2O6CA

Structure of selenomethionyl rtp34 from treponema pallidum
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
158
structure length
158
Chain Sequence
FDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 34 kDa membrane antigen
publication title Crystal structure of the Tp34 (TP0971) lipoprotein of treponema pallidum: implications of its metal-bound state and affinity for human lactoferrin.
pubmed doi rcsb
source organism Treponema pallidum
molecule tags Membrane protein, protein binding
total genus 28
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10634 Iron_transport Fe2+ transport protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o6cA00
3LZRA 5I0VA 3LZLA 2O6FA 3PJLA 3LZNA 5I0XA 5I0WA 3NRQA 3PJNA 5I0YA 3NRPA 3LZOA 3LZQA 2O6EA 3LZPA 2O6DA 2O6CA
chains in the Genus database with same CATH superfamily
1LHZA 4F7MA 3HMXH 4FKHA 4OLEA 2AF2A 4I48A 2CLZA 3PXHA 4PRID 5IJVB 3ATBA 2BZ7A 2VTFA 4N5UA 3U9UA 1ZLWH 3VVVA 3N91A 3DBSA 5DHYA 1UVQA 1XZ0A 3HA0A 4MA1C 3EYSL 2VDMB 1PG7W 3V5DA 1F3JB 5DRNB 3V6ZB 2JNZA 4DGYH 2Z4QA 2MWCA 1KG0B 4PGDB 3WTUA 3KPMB 3IDYC 3MGTB 4P4KA 3IB4A 1CXEA 5C6PB 3UX9B 4JAMA 2F15A 5DVMA 5E5LA 5LQBL 5EU3B 5IW1A 5EWIH 3ROOB 3ZKQD 4DUWA 3HNSL 4RDQG 2NY3D 4HS8L 4O5LH 4PRHB 5AVVB 1CB4A 2FJHA 5AVYB 3T0AA 3QEGL 4L4TD 2H6PB 4X5XA 1YEHL 2OKMA 5GRXG 1IQWL 4M5SA 4UDUB 5IWLC 4GSXA 2PWHA 3S3JA 1H6FA 4P3DB 2QADB 4MS6A 5JA9A 2GCYA 4NQEA 4OJFH 3MRNB 3IJ7A 4GG6F 2KHAA 4P04A 1RK7A 1JERA 3TYGH 1KJ2B 1IEBB 1OOWA 2BWQA 4ATTA 5EPMB 4OR1A 5BS0B 4OLWL 5IIEA 1INQB 2GAZB 5IK3B 2XXGA 4RBPH 4AGLA 5CN2A 3M1OA 4K8RD 2ATPB 3H55A 5K93A 4R7NB 1JZHA 2XFXA 3DVNA 4HLZG 5FDYA 3B2VL 5LVEA 3S4SB 5D70H 1NSNL 1XB8A 2VLME 1FYTB 5FLVA 5C0JB 2DS4A 1RY7B 2OLDA 4S1RL 4JM2D 3VH8A 5DVLA 3DSNB 4HUWA 1B3IA 2NR6D 3NSXA 2G3XA 3L5WA 4UUJB 1MH5A 4BQCA 1K8DA 1ZE3H 4KHXL 4EN3A 5F7EL 4MMYB 1HAUA 3GMNB 1CZ8H 2J1KA 5ESQB 3PWNA 4JM4L 3TOPA 4HCRL 1C16A 2KKQA 2ROYA 3FXIC 2UY7A 1Q9OA 4PJDA 4ONFL 5A2AA 2OSWA 2ZYIA 5FXCH 4ADGA 3CUPB 3LPGA 4AQEA 4PY7A 3RTLA 5IQ7H 3BCDA 2DQJH 2X09A 3JV5A 2AZAA 3O9WA 3DV4A 3IDUA 1I1YA 1HH9A 1F18A 2FGWL 4J1UB 5A43C 3AW5A 1E8WA 4GKZA 5TGBA 3AQYA 4KK9D 4F3FB 4BH8B 1FNGB 5HHOE 5E8DH 3CMOH 4XO9A 2VXQH 5ANMB 1BFOA 2D7TH 2OA9A 1UCBH 1DBAH 3H42H 1MJ8H 2PPEA 4U1SA 3FFCB 4UILL 3D50A 4FLRA 1SOXA 3V6OE 2IH3A 15C8L 1FDLL 1YECL 4X8GA 1P9MA 2G9HA 4S1DD 3P11H 4X5WA 1DJHA 2G75B 4XOBA 2NNCA 4CADA 3VXNA 2VXVL 3KPRA 3SPVA 3NCFB 2AXFB 4NZJA 3NT0A 5BQ7A 3Q01A 4HEPG 2YD2A 5BNXD 2ZUSA 2DQGL 2ESVA 4DNLA 5C8JA 4E5XB 4QJ4B 5LCVL 5JZ7C 1ZKAA 3PXLA 3O4LE 3C6LB 1ZT4B 3I50L 3LSOA 4JGJA 4F15C 2CHXA 2HPOA 4XXWC 4WSKA 4CMMA 1U8HB 3RDTB 2ENPA 1KGYE 3VFPB 5I8EB 2XYBA 4EI5D 2IGLA 4QOKB 3V6BR 5H8DA 4UBDC 1OCCB 4WJG3 1EGJA 1YYML 4X0KA 5KANI 1K9TA 2AJYL 4K7PH 1ZIBA 3NCWA 3N1FC 3LEYL 5C0BA 3L3KA 1BFVH 3OSVA 1KCBA 3U4BL 5TDPB 5FLUA 5IBTL 3BWSA 5CD5D 1SMAA 3W0WB 5CINL 5EF1A 4KUCD 1KXHA 3L1EA 1KB3A 5HHXH 1VZIA 5DMJB 1ZT7B 5D1ZB 1L9SA 2UZIL 2VR8A 4CC0A 3PJSB 5T3ZH 5KVGH 3Q9PA 2EDRA 2J4WH 3ZE0B 3LH8A 2HTLC 2O26U 5HHNA 2DYPB 4L48A 2ZXBA 4Y16C 4YSEA 3WG7B 1CLVA 1TVBA 5B8CB 1MCHA 1P5UC 4R0LA 1J88A 3FQWB 4GXUN 3T4AA 4JKPL 3QUGA 4YZFF 2ZUTA 4X9HA 2EC8A 3BW9B 3PHSA 4M7ZC 4JE4B 5AKTA 2R0WL 3FQTA 3H9ZA 3S4SG 2MMXA 1YMHB 4PBVC 3VDBA 3K0YA 3DX0A 2JVUA 2IADA 5JIDA 5AD0B 5L8JB 5I6LA 1HI6A 1AZZC 4OZIB 2X10A 1KCWA 4AT6A 5J9PA 1KDJA 2X4NA 5GGUB 4ZXBB 3VXQB 5IFJB 2VAAA 4WLCA 4F92B 2R8SL 2EXYD 2QTVA 3E8UH 1FZOA 4OGAC 4JRYD 3RGHA 4UOW0 2VMFA 4IDJL 3QQXA 2IIJA 2JJSA 3AUVA 4CJ0A 2J20A 2HRPH 2BS8A 4KROC 1TJHH 4FKEA 3OJVC 2D73A 2LFGA 2H9GA 3TBWA 1Q9LB 2VABA 3L5HA 4RA3A 2VKXA 2VN6A 4R26H 3MLTA 3U2IA 3WGVB 2M2DA 1LWHA 1GXEA 3FPXA 4PJBF 3H9HB 1Y18B 4BD4A 4F80A 4N2IA 3QNFA 3B9EA 2RACA 2GK0B 3EHBD 5J1TC 2DM2A 1KB5H 3SKUD 1F4HA 3QFJD 4WTXA 1UT2A 1M2OA 1TENA 4YHLH 3THML 3QQDA 1VIWA 3J7HA 5FUZL 5HGGS 4YR6B 3HE6D 5K59F 4PS3A 4H0GA 4C56B 4OD2B 2KLRA 4G1MB 4ZFGL 3ZMRA 3LKPB 4Y2DA 1DANT 1KPVA 1TQCB 4XMLH 1RI8A 4DP5X 4LHJB 4XBPB 1CE6B 1S7QA 1UA6L 1TNMA 4LARL 4PJ9B 2DMCA 4FXKB 1UZ8A 1YC7A 2OR8A 4DKFL 2V5MA 3CK0L 2CBMA 4HLZH 2NW2B 4GXVL 1RZ7L 5EUOF 4M43H 1XF4B 1K3IA 3QRLA 3H7LA 1ZANH 2VXSL 3TV3H 2HLEB 1WQVT 2K7QA 5J57B 3NK3A 2ZF9A 2XJLA 4WCYL 1FLRL 1MHCB 1QWHA 3IM1A 4F24A 1Q1JL 3V0FA 3JV6A 3UBXB 3D48R 3KLDA 1AOZA 4N2NA 1DL7H 4E5XG 2JKWA 3RTQA 1LE9B 2BIIA 3LXUX 4OFIA 2OMVA 1NLDH 3TBCA 1R5WA 1H3WM 5BXFA 4J28A 4URTB 5I6XC 3I6GA 4ZUSB 4PWIA 5CSZA 3RPIA 1T89C 3FTYA 2UUDH 1F58L 3MJ9H 3QNXB 2B20A 1X5GA 1CDGA 3F7YB 2OTUB 4LMQE 5DK3A 4Z0BH 3BPCA 3HS0C 2E6PA 4BWTA 3CV5A 3FTGB 2O5NA 2LAGB 4P5TD 5I1JH 1JI1A 1XGUA 2IBGA 2VDLH 3JVGC 3TIDA 2X0WA 2Z8RA 4IM8A 4M6AA 5C7ZA 3S35L 2WMPA 1KN2H 1HIMH 5H35B 1KN4L 5C6TH 4Z7VE 4MD4A 2H47C 5DR5H 3IVKB 1WBYB 4DQOL 3O6KH 2X53A 2P48B 4M1GL 1IT9L 3JBG7 4B97A 4PTUA 3TL5A 1NCOA 3MNZA 1DUYB 3GRBA 3HLAA 4F2ME 3G5XB 1FZMA 4KZDL 4QYOB 4DKEL 4O2EA 1JD7A 4Q6YA 3GSWA 5I1HH 3MA9L 1PW3A 3Q2NA 4QHUA 5L2KA 4XTRD 2N7BA 2CSPA 5GGTH 3A5VA 3DV6B 3HI5L 1AGCB 1RFDL 5EV7A 4AC4A 3BN9D 1U9KA 2WLLB 4NJAH 5C0CB 3VTTA 4EBQL 5HYJE 