2O6CA

Structure of selenomethionyl rtp34 from treponema pallidum
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
158
structure length
158
Chain Sequence
b'FDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 34 kDa membrane antigen
molecule tags Membrane protein, protein binding
source organism Treponema pallidum
publication title Crystal structure of the Tp34 (TP0971) lipoprotein of treponema pallidum: implications of its metal-bound state and affinity for human lactoferrin.
pubmed doi rcsb
total genus 28
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10634 Iron_transport Fe2+ transport protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o6cA00
3LZQA 3NRQA 5I0XA 2O6FA 3LZPA 2O6EA 3LZRA 3LZNA 3PJNA 5I0WA 5I0VA 3LZOA 2O6CA 3LZLA 5I0YA 3PJLA 3NRPA 2O6DA
chains in the Genus database with same CATH superfamily
4TPRH 2Z91B 3VFUA 3MJ8A 4WENB 2BCMA 4K7FA 1R3IL 3FTXA 3EOYG 4K9EL 2VR5A 1E9PB 3VFVA 3NFPB 3KLKA 3RIFK 3V79C 3QUXB 2OLDA 4HHGA 2D0HA 3GS7A 4PU2A 3UTZA 3GKZA 2ZOLB 1LE5A 4P2CG 3ROLA 3TJEL 1XH1A 1SYVB 2AQQA 5C0BE 3CPLB 4BFEA 1TQTA 2WJ5A 4M43H 3ARPA 3OD3A 8PAZA 4Y88A 1C7TA 3MBXH 1V3LA 1D6EA 4PEEA 4OLVL 2QDWA 1IFHL 4H1LB 3GXIA 3K3QA 5DJAA 3WL9B 4F2ME 4ZW3A 3L3KA 3BLBA 3U9UB 4YDLC 5IEKA 1IT9H 3GJEB 4CUCA 5H37A 1HI6B 1CICA 2VITA 4G82A 1TQWA 4M7ZB 1BYPA 1E8WA 1NC4D 5EU4A 3FTZA 3J7HA 4OB5L 4WI4A 4AC2A 1I85C 1WBXB 2VZ1A 2C9RA 1JRHI 3DWTA 4BYHA 4K9EC 1D7FA 1VRSA 2GHZA 3IJ8A 2LLGA 5CIPB 4XNMA 5C97A 1KTKE 2NW2B 3WI9A 4CC0A 2J5LB 3BVWA 4JY6A 3QUML 2DIEA 4JGJA 4R0LA 5JIHA 1JDDA 3BGAA 4UNIA 4W6WB 5SWSB 1M7IA 1Z5YD 3SPCA 3VG9C 1OHQA 2I5YH 4QHKI 3F2LA 3IJYB 1NCAH 1BG1A 2I25N 1AD0A 5MI0B 5BZDB 1QSZA 1P7KB 2Y1AA 2Z31D 3DJRA 1MJJA 4WFGE 3C5ZD 4Y2LA 2QVMA 2XRAL 4FKHA 3MRIB 4A2LA 4XVOA 4QHKJ 1EJOL 4YN3A 2UZXB 3IGAB 4YFLF 4HWNA 4TNWK 5TK4A 1PPIA 4PJFE 4YGVB 1NAML 2IGFH 1T03L 5FM5M 3F12A 1NUNB 3FUDA 3BWZA 3GSNB 3MGTA 4Z7UB 5I1AA 5CGYC 5ABAA 3D8MA 2DMKA 5JQ6L 2DQJL 3C5JA 2Q8AH 3MGAA 3CVHB 3VJ6A 1EZVY 1S4IA 4ILDA 2JWYA 4N2HA 4G5ZL 4Y9FA 5CEYB 5FFLA 5IJBC 3WN5A 4YDIH 4AJVA 4JN1H 1NCBH 4ZTPL 3O2DL 4FFZH 5IT2H 1LO0L 3GDCA 2F1BA 1XGRA 3GRWH 3G5WA 5C0JA 1BYNA 4Z77B 1ZLEA 3VXUA 3NCEB 4Z76B 4UNTA 5D2NA 4PGJA 3L95B 3QORD 5E00B 1BD2B 1FCCA 5AZ2L 1CTNA 3KEDA 1Z0NA 2P5WE 4W9DC 5I1LA 4JFQA 2A6DA 2N0KA 4YLCA 4OJEH 4R96A 4X6EA 2H45A 3VXME 4RFOL 3U7WL 3ZE2E 2WBXA 3WE1A 3NZHH 4K3EL 1XTMA 1KCSH 1T83C 5DRXB 3SKOB 1KTDB 3VWJA 1DDTA 1KGUA 4LP8A 2DTML 1GZHC 1G5GA 4JFDE 3VFUB 1AZBA 4I5BB 3QWOA 3T6WA 2D7PA 5TTRA 4L4VB 4ODWA 2FECI 2CO6B 4NZRH 4OCXH 3RX9A 5C92A 1NKOA 3S36X 4JFEE 3FU0A 5CUSH 3UAJC 3QIWA 4UNVA 5I66B 3TF4A 1MG2C 2KPWA 2JKLA 2G5BB 4UIKL 3GIVB 5C7ZA 3TV3L 1JI2A 2DV6A 1JDCA 2UZIH 3QQ9C 2RFXB 4O4YH 1JGEA 2IVFC 4Q6KA 4JQIL 2DQEH 1YEGH 4ZO7A 4CMHB 1N8ZA 2OJZH 1E4XL 3QIBC 4R4FL 4XPAL 1UYWL 1ZVSB 1DBBL 4HIIB 1MPAL 4K94L 4JE4B 3WFEL 4IJTA 3A67L 4N5ED 4PJGB 5G4MA 1MH5B 2A7BA 1AZCA 4AQ8C 1A1OA 2O93L 3QB7C 3MA7A 4FYSA 5L4JA 4KI5C 1AS6A 1NMAH 1QTYT 1CFVL 2XKUA 2WQRA 2BNUA 1KT2A 3RVXC 5PAZA 5CKGA 5ESQB 2GBVA 5BV7L 2OW6A 3CIQA 2YRBA 4CN6A 1BFOA 5E8EB 3I6KB 1QLEL 1RJYB 3LH2H 1VKXA 4G6ML 5HY9A 4PCTA 4QRTA 2DMCA 5GZOC 1OCZB 1OCRB 1WH0A 2NXZC 1BEYL 2DWTA 1QEWA 4PJDB 1T6VN 3LKOB 4EN3A 1H8SA 3QXDA 3OV6A 3L1FA 4BUGA 4HFUH 3TL5A 4N4YB 4QRBA 2AK4A 1KLFA 3FQWB 4UU9B 3BPNB 2Y06L 1G7LA 4YL4A 5ITFB 2YGOA 3ZDXE 3IFOA 2YN5A 1NCCL 3PRZA 3FC8A 4QRPA 3GTVA 4UINL 4PY7B 3WHE0 1JI1A 3SZ6A 5TF0A 3RDTA 5I71C 2FQGA 2W88A 3UG3A 2RTTA 4RZCA 3EG9B 5IJKA 3O6FA 3UG4A 1GIGL 3VFSB 2QADD 1RUKH 1E4WL 1SJHA 3VDAA 5FO2A 2N59A 1IC1A 1OGAA 4QDGA 3VGAB 1OZTG 4ALAL 4Y2NA 2Z34A 3QUHA 3M45A 4LLWB 1XH3B 3ASNB 3HE6A 1R24A 2P24B 1IGMH 3EO1B 3KJ4B 2H2SD 5BW7C 3TBCA 1OGTB 4OIBA 3DXAB 2BOCA 4IRJA 5ADPH 3WFBL 1YEIL 2WQWA 1FZOA 3HN5A 3QFJB 3II3A 4U1LA 3VFPB 3D2TA 1RJCA 3GJEA 5LAPA 3VU1A 3MRNB 5K9OA 3FUMA 3C6LD 4NUQA 2AK4E 2OR9H 3OMNB 4NQXA 3WNLA 3MLXL 1BBJB 4ADGA 4IU3A 5I18H 1WBXA 1R5WA 2Z4QA 4F8TA 4YBQD 3RWDB 3KH4A 1SEQH 2LLLA 3ZTDC 2YSSA 3LQAL 4J4PC 2R1WA 3QDAA 4N90D 1X5IA 5EC1B 4CW1B 4NUGL 1ZV2A 3U0TA 3CN0A 3EYUH 3T77B 4FQCH 2JCCB 3GSOB 2F18A 2HT2C 3L3OB 3I6SA 2DQGL 4WKXA 4P06A 3SQBB 5AOIA 4BV1A 1H15A 4RGNE 3N85L 3T2QA 4UV7L 4KK6D 1ND0B 2OX5A 1MFDH 1WFIA 2PWDA 1PAZA 2ZWNA 2R39A 2A6IB 3ARGC 4L23A 2H3NB 1FN4A 1VADA 4S1QL 3ERXA 5EC2B 5GGUB 5CN3A 3NFNA 3ARED 5ICXB 2WCGA 1FVDB 1OGPA 1JFQH 4FGMA 1QSEA 4LNRA 2ZNXA 4A2HA 5C0CD 1C1EL 2CLZB 3ETBJ 3QEUB 5EU6D 1PKQE 3DUUA 4EO5A 1I31A 4FFYH 1ZHNA 2HVKB 3ZT7A 3EHBC 4QR7A 5T3XE 4W4OC 1J1OL 1MAKA 3EGDA 5D8JH 4DK5A 4XVUC 4ZYKB 4JG5A 1J1PL 5DFAA 4FFVD 2IADB 3HRZC 3MNZA 3RGVA 1PG7H 5AFAA 1DSFL 3QQDA 4FQHA 4YHMH 1ZANL 3C6SB 3MLZL 4JN2A 4AMKL 2OAAA 2DQFA 5C0IA 4CNIB 2J55A 4E42B 2DQTH 3WG7B 2UWEF 4YHNA 1QAWA 4IS6B 3WJMB 4LSVH 5F9DC 2WBJA 3QYNA 3E8VA 3MRCB 2N0MA 2Z8SA 4JKKA 4KFZC 4A6YA 1X5YA 4PJ7F 3TJHC 4R2GD 2A9ML 2HUEA 3V7AG 3ZBMA 1ZE3C 3ARUA 1BAFH 1FSKB 2IAMB 1I3RA 5F72S 1DBKH 2AEQH 4MDIB 1T1ZA 1XV8A 3FBKA 4IBUA 4MVBD 4XO4A 1A6UH 4X7SH 4XCEA 2MNUA 5GZOA 1HCYA 1I9RL 3LN4B 5EULV 4X7SL 4U6VL 