2O6CA

Structure of selenomethionyl rtp34 from treponema pallidum
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
158
structure length
158
Chain Sequence
FDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Tp34 (TP0971) lipoprotein of treponema pallidum: implications of its metal-bound state and affinity for human lactoferrin.
pubmed doi rcsb
source organism Treponema pallidum
molecule tags Membrane protein, protein binding
molecule keywords 34 kDa membrane antigen
total genus 28
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10634 Iron_transport Fe2+ transport protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o6cA00
3LZLA 3LZPA 3LZOA 3PJNA 5I0XA 2O6FA 5I0YA 2O6EA 2O6DA 3LZQA 3NRQA 3NRPA 5I0VA 5I0WA 3LZRA 3PJLA 2O6CA 3LZNA
chains in the Genus database with same CATH superfamily
5HDLA 4TUJB 4KZ0A 2ZYIA 4YBLC 3H55A 5I1DB 4IMKA 2EABA 3E6FB 5JIDA 3CZSA 4EVNA 3QNZA 1FYTA 5ID1B 4UTAL 4IBVA 4PRIB 3F64A 5ITBH 2FB4H 5DYFA 4U0QB 3EO9H 2EIDA 1P5UA 1IC4L 2N0MA 1CDGA 4WWKB 3OJ2C 5DD3H 4R83A 5LBSL 4XBPB 2HH0L 1BLIA 1RD6A 4WI8A 3PGCB 2WP3O 1CC3A 3KW8A 1MLBB 4JKPH 4EBQL 4NQSB 1DE4B 4PEEA 4NO2A 3MROB 4MAUH 3QUXC 5I75C 4JCMA 4MXWL 1NCOA 3NACH 5K5YA 4J8RA 2KLSA 5FYKE 4JN1L 4FTVB 2FJFB 3LEXA 4NQXA 1KT2A 1HQRA 1G6RL 4Z7VB 5GGRY 3DO7A 2OMYB 4TVUA 1JE6A 1M6OB 3CBJB 5AZEH 3VH8B 2NY0C 3CVHL 4IKKA 1EGJL 2RQEA 4ZUVB 3D7PA 1GAFH 4LCCA 4ABQA 1RU9L 2IAMB 5HGHB 4HH8A 3Q43A 4Y5XB 1YMHA 3EH2A 2UVEA 4X5RA 1E4XI 3AY4C 3C6LB 3LHPH 1R17A 4IIQB 3HA0A 5FW6A 3P54A 5C0AE 5BS0B 1SLVA 4YSTA 2EDRA 3E6FA 4K8RH 4BCYA 9PCYA 1OB1A 4EZJA 2ED8A 5F3BB 2L7UA 2A3TA 2G30A 3EF4A 2WUCH 4L8SC 1C08A 5A2AA 1IQWH 3SQBA 25C8L 2AITA 2VDRH 1U91A 1AZUA 3ARVA 3GRWA 1NPJA 2WXLA 2NYYC 4MASA 1J8KA 2M2DA 4PGZA 3RY5A 4D3CL 2NPLX 2MOVA 4KX9A 2VXTL 2R8SH 2QVTA 5C08A 1BVNP 3ZBMA 4PJEE 4XO3A 4QRPA 3HMXA 1KN2L 5EEZA 1DBAH 4YSCA 4QXTA 2IWEA 4F7EA 4AL8C 1QTYT 5IMOB 1BFTA 1A4JA 3FFCE 1CL7H 1QBLH 3MLSH 3W0WE 1VERA 2B4CC 3CFIC 3LD8B 4KVPA 5CZVH 1XCQB 1BFOB 3VA6A 1AACA 1GZPB 1M57B 2JKRM 5GZOA 1CCZA 2NY0D 1QLEL 1NUDA 1MREH 3BQUC 3H9SB 5B8CA 3BP4B 5B3NA 4DVRH 1ZOXA 5I73C 2VTFA 5E6SB 4UDTA 3EO9L 3H0TB 2PW2A 3DECA 3MRMB 4GW4B 1P9MC 2LU7A 4O9HL 3VFMA 4S0SD 3RDTD 4HLEA 3VI4B 2H32B 1KMGA 4JX0A 4U1SB 1JF5A 5DJAA 4FA7B 1S7WA 3FJTA 3RWGB 3L54A 4LEXL 2FH6A 2O61A 1IVLA 3MQIA 4L1HA 5L2JA 4WSGA 4MNGB 2FL5A 2CMRL 1P1ZB 4FYSA 5AZUA 4N6RA 3S36X 3UIYA 3DURA 4MB4A 5HHVL 5DC0A 1ETJA 5HD8D 4S1QL 2GK2A 2LOEA 1JVLA 1EZUA 2PW2B 4BSWB 4D8PA 2DAVA 2AGJL 1UWGL 4PJ8A 3IBOA 3F3HA 5C09A 3UYPB 4Y2DC 3EO0B 5IM7B 2NUPB 4MJ6A 5ANHA 4DO5A 5I0WA 4ZW6A 3WHXA 1J0JA 5AW5B 1FDLL 2FLRT 3ESMA 2P26A 3MXWH 4XPFL 1I7RA 3V4VH 3UTPE 1ZSDB 4XMUA 1IM3A 5CEYA 2OYPA 3I75B 4WFFD 2IDUA 3B34A 7FABL 3BSHA 4EF3A 4EZLA 4LCWD 1IRAY 3FDWA 1FNEB 1P9MA 4DESA 2AEWA 1G1OA 5I6MA 1F3DH 5E56A 2QSCL 2ZAIA 3V0VA 1TITA 1EV2E 4NM8H 3VQLA 1XAKA 1Q72H 4GKNA 4X2UA 2CO7A 4IBWA 1GYAA 2WGNB 5BVPH 4GI8A 2GEQA 1KCSL 1DSFL 4YE4H 2XTJB 4U3SA 1RJYA 3MLPA 1T2QL 1GY1A 4I5BA 1HK6A 1N3NB 1Q94A 1T66C 2APFA 4BFIB 4D9QD 1ZVSA 3L4WA 1V3LA 1FYHB 4HBCL 1UD4A 1UXLA 1T1XB 4BV1A 4QHKJ 1DLHB 4KJPD 4P9HC 3RX8A 3X14A 2FT8A 2ZWNA 3DHUA 3QG6B 3K81A 3RWEA 1MCIA 3QIBD 4G71B 2O4EA 3UBFA 2KZKA 5A43C 4XAWL 3SSGA 4TULH 4XNYL 1P4LB 2WO2B 3RI5F 2YMTA 1NQBA 4LKCA 1ZSDA 4KUZH 3RIFK 1VGEL 3Q5OA 2DLIA 1T04A 3KM2A 4YGVB 5LN8A 3OKNB 4O5LH 1B9KA 2CDFA 2DQCH 4G80B 2K4AA 1WVZA 1KPUA 1QSVA 2AJ3A 1UD6A 3N1FC 4G6AC 4K94H 1KTLA 5TGBA 2IDSA 1CL7L 1QBLL 4FJ6A 2Y1AA 1YJDL 1OAJA 3FS9A 1MRDH 2CLRA 2QADC 4ODUA 3U46B 1J0YA 3I6LE 4HUWB 1NC4A 4J7RA 2YK1H 4FL4B 4HFUL 2JB5H 2OJZL 3WD5H 3ZL4H 4M1GL 4HWBA 4XRCA 2F1EA 3ZDZE 3H85A 2O61B 1XZ0A 2K3TA 3U1SH 3WUWB 2NY4B 1DVTA 4M7JH 2OMNA 3QO1B 2QDWA 4P2OA 1RZ8A 4ZXBD 5IBTL 3WKQA 2FDBP 1TQBC 4LL4A 4WJ5B 4HPOL 4EN3C 2IWGA 2HFGL 5C0BA 3NFNB 2Z8WC 1RK0A 2HZHA 4NENA 1IGFL 1QSFD 1I3GH 3N3EA 2ATKB 3DX7B 1S9YB 1MNUH 1FL3A 4N4YB 1DTUA 2HT3C 4JKMA 4PWKA 5FFLA 5CJOL 1T5WB 4X5WB 2D2CC 2RB8A 2Y7OA 1S9KC 3QQDB 2OMTA 4GRMB 1TZGH 1D2OA 3VD5A 1NAMB 3GHBH 4HGMA 2BOCB 4F7PA 5IFAH 4UQ3A 4LK4A 4P5TB 4BFRA 5CO1A 3D52A 3SDAC 2QQQA 4CW1B 2NDFA 4L1SA 1J5CA 4NN7B 1XAUA 2BP0A 3L4XA 4NN5B 2NYKA 4AX3A 3V4PB 1K72A 2Q0ZX 3DGDA 4BFOA 1IO4C 2ZX5A 3RVTC 1UGNA 3T0BA 5IG7B 3MRDA 5D2LA 2DMBA 2PXYB 1O9WA 2OR8A 2DIJA 4IRSB 4B7LA 4QR7A 3IFNH 1D9KA 4G42B 1KDIA 1YVLA 1TVBB 5J11C 2EKJA 1D7FA 5JW4Q 3HPJA 2LGNA 5CLYA 2D7NA 3JTTB 2OZ4A 4R7NB 4GBXB 5T1LD 4X5QA 4Y1AD 2UWEF 3HG4A 2VDRB 4TNEA 1H3XA 3RL2A 2YSSB 5IUSA 2JWYA 4LCYA 4P0DA 3CHQA 1NGPL 1J9RA 5I6XB 1FJ1A 4XMLL 4P5TA 1USQA 1XGRB 2QHLA 3RFZC 5J1TC 2DWSA 4AEEA 5FECB 3E3QC 1OP3K 3FU5A 5DSCB 3LEXB 2YD6A 4CU7A 4WO4B 1AMXA 4ODVH 4AGOA 3PP4L 1E65A 1YEFL 4GP8B 4O58L 3VD7A 4H0LC 1XH3A 4M5SA 3GF8A 4AZUA 4LCUA 4ELMF 5EO1A 1KENL 1L7IL 1UWXH 4LZKA 5MEOA 2DDQL 4PIBA 3OHXA 2BY2A 3MJ9L 4MA8L 1YDPB 5AYQA 3NUKA 3ISWA 5JW5A 2DLFL 3KVQA 3CDZB 1Q0EA 3KPNA 4XXCC 1KCSH 4G70B 3WMPA 3T0EE 3WFHA 2QKIC 2X3BA 1AHWB 2YUWA 2H2PD 3FOMA 1H8OA 4Y4KA 1OPGH 5JOPE 3QJOA 4WFGD 4GSUA 1O6SA 1ZGLM 1WD8A 5E5LA 2D3LA 