3EYUH

Pfa1 fab fragment complexed with ror2(518-525)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
226
structure length
218
Chain Sequence
QVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDDRSYNPSLKSQLTISKDAARNQVFLRITSVDTADTATYYCVRRAHTTVLGDWFAYWGQGTLVTVSAAKTTAPSVYPLAPVGSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords If kappa light chain
publication title Structures of Abeta-related peptide--monoclonal antibody complexes.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 218
sequence length 226
ec nomenclature
pdb deposition date 2008-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eyuH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eyuH02
1EH9A 3PWLB 1CTNA 3NCMA 3VJ6B 4Y16C 5GQBA 1KELH 3QO0B 1EAJA 3F8UB 4LLWA 2NTFB 4AEHH 5ACLA 2VDPL 1W0VA 4ZS7L 1U8MA 2VH5H 1MCSA 4AIZB 3S9DB 5E4IA 4WFGD 5KVGL 5CGTA 2FECI 1C5DA 1G7MB 1NCNA 4DTGL 4PGBB 1FYTD 5EOCH 4WRLA 2H8PB 1U95A 4HPYH 3VRJB 4XZUB 1JGDB 3FTGB 4LCWB 5D7SL 2OLDA 1MY7A 3KPRA 4P99A 2CMRH 4IDJH 3G04A 4DWHA 3PWJA 1GYAA 1I1FB 1KB5A 4Z0BH 1XIWD 3FO1B 4PRBB 5EOQH 1A3RL 6FABL 5I73B 5F7EH 5IHZA 2V7NA 4FQIH 4Q9CA 5K9OA 3DYOA 1RZKC 4O5LL 3ZMRA 4HJ0C 4G9DA 2CLVB 1TJHH 3GSUB 1CU4L 2IAMD 4F7TB 2NZIA 1CWVA 3FKUS 3I6LE 1U8IA 4WGVB 2JKXA 4M1CD 3UPAA 5C0GB 4LVNB 2DYPB 3MV7A 2DB8A 4J8RB 1VFBB 1ZHBA 1NC2A 4LHUA 3IU4L 4RFEB 5HHQA 1INQB 4NFBA 3NA4A 3LQMA 4DKEH 5FM5O 5GISL 4KJQD 4OZFA 1I8LA 4HFWA 5SWZB 2H3NB 4I0PA 2MPAL 2K1MA 4UQ2B 1KIPB 4RWYL 4GAYA 3ORJA 5D7IE 5DRZA 1VFUA 5GGSY 3VFTA 5KVFH 4U1NB 1FO0H 4JFQA 2DWDA 5GGUB 3MOBL 2DD8H 3VMPA 4OJFH 1YECL 5F7LB 2AK4E 3T1FA 1A22B 2XTLA 1MAKA 4YHIA 5LCVL 3KPRE 4HWUA 2FIRT 1ITBB 2H32H 3BH9B 1RZ7H 1NGQH 5F1KC 2PW1B 2IALA 4N8CL 2M1KA 4WDIB 1LO2L 2AJ3A 4F3FA 1AHWB 3MX0A 3VFGH 5EIIA 32C2B 3MO1A 5EPMA 4BQ9A 3GMRB 1DBML 4OM1H 3G6JB 3Q1SH 3OKNB 4G9FE 3HFMH 2J6EA 1WFOA 3HI5H 4M6AA 5JDSA 3GJFB 1FNSL 2PF6A 2CDEA 3K81A 3E6HA 2ITCA 5E7BA 1MCKA 2JB6A 4JHWL 4ZFFB 4H26A 4OZGA 3ULVH 3MV7E 5T3XD 1XIWC 1ED3A 2XPGA 2XTJB 5JMRA 1UB5B 1T89A 3B6SA 1G1CA 1CVSC 3G6AB 4JRWA 3WD5H 4Y4HD 1NCWH 3JUYA 3LIZL 5T1MB 5E6IC 5IMLA 3RY6C 1NEZB 1IILE 2EEDA 4NUGH 1JZ8A 5JIIA 1A4KB 2HKHL 2XKNB 1UA6L 1SYVB 4OQTL 4JB9H 2ZJSH 3BHBB 3F65A 2AXHA 4TUJA 4ESKA 2IAMC 4GQPH 3NBNA 