4HWZB 4W6XB 3PWPD 5TE6H 3QQ3B 4H8WC 3T8VA 3IBEA 5C08A 1CDIA 2RH0A 3QISA 3BHBB 4Q9BA 1CE6A 2OV0A 1BVZA 4P2YA 3SYQA 3QC6X 2YO3A 3B1UA 1QR4A 3MFFB 3O4OB 1WIUA 3THML 3DGCR 3UGUA 1E9PA 1OO2A 3G6JF 2FLMA 2O1AA 3D4YA 2VXQH 3VI3F 3WKPA 4MAYB 1U4EA 3LZFH 5GHWH 5HHNB 3LPWA 3WU1A 3NYKA 4HSQA 3QDJB 1B6DA 2B16A 2OL3B 5BOZG 2ZCKH 3HE6C 3UJTL 4AGNA 1U3HC 5I1JL 2R2BB 5AYTA 2ED6A 4M48H 4LSQL 5JW4M 3T0EE 2VWEC 2ZXAA 2C9AA 4LLDA 4L3EA 1G0YR 3FQRB 1I7TB 4PCYA 4AIZB 2YQ3A 2DWEA 3Q5YA 3QEGH 5LN8A 1MWAA 2NT0A 1FLTX 5BQ7B 5IVZB 1D9KA 5T1LB 2KH2B 3FB7A 2QPUA 4KTDL 4WY7L 4AWJC 1FO0B 4L0PB 2WOYA 3MN8A 1FHNA 4RZCB 4OLXL 35C8L 1KEGL 3NBNA 1NC4A 3MLWL 3HB3C 3X1BA 4Z0XA 2VSMB 3IBOA 5C6WH 3P30L 4EI5D 4K3DH 2J43A 1YJDH 2WYHA 3W1ZA 5CJQL 2AEWA 2R0KL 3BGMA 1MHHA 1LQSR 4JO3L 4PBWD 5KVDL 3TJPA 4HVBA 3OR7A 1U58B 2EJ1A 3B83A 4YSAA 4HKJB 1ZWIB 5IW1A 1HKFA 5CP7B 1ZS2A 1WICA 3GXUB 4TVUA 1O7DC 5JIIA 1Y6NR 1PSKL 2P5EA 3FB5B 5H35B 3W0WA 1T2JA 1DVFD 3T2NH 1PSKH 3ULAB 3GO1H 4U3CA 3WLBA 4DZ8B 3WE6A 4MMXA 4NO3A 1QLFB 4M93C 2YAPA 3I2CH 1ZVNA 1OAXH 3AJ7A 3OQ3B 3MRMA 3V8CA 2BSSA 3X3FH 2EDYA 2NZ1A 4ODTH 1NKRA 1W80A 2G75B 3VNYA 3QXAB 1FA4A 2AJZA 5DJ8B 5BOPA 3LQZB 3V4VB 5IOKA 2ZCLH 3IDYC 5F7KC 3ZOAA 5DD3H 1KB9J 2C7FA 5C0GA 3E6FA 1NGWB 4R90L 5D5MF 5HDWA 1ZMYA 4YZFE 5I15L 2VQ1A 1S7RA 3A6CL 3VA6A 3S96A 1QACA 3TZVD 5T5NG 4HGWA 3AC0A 4M7LL 4YSPA 4LDOB 1WFJA 3NP4A 2BM3A 3EO0B 3UC2A 1JWUA 1PL3A 3X1EA 4NPYB 3V52L 4R2GB 1QSEB 4LNRB 2XBZA 4DEPC 2VDMH 1FORL 4X4ZA 4POZD 2NYYC 3V4PA 2B9BA 1Z9SB 3CHQA 5C0BB 3MFFA 2W95A 3CX5J 1G87A 4P3WA 1IAKB 2ZIDA 1QO3B 3GC3A 4ZOAA 2PW1B 2H6PA 2IDTA 3PNWB 1GW0A 4HK3N 3VXMB 4QHPA 2JXMB 2X4SA 2WC7A 3FJTA 3QAQA 1V7NH 5E2UH 1RULH 3W57A 3RFRA 1I8MA 4U3HA 2VLRD 5CJ5A 1A4KB 4P9HC 2VQTA 1X4ZA 2PWHA 4OU3A 3M8OH 4TXVB 4YK4B 4F8OA 3TNMA 3IRZA 1U30A 1LK2B 2BCKB 2J88L 3IN0A 1YLBB 4WUUA 4UTAH 1S78D 4MKMA 5I6OA 1U93A 1MI5E 5T3XD 4E9RA 3US0A 4QLWA 3ZR5A 4LLUA 2QBWA 1YDPA 2E9IA 3UADA 5I6XC 4KJWC 2VZOA 5T1KD 4ZO9A 1FH5H 1JGVH 3SDXA 2D4DA 2QV2A 4A6YL 5DRNA 1NGZA 4ZX4A 4X7FC 1KCVH 1X5MA 4K0OA 3FNKA 3EOAB 4CC4A 4WU5B 1PNCA 5T33H 1R3LB 3LRGA 1KTLA 4KXBA 5HI5D 2X1XR 4FQXD 4JO1H 1ZA6B 3SE9H 5DVLA 3FUHA 2ZAHA 5H4YA 5JW3L 2X2IA 1RURL 2V8LA 2GBUA 2QDVA 4Z7QF 4UU9A 3ULSB 1GPOH 3QHZL 1AG0A 5F6IB 2ARJA 3GFUA 1U8JB 3RWJB 3BO8A 3RZWA 4KJPD 5LDUA 1RZGB 2O6FA 2W1NA 1RZKH 3D0VA 3W11D 4FQ1H 3TEUA 2FUQA 3BP4A 1NCDL 2O72A 2XWDA 3BWAA 3LZQA 5D2LE 4PJXA 4KJPC 3S37H 3FO9A 3WIHH 3LV3B 4QI3A 1E40A 3QDMD 1S7QA 3BAIA 4YPGA 1BD2E 1F3DJ 2PKDA 2W60B 2NNAB 3C5ZB 4NKDB 3TC9A 1FL3B 7CGTA 1UJ3C 3DXAA 5EOTB 1SEBA 1ID2A 1OWRM 1A1OB 1AZRA 3HFML 4NQED 3B9KA 3O6LH 4X4ME 3IN2A 3BAYA 3SPVA 1LEIB 4G6JH 2BNUB 4ZW6A 1DLHA 1WITA 3PXHA 2Q5BA 5GRUH 4A67A 3EJYD 4IBZA 4OCSL 4OQ1A 1UHVA 1YYMH 3GXDA 1CLCA 3FN0L 4FMKA 3IDNA 1CL7L 1JK8B 3APNA 5D7SH 3U0TB 5KS9A 3IK2A 5KG9A 3FMGL 1GJWA 3PHAA 5HY9B 2NSXA 3S7GA 4D2NA 5C0RH 1WK0A 3CMOH 4M1CC 4N8CH 4NQDD 4RFEA 3VYNA 5L8JB 2X89D 4UTBH 3HMXH 2XTLA 2VM9A 2OP4H 4PIBA 3ULVF 5CAYB 1XMWA 5ID1A 3Q43A 3QR0A 5AW2B 4JFXA 1HH9A 3KBFA 2H0PA 4MCMA 4WO4D 1N68A 4JFUA 2OTWB 3U2IA 5JQIB 3DURA 2A6IA 4A1RA 2H0EA 1ZGLM 4ORGB 4ETYA 5E2WH 3B56A 1DN0B 3JWNC 2WGNB 4CSSA 5LNDA 1N3NB 3MPCA 2PYEE 4QOKE 4V2CB 3UZQA 1CFSB 3ARBC 2IGFL 2ZUQC 3RUGE 1AGBB 1JHTA 1QFPA 4OFYD 1D7DA 1SXNA 4BFRA 2EZ0C 5D7EA 1NPUA 1P7QD 4YE4L 3MA9L 5FGBA 4J1UA 4S1SL 3HPLA 5GQBA 3UTSE 3E80A 1JZ8A 5AVUB 3AU0A 1VB9A 3D30A 4XI5C 4WO0A 1FVCA 3I74A 1D5MA 1AMXA 1XX9C 3SKNB 3OG4B 1WS7A 3PABB 2CRIA 5TQ0H 5B4MC 2RHEA 1KXHA 5C07E 4MYPA 5BS0A 2GUOB 2VLLB 4AKOA 4LSRL 4PPTA 5CSBA 2G9KA 5GISL 1BZDA 3MYZA 2WYTA 1L9RA 4XP9H 1WCQA 3BXNB 3QR1A 1B4TA 2XBTA 2CJUH 1A3RL 3WELA 3DPDA 4AM0A 4QRSA 5IROD 4QTIH 4AEIL 2A0LD 1Q38A 5KUMA 5EIIA 3MBEA 4HQQH 1S7SB 2EIJB 1J8HB 1YUHB 2JKJA 4FDWA 5EMYA 5LBSL 5JXEA 1Z32X 3FSVA 3DIFA 4MKTA 5L2KA 3FOLA 3B43A 1OF2A 4XCYB 4BQ6A 3EYFA 4GMTH 4Z7OF 2VRKA 4MA8L 1HCZA 1LO5A 2O5ZL 3FT0A 4GSRA 4FQJL 1DJZA 4LZKA 4CADB 1BQHG 4MBOA 5KVEH 4XCFL 2PW2B 2ENJA 2JKNA 3UPCA 5G5DB 1QBLL 2B15A 3ZVVA 1XB3A 4PJCF 1JHKH 3U1SL 4KQ3H 3V5HA 1Q9KB 3PJLA 3QJFB 3LIUA 2D7TL 1OPGH 5IEKB 3U1SH 2HRLA 5F89A 4MJ5A 4O2EB 2RGSA 3NIGE 3SGEI 5C3LD 3WMSA 3QZWG 2F5BH 4PI2A 5KSBF 3PHSA 4BFJA 1C9SA 2X88A 4LCWD 3NABL 5FECB 4AL8C 3H9SD 2J73A 5JIKA 5E4EC 1NL0L 1YY9D 4URTB 3I6LE 5CUSL 2YR3A 1AE6L 3GMNB 15C8L 4YDLB 3QPQD 5I8EA 5DGRA 3VMPA 5JW5B 5LCVL 3CLFL 3I9PA 3PGFH 1MRDH 1IBDA 3MJ7B 4KKRA 2XN9A 1I7TA 1W72H 4MASA 3EJRA 3J8F7 5E1GA 2WKOA 2GIXA 3HBGA 3OC8A 3V6OA 2FSDA 3OWEA 3NCYS 1PBYA 4XB8A 5HYSA 5GSRB 2NY4B 4G6AC 1BIHA 2XA8H 4OM1H 3KPSD 2GSGA 1O7SA 3VGHA 2Z6FA 3X14A 3QS2A 2WLHA 2OZ4H 3T0EB 3GMRA 1AQKH 1EH9A 2FB4H 2VQ4A 4IRZL 3DGGB 3S5YA 3DV6B 3FTWA 3ZIYA 2R7EB 1HJCA 3DHJA 1SF3A 4IKNA 1R3KB 2AJ3B 3P11L 1D6EB 2E9WA 3FU7A 1X44A 3MXVH 4HSCX 1ZLVK 4RX4A 4AEEA 5C6TL 2YKKA 1I7RA 5F1KC 1RFDH 3QG7H 4WEBH 4DZBA 4NKOB 4EKJA 1XZ0B 3C60A 4Z76A 2EYRB 2P43B 2P3YA 4J2QA 3WN6A 5CCKL 1FFOB 1SDDA 3W0WB 3MACL 5JHDA 1IBGH 3CDGB 4HHAB 4LSDA 5FFOA 1A6TB 2KI6A 2VDPL 2BJMH 2AXFB 3H7BA 4RISL 5CS7A 3ECVA 1F11B 3LMJH 5FHBL 