4G9FD 1WBXA 1S8DB 1EANA 5F1IA 1C5DB 1NPUA 3JVFC 2VDMH 4JO4H 5CJBA 2P5ED 4ANKA 1D5ZA 2UWEA 4GW4A 3AAZB 1JGEA 3PIQB 3QJHA 5AZ2H 3DTDA 3ARYA 1G9MC 4I5BB 1KY7A 4P2RD 2OYKA 1FO0A 4J8RB 3ZTEA 3UZQB 2OTWB 4HK0B 1F4AA 4S1QL 1TETL 1IGTB 4LB8A 5JDSB 2APWA 1QACA 4FN0A 1CE1L 3WNIA 2VC2L 4LP8A 3KPSE 3ES6A 3P30L 4L5FE 3L3OB 2HT3D 5L7XH 2VJ8A 3M86A 3CTTA 1FA4A 1TFPA 4MASA 4PJFB 3VXMB 4TPRH 5ID1B 2B4CC 3BH9B 1SOQA 4NUJA 2E74C 3GLZA 4OY9A 1HYSC 2JKLA 1KJ2H 3WS3A 5KYYB 3WCYA 1KXQE 3BD3A 1RMFL 3SCMC 1NANH 5I30H 2XZAL 4FMKA 5K1VA 2OI9B 3QZNA 4N8CH 3PWJB 3X1BA 1YNKL 4IGBA 3NTCL 1BAGA 4F9PC 1WP6A 3K8LA 1N0XH 4ZAKB 5FHBH 1U8JA 4XVJL 4Y9BA 3KDMB 2ERJC 3W57A 2NXZC 2EEXA 4FQXD 4FXTA 3HZVB 4I1NB 3UBXG 3LPWA 4NIKB 3OKNA 1LJMA 4PJEA 5IHBA 3LRHA 4HXAH 3WUZA 1AFVL 4AQ1C 4PV8B 2EIJB 2ZUUA 5KYUB 2E7LC 4PJ8B 1BXUA 5DQDH 4UQBA 3SKMA 4YWGH 2NY5C 3OWEA 4M3HA 3Q6GH 2YAMA 3R19A 1MVFA 2B1HH 5DJXA 3FMGL 3QXTA 1KCSL 4HQQL 2A9BA 5TPWH 2VDNB 4IS6B 3VD9A 2VERN 4H4NA 3QDHA 4H13C 2DLFL 5KYNA 3LHPL 2ZXDA 5D1XC 4CVXB 3TS8A 3BDYH 2X89D 1NBZA 1ORSB 2VQ1A 5JOPD 4YSTA 2CKNA 2W07B 4UIMB 2DLHA 3NIDE 1QUNA 1AO7E 1HCZA 2X3CA 3BPNC 3H9SD 3HMXA 2XWRA 3SKOB 3CZKA 3LZPA 4I9XA 1TJMA 1IRAY 3PWVB 4K3HA 2OMBA 4JZNA 3GRWL 3S36X 4XNAA 3N41F 4JKNA 5ISZD 1QMUA 3U46B 5KJRH 4EVNB 4F8OA 3TH2T 1VADA 4Y5YB 4DT2A 1AZVA 2MCPL 2XWBA 5CCGE 4PSRA 1XQ4A 3T5WA 2WK2A 2J1XA 1JNLH 2Y5TB 2XWTA 4WKXA 5IG7B 4NO0B 1FFRA 4L1LA 1Z9OA 2C3XA 4UTCA 5TH2B 1AS7A 1UKQA 3UYRH 2W81C 3QT2A 1U8QA 5GS0C 3VCLB 2ZOKA 1HSBA 1ZT1B 5I0ZA 1AHWC 3AS2A 3MREA 2X12A 1O7DE 4PEEA 1OANA 2EICA 4W9EC 2DLTA 5GISL 1PF3A 5MEPB 1WWWX 1IGML 4GAGL 4BSVB 2X1PA 4FFWC 5JW4N 2YPLE 4UOW1 3GSQB 5C0DA 1ZSDA 1KEML 2CIIB 5ETUA 3S5YA 2Y2YA 4LGRB 5K9KB 4GT0A 2NY1D 2V3EA 1NIAA 3G08B 1T3FB 1A5FL 1GPOL 2A9DA 3V0WL 1ROWA 4ODHL 5EOCH 1G7HA 1E4XI 1RL1A 4WI0B 3TFKC 5J6GA 1MNNA 5IESH 4E9VA 4OLYL 2E0PA 1NCDL 1T1XA 4WZ9A 2W0FB 4WGKA 3BVNA 2EDDA 2WCSA 5F9JA 3LXCA 5GS2D 4HOWA 4WK2B 4YHZH 1FL3B 1JPTL 5GGSA 1IKOP 2B5IB 3RY6C 3D25B 4LPVA 1MCBA 3FUMA 2PYEE 5DMIH 3TO4B 4MYWB 4B3EA 4EI6B 2OBGA 5FM4A 1F6AB 4CBZA 1SVBA 1HXKA 5I17B 2P5WA 4Z7UE 1A4JB 2VZ3A 3MV8B 1NGYA 4PH8A 2X2YA 3G5YB 3W38A 1DDHA 2ADJA 3ATDA 3B43A 3GS4A 3PQYB 4QHKJ 3V5HA 3HB3C 3MRBB 3VFWB 4BK4A 3QJTB 1SMOA 5LGJB 2ZX9A 3T2QA 2EZ0D 2IALB 2OP4H 2EIBA 1JPGB 5BZWB 3GLAA 4E41D 3GBEA 4OUOA 2VZTA 3PGDB 3QIWA 2EIDA 5IVXE 3CD4A 4ZS7L 2F1EA 3VRIA 2R29L 5EDSA 1U8PB 3G6DL 3ILQC 4L1BA 3RWDA 3UJIH 3EJZC 2XIIA 4XCCL 3MXVL 4CJ1A 2MNUA 1BZ9B 2A74C 1HQRA 1OAKL 3VXTA 3BCFA 3FONA 4XP1L 3QQ9D 1N10A 4KKLD 1JK9A 4K94L 4U1KB 3II2A 4N8UA 2GPZA 4P46D 4OZHB 2W9EH 1JUFB 2VXQA 3MTRA 4WUUB 4MSWA 1WZ1L 1FL5A 1OAZH 4JX0A 4QXUL 5E2UH 3KJ6H 5LAXA 1XGYL 3OB0H 3VFRA 3CDCA 2CGZA 2VR9A 1ZA3B 1ES0A 3NFNB 4GBXA 4U0RB 5LG1A 3F12A 3UTZB 2FIKB 5I24A 3X2QB 6CGTA 1M4KA 4I3RH 4ZZFA 4ZQTA 5DFAA 4HXBH 1Q0XH 1L9RA 3NIDF 5F89A 4HPHA 5I18H 4AI7A 2K6ZA 2WB7A 3R0MA 2DQIH 2Z3FA 1CBVH 5E00A 2FR4A 5AG8A 3SE4C 4NQVA 2O6CA 2P43B 4MNQA 4DGVL 4W6XB 5I19H 2XWEA 4YHOH 2UY6A 2PR9A 4IRSA 1Q38A 3GGWA 3JQOB 1ZHNA 5T33L 4JREC 2HLFC 3EOBA 2MOGA 4TSBL 2M1KA 1G0DA 4BIKA 2A1WL 2YMOA 4XZUA 1D5BB 4TRPL 2WVUA 3C5ZD 1NFAA 4LASH 4HZ1A 3TN0A 3BD5A 5EC2A 5KVDL 3QZBA 1I1FB 5IR1A 2ZQKA 5I2IA 3PS6A 3HE7D 4OUUB 5HDBF 4NUMA 2KC0A 3MGAA 3MLYH 3DTUB 5BRZD 5AWNL 3LOWA 1ZWIA 5FGCE 3OZ9H 3E8VA 2VLRD 1CYWA 1PX3A 2AXJA 3U2JA 4QRRD 3TJHC 3FZUC 4KVCL 5IHWA 2V8MA 4A04A 1AKPA 3HZMB 1P7KB 3HEIB 3GSVB 4UQIM 3G5VB 2E8ZA 3HI6H 2MOQA 3VXSD 3IF1B 4PB0H 2JCCE 1KUMA 1DBML 2I69A 1SEBB 1P4BL 5D96B 4A1RA 4DPCX 4IKLA 4TTDC 5F21B 3VNZA 1O6VA 4ZFQA 4G6FD 1MJJB 1QTPA 4E9LA 1ET5A 2ITEA 5GJSL 1F00I 2CCLA 4G8AC 4XWGH 5MEND 5B3JF 3BQUC 4JN1H 4JPIB 2DI7A 4FJYA 4YDIL 3QEQA 2O5XH 4LF3B 1IEHA 4OU3A 5EZJB 1KEGH 2Q7YB 1ZHBB 5ERWA 5BZZA 4OZGA 1T1ZB 4ONOA 1K4DA 3DNKA 3O2VH 1M71B 1P4UA 3X11A 4WDIB 4YX2H 3EH2A 3REVB 1DEEB 5CN3A 3RX7A 2FWSA 2O4EA 3BEVA 5CLZA 4XN8A 2ITFA 5E2JA 3JT0A 4NBYB 2FYYA 3OMNB 4EUPB 1LLAA 2FTAA 5D7LA 1Q9KB 1OP5H 4I9WE 1YHPA 3G6JB 3BYYA 3UFIA 4WEBH 1QX1A 5GZOD 2IV9A 3OAZH 3MRJB 3LIZL 4KKPA 2GG1A 3CFJB 4G8EB 4KJPD 4M9PA 3L7EB 1KB5A 3GHEL 4CW1B 3MUUA 1R3JA 4NOBA 3CFDA 4I77L 4JJOA 5JOFA 3ARBC 1T1WB 2HFEB 4K9EC 1N6QL 1R6VA 3MJ7A 1CD9B 2A73A 5HYQB 4FI8A 1XF3B 5C08B 5SWQA 3V0AC 4BYHA 1NC4D 3QUYC 3OGCB 4M29A 3C12A 3VXUE 3LQAL 2Y07L 4HMDA 3FCSA 3OKDA 4MA3B 1HXYB 1L3WA 4GRMA 1AC6A 2Q8BL 5K39B 1S5HB 3G9VA 1I1AC 4JG1H 3TZVB 2Z9TA 1XWVA 4JY5H 2QZ5A 4N0CD 4TSAH 3ARPA 3QORC 2ITCA 1XX9C 2G60H 4IEFB 3JUYA 5AL0A 3NG5A 3KLHD 1AGFB 1S9VA 1AGBB 5IREA 3RAJL 2FNBA 3WLWC 3ARQA 3L9EA 5DSCA 3VM7A 5DMKA 1TTRA 4JFED 4X6DA 1NDTA 1IMHC 3NESA 1E5UI 2VSCA 3MROA 1WE5A 3MDJA 3IMSA 3L3JA 3QR1A 1FBIL 4Y7MA 2VDRB 1XGQA 4NUGL 3UTSB 4LQFL 3IMUA 1G0YR 1A6PA 2AKRB 4C57C 2A9NL 2AANA 2ZICA 4YK4C 3TO2B 1HSAA 2GHWB 4WFHE 1DSFL 5ICYA 4YXLL 3JV4B 1TTAA 2NUTB 3T3ME 1DFBL 1KBVA 3BWUC 1HEZA 2AEQH 2Y0SA 3NP3A 2VDNH 4JFDD 5KAQG 1G6RB 3KYOB 2WQSA 3GUFA 4LSDA 4YFEA 1F3RB 2BNQA 4H8UA 7PCYA 2DWSA 1TIUA 3Q1SL 3KJ4B 2FJFB 4LCUA 4LQ1A 4ICXA 4OKVB 5IUCA 4XMPL 3HVDA 3MZTA 2QHLA 1NGWA 4MDIB 