3PE9A 2EH7H 4M1CC 2XA8H 3O41A 1W0WA 4M6MH 1NQBA 2FYYB 3BKCL 2WIIA 3PDOA 4L8SC 3NACL 5FKPB 5CGMA 4R7DB 4KJQC 5F9OL 3ULSB 2R1YA 4TVPL 5D96C 1FFQA 5BZWB 4IHOB 2F19L 2APVA 4FS0A 4XBGB 2D9CA 3W2DL 1I85C 3QR2A 4ZFGL 3FB6A 2OQJA 2OTPA 2V5SA 4PJBF 5D7LB 4M48H 1I3UA 2R1WB 4NP4H 5FHAL 5EZJA 1MUJA 4KGLA 3X12A 4YHYC 5IBTL 4OKVA 3ZKSD 1S9YB 4PY8J 5FYJU 3IKCB 3KPOB 3HS0A 4NQSA 3MJ9H 3HZVA 4YXHH 2VXVL 5C3LD 4N0FA 5A2JH 3UCRA 3GO1L 3OAYK 3U48A 3GSNA 3HZMA 5BVJB 1OGAB 2VR5A 3QUXA 3SDYH 1NCTA 5ALCH 3NAAL 4ZQKA 1JPFA 4IS6B 2JIXA 1G7LA 1A1MA 2PYEB 1B4JL 1ZK9A 3PGDA 1JHTB 1PEWA 5GSVA 3S96A 4PRNB 4KU1A 1YUHA 1QLFA 1I1AB 4KV5F 1MCFA 1FVDB 3FQXB 3RA7L 4HUUB 3HPLB 3QFJD 1F90L 4R0LA 1HHGB 3SKMB 2X6MA 5JOPD 4X5WB 3RWDB 1G6RL 4HKJB 4WW1B 4Z95L 4JZJC 2YD5A 2KQMA 3P4OB 2WBWB 5IOPA 2WUBL 4QY8A 4Y4HC 1ZEAL 2IQ9L 1XGYH 1CDBA 3OGCA 5ESQB 3CDFA 2A77L 3MV8A 5DGRA 5LGJA 1F3JA 1KN2H 3G9VA 4PYHA 2V5YA 1JNHB 5A2FA 4I3SH 1CFNA 1K2DA 5HYSB 3PV6B 3QXAA 1HHJA 5IVZB 5FO8B 3V79C 2J2ZA 4BK4A 2G5BA 2LE9A 4HK0A 4MNQE 4ISVA 1ADQH 1EERB 4G43B 2D7MA 3UJTL 1X3DA 4U3XA 4Y16B 4H0GA 5ICZA 1MF2H 3ILPB 2Y7QA 1FN4B 5KN5A 3UBXG 5KG9A 5J1TC 2CQVA 3MRPB 2Z91B 2YR3A 3DOSA 4ZD3L 5IESH 2X4TA 1Q8MA 4DGIL 3THML 2DTMH 4NRYA 1JRHH 4KK8C 2BVEA 4NCDA 3BQUD 2JJTA 1GZPB 3BKMH 1EK3A 1YEJH 4WTXA 1DEEA 1A1NB 2N56A 3BPOC 3CFJB 4UU9A 4PJGF 4FZ8H 5GRUH 4KVNH 5C7XH 2IWGA 4XH2A 4UTAH 2ZSVB 3F7YB 1AQDB 1X5GA 1WBXA 2AV7A 4OZIA 4RMRA 4W4OC 5LGKA 1MHPL 3JV6A 4XVSL 1FFNA 3QXDB 3HCVB 4FHBD 4ZS6C 3SPVB 5IIEB 3O4OC 4M4PA 3UPRA 5B3JE 1CFSB 1T2QL 1T7VA 1F4YH 3CXHJ 4K7PX 4XPHL 4ZUVA 1HNFA 5ERWA 2BNQD 5JUEH 1CQYA 3IXAB 1KPUA 4LCYB 4ONOA 2OTWB 5I18L 5DHYA 3UTSD 1P4IL 1QFUH 5E1HB 5EUKB 4MB4A 2DI7A 4V2CB 4XRCA 1NGWA 4YJZL 5BS0D 4HMEA 1PSKL 4MD4A 1NCBH 3SDXF 2CDFB 5K93A 4TNWF 5BQ7B 1UWEL 4FZEH 2VDOL 2A6DB 2IG2H 1GC1C 2QSCL 3GSRA 4JVUA 3AM8C 3GBNH 5IB5A 1PZ5A 4YUEH 4DUVA 3QH3A 2P5EA 1B0GB 1LO5A 4RNRA 3FCTA 3MCLH 4HIIB 1KNOB 3O2WH 1DANT 5F3HA 4FTVE 5T3ZL 4I5BA 1MRDL 4OD1H 4JZOB 4JN2B 1NAML 2YEZA 5AAMA 5CEXB 4XP9L 1OP9A 2GITB 1NDMA 4R96B 3EYFB 2F54A 1FO0A 3RUGF 3CMGA 4HS6A 5CZXC 3EOTH 2XYCA 4WI5A 3BFOA 3JTSA 2BVYA 1I8KA 1FYTB 2AJVH 3LKNA 4CKVX 3U7YL 3GSVB 4Y2OA 1FG2B 3BQUC 4PJXB 3QA3A 1KEMH 1YYLL 4NM8L 2H32A 4QHNA 1WWAX 5DZLA 