPNA 4RRPM 4GAYB 1NC2D 1TDQA 3K6DA 1MFMA 4K94C 4BQ6A 1REIA 1ZHLA 3WJLA 3GYRA 4NPYA 4NCC1 4FKKA 4H8WL 5KAQF 1MJ8H 3AS3A 1LMKA 5K5YA 2QKIB 3JV5A 5D1QE 4RMRA 5CIPB 3L9YA 3T4YA 3O9WA 4FQIH 5B4MD 2YPLE 2NR6D 4LASH 5D1XC 3T0EC 2OMYA 2FTAA 2ZCLL 2YUWA 3HI6H 2NXYC 5I1KH 1ZS2A 2DICA 3U7WL 5LNDA 2X9ZA 4L4TA 4ZXBC 3TIEB 2DI8A 2F74B 5H4ZA 4LL9A 1U8LB 3CSPA 2IGTA 2XXCB 4LGSB 4XNUL 4G6FB 3UJTL 5CF3A 1OARL 3GMQB 1QRNB 4NAJA 1D5XB 1B0GA 3MNDA 4MSWB 4CN4A 3SDYL 2VSDA 2X4RA 4OD3H 4ZOEA 4PB9H 4YXHH 3DGDA 3Q13A 2QPSA 4TNVK 3CSYA 1YMMD 3SCMA 2GJ6D 5C07D 4ONFL 3WNMA 4PJ9D 1H15A 2BP0A 2ZCHH 3JBG7 2VXQH 3HR5A 4KI5D 1EUUA 1VACA 3H3KA 1XEDA 3IETB 3OF6D 5E2WH 4C56A 2VQ1A 3WENA 1D5IL 3CFBA 4RGMB 1W0WA 2Y7OA 4P99A 2W0KA 5JTWA 5KANG 3S37H 1AD0A 3ZX1A 2EUWA 4QXVA 2JK5B 3DOSA 4Z3EA 3FONB 1KYDA 3P11L 4RAUA 3WKPA 1EV2E 2WCPA 4CU6A 3D51A 1PD6A 3KHQA 3SPHA 4NERA 4ALAH 1QTSA 4CKVX 4KJYB 3FRPG 4KQ4L 2GC7C 4ZMAT 1PZ5B 4G5AA 3CVHL 5FDYA 3BUIA 2HT3C 4Z7UB 3SKMB 3MCKB 5BRZE 2DMBA 3FRPA 3MV7A 3PNRB 3D85B 4GS7B 1KPRB 2BP5M 1IC5L 1OE1A 2XTJB 1KFAH 3QISA 3JTTA 4UOJA 4KV5F 2F15A 2KS0A 4H0LC 3WIIL 1KGWA 3HNVL 4UQCA 3GPEA 2AK4B 1TZHA 5F0LB 3SQOH 1RUQL 1HTYA 2WBWB 4R6UA 3AFLA 4WUUA 4BWUA 3V4PA 1R9FA 3CSBA 4F9LA 2F0CA 3QZLA 1VAHA 3Q2LA 4OB5H 4FEIA 1FNGA 3BYYA 4Q9BA 5LQBH 1CFMA 2ENSA 4DGWC 4IDLA 3MRMB 5SWSB 3SODB 5CJBA 3WNIA 4BFEA 3LMJL 4Z7VA 4BRVA 3UEQA 1OQXA 4N0RA 4YLQT 2NZ9D 2ZKMX 1JHKL 3SGKA 4WW2A 2I7OA 2W0LA 5I8EA 3IGAA 2MCAA 2X53A 4LARH 2EDEA 2LU5A 5KBLA 1IEBA 1IKNA 1DBAL 4HLZG 4FI8A 4WHDA 2HPTA 5AVVB 1KWKA 4OFPA 1BMZA 1OAKH 2CRMA 1NM4A 2X4OA 3G08B 3AREC 4PJEB 1J1PL 5E8NA 1CGUA 3FUIA 5BOPA 5ID1B 1QHQA 4JN1H 3ULUF 2R23A 4GQPH 4H2AA 3GHBL 1J8HD 4H40A 3FU0A 2C4FT 2CHNA 4XMWA 3UEZA 4ZMTA 3GEWB 3ATFA 3E0GA 4KRPC 3S3CB 1G0DA 3SYOA 3WKML 5MEOA 4AZUA 1YC7A 3H1ZA 4R84A 2GBAA 4H8PA 1MI5A 5HGHA 4HEME 3CSGA 4YDIH 1HX0A 1OAQH 4FG6C 1CE6B 1N3NB 3WY1A 5I1GH 3EYOA 5JLZA 2MNJB 2Z0BA 1CWVA 3H3PH 1FL3A 2X88A 2C3GA 3QEHB 3BEWA 4YHZH 4X5LA 2FUQA 1SXCA 1Q0XL 2PMZA 3GPSA 5ITBH 1NC2A 1VGKA 1OQOA 5KBNC 5D4IA 3W2DH 5HYSB 2I26N 1XZWA 3EO1A 1CR9H 1G7PB 4KBPA 1RZ7L 4W4NA 5D6DA 3RZCA 1B4LA 4E5XB 2PTTA 3S6CA 4ZQTA 1BBDL 5IM7B 2XN9B 4I88A 5F9JA 4K5LA 5DEJA 3F7RA 4RFOL 2ZXGA 2APFA 3N04A 1T20A 2C3VB 5J06A 2XG5A 2L04A 2OMXB 4XT1C 3PIQA 4MA3A 4AQAB 3WNNA 1QUNB 3VAEA 5EIIB 1JPTL 1MFBL 1BV8A 3B8YA 3N43F 4GFXA 1U8IB 3SBQA 1FFNB 1H0DB 2VLRB 3UBHA 1NBVH 5IJVB 2CBOA 4M03A 4QHPA 2K9FB 4OTXH 4N3UA 1UTDA 2GJ6B 3MRNA 4KK6C 4MQTB 4ICWA 4KKPA 1CLYH 5E2JA 3VFUA 4KJPC 1ADQA 3H6AA 4EPSA 4OJYA 2Y36H 4MJID 2WJ7A 3ALXA 1N2RA 3GSOA 1GW0A 1EVUA 1DR9A 2MIZA 3QFJD 2HWZH 4NQXB 4E41A 1PD0A 5D1ZA 5EG6C 3VG9C 4HX1A 1C5BL 4YGVA 4JG1H 3MJWA 1SJXA 5MENE 4PMFA 1JNLH 1LK3L 3G5YA 4MQXD 1NGQL 3DURB 3OAUH 3EYFB 3X12B 3CN0A 4N5ED 3E6HB 4UTBA 3DHUA 1BAFL 3FFDA 4XB8A 5DI8B 4CMHC 5DJYB 3FUJA 3SBPA 2M2DA 4P3CH 3ZHLA 4Z7UE 2UVFA 4KGLA 4KKCD 1F11A 4B0MM 5BS0B 5HDBE 1CB4A 3FRUA 5L8LB 3BP7B 4G6KH 4JO3H 4KY1L 2AV1B 2J4WH 1V7MH 5CGTA 3U25A 4YPGB 1IBZA 3D9AH 4GQ9L 4PRPD 3LPGA 4WI7A 4BHUI 3CCHB 1I8LA 4N0FB 3D39A 4AEIH 3SDDB 2A6DA 4OLWH 2W5PA 5KVFE 3R06A 2NY4B 5D7LD 4DP6X 1CGYA 4EN2A 3QG6B 4OLZL 2R29A 3DJ9A 4UT9A 4WNQA 1DVXA 2XIIA 1JPFA 2DQTH 1VSCA 1ACZA 4UU9A 5AG9A 5CIPH 4JM0A 3D3VD 3RHWF 3TFBA 1LQBC 1TQBB 5LO7A 2VERA 1JMZA 4BSWA 1QWHA 1P4LA 4JRLA 1O6SB 3A67H 4PREB 5EUOB 5T5FH 4JM2C 2KC0A 4ORGB 3S34H 1BZDA 3T5WA 4AY0A 5C9JB 1MHPH 4Z0BH 3FQ1A 3FRUB 1OTSD 3EJZD 3NAAL 2CPUA 2D31B 3PWJB 4UIKH 5E1HB 4YUEL 2B1AL 4GRLA 5DJXB 5EZLA 7FABH 1AH1A 5I66A 2G60H 1BMGA 1RMFL 2HN7A 2PR4H 3EKCA 1K4DA 2VMCA 3FUNA 4Z23A 1FNGB 2DEXX 4JB9H 3LNHA 5HBBA 2EAEA 3BUYB 1IRAY 1E27B 2DBJA 3VSTA 3O4LD 4F20A 5F0PB 1CI3M 4I7ZC 4IS6B 4M5SA 4F7PB 4YS4A 1FYTA 4Y5YB 1MHCA 4MTMA 4CA4A 1T2XA 2IAAC 4JW3A 1E9PB 3D85D 4Y19A 3GB7B 3ABLB 2HUHA 2VDRH 4HUUB 2ZNXA 5F89A 4LVNB 1FORL 4ZUSA 3AY2A 2EVJA 4JY5H 5F2FA 2X4TB 4OIAA 4KX9A 