1NL0L 1IZKA 2ITDB 3BXNA 2AGJH 2KHAA 5J0BA 5TPWL 4HUVB 4AJ0A 1QSED 4PCTA 4DQOL 3MRPB 3KPOB 1DCEA 1X5AA 3WIFA 1HNFA 1V54B 2A5UA 2BRRL 3LMJL 1G7JB 4RAVA 4HPHA 4IJ3B 4MJ2A 1BZ7B 1HIMH 4N5ED 1VFAA 4GQ9L 4AQ1C 2J25A 1ZLUH 2J4WH 3N0PB 2I27N 4YBHA 1JI1A 3ARGA 4GQPH 2HT4C 1F3DJ 5JW5B 1AQDA 1NCDH 4JO1H 4WV1C 4N2MA 3L3DA 4PJDE 1BWWA 4OVVA 3VXSE 3IGLA 3AABA 3EJPA 4Z0BL 4MA1B 3BP6B 1TTBA 5K9KB 4TKWA 1L7TH 2YD3A 1L5GB 3AY4A 3AS2A 4ONHA 3WD5L 3O3UN 4YDIH 5HDQH 5FYJL 4WWNA 5GZNA 3UBXI 1FN4A 2YPLD 3O0LA 1D6EA 4CJ1A 2OCJA 1DYZA 3WKYA 5CLTA 1ZLVH 1NFKA 1A2YA 4I77L 4U7KA 3GBEA 3QRGH 5F3HA 3CFCH 3O4LB 5GRYA 2TSAA 3V6BR 1WEJH 5E8NA 3RLSA 3RRQA 3LDBC 3ZYZA 4TQ8A 5INDA 3WDHA 2VZUA 5IF0B 1BYOA 5CSZB 4ESKA 1IE4A 4E42A 1N64L 1SZNA 3HC3L 4IHOB 4MCZB 2VH5H 4QY8A 4F7MB 3ZOAA 4LU5L 2A99A 3BWSA 1O7DE 1OARL 3RDTA 1ID2A 5LCVH 3OQ3B 3IJHB 2WLZA 1OCWH 3VCLA 2HKHH 3KLKA 3FQNB 4NKQB 5FK9A 4X9GA 3IETA 3SCMD 4JRXD 4TUKL 4FJYA 4J2QA 5E6UB 1T3FB 3T6XA 5JIIA 3GEFA 2F53D 2VN4A 3MV8E 4LQFH 3BN9D 4R4NC 3VXTA 3FO2B 4YDKH 3GI9L 1OCOB 1Z9SA 3EGXA 5CZRA 2WBKA 5D6DA 3ULSB 4HOWA 3R1GL 4J12A 2W5PA 4A68A 3EBGA 1GZPA 4PJCA 1HCVA 1SXSA 3IPFA 4QHLB 4XCCH 3A6BH 4RGOH 1BXUA 4JFOB 4X9YA 1HC1A 4P2QE 1NFIB 1W0YT 4ENZA 3OR7B 4L0PB 1M1XB 4JJ5B 3HIZA 3GMOA 3TBTB 4GMTL 1RVFH 2D8KA 3VCLB 4HYTB 1YAZA 5CR1A 2HLFD 3T2NL 5FV1L 1LD9A 5LNDA 4LLYB 1ZJAA 3ARRA 3UPRB 5D7JC 3FQRA 3BN9C 4R4ND 3QHFL 4PJHE 2CCWA 3BAKA 2WKGA 4QXGH 4L5FH 3FO1A 2WWOA 4L4VB 4QRFA 4XCNA 4BBWA 1GTNA 3CFMA 4APQC 2G3XA 2G2RB 3Q6GL 3HNSH 4ZFFB 5LWYH 2VISA 5EZPA 1IKFL 4OCWH 4RMRA 3HB3D 4OLXH 1C12B 5KANG 3BEWA 3VXRB 1GIGH 2PXYD 2OW7A 5C7XL 3B3BA 4FFWD 5IHUH 4G9FD 5D2NB 2IPTH 3KWUA 3BT2H 5IW1A 3D2UB 4TMPA 1N19A 4EDXA 1U3NA 2EO7A 2V2XA 3BP6A 4PGJA 2X4RA 2YPLB 5DJ2A 5IB2B 3UMTA 1MCHA 3SEPA 4QUOA 2XDHA 1S3KH 3NCYP 3CPLA 1E6JL 3KL5A 5SWQB 4BFEA 2Z7WA 3DHJA 2JIXD 4XWGH 1DQVA 3GMLA 4OSUH 2PTTB 4W6WB 5C8JA 2F7IA 1IU1A 4IBUA 5LG1A 1XF5B 2CRIA 3KAAA 4Y4FB 3QDJB 4IW4C 1KPRA 3WIIL 5DI8A 2CUAA 4H1LH 5ID0B 1NAMH 1SPDA 4RIRA 2Z4TA 3BWZA 2V37A 4ZFGL 4PMEA 4UF7C 4PJDF 3RWEB 4GQ9H 2MIZA 4D0BB 5HXMA 3FH7A 5GS0D 5I66B 4OJFL 1BCIA 4X4YB 5L7XH 2F53B 3BUPA 4LVHB 4OTXL 4PRIA 5E0FA 2DIBA 4ODTH 2DM7A 2EAEA 1XR8A 4FCAA 3SD5A 3RI5K 3TBYA 3N2JA 4WZ9A 3DARA 4QNPF 5J8OA 5JPMC 2X2YA 2C3WA 3DXAB 1JXFA 3DPBA 5GS1A 4RAHA 3MV8A 1G43A 1INDH 5T5FA 5C8JB 1TQSA 4E41A 4WTXA 2OR7A 5LKNA 4M48H 4NQXB 1CK0L 2FJFA 3MOAL 4WU5B 3EJSA 3IPEA 5D7HA 2P9RA 1KXQA 4QMEA 4YDKL 3UBHA 4PI2A 1OB0A 1MJUL 2APXA 2VMEA 1FRGL 3FUKA 2G9KA 4FP8H 3UBXB 2F58H 1LE5A 4WSJA 3VQMA 5EBMB 4M6NH 4AVJA 5H4ZA 4X5XB 3IFOA 1FO0L 2RJMA 4LPWA 4PUBH 1KBVA 2EE9A 5D1XE 1HQ4B 4XCCL 4FFVD 2DQ6A 5EU3B 2EKSA 1TQCC 4ICXA 2IOMA 1RUMH 1SJMA 5F7HA 4HEPA 3HR5A 1QVOA 1RZGB 5FO2A 1P4BL 3CMGA 1U8PB 3TH2T 4XE0A 3DOHA 2W9DH 4HWBH 4B0MB 4AGPA 1RK0B 3F62A 1WS7A 3QO0B 4JY4B 2VLJA 4NO5A 1ZVNA 3CHXA 1JHTA 4YHOL 2J72A 3U82B 3CFTA 2K7PA 4X7TA 1FNGB 1LMIA 2XIBA 5G5DB 3GJFH 3JXAA 5H37H 5HDBF 5EU3A 4NQEB 1VJSA 1WT5C 3DX0A 4XOAA 2ATPA 3NSJA 2PP8A 4QIRA 3FONB 4YR6B 1EK3A 3E6HB 4MNQB 3DMMB 4XWOC 4UTAH 4LVNC 4ORGB 4YDMA 5CXPA 1LL1A 2XRAH 4KJYB 2VL4A 4NX0A 2I5YL 5C0GB 4DP4X 4XP5H 4K71C 4Z8FL 3BJLA 4HC1L 3I9GL 1BFOA 1RP9A 5BZWB 3VI3B 2W65A 1QKZH 3GBLA 4NI6A 3H4HA 5CJ8A 4OBRA 5CIPA 1ASOA 3D85B 4NYLA 3LEYH 1IGFH 1T7ZA 3LKRA 4KKLC 4UOQA 5BUPA 4AYMC 1T1YA 4LPXA 3NPSC 2VMFA 2WCSA 2Y6SC 3DGGA 4IYKA 5MENB 3OKEA 4IJTA 5I8EB 1LEIA 1BZOA 5D6CA 4JFSA 4QTIH 3CZFA 3NA9H 3MLUL 5G5DA 1G6RH 4M5ZH 3UADA 3LRMA 1LO3L 1TETL 2AQTA 2DJMA 4ODXB 2NY1B 5E9DD 2VLJB 4FG4A 4M93C 3R8BB 3VXMD 3PRZA 5ABDE 2ZKYA 3DX6B 1DLFH 2PCPA 3ZE2B 1JV2A 2C7FA 1RJYB 5CFHA 2XN2A 4G8IA 3HR5B 3X1EA 4F3FA 1DVQA 2WYHA 3DHPA 4GG6A 1XF3B 3GKWL 3PGDB 3SGJA 1T1WA 4RA3A 5EU5A 3N44B 4HV8B 1EERB 1KBWA 1P2CA 4PJ7E 2FEJA 4J6IA 3UAJD 1FVEA 1N59A 1U8NA 1UEMA 1WUZA 2D0FA 3ILQC 3MTRA 4FXKC 4HFUH 4Q4IA 2OTWB 3UZEC 2NW3B 1WISA 2CK0L 2JKWA 4ABVA 3EYOB 3QULB 4F8PA 2YRBA 4TTGA 3U0TB 1MWAH 3WNOA 1IGMH 4LLWB 1XX9C 1M6OA 2FEDD 1GJIA 5HDBB 1HCFX 1NJ9B 3JYCA 3G5ZA 4OZFA 4OZ4B 3V6OE 5KBLA 4HIJB 3I3DA 5F89B 4ATWA 4FTVA 7PAZA 1HHJA 2DD8H 4HWNA 2AP2A 2VITA 1YHPA 3FFOA 4JHWL 4TRPH 3D9AH 4KNQA 1YEKH 2ORBL 4CDGC 4LVOC 3VXRA 1TG8A 2QLVB 5IVXF 2DM2A 3K2UL 1ZT4A 1RIHH 4XCFH 4BFNA 3FAWA 1WJ3A 3T4YA 4FNQA 2HLEB 5EC2B 1QR1A 3KXFA 3RQ3A 2JIXB 5EOCH 1AXTH 2D9CA 2BSCA 2VDMH 3CXDL 4LPTA 3DVNB 2D3JA 5FA3A 4FA8A 2O5ZL 3BT2L 1EJ8A 2G9HB 2Z31C 3OZ9H 4N9OB 4ZS7H 4TVPD 4EQ2A 5FCUH 4EVNB 2GUOA 3IDXH 1NZRA 1O7SA 2DEYX 4P2CG 4X0KA 3QUHA 3WIAA 5A1AA 3TFBA 3WUWG 4C4KT 1Z1WA 1G7PA 3DKHA 5K59F 1M05B 1E4HA 2DL9A 3IT8D 2A6IA 1PSKL 5AW7B 1QA9A 4UBDD 3V4LA 5IEKA 3P11H 1KFAH 3D0LA 2LLLA 2H3KA 5GZNC 2KUTA 3IFLH 1PG7X 5JQ6H 2FHCA 1BF5A 3NA4A 2P3YA 4X8JA 4HISA 4PG9B 1IFGA 4RFOH 5AW2B 3T6ZA 3GSQA 4JPKH 4M7ZC 4N8VB 1PLGH 3QPXL 1CLYH 4FFTA 1T80A 4PWIA 2NQDA 1T7VA 1BD2D 3ECVA 1JZ2A 3VGFA 1A4JB 2OSLA 1SEBA 3AJ7A 3SE4C 1B0WA 2OMZA 4DEWA 5B1AB 1MKFA 4NUGH 4KKLD 4TNFA 1DBKL 4GW1B 1E5ZA 4PJAA 2B14A 1RUPH 8PAZA 4X6BA 1JWMA 4IRZH 4YHKL 1L9SA 1S7XB 3MRRB 4AZ8A 5IBUB 4N0YL 4MTMA 