3QDAA 5TFSH 2VUYA 3X11A 1FNGB 1S7VA 5F1IB 1XIWB 3SQBA 5FYLH 3AGVA 2V5RA 5EO1A 3UYOD 1I7TB 3SOBH 5JPMB 4NT6B 4XTRD 4JFEA 3FL7A 1GH7A 1AGCA 1TFHA 5FYJD 4KY1H 1T1ZA 3SQOH 4NQED 3H3PL 4PREB 15C8L 4TSAL 1YC7A 4CGTA 5B39B 1CGSH 4XP1H 5DJDA 2IAMB 3BESR 4ODWA 4HPOL 1UVQA 1VGKB 2HYMA 5E2VH 2BSTB 4L4VE 5D71H 3UYPA 4DN3H 4GQ9L 3BP4B 5F89B 4MA1C 3BDYL 2FJGB 2BY0A 4OQ1A 3JWDC 2Q6WB 3U79A 4X99A 5A2KH 3MRQB 3P30L 2GY7B 3DVGB 2PCPA 1BBJB 2JB5L 5D96B 3S37L 4TNVK 2GTWB 4FFVD 4PTUB 3BD5A 5DD5L 1CE6A 3MQIA 4OIAA 3V6BR 3WE6A 3KAAA 2LAAA 4K7FA 3WNOA 2AEPL 2F54E 4I8DA 3L7FA 3HMXH 4OGYL 3NVQA 4YHYB 4P57B 2DDQL 3QWOB 1NGXA 4KKBD 1V7ML 4R97C 1DQTA 4G6MH 1P7KA 5AYUH 3ZYOA 3BE1H 3ZE2F 3KYOA 2X4QB 4EI6B 3SEPA 1IC7L 1NFIB 4OBRA 3KPLA 1S7UB 1XZ0B 3N50A 2FJHB 2IGFL 4XNMA 1MNUH 4EQ3A 4I13B 1J0KA 4ZYKB 1FAIL 3BZFA 2VWEC 3VI3E 2X4PA 1CXKA 4U6XA 1A7OL 1PDKA 4NO0A 4JKWA 1PX4A 5ITFB 3AAZA 1V3MA 3MJ9A 5D93C 1T89C 5HHVL 1A6WH 4NJ9L 4Z18A 3PQYA 2OL3L 3T3MF 3T0AA 3ZT7A 5IW6B 1YNTA 3QQNA 3LKOA 3SDAB 1I7UA 2RQ8A 4QOKE 1E4WL 4M7LT 4PRIE 4YGVA 1IGFL 4JZJB 4M61A 3ESUF 2WBKA 2X4NB 3QWRA 1BFOB 4O2FB 4U6HB 4XTRC 3QQ4B 4PBWD 1CICA 1SEBA 5DS8A 2EDXA 3A6CL 4L8BA 4LNRB 4U31A 3IGAB 1MFAL 3VCLB 5ABDE 4HIXH 5MENB 1AGBB 1N0LA 4FABL 3A67H 1B4RA 4N0RA 1DVFD 2FLBT 1MHCA 3MRRA 4Z76A 1QHPA 4HIJA 5I1IH 3G6JF 3OV6A 4JFZH 3MTRA 2X89A 1T0NA 3TBYB 1MPAL 3SKOA 2YPVH 2P47B 4ENED 4ZDHA 5HBBA 2G2RA 1C08B 1I7ZB 1N4XH 4HQQL 4Z7NF 4Q2ZA 5IMKB 3EFFA 1KCRH 1U8LA 1W8NA 2C3VA 3HC0B 3WFEH 3ESVF 4PRHD 1OGTA 4RMUA 1N5YL 4JQVC 5L7XH 5CMAA 4N0YL 4M7KH 4QHLA 5ECJE 3MRGB 1T03L 1ADQA 5HDLA 3LZFL 2NW3A 4JFFA 3BPOB 4QRPA 5JXAL 1XF2A 1X6NA 1IAKB 4KKBC 4V2BA 4MCZA 4YWGL 3VD7A 3MR9B 3WSQH 5C0RL 1JN6A 5SWSA 4GMTL 3RP1A 3LEVL 1R5VA 1DSFL 4LRIA 1S7SB 3NIFE 3OXRB 3O3DA 2EDFA 3GMQB 3WO4C 2DQTL 4YHNA 3O4OB 2C1PB 4JRXD 1FV1A 5DHVH 4CW1B 4MAUL 1TNNA 5F6IC 1Z9MA 1GIGL 3BIKA 4APQD 4G80B 2NW2A 4NZTL 4H0IA 5D1QA 5I8CA 3RWEA 3JVGA 3LV3A 5HGHB 1G7JA 5FA3B 1IZJA 3QFJB 5I75B 2VR4A 3A0OA 5H94A 5I1JH 4NKDA 4JY5H 4NRXB 3FFDA 2MOVA 3QHZL 3V0WL 5LBSL 3FQNA 3HI1B 4NO3B 2HLAA 5I1LA 3DARA 5HPMA 3G5ZB 4KRMB 2XFXA 4PRDB 1FIEA 4MNHA 1HZHH 1P5UA 2ZNXA 1OT2A 4H5SA 3V7AE 4ONGL 4WIQA 3KLAA 1Q1JH 1R3HB 1VADA 3V9FA 5TQ0L 3FMGL 3FQUA 1G9EA 1DVFC 3UZQA 3QEHA 