4NPJA 4BYHA 3LPPA 3NTCL 3UMTA 1TJXA 4KKAD 1CXLA 2E7CA 3TP4A 4LSUH 4S2SA 4ZMNA 1UD6A 3GXUB 2IAMC 1DFBL 4OM1L 4XR8C 3NDZE 4FG4A 4J3SA 3EJUA 4KKLC 4H8WC 1CYGA 2BXYA 2FJGB 5FYKE 2XG5B 2BK8A 4Q7DA 3FCGA 3O2DH 5IG7B 1BFTA 1D9KA 3BAYA 4MGXA 1EVTC 5AAWC 1X7QA 4U1JA 4YN3A 3I2CL 5HYJD 5F89B 3HAEA 4MAYB 3ULVF 3DUSA 2E46A 3CLEH 3GSWB 1GY2A 3V0GA 2D0GA 2BRQA 2WWMD 2QSTA 1Q9OA 4MNQA 4TULH 3N0AA 1G1OA 3NABL 4JHWH 1BLNB 1CVRA 3EHBD 3FB6A 3KDMB 1DQQA 3CZSA 4ODVH 1NQBA 3HI6L 2D4DA 4KFZC 4U1KA 3GSWA 4CVWA 2ERJC 5HYSA 4MSWA 3ZK0A 3LKPA 3EYUL 3LRMA 2B15A 4FZ8L 3QI9D 4U1HB 1OARH 4ZQKB 2W38A 4Z7OB 3TBTB 4IQHA 2YOCA 4B6ZA 2EDBA 5GJSL 4I1RA 4XP6L 1ZV5A 3VE0B 4CUCA 5JPNA 5IIEB 1P6WA 2LR4A 4K3EL 4JJ5A 1P7QD 5EBMB 3GMLA 3TWYA 1UWXK 3BQUC 4GXUM 4L4TD 3C6SB 4Z7WA 5DZOA 3HAEB 1GCFA 5I1LA 1M53A 2Y1ZA 4HXAL 3UG4A 5HGHB 3GMPB 1A65A 2OA9A 1T5WA 3LS5H 2DB8A 3H0TA 2BNUA 2GEEA 2FAUA 1DQTA 5C0AB 4P4KA 1QKZL 1W72L 4PRIA 5CO1A 5IFHH 1KZQA 3IXTB 5KG9A 5A7EA 1N6VA 2ZZUT 3DYMA 1ZY9A 3TOPA 3B7TA 2GHWB 2GYSA 1UVQA 2OZ4A 2H6UA 2XTLA 4G8GD 2EIEA 1RIHH 2NUPB 3K46A 2VXUH 1ZVHA 4O02B 1PZDA 1JZEA 1G1CA 5FFLA 1GRWA 4OLXL 4G80A 1E4XH 3UACA 4MD5B 3R7QA 1CJYA 1YMHB 3GS4A 4MRBA 3AG2B 4R0LC 5A2CA 4FN0A 1KIPA 4RVBA 4X2UA 2ICWI 4YEFA 4TQ8A 1U8OB 1FFOA 1QFWI 2IPTL 2X1QA 4W6YB 4YIQB 3RVTC 3NMEA 5AVTB 1MJ7H 2ZUSA 3LYRA 3TNNB 2HN7B 5AZEL 5B38A 1NEZB 3VFGL 3ISRA 1A4JA 4A6YL 3FB5A 5JQ6H 1AE6H 1GYVA 1TTRA 2WD0A 3S5YA 5J1TC 1WISA 2WKLA 1BZ7A 4IBZA 3S96B 2ENYA 2B59B 3MRQA 4AL8C 2GJ6E 4QDGA 1BFSA 3DX9B 3GBNH 2EABA 1S7UA 4L0PB 4QRTA 4YE4H 2E9WA 5E7BA 1INEH 2QHRH 4HIPA 3WUWA 3LZPA 1CK0L 1SUJA 4KTDH 4U3SA 3B1UA 4X5RA 2ICWJ 2EO7A 1BZ9B 1XGYH 4UAOC 3PAYA 3UTSA 3LZRA 4M7ZB 2YFNA 1LYQA 1OT1A 1KEML 2XN2A 2DQFB 4BFGA 5JA9A 2FSEB 3G6JF 4CC0A 4NUJA 5C0CE 5CZRA 4FJ6A 5TGBB 4ADIA 4CSZA 2EICA 1FF5A 4ZFZA 3IS0X 5IZ7A 1EJ6A 1MLBB 1HEHC 5H37H 2WVSA 4PYGA 4YDKH 5BMFL 3NGBC 2PWEA 3WHE0 2NRDA 1XIWD 2XV0A 4PJ7B 4ZZKA 3ZQ9A 2OTWB 3CVIH 1Y1DA 5BVPL 2B20A 4M61B 1G6VK 3GZQA 5I1GL 1KXTA 1UD8A 1OAQL 3HG1D 3VI3A 2AI0H 3JT0A 1F4HA 43CAB 1C5CL 2YD4A 3V52H 4R2GB 1C5DB 4P2RD 5ICXA 3QH3A 3GRWA 1RFDH 1T4KA 3IMTA 2QKSA 4S1QL 5D7KD 1AANA 2LAGB 4R2GC 3PV6B 4U1GC 4MHHG 2BVPA 1F4XL 3V5HA 5IQOA 4E0RB 2HJLA 4LLAA 2JVUA 2ATKA 3IE4A 4JZJA 3EUUA 2IFFL 4MBOA 4NOFA 4HK3J 1JYWA 4OFDA 4UTBL 1N4XL 4P5TD 2R1YB 2JMRA 4YJZL 1PDKA 4RMSA 3RB5A 1OAYH 1G7QB 4FD0A 3ETSA 5JXAL 4XXDB 3DETC 6CGTA 1WFOA 4UYQA 3KYOA 5F9JB 3BP6A 4YO0B 3GM8A 4I3SL 3EJYC 3FFCD 3UCQA 2EIZA 1K4CB 1SXBA 3GBEA 3NVQA 3SDCD 4EDWH 1UOLA 2R29L 4G6ML 4PWGA 3VXQB 3G5XA 4PLJC 2GITB 1HDMB 4IRSD 3SDXE 4E5XG 5E9DA 1KGXA 3FCTB 1JZ3A 4DH2A 5LN4A 4Z7QE 2ZCKL 4X8CA 4N9OB 3DX0A 1K5WA 2G5BA 2ZP8A 3CLWA 3N0PB 3QUKB 4PGCA 4Q6YA 3DX1A 5CUSL 5TJWK 3RVWD 4LSRH 5IREA 5F1NB 2QQNL 4FFYA 4QTHA 2B16A 3VNYA 2WO3B 2FIKB 5EU6D 1MPAL 2K6WA 2Z0UA 7PCYA 3LD8B 3BLBA 5IB3A 4NM4L 1V54B 4M8VA 2ARJA 1KB5B 4QCIA 3WUWG 4TTDC 1EDQA 4YHOH 3ARXA 2CKBB 1XMEB 1CLZL 4WI8A 1PYWA 1IIKA 2CO2A 4FP8L 2J88H 3QQNA 1VB9A 3VYNA 4AMKH 3F7LA 4L8SB 4NHUA 5GGTH 2Q8BH 2XQYA 2XWDA 3TV8A 1KELL 3MLWL 3O8XC 4KZDL 1A6VL 1DQJA 1MIEH 1OSYA 3KPMA 1T0MA 2CLRB 1L6XA 2BNUB 2BHUA 3VVVA 3OMIB 1LJMA 4NCDA 2X9WA 5AL0A 1MW1A 5LDUA 4G6KL 6FABL 1QG3A 1D7DA 4M1DH 1DQJB 3D9AL 4GQ9H 2XZCH 2VZSA 3IS1X 4O9HH 1J1OL 3S4SB 3K6SB 4LESA 5DURD 1YPZB 3N41B 3D09A 5FM5M 4X9BA 1OSZA 1W91A 2QSVA 5F3FA 2H5UA 1MCJA 1BXAA 4K7PL 2PUQT 3D2UD 4BCYA 2YD6A 4QRQA 5IB4A 2DD8L 3DURA 3IRZA 3CFBB 4YXLH 4PTUB 1JS4A 4EZLA 3V4VA 3OR6A 2E7BA 3B7UX 4UV4H 3MAWA 2VXSL 3ARBD 5DVPA 1U58B 2AP2A 4JPKL 4E42A 4BFFA 1JV5A 1S4IA 4UTAA 4XCCH 2Z31B 5E08H 4LKCB 1PKQA 1AR1D 3BUDA 3B2UD 3P3UA 4WVRA 1QR1B 2IG2L 4JY6A 3QRBA 3IF1B 1NFAA 1BQUA 2A6KB 3WFEH 4B9GA 4YVNA 4B7LA 4IDJH 2GABA 3GZKA 1BQHB 1LEGA 4MB4A 4TSCH 1KXTB 1T5KA 5C0BD 1YJDH 2EEBA 1DVFC 1AQMA 3KWWB 3WE6A 3MJ7B 4WY7H 2IPKB 2ITCA 2CHDA 2VR8A 3MOQA 1WD8A 2D4FA 3B9KA 3U30C 