3EXLA 1CD1A 2H1LM 5E1IA 3HS8A 2PCFB 1XGQA 3P77B 1JZJA 2PYEB 3IE4A 5ACMA 3F04A 3WE6B 1ZTXH 5FO8A 2WUBH 1N0XH 1SVZA 2F5BH 1DUYB 3OLEA 1QG3A 4YK4C 1JPEA 4AIZA 2D03H 3NSXA 1SXZA 1D6VH 3SCMB 4QCIA 4BH7A 3I9GH 3O6KH 2JFCA 2X7LB 4D9RE 4GMTH 3RGVD 1GYUA 3WOVA 4LU5H 5I15L 4K7PL 4P2YA 4F7CB 1NAMA 3UAJC 2OMZB 3VM7A 4KDWA 4GRMA 1ZRUA 5GGVL 4ACPA 4BQCA 2R2CA 4QXUH 1MW1A 4KXCA 4FQHA 3KPRA 2P4AB 3MBEA 4JFHD 3C5ZB 2BERA 4NT6B 3ARDB 4XR8C 3S2CA 4WW2A 3LNDA 1A0QH 1EDQA 5E6IB 1YEDA 5F7FA 3OZ9L 4ZS7L 2A74B 3P0VH 1JRHL 1R0AL 1TTRA 4AWJC 1CXLA 4NKOA 1DQDL 3NRFA 1E0OB 5TE7H 2BNQD 4ZRGA 4XXDA 4OLYH 2V2WB 5FM5M 4NQSA 1U8HB 4MS8C 1OD7A 4KJPC 1OAZH 2W0FB 1T7XA 4Y4KD 1JCKA 1CLZH 2HFEB 3UABA 1WAEA 2ILLA 3EF7A 5FO7B 3MRRA 1EEUA 2ZXGA 3V9CA 3OPZH 1UOVA 2Y6SD 1QYGH 1ZA6A 4PJCE 4H1LA 2OMWA 4JBSA 3HMWL 3TBYB 5FYLL 3MRGA 4AM0B 4IEFB 4AQOA 3IFLL 5ANMA 3EO1A 2GEEA 1XCWA 3FO0H 5EO0A 4RQQA 3WJLA 2VN7A 4XNUH 4CADB 2QVKA 3KNBB 4ODWA 3MSPA 4H44C 4ZAKC 4HIHA 1FZOB 1OPOA 5FDYA 5FYKD 5F88B 1IGML 4XN5A 2QHRH 1CVRA 3QZWA 3V8OA 5E2TH 3VFPA 4YQXH 3WFZA 4Q9BA 1TJIL 4RRPG 3QS3A 1WBZB 3CHOA 4P23C 2BDNL 2WKOF 3WENA 5B3SB 2CSPA 3MLYH 4G8AC 4B95C 1XWVA 1YQVH 4GRLC 4PJXF 5DS8A 1FNSL 2YQBA 4KK8C 5GGUB 4B96A 5KSUB 4KKNA 5L0QB 3HHSA 1IVTA 5DFWH 2OMXB 4N90E 1X5GA 1T83C 3BPCB 1NCNA 1DVFC 1F41A 3RZCC 3ZTEA 4OIFA 3RFRA 4RQQB 4OCMC 3LIUA 4OF0A 2C7UB 5HD8C 4E9XA 3O11B 4ADGA 2QFPA 4PCSA 3TT1H 4FE9A 4J3TA 4WNJA 1G7LB 3GBML 4FMFA 2E47A 4K9EH 1UWFA 3MV9B 4PV8A 1TJHL 3V6ZB 1L9OA 3DIDA 1UQSA 3F12A 3SDCD 2CHXA 1ITCA 2V2WA 1BQRA 2XV3A 4K3DH 4YC2B 3RA7H 3VACA 5LGKA 1WBXB 2F58L 2D73A 3M46A 3K8LA 2XXFA 2Y5TA 1VESA 1ZGLA 2D31B 2EYSB 3ECBA 1HHKA 1E4WH 3Q2WA 4OGAD 4TSBL 1YCSA 3U4AA 5EWIH 2X40A 4ZMYA 1CLYL 4OZIA 1WIPA 2IH1A 3GLAA 2FJUB 4JKWA 1H3TA 3ZHKA 3BMWA 1UWYA 4NBYB 4R2GD 1HHHB 3VAEA 1W0WA 4F7PB 1HVXA 1AVAA 2GJZB 3DOSB 4GAGL 1JXJA 3D85A 4H0GA 4NYLB 3P30L 4PJ8C 1UACH 1JYWA 3L4TA 3VG9B 3S2AA 2JJTA 5FUCE 3FTYA 3WDIA 2NY1D 2VDOB 1QTPA 4POZD 1IIKA 3EOBB 2XIDA 4HVBA 3BWAA 5E8OA 4KRPC 4KO7A 2XVBA 1S7TB 1CE1L 5LDSA 2NYZA 3HNVL 1H6UA 5C7XH 5FCUL 5AKTA 5DRXB 2WN2A 4XNUL 5F3FA 3QRFM 1NCAL 1A7PL 1NLBH 3TTSA 1KJ2H 2D7TL 3BP5B 4EIGB 4Q6KA 6TAAA 2E6PA 2V8LA 4MSWB 4PB0L 2AFNA 2WLYA 3HE6D 4R7NA 4X7TB 2GG1A 5E24E 2GJPA 4UNTA 5C07B 3NEEA 1BG1A 1I9JL 3CQFA 4PCKA 4C56E 3DV6B 4O51B 4Y19B 3QFDB 4XC3L 1D9KB 3W81A 1A6VH 1GKOA 3H7BA 4Q0XH 3KLHC 4OCNC 1KCRH 1VGKB 1DQML 1CS6A 1R24B 5DUJA 4LASH 1ZLSH 5EOTB 4YSDA 5JPNA 1P4UA 2IO5A 2Q7AA 3MV7E 4DFIA 1PL3A 1JHLL 1E30A 5E00A 4N2KA 5EZJA 4Z7QB 3BVTA 5BZWA 2FHFA 3V4VB 3GTVA 3IDJB 4RA0C 2J2ZB 3MN8A 5EIQA 3VYOA 4EN2A 3ALWA 4XBEH 4FNUA 2CDFB 4OLZH 2WIIB 1A7OH 4JFFD 3U1PA 1JMZA 3CVBA 4XX1E 4P46D 4DGUA 1FNHA 3KYKH 5IY5B 2IGFH 2AQQA 1RULH 1IKFH 4OCWL 5KS9E 5F9DC 1ZPLA 5I1KL 1ED3A 1BZ8A 2G5UA 4ZO8A 1A1MB 3MRBA 3KLHD 3KJ6L 3C8KA 5A3IC 1CYWA 2LLNA 1Q9WB 3OKYA 5J06A 1RLWA 2WBJA 3AS0A 5FV2A 3DVNA 2J20A 1KCUH 3HC0A 4Y2NA 1R5WB 3QFJA 3JWNH 1U3HD 4PJXB 2NY2C 2IPKB 2D9QB 2DWDB 2EYTB 1AD9B 3HE7D 4I2XA 1XDTT 4JANA 4ELMB 5C0CD 3OKOB 4JHVA 5T1DL 4YHYB 4D7BA 1MIEH 2BM3A 3GK8H 4FP8L 3BD3A 1E50A 4LSSL 3RTQB 5KVFH 3FC8A 4PRIE 1QFWL 2WJ5A 4XNXL 4Y4HA 5F9WC 1IQDA 1A3ZA 1CT8B 3LSOA 4ZUVA 3SE6A 1J1OL 2IOIA 1CGYA 3QRGL 4MNHA 5D7KE 1BLNB 4U05A 3FQTB 3VRJA 4ZPVB 1CFBA 3NK3A 4YSSA 2AEQH 2F15A 4AYFA 3N40P 5CM1A 3MRCB 4X99A 4ZAKD 4D9QE 1NDTA 4JFFA 1E9OB 4H0HB 1FO0B 4R7VA 4C55A 5C3LD 1JFQH 2X4UB 2YD5A 3GSWA 4PW3A 4WF7A 1R5VA 2WTOA 2I60H 3MLWL 3O3AA 5JHLA 3W39A 3RGVB 5E5MB 3RPIB 5D5ME 2AEPL 4BCZA 1IC0A 4XBPA 3MOBH 1E8XA 3PQYD 3BZ4B 4O2EA 1ZV2A 3FQTA 3VRJB 3CU7A 4NQDD 4M56A 1S6NA 4Z76B 1WZ1H 2ZCHH 2Q2LA 4N8CH 2R83A 3O6FA 3QEHA 1G0DA 4RMWA 4HJGB 4X4XB 4JHUA 2QL1A 1GOFA 2IOOA 4X4YA 2RFXA 1RKRA 1BAGA 3ZDYF 3F58H 4G8GA 3DUSB 4P3DB 1NOLA 4UDUA 2JMRA 1FLRH 5DZJA 1ES0B 3C6SB 1G1KA 5T1LA 2YPVH 3V95A 3TX4A 3VFVB 1UACL 5CILL 1FZMA 4GAJH 3QUZC 5IFJB 3MREA 3K2UH 4NN6C 4JPIB 5FB8A 2AJVH 2VXQH 4HW6A 4FABH 3MRDB 3BIAX 4J8QA 3VNZA 2JI3A 4JDZB 3FB7B 3GMOB 2VDLB 3L08A 3D39D 3IRCA 3LN4B 5I74B 1HNYA 1M9SA 1EEZB 1ORQA 1UA7A 1G87A 3N42F 3WXVH 4J23A 1IM9B 3LVEA 4JFOA 1CQKA 2VO5A 4FFZH 3K46A 5GIRA 4QXTB 5HVGB 4M61A 3BUDA 5D4IA 4F37K 4YJZL 4K94C 2FJGB 1CD9B 3C08H 5DD1H 5HYEA 3QDGD 4DCQB 1KLUB 4A7GF 3GKWH 4IRJB 2HFTA 2Y36L 1ZJBA 4LP8A 1KTDB 4Y1AE 5KW9H 2BJML 2YAPA 5IQMA 1CFQB 3QUGA 3OC8A 1CICD 3H3BC 4KMLB 3SYCA 1ECZA 3D0VB 1M2VB 3OKMB 4G6FD 4PJHF 5GSVB 3VQ1C 3REWB 1LD9B 1QKZL 4K23L 3NN8A 5FKPA 3SOBL 1S7QA 3QWOA 3IJHA 5DD5H 2XYCA 3CHRA 3VD9A 1CQYA 3LEVH 1U3HC 3MACL 5AWNL 4Q52A 2QQLL 4FC3E 3B9EA 4XVSL 3UH8A 4PRHD 1WCQA 3K6OA 3H0TA 5BS0D 3GHBL 1MIEL 2DQUH 3AG1B 4BQ8A 5EA0H 3CDCA 3VRLF 5IJBC 3MLTB 4AGLA 1I7TB 3ZIMA 1ZLUK 3QC6X 4NWTL 2XACC 2XA8L 4YHOH 4LCWB 4B6ZA 5C0FB 4IBZA 4LFHG 2LV4A 3HN8A 2HA1A 5FEBA 4Y7MA 3L1OH 4HKXA 1KTKE 4P5MB 1VHPA 5FYKL 5F44A 2V6HA 3G5XB 5I1AB 1I7UB 1KTJA 1J5OL 3VA2C 4EIBA 1ACXA 3QXDA 3S0PA 3NH7L 4RMSA 3BPLC 4R96A 4X4KA 4F7MA 4P5RA 2QR0A 2Z8VC 3SDCA 1EAQA 3I50H 1GY2A 2WB7A 4UTBL 2E9JA 3O8XD 4L3EA 4BFBD 3MNDA 2FIRT 2GTWA 4S11A 2Y6TE 2VQ1A 