4XCYA 5EZLA 4J2XA 4DZBA 4OLYH 3B2VL 2VXTL 3HG1D 1U95B 4JM2A 4L4TA 2VDKL 3VXRA 4J3VA 5E8OB 4ENEC 5SWSE 3ZL4L 4PB0H 3GMOA 3MLSL 1WV7T 4QTIL 3T3PF 2HLFD 2W38A 2OK0H 1U8NA 3BQUB 5D7JA 5HHNA 3TCLA 1RJCA 5LKNA 3QHFL 1YQVL 1XR8B 2FH6A 3QHTC 1TTUA 2ZPKH 4H88L 4RAHA 4C56E 2MHAA 4FG6D 5SWQA 5IB3B 3DGCR 4MJ6A 4KHXL 2WK2A 4I3GA 4KI1A 1ES0A 4X6CB 5FAAA 4EUPG 3L6FB 2VZ3A 2KZ1B 5JORA 2YUZA 4WWKA 5HHQB 4WFFE 2BOBA 1GGBH 4HKBA 5D6CB 1CIDA 4O2CA 4QF1A 3KNBA 1JRHI 4OD3H 2NYYD 4LFHD 3K3QA 4CU6A 2AXGB 4RDQF 2BNQB 4MA1B 4APQC 1BJ1J 4MD5A 4X9IA 1NFDA 2CK0L 2A9NL 5DQDH 3I75A 3UTSB 1Q9OB 2DIAA 3VFTB 2A73A 5TPWH 3IKKA 4RA0C 1S7XA 4P2QA 1R3JB 4XNXL 1RVFH 2JLLA 3BVNA 2ADIB 2AJSL 1A6UL 1RUAH 2EIDA 5BS0B 5FGCE 3SHSA 2YBRA 4YBHA 2IANA 4NBZB 5CINL 2OSLB 2KUTA 2ILLA 3WUWB 1FBIL 4NOFA 4P2CG 3VXRE 5CEZH 2EC9U 1ZGLA 4OKDA 4YHOL 3LY6A 1EGJH 3P9WB 2XNAA 4HGMA 1GC1L 4QHKJ 2QJDA 2Y9RT 2YMXL 4R97B 4DAGH 1AQKL 1I9JH 2NY1D 1AJ7L 2ARJB 1MFEH 3ZDZF 3UJJL 3GB7A 5H35B 4YHML 4E5XB 3C8KB 4NO5A 4PJIB 5DMGD 3MO1B 1D5ZA 3V6OA 5HI5D 4PB9H 3GHEH 4JPVH 2JK5B 1MJUL 3GGWB 3C5ZA 3HMXA 5DURD 2G9HB 1DLHA 4QRTA 4FNLL 1QSEA 2D4DA 3QI9D 2ZG1A 1UJ3A 3DLQR 4QNPE 2DM2A 4OZHA 5IHUH 1KB5L 1ED3B 5D93B 1XCQA 2HLFC 1K5NA 2FJFB 2HTKC 5IMLB 3V7MA 5E94B 1G9NC 2R4SH 4HKXA 5L2KE 3NH7H 3R8BB 4EI5A 1KLGB 4NQCA 4QHMB 3DMMA 4X5XA 1J87A 3WJLA 4YPGA 5DD0L 4HWZB 1D6EB 4G8GE 1J8HA 3DNKA 5DJ2A 5JO5A 2DL9A 1H3UA 2J3SA 1AY1H 1A0QH 3K2MC 5JW4Q 4NHUA 4M93B 4P2QE 5I74C 3QUKB 5IMMA 1RHHA 4NQEB 3ZE0E 4RIRB 3E1F1 3ME0A 2XWTA 1A6AB 1RFDL 1OSPH 2P8PB 3KPSD 4FXGA 5DRNA 4XC1L 3GIZL 2NYYC 2P24A 3QPXL 2VXUL 5AG9A 4G8EA 2GAZA 4OFDA 2NLJB 3DX8A 4IOFD 4PJXF 1BBDL 2BZDA 3T77B 1BQUA 2EXWD 1J0JA 4BKLB 4F33A 2I26N 4OFYA 4UV7H 3SBWC 3CU7A 1L9MA 3SKJH 5C1MB 4JFFD 3X13A 1BZ9A 3KWWB 1TPXB 1WICA 3KPMA 4BUGA 2ICWA 1XCTA 1CXHA 1DEDA 2OR8A 1QSEE 5J6GB 3UTQA 1K6QL 1TNMA 4U1SB 2VISA 3HZMB 4AIXA 1A3QA 4Q9QH 2ARJQ 1VKXA 3CC5A 1DZBA 3EOAB 3H7BB 4WV1B 5FUOL 2NY1C 4NCC1 4Q6YA 4OI8A 1T80A 1CBVH 4IRJA 1HNGA 3T1WA 5I9QC 4PLNC 3CJJA 3UBXA 5DMGC 4WHDA 2VLME 4TSCH 3ARVA 3GSOA 4GW1B 2J6EL 1Q0YH 1MCBA 2VXQH 3TIEA 5I1EH 4YDKH 4FQXA 4JEGB 4UDUA 4PLOB 1LDPL 5C9JB 2WIMA 1LP9E 2EDBA 1EVUA 4P0DA 1SBBA 3UTTA 3FB5A 4HK3N 1F3JB 4EIZC 4X4ME 3LN5B 1IM3B 3VGHA 3SDCD 1MY5A 