2WY3B 2OMYA 2JIXB 3QCUL 2D3NA 4FQJL 5J11B 3I9GL 3F7KA 3CSTA 4JQXA 4XAKE 4Y1SA 3F7PC 1KJVA 2FB4H 5GGTA 2A99A 3V52H 4HWZB 2WSDA 4M6OL 4WU5A 3KGUA 1RIVL 1UXWB 1P4LA 4GUPB 1T7YA 1CLZL 1JD9A 1IAMA 3OZKA 4C83A 5A2FA 2D9QB 5I75C 1QTYT 1VKXB 5D1XE 4W6YB 3ZHDA 5INCB 5BVPL 2D0HA 3KWUA 3SGDH 1KCUL 4MX7A 4KKBC 5IMKA 5DRNA 1A6WL 1XCXA 2X70B 4HP5A 3V6ZA 1DR9A 4PGDA 3H0TA 1YN7B 4HCGA 1OXYA 3KPMA 4L1TA 3MGTA 1N5YH 5EN2A 1AKJA 4W9HC 3CLEL 4EUPG 1MFDH 3MI6A 3QIBD 1IIIA 4RMVA 5EU3A 3ROOA 3LY6A 3GSNL 4ZJ9A 2X2HA 2DD8L 5G5DB 2D8KA 4NC1C 1EXGA 5HGAB 1NGZA 1ETZB 1JZEA 4NKIH 4WI3A 4EN3C 5E7FA 5K9JH 1OGAE 4PMFA 1KIUB 1EAQA 2A77H 1BDYA 5ADOH 3UCRA 5AKRA 1E0OB 3CN3A 3FSVA 2DWDB 2P3YA 3ZTJG 4XP5H 3IJHB 3TONA 3L1FA 1KJ2A 3KYNB 1IEBA 1OALA 3U1SL 5EPMA 2WP3T 1BZ7A 4WWKC 3W9EB 1INQA 2GAZA 4ZMTA 3O9WC 4PJAB 2IFFH 5IQMA 1XB3A 1WA1X 5F1KC 4K5PA 3WFEL 4ACPA 5TDNB 4XP4H 3P4OB 3QO1B 4IU2B 5IMOA 3UL4A 4B3VA 3UAJA 1FYTA 5KVFL 4PJ5E 3QZLA 1MW3A 1B0GB 2OCFD 2QGEA 4TQEL 3VAEA 2XFGB 2BNRE 2YRBA 4DIXA 3U0TA 2F8IA 1BMGA 4J3OC 3SDCD 1TCRA 5JR1L 1P9MC 2ICWB 4PRHD 1MFAH 4BZ2H 5AB1A 4PRPB 5D71H 2LLLA 2RBLA 3UZEA 2IV8A 1SHSA 2KDYA 3QZPA 4ZOBA 3ZGIA 4BWWA 1PIGA 3EOAB 3OAUH 5H94B 5B1BB 3B9VA 1J9RA 3C2SA 5EU6A 3SOBH 3GXUB 4G6JH 4Z6AT 2K45A 3BZ4B 2GY5A 3F7VB 1EEZA 2OM5A 4GAAA 4HV8B 4J1UA 5E8PB 2K7PA 4FNLH 3L1OH 2B77A 4BH8A 3M8OL 3MGOB 1QEXA 4O9HH 3WN6A 5HVFB 3ABMB 1JZ4A 1OCWL 4QD2E 1O7VA 1ZTXE 4EMZA 1JF1A 2ZCKH 2ZAIA 1XH2A 2CLVB 1NUGA 3FFCA 4A2FA 1FIGH 3O0RL 3LB6C 4YZWA 2AQPA 4WF7A 3NDYE 2XWJB 3B9KA 1J0JA 4DW2H 1JBJA 5T1KB 2VZSA 4Y4HA 2CO7A 4LRIA 2PYFA 5AW4B 3ZE1E 1WFUA 1AZCA 2BS71 3QWOA 3NH7H 5HDWA 1IIKA 3RVUC 1I3GL 4EI0A 2OMZB 1AQDB 1A65A 4JCWA 3QWRA 4OJCA 2HFTA 3V5KA 4R0LC 3CZSA 3PL6B 4E5XA 1YEJH 4GQRA 2Y06H 1TZGL 3ESVF 1CFNB 3GSXA 4WEMB 2EYSA 2GYSA 2LHAA 3C6LA 1CXKA 3M17B 3MBXL 1RURH 1JZ2A 4J23A 4R2GD 2NYYD 3FU8A 3DURA 2WKOA 3F7LA 1INDL 1TJGH 4IBSA 1AS6A 3RDTA 2FEDC 1KCKA 5D8JH 1SNRA 5I8EA 4L29B 5AOKA 3QUHA 3ZIMA 3FQRA 5IW3A 5LAPA 5EC1B 2H2SD 5L4FA 5IM7B 1MCDA 3GXFA 4ILDA 4HT1L 4NWUL 4XC3L 5TDPA 4KQ4L 3VG0L 2C26A 3W0WA 1YC8A 5J6SA 2FUTA 4G6ML 5EZOH 3VD1A 1M1SA 2D03H 1ZT7A 2JJSC 1PTZA 1JRHL 5DZLA 3T0XA 3ZHLA 3SBPA 4GW1B 4ONGH 3RUGA 4N85A 1AP2B 4X5QA 3RNKB 1U92A 4WKZB 2CLRA 3MA7B 2BVQB 4RWHA 4ABQA 3NP4A 2TSBA 4GKNB 4RMBA 5B8CA 1BIIB 3FQWA 4LOUC 5GRUH 3MO1B 2J2ZB 4EAEA 1KTDB 4HCFA 3S88L 3WXWL 2FD6L 3ARDB 2YRPA 5CEYB 3BW9A 3F64A 2X6MA 2AK4B 4QRAA 5DD0L 1QR1B 2A6IB 1BPLB 2KPNA 3MCYA 2CHWA 4QOKD 4LO9A 3JWNE 2P8MB 4NEHB 4LSVH 1UFGA 3DOHA 4HJ0D 3FN3A 5CIPB 1M3IA 3BKYH 4OVUA 4EKXA 3VXQA 1AG0A 1OE3A 1GHFH 2MKLC 3GIVA 4XCYB 1X9LA 2NY0C 4G3YH 5ID0A 1Q0YL 1HHIA 1J18A 1NBVH 3ABZA 1FZKB 4WI6A 3DMMB 4FFZA 4Z7WF 5D1ZD 4YSOA 1SVCP 4HWBH 3VXPA 4M7LL 2NSXA 3TTSA 5IOPB 4LK4A 2MTAA 1SN2A 1GSKA 1T1YB 4LIQH 1WEJL 3QUXD 2G3MA 4GO6B 4HS8H 3RTQC 1ZK5A 4AM0Q 4YFLF 4BHUA 4M1DL 3FQXA 3F6LA 2B9BA 4X9FA 1Y18A 1NIFA 1UD5A 2V9UA 4PGJA 2GK0A 3QEHA 2DI8A 3EJYC 5J06A 2LTQB 3K91A 3ZTJH 2N1KA 3NEEA 1ERNA 1NMCB 3PF2A 4OLWH 4EE2A 4G43A 1LWJA 1B4JL 2RQEA 4FF9A 4XPGL 3BE1H 2N01B 2RMNA 4LCCA 5DURD 4JCMA 5INDA 2OYMA 4ZXBD 4LSPH 5I1KL 4XBPA 1CE6A 5DJ6B 5EZLB 2OXHB 3B2VH 2X4QB 4LEXL 2WW8A 5DC0A 1MY7A 3P4LA 4GS7B 2V0AA 3Q8FA 1IBGH 5AVRB 4AENA 1E50A 1QFWM 2G5BB 3DXAD 4QNPF 5DHMC 1I75A 1PKOA 1MHCA 3UACA 5CZXD 3MLVL 4UNTA 3TX4A 3MV11 2DBLL 2VXTL 4CVZB 5EA0L 4CSTA 4NN5B 3X17A 5LDSA 3VMPA 1UT1A 3ARFA 1KT2B 2NZIA 1LE9A 1ILSA 3EYOB 2K9UA 1DQIA 1XF2A 3LQMA 1L7TH 3NZSA 1KXTB 3MV7A 4S0SD 4ZUSA 1DLFL 2PPDA 3OKMB 4HCRH 3EJJX 5GGSY 5LNGA 4OLVL 4ZMWA 2NY6C 5I71B 4ZFZB 3OJMB 3U6RB 2VDRH 4C56D 1GCFA 1WFOA 1FHGA 3FTGA 4MXVF 5AVZB 4JFXB 4ZMVA 1FORL 1SFDA 1ZPLA 3RVWC 3HMWL 1XF5A 4X9GA 5DGQA 3QWNA 4PJ9D 3QUMB 5DJDB 1DUZA 4WWOA 5FWQA 1WBYA 3L3IB 5DWUH 1K2DB 3IJ8A 1MIMH 2EH8L 4HSQA 1WAAE 4A6YL 2A2QT 4XMUA 4KOBA 1PZCA 2EDYA 3NCMA 2BC4A 5DD5H 1MQKH 4HPOH 3EW3B 2X4TB 3SODB 5EF2A 4PJXA 4EDXB 3UJTH 1BJ8A 1CFBA 1FDLH 1U36A 2XY1A 3DLQR 4D7PA 4ZYKA 3RZCB 3PDOA 3LEVH 1YZZA 3ULVH 2R4SH 2VXVH 4YHYC 2W8CA 4YXHH 4I1RA 3CDZB 5MHSE 2H0PA 3NZHH 4XWOD 4GG6B 1LE5A 3D3VD 2EXTA 3MBED 5KJ7E 2VLKD 2X9WA 3CFQA 3NPSC 3VJ6B 4PVNA 1ML0A 1CPUA 3I50H 3HFFA 4NGHH 1EXUB 4PVBA 3ALWA 2KDGA 4IGBC 1D9KA 2KZWA 3AAZA 3PIQA 4KKCC 4PJIA 2X6AA 1MJ7H 2DPKA 4FNRA 4I5BA 1NUNB 3T6VA 1GS6X 1NCCL 2ENQA 4L3CB 3UZQA 3TVMD 3H6AA 2WTRB 4HK0A 4U1MB 4XNXL 5EO0A 4ZS6C 3FT2B 4XZ4A 5GGVL 2HRGA 2J71A 2AMUA 1AGDB 3L3OA 4P0DA 4HIQA 1IKFL 2FWOB 5LJYH 2GITB 1BMZA 4NDMB 1XO8A 1OP4A 4PJFA 1LM8V 5DJ2B 2Q3XA 5ACZB 1F11B 2M8XA 1QLFA 3VD2A 3OTTA 4I0PB 2H6UA 1OY3B 1IQDB 1CTNA 1Z0NA 3T0BA 4TQHA 5I16A 4N6QA 2HG0A 5AOLA 3HR6A 2A9CA 5KYYA 3FK3A 1I7RB 3AU0A 4K7PY 3ARED 4XH2B 4HH9B 4JE0A 3FYIB 4N1EA 2E3VA 3RWJB 1JF6A 4NC1E 4AGOA 4RESB 1WBZA 4PRIA 2A6JB 2ZAGA 3QXDB 1NQBA 4U6HA 3CZFB 4QPEA 4MD5B 4M56A 2DKUA 5LGHL 3KDMA 5CEZE 4O4YL 2DQUL 3BVWA 5GZND 5K9QG 1FV1B 1U3JA 4JHBA 4FADA 3RJOA 1A1NA 1LK3H 1FCCA 1MFBL 1XSIA 3ELQA 4QHMA 1W80A 1N59A 4L8DA 1RZ8B 4MNHB 2P7TA 5E03A 4QTFA 4YAQB 4WWNA 2AK1L 3GSOB 2ZJSL 2E9JA 2Q9OA 4LLDB 3WTWA 1A0QL 