1N3NA 1O5DT 2JTYA 3FFDA 2PCPB 4UB0H 4D0BA 5KYUA 2BK8A 5KBMA 1ZV9A 4URKA 1IMHC 1A4CA 5C0BD 3QIBC 2HWZL 3ABGA 1P7QB 3CK0H 3MOQA 3GSNH 5KYYA 3LKSB 4M3JA 1WC7A 3B7TA 3KYKL 4NCDA 5T33L 3OKDB 2J55A 1I1YA 1T66D 4PRAA 4WEBL 4XOBA 4LKXA 3Q3GB 4PJIB 3R8QA 1PZSA 3BAYA 5KBPA 3WTTA 3ZLQC 3VWKB 4AH2A 4Q9QL 3GRGA 3LZFH 2Q86B 1JPTH 4HSAC 5LGHL 2Y36H 4H8QA 4PJBB 5ISZA 4W9KC 2I9TA 4YAQB 3E1ZA 1TEFA 5E9NA 3VI4E 3NCJL 3JV6A 1F4WL 2F54D 5SX4H 4L1LA 4OFQA 4QO1A 3MJWA 1HEHC 3AS1A 1XR9A 1TOXA 2K7QA 4MNGE 4P3CL 1S7SB 1HINL 4D0CA 4MJ5B 4KTYA 3V7AG 3QRBA 4AT6A 5AW9B 2V7HA 5JXED 3QIWD 2N7AA 3BJ91 4PLKD 4OCRH 5IGXL 1G0XA 4NQEA 3IU3B 4L3EB 1UXSB 2QADD 2VR3A 2UYLA 3CVIH 3WY1A 1QP1A 3TN0C 2DD8L 1CFSB 4HIPA 5DXWA 2QTEA 2VZOA 1X6LA 3LRLA 4GSDL 4P5SA 4XCYA 4HALA 5FAAA 4HP5A 4QHMB 1SLUA 3BUQA 4JJ5A 4NQQA 1JDAA 1YEFH 5GHWL 2JJSC 2MHAA 4ZXBC 1HE7A 2R0KH 4L8BB 1UZ8A 2AV7B 5DQJB 1IKOP 4TV3A 3HE7B 5HGBA 1L7TL 5LCVA 5DYOA 2W0KA 4P2QD 1NUGA 4JPSA 3TO4A 2NX5A 2DS4A 4Z7UB 5E6YA 2IBBA 2J71A 3HKZA 4PREB 3LKOB 4OGYH 2SODB 5J6GA 4M5TA 3NSDA 4J3WA 1WAAE 3G5YA 3WGUB 5SWSA 2WQXA 2VZVA 3RBSA 4N1EA 3VXTB 4PS3A 1QWHA 1OTTC 2A1WH 2EO9A 3G6AA 1A7QL 4JY6B 4LL9A 3H4FA 3DRTB 3IRPX 1BGXH 1RK1A 2YSSA 3QJFA 4GP4B 1N68A 2MQCA 3KPSE 3U0PA 4FQPA 1PZUB 3ULAB 3KWWB 1ROWA 1TVBA 3NAAH 2WLIB 5C0CE 1Q1JH 3TIEA 1VB9A 5IB5A 5J3HD 2V33A 4FXGA 2GHZA 1M71A 3D07A 1F5WA 5IHBA 3EH5B 4P5TD 4PRID 2GAZB 2LU4A 1XQ4A 4L29A 4LSQH 3TV8A 2CIIB 1Y1DA 3LH2H 4CSZA 4K7FA 1CTMA 2TRHA 2OL3B 4LAQL 3TA3C 3OZLA 4MX7B 5HSFA 4G6KH 1GOHA 5FUOL 2A6DA 4AITA 2CHZA 4K5MA 5D1QC 4Z76A 3T0EA 1SM3L 3ZDXB 4YPJA 4PS4H 4DN3L 4PVLA 4P57A 1MH5A 2CH8A 4FRWA 2BNRE 4FFZA 4KY1H 2ZG2A 3OL2A 1FV1B 1JK8A 4M5ZL 2FIKA 3MX0B 4BDVB 2Z7UA 4PGCB 4UT6A 4N0CC 1JPFB 1R5VB 1XTMA 1ADQA 1N0XL 5HGAA 1S78C 3O3EB 4I18C 1PD1A 2KZBA 2ADJB 5KVDH 4JRYB 1LWJA 4NNPL 4XP1H 3UJTL 1GGBL 2EIZB 2Y69B 5DJ2B 2NY6B 1LMKA 1I8IB 2H6OA 2PABA 3NCWA 4Y4HB 3M7OA 5E2WL 4JKKA 5KBNC 2P8PB 3WXWH 5EFIB 3GLEA 3ESUF 3T6VA 3HBGA 5E1GA 3T0EB 4KK8D 3RTLA 2XOTA 3OAYH 4LHUB 1PZ5A 4RGND 4Z1PA 1GVIA 3Q2LA 4OFPA 2X1PA 3FRUB 5GRZA 2N7BA 3LH8A 3AXIA 4HJ0C 4QGTA 3ULUH 5HVHC 3GEWB 3UBGA 4XNZC 2VSDA 5AAPA 1RIVL 3JTSB 5IB5B 3IMWA 2L8AA 3CX5J 4NPJA 5HI5C 1ZHNA 3IDUA 2EEBA 2VJ0A 3Q8FA 3OXSA 3H42H 1WIOA 4G7SB 1DO5A 3DHMA 2IPUG 2G75A 2H7WA 3GS7A 4UT9A 3MNWB 1G7HB 4V33A 4XXCA 3G6AB 4JY6A 1HE8A 3V7MA 4RMVA 4WK0B 3EGDA 1JGLH 5B39G 5E03A 1A9EA 3ARFD 1GZQB 5E9AA 3KW7A 4GUCA 2QPDB 4HT1H 5L7XL 2EC9U 1MRCL 1JNLH 2QSVA 3EO0A 3O3BA 3HC2A 4PTUA 3RILA 3V8CA 3ZDWA 4DH2A 5LUMA 2DB8A 4NPYA 1BOYA 2ICEB 5DRWB 1OK0A 5C0CA 3FMGH 3NGBC 4JO2L 1TUPA 1EDYA 3HE6A 5M7QA 1D5BA 2AAAA 5DMIL 3WG7B 1RK7A 3ATEA 1FDLH 1OP5H 1JWMB 4J4PC 3U7YH 2X28A 1OL0A 5FF6A 1A3RH 1J7VR 2PCXA 3N1GC 1IAOB 4JRFA 3QEUB 5FKAB 3DUUB 4HMCA 4FQXA 1II4E 2XBTA 4Z6AT 1MY7A 4FI7A 2VIRB 2Z92A 3MMEA 4U1SA 4FNSA 5AKSA 4ANVA 4UM8A 2ITCB 2J1YA 1DBMH 1JDCA 3P9MA 5SWSB 2CM6A 3OZKA 5E6ID 1KLUA 1WDAA 4UDTB 2ODIA 4F7TB 3AW5A 3CC5B 5MI0C 3EGSA 3ZKNC 4YXHL 2VC2B 2FH8A 3GZKA 5AALA 4AW7A 3GI8L 1J1PL 1KELH 1PG7H 4PBVC 3HUJF 3QE5A 4Y5YA 3STBA 5JLZA 3V4UH 1G7MB 3ZW3A 4DKEL 1K6QL 4D8PB 1HSBA 4WHCA 4HHAB 3GSNA 5CBAB 2UZPA 3FB6A 5C6TL 2EUVA 4OLWH 1BG9A 1I1FA 2LHAA 5EULV 3ZK0A 4Z78A 3UZQB 3WYRA 1SMOA 3ISRA 5T5FL 4QHMA 2LT9A 5JHDD 4YX2H 2IBGA 2J1ZA 3D2TA 3PL6B 3HBQA 4ZS6C 3BQVA 3LEYL 1IAOA 3TV3L 2A9NH 3E1F1 1NGWA 5B38G 4GYBA 2CD0A 2F7QA 5LLIC 4HUUA 1WS8A 5AZ2L 4MJIA 5CP7B 3WMSA 5IZ7A 2BY0A 2J5WA 5TDNA 3HMXH 1I31A 5ERWA 4N0FB 5KG9A 2J1KA 3QK0A 4WNSA 2XFXB 5AVYB 1XH1A 3FUJA 4KUCD 2R2BA 3TCLB 3C5XA 4HK3J 4HMDA 1RUAL 4PJ5A 3BP4A 2VN5A 2RFXB 4HUWA 1WZKA 1NDGB 4K9EC 3GSOA 2VDKL 5ESAB 4P2OC 1BVLB 4B9YA 1OM3H 1E6JH 1JGDB 1KJ2L 2AJXL 3FU7B 2WXJA 2WNXA 2ARJB 3RWIB 3SGEI 2IBZX 1UM5H 3PWNA 5T3ZH 3K2KA 4WTQA 2CA4A 1KGXA 2MWCA 4QKXB 3M7FB 4NNPH 2IFGA 4XP1L 3EOAA 2B15A 1I8LA 4PJ9B 1T0MB 3FHQA 4K07A 2X1OA 5CEXA 5CHNA 3KGUA 4C4BA 1YJDC 3D09A 5E2WH 3ASOB 4C58B 5DUPL 2WUCL 4UM9A 1EVTC 5HI3C 3IDMA 4AG4L 4KKAC 3HKFA 3K72A 4ISVA 4M43L 3UTPD 3H54A 4PQXA 2XN9D 1EFQA 2NW2B 3D2UD 4ZG1A 2J8UE 3EOYG 3GLDA 5AFAA 5D96C 1TQTA 5E8DH 4QHUB 4ANWA 2Q10A 3MFFB 1WTLA 5HYJB 3H8NA 2WYZA 3NIGF 3IU4L 1PCXA 2WN3A 3CQPA 1B3IA 4B60A 3B9AA 1EFXA 1ZV5A 3B5HA 1XIWC 2EECA 1B6DA 1JZ3A 2MEJB 4ZQKB 4NUPA 4H1LB 2Z3FA 1OW0A 4Z7WB 5KSAB 1Q4NX 3V5HB 4P9HL 4MD0B 4N2HA 1HHIA 1PVHA 3PXLA 3GIZH 5GSVA 4Y9GA 1JNHA 4O58H 5FGBA 4M03A 5DLML 3VU2A 1A3LH 2R7EB 1CK0H 4P2OD 1Z9LA 1JD9A 1DDHA 2BHZA 5C6TH 1KTCA 1LO5A 4ZTPH 5EEXA 4POZC 4WI0A 1PW3A 2LE9A 1CMOA 5JIPA 5DJCA 1TVHB 1JPGA 1YNLL 2R2HA 3CIQA 1JTPA 2Q7YB 3LS4H 4OI8A 1CDIA 1KIQA 2MJWA 4M8RA 2WYTA 3VWKD 4BH8A 2Z4QA 4PJHB 1JPST 3IGAA 2WBJC 4YDJA 1JGEA 1J0HA 5CCJA 2CGRL 3A47A 3D4ZA 5I82A 5KVEH 2ARJA 5KAQG 4GW5B 4G9FA 5CINH 3DURB 4F2ME 4JMXA 2MNJB 5I1CH 1CBVH 3N50A 4U6HA 5ID1A 1UURA 2W8CA 2EDEA 5D2NE 2F6AA 3ABMB 3P0YL 1ZA6B 4OQTA 2WWMC 3WEBA 3X3FL 2J4WL 3NFNA 1E4KA 4X8XA 1BF2A 2NY5H 3OAUH 3UDWA 4JM2A 2JJSA 3FQ4A 4ZXBA 3D69A 5LVEA 4GBXD 1MUJB 3CCHB 3DX8B 5T1LB 1QVOB 3JWDH 1ES0A 3C6SA 4BRVA 2ENSA 2FYYB 4W81A 2Z9TA 