5DHVA 3SKUD 1G1YA 4OCLC 3IFOB 3R0NA 5JIKA 3FO2B 4H1LB 5I1AB 4BK5A 3PG2A 3NABL 4OSUL 1SJHA 3NOIA 1Q72L 1GL4B 3FRUB 5KAQG 3VW3H 4XVJL 4WI3A 3E2HC 1R3IH 2YA0A 3PWNA 3RZCA 1DVFB 3QCTL 3B5HA 4P2OD 1BVKB 4LBEA 1CK0L 2YN3A 4LSTH 4UQ3B 2OTUA 3QDGD 4KUCD 1MCOL 4IOFC 4P2RE 4PY7A 1V7NH 3S34L 4XP6L 3OWEA 2UUDH 1N2RB 5JHLH 1T7WA 1OARH 1YEEL 1ZSDB 1IQWH 2XKSA 4YE4H 3LEYL 4PRHB 1SM3L 2UWEB 5T1LA 1M71A 3ARWA 3P11H 1NKOA 3DX6A 5DMJB 3P9MB 2DQJL 5J9PB 3DO3A 4A6YH 2QLVB 5TH2A 5DR5H 4U1IA 4DOHE 5CEYB 1WBXB 5IBUB 1T0MA 3DROA 3P0GB 1JWMB 4LAQL 3LDBC 3ECBA 3DYMA 3GMLA 4LRIC 5EZOL 2ICWI 3VXOB 3GSNL 1T66D 3ZTNH 2NX5A 3MLUH 2YK1L 5MEQA 3VRLF 1V5JA 4DUXA 4EDWL 1KFAH 4TTGA 3Q6GH 1XF5A 4ZO6A 3NPSB 5FYLD 1CG9A 3LH2L 1AIFA 4MJ4A 4D0DA 4Z78A 5DHYB 2W0FB 3RBGA 4OUOA 3QEUA 4OIBA 3EO1A 1IEAA 4EUPH 4JRXB 3UBXI 1JZ4A 5E7FA 5DJYB 3X17A 1CD9B 1UKSA 1V3LA 3H3BC 4JFPB 4MHHG 3BW9A 4APQB 3QDJD 5D2NC 3EYVA 3RJQB 1KEGL 2F5BH 2NQCA 2W65A 1U93A 1B6DA 2BCKB 1SJVA 3A6BL 5IFHL 5BV7H 1NGYB 4Z8FH 3O6FD 1W72B 4NJAH 1JWUB 1R5IB 3OPZL 4LLVB 3L5XH 3SDCC 1U8OA 4I77H 4TUKH 1KN4H 2HVJA 4PJDA 2MCPL 3RNKB 3GEWB 4XCNB 4WEUD 3LVEA 1AXTH 1ZMYA 3BAEH 1RZIA 3C5ZD 3GMNA 3BWUC 4IIQB 3X14A 3RJDA 5DI8A 1O7VA 2C7UA 5E1AA 4FP8H 2Z8SA 4P2OC 5IB4A 1VACA 3AY4C 5B8CB 4WJ5B 2ARWA 1DBJH 4PLKD 3HG1B 5I71C 4NKIL 1U8HA 2NX5E 5D7JC 2YOCA 3F58L 1EGJA 1LHZA 1S7QA 3TBVA 3MRBA 4UIKH 5AAWA 3CFEA 2E7CA 3IVKB 5KJRL 1QO3B 4AEHL 3AS3A 2V2TA 5DUBA 1LEGA 1J8HD 2D0FA 1XH3A 3TBTA 3GJEB 3VGBA 4LLQA 3SE9H 1AD9A 5EOCL 5FM8A 3GKWH 1KIUA 4HPYL 3ARFD 5A16B 5C71A 1T66C 2CJUH 4HZLB 4WWKC 5C07A 2Q76A 2CMRL 4ODWB 4R6UA 4WI2A 3BKYH 3OGOE 4IDJL 1A02N 3WDHA 3W11D 5I74B 3TWCL 1HSBB 4QYOB 2Z4QB 2R29L 1WGOA 2O26U 5EOQL 1JK8B 1VEOA 4KK6D 5F7EL 4FQIL 4Y89A 4FN0A 4HHAA 2H2SD 2HFTA 4P4KD 4DCQA 2ESVD 1HN1A 3SN6N 1TJHL 3VXQB 1QP1A 1SEQH 4TN9A 1IGCH 5FKAA 2EKJA 3LHPH 3S37X 4JQXA 3NFPB 1UXSA 5AWNH 4G6JL 1EFQA 5JW4R 3IXTA 4PJFB 2FEEI 5HHME 1X7QA 5BW7C 3O6FC 4NNYA 4RGMC 3O11A 4DKEL 4LCCC 4X6CF 5JXEA 4I9WD 3WUZA 2B5IC 4IRJD 4H20H 2WMPA 4Y4FD 4Z7WA 2MSPA 3TA3D 3CVIL 4GRWF 1ZWIB 4OGZA 2BVQA 2NY1B 3C5ZC 1FNFA 1MHHB 4ODUA 3CSYA 4XPFH 5KVFL 3N1FC 1FO0L 5I9QB 1OAYH 1UJ3C 2ZUQC 3DXAE 5C0ND 2DD8L 4N68A 4OJFL 4L3AA 4LSSH 5EBLA 4PLKC 4WHCA 1BQHG 5DURB 2LVEA 