5E4OA 2JQZA 1FZJA 1GKEA 3WEMA 2KLSA 3L4XA 2R29L 4DP4X 1T0MA 4YVUA 1H8NA 6PAZA 2ITFA 4BWUA 1P2CA 3UAEA 4DN3H 4B5EA 4UCFA 4QLRA 3DHMA 3HHSB 1TLMA 3EADA 1E9QB 3EYFB 1OB1B 4LSVL 5IB2A 1AHWA 5C09D 3ARYA 5I19H 1PG7W 3SO3C 1DANU 1MFVA 1F02I 2JV6A 4LF3B 2XVBA 1HKLH 3ZYIA 5K39A 3QCTH 1HESA 5HI4D 3I50L 3U7YL 2YD3A 1GGYA 2Q3ZA 2V9TA 1R17A 1IAOB 4JHZA 4HGMA 1U2HA 3CG8A 5HD8C 1J11A 3CQQA 2R69H 4PW3A 2J6EL 3I02B 2JMRA 3U4EB 2EVGA 1NUGA 1HINL 2PXYB 3PAZA 5C0BA 2BHZA 3ILPB 1KYAA 3WMPA 2F54B 4FQCL 2ICWJ 3HZKA 3FSAA 5ERWB 1MUJA 3MSPA 1PCSA 4F80A 3WNKA 1D6VH 1WE5A 1AQHA 4DN4L 2VLRA 4GRWB 1ZT7B 3N85H 3VH8B 4QAWA 5FUOH 4F7TB 3NDYE 3DUSA 5J3HC 2MOVA 3ZRCC 4M03A 3DO4A 5CU9A 5JR1H 1JPSH 5E5RB 4CVZB 2P52A 3R06A 4OJFL 4RGMC 3I9IA 4LXFA 1L9MA 4I4WA 4PWFA 5T1LD 3B9EA 4ACPA 2HT2D 4HJTA 4Z7WB 2DQDL 3IDJB 3QW9A 4XXDB 3K2MC 5B21A 3CC1A 3E2HB 1RV6X 4TSAH 5AVVB 4TRPL 4NI3A 3QXTA 3ARBD 4U1MB 1X5XA 3AU1A 4HMCA 1DO6A 4JY6B 3ZMRA 2YGNA 2BHUA 1E3XA 2OYLA 3L5WA 3NJNA 3TIDB 4PJDE 3O11B 5EEZA 1HH6B 2IBZX 1GGBH 4FJYA 3PXLA 3QA3B 3CZSA 4G7SB 5IQLA 1ES0A 3TIEA 3P4MB 1B9ZA 3TVMD 5BPPA 1YEDB 4YHYC 1E5BA 1LDSA 4LL4A 4LLMB 4LK4A 3MOBL 3V6OC 1G7JA 3AFLA 3QZPA 4N2KA 2ITCA 4K94C 4APQD 3DPBA 3L1OL 4LHJB 5EZJB 5GJSL 3SOBH 3KPPB 1ML0A 4N90E 3HS0A 4X7EC 2UZXA 3IGAA 1AZUA 4IOSA 5GJSH 4BKLB 5F88B 2YEZB 1V54B 1S3KL 2GI7A 1KYUA 2X4UB 2OMVB 3MJ6A 3FUNA 1QI5A 5E6YA 4JKLA 1XH0A 3AXLB 4IK6A 1E2WA 3KWWB 3B2UC 3RRQA 4JZJA 1C5CH 2Q3XA 3UFIA 5FKPB 4L3EE 5G55A 5ADPL 3G9VA 5GRYA 2HN7A 1XF2B 1I1AB 3QFJD 4HJ1A 3SBWC 3I2CL 4FFTA 1WC7B 4JO8A 4G2AA 2VUYA 4LLYA 5HYSB 1O6SB 4M1DH 2WZ0A 2CA4A 2DJSA 1JZ6A 4JFQB 1ZLDA 4NT6B 1V05A 4OF0A 3WY2A 5EEUA 3OC5A 4B96A 4AJYV 5JLZA 5DD3L 4AL8L 1EZLA 1RZQA 2H2SC 1JPTH 3K8KA 4QHUA 4UDUB 2AMUA 3FUKA 4OGYL 5CJOL 3P4OB 4UM8A 1MIML 4MJHA 1RJZA 3DARA 3LSOB 3OGCA 2HX7A 2FX8H 2EKSA 2MQ3A 3S34L 4YHPB 1FNGB 2QHRL 3FPYA 5BZDA 1OT1A 3BUPA 2WUCL 1SXZA 3CLEL 43CAB 4APXA 1KMGA 2PP9A 1QFWL 4WHYG 4ZUUA 4DKFL 3FT4B 4M5YL 2DQIL 1CGTA 3OHXA 4P46A 4WO4B 2Z8RA 1XHHA 3M1OA 2HFEB 4MNGB 4LFHD 3IEAA 4PJAA 2HG5A 3D0VB 4OZ4B 5EZIL 2HLAB 1XXFC 4NN6C 1S46A 4QNPF 4PRIA 1DEDA 5TFSL 4HIEA 3WTXA 2YK1L 5JYMA 2CCVA 4BZ1H 2APTA 4OCMC 3RIFF 1DTUA 4WGKA 5I0ZA 3HNVH 4GIOA 1GY2A 3ASWA 1AKJA 3P30H 1LP9F 3CK0H 1CDCA 4A7VA 3IJSA 3AS0A 1GZQA 3R4DA 4WJ5A 2A9DA 3FTYA 4ZMLA 5MEOA 4YHML 5HGBB 4FERA 4OCRH 1E4JA 4X9HA 4LEXH 3HC3L 5B8CA 2VISA 3OKMA 4BD4A 2ETWA 2JI1A 3ZHNA 4OZHB 1N8OE 2DJUA 1CURA 2ZG3A 2A77H 2X6VA 4KK5D 1JAEA 1TFPA 3OAZH 1H0DA 1UENA 2JB5H 2O6PA 3MLSL 5EWIL 3MQIA 3WS6A 3KGRA 2ZWZA 1WD9A 1B3IA 3OB0K 1OY3B 5IMLB 1CGSH 3EFOA 3JWOH 1XEDA 4GG8B 1CGYA 2UUDH 3UMTA 5DZ9A 2Z35B 2NT1A 5FA3A 2EINB 1WLHA 2VDMB 3L54A 5LGYA 1P0SE 5LGJB 1W2KT 3TZVC 2XIDA 3K6NA 3WEOA 4G7YL 4YVNA 3M8OL 3ZRSA 4CSPA 1VACB 4V1DA 2ERJB 2VAAB 3PWVB 2YPLB 3N41F 4LL9A 3SYAA 3JV4B 1G6RH 5AOMA 1IAII 2NUPA 5I6PA 1K4CA 3WFCL 1MI5A 1AHWC 4EI6A 1T2XA 5BRQA 2WHVA 3QNZB 5D7JB 5CKAA 2G0LA 4B9CA 3S8FB 2IDSA 1FFQA 1WHOA 3F64A 43C9B 3HS0C 4UOZA 4XRCB 3PL6C 2J5LC 2ZOKB 1D9KC 4F3FB 1P53A 3EDJA 5F97E 1ZEAL 5AAPA 2E7MA 1OANA 4KKLC 4HBCL 4KRPD 3K8MA 3S4SG 4DFHA 2Z1KA 1FLRH 5JLZB 3UTQB 2Z93A 3MGOA 1DFBL 5KSVA 4L8DA 2Z31B 3SQRA 3HN8A 1MRFL 3BVNB 4X8JA 1QEWB 4CVWA 1KIRA 2WVTA 3BZEB 5FEBA 4NKMB 1HJBC 3B9AA 3KPOA 1YEDA 1HZHH 4M9PA 2OKMA 5E9DE 5IMOA 3LD8C 5J56B 4F9PC 5F7MC 1KYOK 1J8HA 1YUHA 1OD9A 4PREB 3BWUC 2G2RA 2HFTA 3QZWA 4ZUWA 5EF2A 1P7BA 2HH0L 3CMOL 2CPUA 5FUZL 4JHVA 1AZNA 4F5CE 1NAKL 1JXGA 4N3TA 1OCWH 2YQGA 4D0DB 3JBG7 4PJXE 4QT5A 2J8UE 4BHUA 4DP7X 4Z7NE 4RNRA 1P4BH 3MRMB 1PNDA 3IDUA 4DGVH 3IKKA 4OQTH 2ZUXA 3U0WH 5EU6E 3HRPA 1QFOA 3Q8AA 5L9DL 1YEFH 5D55A 5HYJD 4ZUSB 4B9FA 3P2DA 3QEQA 1G7HA 4A38A 4YSSA 5B39A 5K9OB 5E6RB 1KENH 4W68A 3RZCA 3EJQA 4NC1E 4NGHH 3LVEA 5E9DA 3VWKD 2WB7A 3GJFB 3F7LA 3R18A 3V0VA 2ZUQB 4I89A 1WEJH 1IAIM 3D9AH 2OZNA 4HJ0C 4LASL 3P0GB 1ZHKA 3SE6A 2VCOA 4GS7B 3MCG1 4GY4A 4BQ9A 4QXTA 5HDQL 5IHHA 5FYJH 5AZEL 5BVPL 4BEIA 3DRTB 4GO9A 3BKYL 3BGFB 2GJ6B 2H5UA 2IMMA 2Q10A 3T6QC 1MNNA 5DZOA 2P46B 2ID5A 4IYKA 1DQLL 3NSDA 5K9QI 4F7KA 4IRJC 1KB9K 4KKBC 2GQHA 3BCFA 4GJTB 3S0PA 4TNFA 5DEGB 2AK4D 2ZP8A 1V7ML 4NUPA 4XGZB 1SF5A 3KLAA 5DQJB 5C0AB 3DBXB 1N0LB 4WHYH 5DDHA 3IFNH 1ZLSH 4PJ5E 1BJ1J 1KZQA 5FO7B 1EXHA 5FLUA 3RNQB 1WCBA 5HGDB 1J05A 3MLVH 1HHJA 3LXUX 4PFEA 4PP1C 2EDHA 1ASOA 4UBDC 5F3HB 5TDNA 1SYSA 4FJ6A 5D2LB 3T3PF 2A6JB 3PP4L 2ZTBA 3BN9D 3ULUD 2IPTL 3S3CB 3SCMD 4FTDA 4CNIA 2R56L 4AIEA 5J13B 3BJLA 5F7FA 2CJUL 3C6EA 2VR9A 1M1XB 4NKIL 1MLCB 3A4FA 2R69A 1IQDA 4AUYA 2R15A 5AW1B 4OD2A 3H9ZA 3MA9H 3FB6B 4HOXA 1T03H 3FXIC 2XTJD 2YN3A 2C9UA 2LR4A 4OGZA 1ZHBB 3PREA 4HFWA 3U6RB 2ZCHH 3MNMA 1GGUA 1CU4H 1F5WA 1G9ML 5I1IL 5LUMA 5DJ0A 5TQ0L 1IFGA 1QTPA 3O2VL 3DVNA 1J9SA 2F5AH 2WW8A 3T4AC 1BQLH 3ZPDA 2OYKA 1OAKH 1DJGA 3IGFA 1SXSA 1XD1A 1IV8A 3F7YA 5CO1A 3VXQA 2V9UA 5C0DA 5TDOB 3KYMB 3W0WE 3ZDWA 5EO0B 3ZYJA 1UWXH 4NCC1 4TKWA 1UM6L 2O6DA 5DRZA 1H8OA 1QSFB 1O9ZA 3B9KB 4LGSB 3VFWB 1U8HB 4WU7A 2MPAL 5B8CC 2FT7A 4JZOB 4PSPA 1E8ZA 2K8MA 2Y0SA 2CNYA 4WWNA 4PCSA 2NY1C 4WWKD 2UYLB 4JUTA 