4NXKA 4Y1SA 3EG9A 2G75B 3P9LB 3NJIA 3ZDXE 1I9JL 1KCRH 2EADA 4EQ2A 1J7VR 3ZRFC 3BKJL 3OC5A 1CICB 1VGEH 4YOKA 2O5XL 3FRPB 1KTJA 2VDOL 3EBHA 2IAMD 1QSZA 4NC1C 4FQ2H 2YN5A 4Z8FL 2DM3A 3UC0L 3GKZA 32C2A 9PCYA 2J6EL 5H94A 4J3OD 1EEYA 1W16A 4D0CA 5CEZH 2VRKA 3LS4H 2JJWA 1T2JA 3ULSA 1IAIH 1MELA 1A7QL 1HAWA 1PMYA 4K94L 1MNUH 4N28A 5F0JB 3BIKA 4Y9EA 5EUKA 1PFCA 1T5XB 5FYKL 3NA9L 4YFEA 4LCIL 2EH8L 2FBJH 2X70A 3SPCA 4TUJB 2EVFA 2QVIA 2QPUA 2VL4A 2YWZA 3GSQB 2AMUA 2FX8H 3C08H 5I1CH 3WTSA 3SO5A 4UNVA 1AXTH 4X4XA 5E6ID 5KTEH 3IDJB 2ATPA 2APBA 2J72A 3KLQA 4MB1A 3STBA 5E6IA 5GRWA 3QEQA 3TZVD 4CVXB 3IAPA 5HHNA 4N2IA 2VR7A 4HGKC 3GZOA 2H47C 2VR3A 2NY7L 3FOMB 3GMQA 5DA0B 2YBRB 4LLQB 5BO1L 1AYOA 2UY6A 4PJ8A 5IVZB 4W9KC 1JPGB 4D9LH 4AH2A 4U0RC 3L7FB 4LLVB 2J43A 3JWNE 4YR6B 4BFNA 3MLUL 2R23B 2R2EB 3I6SA 4OGYH 3T8XA 3OKOB 5C0IA 4NENB 3ZE1E 2FO1A 1RZ8B 3I85A 3W9DB 1WGOA 5ISZB 3QUMB 1NMAH 4X5WB 3WN5A 3MNWB 3NZUA 4IIQB 3SDXB 5C97A 1RIVL 3H0TB 1E8ZA 2VDMB 3ZDZB 4ACPA 4FMKA 2KHAA 2J5LB 4KX7A 5T3ZE 2R8SH 3QIUA 3S98A 2UWEE 1TYEB 4YO0A 4UI2A 4L5FH 3T0VA 1FRGH 3WLBA 2DYRB 4P2OC 1OB0A 2BIQA 4CC4A 4MDJB 4JZJC 1B3IA 4XXWC 3FCUB 3RIFF 4KV5E 3FB7A 3GIVB 4NQCE 3MCYA 4D7BA 1XO8A 3QRLA 4NKIL 2VGLM 3KHOA 1QFUH 3NIFB 1NBQA 2WM0A 3BZ4A 1A6UH 4JQXA 4U4BA 1IGIL 5FKPB 3ZMRA 2ZUVA 3OKDA 1X4YA 4QIRA 4A38A 1WZAA 4PRAB 4KKQA 1U8QA 3KDPB 3LRHA 3DO4A 4OZHA 4TLTA 1MJUH 4OJFL 4KAQL 2ADIB 2AEPL 3DXAE 1KPVB 2NXYD 4HUWA 4PJGF 1QHOA 1JI1A 2K0RA 1UXSA 2COVD 3PNWB 2QQKL 2ZWZA 2H1PH 4KTEL 1T4WA 4A67A 1CLOH 3KL0A 4XBPA 1JRHL 1RZGB 1U8KB 1J9CT 4KKRA 1UYWL 4XRCA 2L7UA 4GINA 4CMHB 4O4YH 4K7PX 5C08E 1QHPA 4A7UA 2AQSA 4PSRA 2AEIT 1Q94A 2WXIA 3GXMA 4EN3B 4JCLA 5E24E 2V8LA 3L9EA 4MFHA 1NCJA 1R3HA 5KG9B 4PJDA 2I5YH 5CJ5A 3HZKA 3US0A 4PG2A 4S1RL 1BBJA 1J12A 3BFWA 3FQRB 4FQ1L 2BHFA 4HWBA 3BUTA 3MXWL 5LB1A 2YK1H 1JYNA 1KPUB 4CAGA 5MEPA 4YSAA 4UM9D 2VDQB 4JFQA 4K7PH 2DTMH 5HGDA 3ZE0B 4AITA 5CGMA 5L2KB 4YXLL 4NUQA 3VI4E 4LP8A 3PL6A 1RCYA 4AYMC 2FGZA 4K7FA 2B2XL 3LDBC 5EU4A 3S35L 5FECA 1CMOA 4MLIA 5B21A 2OMBA 1KJ2L 2A1WH 2QL1A 3OB0K 4R83A 3ZSSA 3NZHL 4XZUB 3O4OC 1KDJA 3PWPA 1OT4A 1JUFA 2FL5A 5I74C 2Z35B 1F45A 1VEMA 2JIXA 4L8SA 4LZKA 2ZJSL 3HPJA 4PS3A 1XB6A 1QR1A 3BT2H 4BKLA 1TZOA 3B2VL 4C55A 5JHMA 1BVOA 5IVXA 3WXVH 3R4DA 3ARZA 4C56D 3MV7E 2CIKB 1T0PB 4R0LA 3MRBB 4HU2A 1RLBA 4X98A 1L7TH 3HUJB 1GTFA 1EQWA 3LV3B 4PJDF 2WVVB 5LXGL 1F42A 2AGJL 3EZ8A 3SHSA 3UPRB 4MA8H 1VGEL 2JTYA 4NKQB 3UJIL 4E36A 3KBPA 4YEEA 1OCZB 5KJRL 1UM5L 2JXMA 3ULUE 4LPYA 2FO4A 1UD2A 3MOBH 4XBEL 3QULA 4W9DC 2AXGA 3MROA 2PNDA 1CGTA 2ICWA 4KKNA 4UOW1 1PX3A 3BP5B 1QSEB 3NYKA 3KLKA 2B4CH 1I1AD 4LSTL 5FO2A 2IADB 2DJ4A 1I1CA 3W11C 1CFSA 2H41A 3S48A 4QF1A 1JWSA 1IVLA 3X17A 3H4HA 1RUAH 1YEFH 2E27H 5JMOC 5AALA 4QT5B 2FQGA 3EFDH 5K33A 1C16A 1IARB 3GB7A 4QJ4B 1A1NA 3E6FA 3U1QA 4WAFA 2MH4A 3PAZA 5K59F 4ZMXA 4PD4K 3CQFA 4AMXA 1BXXA 1PDKB 3TV3H 4UV4L 3L2NA 2EDNA 3P1VA 4IRZL 5K93A 3QORA 2FB4L 5G55A 4K71C 4HKJA 1WICA 3PABB 5DWUL 1A7RL 3FQXB 4HFWA 4XN2A 4DP2X 5D71L 5HHPA 2V37A 4JG5A 1SOSA 4OVUA 4WKXA 2NXZC 4HKJB 3HHSB 4YVUA 3VACA 3VFOB 1NA8A 4YHIA 3R18A 3SDYH 1FNEB 4XN9A 3RFRA 4JG0H 3SSGA 1A4CA 1H6EA 2JCCA 4Z7VE 1HWGB 3BQUB 4WJ5A 1MIML 2UY7B 2Y7LA 2CK0H 5EBGA 4DGVH 3DC0A 3FQ2A 4G6FD 4MNQB 5EEZA 1IFHH 2FWOA 1UACH 3LEVL 5EU5A 1TTCA 3ARDA 3NIFE 1ZVYA 2AXFB 1CFNB 2GUOB 1H8LA 4G9DA 4JPWH 4NOBA 2D2CC 2J1XA 2VAAA 1KCUL 4M8QB 5CSGA 4GW4A 4OCSL 3F7VB 2F7RA 2OMTA 2QPEB 4PB0L 1Q1PA 4W9FC 4IOIB 3EOBA 2AJUL 5GGVY 3M1BA 4HGMA 3OMZA 1DBKH 1Q9LB 2C34A 3GSXB 2RCSL 3TBYA 3VFPB 2UXTA 2BZDA 1CDIA 2JJVA 1T04A 4GRWH 5EBMA 4PJ7F 4A6YA 1Z5LA 5DD1L 4KNUA 1R0AL 2YGVA 4WJ5B 4X6CB 4Y16C 1P5VA 3V7MA 3KR3L 3Q7JA 2A7BA 5SWZD 3OXSA 5I9QB 3S88H 2FJHB 4GIPD 4TV3A 2ZXEB 5HGBB 3LN5B 3W9EA 1YHPA 5DK3A 5HHQB 3LZFL 3P4OA 8CGTA 4KI5E 5AOJA 2N0MA 3BCDA 3QJQB 3QIBB 3RWGB 5DVNA 2DWDB 5IHUH 4LCWA 4MD5A 1U8NB 4GKNA 1CYWA 1G94A 