3LRSB 2W1NA 1YMME 3QI9B 4S10A 4EI5C 3UTTD 1Q9LB 1RZ7L 4ZO9A 3WL9A 3DMMC 3HLAA 1NGQL 1BQLL 4G8FA 3H3KA 3FHQA 3U2SB 4HV8A 4FQPA 1LNUB 3L3HA 5GXBB 5EU5A 3VFGL 1S3KH 4YHLH 3O3BB 3SO5A 1G9NL 3NCYP 5DS8B 4XBPB 1ZT4A 1G7QA 4OM1L 3Q1SL 3T2PA 5M95B 1DQQB 3HFML 4F15C 4FMKA 3HI5L 3RDTA 3PGCB 3EIFA 3V6ZA 1FHGA 1DE4B 5JIPA 3VXMD 4Y7MA 4PJIF 3ULVL 3W11C 2ZOLB 4TOYL 2AQ2A 3QDMA 1PKQA 3WD5L 1NCWL 5IUSA 1NANH 2FLRT 4G6FD 3IDXL 4KK6C 3E2HB 2VIRB 4NUGL 3KPSB 4D2NA 3KPPB 4P4KC 4XXDA 3EFFB 4JB9L 3R0MA 3DV6A 4LCUB 5HHOA 5IR1A 1A6VH 2ZWLT 3O0RH 5FM4A 5BMFH 2EH7L 3W9DA 1EIBA 4X9GA 2ICCA 5F9AC 2XA8L 1QFWI 5D1XD 4M6ML 3TPUA 1LEIA 3DBXA 4JFFB 1CL7H 1YMHB 4ONHB 4BFEA 3BH8B 2JJSC 3FT4A 4F7CB 3VXPA 3NPZB 4JJ5B 4IRJC 4MAYB 5DC4B 3LDBB 4X7CC 2BJMH 3STZA 4Y4FC 1QRND 5EU4A 5AD0B 5ENWA 4M48L 1PW3A 5DK0B 4NP4L 1CLOH 2PTVA 2VLKA 4KROD 4HWBH 5KSVB 5DEGA 5H37G 3SO3B 5C0NC 1QA9B 3SE4A 4A6YA 5CZKA 4U3HA 3MJ9L 2Q7YB 4P9HH 1G7JB 3MRNA 2WUCH 4L29B 3FT3B 4ODVH 4YXHL 3V2AR 1U91A 4UBDD 1JYXA 2FX9H 4ZFZA 3R1GH 3WNLA 1LE9B 1U8QB 2H2PD 5D2NB 3SDYL 1BGXH 3QDME 1T21A 1D5XB 4WU7A 5ALCL 3S7GA 3BT2H 1I4FA 3WXVL 5L6YH 3DUSB 1MSPA 5DVNA 3QIUD 3ZYJA 1HSAB 3IETB 1XF4B 2CGRH 3TYGH 1QOKA 3SDCB 4EUPA 3LD8C 3K1KC 3DRTB 4KKCD 1OD9A 5F7DB 1QG3A 4I48B 3GSXB 3ES6B 3PDGA 3D0LB 3L5WA 3VXUA 2J8UB 3H42H 5ICXB 1XGYL 3UROR 3UTZA 1YDPA 1ND0A 3D9AH 3T04D 1IAOA 4P2OB 1OAUH 4HEPG 4KDTC 5HD8D 2Z93B 4DUWA 5KS9A 3QDGB 1BD2A 5I71B 3IJSA 3C87A 1A6PA 3DI2B 2P44B 1BQSA 4Q9BA 3SCMA 1ADQL 5HTSA 3MA7A 2WINB 1MF2L 5AZ2H 5CP7B 4UOW0 1X6LA 1UKTA 1E4KA 5IESL 3C6LA 1Q9WA 4M7ZC 1HEZA 2D0GA 2DTML 4N5ED 1RJYB 1XGUB 1CFBA 2FCBA 4Q9RH 4OAWB 1VEPA 2UVEA 3BKML 2PN5A 1YEJL 3KS0H 3OKEA 3C6SA 3BRFA 1IAMA 1GSMA 5FOJA 3UPCA 4FZ8L 4JE4B 5GRUL 4KROC 4KKAC 4MD5B 4KVNL 1U42A 3V52H 4HS3B 1KCUH 3I75B 2LABA 4MA3B 3H9HB 4UTAL 5CBAB 3PWUB 2PTTB 4UBDC 5IQ9A 4NOBA 2BY2A 3QIBB 4NNXB 4LMQE 3QDJB 2AK4D 2H2PC 4OV6F 4OF5A 3S4SB 4PJAB 2BHYA 4RQQA 3U7WL 4XX1E 5JXED 4Q74A 1F4YL 5DEFA 3QIUC 5C0JA 1ZGLB 5JUEL 4LARH 3D6GA 2ZUVA 3O6FB 3I9GH 4BSJA 2Z31D 2VDMH 3HPJA 1IVLA 1WC7A 1BD2E 4LCCB 1QFUL 4BZ2H 3L3GB 2HKFH 3Q6FA 2CKBH 3LN9A 4JO2H 4KUZH 5CJ8A 3HUJE 2DBLH 1NCBL 4PJCE 5EZIH 1H5BC 1X5FA 4NKMB 1U58B 2FX8H 2V2WA 1KPVA 4FZEL 1HIMH 3C5ZB 2IG2L 5B38B 2O5ZH 3WIFB 