5IV2A 3HCVA 4DPRA 2NRDA 3NP3A 2BNRD 3HAEG 1XXFC 3ECWA 3HI1A 3NVQA 3QUYC 2ADIA 5EIIA 1B4LA 2AI0L 1F90L 4ZMNA 5H37G 5GS0C 1A6AB 5ISZD 5F8QC 1JGLL 2R4SL 1A7PH 1UT1A 4QOKE 5IK3A 1SDYA 4LSPL 3KLAB 2Z65C 3P2TA 1PKOA 5TQ0L 3RGHA 5B22A 4P2RB 5DTFB 5IFHL 1UT2A 1X7TA 1REIA 5DJ8A 3RIKA 4L37B 5CJBA 2AK4B 4Y16B 4YDJB 4AMKH 4M62H 2P8MA 4HOZA 5G2NA 4JM2F 5TE6L 3QH3A 1UADC 3DOSA 1CGTA 5MEND 1J1OH 4QCIB 1L6XA 3ASNB 1DL7H 1S9YA 1TVHA 5AEAA 4U6XA 4FXGC 1ORSB 2QJDA 1UWGH 4LSSH 3SJVB 1RZQA 3VWJD 3ZX1A 8FABB 4DKFH 4DO4A 2Q87A 1NGXB 4F9PA 1X9RA 5BOZG 1FHGA 4GKLA 2XTLA 2IQAA 4X0KB 1BJ1H 1WWAX 4OFVA 5CMAB 1BOGA 2AVGA 3CFNA 2Z1PA 1OAXL 1TSHA 1A1OA 2CM5A 1RFDL 1I85A 2M1KA 3R1GH 1QRNB 2BNQE 1UYWH 4U3SB 3RY6A 1ROCA 1SXAA 3QDGB 4IMLB 2ICWA 2VXUL 4Y5XA 5BV7L 2N0KA 3HC0B 1A6ZA 2WXQA 2DV6A 3FCSB 4P4KA 1FL5B 2BSRA 3NCBB 4NPYB 5IF0A 2DQIL 3W39B 3Q1EA 1Y7VA 1VFOA 2WQ8A 1CFVH 1NPUA 2GI0A 2X05A 3STLA 1BYNA 4JJOA 4E9YA 1YUKB 2BWDA 4N90D 2V9TA 1T0NA 2IPUK 3IF1B 4Y19D 4QXGL 4WDIA 2DQGH 4E5XG 3M1OA 2OXGA 3L5XH 3B3IB 3O6FD 1N64H 3L3KB 4LKCB 5F71A 2GKIA 3U79A 4KKZA 1P7HL 2WMPA 1ZT1A 5J13C 4AV0A 3N55A 3S9DB 1E2ZA 5K69A 2H1PL 2PTVA 3J7HA 4HKBB 1JK9B 3IU4H 1AQDB 4G7VL 2YZ8A 1P5UB 4WWKA 4NRXA 1NOFA 1DZBA 1FBIH 4MA7L 4Q56A 3DOIA 3JTSA 1RL1A 1QHPA 4Y5YC 1UWXK 4M00A 5F9OH 2B59A 2EYRB 2VQ1B 2BVEA 3G7TA 5CJOH 5IB3B 1U9KA 2I07A 2ID5A 1XGPB 4F8QA 1SYVB 1YMMB 1F45A 1ZT7B 2AANA 4XT1C 1GW6A 4ACTA 5EUKA 1MF2H 1S3RA 3JWNC 4OUOA 5KYNA 5T3ZL 1LWHA 1SLXA 3QUYB 4I3GA 3II2A 4M7KH 4MAUL 4Q2ZB 1A7QH 3GS0A 4NM4L 3P1VA 4WFHD 5FCSH 3RGBA 5I6NA 2YARA 2BX5A 1BZ9B 2VSCA 3MRMA 3X17A 4JG9A 1DQJB 2L7EA 5AOIA 3C5JB 1Z66A 2ADJA 4KTGA 3ECQA 1FPTH 3ZDYB 5AAMC 4JUSA 2ZG3A 4LLMB 3BD4A 5E6IA 1LDPL 2QGDA 1CYGA 3AT9A 4HAGA 4N24A 2GBVA 3MV11 4LBEB 3GHEH 4IOFD 2NX5B 1ANUA 5I19H 4CILA 1FI8C 2YRLA 3AU0A 2OI9C 3TJEL 4L8DA 2W9EH 3RIAK 3VI4F 3PU7A 3Q7JA 4F5CA 1RIVH 2UUDH 4PGDB 1OAXH 2KKQA 4A7GA 1OAKH 4BSWA 4MGXA 3UAJA 4R4FL 3IETB 5L2KE 4LLDB 2YBRB 1U3JA 2AXWA 4M48L 1EUTA 1FNGA 1MWAB 3AZUA 3K4AA 4PJ7B 5L6YL 4U1JA 4YHLH 3CFJA 1OF2A 1IBGH 3SKJL 2BHFA 1UWEH 1YEEH 4TSBH 5F3BA 1S7TA 4HGWA 3RY4A 1YUHA 3E8UL 3MV9A 5GS2H 2VSKB 4RAUA 5AVRB 1UZ6F 5TQ0H 3KYAA 1AO7D 1G9MH 4IU2B 4L8DB 5C0DA 2G2NA 1X5YA 3VXPB 1QW8A 4QRRD 4P04A 3FOLB 2KDGA 1JTOA 4NHCL 5TH2A 1WTGT 1HKFA 2WLJA 2X2JA 2FO1A 2IANB 4NEHB 5IMOA 2FO4B 4IGBA 3MGTA 1MPAH 3O9WB 5AW3B 3LAFA 3HHSB 1UXWA 3F00A 1CXFA 3P9WB 3RHWF 4X6EB 1ZWIB 4PV1C 4PJEB 2A4ZA 1E28A 4MQXC 3ULUL 2R15A 2JNZA 1Z5LA 3RJQB 3ARXA 3QQ3A 3QDAA 5HY9B 2XA3A 4NJ9H 3H6AA 1FGNL 1RZIB 4PJ9C 1BMGA 3F12B 3T4AB 3ALXA 1SDDA 3FFCB 1BIIA 3TBBA 4PGEA 1YMMA 1ZT7A 5BMFL 4P59L 4J3XA 3FN0H 4MMYA 1BZQK 5BRQA 2ENYA 3ZDXF 2H2SD 4IU3A 3WNMA 1NIAA 1DVFA 2QZ5A 4HH9B 1N4XL 3S34L 1RPUA 1MREL 5T1KA 4S1QH 5HP5A 5D7KD 4FA6A 3F8UB 2R1WB 3TBWA 3BKCL 4MWFB 5KVDL 4ABUA 2B1HH 2NTFA 3MLRL 1U8CA 4AUYA 3EG9B 4XRCB 1VCAA 1W8EA 4S1DC 1SDDB 2V5TA 3FFCA 1BQLH 2HFEA 2WVUA 1TU2B 1AE6H 2H26B 4TUOA 4CSTA 1RIHL 1KXVC 1KGYE 4DK5A 4HD9A 2UY6B 4G3YL 5EDXA 2AVFA 1HH6A 3CSPA 5DHVH 4MB5A 4UM9B 3B5TA 4HUCA 3VFPB 5M95B 3SYAA 4YC2C 2GHWB 3QUMA 2DQJH 2NNCA 4HKJA 1FORH 3CE1A 1PYWA 2EH8H 4F2FA 5GZOD 3FOLA 4B0MM 2NT0A 4HZAA 4MJID 2O5XH 3F01A 2CRYA 2FLBT 4A6YA 3EW3B 4WEBH 5JOEA 2FR4B 4MWFA 4ZQKA 2X89A 4JQVC 2IGFL 3MV9D 1M6UA 4RX4A 2XN9B 3JTTA 1OGPA 4OD1L 3FT3A 4X9BA 5DJZB 1V7ML 5C0NC 3RZCB 2DJUA 4GXUM 4HH9A 3QZOA 4Y2DD 3W9DB 2R69A 1U8MB 3JUZA 5F9AC 1AZRA 5TK2A 1DANU 3UJTH 5L0QC 3GBNL 4GRLB 1OAUH 1TTUA 4P3CH 4R96B 3CDYA 1YYML 3KYOA 4DCQA 5HYQA 4P23B 2OPCA 2VC2L 2HJFB 3LXBA 1YEJL 4ZJ9A 2A9CA 3IFPB 3HC3H 1LEKB 1DBJL 1OSZA 2J6WA 4JG0H 3VTMA 1OKEA 2RAMA 2AF2A 3OF6D 3NGBB 3MOBL 5DJXB 4ZAKB 2G5BA 3ES6A 2P5WE 2ICEC 3OR6B 3MC0A 1LM8V 1NWPA 3SKOB 1AZNA 1OT1A 2VGLM 4C4UA 3GXFA 2DBLL 3L81A 3FN0L 4V1DA 3BSZL 3CFUA 4OJAA 3ZGHA 2EVHA 2R69L 4Z7UA 4XPAL 3K71A 1FIGH 2B1OA 3CHPA 2Q9OA 1BFVH 2G3NA 1PAZA 4QHNB 5FDWB 1OGAD 3IEAA 3O4OC 4WY7H 5GGSY 1MFEH 1T1ZA 1W72B 1WRFA 2A9ML 2VJXA 3RWCB 4PWJA 1UH3A 5IJDC 3FONA 4YR6A 1CDBA 4MXQD 1OF0A 1TTGA 1KENH 2C9PA 2Y06H 3L3JB 3L2MA 2J8OA 1BAWA 1P1ZA 4HQQH 4WI5A 2ZG1A 2BC4B 2JB6A 5KTEH 3ABLB 4LRNL 3C6EA 4TQEH 3VXMA 4FZEL 3LNFA 4X5LA 3QJQB 4N3UA 3M8OL 5DEFA 5SV3A 3UGXA 5L9DL 1FNAA 2HT3D 3X2QB 4KX8A 3QFGA 4GW4A 4ORZC 1H5BC 4DJMA 1YZZA 4E0RA 2PN5A 3KG5A 4Y19E 2AQNA 1BAFL 3T4YB 2TAAA 3SBQA 1EH9A 5DUBB 2EIJB 4DGIH 4KK9D 3RUGB 2BSED 3GD1C 4KH9A 1HQ4A 4QHNA 1M9WA 4DQOH 4XMKH 3QCUL 5SV4A 4WI7A 4Z7QE 4YK4B 1HILA 3B2UC 4I2XE 4OFYA 5DK0A 2X6CA 4D0DB 4MAZA 4Y4HC 3Q8CA 5CCKL 1J5HA 3WI9A 2MCG1 5IWLC 3LN4A 4L9DA 1ETB1 4UQ2A 4UTCA 2H3NB 3FCTA 3EZJB 5DEJA 3TYFA 4Z5RB 2GUYA 5IESL 4Y5VC 2BXZA 3ZRCC 5KVGH 2EDWA 2J8UA 3QEQD 3DIFB 2VLMD 4FNLL 4OZGB 1GHFH 3AACA 1YEIH 2CO1A 4RAVB 5D1ZC 3FHAA 1UQSB 2MFNA 3WS6C 1CLCA 3TYGH 2X4PA 4QT5A 4FG6C 4PJXA 3T65A 2ICWB 1LTXA 1XGTB 1JD7A 1S5IL 1JZFA 3ESVF 2Y23A 2B9BA 2YEZA 4G8GB 1MCBA 2FJSA 3O11A 1WFTA 1X5JA 3ULUF 4KHTL 2YMOA 3BPOB 2X42A 3PHOA 5D1QB 1F86A 5JHBA 4JDTL 3N91A 2JV6A 4M7ZB 4BKSC 4W9JC 2J3SA 4YLQT 1W8OA 1PAMA 3MRBB 4NPKA 3IN2A 4NC1E 5I0VA 