1A3QA 4MCNA 3MLWL 4CGUB 5DVPA 4JO3L 4DZ8A 4LPXA 5HTSA 1E6JH 2DWXA 4WV1A 3CBRA 4ZOEA 3BKCH 2G30A 1CFSB 4QAMB 1A7BA 1TKWB 2WN3A 4PY8J 2FAUA 2WVSA 1T04B 3S3CB 4Q2ZB 2CO1A 4V1DE 1YDPB 2I24N 4NKMA 1QZ1A 3KPLB 3T71A 4OIBA 4YC2C 4QR7A 4CVXA 1QLRA 4XPFL 4ZAKD 2YBRB 4ZUVA 3EDJA 4UIMA 1JHKH 3F5WB 2CD0A 1L5GA 1CTMA 4AIOA 4F20A 1J5OH 3VFMA 1C5CH 2ESVE 2G2RA 3CFCH 2R9HD 5KSAA 1WTGT 1U8CB 3WKQA 1IEAA 4QF1A 3A4FA 3VX1A 1R3IH 4ZO8A 4DKFH 1WIPA 5E6UB 1AAJA 4EDWL 1RZ7H 3HG5A 4EVNA 1SLUA 3VVWA 5CM1A 2YWZA 2Z0BA 1G9HA 2EDBA 1U33A 4PJ8D 4NM4L 5E08L 2D31B 3U0PA 5T8IA 4JM2A 2BHZA 4W9IC 3DX4A 2ROXA 2WQ8A 3NCJH 1SYSB 4ALAC 1ZV5A 4TNVF 3NCYS 4L9LB 5GSRB 3BWUF 1D7DA 3HG2A 4DVRL 5A16A 2YQ2A 2AGJH 2Y5TA 3GLEA 3W11D 5G4OA 1UACL 5C09B 1H5BA 1CDBA 3DK0A 1YEEL 2LLNA 1X5AA 5E99L 4HIXH 4ZW8A 1LO4H 3DWTA 3J07A 4JZJB 4LAQH 4NQSA 3I2CL 1JHLL 4AY0A 4E36A 5DD1H 5IB3A 1UUSA 4LKCB 2YAOA 4ECNA 4XE5B 1ZE3C 1IBZA 4KBPA 3RVTD 4IBLT 2WPGA 2DICA 2HX8A 1VFUA 3H2WA 2OL3L 4NQXB 3QUZD 4TN9A 3BPLB 3IDIB 4K2UL 2AQQA 3GSQA 1VFAA 3QIWC 1L7IH 3RA7L 4Y89A 5EO1A 1QKZH 4TSCL 5GIRA 4BRJA 3MRGA 3RPBA 4M5TA 5BO1H 5JPMB 1BVLB 4YSSA 3MJ6A 4IBZA 1BVZA 3BUQA 3MTXA 4WI0A 3ESOA 1OLLA 4FQCH 2XTJB 2EIMB 3V10A 2R4RL 2F68X 2W0FA 4U31A 1B0WA 3NRFA 3SDAD 4KZDH 4KMQA 4EI6A 3QQ4A 1SY6H 2QHRH 4AW7A 1NFKA 1F6AA 1YSOA 4MB4A 2R0KL 3GMMB 5ENWB 3OF6A 2CKBB 1A4JA 1CLCA 3V8OA 3EG9A 1RFDH 3MV8A 1TFHA 1URLA 3G5YA 2AQTA 5DFTA 3KBFA 3EGDB 3FOLA 3CN4A 3DIDA 4GBXC 4L8BB 2C1OA 3VGBA 4NZUH 1MWAB 4BZ2A 3DX1A 4YHKH 2R1YB 5JMOC 3NK4A 2EE9A 1B3JA 2IALA 4GEJA 4WNQA 5CIPH 3W2DH 4QMEA 4PJDF 4XC1H 5HHOB 4E9SA 3DJSA 4EI5A 1UM5L 1ROCA 1CK0H 1G6RL 1BOGB 1U8LB 4JM0A 3F00A 3RJDA 1AR1D 4DESA 2DEXX 1JZ5A 2WXQA 3HC2A 5TQ2L 1BZ9A 2OXGB 1TETH 4CU8A 5EU4B 5DZAA 2VLJA 2ODHA 4B9YA 4IRSC 5IKCA 3GKWL 5I0DA 1FWXA 4U1KA 5ICZA 1C12B 5BV7L 3L45A 3WHXA 1JUFA 1IGFL 1MSPA 3BH8A 3TN0C 2B2XH 4J3OF 3RL1B 4YHNA 2HPTA 4EIBA 4TYUA 4H25B 3N06B 4GSQA 4J6RL 4QRTB 3FF7A 2Y2TA 1CFVH 3W1ZA 3O4LB 1MF2H 1ZA3A 3NFNA 4QYAA 4G72B 3UTZA 2FIKA 2VXUH 3FCTB 3QDJE 5E9DD 4TNFA 1UM6H 2G0LA 3P77A 3WFDL 3VGHA 4YPGA 4WO4D 3NTCH 5KBNC 3U0WL 2VZVA 2LAAA 3ZY7A 1V55B 1QSFD 1S7TB 1RKRA 1MFEH 3JZ7A 2UVEA 2CJTA 3A3YB 2V33A 1WFJA 2C7UA 4JRYA 5JIKA 4JL2A 5LKNA 5DRXB 5DQ9B 1D5BA 3WNJA 1JGLH 5GRZA 1BVNT 2VDQL 2FWLB 5LXVA 3WFBH 2TAAA 3FCGA 4D9LL 5DXWA 3ZOAA 1N8ZB 2C9XA 1BLIA 3BX7C 1T22A 4UMSA 3MUGB 2X4OA 4MLSA 1XD0A 4R7VA 5FK9A 4ABWA 1I1FA 2UXVA 4RCAA 3PWPD 1PLGH 1QWUA 3QFJA 4YSRA 3CIAA 3LZNA 3SY0A 5DK0A 1RK1B 5E95B 1Q4NX 1IC5L 1XVSA 3FU5A 1EEYB 3HE6A 4D94A 3TEWA 5E8NA 5FIEA 5L2KE 3QE5A 4IYKA 4KKNA 4XB3A 1N5AB 4A7GF 2ZP9A 3HZMA 5MEQB 5FYLL 4RAVA 3L5XH 3G5VA 3IF1A 5L6YH 3GWJA 1OW0A 1MJUH 3NFSH 2YEVB 3L9RB 4BBWA 4M48H 4D3CH 5AW2B 1MJJA 1E42A 2WINB 4IJ3C 3GRWH 4UAOB 4Q9CA 3RP1A 2HJLA 4YDLB 1FE8L 1LYQA 3ARGD 3VFTA 5EZJA 1VLXA 2QVIA 4F7PB 2Q7YA 4L2LA 3MXWH 3MV9D 3ZDXF 2IQ9H 4J27A 4BXSV 1VGKB 4HX1A 2DOCA 3MPCA 2AJVH 3HS9A 4HHAA 1ACYL 1KENH 3GZOA 4KJYB 1JG9A 3N1GC 3RLSA 1IM3B 3LKNA 3GHBH 1OE1A 4J4PA 3WJMA 4AKQA 4RISH 2FWUA 3RWIB 1E5BA 1Q9KA 1CFQB 3S5LA 1SGKA 3G6JA 2GI7A 2OZ4L 3K3QA 2IAMB 5EEXA 3MRJA 4PGBB 3ULUE 2JJVA 3D05A 3KEDA 5JOEA 3CFJA 3DRTA 5M7QA 1JHTB 1OT4A 1RJCA 3P0YH 4N6RB 3F58H 5JHDE 1EK3A 1T6VN 4CW1A 5E1AB 1FNFA 2H32B 3LKRA 2Q3ZA 1QOKA 4IBVA 2YPKA 5DUPL 2VW4A 3T8XB 4MKTA 4BZ1L 2FJGB 3D39D 3Q48A 3I02B 3WKMH 4TVSa 3WU1A 1X7SA 1XF3A 1PL3A 4NP4H 1DVYA 4B50A 3QDGE 4DGUA 4OM0L 5EBLA 1CT8A 2Z91A 4IIZA 1AQ8A 1EH9A 1X9QA 3EYUL 2GJ6D 3TXAA 1MNUL 4FE9A 1VPOH 3DVIA 4YEEA 5D1QB 1S5HA 4Y9CA 4P23D 3WN5B 3J27A 3EJUA 4AX3A 4GFXA 1JZ8A 1ETA1 1UYWL 4A2GA 4NO2B 4G9FA 1GC1L 1JK8B 3P9LB 3DPBB 1QFOA 4QUOA 4Z3EA 1ZLSH 3IU4L 1RZGB 3HN3A 2P5EA 3KYMB 5B38B 4JQXC 4Z7VB 3K7UA 4U6YB 4HCRA 4W6WB 5FEBA 5E70A 4P2RA 4KHTL 4ZDHB 4W9JC 2ENYA 3FT3B 4AQZA 3UTSA 5C0ND 1PFCA 3VWKA 2AKRA 3N41B 4PV1C 3RBSA 5AW7B 3BGFC 4ELKA 5J13B 1X5YA 2OV0A 1E8YA 4F2MB 4K5NA 3AG1B 5DUBB 1TZOA 4OZ4B 3AADB 1J8HD 3ZTNL 1P7BA 2BLFA 1OHQA 2NUTA 4D7BA 3VXRE 4NN6C 1JTPA 4HKJB 4DO6A 1A8JH 3KYOA 4AEIL 1WZ1H 1AR2A 1OTSC 2HMIC 4U6TA 3UTOA 4MWFB 5C0AE 5HYJB 1PKQA 1G4MA 3SBRA 1AZBA 2WVTA 3RKDC 1YNTA 4Z8FL 1RUMH 2JIXA 3VTAA 4FQIH 1NGPL 1OVZA 2DAVA 4LLQB 2A0LC 3S7GA 1R46A 3D0LA 4RFNC 1MHHA 1PEWA 2E7HA 5I8OL 5DRWB 2XIBA 5SX4I 1CL7I 1FH5L 2CNYA 1MFCH 3I6LE 2WQRA 4NCC2 1UXWA 1FYHB 3HOGA 4AW4A 1FVDB 4EPSA 5FCSH 1K4CA 3P3SA 3SGEI 1PNCA 4FTVE 4JFZL 5E94A 4DGVH 2IQAB 3KPSB 2NXYD 3BO8A 3QI9A 3L95A 2XV2A 1ZLDA 3BXNB 4MA1B 2UWEF 3BP5B 3AMKA 3MJ8B 4YL9A 3WD5H 2CDFA 2X70A 4OD3L 1H8LA 32C2B 3AT9A 5T33H 3MLPA 3LV3A 2J3SA 2R2EB 3PUCA 1WISA 2Q8AH 4TSBH 4LEOA 3S37L 4B7LA 3IS1X 3UDWA 3UAJC 2BY2A 2GFBA 3NN8B 4HS6A 2DM7A 3ZDWA 1EUUA 3ENEA 4UZSA 3S96B 5E5UB 5KVDH 1R24A 1UCTA 4Y19A 1E2VA 2O30A 2PLTA 4JHAL 3VUAA 3WIHL 1TTCA 1KFAL 3U4EB 5DMGD 1HDMB 1WG3A 5C07E 2FEJA 4NRZA 4QXTB 4WU7A 3D2UB 5EOQH 1F86A 4MB3A 1WSST 1JXKA 5GRWA 2YMTA 3NRPA 4LGPB 2YKLL 3V0GA 3CN1A 3CG8A 4XPBL 4LEEA 4F7TA 1OSZA 1ZLVK 3CVIL 3W9EA 5F3BB 5JYLA 2ADGA 2P5WE 3K46A 1QNZH 3DO4A 1CCZA 2MHAB 4AGNA 1DBMH 3QXAB 5EO9B 4LPUA 5CMAA 