4GW5B 1G0DA 2O5YH 4LMQI 2NY7H 2XA3A 1UJ3B 2ZUQB 2FBOJ 2YD3A 3O6KH 3GDBA 3GBNL 4NDMB 2XQYK 4YUEL 2VE6B 5HD8C 4U6VH 4AT6A 5I19L 3P73B 3MCLL 4AM0A 2A6JA 5IM7A 4KPHH 4GBXA 4OD1L 3AB0C 1TMCB 4KDVA 2E8YA 3I3EA 1UM4H 4ZXBD 3D18B 3QEQA 4F8QA 3EOTL 1NDGA 4WI9A 3VH8B 4U3CA 4F15B 3HKFA 3ARFB 4MDIB 3W82A 1T1YA 1YZZA 4WW2C 2FWOA 4J4PD 3MLVH 4QHUB 5TFSL 4M3JA 5DQ9A 5ESVB 5ADOH 5FYLL 4OF8A 1MCIA 3OJDB 2I60H 3SOBL 1C7SA 3ZDXE 3SGJA 2H26B 1MELA 4GXUM 4XNZC 5IT2H 3E6FA 4E42A 2V2XB 2YHGA 4KY1L 3DX7A 4P4KB 1EO8H 3GBLA 1PQZA 2ESVB 3SQOL 1YA5A 2FR4B 4P49A 1MQKH 3C5JA 1KG0B 1CGSL 4TSBH 4XP1L 4P23A 3U4AA 2VAJA 3DUUA 3JSSA 1LK3H 1MFNA 5JXEC 5CSGA 3OKKA 4X4YB 5D71L 4DN3L 2Y23A 5ELIA 4KMTH 3TZVA 1ONQA 3VD9A 1A9BA 2Z31C 3MA9H 1O0VA 1UGNA 3B3IA 4HH9B 3CC5B 1JGLL 1II4E 2D4FA 3ARGA 3OF6D 2FBJH 3O6MH 3AS2A 3MGOB 4Y4FB 5CFHA 3RVXD 2HVKA 3TA3B 1P4LA 4HIHB 4BH8A 3SJVE 1NCAH 5C0AE 3NCBB 5FUCC 5J57B 4IMLB 3HMXL 3RHWF 2YA2A 2X9XA 3RIAF 2ICEB 1FQ9C 2OCFD 5GGSB 4G6ML 5DJ6A 3EDJA 5AYUL 3BE1L 5ILTH 2BVPA 4D0CB 3TN0A 1EEQA 4HD9A 4XP5H 1ZGLP 2EDHA 5HGAB 1AXSA 2HAZA 3LN4A 5D5ME 5ITBH 2CDGA 2EDRA 3QFDA 4LF3A 5H37H 4I4WA 4FXKA 3UTTB 1HINH 3I85A 3QG6B 1JNNH 4TPRH 4DGYH 1CIUA 1MNUL 1DUZA 4ELMA 4MNQD 2YKLH 4ZXBC 5C0DB 4HWBA 4UUJB 4X0KA 2PXYA 4LKCB 1OCWH 2F53A 3T0BA 1A14H 5ICYA 1A6WL 1B6UA 4JPKH 3DI3B 4KTDH 4NSKB 1TZHB 3LD8B 3VXUD 4F7PA 2N1KA 5CWSB 4MNGB 2JF1A 4J4PC 3VXMB 1E6JH 1HE7A 2H9GA 4MGXA 4MYWB 4KZDH 4E9LA 3RI5K 3MRMB 4XWGH 5E2UH 3C09C 2PNDA 1CD0A 1F2QA 5KVDH 1OLLA 4XVUD 2P5WD 4G6FB 3ROOB 4Y5VB 1EV2E 1I8MA 4OV5A 3RVVC 5GS1A 4X7TA 4I2XB 4HIXL 3IAPA 4MA7H 5JPNA 2D7NA 2X10A 3NFNB 4M8VA 4P9MH 3A67L 4XAWH 1KJVA 4MCYB 3ZKMD 2UV3A 1REIA 4DQOL 4PD4K 4ELKA 2HT3D 5CJQH 5D1XB 5I1IL 4JFZL 4LNVA 4YZFE 5I0DA 4MVBD 3D5OF 3L3KA 2YPVL 2J4WH 4PJ5D 1OTTD 1MJJA 4EXKA 4B5EA 3HR5B 1NUGA 3BEWA 4M7ZB 1N4XL 3WFEL 1KCRL 2JCCB 3AMLA 2GUOA 1NANI 4R8WH 1P69B 4N1EA 1QRNB 4D0DB 2HT4D 1FGNH 1UJTA 5L7XL 5KSBA 1QLEH 4M7KL 3SE4C 4HJJL 5HY9B 2Z9TA 2X70A 4JJHA 2VC2H 4PJHB 3IAGC 4RFNC 5DRWA 3BXNB 1FGVH 4KROB 1JHKH 4D94A 4UT9H 5LAXB 5I1KH 4S0TD 1CL7I 2ATPA 1H0DA 3P77A 1M05B 4X6DB 4LVEA 3DRQB 1TETH 3C5SA 3VFPA 4HCRH 5GJSH 1HHKA 3I02A 4NRZB 4D9QD 1I1YB 1NMCB 1EZVX 2HVJB 5I66A 4FTVD 3QIUB 4X8JA 5D72H 1MCPH 4LLAA 2HFFA 