3SY6A 1B4TA 5L2KD 3VX0A 3RVXC 1T1ZB 1T6WA 4GO8A 3GSXA 5PAZA 3SE3A 1ZS8B 3HJEA 2NSQA 5KYXA 3VA6A 5LWYH 4NEHB 5KSUA 4GUQA 3MLTB 3V4VL 2YK1L 5D1ZI 4R7NB 5EU7E 4H5SA 4FQXD 2GK0B 3NFSL 1I8IA 2X1PA 4BKTC 4JM2A 4F7CB 2VAJA 3FQTA 4JFED 1XF1A 4JANB 4LSPL 2QTVA 5ICUA 2ZD0A 4BBWA 3IU3B 2CRZA 2DTSA 5DS8B 5E8DH 3KPSB 3PE9A 2Z31D 4MKTA 4PREA 1CD0A 4V11A 5EBLA 3HLAA 2X4TA 2P8LA 2FQDA 2V17L 3HN5A 1HKLH 1Y6KR 4NQDB 2DWSA 4UT6H 4YH6A 1TQVA 3PGCB 4OZGF 3IMBA 2DLGA 3S0PA 4G7YH 1X5MA 3H2WA 4UWQB 3G6AA 1IKFH 4EN3D 2A9DA 1CIDA 1A9BA 2VMEA 2D7NA 3LH8A 3SJVE 2JB5H 5EBWB 1PF3A 1WIOA 4JKNA 1BW8A 2AV1A 4M5YH 4TVPL 1UG9A 3VYOA 3KYNB 3ETBJ 3V6FB 4OUUB 5BZWB 1ZT7B 1UFGA 4A2FA 3HE7A 3BH8B 1ADQL 1AQKH 3FO9A 3HI1A 5BOZG 4F9PA 2W9DL 1N5AB 1QSEE 4RETB 1T89C 2G2RA 3ZBMA 2AEQH 2H1LM 4W9HC 4BELD 5JW3H 3EZJB 4PJCF 4CVUA 1AD9B 3II2A 4AGNA 2Y72A 2WB7A 4RAHA 4G7VH 2ENPA 1I3VA 4LPVA 1UB6B 4XCNA 1P4LB 1UC6A 3M8OH 4IMLA 1BVZA 1J0JA 1NGPL 3J8F7 1WAAA 2VLJA 4NM8L 1RZ8A 1I9IL 4WI5A 1H3VA 2X0WA 3B37A 4ZO9A 3WD5L 3WO3B 1NAML 3B8SA 4MDRA 2WLJA 3PHOA 1IJ9A 4PH8A 4HJGB 4CILA 1CGXA 3B7SA 5DR5H 3CDFA 5GZNA 5IVZA 2Q87A 3FAXA 3DK0A 1DJIA 3TZVB 5DMKA 1OP5H 1N18A 5FOBB 4XHJC 3GNML 3HMWL 2R2EA 3T8XB 1I85A 4L3ED 2EDYA 3KM2A 1EWHA 3VXMB 1UM6L 4ODWB 1J1PH 4LQFL 4MNHB 4L3EE 4ANKA 3P2TA 2P80A 1R47A 4MCYB 1ZRUA 1SN2A 2EE6A 4R4FH 3RZCC 1OXYA 3FU7A 2R0LL 3GMRA 2VTFA 4CSSA 1H3XA 2XPYA 2XVLA 4N0UE 1I1AB 4UANA 3IDXH 5DYOA 4HUWB 2XA8L 2ZKYA 1AQ8A 2CR6A 4NUGH 3L3IA 1BZOA 3APCA 5EU3B 4Z77B 1HILB 3VRIA 2YXMA 3VB9A 5HHQA 3KVQA 3ZYJA 4UUJB 4A2GA 3T77B 1A7NL 3IFOB 4JRYB 3P9MA 2AV7B 1I3UA 4EIUA 4LSVH 1ILUA 3BKMH 4X8JB 5EB9A 2WBJA 3CZEA 1KGYE 1NCCL 1CFNA 2GUOA 4K23L 5CNHA 4PS8A 4WK0B 3W3BA 3OGCA 4H88H 5L8JB 4PQXA 3DSNA 3QXAB 5IMOB 1M3JA 2QQLL 2W1NA 4NBZB 1NGXA 4U1GB 1HK6A 1F3JB 1D2OA 2XKNB 3OJDB 3GUTA 2IH1B 4ZPVA 5JIPA 2O5ZL 1CZ8H 4PJAB 4Y8DC 2EVIA 4FFZH 4K4KA 1I82A 4WTXA 4DVBB 3EADA 1BGXH 4YPGA 3BPCB 1MCOL 3WAKA 5DC9B 4YUEH 1T0NA 1JWUA 3WFCH 1DUZA 3V0WH 4KDVA 1RUKH 1UXSB 3MYJA 4N0CC 2XUWA 1A6WL 5LLIC 4PGCB 1M6OB 4HUMB 2QGEA 3E3QC 2K7QA 3QXWA 4P2OB 4WW2C 5DJ8B 5AKRA 1L9TA 1UT1A 4QMEA 2HUEA 2XNAB 3CX5K 5IB3B 4NNYB 2KT6A 2YMOA 3BP7A 4KRPB 2NY5C 4L4VA 4RFEB 2WWKO 3D12B 4JFTA 1JPSL 5EV7A 5F7HA 4ZOBA 5FUZL 1LK2B 2P48B 5DJZA 4JFZH 5D5MB 2APXA 5HPOA 4NUMA 2RGSA 4X7DC 3VD9A 4XVUC 5IESH 5ANME 3P73A 4ZNCD 4WO4B 3MA9H 2CDGA 3IWVA 3AY4C 3N1GC 3OVUB 1MCRA 4MB5A 5LBVA 2X4QB 2VDQL 4NZUL 2FATH 4MZ3A 4BE5A 2FL5B 1FNFA 2XWBB 5EHFA 3GSUB 4QOKE 4NQXA 5T3ZH 4BHUA 1R3IL 2D7TL 5ESQB 2ZAHA 1NEPA 1M2OA 4JFSA 3INUL 4OZ4A 1DQKA 5DTFB 1FVDA 4UOZA 5BJTA 3AMKA 2VDRL 5FCUL 2HWZL 4HETA 3W11D 4OM0H 4GSQA 1DVFD 3QG6A 5AW1B 4K3JL 1E2ZA 1R24B 4DKAA 2JQMA 4OZ4B 4JG1L 1IIIA 3RA7L 2OL3H 2R1YA 3ZKNC 1CT8B 1KBKA 2B77A 4JL1A 2HH0H 4JKKA 4DK6A 2C3WA 3QNXB 3PWPE 1TITA 1TU2A 4BINA 5FKAA 5KVGL 4JO4L 4CSTA 4EJ1C 1KXQA 2BVTA 4JKPL 4W93A 3OZ9H 2YD8A 1TIUA 3QVAA 4PRHB 2R56H 4ODUB 1IGCH 1OAJA 3HC3L 1SXZA 3RNQB 1D7BA 1KCVH 2BW4A 4G1MA 4NKDA 3LV3A 5B7EA 1RP9A 5E6IC 1NJ9A 4ES9A 1TJGL 2CGRH 1T2QL 3MCLH 4L0ZA 3ZDYF 4G42A 1DBJL 4KZ0A 4XE0A 3O6FA 4LU5L 4R26H 3VXQA 4BFRA 5T5FL 1NM9A 2C9XA 2CCVA 3SY0B 2F61A 4G1MB 1YEEH 1ZV9A 3NRQA 4NKDB 2BY0A 1S9YA 1KLUA 5MP6L 4U1SB 3L7EB 2LTQC 4KRLB 4WZ9A 2EZ0D 2I9LA 5AUMA 1N70A 2WOYA 1XGRB 2AANA 1WWBX 3UTSB 2BM3A 5I1IH 4XOEA 3T71A 5JXAH 4MXVE 1C12A 3FU3A 2I69A 3BOVA 2RD0A 2XICA 3DPDA 3LQZA 1WBZB 4JMNA 3FN0H 1N6QL 4YL4A 1ZK5A 3QZNA 2AHIA 1RU9H 1P4IL 1FVEB 1KJMB 2A74B 1N9PA 2A77L 4X4YA 2VXQA 5I17B 1F4YL 5GGVL 3RUGB 3WJLC 2Y2YA 1E5ZA 1TJHH 1MFDH 4E9WA 2R1WB 1IEHA 5D9SB 1SM3L 4X8JA 1FP5A 2BSRA 2YFOA 3BESR 4M48H 1T21A 3IEAA 3PG2A 5DD6B 1SEQH 4IRJC 1H0DA 2VLRA 3LQAH 2XJKA 2DIJA 3QDJE 2O4EA 5FF6B 3R8QA 2Z6FA 3JZ7A 3HUJF 4PJBF 3GIZL 3L81A 1QLEB 1JGLH 3VXUB 3IGLA 3KPOB 5GGSY 3DV6B 1L9NA 3DJTA 3DOHA 3VFMA 1AOZA 2RCSH 4RSYA 3L9BA 2L4OA 4P2RA 1Q9KB 3NRPA 1JD9A 2P5EA 