2FH8A 5JQHC 3ESPA 5IHHA 3POHA 5TDNA 1XTMA 3O2DL 3P4OA 3V0EA 2XZCL 2VZ1A 3IJYB 5GJSH 5E2TL 3Q44A 4IU2A 4A63A 5IJCC 3APFA 2ORBL 3V0DA 1B0GA 1S2EA 1X9UA 2VL5A 4YUEL 4POZD 4PJEF 1PZSA 3UG5A 2CKBH 4BM7A 1KTKE 2ICWA 3B9KC 1J05B 1D7CA 4P4RB 4Y4HC 3IRZA 2WXMA 4LRIC 2FX7L 5B38G 5I1IL 3MRLB 3BUBA 4PJHE 4XN1A 1IL1A 2Q76A 4L4JA 5ABZA 2CGRH 3QUML 2XRAH 3VWJD 3C75A 4MJIE 5CN1A 3EXJA 1BQLL 5EU7C 2XNAB 3ML9A 4MDJA 4C4KO 5HPMB 3NIDB 5FCUL 3B7SA 1AO7B 1GKEA 2ZKHL 1MCPH 4FQ2H 1X5IA 1LK2B 2ZSVB 1RJYB 1S9WA 4XO5A 1SXNA 5FAAA 5F6HI 3SD5A 2D2OA 4YVNA 4H8QA 3ARRA 4W81A 1D5MB 3EYQD 3C6LC 3CFBA 4G6KH 2OMWA 1T2XA 3GHEH 4AITA 1NMBL 4M7KL 4HV8A 1XB6A 4H0LC 3QC6X 2RH0A 3RDTC 1TLMA 3MGOA 1UFUA 4PJGA 1FNHA 3P02A 5AZEH 4QRPE 5DJ8A 5FYLD 4HUNB 1IFHL 2PCFB 4JFVA 4G7YH 4PP1C 2CLVA 2V6HA 1VFOA 2QMJA 3MLUL 3MRCB 4HD9A 2F7OA 2Q8BH 4HUCA 1WWAX 3G6AA 1CICB 4AUJA 2X7LA 2OMZA 4YE4L 1AQDA 5DQJA 3IU3B 2PR4H 1NJ9A 1NIBA 4UQ2B 3H4HA 4QGYA 2YPLB 3V9CA 1I8KA 1NPNA 4NM8L 5B8CC 1V8HA 3KEHA 4UB0H 3AMLA 4XMVA 4E41A 2ICEA 1PS3A 1CFNA 3KD4A 5JW3H 2F19L 4JFFD 3M17A 1U2HA 4BE5A 4WSJA 2DLEA 5HYSB 1QZNA 4XXDB 4YE0A 3CZGA 3A24A 4LLWA 1PDKA 5KVGE 5SWSD 1UD8A 3GMLB 4OLZL 3H56A 1X5HA 3ZT7A 3NA9L 3QS3A 4M7LT 5F3HA 4D0BB 2GJJA 4KRPB 2P28B 2X4SB 4ABUA 5AAPA 5KW9L 1DSFH 4GXFA 3LNGA 4YXLH 2PYEB 4DH2A 3ARWA 3O8XD 5L0QC 4K3EH 2ED7A 3ZYZA 3GRGA 2R0LL 1BD2B 4BFBD 2J44A 1M6OA 1TITA 1H0DA 2WSKA 1Z5YD 2P49B 3BIKB 3Q1SH 1OTUD 1QHQA 4LCWE 1AP2A 5FYKE 3FRPB 3N04A 3P0VL 4WKZA 1QSEE 4OLUL 2YEZA 4Y16B 3QCUH 3HFML 3K81A 1T0NA 4J8QA 5IVXB 1BIIA 1XIWD 2CH8A 1SY6A 1BX2B 2J2ZA 1F4YH 1KTDA 5IEKB 3ARDA 2F54E 5CEYA 1QLEB 2X38A 4M6OH 2P4AB 3UTPE 5HGDA 2LR4A 4DO5A 1KBBA 3KWTA 4CA4A 3OR6B 3GEWB 5ITBH 4EO5A 2P8MA 5D7LE 2XU9A 5C3TA 3K6SB 1U8OB 4H7VA 2NX5E 1SJHA 3HR5B 4LCCC 5CIPA 1TQCC 4PTTA 4XCYA 1I3RB 2LW3A 3L3HB 5IB2B 3A21A 4FXKC 1WIOA 4Q0XL 3QIUA 5AOMA 5JHAA 1NKRA 3KGTA 4HC1L 5DU7A 3C5ZA 3DMMA 5CBEB 4YHML 4BA0A 3FO1B 2HLAA 2W59A 4H88H 2QSCH 1I9RL 2W65B 4KVNH 1T1YA 3EO1A 4YBQC 4W9LC 1J5CA 1A3LH 1M7DA 1Z9SA 4YQXL 3ARFC 3TURA 3T2NH 3SDYL 4P2OB 4M6ML 2EDNA 5IB4A 1WFNA 4XNMB 4E9WA 2VR6A 1UOVA 1S7WA 1OSPH 4RMUA 2AK4D 4S1SL 4HPYL 2H32H 3V9EA 4L37B 4P57B 1RAMA 1S5IH 3NACL 1JTTA 4UQDA 1GGCH 1AE6L 1FZJB 1MLBB 2HRLA 1O6SA 3ISRA 3KXFE 5F88A 1E7VA 3JTTA 1A6TB 1HWGB 5EZLA 1BZOA 2J1ZA 2SEBB 1WDAA 3FBKA 3DO3A 3C6EA 1IM9B 3MOAL 3QJRB 2X4QA 4N0UA 2LFEA 1PCXA 3GBNH 4RGMB 1Q9WB 3RU8L 2OSYA 2AI0H 2YUWA 2C3VB 2L8AA 5D2LE 1J5IA 5J3HD 4UTBL 4OM1L 3W9DA 1MHPH 3EUUA 4KXBA 5FGCB 2DB8A 2WLIB 4KI5C 3EYOA 5DJZB 2EYTB 2FLBT 2PTUA 4X7TA 5J12C 3EFFB 1X4XA 2JSFA 5HYSG 3OKMA 4K7PX 5FO8A 2DQHH 3QCVH 3RKPA 1QABA 5GZOA 2JCCB 3EOYG 2WP3O 4IOSA 4ZFZA 2BNQE 4CNIB 3HS0B 1HCVA 5F70A 4E9TA 4UM8A 1AH1A 4F7CB 3ZMEA 1N7MH 2GEEA 1SOSA 1KZYA 5FM5M 1D9KC 1QNIA 1D6VL 4GRLB 4RIRB 1JZDC 5DJDA 5AAWA 4IBUA 4TLKA 3SE9H 1K2DA 1TF4A 3M8OH 4NKOB 1T2QL 3CH1B 1M05B 2L7UA 4H2AA 1NC4A 2IPUK 4XNYH 2AHIA 1CR9H 1CWVA 3RI5F 5JHLL 3FRPG 3CE1A 2HKHL 3DO7B 4X8JA 1IBFA 3GRWA 3L3OC 2ITDA 4M5YL 3CFKB 5JNYA 5AQ0A 1H3UA 2XJKA 4OZGF 1UEMA 3CXHJ 4UIKH 2WQUA 3MRIA 2QQNL 3WTTA 5DUJA 3AGVA 2N0MA 1A7PH 4KUZL 4L23A 4FLQA 2RALA 4XPTH 5TD4A 4KO9A 2UZYA 5T3XE 3DJRA 4ZMXA 3GEFA 2Z93B 2CO2A 3KPPA 2WXIA 3OZLA 4UV4L 3VJ6A 4L5FH 3RGBA 3K1DA 2XPGB 3PDGA 5E1HB 3RX9A 3DOIA 3ESNA 2OI9C 4HETA 3E9UA 2V37A 2XN9E 1INDH 1CMOA 4XMWA 4S2SB 4WFFE 3ZKND 5TE7H 2MSPA 2QKIA 1BEYL 1U3NA 3VXUB 3TJPA 1JYXA 4ZX5A 4DCQB 2P8PB 4NWUH 3UC2A 4KQ4H 3FT2A 5D5MA 3PJLA 3SQBB 1MIEH 4CAGA 4ZD3H 3OX8B 1NIEA 3C8DA 1XBDA 1LVEA 3P3TA 3TIEB 4J3XA 2FWOA 3RZCD 3STZB 2GITA 2HG5B 3BWAA 1JRHH 4I88A 4NDMA 5DJ2A 5HI3D 1TQWA 4PRNA 2NY3C 2XWXA 4XHJD 3NJJA 4WV1C 1OAUL 2XQBL 3GI8H 4W4OA 2IGFL 3DETC 3MLZL 1A6ZA 3C8KB 4AL8L 5KVEE 1CFMA 2FD6H 3FT0A 1R5IA 1GGTA 2CPCA 1YUHA 1TNNA 3U4AA 3D4ZA 3DX9B 3FO0H 2ERJB 1L6XA 3HG0A 3TP4A 3Q8AA 4X6DF 5ILTH 3MX0A 2RHEA 1OHZA 2CO6B 2VE6B 5KSAC 4CUCA 4JFWA 1YEDB 3ZW3A 4MNHA 4LSTH 1MI5E 5EU6E 3IMWA 2GJPA 4P49A 3ZDZF 3HRZA 3LEXB 3PGCB 4AQ1B 4G80B 3QIBA 3EO9L 4LLDA 4HUVB 3SOTA 1RP8A 2WBWB 2AJ3A 2Y23A 4JM2C 5F7YC 5IJBC 1F4WH 4MRBA 3C5JA 3HJEA 1XGRA 4I0PD 4OCSL 1IC7L 3AU1A 3NIGE 1FJ1A 3WE6B 5FECA 1TKWA 2CMRL 4GYBA 5E0QA 3T6ZA 1H5BC 3WEAA 4G42A 5EZIH 5HI4D 2YMXL 4FJ6A 4AZUA 4L4VE 4Q2ZA 3WAKA 3C08L 4LGSB 4JFYA 1A7NH 2BVPB 3TNMB 3HNTH 5D1XB 4R4NC 3IXAB 4MVBC 1X5JA 3S3PA 5EF0A 2DM3A 4XVTH 1B4JH 4PLKD 5AVXB 1JWUB 1WK0A 3L2LA 4JKLA 3D09A 3N9GL 4G8GB 4XNQA 2K0RA 1U8CA 2JH2A 5AYUL 4ATWA 1YAIA 4V2CB 1J8KA 4JG0L 3GI9H 4M7JL 1A9BB 1YEWA 3QFDB 2KQMA 2HZHA 4H8WL 1HZHL 5DS8A 2R23A 5AW0B 2EXWD 1LD9A 1MREH 2AFNA 2BK8A 2JI2A 2JWYA 1SYSA 3AY2A 3G04A 1OGAB 4L9LA 4FQQB 4S1DC 4ZPTA 3F62A 3NPZB 5KSBE 3NEXA 1ORQB 4GKLA 2CO4A 4AYID 5AYTA 4G8FA 3OV6A 3IDJB 5LXGH 4JNXA 2X3BA 4L1HA 2FO8A 2GW5A 2NNAA 1KGIA 2FEEI 5EBWB 4N87A 1CG9B 2K4WA 3HC0A 3JWDH 4JZJA 3HZ3A 4LXFA 3WTVA 1YPZA 5D72H 1BV8A 3ZU8A 3RUGE 1ODUA 2WXJA 3DVFA 1A6VL 3D18B 4KTDL 4ETYA 35C8L 1JOIA 1S7UA 2X28A 3EFOB 4FP8H 4TS6A 3PP4L 4KMTL 4EI5C 4J7RA 2D7MA 4PJ5B 4QLWA 5DUML 2PTTA 3ROLA 1FFOB 4UU9B 1R3HA 2BNRB 1DZ0A 