4U4IA 5D1XC 3RWEA 4AENB 3RTQC 4LB8A 3WE6B 5KBDA 1BZEA 4X4XA 2HFFA 3LKQB 3QJQB 4YDJB 4XNMB 3S35H 5IHZA 4D9LH 3Q1EA 2VDRB 3L1EA 5C0EB 4GMTL 1VZIA 1A6VH 2VJ8A 4ZAKB 3N1FC 2YD8A 4PGCA 2UZIL 1EANA 1CE1H 5HDBE 1J8KA 4XPFH 3MLRL 2FX9H 2PPDA 5FM8A 4RGOH 3RVWC 3I9AA 4UOJA 3B9VA 3OR6B 3LQAH 5DJ6A 1IC0A 2YMXH 2K70A 4NZFA 4S2SA 4CU7A 1CXHA 4X6CA 3A67H 4ZOCA 4Z78A 2SODB 3P0VH 1ACYH 1BVKA 1U42A 3EBIA 2D3JA 5C0AD 1PQZB 3F7VA 2J4WH 4PREA 4AQEB 1CFSA 5F93C 4DTGH 2G60H 4JPKL 4Z7VE 3QJXA 3NFSH 1D3CA 5AEAA 2DPKA 4ANXA 1EFQA 3K71A 4GAGL 3QUZA 3RWFA 4N9GA 1WUZA 1EJFA 3CJJA 4ZTPH 4BKTC 3RB5A 2V0AA 2UVEA 4YHOL 1AR1D 3VSTA 1UXWA 3TBVA 2CKBH 1X6LA 3GI9L 3VJ6B 1UM5L 3VW3L 2J72A 1F1DA 4TQ8A 4NKQB 1SM3H 3GXNA 2HFGH 1CFTB 2D3VA 2XI9A 4UILL 2FECL 3TVMC 3BSZL 4AQOA 4Z8FH 5J4MA 4BSJA 3BIBX 5KWYC 1TMQA 1LL1A 1QATA 9CGTA 4DF9A 1B0RB 1PLGL 1MFBL 1RMFH 4DPRA 3IDIA 3NN8A 1N6QL 3WHXB 1PKQB 1UXSB 1MCFA 1ZV9A 1WFMA 1JXDA 3MRFA 3LTVA 3UTSB 3PPEA 2R29H 1CQKA 3IWUA 2BSTB 4GW4A 2NW3A 3MCKA 5DJ2A 1USQA 2Q2LA 2UY7B 1ITBB 5DC9B 4KNTA 4PJBF 1OTSD 4DW2L 2BVQB 4Y4HD 1IJ9A 1G6RB 5DD5H 4MQTB 4Q56A 4EKXA 1PZ5A 2DD8H 3RJQB 3C5XA 3TEYA 3G08B 3PFQA 1UADC 1K6QH 1MHPH 3CDCA 4JFXB 4E36A 4BFOA 1MWAB 4WUUD 1D2OA 4H1LG 5G2NA 2R2EA 3PJSA 1BLIA 1CDUA 3GHPA 2XWJB 3G5ZA 5FYKE 4EE2A 1UM4L 2ZYRA 3OKYA 3RX7A 1W72B 5FYJE 4ZK8A 5TDPB 2MOQA 4UQDA 1TZGL 1BAFL 3GZPA 1NC4B 2X2HA 3QCUL 3AM8A 3I75B 4RDBA 2RMNA 2XTJC 4Y1SA 4F27A 2I26N 1ETA1 1HDMB 2P8LA 3JVGC 2WKLA 3GSNA 1HXMB 3GK8H 1IEBB 1E50A 2RALA 1JGLH 2V17H 2Y7OA 2JELH 3BRFA 4JFEA 5A16B 1HL9A 5ACMA 2EC9U 1GCYA 1JV5A 4KZEL 1VFBA 2PPFA 2R59A 4BQCA 1OM3H 1IMHC 3ZMEA 2NX5B 3IMWA 4L4JA 5E99H 5HI4C 5JR1L 4TTDC 4X6DB 1B0IA 1BCIA 2R4RL 1CFQA 3QDGB 5TPWH 3MTXA 1UXMA 3V8OA 3WXWL 4LAJH 4ODHL 3VFTA 3MV9A 5AOZA 1MPAH 4K94H 2FWOA 1SEBB 4TVPL 5H37H 3TCXA 3TZVA 3UJJL 3ZKMD 1F58H 3PWJA 4GP5B 3DOSB 4U1NA 4Q9QH 2J1XA 3FZUC 5E9NA 2VITB 1RZ8A 2A4EA 5CGYD 2FGWL 1JNLH 2R69L 2R83A 3RUGB 3SDXB 4HIJB 2R0ZL 3IT8D 4XC1L 3FQYA 1RLWA 3GSVA 1N0XL 4WWOA 4Y19D 1E90A 4P5MA 1YY8B 1YNTA 4HZAA 4P05A 2CM5A 2PN5A 3DMMB 1FNSL 5A3IC 1YPZE 1QPXA 1BQHB 3F5WB 1I3GL 3LRKA 5GGTA 4GIPD 1A7OL 4N0UA 5AG9A 3FFDB 2Q1EA 5HDRA 4BE6A 4FNUA 1NIFA 2NYYD 5JOFA 2CDGA 1XWVA 1Z66A 3ARFA 2N7SA 2R0LH 4BCXA 5D5MA 1OAYH 5B7FA 4K8RC 3W39A 1E4XH 4RSYA 1TJGH 4KPHL 2X2YA 3IETA 1OAYL 5GHWL 4NQXB 4NUGH 4FYQA 3BDXA 2D0FA 1PLBA 3EYUL 3JWDC 2QQNH 5IG7A 4U7MA 4AENA 5CJQH 2XTJB 2LFEA 3WY3A 4XCCL 4PI0A 4KGJA 2R1XB 5FOBB 1JMZA 4ZAKA 1RIHL 4R7DB 3X1NA 1T66D 3QGVA 5BO0D 4MXWH 1JWMB 2XCMC 3V4UL 4ZMNA 1KXQA 4N0UE 2Z7WA 3B9DA 4F2FA 4MD5B 2BCKA 4WUUB 4H7VA 1MCIA 3ARZA 4KI1A 3L3KB 1MREH 1YPZA 5FYJD 3HI5L 1BHGA 2HRPL 4RBPK 3X17A 3OLIA 2NTFB 5IREA 43C9A 3KYAA 1LEIA 1TFHA 1IM9D 1KXTB 3K4ZA 5E8DL 3WTTA 1PQZA 5I0XA 2XG5A 2A99A 2BIQA 5EU6B 1KTBA 1B90A 4QF1A 3IDXH 1RIVL 2GAZB 5JUEL 1S9XA 1FVDA 1KTLB 4UINH 3RZCC 5I1EH 2UZYB 4KKZA 1MCEA 5E6UB 5KVDE 1NBYB 2K8QA 3AADB 5D9SA 1J5OH 3RQ3A 3N44F 1H9DA 2W0FA 4AEFA 3INOA 3LHPH 4EI5C 1F90L 1AOHA 1AC0A 1KCLA 2DM2A 2XUWA 3EF4A 1SFDA 4G8GB 3MLTB 2AXGA 3C8HA 5A43C 4XTRC 4XWGL 2GITB 1U8NA 3VXSD 2A77L 3IDMB 1WWWX 3MOAH 3LZPA 4GH7B 1N64L 2AV7A 4ONOA 2Z0UA 3FYIB 5DEGA 2Z9TA 3TNNA 2WTRB 3O6ML 4WQOA 4P2RA 2VKXA 2QKIB 1H5BA 1NANH 1CLYL 3W9DA 1UOVA 4JDEB 3RTLA 5EF1A 3BW9A 1C1EH 4KNSA 4NYLA 3T2OA 2AABL 1D5BB 3ZQ9A 5HYSG 2I69A 2VE6A 4CDGC 3MUZ1 3FFCA 6TAAA 3NCMA 3SGDH 1T04A 2EEAA 3BSHA 4HS6A 4MJ4A 4FQPA 4XVJL 5I24A 1PG7L 3AS3A 2VM3A 3GSRA 3HZVA 3ML8A 4PRPE 3WIFA 4DN4H 3WFCH 2FR4A 1ORSA 1DQDL 5E94B 3DXAD 5IJVB 1YA5A 1KCRH 1PEWA 2CD0A 1E67A 2MWCA 3MV8D 2HMIC 1FIEA 2VMEA 3ZIMA 4PJEB 2AS5M 4RDQF 1NFKA 3OQRA 1BZ9B 1X5LA 5GRZA 3ZSTA 2OA9A 1CD9B 1EGJA 3HZMB 4LCVA 4AVIA 4OD2B 2V5RA 3PWLA 2YQ2A 4MLIA 4P2AA 3BHBA 5EORL 1Z6JT 3GHEH 1JG9A 3HAEA 4L5FH 3W39B 5HHXH 1KBPA 2ZX9A 3BPNC 4LPWA 3Q2WA 5DR5L 4KK5C 5E6IA 3UZVB 4JDZB 2F54A 5IGXL 3IXAB 5A16A 1LK3L 1IM3A 3MJ9A 3QS3A 3V9FA 3OXSB 2ZCKL 4JKNA 4AMWA 2F53B 1K3IA 3GMMB 4FNSA 1MFEH 3BESR 3DURB 4FNQA 5D2NE 4DKEL 2AITA 3QDME 3DV6A 4JVUA 2IMNA 3QHZH 1U3JA 3I85A 1JWMA 5D7KE 3RWGB 1QLRB 2DIAA 5IKCA 5DWUH 4JZJC 1UXLA 3AUVA 2DW5A 4LSUL 3QJHA 3RDJA 1BVNP 1OALA 3MV7D 4WY7H 5FW8A 2BP0A 2ZOWA 3ZXAC 4YXKL 3DIVA 5A6MA 2JJTC 2BS9A 1QD0A 1I1CA 5EOCJ 1CBJA 2WWKO 5BZZA 4HHAA 4NXKA 4QHLA 4O51B 4GXUN 1UD8A 3VM5A 1BM3H 4DEWA 4KJYB 4M1GH 3VMOA 3VRLF 3QIBB 4YDJA 4KHXH 1UCBL 2O26U 3FOMB 4RMVA 4XT1C 5LG1A 4GPVA 3R7QA 4E9SA 2D3LA 2I7OA 2NYZA 3GGWA 5I30H 3LEXB 5K69A 5J13C 1EO8L 1JD9A 2IEPA 1HZHL 2OBGA 4JM4H 3VH8G 8FABB 5IJDC 2Q7YA 6FABH 1JUFA 4Q9RL 1CF8L 3NCCB 4W93A 2BP8A 1BGXL 4Z78B 4N2OA 3LRSA 5F1NA 3TH4T 3D69A 2WAHA 3SD2A 2XA3A 4L8CA 2KL6A 4UM9A 2X6MA 2GSGB 1BV8A 2CHNA 3IU3A 5DFTA 1G6VK 3VQ1C 1GW6A 2FAUA 4KO7A 4WFFE 5HDBB 5FR3A 3DVNB 4XPGH 5DURD 1FQ9C 1HE8A 4PTUA 4AXWA 1SN2A 2IBGA 4BFNA 5IK3B 4ONGH 4XBGA 1OT2A 1FZKB 3EDKA 1TSHA 2X09A 2HG0A 3TBBA 2I32A 2JNZA 2YC1B 4KXDA 1DVSA 1F00I 1F4XL 2GYSA 2YJQA 3LQZA 2NY3B 4JPWL 3STLB 3MV8B 3MNWB 4K71C 4I3SL 4OUUB 3FDWA 2H26A 3MTRA 3GS0A 4WU7B 3VFGH 3TX4A 2XXCB 4XNXL 2XIIA 3K2UH 4K5PA 