3UGUA 1A1OA 5KVFL 3V9CA 2BNQB 1BD2A 1KXVA 3CPLB 1GYWA 5IM7A 5C0DB 2OW6A 3EUDA 2ORBL 2VR6A 1BM3L 5IB5A 3AXHA 3MLSL 4MJHA 4KXCA 4Q2ZB 4WW2F 4XWGH 3MUUA 2DYSB 4G2AA 3V4PH 3MGOB 4FNTA 1VKXB 4FNUA 1ZVSB 3TJEL 1UH2A 4FXGC 4JO2H 4F8TA 4D8OA 3TZVA 1ZE3H 1PZCA 1CK0H 1TNMA 2NY5L 3BAWA 4EKXA 1LD9A 4S1SH 1UVQB 5BPPA 3VMOA 2EDMA 1P7KB 4P2QD 3PWUA 2CRYA 2LHAA 2WCSA 3NIFF 2B5IC 1ZTMA 4JHWL 3HTLX 4XO4A 3GMNB 1TZIA 2BVQB 3U0WL 3U82B 1WITA 4B9FA 1DSFH 4I77L 2MWCA 2OMVA 4Z7NE 3HLAB 3U4BH 4WCYL 3EGDB 4IJ3B 2W88A 1ZVNA 2E6QA 2UX6A 1SFHA 1OY3B 4OF8A 3T8MA 4FOMA 4L23A 1LO4L 1FFOB 1OTUC 5ANMB 4P05A 4JHBA 2AVGA 2Y7QB 1UXLA 4YSPA 5TQ0L 3JXAA 4GY4A 4TN9A 1QNZH 2W60A 3BD4A 4AEHH 4HMDA 4KY2A 4JREB 3ARTA 3MLTA 1MJJB 3IJSA 3Q8EA 4HS8L 3N6YA 4ONHB 5BZWA 4J3WA 4DHLA 2EYTB 1IGJA 3BE1H 4TUJA 1RIUL 3B56A 2FATL 3OSVA 4EI6A 3K6NA 1HU8A 1FZJB 2C4FU 3U83A 1DE4A 4UM8B 1ILSA 4BWTA 2BSTA 4WEUD 3TYFA 5CFHA 1CBVH 3KPSD 4JO5A 4NB7A 1SMDA 4BKLB 3W0WA 5AOLA 5GS1B 1H5BA 5TFSH 1BCIA 1MHHB 2NX5E 2VLMD 4PIBA 5F3BA 4ZD3H 4JHZA 4BEIA 3JTTB 1WO2A 1YNKH 3VRLE 3BPNC 3TT3L 4K8RL 1JGUL 1V10A 4OQ1A 3A0OA 4NX0A 2VC2L 1UB5B 3CFJB 4O2CA 3WI9A 4XO9A 4AX3A 2VN4A 1F8TL 1JVKA 1U91B 1KBBA 1ODUA 2IO5A 2XVGA 4XBGB 1E4XI 3RWCB 2WZ5A 1S5IL 2BDNH 3ZTNH 3NFPB 3VXTA 2CBQA 3FT3A 2AVFA 3S3SA 1MWAH 4J7RA 5DHDA 1NMBH 3GLAA 5C0JA 1U91A 5FUCC 2MNWA 2FEJA 4UTAL 5IFJA 3NGBB 4XHJD 3SO3B 3QDGE 2PYFB 2HTKC 1OP3H 3CH1A 5C6PB 3IN0A 4MMXA 4JVWA 4ZAKC 6PAZA 2R9HC 5BZDA 4MWFB 4QTIH 5CZXD 4N2OA 3TGXA 3TPUA 3VMNA 2G2RB 3BDBA 4BZ1A 3AZUA 5JYLA 1MF2L 2IMMA 4WGVB 1RK0A 3KWWA 2WLYA 3BGFB 3HB3B 5CJOL 4AK2A 4EVNA 4PJCA 1FI8C 4TOYH 2E7MA 3ROLA 2E9IA 3PGFH 4IS6A 3NJLA 4GMTL 4WU7B 4TRPL 1EBAA 1LP9A 3QYMA 3RTQD 4NZRL 1A25A 1DSWA 3ES6B 4PY8I 4U1KB 2Z93A 4C83A 5B7MA 5I1EH 1EHAA 3CC1A 5AVWB 3FFCB 3PHSA 2LU3A 1YY9C 2BIOA 3ZE1F 1XH1A 2UV3A 3B3IB 4F58L 4KZDH 4IOFD 3T0DA 3UGEA 1ZOXA 3KCPB 4HZ1A 4MNGA 5IJDC 4QHKJ 3VFSA 3QCUL 1FC1A 1SYVB 4Y5XB 2NQCA 3L08A 5E2UL 1CLZH 2P80D 1EZSA 1E3FA 2ZX7A 4U2ZA 1EZVY 3PP3K 3B6SB 4EI0A 5FO9A 3E1ZA 4TSAL 3VFRB 1E4HA 3WNKA 1NIFA 4JPQA 2P5WB 4LNRA 1UH3A 2VYRE 4NCC2 4M43H 2VW7A 4HQQL 2DDQH 5D7IB 4L3AA 3KGRA 2DEWX 4R3SA 5E6YA 4OFKA 3QNZA 3WEBA 2TRHA 3MUGB 3LB6D 1FFRA 1U3JA 1FFTB 2JQAA 1P7KA 3ULVL 5D70L 4Y5YA 2IH3B 3KBEA 3C60C 4L37A 5IB2A 4HIJA 3KJ6H 5TDPB 1OM3L 1FLTX 2FLRT 4HK3N 5KVDH 3FOMA 25C8L 4DNLA 2Q3AA 4UT9H 4KZEL 2ZQKA 4KHTL 5DJ2A 3MRFA 5GS1C 4FXKC 1JMXA 4OSUL 5IVXF 4APQB 1XCTA 5HHPB 4AH2B 2ZOLB 4NWTH 5DZPA 4CGTA 5SX4H 4HUNB 3MRFB 5CGYD 1W9XA 2Y06H 3S8GB 4RFEA 4O58H 2DQDH 3VVWA 1U8JA 4G8GE 4TPRH 3MRRA 2V8MA 4P4RB 4H8WH 2XLLA 5GS0H 3WJJA 1KBPA 2A4ZA 4NQTA 2CIIA 1ZD6A 1PZ3A 2R1WA 3I3BA 2KDGA 3BAEL 3P4NA 3K91A 4IOSA 1AGDB 1K6QH 1JNNL 1ETB1 4DVBA 2VLLB 4IOSD 3SCMD 5INDB 4DSYA 1WLHA 2WJ5A 4LEOB 2FWSA 2VABA 2JKWA 4TL5A 1YYLL 1AGCB 4PCKA 5F6HI 1CPUA 2H8PA 2Y6SD 3OHXB 1I75A 1PU0A 2F7OA 2DWYA 2WXJA 4JLRB 2WNKA 3O6MH 3MODL 5D1ZD 3WJMB 4I13B 3KPSE 1JD7A 3KH4A 5FV2A 5IIEA 3Q2NA 4G8IB 5AOKA 4A2HA 4LDLB 4D0BB 1ANUA 2FSDA 1G9NH 2N01B 2Y4SA 3JUZA 4JDZA 1U21A 1T6BX 5CBAA 1T03L 4ZTPL 3HE6A 4PRID 3KPRA 3RNKA 2AK4D 2BNRE 2ED9A 1HKFA 5AVZB 3RDTA 2NYYD 3QRGH 1IC7H 4A68A 5CGYC 3O2VH 2IBZY 5I6XB 1ITBB 5DT1H 3MTXA 3QAZB 3VX1A 4LKXA 2IAMB 4A7QA 5HI4C 1JV5B 1NCNA 3WS6C 5AWNL 3BRDA 2ZYRA 5CZVL 4P23D 1TTGA 4PJDE 4FQJL 2H1PL 3HAEH 4PRBA 3QNXA 2XHNA 5IFAH 4K8RH 5CZKA 2XDHA 4YGAB 2P5EE 1T2QH 3HG3A 3H42H 4LPWA 1SPDA 2C9QA 3QZWG 4JFVA 2Q1EA 2BCMA 4JRXD 4HV8B 2XXFA 3FSOA 4HFWB 4HWZB 1U58A 4FABH 1RUMH 3U4AA 2YPVL 3CXDH 4BSJA 2YMXL 3QDGB 3KEDA 4XCYB 3I9IA 1SDDA 3RWCA 3QIWB 2NLJB 2XKUA 5IT2L 3NOIA 2FHBA 1Q0YH 5C3LD 1OOAA 3QUMH 4GKSB 1LO0H 4GXVL 2VXTL 3IGAB 1NDMB 5JPMA 3EGSB 3MUHL 1U8MB 1ZA3A 3MV01 1G7IA 5D8JH 3TO2A 3ML9A 4XCFL 1U33A 2FWUA 4UT7L 4M6NH 3HC0B 1RIVH 1WCBA 3GSNA 3KWVA 4K73A 4DGUA 4GRLD 2EDDA 2YZ8A 4NJ9L 5IHZA 2E4TA 4JPIB 3MKKA 3ZDZE 3NIDB 3O0RH 4FKEA 1WA2X 