3EJPA 4Z7OE 1MDTA 1MCCA 1I1RA 1BVLA 3A67L 1MW1A 3ZZQA 4Z7WB 1E5ZA 3ORJA 3SDXA 1AYOA 1DJWA 1HEHC 2QV2A 3E0GA 5T1MB 2D7OA 1OL0A 1TQTA 3MRDB 3MRQA 3GSRB 2BY3A 1JWSA 4X99B 4CC4A 1H3XA 4JFTA 1F97A 3D6GA 3GMPA 5C09D 2JI3A 4NO3B 4OBRA 4E0RB 3ECBB 4RAHA 3S36L 3GK8L 3Q05A 2KYIA 3GMMA 2GTZB 3KPNB 1QLEH 3B6SA 4JRXA 2CUAA 2AXWA 4B9PA 4YOKA 3EGDA 3QDAA 3QDME 4U0RC 3HB3B 4G2AA 2FCBA 4B9KC 1MRFL 2R1YA 4E9XA 2RGSA 1LO0L 1K72A 25C8L 4JHVA 4BWUA 3LD8C 3QA3B 5JO5A 5HHOA 3LS5L 1QASA 2VLMD 4I3SH 1U58B 3QG6B 4KY1L 3EO0B 1NFIB 4A7UA 3L7FA 4NHUA 1BOGA 1BAFL 1OK0A 2FK9A 1OSYA 1AQKL 1NCCH 4UM9A 4HG4K 1OOAA 4F33B 2ZXCA 2OXGA 3V6OA 4CKVX 1BVKA 2APTA 4QIRA 3ULSB 3QNZB 2R69H 2XTJD 5I1AB 3II3A 3QFGA 5GGVH 4WJ5B 3ZE1B 7FABH 3RY5A 5E1GA 3KYKH 4YS4A 3NIGF 3WLBB 4FL4B 1TJXA 3D0VA 2X5PA 3FU6A 1UWGH 4OQTL 1NCBL 3AWGA 5IGXH 5DDHB 2X1WL 5I0XA 2QR0A 1J0YA 3NAAL 3O4LA 3FJTA 1XH3B 4OT1L 3MMEB 2HJFB 3W5MA 2X4PB 1JVLA 2VN5A 2F5BH 1VCAA 2GABA 1QO3B 1YEGH 3KNBB 4OJAA 3HE6C 3HG4A 4MAYD 1JTOA 3FH7A 3M7OA 4KKQA 2I5YL 2RCSL 4TVPL 5CLTA 1I3VA 4URKA 5EG6C 1F4XL 1HHHA 1GSMA 3MV7E 4TQIA 4ZK8A 43CAB 3DARA 3ILPB 1W0VA 3QPXH 3QQNA 3OLEA 2P26A 1QR4A 3PWLB 2IBBA 3VFGH 1OW0C 1A7OL 3O6FB 5JW5B 3ZQWA 1QVOA 4JUSA 5IFHH 1S7TA 2BX5A 2WKOF 5TK4A 1MCJA 1MCLA 3PY9A 4DN4L 3IMVA 1GZHA 4JREB 2VLLB 5DRXA 5DQ9A 3N6YA 3HRPA 3BKMH 3MLWH 4M61A 4RGOL 4D9RD 3K8MA 1X5XA 3NJGA 1H15A 4AYSA 2IAND 4JDZA 1GW6A 3MUGA 1ZHKB 2JKXA 5EBMB 2V17L 1NCTA 2IPKB 5FHAL 2QJDA 4DO4A 3EYVB 1E6OH 4G6AC 3QH3B 4PJXE 1MEXL 2LQRA 4J4PC 3CVHB 4XOCA 3T4YA 3ZE0F 4RRPA 2YAHA 1WH0A 4J39A 4HAFA 4LBAA 2JK5A 3QBTB 1QRNE 1UADC 1ZVNA 5F7AA 3RIAK 4KK6D 1N5AA 1NC2B 3CC5B 4MS8C 3CSYB 5DHVB 2ZWSA 3L4WA 4RFEA 4Z7OF 1JVOA 1P1ZB 3O81A 3MRRA 1G7QB 3FOMA 4LKXB 5C7XH 1Q0EA 2CNZA 1VESA 1SRDA 3PJNA 2WINA 4EXKA 5KUMA 5GGQH 4DP4X 4JO1L 2KMWA 3T09A 1BQKA 1BBDH 1XDTT 1XR8A 2ADFH 3EAKA 1SM3L 5FM5O 3AT8A 1XGTA 4F9LA 3WOVA 4AE0A 4F7PA 4PJIE 3D9AL 1N8OE 3HPJA 1NAML 5DD3L 3ECWA 4DVRH 3VFNB 2Q0ZX 1QFUL 4Z18A 1WGOA 3HG1D 2VNCA 1INEL 2XV3A 3MOBL 1YEEH 3S34L 2KLTA 2KPWA 3FO2B 4K5MA 3RVXD 3K72A 4PSPA 4MXWH 1JGDB 2P80A 4NT6B 4UNIA 3D2TA 3PWUA 3GSNA 5KSVB 3IDNB 2BXZA 3BN9C 5EIVA 1MWOA 2VCOA 1OARL 2PW1B 2YD8A 4FNTA 3RIFF 4ELDA 1X9RA 3T65B 4PGBA 3F8UB 3V4VL 1JHTA 4XPHH 3ETTA 1QI5A 1EFQA 3L17A 2E4FA 3RA7H 5BRPA 4DAGL 3LS4L 5ABAA 8CGTA 1GS7A 2GSGB 3T8XA 3VWKC 3MCG1 1WA2X 1RCYA 2FJGA 2PCXA 4PRIE 4XMKH 5D7IA 5IQLA 3I02A 4YO0A 1KF9B 2I85A 3CJJA 2HAZA 3M45A 4GXUM 5CF3A 3WV0A 1AXSA 1NCWL 1IAIH 2Z92B 2ZUWA 1L9NA 3RJQB 3V79C 3D85A 1T21B 3C9NA 3MJWA 4OF5A 4YDVB 3B7YA 5AVTB 1GGBL 4YXKL 4AKOA 4KO7A 4AV5A 4K7FA 3QCTL 3SPCA 2OPCA 4CN6A 5IMLB 2X1XR 4U3HA 4ZX3A 2R0KH 1I1AB 3WN5A 5ALBH 3LYRA 3QNYA 4J3WA 2B16A 3UH8A 2YZ1A 3MBEA 1AHMA 3OLGA 5JIHA 1SF3A 1T83A 2VLKA 1JK8A 2IAMD 2PCPB 3MUJA 4FG6D 2HP4A 5J11C 3T2OA 2BWDA 2NNFA 4OFDA 5EEUA 4APXB 2Y6SC 4ODXB 3V55A 1F6FB 4G5ZL 3ULVC 4L4TE 4F7MB 2XG5A 4I48B 2CLZB 4ZDHA 5EEVA 1F56A 1E5YA 2CR0A 4NJ9H 1AZRA 4DKAA 4K73A 2BVOA 1V7NH 3L3DA 3U9UB 5T5FH 4F2MA 3QI9C 2P44B 5DHYB 4ZQKB 1UVQB 1XZ0B 4YK4B 2Q2LA 2OR9L 4YSQA 2NLJA 3KZ8A 3V5DB 4MTMA 2YOCA 4JKMA 2XDHA 3GKWH 1A6UL 2Z4QB 2WBJD 1RLWA 2NY4B 2XY2A 3HUJA 1JZ7A 3UDWC 4P4KB 2AQSA 1GTFA 3MVSA 4DOHE 1DBKH 5D1QD 2J8UA 3JWNG 4JAMB 2W9DL 5IW1B 5HYJA 1MCFA 4PJXF 3FULA 1PNDA 4OFVA 3WY1A 1RD6A 1CGWA 2BERA 3HBGA 3GZKA 3JTSB 4M62L 4YGVB 4KI5F 4OIFA 2FJHB 3P73A 5ECGA 2X6BA 3KCWA 4X5XB 5F7MC 2OFQA 2ZG2A 4PIRF 4LEBA 3RYMA 2GCYB 3PAUA 4OBSA 1KTJA 2BVEA 5TFSL 3PNRB 3WMPA 2DQTL 4TUKH 1SYVB 5GZNA 3SPJA 3VDAA 3WSQL 1GTNA 4NKDA 3H3PL 5AG9A 2PWDA 2F9BT 5DJYB 3WNPA 5CJQH 1DBJL 2DIJA 1QQDA 2ICCA 1FRGL 3BP5A 1PG7H 3E1F1 3MJ8A 3CU7A 4PJIF 5GQBA 2AITA 3BAEH 2HJKB 1F41A 2V4LA 5B4MC 2XFXB 3DVNB 4P9HH 2DQFA 2HTKD 4B9CA 1DHKA 4JKKA 4WTZG 4BFIB 1KXVA 2YN3A 3BKJH 1PSKH 3TA3D 5BOZG 1UH4A 4APQD 4HH8A 1PIFA 4UTAL 1DEDA 5EN3A 1KXQA 3AJ7A 3BJ91 4U3SA 2VGLM 3VH8B 5F7LB 1V05A 3DKHA 2CXGA 4HUWB 3SPGA 3FBQA 3VSUA 4PB9L 4BCZA 3TT3H 4PJFF 5I5RA 1SQMA 2A4EA 1MH5B 1K8DB 3KR3H 3RWFB 4BFNA 4L3ED 1BSIA 1NWPA 3BDBA 3D2UA 3PWNB 5FGBA 3I6SA 1C16B 2VR4A 4R7DB 4DK6A 2UY7B 1Q9OB 4DUVA 1BQRA 3FUKA 1P2CB 3FAWA 3O9WB 3KPSD 1XGPA 2DQDH 3I6KB 4M03A 2G0KA 5EO9A 4IMKA 3WEXA 1NCHA 1R75A 1ZTMA 4HJEA 3EH4B 3GJEA 4PGCA 4GKZB 5TGBB 3IJYA 5I6PA 4DN3H 7CGTA 1FE8H 4TVPD 3K2MC 3PHQA 4HHGA 1EHXA 1PVHA 4H0HB 4GAFB 1BFOB 3M1CA 2H2PC 3QHFL 4ERSH 1AANA 1ZV9A 5FB8A 2V2XA 3U36B 4W9CC 1W2KT 1WFMA 2A6KA 5GRYA 5FM8A 1S46A 5KSUA 2IH3B 2B1OA 4V1DB 1YEFH 2G9HB 2XVBA 4XN5A 1X6LA 5LBSH 2QL1A 4LLVA 4XOEA 3MRLA 1XR9A 4CADB 4ZMAT 3VXNB 3KPRB 3SPVB 2JLLA 2ZXAA 4Q9QH 2O61B 4ZT1A 1CJYA 2ZF8A 1OAXL 2ESVB 4OIAA 4CU6A 1MHEB 4JGMA 1CD8A 2ICEC 3R06A 3QUZA 2IDQA 2CJUH 4BFKA 1QYGH 2OZNA 3LSOB 2V5RA 4ANWA 2Y36L 2ZPKH 3C8HA 5AL8A 3CXHK 5EHFA 2BNUA 4CMMB 3DI2B 4PJ6A 4P3CH 3BYTA 2C7FA 3EFDL 1J1OL 4X0KB 1Z5LB 1H6EA 3L3KB 3T6QC 1B6DA 2VH5H 5E9AA 3UP1A 4M93B 2GBTA 3UBGA 4JFHD 5FKPB 1E90A 2VRQA 1RLBA 4I7ZC 4Y0GA 3T6WA 4P2QD 4TV3A 2A9MH 4JM2F 4JRYE 1G5AA 5E2VL 1T4WA 3EF7A 2Y7QB 1CICA 4TULL 1OAQL 1KZQA 4LU5L 5DHDA 1G9ML 