4KX9A 4FHBD 4JN2B 2Q8BL 1CTOA 5BW7A 3FO1B 1OXYA 1W91A 3EFDL 4ISVA 4JRFA 2EYSB 4AH2A 2H4EA 4N2FA 2OJEB 4P2RE 3U6XA 1CD8A 5KAQG 3HJEA 3KPSE 4OM0H 1DQTA 1T7WA 3RWIB 3F7KA 1MJ7L 4H0GA 1IGTB 4NN7B 5J6HB 2FQFA 4JRWA 3B5GA 5E1HB 2XQYG 3SKUD 2IPTH 4OJDH 4B9ZA 2QSCL 2LLNA 1I75A 3HI1B 1FFNA 1WZKA 2IAMA 2B59B 4ZO6A 5MI0C 4ELKA 5KSBB 2W0FB 3EJPA 3HS9A 3HBZA 4GG8A 5GRJL 3HI6L 5H2BA 3LS5L 3U0WL 3DYMA 3WV0A 3G5XA 2FUTA 4LAQL 1ZA3A 2LU4A 3KVDD 4EAEA 4LCYA 1OP3H 3VXMD 4LAQH 4JHAL 4JQVA 1XF5A 5KVDH 2LU5A 5KVGE 1NSNL 4UB0H 5DGQA 3KD4A 3NJJA 3IVKB 4FZ8H 5F3BA 2DQJH 1AO7E 2Q8AL 3BKCL 3HZYB 3QEUA 4L48A 4M6OH 4FZ8L 4C56A 3U4BH 4PAZA 4Z3FA 4HISA 1JVOA 4OF8A 4OBRA 2TRYA 4KY1H 4PMFA 2WXLA 4H26A 1QRKA 5IVXA 1E7UA 4NDMA 3BKYH 1MCPH 1NANI 3COOA 2E56A 5DHXB 3UBGA 3KMDA 3UTTB 1FGNH 2I7SA 2CR6A 3KYNA 1B4RA 3HJ0A 2DYSB 4K15A 4WW1A 3KWWA 2EO7A 5CN2A 4ZPTA 1PY4A 4WJG3 2EO1A 2PYED 3EDDA 3FCTB 3AAZA 4TQEL 5D2NC 4KUCF 4HUMB 2JJSC 2GFBA 3SDDA 4ZMYA 2J1YA 1U8OA 3VQMA 5FHAL 4Q0XH 4ZODA 3VE0A 1D9KB 1Q1PA 5A2JH 1I82A 3L3HB 3UZVA 3UBFA 1HEZB 5F7WC 1FVEB 4P5TC 5D7JC 3BVDB 3S6CA 3A4EA 4NT6A 1BQLL 4EDWL 1SMDA 4AC4A 1AHWB 3VAEA 5EU7C 1JYWA 2JCCF 3KL3A 2VWEE 4HUCA 2ED7A 4XXWC 1KELL 4B53A 3TO2A 1AKPA 1IKOP 3HUJF 4WI8A 3STZB 1MF2H 4BWTA 3CH1B 2OXGA 5ALCL 2CE6A 3B7UX 3S98A 1IB5A 5D7IF 4JFFD 5IW6A 3DV4A 4OZIE 3BYYA 4HC1H 2NY2D 4R4ND 3PWPB 1MCCA 1A14L 2ROYA 5GIRB 1BZQK 3TBTA 4XRCA 2C26A 4U3SA 3QQXA 5F1SA 1MUJB 1KBGH 1L0XA 4MRBA 5T1MB 5F88A 4KROB 4NO3B 4KFMA 5IBUB 3Q6GL 3VX1A 1DCLA 4HOWA 4MXQC 1XGQA 4HK0A 3C87A 4RSVA 3DK0A 3LEXA 1KDIA 4NHUB 3MBXL 1BA9A 3K72B 3DDFA 1SXCA 4GSDL 1JYXA 1EWHA 4MD5A 4PRDA 3FCSA 3WJJC 1MFBH 1RMFL 4HPYL 2OTUA 4NKMA 4RESB 1XSJA 2KKQA 1XL4A 4MMZC 5TF1L 4BKSC 5FV1L 2CUMA 3CX2A 2XXGA 3C6LB 1A4AA 2DEXX 2GCYA 3BH4A 2KZWA 3RIAF 5B3JE 4M56A 1UFUA 1UA3A 1NCNA 1KB5L 3A3YB 4IMKA 4Y16D 4YE4H 2IJ0C 2UWEB 3DX9B 4OZIA 3IU3B 3KXFD 2TSBA 4HF5L 4U1MA 3QWQB 4Y2DC 3WFZA 4JCWA 2E6QA 4NN6B 2B39A 4J1UB 3NJFA 4KMLB 1ZPUA 4JJ5A 3Q01A 2VNCA 5HDQH 3HIZA 1J9CT 1CQYA 1RP8A 5I16A 2CDGB 2CDFA 5DD1L 2CG9X 5CBEA 1UGNA 3I6LD 4G6FD 3BE1L 1XGRB 5D1XB 4JFHE 4HUUB 2DWXA 4G8GD 3H7LA 5MP6L 1DLFL 4ZUTB 3BQUA 1N6QH 1GOHA 3L95A 2GJ6E 3RIAK 2WMPB 1WFOA 2AZUA 2Q2EB 2QKIA 4RFOH 3U7WH 1HILA 5E9DB 4Z7UE 3VFMB 1L0PA 2N7AA 1OVZA 5I5MA 3NFSL 4XVSH 4Z3IA 1CXLA 2P5EE 3VTTA 2VE6B 3HE6D 1ERNA 4XVSL 4RFEB 2X4OA 4GSXA 4MA8H 5DHEA 4AZ8A 1FFNB 2IPUK 3OZ9L 3PDDA 1MCOL 5C0GB 3WTVA 4RA0C 2AJVH 3VI4A 4E2OA 2DKMA 4FA6A 1I1AC 3EXLA 1KC5H 3QC5X 3BAKA 3IKCA 2FJHA 5KN5B 4A66A 4LT7A 1NBZB 4LIQH 1P4IH 1DZBA 1CMOA 1TVHB 4G8AC 1JZ7A 3TTSA 4Z0BL 5A2LH 4P49A 3S48A 4PV9B 2BXZA 3ZE0B 3NJKA 3AMLA 1JDAA 1UD2A 3NEOA 5F71A 2VO5A 1MY5A 1KJ2B 1T5KA 2IBBA 1A9BA 2D4FA 1G7QA 2JELL 4KVNH 4ODSL 4PJ8A 1BYOA 4JFDB 5IV2B 2QSTA 3WCYA 2C4XA 2HWZL 2H32H 2P5PA 3AS2A 3RVUD 2HTLD 3EFOB 4F7EA 4HLZH 3FZUD 4A7QA 3APCA 5CP3H 3N40P 3NIFB 1A7PH 2JFCA 3WEXB 5JQ6H 1W0WA 1Q9LB 2IALB 3ULUF 3DSFH 1ZTXE 4NZTH 3WNJA 2JQAA 4LRIA 5DI8B 4X5XB 4XXWA 4FFZA 4ODHH 5C07D 3ESUF 4W70A 4X4YA 2F6AA 4MBRA 4TS6A 5JHBA 1MFAH 2WO2B 3H9SA 4NLAA 2IOIA 5I19L 2B3IA 4G9FE 4K8RH 3K72A 3MKKA 1MFAL 5GISH 2EH7L 2A6DB 3Q8EA 4LGPB 3WFEH 2IFGA 1KJMB 1NEZA 4I87A 2XN9B 1UZGA 3T4AB 3QZLA 4NRZA 2CUAA 2G9HA 4HJGB 5E1QA 5KYWA 2Y4SA 2XXFA 1H6EA 4M8UA 4BH7B 3GK8L 2H1PH 3GMLA 3NK3A 1N59A 2ITEA 5DHYA 5L4MA 5B1JC 1DBJL 2G4GA 5EBWA 1EAOA 4UOW1 5PCYA 4MZIA 1RK0A 2R8SH 1OT4A 4ABVA 4R0LB 1CUOA 1FZMB 3KDMA 2G5BA 3LVTA 5KUKA 2ZSVA 2ZWSA 5LG6A 2VW7A 1ZPLA 4PJEA 4C4UA 2ICWI 3OSKA 1IGCH 1A1MA 5AOKA 1T22A 2VXTL 3CH1A 3BH8B 3PGFL 3TBSB 1AXTL 3H55A 1U8IA 1KYOJ 1A65A 4AE1A 2CLRB 1SUHA 1W72L 3EFFA 2X1WL 4Y4KB 2VN4A 3QYCA 4HUUA 5GS1A 1U8JA 1WP6A 3PV6B 5B3NA 5I1EL 4MJIE 3UXFA 2GEEA 5DYOA 1SDDB 5JHDB 4Q14A 4I9XA 4LSTL 4OZHF 4BRJA 4F8QA 5JHDD 3ZE1F 1GAFH 3FONB 2AEIT 2PCPA 5IMKB 2R1WB 4CW1A 1H6TA 4U1KB 1WA1X 2JIXD 5K5YA 2JJVA 3CZJA 4JCMA 1PZAA 1LEKB 5SWSD 4OLUL 3UH8A 4PRPB 4JR9H 2Z3FA 1U36A 2HJLA 4J6RH 3PWVA 2UY7A 5IBTH 3CN4A 1OGAD 4YEFA 1PFOA 3L2LA 3FB8A 3NSXA 5F44A 5FO8B 5C7XH 4PJEE 3SO3B 3RPBA 2BC4B 4JS7A 4LU5H 1ZIBA 1MFCH 1QUNA 2V2XA 5HJGA 3NSYA 1E2ZA 2X7LB 1N6VA 2AK4B 5DMKA 2GCYB 2XYBA 1DQQA 1UH3A 2LU3A 3S4SB 5B38G 1KIUA 4X6CF 1ANUA 2ATPA 3N41B 2QSQA 3N1MC 3THMH 1JK8A 1KF9B 3HG4A 4KWUA 1MY7A 2B8OT 1I4FB 4XPHH 3S36L 2XVLA 5F9OL 3SQOH 5K9KB 1A66A 3MJWA 1JNNH 4BRVA 4EVNB 4KDTA 3NCJH 1U91B 4MDJA 4ZS7H 2F53D 1C08A 1W0VB 3FOLB 3CVCA 2AJ3A 3QO1A 2I60H 2OI9B 3GNMH 3TA3B 5IMOB 1VFBB 4QWWD 3S5LG 1SBSH 3FH8A 2ENQA 4GXUM 2NNRA 5I74C 5DRWB 5D1QB 3V52H 3C9NA 3LPOA 3M07A 4GOSA 4LEOA 3IMRA 4DCQA 1IC4H 3CVBA 5ISZD 5EF3A 5EEXA 2XPZA 4X50A 4KBPA 5HGGS 1SQ2N 3L3GB 5IF0A 4GQZA 1SMAA 2V2WA 3MROA 4YDZA 3LEVL 4D9RE 3FQ1A 3LV3A 1CLZL 2NXZD 4U1NB 1U6AH 2WP3O 2NZ9D 1CYXA 4S1RL 1KYFA 2CM6A 2BJML 5JTWA 4F20A 5AW5B 1H3PH 1XGPA 2MTPA 2OL3L 1M56B 3CU1A 4AG4L 2X6BA 3GBEA 3HE7C 4HV8A 4H8UA 4W4NA 2R23A 5IVXB 5CEZD 1PX3A 1HSAB 3SJVE 3AU1B 3NGBC 1RUPH 4OLZL 4OUOA 4E9LA 2DYPB 3MRQB 3IFLH 4GAJL 1NDMB 2FJFB 3F83A 3MCLL 4H5SA 2PYEA 3Q9PA 4N0UB 3ATFA 3FUJA 1LD9A 4L4TA 3MOBH 