2FHCA 4DN3H 3A6BH 5D5MF 4GRMA 1N5AA 4FERA 4NNXB 5GJSH 3EDFA 3NSYA 3LHPH 1SLWA 1P2CB 2J44A 3NESA 3PWVB 2PWFA 1CU4L 4XGZA 3NJXA 1IKOP 4G70B 4A04A 3CH8A 1AS6A 1H6TA 1YPZF 1HINH 3FSZA 3LEXA 3IM1A 4QTHB 5GGUB 3ATDA 3MLVL 3KJ4C 3KDMA 2WYHA 2CHZA 3GSNB 1FDLL 1FPTL 4KQ3L 2DWEB 1VFAB 4NJAL 4XAWL 5A2KH 2GAZA 3GXNA 1Q72H 4QPEA 5FB8B 1EZUA 3C5ZB 3ZKXB 1XAKA 3ZMNA 1CFQB 3PWLB 4QRPB 1BEYL 4M62L 4ENEC 2P1YA 3X3FL 5I6XC 1AHWC 2GEQA 1DEDA 3EJTA 3NTCH 3W56A 4LSQL 3V6OC 4LLUA 3G6DL 4NIKB 2WHVA 1MLCB 2C8NA 1YAZA 5DHYA 5FGSA 4OF6A 2XBDA 1U6AH 3WFZA 4JDTL 2ARJQ 3SBWC 4S11A 1FG2A 4Y5VB 3MCLL 5KVDL 3UO1L 3NP3A 4RSVA 1ZVSA 3MX0A 1OPOA 3FQTB 3U2IA 4ONGH 3L7FA 4LASL 1R3HB 3GUFA 1JV2A 5EMYA 4L2YA 3ARGC 4FG0A 4KO9A 4E2OA 1SY6A 5C0DA 1TETH 5F70A 1A9EA 4B9ZA 4V1DE 1HCVA 3E9TA 4XRCB 3QUGA 1EZVX 4HULB 1WTLA 2K1MA 2CPCA 2OMWB 3L3IB 3LVTA 2HVBA 4UIKL 1IJNA 4Y4FD 4Y5XC 5DSCA 5D71H 4UM9B 4OZFA 5GRJH 1DP0A 2ZKWA 3PGDB 2CXGA 1IGJB 2HKFL 1LO3L 4Z5RB 1R3JA 2X40A 3I75A 2DLFL 1NGYB 3L1EA 3MBWB 5I0ZA 4JCWA 3OV6A 2V4LA 3BJ91 4JDEB 5E4EB 4IGBA 43C9B 1OZUA 1FFNA 1XIWC 3KAAA 5CFAA 4LSDA 2CJUH 1F90H 2AJYL 1H8NA 1BPVA 4XMXA 1ETJA 3GSNL 3SOBH 4TVPD 4PJ9A 2VDKH 1QSFD 4WSJA 4NT6B 2WYIA 4PGBB 3VWJA 2Q3ZA 2ZUQB 3RAJH 3RWJB 5E03A 1GS6X 5CCKL 6FABH 1OB1A 1KENH 1BVKB 1B6DA 4O9HL 3WJMA 1DBBL 4R8WL 5F7EL 1Z3RA 3N1FC 4Y1TA 2WZPD 2YGNA 5DQ9A 3OKEB 3ZKND 1ZCRA 2YD9A 3ETBF 4HCGA 2BXZA 5SWZA 3VM7A 4N2LA 4N0FA 3VXNB 3CZGA 4P4RA 5DF0A 5KVEH 3Q2VA 1EAQA 4HC1L 2PYED 3RIAF 2OYPA 4X98B 1HHKB 4ZS7L 1AR2A 3SKNA 4W9EC 2H7WA 3FPXA 2X7LB 4B60A 1OKEA 1MRDL 1GL4B 3D8MA 3RTQC 1QATA 2QV4A 2E9JA 1CI5A 3M6DA 2B1HH 4YK4C 3SE9H 1TEGA 3FU9A 4QHUA 5E51A 3IPBA 5IBTH 1GGCH 2OR8A 3GI9L 3KVDD 4G3YL 4JZOB 1JRHI 3AVEA 4JM4H 5DQDL 5LGHL 4Y0GA 4F7TA 2BIMA 4U1IB 3O6KH 2ZX6A 4BH8B 2YN3A 2HB0A 5ABZA 1BWWA 1LO0L 2VDNB 4GXVH 2KZBA 5I30H 3FU5A 3LRGA 3QUML 2QHLA 3WKQA 4JKMA 2ZXCA 5DRXB 2P3YA 2EE0A 2YJLA 3FW6A 3J07A 4YPJA 1E65A 3N40P 3MNWA 3C8DA 4KI1A 2Z92B 1UCBL 5HI5D 4GUPB 1NL0L 4KHXH 1T22B 3MYZA 2OZNA 1DQLL 3QUHA 4O5LL 3KYKH 3O4LB 4HMEA 4PN6A 4ZMWA 4J39A 1YNLL 4R4FL 1AZCA 3QUXC 3ULVE 4D9QE 2HAZA 1XAUA 2DQCH 3C5XA 4GKLA 1ACCA 2H2SC 2AXJA 3HNTL 4ZMPA 2ITFA 2Q5BA 1ZLDA 2MOGA 1HCYA 5HHNB 3NPSC 2V9QA 4JHVA 5F71A 3BQVA 4LSSL 1DQIA 1O6VA 1D9KD 4L8BA 1FDLH 1FPTH 3QO1B 4Y5VC 4U1SA 5MERB 5I26A 5EN2A 3UZVB 3WDIA 3VXUA 4WHYG 4PG2C 5F7YC 4Y4HD 1WFIA 4F9LC 2X28A 4ZQKA 3V4VH 3VA2C 2XQBL 1HWWA 2M83A 4XPTH 1LEIB 1CDJA 4M1GL 3TTYA 4LVHC 5KN5B 4OCYH 2VLJD 5JNYA 4GW1A 4UTAH 1MFEL 5FXCH 2X4NB 5DSCB 1I3GH 1J8RA 2V2XB 4KTGA 4HBCH 2N0KA 1NGPH 5JLZB 2GVYA 1OEZW 4L4TB 5J1SC 1TJIL 4U3XA 1OGAD 5HDBB 3RUGA 3FO0L 4OIFA 5KSAC 3QJXA 3TBYB 3VFPA 4EKJA 1A6PA 2VWEC 3GBML 2AQQA 4HAKA 5E8EA 4LQ1A 2K4AA 4DP7X 3QDJD 3QSKB 4Y4FA 1TYJA 1BFOB 1WAAE 1IILE 3VWKA 2CK2A 1Y0LB 1PEWA 4GW4B 1JFQL 2FT6A 1INEL 2QHRL 3P40A 4QRUA 1BG9A 3L3OB 5EORH 5IMLA 4IRSA 1EJOL 4U1LA 5TQ2H 1UWXH 2ZXAA 5E9DD 2GJZB 5BJTB 3MFFB 2PO6A 2A6JB 2Q6WB 1I8IB 2TSAA 2W9EL 3TFKD 3FB8A 3AU1A 3VGGA 2V2XA 4P48A 1WF5A 3V0IA 2ZX9A 2B9BA 3UABA 3MRRB 5ILTH 3UJJL 2WK2A 1AMXA 2V17H 4JAMB 4QRPD 1D5XA 3VWKC 1L9QA 2MTAA 5KYXB 3MV9D 2F68X 3IRCA 4YNYB 5DUBB 1UA6H 1D7CA 3IF1A 4LCWE 1QSFB 2IWFA 3HRZA 3IRPX 3OKNB 2FEEL 4HIXL 4QRPE 1B6UA 3N85L 5AB9A 2Y07H 2F74A 2Q7YA 1I4FB 1YJDL 3ARFD 2ZYHA 1DL7H 1HXMA 5KSBF 3M86A 1GMIA 2ZWKA 4M6OH 3DTXA 4EXKA 4EUPB 5KYNA 4E68A 3UAJC 2E7HA 2RMNA 4YX2H 3QWRD 1L9PA 1EHXA 1L6ZA 3SPIA 1YPZE 4J3OC 1KLFA 4OCRL 4BUHA 3DX6A 2MCMA 2EEDA 4C57C 4LIQH 4L0YA 4G11A 2V7NB 4XNXH 3IDMB 5J12B 1OLZA 3T3ME 4JFPA 2P5PA 1PKQE 2BIHA 3PU7A 3QJVB 2VJ0A 3NN8A 3DX6B 5EOCH 1J1XH 1OB1B 4GNKB 1IGYB 4XNZB 1SVCP 1WHPA 3C5JB 1M42A 1S7RB 4F93B 4X6DA 1IEBB 5KW9H 1FA4A 2DQHL 3Q3GA 1G9NC 3LS5L 1QBBA 1YECH 3S96A 4N24A 1UGKA 4EIGB 5ID1A 4ZMLA 3P4MB 1AGFA 5FGBA 4LL4A 3RWHA 3MNMA 3O2WH 3SDAB 2X89A 4JRXB 2EINB 1NCDL 4XPFL 4NO3B 2IF7A 2A3TA 5A7BA 1LEKB 