5HHNB 3ZL4H 3K2UH 1GC1H 1AXTL 2N1TE 4RWYL 4F91B 1IB5A 4B9JA 3T4AB 4EZLA 2AS5M 1DJGA 3MACL 3ARDC 3B7UX 4JO5A 4D0CB 1RUPH 2PO6B 3AROA 3KWWA 4ODVH 3ZIYA 5A2CA 1GOFA 5T5NF 3QFJE 5DJAA 1QUPA 2R1XA 1S9XA 3I84A 4F1SA 5CZVL 1XFPA 2IADB 3P4MB 4LSUL 1RULH 4A7SA 4IQHA 1L9QA 4HDIA 1HI6B 2BP5M 2R2CA 1NKOA 5J9PB 1HOCB 2X4NB 3N43B 1KYAA 1G6VK 1K6QL 3APMA 4OGXH 4UT7H 3VH8G 4TL4A 1NAKH 3MYZA 3QIUC 4I2XE 3CPLB 4O58H 1RVFL 4RSVA 2FJUB 1HINH 3DMMC 1CDCA 4Z7UA 2Y25A 4MXQC 4AKPA 4AEIH 3LKQB 4NO5B 2HWZH 3IWVA 3TBYB 3HC4H 3TBWB 4EZMA 3JWNH 2VABB 3BIKA 1M56B 1WUNT 4CSZA 4HVBA 5CEXA 2ICWJ 2J5WA 1UKSA 2NT0A 1DQKA 2YPLD 1NANI 4NSKB 4MHHG 5D9SB 3MLRH 5DFWH 2OSLA 5E9DA 5IVXA 5DHVH 4BA8A 3ZTCC 1F5WA 4M3KB 5JZ7D 1LL1A 2EC9U 2DY2A 2NMSA 4WO4A 1FH5H 1ZA6A 1G9EA 3QQDB 1B9ZA 2VDOB 3WEBA 5L88L 3C2AH 4ZUWA 1TQBB 1CIDA 1JXGA 5E6IA 5JORB 3OR6A 1OKEA 1YJDH 3FQ2A 5DJCA 1QSFA 1U8OA 2WD0A 2NY5L 4Y2DB 3IAQA 5TF0A 3HC3H 1KPVB 4J3OG 4JDTL 4LCYB 1I3RA 2NY0B 1PY9A 1S7QB 4RA0C 4CDHA 2WUBL 3L3HA 5IB2A 1UZ8B 2LU5A 3OKKA 1T66D 4FZ8L 2VM4A 1DVUA 3CDFA 1UQSA 3FO1A 3FUHA 4JQIL 1BD2D 2ICES 4GAJH 2IPTH 2JB5L 5CJXA 2X41A 2XWZA 2R69A 2EH7H 2GQHA 1EJFA 2HTLD 3N0PB 3JV6B 4NN5C 5JW4M 4OZHF 2I9LA 3V0JA 5E6RB 3DYMA 4G7VL 3PWPA 2CA3A 4JHAH 4Y16D 4EXPX 3RTQB 5L4IA 1KFAH 2EKSA 1DO6A 5C92A 3CLFL 4OGYL 4MZ2A 4P2OA 4PR5A 5BXFB 3I6GB 4XNMA 1CI5A 5CSZB 3RPIB 5MP6H 3PHAA 5CFAA 5GZOC 4L37A 4XPBH 3DTXA 2Z7YA 3FH5A 4AJVA 1MUJA 4ETQA 2BMKB 2IDUA 1SBSL 1RIUL 5D2NE 1XGUB 4U1NB 3TIDB 4G9FE 1E8XA 2WMPB 1LNUB 3SBQA 2GVYA 4H26A 5AAWC 2P5EE 2XZCH 2B14A 1NGQH 4GIOA 4OGAD 2BZCA 4JKWA 5GS0L 4P9ML 2Z31B 4P2RE 1A1MB 1KJ3H 2BFGA 4KROD 5GJTH 2C3VA 2EACA 4PTUB 4P5SA 3MNZB 4J3BA 5LNEA 1HEJC 5BW7A 5B7MA 5IVZB 4MA8L 2RQ8A 1FZMB 2OMUA 1LQBC 3BVVA 1MPAL 3IGKA 4O2EB 2WLIA 3GSWB 4WHTB 5DJZA 2BJML 2DIEA 2D3VA 2FX7H 2AERT 4GSDL 2APBA 4OB5L 4JN2B 4QHUB 3RWHA 5L2KB 1IC1A 1O0VA 3U4KA 5F1NA 3B4NA 2Z4TA 5EOTB 1GL4B 1AMYA 2JCCA 4KTYA 2NY6B 3FN0H 3DC0A 5KS9E 2EECA 4F58L 2DH3A 5KAQF 3U30C 1RZJH 1PKQE 2BHFA 5LBVA 3UZVA 3EBAA 2CBQA 1EFXB 5ADPL 4U05A 5CR8A 5F1IB 1ADQL 1QBLL 1QPXA 2H45A 3QPQD 1N6VA 3ECUA 3BVUA 1NMBH 9PCYA 4P59L 2UWEB 4GW4B 4GRLA 1IM9D 4RLDA 4RIRA 3QJHB 5D1ZI 5JHMA 3BAWA 2XZQL 5C0RL 1FO0B 8PAZA 2NNRA 1J1XH 2BSRA 4NKOA 3CH1A 3RHWF 2QKIC 3B2MA 1E4XH 1DSYA 5I1GH 4W70A 3NJKA 5DJ0A 4FABL 2GJ6A 2V7NA 3ES6B 4ZTPH 3NABL 5CLYA 3MFFB 1H3PH 4X5RA 3GM8A 1F1AA 1DQJB 1HWHB 4YHYB 2OJZL 2VN7A 4WWID 2DDQH 5CILL 3IEAA 2WOYA 4W4OC 4Y1AD 3WS3B 4B41A 4L2YA 5JHDB 1WHPA 2F19H 1XT5A 1XSOA 4U49A 2AJUH 4GW5A 3O45B 3G6JF 3OLIA 4IGBB 4KNTA 4IBWA 4QXGH 1U8JB 2H6OA 1TDQA 1KCVL 3QR2A 5HDQH 3ZHNA 2KERA 5JOPE 3QDGB 3GIZH 3VXUA 1FLTX 2HX7A 4HUUA 1M2VA 2TSAA 1LO2L 1T0OA 4DCQA 4K9JA 2E76C 3H9SE 3OKNB 3SQBA 1U8IB 3OX8A 4JHWL 3EYFA 4BHUI 2Y24A 1U95A 3HRZC 1RUKL 3TIEA 1E9OA 2V9RA 3BUYA 4HZAA 1PAMA 1X44A 2R0LH 2Y5EA 2F53D 3SKMB 5CEZH 3TJEL 3OR7B 3PCYA 2FHCA 4K94C 3H7BA 4I87A 1A4KA 5LG6A 4NS0A 1E3XA 2G4EA 4OLUH 5DJXB 4Q8BA 3U2SA 3UGEA 5J56B 4G1EA 4OFQA 4JVPA 4PWKA 4WI2A 3MHZA 1IE5A 5MI0B 3CU1A 4NQDD 3U1QA 1QFWL 2E7BA 1NBZB 3MLSL 3KYAA 4JJ5A 5IB5A 5DMYA 2CZNA 3G5WA 2B1AH 3MR9A 3VXRB 1QUNB 2J88H 4LSRL 3P2BA 1NOLA 3UBXI 1TVDA 2V3FA 2BSSA 4BGLA 1YEDA 4ZTOH 4BXVA 3FPYA 2BFVH 4JZNB 4GUOA 4JO2L 5HVHB 2HFGH 4EZKA 1RK0A 3LEXA 3PGCA 2GB2A 5C0AB 4HMCA 5T5FA 2OMTB 3CVHL 2E9GA 1VADB 4QGTA 2GY7B 5B1KA 4YSUA 3DBXA 1RU9L 2VN4A 2H1PL 3VRJA 3BGMA 2YUVA 3LN5A 4L9LC 3UTQA 1ZS8B 1HYSD 2BVTA 3EJTA 4GAYA 2XWTB 4PJGE 3WE6A 2V7HB 3Q2LA 2ALWA 2EEBA 4LE8A 3SCMD 1U8QB 3P2TA 2GTWA 4GMSL 1I8UA 1GIGH 1HSBB 2IDCA 2BVYA 4JZJC 4FTVB 3TNMA 1DJIA 5HJ3A 1YNTF 3QUKA 3ZX1A 2XT1B 2YXMA 4YC2B 1FGNL 3TH4T 3LMJL 1AE6H 3ULVF 3T1FA 4XGZA 2HA1A 1D5IL 2C3HA 2NXZD 4U7SA 3SO3B 1NMAL 5CUSL 4HU8A 1ZJAA 1J9CT 3MLXH 3GBML 5C0DB 4E41E 1AXIB 5ETUB 2DEYX 1HJBC 2TRYA 1ZLVH 2WJ7A 2AJXL 2OTPA 1JFQH 3E6HA 1A9BA 4RFOL 4R8WL 5IROD 3GUTA 4HIJA 1SQ2N 5J6GB 1MZYA 5E51A 2ATKB 3QJFA 2OMNA 4FQQA 1HL4A 3BVNB 4Y4FA 1SDDA 5F9JB 1KLFB 1OLZA 4CC4C 4EN2A 5GGSB 2DV6A 4HLEA 2JF1A 5IOKA 2MEJB 1KTLB 1VHPA 1RIHL 4B27A 4Q6IA 4UT6H 4N2BA 3VWJA 1EZVY 4NAQA 5E5MB 1Z6JT 2P5WB 1FI8C 2V5SA 4XRCA 4GLRH 3WIAA 1NGYB 2VUOA 4MA7H 1A7RH 2F58H 3Q06A 4PI2A 2Y1ZA 3D18A 5H2BA 5JA8B 3WFCH 1M1XB 1SEQH 4BCYA 5JPNA 2XKUA 4G8GD 3EFOA 4BSWA 5CNHA 3NCXA 2YGPA 4PJ5A 3RFRA 3C5SA 2BNRA 2IBZY 4ENEC 2VSDA 4LVOC 1T03L 1MRCH 1UB5A 3RFZA 5DT1H 3GSUA 4FERA 5I1CL 3AT0A 3V6OC 2JMRA 1HQRB 2ZONA 1OGAD 3FUFA 4NQUA 3K71A 1JPSH 1JK9B 2A83A 2AEIT 5T1MA 5LDUA 2CRIA 2IMMA 2EUVA 3GSRA 1MCNA 4PJHB 3MU3A 3DRQA 5KEZA 1XF1A 1R5VB 4G71B 4MJIB 4AVKA 1OP9A 4KDTA 3LRLA 2HVBA 4MSWB 3UMTA 5GS0D 1SJVA 2NNXA 2E9WA 2ZX6A 3ARUA 5I15L 5LAXB 1ECYA 2VDOH 4NWTH 3LQAC 1OSEA 2DKSA 1F02I 2ED6A 2BRRH 1ES0B 2QPUA 3HI1A 4GBXB 4NHCH 3TWYA 1DJZA 3TBVA 5LBSA 3SE8H 1UOLA 4FFWD 2VDPB 1MW0A 5BRZE 5SWSA 5F89B 1TMCB 2CIKA 4O02H 4QRPB 3ZR5A 2VLRE 1FAIH 3Q2WA 4KH2A 5E00B 3LZRA 5HGHA 4NQVB 4QRRE 4XPAL 1MCWM 1A14H 1ICTA 3SKNA 5A40E 3TFKD 3T0DA 4Z23A 3VXSE 4GO9A 2UY6B 3QYCA 4KTEH 4IRSB 3GGWB 1GZHC 1ZHNB 3D69A 4JFSA 4WJ5A 3ZUCA 3RRQA 4FA8A 