4OGQC 3BN9C 1F3JB 1FJ1A 3MCLH 3GBMH 2H1XA 3QFJE 3SE4C 3NZUA 4BSWA 1OAJA 1OSPL 2FLBT 1HHGB 4DVBA 1D5ZB 1R3JA 2EDWA 4ES8A 2AC0A 5J1AA 4MQ7B 2GY5A 2W5PA 3MU3A 4WWKB 3QIBD 5FGSA 1YNTF 2J20A 2F8OA 3RX8A 2QL1A 4N2MA 5SX5H 5GS1B 5B1JA 4GSUA 2I27N 1FPTH 1RP9A 1WGOA 2VW4A 1T7YA 1OK0A 3ILEA 5J3HD 5H2BB 1VJSA 3ILDA 3UTPD 2YD5A 3QZMA 5LWYH 5J6SA 2BW5A 4QRAA 4OLYL 5IHUH 2VH5L 4N0YH 2JK5A 2K78A 5D6DC 4ZSOE 4TPRL 2ZKYA 3SCMC 1I8KB 2LAAA 3M46A 4P23C 3WDIA 4DGYL 3BP7A 4JGNA 2VDKH 2YRPA 2YPVA 3HPLB 1CDBA 2A3TA 1YPZB 2EUXA 5I1CH 4WLCA 1DVQA 3VFWA 4LBEA 2VC2B 1TU2A 1R5IA 4OSUL 4TQHA 5CEYA 1JZHA 1WBZA 3QXVA 4O02H 5KVEE 1P4BL 3TBYA 4AITA 4EJ1C 2JVUA 1LDPL 4WW2F 5AOLA 2FYVA 4R3SA 4OGYH 3HC2A 4JL2A 5D2LA 2WBKA 4GRLD 3GUTA 1S7TA 1URZA 5D72H 3KLLA 3EDFA 2AI0L 3HC0A 3LB6C 4H8WH 1FZMA 1BG9A 3KDMB 4HBQA 3S34H 2RAMA 4F2MB 3ULUL 2X4NA 4XNXH 1T0MB 1AZZC 1T83A 1OSZB 3HR5A 1A1MB 1RURH 1ZIAA 2XWEA 2BVEA 1IQDB 1A7RH 4HC1A 4PN6A 1OTTC 4H13C 1XZWA 4M5YH 4CVUA 3CFIC 4F1ZA 4Q6YA 3FB6A 1L7IH 1P5UB 5I6KA 2E0PA 1KPUA 3PS6A 2X44D 3ZE0F 5CD3B 4WTWA 2P26A 5E03A 4YDVA 1Z2KA 2ED8A 3L5HA 4F58L 1PIFA 4XODA 5J8OA 4UYQA 2Q7NA 4XE5B 4KX7A 4BZ1L 4J3SA 2APFA 1SJHB 2FX7H 2GT9B 4DPAX 3MLWH 4WV1B 1BF2A 1HXMA 1EBAA 4HWBL 3SDXE 3QZBA 1M3JA 3HG1E 2UXFA 3EGXA 4KZDH 5IQMA 5KYXA 1MKFA 3C2AH 5FA4A 5IFJA 3DV4B 3Q0HA 4Z7OB 3BQUD 3K2UL 4HIHA 3CGTA 2ZOUA 2AHIA 1IEAB 2X87A 5ESAB 2MHAA 4MYWB 3EZ8A 2K3TA 1NFDA 3GSRB 2JKSA 4IRSB 5CP3A 3HNSH 1RQ5A 1DJHA 4YBHA 1UB6B 5J6GB 4WFFD 1A02N 2AXFA 4ZPVB 3B9KC 1P1ZB 4X9BA 4KVCL 3DHPA 3RX5A 3CDZA 3EO9L 2C3HA 4DVBB 4JG1L 5I2IA 5DJ2B 5GXBB 4JGMA 2XETA 4AYMC 1MNUH 3UGXA 3SIKA 1W15A 3D2UA 1DDHA 2ZE0A 2AMGA 2PR4L 3DBSA 3IF1A 4YHPA 2ZPKL 3US1A 1W0VA 2BNRB 4XNUH 1E9QA 1F4XH 1IFHH 4DFIA 5T3XH 2X4TB 3FO2A 4PLKC 1NIEA 3G5ZB 1G1CA 3Q3GB 4MVBC 2P5EB 3FB5A 2P7TA 4G6AD 2WV3A 1F6AA 2COQA 1MHEA 4QAMB 4GUCA 5EA0L 2CO7B 4M4RA 1EXUA 1L0QA 2K9FB 1CJYA 4KI5E 4K4KA 3QNYB 3BDYH 3HMWL 1SHMA 4WI6A 2P49B 3D18B 1QFUH 2QZQA 2XWTA 4QUOA 4R97B 4LASH 5DVMA 1WHPA 4N0CC 1HOEA 1D5BA 3ZE1B 3ARDD 4NQDA 1R4XA 4X5RA 2Q86B 3VXTB 4LKCB 5L88H 3TEZA 1E6OH 5ECGA 4N2EA 2Y07H 2YRZA 4TUOB 3MNVB 1A1NA 5EZLA 4ES9A 5FUCE 4F9LC 4XAWH 4KVPA 3QDMB 2XKNB 3EW3B 4XAWL 4KJQD 5C0NC 4YHYB 5HHVL 3VB8A 7PCYA 3SDAA 2K4AA 4ICWA 2EDJA 1KIRB 1FYHB 1UD3A 3A6OA 2F5BL 1SJEA 4DPBX 1OF0A 3PWLB 2A4ZA 2XZCH 4YXKH 1RZKL 3E2HC 3V4LA 3ZKMC 4HKBB 4WFED 4HHWA 4XMLL 1FH5L 4ATTA 1NFAA 1JZEA 4PB9H 1OAKL 2F53A 3GEWB 3GMMA 4XPFL 3BP4B 3BWAB 3AITA 4DK6A 5KANI 4R26H 2GT9A 1QTSA 5L9DH 2ATAA 4PJBB 3GS4A 1SYVA 3MRBB 4NAMA 4JK0D 1WWBX 1TJHH 4RRPA 1FNGA 4PJIF 3DX0A 3GSWA 4QO1A 4PV8B 2JF1A 4B60A 1WWCA 1RULL 1A8JH 2V2TA 1P84J 3QIUC 5JNYA 3I6GB 4HWEL 1BEXA 2YUZA 3ZTJH 5GRWA 2HJFA 4Z1PA 4QRFA 3U2JA 1G0DA 4JFEB 5IQNA 3V0DA 3VXPB 4K55A 3RU8L 1HNYA 3UX9B 1K85A 4WKZB 3LN5A 2TAAA 2FDBP 1LVEA 3TYGH 1Q9LA 3MUHL 3UTPE 4PRIB 4Y9BA 3IXTB 4PP2A 3BUIA 1S7TB 1CU4L 1A64A 2EXYC 3VXSA 1BOYA 5LBSA 1W8OA 2HJLB 1EVUA 4PG2A 4KKNA 3RKDC 2UX6A 3GLZA 4Y1TA 1DE4A 2BC4A 4PLJD 5E4AA 3UPRA 2MKLC 3F3HA 3L4YA 2H41A 1KIQA 5FLVA 4QYOB 3VSQA 5DMGD 2Y3AA 3B2UD 3QUYA 4O5LL 2ZUSA 2NY4C 5ISZA 3IDYB 1IFRA 1KPUB 3IDJA 2X4RB 4JQXA 4HT1L 1IQWH 1YYLL 2WQXA 1NCOA 4UQIM 3QZWB 3LS4H 4DW2H 1YNTB 4G3YL 3LZRA 3ULVC 2X12A 2XV0A 2QGCA 2ZG2A 5DZVA 3WO4C 1UM5H 2NZIA 1NFDE 5FO7A 3U36B 3DO7B 4XX1G 1RJZB 5KVMC 3RFZC 1YSOA 1Z9SA 3QEHA 4N8PA 3QQNA 1S7QB 3WDJA 5F1IB 4EF3A 3FYEB 1BIIB 3EGXB 4FLQA 4OZGF 4BE5A 1J05B 1F4YL 1E30A 4JRXB 2IQ9L 2AXGB 1XF1A 1H3VA 3TJEH 2NSQA 3SPJA 1TZGH 2LTQB 1AJ7H 1J0ZA 3FQNB 1LWRA 3A21A 4ZUUB 3WSQL 4LEOB 4DCQB 3GBDA 3WUWA 5LCVA 4C83B 4L1LA 4A2MA 1V7MH 2ZXGA 3O3DA 3TEXA 2YPKA 3QWRA 4GMSH 1A9EB 1T21B 1QWUA 4G6JL 1Y6MR 5GGTH 1OZUA 2IWGA 2Z64C 5KS9E 2NY6B 2QVFB 4JDVA 1JK9B 3TYFB 5T3ZE 3EH1A 2EDQA 2E46A 1EHAA 1MCNA 4G5ZH 4QHLB 2B59A 2O5ZH 1EZVX 5FCUL 3ZZLA 2WKGA 2EXWC 5L2KB 4YGAB 4JHUA 5GZOD 1YHPA 3GRWL 4IRZA 1AOZA 3RL2B 1IO4C 1LO3L 1ZA3B 3R1GL 5FYJL 4TF4A 1MIEL 2C8NA 3CXHJ 1KIUB 2DQMA 3ATDA 2EE9A 3BE1H 2C3WA 4TLKA 5SV4A 5C3IA 4WHTA 2Z7UA 3Q3GA 2ADYA 5AW4B 2A74A 1JSYA 3O6FD 4LARH 3NJXA 3GPEA 3DBXA 3QNXB 1DBJH 3OBAA 3Q6FB 2R0WH 4MHHI 4TRPH 3L13A 4WI2A 3UDWA 5M95B 1HAWA 2YA1A 2V2TB 4KU1A 3VCLB 3H2QA 4MAYC 1J8HE 3RVUC 3D69B 1EEYA 5CR1A 5LBGA 1R6VA 4DOHE 1PU0A 2CUIA 4R83A 3S35L 2BVYA 3AABA 3CZEA 4XWOC 3UCQA 2BY1A 4P59H 5T1MA 1J48A 1TTBA 3UTZB 5C08E 2C3XA 5JW4Q 4FF9A 4H20H 3ULUC 3MLRH 3A23A 3VXSB 4ORZC 3TA3C 3BC9A 4YPGB 3A5VA 4LPTA 5KVEL 1HKLL 1E6JL 1KNOA 2WO4A 2WWKT 1HAUA 3AQDA 3QEQB 1B0GB 1JHKL 2K45A 3L17A 3LZFL 4U6TA 1KN2H 4XP9L 1G1OA 4WFEE 1YDPB 2NY5L 1N9PA 4IKIA 4U1SA 1C5DA 4Q74A 5J12B 3V4VA 4Q52A 5FW7A 2UWEA 5DHVH 3JQOB 4R3SB 1C16B 5FDWA 3EG9A 3HZVB 3O4LA 3WIFB 1FRGH 5GPRA 1HQ4A 2IH9A 4FQLL 3SBQA 1OGAB 2WWNA 2X6AA 4ETQB 4JFYA 4NQCE 4PP1D 3QG7L 4NQSB 4WEBL 3WXVH 1BEYH 1MFNA 1SNRA 4QKTA 1EO5A 1HXYA 4HPOH 5EU3B 5L0QB 2ENSA 3RA7H 3WOVA 3QJSB 4JKMA 3P0YL 3MRJB 4H44C 1RY7B 5DHVB 4DGIH 5LNGA 5SWQA 4KNQA 1M9SA 3PP3K 4A2EA 4PYGA 2PXYD 3ORJA 1SDYA 2X53A 1QHPA 3EJSA 3ZW3A 1XSOA 2A9MH 4GNKB 4KKAC 4XX1E 2DQDH 