1EZLA 4NQVB 2J8HA 2XCMC 2IC2A 4EIUA 1YYCA 2QGBA 4U1HB 1I1AB 2LU3A 2IAMA 3L4ZA 3MNWA 3QDJA 1NCCL 2A4CA 2MNUA 4D3CH 4DW2H 5MENA 5MEOB 5I18H 3AUWB 3W5MA 4RGMB 3N1MC 4X7SL 1FH2A 4BK5C 4OFYD 3AWGA 4OIIH 1I4FB 2J57A 5KUKA 4JO4H 4BUQA 3MRCA 4X99B 4HQQL 1YA5A 3LXCA 2BMKA 1T5XA 1BSIA 2OQJB 5F1KC 1L9TA 3U9PL 2I9LA 1QFWI 3GXPA 4G8FA 3P4OB 1TYEB 3RU8L 2Y1ZA 3WNNA 4QRSA 2XFXA 1UFUA 2F7RA 1T6VN 2WLMA 3E6HA 1WZLA 5ELIA 3W2DH 2OCCB 3DV6A 4O51A 2B16A 4I48A 1SFHA 2EXWC 4HUKB 4PY8I 3FNKA 4GBXA 1D9KD 1A6TB 5FYJH 2CIIA 2NY2D 3HE7C 5EZIH 2HRLA 4FQIH 3H3PL 4ZXBB 2R56H 2VXSH 1JF1B 3HUJB 4JY4A 3CSYA 3D85D 4NUJA 2Y2WA 4HKZB 4H8VA 4MD5B 1KIRB 4OLWL 1N12A 1I53A 1ZA3A 2K1MA 4RRPM 4UQIM 4YSUA 3WKML 5I1HH 1NCDL 3ENEA 1E2WA 4PBXA 3WUZA 2R0ZL 3I85A 2GK0B 4OLYL 4H8HA 1O0VA 3ZIYA 5DK2A 3QFJE 1WT5A 1YEIL 3K7UA 3KVPA 1SYSB 2X9ZA 4HS8H 4NP4H 4Y88A 3IGAB 1CE6B 3CH8A 3QXUA 4HIQA 4PWGA 2X7LA 4J28A 4P5KA 1F8TL 4PJAF 1KBPA 4PJXE 5J5EA 4YHML 4Q6YA 4OCXH 4M93B 4JW3A 1FFPB 4U1MA 2VN6A 1TYJA 1IC5H 4GH7B 3NJFA 4D7PA 1NMAL 1TF4A 1XB3A 3L3GB 1DZ0A 3Q48A 4YHPA 1JHLH 3RPBA 1A7BA 3P77A 4HUNB 3EYUL 1VDGA 1BQHA 3AADB 1CI3M 3B7SA 4DGIL 3VWKC 1J18A 4DEPB 5BS0A 5GRXG 3S3DB 3GNMH 1HXMB 4XPFH 4IS6B 1L0YA 1KIPA 2KMWA 3KPSD 2X4NA 3MR9A 3RDTB 4QRBA 1EXUA 2EDQA 4Y1SA 3S48A 3OAYK 1OK8A 3WFEH 4FQCH 1AG6A 1NGYB 3MHZA 4L9LB 2KI6A 4K71B 3QIBB 2XBZA 3PDGA 4HXBL 4EUPA 3BI9X 4KJQC 4LVNB 3JWOH 1G9NL 3UACA 1TNMA 3BWAB 4IRZL 5DD0H 5E8OB 4HBCH 2MKLC 1JNNL 3EZ8A 1WWCA 2PPAA 4I0PA 3L5JA 4A2HA 4ISVB 3DBXB 1W0VA 1BJ8A 3WEAA 3MCG1 4LP5A 4P59H 1M2OA 3BPLB 5TE4H 2X2IA 5GS1B 4JFFB 3U7AA 4PRPA 4PPTA 3KNBA 4ODWB 4XC3H 5H35B 1S7RB 4H20L 2DTML 3MBWB 1HHIB 2ZNWA 4HCGA 5CBEA 3UC0L 2R0WL 4JFHE 1L9PA 5HI4D 2E9BA 4BQBA 4LIQH 3WNPA 1TQCB 5AW6B 4BUGA 3BSGA 1HYSD 1JXKA 4NFBA 2EADA 3SQRA 4O2FA 3NDZE 4OIAA 3QA3A 4NQCA 2V3FA 1H15A 1JFQL 4FHBD 1HKLH 4ZNEE 3F83A 5AVUB 4N0FA 1XGPA 4L4VA 3QSKB 4ZT1A 1IL1A 4NKMA 2F9BT 1JRHH 1Y18A 5FGCE 4MS6A 2X6VA 2DLTA 1J9QA 1KDJA 4R5VA 3CXHJ 3U4BL 3OF6A 4KI5E 4IDLA 4Q9QH 5C0AA 4DNLA 2VWEE 1AAJA 5L4JA 1NM4A 3CN4A 3P40A 4OZ4A 4WW2B 1AGEB 4PJBA 2OJZH 4O02L 3OQRA 4JCWA 4L4VE 4YGVA 1LP9B 2MRYA 4KJWC 4CVXB 5JDSB 1WLHA 1WCBA 2DL2A 3UMNA 5IB2A 1GSMA 1YJDH 2CDGA 1GHFL 4PJIE 1B2WH 4ODSL 4R8WH 1HSBB 5FHAH 2YAEA 5DMYA 1IM3B 5CEYB 3VXPA 3NSYA 4X50A 4UU9B 1GR7A 2YAFA 3D39A 4XTRD 2CO3A 3LZQA 1YPZA 4OLUH 3Q01A 3FU7A 3LKSA 2CBOA 3WNIA 2DQEH 5IM7A 4OQTL 2WHVA 3DBXA 4PRPD 1I1AD 2FBJL 1MFDL 4G6MH 4MDIB 3BAEH 2NY3D 3T0AA 1GGYA 1PLAA 3VVVA 3Q5YA 3WLWD 1WQVT 1UOKA 1AR2A 2OZ4L 2YD8A 3NEOA 3QJUB 1X5MA 4MCMA 4Y1TA 1KN2H 5E94A 5HHOE 3NZHH 1GYWA 2BS9A 2XZAL 3UAFA 3VFGH 4F8TA 5DQDL 4F37F 3FQ1A 1QSEA 2JELL 3N42B 5DJDA 4HS6A 3AU1B 4I0PD 2WAQA 3NJJA 3OB8A 4NN6B 1NIDA 3C09C 2B3IA 3L3OA 4E9SA 5T3ZD 3L2NA 2E27H 1OV8A 2CCLA 3CZLA 3VD4A 1MI5E 3MUY1 3A4AA 4B97A 4E42B 3KGTA 5IQOA 1PQZA 2WXMA 2ZP9A 3G5VA 1IGJA 2VAAA 3JWNG 2BVUA 2NXYC 1HI6A 3KCWA 4KVCH 4U6XB 3FQUB 1W6LA 2QGEA 1HILB 4KI1A 4YFLF 1DVYA 2HYMA 4LL1A 3S3PA 4R84A 3GSQB 4POUB 4UQ3B 3QH3B 4WEEA 4R0LB 4UOW1 1SQ2N 1UXMA 3D39B 4APQB 4J39A 4WJG3 1LHZA 3SOBH 1U8LB 2ZPKH 4ONFL 4HWEH 1RUML 4P2RA 4WFEE 2MPAL 4OI7A 1D7BA 2FSEA 4HC1H 3GXMA 2K8MA 5HHMB 3EFOB 5JDSA 3RGVC 1MCKA 3AG2B 3T0XA 1AS7A 3FB5A 2BPBA 4M7LT 5D7JB 1S7QB 2H9GA 4BM7A 3WO4B 2ZUTA 2ETWA 1WZAA 2DQUL 4NHUA 5CN1A 5JOFA 3JWOL 3SE8L 3VXMB 5EF1A 5I5JA 2Y5TB 3E9UA 3OKKA 1TZ8A 3OAZK 3DSNB 2L7JA 5CR8A 1M1SA 3KCPA 3VI4A 5CP3A 1XGQB 4PRNB 2WZ5A 3CDFA 3BAIA 1PZ3A 5INDB 5C0CB 2FZ3B 2P47B 2K6YA 2OV0A 5BO0D 3X11B 1ACYH 1ZEAL 4FAAB 4FMVA 3ULUC 1Z7JA 3K4ZA 4E9LA 1A25A 3RTQC 2X4OA 2SEBB 3SHSA 1XZ0B 2AJZA 1XF4B 4G72B 2MOGA 4I8DA 4QRSB 1ZE3C 3GI8H 2BIHA 2XXMB 3MLUH 4HJGA 3QARA 2RIKA 1HHJB 3CFBB 2I85A 4QXWA 1S8DA 1AYOA 4V1DD 3NCXA 1C5CL 1EWHA 3GUTA 1KF9B 3ZN6A 4BWTA 3O6LL 3O3EA 1HXYA 4BA0A 5JQHC 4L3EE 1WGVA 2H1XA 2UV3A 3MV7D 4OGXL 1R6VA 1PZBA 1HH6B 1W72H 4WKXA 3RWDA 5EEWA 5F6IB 4U3HA 1IGYB 3FF8A 3FMGL 3OJMB 3KWTA 3L16A 1VA9A 3HRZB 3RAJL 4GKOA 4GIAA 3B2PA 5ITFB 3SN6N 3RA7L 4CC1A 2IQ9H 1JPSL 5IEKB 1TZIA 2VW7A 1MFVA 1LO2H 2GVYA 4RDQG 5JXAL 4BEIA 1UCBL 1EPFA 2QSTA 4JRYE 4MNHB 3TEUA 1LLAA 4R5TA 3AUVA 1TFHA 1GYVA 1T1XA 3L1GA 3O45B 2CIKB 3SOTA 2Y22A 2YA0A 4K3EL 1MJ7L 1VPOL 3U4KA 1MRCH 3SPVB 3AB0C 1G9NH 5T1KB 4DT2A 2X70A 3I6SA 3B2DC 1OHZA 2BNUB 2X88A 1OAYL 5B3JE 2I60L 3UX9B 1QAWA 4GRWB 2E7LA 3RP1A 1YDPA 2ZJSL 4MA1C 2IMMA 3CXDH 1WO2A 4PY7B 3K74B 4B9ZA 3GSVB 3IB4A 4JM2C 4JFWA 3DLQR 3RB5A 3QIUB 1BIHA 1F4XH 1B3JA 4YLCA 4ZUSB 2KZ1B 3DV4A 4DUVA 3MRHA 1A1MA 4X6EA 5DJ8B 5E7BA 3VI3A 3A0OA 4Y89A 5FECA 3BRDA 4AG4H 3MROA 4LLWA 1U6AL 1D6VL 1IQWL 3NT0A 1XGUB 1FJ1B 3TO4D 3N44F 4IOSA 2ZX7A 4KMQA 2HCZX 1H3WM 2BCKA 5JDJA 4G1MB 3BMVA 4WTWA 4PJIF 3E2HC 4G43B 1S5HB 3MXVL 2E27L 3EYQC 4PJ8B 4P46C 2DPKA 1BVKB 4I4WA 5F1NB 3U9UB 3K0WA 1DBAL 1MLCA 2O5ZH 2QKIB 4YO0B 5CINL 4AE1A 1ZHKB 2GAZA 3IM1A 5J6HA 1A0QL 3NCEB 3WY3A 3PQYE 3BSZA 1KIRA 1W15A 4PJCF 4TUKH 4EI0A 4HXAL 2W80C 1R3HB 4JFVA 5EEUA 3V5KA 4NQDE 4Z95H 1A6UL 5C07A 4U1JB 2BSSA 5I28A 5I8KH 3D3VA 3PWPA 5DZNA 1U92A 3U36B 4NLAA 1S5HA 3GJFK 4E5XB 