5I23A 3CHXA 3FC8A 5BZDA 2VQTA 2E27L 1MLCB 4XZUB 3OPUA 3B83A 2PPFA 1TO4A 4Z7NE 1RJZA 3TN0B 2IH9A 3CIQA 4HFWA 5K9OB 1OD9A 1EAPB 1S7XA 5IR1B 1XIWA 3NQKA 4Y2NA 1OM9A 2QFPA 1WIUA 2BDNL 3BUDA 3HB3D 3MLZH 3O3UN 4NZTL 2BO0A 2HJFA 2HKFL 4P06A 2VIRA 5EORH 1EZUA 1QO3A 3KNBA 3L13A 3HIZA 1ZWIB 4IBTA 1IBBA 1CXLA 1P4IH 1QBMH 4X2UA 3ERXA 3Q5TA 4HMEA 3RGVB 3SGDI 4FQLL 2VAJA 2JKSA 3CLWA 5JW5A 4GMTL 5F7FA 2FBJL 3LX9A 2OR7A 1J12A 1PMYA 1V7ML 2WZPD 2MRYA 2R39A 2ZX8A 3O4OB 5K1NA 4FTDA 3B5TA 4UAOC 2VLLA 5LUMA 2NY2C 4HIEB 4LCWB 5FOBB 1G84A 1LGVA 1FPTH 3QEQB 3HNVH 4F9LC 4FCHA 5G2NA 4PGEA 3FKUS 3UC0H 2WO2B 3FCUB 3QZOA 4NQQA 1DVFD 3QG7H 2EDKA 4HBCH 5FFGA 1EBAA 2HFFA 2PXYD 2WXLA 1K4DB 2O6EA 3S35X 1I9IL 2V2TA 3DGGB 2F54B 4KJWC 2YIHA 5DVKA 4L3AA 1ASQA 3MRMB 3BEVB 1XBRA 1B88A 2CJSA 1KWKA 4E9QA 5D7LB 5HYEA 2NX5B 5HHPA 4ZO7A 3ZHFA 5ES4B 2EEFA 1NC2A 1BF2A 1NCUA 5FS5A 3RURA 4CL7A 4WW1B 4M5ZL 3CSYA 5L9DH 4YIQA 3O41A 2P46B 1P1ZA 5F7DA 1S3KH 4Q4IA 4KPHH 1KB5B 1NLBH 1VB9A 3MNMA 5D7KD 4N8VB 5K69A 1LO5A 4IJ3B 4JFEE 2L4OA 2HLFD 3CFDB 1KJMA 4JG0H 4LRNH 3KH4A 3TBSA 1P7QB 4XI5C 1KC5H 4AIEA 1GJUA 4H8WH 5BUGA 2WXFA 2I60H 2A73B 5FO2A 4U4IA 4N0YH 5SWQB 3S0PA 4XNDA 3ULUH 3P3UA 2AEPL 3IFLH 2IEPA 3VFNA 4KDWA 3B5HA 4X4YB 5F6IC 5CO1A 2Z7UA 5E23A 3EUDA 4WTZA 5B21A 3R7QA 1YEKL 3AY4A 4GRMB 2YD6A 4K23H 4IRJB 1SZNA 3FO2A 4JFDE 4LDLB 4EIUA 2ZKWA 3RBGA 3WN5C 3GQFA 5A2BA 1JGDA 4JZOA 1JZFA 4NT6A 2R2BB 3ZRSA 3IDNA 3KXFB 3MBEC 2ITCB 3BP6A 1T83C 1LEKB 3TJHD 1EGJL 3FZUD 4O2CA 1N4XH 1S3RA 3U7YL 4WGWB 3T65A 4YSPA 4F5CA 1UXLA 1ADWA 3WNNA 4P05A 3BPOC 3LZFH 3PP4H 4TTDD 5SV4A 2AABL 5DUMH 1VGEH 4EQ2A 5KBLA 4QEGA 2F7QA 3WKNA 3L3JB 1XGQB 1Z32X 3OBAA 5BVJB 3BQUD 3R4RA 2XA8L 3A67H 4AEEA 2NQCA 4YFDB 5BOJA 2XYCA 3QEUA 4JRFA 4L05A 3CSGA 4L3FA 4F93B 4Y2OA 1HSAB 1FGVL 2C9AA 3COOA 4NNPH 2E4TA 4Z7NF 1Q72L 4JHZA 3QHZH 1IC4L 3TNNA 3O2DA 4YDVA 1UT9A 1HKLL 5TF1L 2LE9A 4IKIA 2UX6A 4AXWB 5FR3A 2ADIB 2ZCLL 3ZE2E 1HNYA 5ALCL 2X1OA 3LVTA 1RPQA 5IMLA 1MCEA 3GK8H 2BNQB 3ZQ9A 3R1GH 2GUOA 4LCIH 3VFVA 2EE3A 1WA0X 3TV8A 2BPBA 1XCQA 2WLJA 2WBKA 2EC9T 4LHUD 3BFQG 1DSWA 2PCPA 1A3RL 2OMYB 2WC7A 2EUXA 1TU2A 4NQCA 5DA0B 4X6EB 1MRFH 2FHFA 4ODXA 2XBTA 4GIAA 1GAFH 1KJVB 1RV6X 2R0ZL 2ZCHL 4U1GB 1HHGA 4N86A 1U3ZA 1WAAA 2X88A 4WU5B 4XNZC 1P4LB 3BVTA 4C83B 2H8PA 1BAFH 3CFIC 1SLXA 3ARBD 3OJDA 3BGFB 1BYNA 4ZQKA 3INUL 2DWTA 5L4JA 3ECQA 1JNNL 2DWYA 2DJMA 4ODTL 4MX7B 4DP0X 5IMKB 1EHLL 3MRKA 3QUYD 5JIMA 1JGVH 3CBKB 3H0TB 3WS6A 1U3HB 4FYSA 2EDMA 1KXVC 2VDKH 4NN6B 5EN2B 4D8OA 1AKJB 1EJOL 4G83A 5JXAH 5E4EB 5DWPA 1I1AD 4OTXH 4XP6L 4ZUTA 1P1VA 3EOTL 2LVCA 4Z3IA 5F8QC 4BFRA 1EIBA 3QORD 3ME0A 3DHPA 3JTSA 3QGVA 4YGVA 4JPKL 1NGZB 3IPEA 4TMPA 2XN9B 3O3AA 3WLWD 2W95A 3IWUA 4DPRA 4DP1X 4RFNB 2Z34A 4AM0B 2G5UA 4HD5A 2RFXA 5GGVY 1T4KB 4N8VG 2IOMA 5FGBC 1HX0A 2I5YH 2RCSH 1KV3A 1SYVA 2G9KA 4HAKA 1BZ7B 2ZT9C 1I8LA 1T5WB 5DJYA 3TGXA 1YPZE 3P2DA 1NBCA 5CS7A 5KVDE 5CGTA 4IMKC 3B1TA 4KFZC 2GBVA 2PPAA 4ALAH 2HJKA 4AQOA 2BOBB 3VW3H 4HF5H 2F7PA 3US1A 1AI1L 1ONQB 3E3QE 4BFIA 5IMOB 4IKKA 2X9XA 5C2BL 1KLUA 2EDEA 2V3DA 5FF6A 2J43A 5D5MF 3S2CA 4GB9A 3U0TB 3W11C 1BFTA 3DECA 2YK1L 4M8RA 4ZW3A 4AEHH 1TCRB 4QXWA 2R56L 5FOJA 3SDXE 1U6AL 2PMZA 2YGOA 3IMTA 4XO3A 5FHAH 1CU4L 4KFMA 4XBEH 3RWFA 4Z7AA 3OAYH 4YH6A 1MEXH 2XSKA 4W1TA 3SQOL 4YDNA 3EH3B 3P0GB 4NQED 3C6SA 2XCMC 4QWWD 4R7DA 5CCKH 2X4RB 4HUXB 5DVNA 2MPAL 1YQVL 4PP2A 1CF8H 3RVTC 1HILA 1P2CA 3P9MA 4PS8A 1C1EH 2J1WA 3KVPA 4K0OA 2D4FA 5EU6B 2Q10A 3I6KA 4JRXE 3DX8A 1L9PA 1ZEAH 2QGCA 4DGIH 1EEZB 4XE0A 4OLXL 4KKBD 4GQ9L 3WXVH 5JXEA 4GY4A 5CJOL 1IGIH 4TOYL 5BZXA 2WGNB 3GXPA 3GBDA 4MJHA 1NGXB 1SHWA 3NIFE 5F9AC 4PRBA 3NIGB 3ZE2F 2ENJA 2PPCA 5DLML 1S7RA 2Q3AA 1JF1B 3U36A 5LN8A 1BGXL 3FU9A 3N85L 4V1DA 4LLMB 1G7LA 3B9KB 1WD9A 5CKGA 2VSMB 4XHQA 4EN3D 3N5AA 4Y4HB 2CO7B 1O7DC 2PYFB 1YEIH 3V4LA 1CICC 2FEEL 3A4EA 3QWOB 1OM3H 1GJIA 1T6WA 1EO8H 5HGBB 2O61A 2VDPH 3MCLL 1CXFA 1MCWW 1IE4A 4IHBA 4NLHA 2DI9A 1FO0L 3UYOD 4YMPA 2EAEA 1TYRA 4WWKD 1MHEA 3V5KB 3ZDYE 5J4MA 3GSXB 4WY7H 2EYSB 5GHWL 1BQSA 4ODSH 3MFGB 2JKTM 4W9KC 3JWDC 3LXAA 1UWEL 3SJVD 3DURB 1RP9A 1W91A 4B5EA 4PUBH 5AB0A 3TM6A 5IHUL 2FVNA 3K1KC 5CWSB 3SD2A 4QOKE 1Z5LA 5SWZD 2EE2A 1C5BL 3CHPA 3FQRB 4KRPC 5KSBB 2YA1A 1VRSA 1FSKB 3GDBA 4UV7L 1BJ1J 3K74B 5AFAA 3VQ1C 2X05A 2CALA 3C60A 3GD1C 4KNUA 5FKPA 1KYOK 4KQ3L 5FGSA 3RWCB 3KLKA 2YRLA 2XVKA 1GZPB 4U6VL 2NZ1A 5F8RC 2JELL 2Y7QA 3RUGB 3ARZA 3KPRD 2G4GA 1I8MA 3HCVA 4OV5B 4C4BA 1KDIA 1U92B 1CDUA 1MG3C 1UM4H 5BJTA 1X5MA 2CLRB 3ZO0A 3P3YA 4KRMB 2GSMB 1QI4A 2TRHA 4YN3A 3VE0B 3MNWA 4UT6A 4YVUA 4Z7OB 4D0CA 4WO4C 1EBPA 1N64L 1YPZF 4WW2A 2DQCL 4BUGA 2PO6A 3Q3GA 3MC0A 2BCMA 2VW6A 2YC1B 2OAAA 5E6IC 2AJZB 3ET9F 5E2WL 4KO6A 3P4MA 5FYKH 4G59C 2A4ZA 2B9AA 2CK0H 1HOCA 5C0BD 2X87A 3GIVB 4OZIE 1T5KA 2OS7A 5FYJL 3GPEA 2FSEA 4OD1L 5ID0B 1R47A 3CPLA 1HHIB 3LB6D 5L0QB 4OW6A 3QJXA 5F9OH 1MOEA 2ENSA 1S78C 4XB8A 3VXPB 1DFXA 3LKQA 4NO5A 3FAXA 2L3BA 3MODL 5CJXC 3CDGA 3TBYA 3RVUD 3DXAE 3O6ML 3VI3A 4MD0A 3RI5K 1DQVA 3OXSB 2ED9A 4M62H 2W88A 3PFUA 4NSKA 5D9SA 3RWGA 1BM7A 1NFDE 3F6JA 3FQXB 3X3GH