2GJPA 2HJKA 1ET8A 5JMOC 1DJSA 3UC0H 2ZQKA 2EIZA 3V4UH 3C5ZC 1SY6A 4M7KL 4N8VA 1UWGH 2DJMA 1CT8A 3PDGA 2PYFB 2VB5A 4UV7H 1EMTH 3BZFA 5D7LE 5T5FA 1SN0A 4EMZA 3I84A 1FFPA 3D5OF 3NIDB 4ONHA 3S3DB 4FG2A 2H26B 2VMFA 5D6DA 4HIXH 4WSGA 4S2SB 5MP6H 4IRSD 4LVHC 1LEGB 2EC8A 1TZHB 4U7SA 1DVFC 4ELME 4YH6A 2BOBB 1TJGL 4B9YA 5J6GA 1DP0A 5CZVH 2DLHA 4DIXA 5IEHB 5LLIC 3D25A 3GSQA 5F9JA 3TCTA 5I0DA 3MLYL 3AG3B 2GFBB 3R0MA 2XA8L 4OM1L 1M7IB 1L9QA 1P6FA 5JOPD 4RWYL 5E7FA 4Y16C 4LPCA 1H3WM 2QHRH 4XMUA 4GBXC 4OLUH 1BMZA 4ZSOB 3EOTH 3BZEA 4F7EB 5A2CA 2BWIA 2CO6A 4HUNB 4HGKC 1GCFA 4U1IB 5CLWA 1OD7A 2GJZA 2R4RH 3HUJB 2IALA 1WZLA 3ZE2F 3IDGB 3VW3H 4BHUI 3ABZA 1DUYB 4NKOA 4D9QD 3QPQC 4IKJA 4DHLA 3S37X 3NP3A 3PF2A 1HN1A 5KYYB 4UT7H 1H3TA 1YY9C 3G6AB 5CHNA 4KXZH 1LLAA 5LBVA 1MDAA 4HW6A 5EH1A 4RGMB 3T3MF 1UZ8A 1XIWD 3MNDA 5CJXC 2XQYA 1TQVA 2NNXA 4HJGA 3N1QC 4WI0B 4J39A 3HOGA 3CN2A 2JLLA 4YQXL 1ADWA 1GYUA 4JMNA 5F1OB 1XR9B 4ANUA 3STLA 1S5IL 1CXFA 1RUPL 2NCEA 5F3HA 5TDNB 5L2JB 4NCDA 3D52A 1SOSA 4XN5A 3VO0A 2DLFL 2D2CC 1GGIL 3IU4H 3DTXA 1JE6A 4HEMA 3IWVA 4HH9A 1OSPH 2E3VA 3NIFE 5HPMA 4R2GC 2OTUB 4PV9A 5DD0H 4PUBH 2FNBA 3BDBA 1AP2B 2MCPH 3CZLA 3VFRA 4Y8AA 2X28A 5ICYA 4JHWH 4TL5A 4YFLI 1FLRL 1DDHB 1EIBA 1KTCA 2GK2A 2DI8A 4B7IA 5FYKU 3UJIL 3ZGHA 3E38A 1HTYA 4UYPA 2XV3A 1NMAL 5C0CA 2EZ0D 1P1VA 4IKLA 3T4YB 4F92B 4OZGB 3TCLA 2FEEI 5E5MB 5AAWC 3NZ8B 1J1PH 2P80D 4G43B 4H8HA 4JPQA 4GT0A 2PR9A 1K8IA 3KLAB 3PHQA 5DQJA 1YQ2A 5C0AA 2PYFA 1RUQL 4M3KB 1QLEH 1TJIL 1G1KA 3FQUB 4NOBA 5J12C 1ADQH 3MGTB 4Z7UA 1IE5A 1T6WA 1T20B 2DQTL 3MRNA 2BVOA 2OS7A 1CDYA 4MZ2A 5B1CA 2EDFA 4FCHA 5CWSB 5JHDE 5A2IH 2FT6A 4HKXB 5AALA 4H26B 1E3ZA 5FKAA 5CZRA 3KW8A 5CM1A 3C8KB 5J89A 1LYQA 2F2HA 4Y1AD 5FM4A 2A6JA 4I88A 1FGVH 5FECA 1KPVA 1EGJH 1D7CA 2B08A 4NEHB 1BD2A 1IGFH 5K93A 2GJJA 3O6LL 1P5UC 1YMMA 3JV5A 5E8OB 3RY6A 5E4IA 4LEEA 4ZAKD 4K5LA 4GKNB 1CVRA 2XWXA 2JKXA 3EHBD 3MLPA 4JJHA 4KUZL 3QUYC 1J88A 5KBKA 2ZWKA 3HCVA 2WY3B 2HRPH 5ABZA 1QPPA 1TPXC 1IL1A 5IBLD 3IDGA 2H9GB 4APQB 2F8VA 2IANB 4FXKB 1AD9B 4N87A 4HG4J 5EUKA 1GYAA 2NY7H 4MAYA 1KDJA 2XN9E 1LDPH 3QXWA 2C9SA 3QUZB 1ETJA 1I9IL 2FHBA 3FQTA 1I8IA 3KCWA 5FWRA 3RWFB 4R4BB 1PX8A 2OMVA 3GSXB 3DO7A 1BOGB 3CHXA 4J3WA 3HE6B 4HKZA 4WI0A 4KZCA 1J8SA 5I16B 4JRXD 2K0RA 3AUWB 4RAVA 4H0IA 2V33A 2YLHA 2YD2A 4ZX6A 3GQFA 2AXWA 4HALA 5K1VA 3MNZB 4KTYA 4OJYA 5C07A 1F3RB 3AG1B 2NX5A 3FQRA 3RGVB 3V0WL 1S9VB 3MA7B 5DS1A 5IUSA 1A7NH 2BOLA 3P4NB 3D6GA 1BECA 3TFBA 2B0SH 4MRCA 4D8OA 4M6OL 3RKDD 1DBAL 1SGKA 2G4EA 5BNXD 4NUMA 3IPBA 3OKOA 3UTSA 4TOYL 1GS6X 4MSWA 1J8HD 4YIQA 4XR8C 5J9PA 1BFOB 4WCYH 5FUZH 1VFMA 3LIZL 2XZAL 1UH4A 1VAHA 3EYOB 4WWKC 3ARDA 2MJWA 1PZ5B 2WQ8A 2NR6A 1M4KA 4ZX5A 3C6LA 3BEWA 2GTQA 1UVQB 5CSZB 3WO4B 5AENA 2IWFA 43CAA 2ZSVB 4JLRA 5F9WC 5D1QA 4L05A 3VXMA 2JI2A 3SE8H 3CSFA 3QZOA 1AG6A 4NBZB 3LN4A 1YG9A 1BXUA 1HWHB 2Y6TE 3SDAD 1OOWA 2NXYD 3BP5A 1M1SA 3O6FB 2WUCH 4GYBA 2YPLA 2AVGA 4PRHA 4PWIA 4YXHH 2X9WA 3O6KH 2FBJH 4AT6B 4APQC 4YXHL 5DVKA 1XCXA 1SDAB 1N18A 2VDML 3A0OA 1DFXA 3HKZA 3PHOA 5GS3A 3BIKA 2Y9RT 5IB4A 2BPBA 3KH3A 3VXOA 4JQIA 2V4LA 3QDJD 1G4MA 2EIEA 3L9RB 1UEMA 4PHZA 4WWID 4IMLA 3GLEA 3IJSB 3VFPA 4B5ZA 1NGZB 3QULB 4KXZI 3STBA 5L2JA 5BRPA 4H25A 3EDEA 2OL3A 4NQCD 5FV2A 4PRPA 1V7NL 4Q9RH 2PCXA 2J57A 3SY0B 3G6JE 1HL4A 3FRUB 3GSNH 3CHOA 3IYLW 2Q7YB 3WJLA 3T08A 1GTFA 1DVFA 3MREB 4KH2A 2MIZA 5JPNC 4XP6H 3IMUA 5EN2A 4N5EC 4FLRA 3NQKA 3ULSA 4L8SB 4JKWA 3GMLB 1AZVA 3LN9A 5DHYB 1PS3A 3QO0A 4JDZA 1EHLL 5JYLA 2WWMD 1GHFH 3B3IB 4ONFH 3TBWA 3RWHB 7PAZA 5JDJA 4G42B 5HBBA 3CLFH 1QWNA 2P28B 3M17A 1J18A 3QEQE 4NRXA 3ZQXA 3MI6A 2NDGA 2DM7A 4FADA 3IGUA 5KW9H 2VDLB 3IS1X 3R7RA 3S88L 1KG0B 2WLZA 2ZCZA 3LQAC 4Z5RB 5HYQB 3F6JA 3TIEB 4WTQA 2QHLA 4NNYB 3CTTA 2NY0C 4C4BA 4CBZA 3KPMA 3FQUA 3O2WH 3D7PA 1AACA 5E51A 4MX7A 4NO2B 4W9IC 5JHLL 4MS8D 5ADOL 1TU2B 4UZUA 4AKPA 1KCWA 4IGBA 1OGAE 2HTKD 4E9TA 5A2BA 2XZCL 4G71B 4NM8H 3PWNA 5IB3B 3B7SA 5F7YC 5DD1H 4U1KA 5GSVA 5IUCA 4QTFA 3HPJB 1NCJA 2FWUA 1LMKA 2YGQA 3C6SA 3MYJA 1EPFA 1UT1A 2YAMA 3SO5A 2VDQL 4NERA 5FYKD 3S37L 3RPIB 1WV7T 1GYCA 3E6HA 2O5YH 2NDFA 5EOQL 5MEPB 2YD0A 2FEEL 1UWYA 4BM7A 1KCUH 1YQVH 1KGYE 5D7IA 3ARGB 5I0YA 4P9ML 3KPOB 1G7PA 4RMWA 4HEPG 1AGCB 1NGQL 1OAUH 2V7NB 4NSKA 4X42A 3BEWB 5I71B 3BVXA 5HYJA 1KSRA 2UUDK 1KGIA 4Q4EA 5IJVA 3EYSH 5CZXD 4M5SA 1JGUH 1CBVH 1U8KB 3EFDH 2ZYIA 2P8PA 1U4FA 3ZL1A 1RZGA 2V3EA 3CAFA 1YNLH 3V6BR 2VLJA 4G8IB 1NDTA 3NCWA 3SGEH 5TE7H 2UZYA 3HLKA 5E23A 2L7EA 4WWKA 4GQPH 3FFDA 3U46B 5I5JA 3MJ9H 2FE0A 4N5UA 3IXAA 4KNUA 4UTBL 3PL6A 4ZUVB 4K73A 5KBLA 4JG9A 4N8CL 3S3SA 5BVJA 1QABA 1HXYB 5A7BA 3ZGIA 4HAFA 1DVTA 4ZZFA 3MO1B 3H0TB 3S35X 3QRGH 3QDMA 3BFWA 5IQOA 2GSIA 4FLHA 2B1HL 4R90H 1Z7JA 2LE9A 5AVWB 4U0RC 4J3XA 2WUBH 1X6NA 2C7UB 4N1EA 3GJFA 3A47A 4X6FB 1T5XB 4YIQB 1EUUA 4KKAD 2AJUH 2NR6D 1A7PL 2EYTA 2WWOA 5A6IA 4Z7NF 4HCRL 1Y7VA 3JUZA 3KM1A 4NZRL 3AXLA 2QZ5A 3HRZA 3N1PC 3FB8B 2C9VA 2XFGB 2XZZA 3FFCB 3PL6D 4XNBA 2YOAA 1QLEB 4F3FA 4FABH 1WTGT 3DRTA 4UAHA 3TV3H 1FL6B 4AYGA 4FFWC 3IF1B 3T1WA 2HN7B 4ZQKB 4HSAC 2LVCA 3B3IA 3E0GA 