4M29A 3B9EA 1NGZA 1S9WB 3TM6A 5EBWA 2CIKA 4LCCA 1R4XA 5C2BL 3QEQB 4YXHL 4AV0A 1UXMA 4RA3A 2W65A 5DS2A 3BVVA 5HJ3B 4N86A 5J13C 4ZAKD 1MCWW 3W39A 4AJVA 1AOHA 3MRIA 3CFCL 2ZKHL 4K71B 2JI1A 4HT1L 3ZIMA 2Y9RT 3GSQA 3BGFC 4U1HA 2RAMA 3D52A 1LP9B 4QRBA 3S37L 4L3EB 3CUPA 3FSVA 3U6RA 5FW6A 2Q86B 1I85C 2L0DA 3KGSA 3I9AA 4XZUA 3RP1A 4DOHB 1QFHA 3SE4C 1SJVA 2DQFA 3DV4A 3VD5A 2ADYA 1SBSL 4WWKA 1GH7A 1W0VB 2EUXA 5KEZA 2EDLA 1L5GA 1XBDA 3FHEA 3L2MA 1D9KB 4UBDC 1KENL 4N90D 1KT2B 2GSIB 2OSYA 3ZHFA 1E3ZA 4OFQA 1VHPA 4W70A 3ZO0A 1A6TB 4FZEH 5EEVA 2H6PB 1IV8A 1F41A 2PTVA 1IAIL 2YD1A 3NCBB 3D18A 1QUNA 4FMVA 3HG4A 1I31A 3ZVVA 1DVZA 3HA0A 4X42A 5G5DA 1TCRA 1USQA 4ANWA 3X1FA 3TBTA 1HQ4B 1GY1A 3HZVB 4N0UA 1JZHA 1S5HB 2HLFD 1N19A 3APNA 4QGYA 1CTNA 2GBUA 2NR6A 4P46C 3QZWB 2NYZA 3HHSA 1JG9A 3KXFD 5DU7A 3PNWA 1M2VB 4XPHL 1B0RA 3ZZQA 4CN6A 5HHVL 3OQRA 3X1BA 1DEEB 1EEUA 5KBKA 3OKDB 4S0TD 1PG7L 5CD5D 4JM4L 3C2AH 5LGHH 3WLBB 2F54D 2FX9L 1NBZB 1E6JH 2VXVH 3CFQA 3P77B 3QEGH 2WZ6A 2AI0L 3ESVF 1KGUA 1KCBA 3UTTD 4EIBA 3QPXH 4XP9H 2R0LH 4M8QA 5E95B 5TTRA 1BJ1H 1D3CA 5IMMA 1EEZA 3QAQA 2I07B 3UO8B 3QQXA 4FCHA 3OLIA 2XBZA 2HFFA 3OG6B 4HKZB 4NUGL 3L4UA 1HHIB 3A67L 3S34L 1FHNA 2MPVA 5INDA 1M05A 2IH9A 3FYIB 1SLUA 3N9GL 1P53A 5AQ0A 5C2UB 4MJIA 2WXMA 5IR1B 2LLLA 1DDHB 1P1ZB 1FNHA 2XWXA 5FYLH 3SE4A 3W1ZA 4MX7B 4OZHE 4HIIB 1EFQA 5JXED 1NFDA 1I7ZA 3GMLB 2CDFA 4GSUA 4WV1A 3DBXB 4K9EH 4AL8L 3CX5J 4Q2ZA 4YC2C 1FO0B 3LNIA 1G7HB 5C08B 1N7ML 1RHHA 2ARJB 4J6RL 1T5WB 1AI1L 3QIWC 4QCIB 2EXYD 5IBUB 4PW9A 4Q9RL 5CP7B 2YXVA 1JDAA 4HGWA 3BWSA 2QV2A 3QJTB 1RURL 4XXCC 1I4FA 5I19H 4HA1A 4QHLA 3FKUS 1WBYA 4W68A 3FU6A 5DJYA 3WDJA 5JW5A 3K8MA 1ACYH 1SDYA 1KV7A 5D5MA 2EYRA 3VFGH 3H56A 3T0BA 3KPQA 3LRLA 4YGVB 1RU9L 3ARUA 3PWNA 4XB7A 3FTYA 4LRNH 2AABH 3EBIA 1QACA 2IDTA 4PRHD 1EDHA 1HHHB 2NW3A 5CLYA 5IK3B 3TO4C 3M7FB 3D3VA 2V9UA 2IANA 3TBWB 3FT3B 1NWPA 2EH7H 4DKFL 4PWIA 5ICZA 2FUTA 1XZ0A 3EFFA 1ZMYA 4NNPL 2OAAA 5E5LA 2NLJA 1KEMH 1U2HA 4LHUA 3H9SD 2OTPA 4B96A 1HKLL 2X3BA 4P06A 1ZLVK 1A6UL 4AQZA 1ZS8A 4H26A 1GSKA 3B2MA 2PP8A 4M93C 2PWDA 1QI4A 2ICEC 4YFDB 4M48L 2JI3A 5F96L 1S78C 3TBVB 3OHXC 2JLPA 2G0KA 4PJEE 5LNEA 2JJSA 2ITEA 2VMJA 4WY7L 3DUUA 3NCYS 2JB5L 1FYTE 2WXQA 3FXIC 3CK0H 2CLZA 1FGVH 2HRPH 5GGSA 1KN2L 4HUVA 4XWGL 3HNTH 1P84K 4I1NB 4JL2A 1NAKH 2WO2B 2LQRA 1A64A 5DEZA 1I1AA 5GHWL 3WSQH 2DIAA 4JPKH 4QUOA 4HLJA 3MJ9L 4AYFA 2YQ3A 5AW0B 2IV8A 3UBXA 2EIMB 4KK5C 1NTDA 2XZQH 1EFXB 4JO1L 4TSAH 4AW4A 2RBLA 1J5IA 3U46B 5DRWB 3SGEI 4PJXB 3A4AA 2Z7UA 1Q0XH 2AAVA 1CDYA 4KTEH 5T5FA 2MQGA 1CL7I 1M7XA 3NZ8A 1KIQB 3H3PL 3QUZC 4YSUA 1OGAE 2EDRA 4R3SB 3EYQD 1NOLA 2OMYB 3JVGA 5FHBH 3JWOC 1PLBA 4N2HA 3ECWA 5CD3B 2OJ1A 4KVNH 2AZAA 1IQWL 5CJ8A 5DHYB 4JKWA 4ZS6D 3B9AA 4NPYB 1PSKH 2FJSA 1L9OA 2O6CA 4TS6A 2VLKD 3H4FA 2CO7A 3GI9H 2P43B 5DO8A 5GGRY 2FYYB 4YHKL 1ZLSL 2J1KA 5FB8A 4OI9A 3WEXB 5F1NA 3UYRH 4JX0A 4P49A 3BO8A 2H6OA 4IMLB 2X6BA 1KNOA 4TPRL 1PD1A 5J0BA 1BQLH 1A4BA 3G5ZA 3ECUA 3HKFA 1YEKH 2VDLB 3AG3B 1K8DB 1Q9WA 3ARPA 3BAEH 1GJWA 3KNBB 3M17B 4MNQE 4UT6A 1Z2KA 1HZLA 3QEGL 1JL8A 2D9QB 5C08A 2Q7YB 4E41E 3QDJB 4ETYA 5DI8A 3RWDB 3NJJA 2AEWA 2YUXA 5FYKU 1LK2A 1O6TA 3L3DB 4UQ3B 3UAJD 2PO6D 1OHQA 4QHMB 4HVBA 2CO7B 3VRJB 4WSGA 4X80L 4WIQA 5JPNC 3HNSL 1FZOA 1UUNA 5HJGA 1JXDA 1RJLA 5LAPA 1UACL 2WIIB 1ZWIA 1E50A 2GSGB 1HOEA 3QC6X 3S35X 4QGTA 4BM7A 1TZGL 5J9PB 1HJBC 1G4RA 5TFSL 5IROC 1QAWA 5IQLA 2VRQA 1BLIA 3BPCA 5C0EA 2WZAA 2FZ3A 3QWNA 3UPCA 4G8GA 1W8EA 1BD2E 1ZIBA 1IBFA 2GK0A 3QIBD 4WW1B 2CO1A 4L18A 2MRYA 4O2EB 3ULVH 2VDMH 5HDRA 3RWEB 4W4OC 2P42B 1NGYA 1MCOH 5BXFB 3ARFB 4UUJA 1NDGB 4O00A 4N2DA 5BRPA 5E8PB 5F1SA 4Y1AE 3TO4D 2R59A 4F3FB 5CU9A 3JUYA 3ESNA 1TFPA 2BVYA 4H5SB 4QNPE 1E67A 2LT9A 5DJZB 1PTZA 3OAYH 4MD4A 1VA9A 3VTAA 3B43A 2I32A 1UKSA 3FF7A 2CMRL 5BS0D 4N2BA 1YDPA 4NZFA 2WLLA 4D7PA 4U6XB 5FW7A 4UOQA 4BZ2A 3PWPD 4KMTH 3RZWA 3MRIB 4ZMQA 1IL1B 4IBVA 