3NTCH 2FJGA 4AVKA 1SHXA 2KQMA 5JIHA 4IBTA 1HHGA 1MHHA 3GSXA 3DX2A 4LLVA 1THCA 5D7IE 2PW1A 2GPZA 4M6ML 1IEHA 5D4JA 2DQFB 5I6XC 4KDVA 2NY4D 2XIIA 4W1TA 2BS8A 2V7NB 1W9XA 2JKXA 4UOJA 4QRUB 5K93A 1MW3A 5SWSE 4EI5A 2XJLA 5EZIL 3O6KL 4TVPL 3SJVD 4JVPA 4ZO7A 4NZUH 1A6VL 1XO8A 4LBEA 1HFUA 5TTRA 1E8WA 1EMTH 2B5IC 3MLVH 4OCYL 1WZMA 4E2OA 2BVPB 3NSFA 1NIFA 3LH2L 3NDYE 4NCC2 2VDQL 4AV5A 5HI5D 1E4KC 1E5YA 5TE6H 3EH1A 4QRPB 1UB5A 4GRWF 4IRSC 3VG0L 3OGCA 2JXMA 1IIIA 2C1OB 1N5AB 1YY8A 2C9QA 3LHAA 4L0YA 1PKQE 2VNCA 3KPRD 5DD0L 4UIKH 4NN5C 2YBGA 4NQTA 4HUMB 4Y0GA 3CAFA 3OMNB 4LMQE 4OBSA 4JLRB 4XO5A 3TVMB 5E9DB 3PNWB 4KI5D 1GMEA 1RURL 2A1WL 1T21B 3QG7H 3H9HA 2EZ0D 5E8NB 1ASQA 4NRYA 2NY7L 3WCYA 1A14L 4UT6L 5HHXH 3AM8A 3VD0A 3DUHA 1OZUA 4K3HA 3ZZQA 4DVBB 2BP5M 1DFBH 2PO6D 5C09D 2R39A 4ZUTA 5AYTA 3D1MC 3RKDC 2ED7A 2VLKB 3FAXA 4X6CB 3VGAB 3IGFA 3GYRA 4HOMA 4H26A 3DIVA 3HZYB 5I1JH 2OXHB 2RBLA 3FUFA 3H53A 3PWUB 5EG6C 4F9PC 4DFHA 2WKLA 1Q1JL 3MUGB 3HS0B 3QCVH 4H8UA 5KVFL 3MACH 2UY6A 5AWNH 2G60H 4GI9A 1IGTA 5C08E 3S98A 1E67A 3ARDC 1XF4A 7TAAA 3C5ZC 2VL5B 3JSSA 3OKOA 2P1YA 4GS7B 3UZVB 3W3BA 5I8CB 1WUNT 3QZWB 1OAYH 1INDL 5ADPL 1HCYA 4P23D 3T65B 3F7QA 1SVCP 2QADB 2LABA 2ZUSA 4BSVB 5F0JB 4WFHE 4OF6A 1R4XA 5BUGA 5JHDB 3ATBA 2W0LA 1BQKA 5F0LB 1NLDH 1ND0A 2X09A 3FT2B 4Q9CA 2E6JA 3S7GA 1SY6A 5I0YA 2HN7B 5D7JA 4N25A 4UINH 4Z7WE 4EE2A 2H32A 1UD8A 3P02A 1NCWL 3A4EA 1EA9C 3QBTB 1WEJL 4U6TA 4J1UA 4GRLD 1RUKH 1SJVA 5JLZB 3VXUB 1VZGA 2XN0A 1XBDA 3EYFA 3QJVB 3FTUA 4OD2B 4ZDHA 1EBPA 3VH8G 1CBJA 1CGSH 3BVNA 3ARDA 4XE5B 4BWWA 4KTEL 5TF1H 1ESOA 4EZKA 3PJSB 1LO3H 1R34A 2KBGA 3KPPA 5AOLA 2XXCB 2XKNA 5IT2L 5CGBA 1RJCA 4N6RB 3DDGA 3BESR 1X7QB 3ABZA 3F7YB 3WIHA 3WELA 5DEFB 3U2SB 3EJYC 3MRIA 5DGQA 1C1EH 1NCCH 2PR4H 4X83A 4U6YA 2FGZA 3QZPA 3T04D 1PKQA 4HJJL 1MF2L 5EU4B 1OTTD 2XFGB 4PR5B 4YVUA 5EUOA 4FXLA 4AENA 3X12B 4JAMA 5EU7E 3VG0H 3PHAA 3CUPB 5IROA 4QTIL 1BQHB 4EIZC 1CG9A 1NANH 5D1XA 1S7UB 4ZUUB 5DZVA 1AY1H 4ZZFA 1TPXB 5IQ9A 3HLKA 4N0RA 4UV4L 5IMMA 3MLVL 4GI6A 4MHHI 1CTOA 4AQAB 3TH4T 1RZFL 4JFXB 3TH3T 3EFOA 3ATAA 4Y2DB 2DWEB 1D2PA 1F42A 2PUQT 3ZHNA 4A7SA 4AW4A 2X5PA 1XSIA 4F80A 1U3HA 2B0SL 2W95A 4AY0A 4Z3GA 1U8LA 3W56A 4HS3B 4OZHF 4BELD 4G5AA 3K4DA 5JPMA 4KKBC 2KH2B 3KHOA 2HVJA 3PAVA 4FFWC 4UQEA 1T4WA 2NNAA 3J2PA 4PU2A 3NIFB 4KKCD 1ICTA 3QHZL 2WOBA 4KKRA 5DZLA 2ZF9A 2JJVA 2AK4E 2VDKB 4NWUL 1XMEB 1QNIA 5E7FA 4BZ1L 5FOJA 4HXAH 3QUXD 1TFPA 5HGBB 5DHEA 4XH2A 2DWTA 4Z7QF 1O9ZA 3IPBA 1LXMA 1OB1B 1J05A 5D7JD 4YEFA 2HKFL 4YHZH 3H56A 4HJTA 4X6DB 3V5HA 4Z7OE 3F6IA 4KUZL 2WZPD 3VGDA 2JLLA 4UBDC 2VLRB 5ADPH 3ILPB 3KLDA 2BFGA 3K5RA 1M7XA 1MJ8H 2QPSA 1WBYB 3U2SA 3AXHA 1E6OH 1LGVA 5SX4I 4JPKL 2WNGA 1NBZA 3MRFA 1VFBB 4MA8H 4H88L 3WMQA 2NLJB 4UCFA 4ILDA 2JTDA 4KO9A 1DANT 2FB4L 2R1XB 1P4IL 3FQ2A 4WKZB 2DKSA 5AVWB 4FJZA 2XZCL 4MAYC 3UTZA 3JVGA 3HI5H 3CZJA 2WLLA 1KTRL 5AZ2H 5TFSH 1EIBA 1CUOA 4JS7A 2M83A 4RFNC 2ZOTA 4TPRH 4Z77B 3KPLB 4AQ8C 2C9SA 4I9WD 1UM6H 3IJ8A 2CLVA 4KAQL 4LSVL 4YDLB 4HIJA 2V17H 3TBCA 5E0QA 4EI5D 3D08A 4YAQA 5KJRL 2R2EB 4OM1L 4N68A 4RFOL 2IANA 5EO9A 4H25A 5K9QI 5K39B 3S6CA 4K7FB 1RURH 4XAWH 4JFQA 3RL2B 3GTTA 4QNPE 2AEPH 3IKCB 3OMIB 2WY3B 4LOUC 4NGHH 4C47A 2AJZB 3H42L 4Y5XC 1YEGL 2IALA 5CWSB 1OTUC 2TRYA 2WLNA 4XZUA 4RAUB 4IIZA 5IOKA 1VKXB 4OSUL 1BIIB 3KEDA 4B9GA 3VI3F 5KYUB 4J2XA 1OGAA 4RCAA 4PB9H 2OM5A 4TNVK 1A6PA 1OP5K 2BS71 3UTTD 4XN1A 4JCLA 4PRBA 4CNIA 1X9UA 1FAIH 2NY6D 2FYVA 2AQ3A 1O9VA 1AHWA 3DRTA 2XWBB 1QACA 1NEPA 2VM3A 2K6ZA 3NJKA 2ZIDA 1RZJC 3KZ8A 2Q6WB 3SJVE 2GABA 3G6JA 3ESNA 2Z1KA 1K8IA 4IBSA 1MFCL 4XNMB 2BSEA 2X3CA 3AVEA 3EYOA 1AZBA 3JWOC 3L5HA 4GP5B 4N2IA 4WWKC 4BIKA 1AGFB 2VM9A 3X3FH 3C60A 5IHHA 2XBDA 1LO4H 3TWYA 2EIEA 3ZDYE 3N40F 4MZ3A 4R4FH 1NAKL 5GRUH 1QSZA 4YSAA 5JIQA 4WJKB 2DH3A 5DTFA 4PD4K 2JK5B 5LWYL 4E0RB 3QJHB 5KN5B 2UZXB 4AV4A 3GB7A 3H7LA 4G3YH 5AVXB 1Z5YD 4DGVL 3UDWC 1N8OE 2GSMB 3ZYIA 4BA8A 5DO2C 4DGYL 5CLZA 1QI4A 5IHLB 3CFJB 1DJHA 4PP1D 5L2KB 3HI1B 5D8JH 3MLWH 3ZTNL 3G3LA 3ZR5A 1F4YH 3NZSA 3ZZSA 4WSKA 3D3VB 3PWPB 1YYMH 5D5MB 4MMXB 4N22A 3PS6A 4X6BB 3U30B 1QSFA 1P6FA 2Q76B 5T3XH 2PPFA 5L8KB 3KXFE 4NO5B 5D70L 2DYPA 3UTOA 2B4CL 3MRJA 3O2VL 1N4XH 5B8CB 4KNUA 1CXKA 2P5EE 4NFDA 2WB1A 3SQOH 3UZQA 3IS1X 3V4PL 3MDJA 4LLQA 4D9LL 1DJSA 3S96B 1H3PH 1SXCA 1GZQA 1QBMH 2VDLL 3JV6B 4LVHC 4Q4EA 2QQLH 5ES4B 1KBGL 3I6KA 3UO1H 3PV7A 1I4FA 5GGTL 3C60B 4NNXB 2E6QA 1VIWA 2HG0A 3FB8B 4PJ6A 4Y9BA 5E2TL 4D2NA 3C08L 4KGLA 4J3BA 1SYSA 3SIKA 4OFDA 5KOMC 5GGUA 1FC2D 1GGCL 1QA9B 5IBUG 1K2DB 5J89A 1QBBA 2EC9T 1L0QA 2BNQA 2ZZUT 5SX5K 3DSFL 4NRZA 5MEQA 4A67A 1CN4A 4GMSL 3HMWH 3KWXA 2CHDA 1AXSA 3PGFL 4DK6A 1JN6B 1FZOA 1UJ3B 1IAIH 1DSYA 4HD5A 2BSRB 4M6OL 1I9IL 2FUQA 5HPMB 5AD0A 5KZCB 3Q8BA 5F1NA 1E4JA 1C5BL 1MQKH 4OJEH 3O8XA 4AGQA 2UZIH 4XNDA 1AR1C 1U8KA 1FRGH 1ZCRA 2YQ3A 1FH5H 3SQOL 4A39A 4UUJB 5D7LA 5FGSA 2G5RA 1JPSH 2VZSA 3ZTJH 4QRQA 4X6FA 1IB5A 2W0FA 2BIOA 1ETZB 3Q1SL 4X9IA 2NW2A 2OMYA 3G6JE 2F54B 5D1XD 3FN3A 3RE0A 2R23B 3OV6A 4KI5C 3ROOB 3G9VA 3U0WL 1H8SA 5C0EB 2XV2A 2Y24A 3GBMH 1TZHB 3U9WA 3INUH 