3WIAA 3W56A 5FYLE 4EUPH 4RWHA 4G7RB 1KXTA 1MEXH 1XGYH 3CN1A 1DLFH 4LVNB 3SCMA 1OPGL 1G7MB 3KPQA 4OGAC 2Y2WA 1XF4B 2A1WL 5FO9B 4Y8DC 2IF7A 5D6CA 2FIKA 1JTTA 1TQSA 5EOCH 4EVNA 2AJSH 4GRLA 2ZXEB 3E1F1 3WTWA 3APFA 2BH0A 1QEXA 3FO0H 3O3BB 4MJ5B 1AH1A 2YFOA 4URKA 2ZZUT 3NABH 5EG6C 4D9LL 1MJ8L 2OCCB 4U2YA 5EHFA 2HKAA 3TPUA 4M7LT 2FJUB 2GKIA 4F15B 4Z7QE 5IWLC 2NLJB 5L6YL 3U83A 4OZGA 3U9PH 2B20A 4YDIL 1ZK9A 5E8EA 1CICC 4WO4A 3CFEB 1LO3H 5FYLH 1NFIA 4TTDD 4L2YA 2I9LB 5I75C 4JRYD 5FYLL 1U3ZA 4PG9A 1EJ6A 3WNIA 2D2OA 1X7TA 2F54E 3K8LA 3PLYA 5FIEA 4L37B 2VN3A 3FT2B 3SDDB 5K59F 5EN2B 4XNDA 4I0CC 4EUPA 3JWDH 2R0ZH 4H2AA 5DK2A 1WA0X 4HKXA 1AQDB 3ZKXC 4E41D 3ZU8A 1JN6A 1QA9B 3DROA 2B9AA 4KJYA 4HAGA 4LRNH 4M6ML 1RKRA 1AQMA 4P23B 3V0VB 4AVJA 1PZUB 4FYRA 5DUBA 2OMYA 3IJ9A 5MEOB 4PRID 4W9LC 4HQQL 3UTQA 3BMVA 3G5VA 1QUPA 1HSBB 1MWAL 2HXAA 1OM9A 4JM2C 3C6LC 4HH9B 1EFXD 3BVNA 4X8JB 2APXA 2CK2A 2KZ1B 4CILA 1XXDC 3AGWA 4CJ0A 5G5DA 5IIEB 5KSBA 1LMIA 3WXWH 4FA8A 2WPGA 1D5ZA 1R3JB 4A2FA 1TETL 3NPSC 2D73A 3NJGA 4I77H 2WXGA 4X83A 5HHOB 2XQ0A 4K2UH 4QRPE 4UOQA 4YFDB 4YDVB 4M7ZC 1YYCA 4MWFA 4LOVA 3OKDB 4G9DA 4C83A 5C0CB 2WZ5A 1BQKA 1JV2B 1A0QL 1KTRL 2KMWA 4F57H 1F3DH 2EABA 3LHPL 4LVOB 1GIGH 2LABA 2WXHA 4Z18A 4XBGB 2P1YA 3MRGB 3ARVA 4N28A 3SEPA 2EEXA 3REVA 1XDTT 1TO4A 3AWFA 5GS0H 4YHLL 1TCRB 5FA4B 4NJ9H 1TXKA 3BD3A 1BPVA 4OV5B 3ZTNL 1IGCL 3LKPB 4P4KD 4QRRB 1RSYA 4UT9L 1SM3L 3MXVL 1KGXA 2UXVA 4M1CD 4RMSA 1NFDB 5AAWA 3KE0A 3OX8B 4MCZA 4X4KA 5E7BA 2YLKA 3P0YH 2YPLD 4XMWA 3WJLC 3CVIL 4AH2B 1FNAA 1IU1A 4NWUH 2QVIA 1PJWA 4X7DC 4OI7A 1KN4H 3OKEB 1UC6A 3L1OH 4PS4L 3D3VB 4Y9EA 3SOTA 2DM4A 3ZL4L 1UOLA 3RWIA 3SN6N 2VDOH 5I8OL 4YSQA 2OSLB 4WZ9A 5E8OA 4K7PX 3D2UB 2IPKB 5CILL 3E1ZA 1RK1A 4AY0A 3QI9B 4KHTH 1SBSL 1YUKB 1EEZA 5IBTL 3MV9E 2VDOB 5FUOL 3RVWD 2Y6SD 4BZYA 5CCGE 5LDSA 2CH8A 1QR1B 1GTNA 3R1GH 2NLJA 1SJXA 5D4JA 4ZMQA 2RJMA 4UTBA 1FSKC 2IAMC 5EWIH 5EBLA 1PD1A 3CFDB 2AJXL 2KDGA 3DA0A 1CD0A 2H6OA 4MMYB 1FAIH 1GSKA 4AXWB 3RTQD 1KNOB 1M6UA 1UH2A 3DX4A 1T7VA 1PLGH 1FZJB 3DSNB 2HJFB 3AROA 2OTPA 3NRQA 4ZD3L 2WIIB 2GK0B 1FVCB 4DKDC 4JFVA 3CLWA 2FK9A 1S7XB 4PJ7A 5IB5B 2HCZX 2BVQA 3BUBA 4ZFOA 3FT9A 1FC2D 1BVLA 1HE7A 5K33A 1I3GH 3QJOA 3OF6A 3EOTL 3IM1A 5BZWB 2DWDA 3OVUB 4BQ8A 1L9OA 4XNQB 4XNZB 5HI5C 4RBPH 2EICA 3GMNA 4UIKH 2IANE 1N64H 3FCTA 2K6YA 4L4TE 4PJ9B 1EA9C 2W0LA 3ESMA 4RIRA 4XB7A 3TO4B 5ICZA 1UZ6F 5EZIH 3UJJH 1AYRA 5DEJA 3QCTL 5C0FB 2EIDA 4IHOA 4J12A 4Q9QL 3U7YH 32C2A 1MCBA 2EDXA 3P2TA 2J71A 3F84A 3FHQA 5BO1L 5SWQB 4ODVH 3HZKB 1GJUA 3HNVL 3VXRE 2HLEB 5D93B 5CGBA 3OPZL 4IBQA 2B3RA 4LEBA 1RXLA 2DBLH 5BJTA 1CFNA 5AW9B 4FXGB 5F0LB 4QXUH 3JWNG 4XHJD 5HJ3A 2F7PA 2YAFA 4ZTEA 3ZDXF 4KOBA 4L3ED 1UUNA 2W94A 2VC2H 1WZMA 3K0YA 2DQFB 1QRND 3D1MC 3Q1SH 4KJQC 4PGZA 4K71B 5JDSA 5C0ND 2E76C 2ZONA 3QJRB 1ADQL 1X5KA 3UO8B 3BZFB 5I1CL 1G9MC 3LH8A 4PV8A 3PG2A 5EBMA 2G3XA 2ZKMX 1JCKA 3DIDA 3VA2C 1I1AD 3PAUA 4M1DL 2FO1A 5D1ZB 3FRPG 2ATKB 1CK0H 1I85A 4N86A 5F7AA 4TVPH 1R47A 3CZKA 3VRJB 2K7QA 1JYVA 1TVDA 1MHCA 1EGJL 1UXSA 4QYAA 3V6OE 2IV9A 2Y23A 1IJNA 3PQYE 4H25B 1PD0A 1U33A 2IQAA 1A22B 1COBA 3P3UA 1YMME 2XVKA 3NUKA 1RK7A 6FABL 2FGZA 4PJHF 4JKPL 3WKQA 3NIDE 2WINB 2VQUA 1NIBA 1FO0L 3G04A 3MUGB 1WIOA 5C08B 5HD8D 1CYWA 1NUFA 2MOGA 2QPFA 1NLDL 1OL0A 3OJ2C 3VE0B 1FE8H 2QQQA 1BVKB 5TE6L 3C2SA 2WTPA 4WGWB 4AQ1B 2CMRL 4QOKA 5KYYA 4YNYA 4EDXA 3ZO0A 2JQMA 1U6AL 4R84A 3QNXA 3DDGA 5IMKA 1LWHA 1F1AA 1X7QA 1PDKA 4RETB 4M1GL 3AWGA 5F9OH 3DX7A 5T1DL 3SQOL 4Y5VC 3U46A 1IEBA 3NSJA 2YD4A 1MVUA 3LKRB 4WK0B 4UZGA 3G9AB 4ZX3A 4JRXA 4BGLA 1ROCA 1MQ8A 2H8PA 3KYKH 4X9IA 1OTUC 1FZOB 1A7NL 1AC6A 4MX7B 4NO2A 4MQXD 3HC3H 4PV1C 1VEMA 2ICEC 3K1DA 1NCGA 1TNNA 2B2XH 4G8EB 1E3FA 4W9EC 3VFNA 2DQIH 1IC4L 2BIIA 1SMOA 4KUCD 4MAZA 4DKFH 4E42A 3PNRB 3QG6A 3OAUL 4PJAE 1OV8A 4OM0L 4EIGB 1CLVA 3RAJH 4L5FL 1T21A 1UATA 2XXMB 3RAJL 3ECWA 1ZSDA 2OSLA 3FUIA 2NQ3A 1A4JA 1AP2A 2OPCA 4IRSC 2Y72A 3P2BA 1DE4B 1F56A 3Q2LA 3S36H 1VZHA 5HDLA 1AFVH 5FDWB 4Y1AE 4U31A 2CHXA 4AX3A 1VGEH 3F58L 3IMVA 4P2QD 5E8NA 2R0KH 5GSRA 5LGJA 3VD0A 3ELQA 1E0OB 2JK5B 2P8PB 4Y2DB 1HH6A 3RFZA 5SWSE 3QDHA 2N4IA 4KRPC 3D08A 1QLRA 2M83A 3QT2A 5HI3D 4X98A 3WEBA 1D5IH 2ICWB 4BK5C 1QKZH 1T7ZA 4M3HA 3KYOA 4LBEB 3C09C 3OJDA 5D4IA 2E8ZA 4S10A 1RUAL 1KEML 5I26A 5JXED 3RL1A 4FNRA 1FPTL 3AMKA 2JB6B 5TFSH 3C60C 4P2OB 1MF2L 3OAYK 5C09A 4EOWH 3O3UN 1GZQB 4OZFH 4RMQA 1Y1DA 4DZBB 1GKOA 2VYRE 2ZPKH 3FOMA 1EO8H 4PYHA 4QPEA 1KPVB 4X6DA 2B1OA 4R7DA 4N8VB 1WJ3A 1WZ1L 5DMIH 5BUAA 5E2UL 4MJJA 1MVYA 2QGDA 4MB4A 1A6PA 4PG9B 4DPCX 1FFPB 3WIIL 4TQPA 2B1AL 2F58H 3DC0A 4GAJH 3LHAA 5HP5A 4LNVA 1GGBL 3ABKB 3LQMA 1XCQA 2IXQB 5D93C 1KGWA 5E0FA 3FT3B 3OKNB 1ZLSL 3RIKA 4BA8A 3UDWC 3CIAA 2LHAA 4UI2A 4JFZL 3UYRH 2WLKA 2IAMD 1UGKA 2R4SL 1THAA 3IE4A 4CAGA 3CFJA 2O5YL 4EIUA 4OKDA 2QVTA 1HOCA 1HL8A 2X3CA 4H8QA 1S9XB 3SOBL 3SDYH 5BV7C 4YDKH 1MCPL 3DX7B 3C2AL 4ETQA 3PP4H 1I8MB 5I1HL 3B2VH 3GMQB 3MXWH 1MFEL 4HWZA 4P5TB 4KDWA 4HXAH 3SBRA 2F7RA 1W8EA 4UMSA 4PBDA 5DEFB 1HDMA 4XN8A 4JFPA 1CL7I 3EH4B 3KPTA 2BSCA 3NESA 4W9KC 4PRAA 5ALBL 4U2ZA