1ASOA 2RALA 4I77H 1P0SE 3PGFL 3NIGE 5CN1A 2OTWA 4PI0A 4TOYL 5I0DA 4OZGA 5DJ6A 4U6VL 4WQOA 3BHBA 3QJHA 4FYSA 1AXIB 2QVMA 3IPEA 4N2CA 1LEKA 5D2LB 1TVHA 3KPRE 2G3XA 2P7TB 2HLAB 1HNYA 1J88A 3VW3L 2QFRA 4YAQA 5KS9F 3MVSA 4WO4C 4D0BA 4UZGA 2JKSA 4GO9A 3MLYH 5I74B 1DJHA 2L3BA 4B9YA 5HDLA 4YQXH 3QIUC 2X2JA 1M7UA 4QO1B 2Y36L 1BZ7B 2ZUXA 5ISZE 1XGYL 5D96B 1AHKA 1DQML 2JF1A 5CCGE 3HPLB 4BFOA 1AP2B 2G3ZA 3BT2L 3N2JA 2YSSB 1QLFA 4LF3B 4L9LB 3OKLB 3U1SL 2JE8A 5IJCC 1YNKL 3G5WA 3M1OA 2W8CA 5FYJD 3WGVB 2EC9T 4LB8A 1C08A 2WXOA 1JNLL 1WK0A 4Q8BA 1KDIA 3ZIYA 2B5IB 4IHOA 1V7NL 4A7VA 5IP4A 1MHCB 4UNTA 4PHXA 4J3BA 4WGKA 5EO0A 3PV7A 3OKKA 3QARA 2CXKA 3BPNB 4FDWA 3U6RB 2YQBA 3AACA 4I9WE 3WIHL 3WTUA 1KJ2H 3FTXA 4IKIA 2ZTBA 2XZQL 4JO1H 3MXVH 2QR0B 4GXUN 5EZIL 1ZANH 3BVXA 3BZFA 4Z0XB 1IQDA 5GGRA 5A16A 3VFWA 4FQLH 1F6AB 5C6TL 1SJEA 2FT7A 2D31A 3TIDB 4NP4L 4NQEE 4PJHB 2QSCL 3EGSA 1ZTXL 4OW6A 3KWTA 2EC8A 2KZKA 1C8QA 4HJIA 3U4EB 4DEUA 2FDBP 2ATAA 4MDIA 1XD1A 2X70B 3FN0L 3HHMA 3O9WD 3QIUB 4MMYB 4OCLC 1FAIH 5DO2C 3E2HC 5JOPE 4L37B 4TRPH 5IB2B 3QHFL 5CBEA 3E6FB 5HHME 2HFFB 2OJZL 3KYOB 5H37A 2XU9A 5T1KA 1NUDA 1U3YA 3UH8A 1UENA 2P45B 4ZZFA 3SDCA 3SB3A 1R5IA 2N1KA 3V6OA 4Q0XH 3HC2A 1EAPA 3FUDA 5ALCL 2RIKA 5C0RH 3CSTA 4IHBA 1FCGA 4YDKL 2HFGL 5BMFH 4KQ0A 3IAQA 5EU6E 4TUKL 1XB8A 4QAMB 5G4NA 3US1A 2WYTA 3IDYB 4FFYL 3AADB 3CVIL 5CR8A 1QFUL 4NN7C 2WLZA 3UG5A 2NPLX 1NLBH 4JG9A 5T33L 5K9QI 5BCAA 3DX8A 4Z6AT 1M6UA 4U1MB 1JHLL 5IROD 4N87A 1QR4A 3VYPA 4CC1A 4Z76A 4W4OA 2J1ZA 4R96B 3R7RA 4HBQA 1HEZB 4EN3C 4Z5RA 1U8OA 4PHZA 4JAMA 2GITA 2JV6A 2YAEA 8FABA 4LARL 1S7WB 5D1ZB 1H15B 2BP0B 3DPBB 3W0WD 3P0VH 4JDZB 5DT1L 5CBAB 5IOKA 5DDHB 1HL4A 4OD1L 1LP9F 3GK8L 4DEPB 2AJVH 2A6JA 2Q6WA 2BRRL 4XPGL 4BGDA 1DBKL 1O75A 2F19L 3TYGH 4JLRA 3MPCA 4LNVA 2K4WA 2FLBT 4FZ8H 2P24B 4FL4C 4HW6A 5DMIL 1UWGH 5HGDB 3QWQB 5K39B 1H3PH 4YHYB 5TE4L 5D72H 2XV6B 4P2OD 1KMGA 1YQ2A 2CGYA 3SJVD 5HDQH 5I6LA 4Y4KD 3GC3A 5GGQH 4P5TC 5C0EB 2OXHB 2G30A 1MFCH 3MRHA 4I48A 4P23B 4GRWE 5IOPB 3K6SA 3WIAA 3QAZC 4RX4D 1MIMH 1GC1H 1OF2A 2DN7A 4IRJB 2NY0D 2W91A 1SHSA 1QASA 4LBAA 3BVNA 3QS2A 3QE5A 3GMOA 2F9BT 1X5KA 4NC1E 5D7JD 3ET9F 3UYPA 1MH5A 2VLLA 3VI4B 1Z5HA 4GIOA 5I8KL 5KTEL 1RJCA 1UWEH 4DGYL 3MRCA 5IVOA 2IANB 4NZJA 4DO5A 1MJJA 3HBPA 3IJSB 3ILDA 3JVFC 4P2AA 3FQNA 1JWMA 3VXOA 5D7IF 4M61A 3ZZSA 1NKRA 2YAOA 1EO8H 2CWRA 3WFBL 4BDVA 5PCYA 3PWNB 3QW9A 1GA2A 3ESPA 2PPAA 1TEYA 3IDNB 1DVFB 3NJMA 3K74B 4FX5A 4RFOH 2Y22A 5TE7L 3V6ZA 3AM8C 1QVOA 1AGEA 3DECA 2AF2A 4ZYKB 1MHEA 3LKRA 3C8KA 1FN4B 2FVNA 3HFMH 2WQUA 2NSMA 4HIEA 1IC7L 2ZOWA 5ANMA 5KJRH 3GHPA 5DD3L 4ZG1A 3ARFA 1AMYA 2DKSA 3DGGB 4N26A 3LN4B 1PZSA 1II4E 3HC4H 3APDA 3DRQB 5BQ7B 3FCBA 3KYKL 2OMUA 4TLSA 1J05B 3MI6A 3B7YA 1F3RB 4Q4EA 1V7NH 4PV1C 1L0PA 2NXZD 2GTWA 1M1XA 3KXFE 2AQ3A 1QLEL 1HESA 4OT1H 4NAQA 5BVJA 4HJEA 4FL4B 3KBFA 2WCGA 4PP2A 5AW9B 1I7RA 4N8VA 4RDQG 5D1QA 2OXGB 1PS3A 3DK2A 3BVDB 4X5PA 2IIJA 4P2RB 4AOFA 4GUCA 2Y6SC 3OKKB 4JJOA 3U7AA 1AXTL 2IPUG 4RH4A 3DO7A 4OZHF 1NCOA 4C83B 2G0LA 1E7UA 1AJ7H 4NKOB 3IFLH 3LQAC 4OD3L 1EHKB 1MQKL 4RMTA 3T04D 4QYOB 3HZ3A 1OGTB 4NI3A 1RZQA 4KY1H 1LTXA 1GGCL 1OIOA 3LRKA 4YL9A 3BRFA 2WANA 4OY9A 2WMPB 3VDCA 1DVQA 1JPSH 3IDJA 3MBEA 4G6AC 3QWOA 1FL5A 2FX7L 2QTEA 1I1AC 5I0WA 1WDAA 5BZDB 4M4RA 3ILQC 2O6PA 3OLDA 5LBGA 3SGDI 3K4ZA 1BVLA 3L48A 2VLRE 4XVSH 5AD0A 3IFPA 1JTPA 1L9RA 2ED8A 2Y2WA 5KJ4A 1O5DT 4X6EB 4POZC 2WXGA 4K3GA 5B1CA 3VXUE 4IBUA 3DSNB 3QXAA 4XN7A 5IMOA 4U1LB 5I8OL 1M1SA 1KTLA 2HRGA 3OHXA 5KVGH 1FAKT 3OWRA 1TVBA 2DKMA 3P3RA 5JR1H 1MPAH 3PIQB 1FIEA 4MJ6A 1IC5H 2DL2A 4MQ7A 1OM3H 5FFOA 5HYQA 5I1DA 2VDLL 3UADA 2JB6B 3QWRA 1MRFL 4PJHF 4K3DH 4PJ9B 1GZHC 4OF3A 2EIBA 4RQQB 3F65A 3EJJX 4PUBL 4UQ3A 2GQHA 4TQEH 4X6CE 1JZIA 5DVKA 3CXFA 3FT9A 4FJZA 3SJVB 3P11H 4PMEA 3ZKMD 4K15A 3X12A 1QRND 3AWGA 8FABB 2WLLB 4R97B 2VL5B 2QEJA 4PG9B 4Q9QH 2A6KA 1DO5A 2CHXA 2YMTA 1FORH 3ABGA 1WWAX