1TQVA 1P2CB 4HLJA 3RKPA 1NEZB 5BXFA 1JWSA 4K5PA 3TM6A 5LJYH 2BSDA 1BBJA 5EZLB 5ACLA 3OG4B 5F88A 4F7CA 2ZKXA 2RQ8A 2OMUB 4CC4A 3HNTL 4PYHA 3KLAA 2V2XB 1T21A 1NGQH 5BZXA 3VGGA 1KJMA 2F61A 2WC7A 3E9TA 1G6RB 1AHMA 3BVUA 3FSZA 1PZ5B 2QT6A 1YEWA 3RWGA 4IBLT 4KU1A 4FD0A 2YUZA 2HKAA 2ADFH 4B9KC 2EDYA 4WI4A 3O8XB 2XN9E 2NQ3A 5ACZA 1L0PA 4H0IA 3T6QC 4N2FA 5IFHH 2X2HA 1FFQA 2UZYA 3IMBA 3D9AL 1KB5L 4PJFB 4LHUG 1KPRB 2J5LC 2C9UA 1U93B 3W0WD 1ZKAA 3NFSH 1EXHA 1IGCL 5C0JB 5DFAA 2M8XA 1HX0A 4YHPB 3UBXG 1MHCB 1ZY9A 2FBRA 3HAEH 5FM4A 1V55B 3PL6A 4TLSA 3PF2A 1FNEA 1CF1A 4IGBB 5C70A 3SPHA 2HTKD 3NFPB 4XVTL 5CNHA 3DVFA 3PWVA 3WJLC 2D7QA 4RRPA 1K2DA 2P42B 5C0GA 2G3MA 5I6PA 3BGMA 3MJ7A 5EC2A 5H4YA 4OV6F 3LDBB 4FQJL 4BQ9A 2VRQA 2XJKA 3NJNA 1A6AA 2ZOOA 3DMMA 5J9PA 1JUFB 4K5NA 3SBRA 3GMQB 2A0LD 3SKMB 3ISYA 2OSYA 4X5WA 1U58A 1NA8A 3RB7A 4JFYB 2C34A 5AB2A 4LIQE 3SO5A 4PJFA 1FL3B 1MCOH 4FN0A 1BA9A 3D69B 12E8H 1J8HE 5GJSH 4Y9CA 4LASL 2WSKA 3PGFH 3ARZA 4NHUB 3G6JF 5JOFB 1RZGA 1W6WA 1DQKA 2UYLB 1SHMA 3TONA 4AQ1B 3EUUA 2DKUA 3ARFC 4GW5A 5D1ZA 5EC1A 4XGZA 2VE6A 2H2PC 3U4EB 1F6FB 3V0FA 2CJTA 2IV8A 1L6ZA 1A7NH 5A6IA 5JYLA 3CHSA 1SEBB 1JGEB 1ULVA 3KBHE 1HEZA 3CH1A 3BUTA 4AIEA 4I9WE 3TEZA 4W9GC 4Y1AA 3P0YH 3SDAA 1G7IB 3FU9A 1SY6L 2IAMD 4DKAA 2IBZY 3F65A 1JCVA 5CS7A 3QXTA 4E68A 4LLUB 3RUGE 2WVVB 1KACB 3BOVA 4JGUA 1E43A 1QYGL 3ELQA 4IOSD 2FQEA 4QRRB 5F9JB 2J21A 2GJZA 4QKTA 5KSAD 4QOKD 3KMDA 1JGUH 2B39A 4PJ9A 3U1SL 3LY6A 4R97B 1BZ9A 1KBBA 4TQHA 3BKYL 3PPSA 3LPFA 3HI6L 1QPPA 4MFHA 3BDBA 3DXAA 1ZHNB 1W2KT 4KKQA 2XV6B 4Z7UE 5F6HI 2HT2C 2V3EA 5FOBA 4DAGH 3D18B 2DYRB 1SGKA 2IH8A 3K8KA 2C9XA 2O30A 4E9WA 1T0OA 5PCYA 2YGOA 3SPVA 4KITB 1FYTB 3SB3A 2Z91B 3L7FA 1M7IA 5D7IA 1Y0LA 4MMZC 3V5DB 5DDHB 4DERA 4LIQL 3PNWA 2YUXA 2FUTA 4JDEA 1YNKH 1OCZB 3KPSB 4L4TA 5D72H 3O6FC 1D7DA 2FD6H 4X6CF 5TF1L 2OL3L 3QWRD 3RWFB 3PUCA 4XBEL 1E2VA 2XU9A 4FADA 5ID0A 1URZA 3FSWA 4G8GE 2MSPA 1P7KA 1ZHBA 1AXIB 1O6SB 3IJYA 4LSDA 1Z0MA 1OEZW 3AITA 1KEMH 4ONHB 4R5XA 3CZFB 4IRSD 4GBXC 4YNYB 1BD2E 2ZE0A 4HAKA 4WGVB 2WMPB 1PYWB 1KJ3L 4QYAA 3VD3A 4NAMA 2F74B 8CGTA 5I17B 2OXHA 3PWUA 1TZOA 5L88L 4RX4D 1X4YA 4CC0A 2PXYC 1GYCA 2DJSA 3BEVA 5EU6B 3TU6A 1DN0A 1IAKA 3U7WL 4F91B 2WXGA 5DS8B 6CGTA 3G08B 2F7PA 5GJSL 1PX3A 1A9VA 1AY1L 3LZLA 5E00B 4P06A 5EZJB 5AW4B 1Q1PA 3UTQB 2E9IA 4CRPA 4LRIC 4FMKA 2EO1A 3S34H 3SDAB 4IU2A 1T1WB 2NR6A 2R0LL 3MCLH 4ORGA 4MQTB 1MCSA 4QPEA 4W6XB 1XCTB 4W9EC 4F7TA 1KELL 1PG7L 3K1DA 4IMLA 4EBQH 2EQDA 3LVTA 3UYOD 2EE6A 5ILTL 5A16A 5F7YC 3RX5A 2ATAA 4MMZB 2C5DC 4Y7OC 5DEGB 2CBTA 1QSFE 1WA0X 4XBGA 2DKMA 3MV01 3OWRA 4UM8B 5SWZD 4ZO9A 3IJSA 3F2LA 1PLGL 1PDKB 4F2EA 3M6DA 5FM5O 1M42A 2QPFA 2X4TB 3REWA 2N3JA 1VZHA 2YD0A 5CFAA 4D9RD 3ZR6A 4L4TD 1BXXA 4TRPL 4IS6A 2DTMH 4YEEA 1YNTF 3NCFB 1K3ZA 5TDPA 1N5YL 2A9DA 3ESOA 2V2TA 3O2WL 5KSVA 4EN3B 4CMMB 1UH4A 3R7RA 5FYJD 1C5DA 1EGJA 2NQCA 2AQRA 4TNVF 4XX5A 4QRRA 3KBFA 1VCBC 3BP7B 1FC1A 2P8LB 1PFCA 1A4BA 2V9RA 3FH5A 5HDWA 1XCQA 2VRKA 4PP2A 1KLFA 4JM4L 4P5KB 3WJMA 3KPRB 1JNNH 1N7MH 3JVFC 5FYLH 5B1KA 4CMHC 3PABB 2P52A 3VFNB 3QR2A 1KNOB 2ICCA 4C8XA 3DUUA 3MRHB 1JVOA 3ARFB 4L8CA 5ICUA 1C5DB 2A6JA 4CJ0A 4OF8A 2G4EA 4FLOA 5IV2B 1FVCA 3HPJB 4XP6H 4YXHH 2I25N 4XPTL 3G5WA 2QV4A 2X4QA 5KSBA 4W9ZA 5KOVC 1RJZA 3TT3H 4DP2X 5JO5A 2B9AA 4IK6A 4JFZH 1JWUB 2XZZA 5D7SH 3VFSB 3IDGA 4M8QA 5B1JA 5L2KD 3AG3B 5BOPA 3TJEH 3JTBA 4JFDB 1AGBA 3CFDA 4XPAH 3VFWB 3MRLA 2VQUA 3U9UA 3CZGA 1FFPA 5ECGA 3OXRA 1UXSA 5FA4A 5DRZB 4X4XA 3WTYA 1MDTA 2ZUQB 4LEOB 4XBGB 5DO2D 3HMXL 4PVNA 3PP3K 4FZ8L 4NSKB 2F1BA 1JFHA 4UMSA 4HUXB 4HCRA 3RY6C 2XTJC 3F7VB 2AQPA 4J3OF 3RL1B 2HB0A 3BDXA 3OPZL 3QQDA 2NZ9C 1E4XH 3K80A 4Z7OF 3SE4A 1ZS8A 2A9MH 1KB9K 3HHRB 4GSQA 3T0ED 1YEGH 2BY1A 3QDME 5FYJU 3COOA 4RDQF 2F8XC 1TZHA 5F7EH 2V3DA 2WW8A 2XXGA 3FBKA 3I50L 5DHYA 4OCSL 2FWOB 1DQIA 2IWFA 4LQFL 4NNYB 2E7MA 3OC5A 5EBLB 3R19A 1J87A 2COVD 4G80A 4HETA 3VFGL 3H2QA 1OE2A 3MZTA 4J4PD 3VXNA 2Z93A 5LAXA 3HUJE 3MNZB 1Y18B 4MD0A 1ZK5A 3O8XC 2X53A 1CGSL 4MRCA 1CZ8H 1J86A 1H3GA 3P11L 3TZVA 4KVNH 4L2LA 5DU7A 2ZOWA 2MPAH 4N2NA 2WP3T 3CN2A 4JY5L 1ZVSB 3BAEL 3QEHB 1CPUA 1R5WA 1AGBB 1RVFL 2I07B 1N26A 3CFDB 3QFJB 3QNZB 3RDJA 4JUTA 3FSOA 3S4SB 5LXGH 1F18A 1JXDA 2WKOA 3KCPB 4F57H 5LAXB 5JOPD 4LVEA 1L9RA 1XL6A 4AEIH 3ULVF 4P9MH 1RV6X 4PYGA 1IC7H 1F1DA 1ZT4B 3VYPA 3T4AA 5EBLA 2A73B 5AAWA 4A55A 4R26L 5BJTB 4R8WL 2XTJD 2WNKA 4DUWA 2NMSA 5BRZD 1M1XA 1KG0A 1K8DB 4HIIB 2F5BL 1AGCA 4KK9C 4S1SL 3T6WA 3PWNB 2VDOL 3EFFB 1Z9NA 4DAGL 3T2OA 2V4LA 4R0LA 3CFCL 2LTQC 4WGWB 3WFBH 5H94A 1BX2A 3NYKA 2WLHA 4ZUTB 3DGCR 2EINB 4GJTB 3LD8C 4HDIA 1T22B 1J8SA 4I1NB 3X11A 1BAFH 4IQHA 3VDBA 5F7NC 4DKDC 2MHAB 3H6JA 2GY7B 3MXVH 3TIEB 2CO7B 4WW2F 5D7LD 3IXAA 3VFUB 1LO4L 4K5LA 4MJIE 4R9HA 1ZIAA 3BLBA 5HHPA 3IGUA 1IX2A 4MNGA 3H9ZA 4RSYA 2J8UB 1X5IA 5DO8A 1E3XA 1EHNA 3ZKQD 4G1EA 5E8EB 3IDYC 1FYTD 3EH4B 1NGXA 4AQ8A 4ZSOB 5IESH 4G9FB 2Q3XA 1F2XK 2J1WA 3QJSB 4O2CB 2DQHH 5A16B 1TCMA 1MI5B 2D7MA 3T77A 1MZYA 3SBWA 3C5ZD 1F11A 3APMA 4NQCD 2FEEL 2DW5A 5IHUL 1HL4A 4AUUA 4OD2A 2GB2A 1CGVA 2XZQL 2A83A