3D85A 5D2LB 2DQHL 3X14B 3OHXB 3HHRB 5BV7C 5I1JL 2N7BA 2BNRA 4JY5L 5CD5D 1GAFH 5ANME 1H5BB 4R4BB 3VRIA 3STBA 4ORGA 1HOCB 3QNYA 4Z7VA 2XN9E 4ETYA 4YFLI 1WZMA 4XVUC 3GMPA 3PHOA 1FFPB 2A6IA 4N0UA 3VG9C 5IFAH 1HZHL 2YWYA 4QRSB 4YFEA 1Q1JL 5EC1B 4JZNA 1LEGB 4W4NA 3ZKMC 1E4KC 3MLTA 3QUMB 4DN4H 2HT3C 3PL6D 5J89A 4OLYL 4QRRE 1QPXA 2KDGA 1H3VA 3REVB 5EU6A 3HR6A 1JF6A 1HQRB 4KKNA 1OTTC 4OCRH 1WIOA 4L4VD 4LVHC 4KMQA 4PB0L 5DD6A 2SEBB 5FM5M 1FFOA 3EDFA 2J8UF 1VPOH 2AI0H 5E00A 1OSZB 4WW2B 4XC3H 1P7QD 4ZUSA 5FCUH 1A7NH 4G3YH 3D39E 4HHAB 5L2JB 1BQHA 1T4KB 4UZGA 4KUCF 3OKMB 1A9EB 2ZPKL 3MLPA 5D7IB 2FEEL 3IF1A 5FKAB 4XNZB 4Q97A 1SVZA 1DP0A 3KHQA 3QQ3A 5KTEH 1RPQA 4CVZB 1T22A 4D0BA 2UY6A 5BVPH 2AK4B 3MLXH 2DF3A 4NNPH 2D2OA 4YDVB 4YEEA 3WHE0 4JFYA 2C1OA 3BZDA 4OD3L 4NQXA 3VD3A 1VFMA 1A1OA 1UM5H 5F9JA 1JNLL 4X7EC 1G7PB 3FQWB 4IOSD 5DQDL 5FB8B 4OF6A 2F58H 1KT2B 4FQQA 2Z31B 1QNZH 3OX8A 4RWHA 4HFUH 2A38A 4M03A 5TPWL 3WHXA 3D0VA 3FOMB 5DJCA 5IMOB 1RVFL 1QSFE 2H41A 4LLUA 5CD5C 5J6HB 1DBAH 3O3EA 1WK0A 1AE6H 1FC2D 4G9FB 1H3PH 3RY5A 5C0IB 4IRSA 2EDJA 2B39A 3MRIA 5CEZL 4GKNB 4QOKD 2GJ6E 1EPFA 1URLA 4PRID 3MGAA 1J0YA 1EGJL 4R90H 4JY6B 1FJ1B 2EKSA 3EJZD 3IU4H 4PJAF 3HLAB 4DAGL 5IEKB 4PGDB 3EOBB 1I9JL 3EYUH 3X3GH 3MRFB 1FL3A 1MFEL 4ZFOB 1ZLWK 5FOBA 1MAJA 1QQDA 2ZUWA 5CBEA 2PXYD 1ORSB 3PL6C 3MLZH 2HMID 4PB9L 3GHEL 4PR5B 4JPVL 4RWYH 1WCBA 1KXVC 5GSRA 4KJWD 4ZXBB 3U82B 3NZ8A 5HYSG 1JI1A 1JWSA 3CPLA 3HRZB 1TCRB 5IHUL 3PWPA 1CDGA 4JPIA 2YD1A 5FYKH 1IQDB 1HCFX 1FIGH 2R4SL 2R56H 3DURA 1P4BH 1GOGA 4WU5B 5C08E 1PLGH 1BLNA 3LPFA 1IGYB 5IK3A 3C09B 5JTWA 1KTDA 1RJZA 3GUTA 5EO0B 1AY1L 4OGAD 1A0QL 1FZMB 3S97C 1LEIB 2YPLA 1U3HD 3CX2A 4LHQB 3L3JB 2X4SA 1D5MB 4X6FA 4JGJA 1QR1B 1OSPL 2J5LC 5IF0B 1W2KT 5EBMA 3IFNH 4G6AD 3OSKA 4WO4D 1F6FB 4Z5RA 2YUXA 3IT8D 2BVOB 3B9VA 3BEVB 1OF2A 1A5FH 4UV7L 1CTOA 3SKJL 4Z77A 1J0ZA 2HKHH 4H8WH 1OB1B 1UA6H 1CDCA 4Z7QF 1N6UA 4ETQA 4YIQB 3GZKA 4A6YB 3WS3B 4U33A 5F70A 1EEUA 4PV9B 5JQ6H 2E7LC 5F1NB 1YEHH 2VABA 5AUMB 4BM7A 4E41E 1WZKA 3IFPA 3RL2A 3EYOA 5IB2A 1A6ZA 2BK8A 3D69A 3BP6A 2X1PA 2DQFA 3EJZC 1JPTH 1RIUH 4Q9QL 4O58H 2NZ9D 4KMLB 1QVOA 1JTTA 4CVWA 1CBVL 4PJBA 1K8DB 1AKJA 3MLWH 1G84A 2PXYC 1GOFA 3IJYB 4XMLH 2R0KL 4P9HC 3W2DH 4L3EA 1ZA3B 4MLIA 2D31B 4GKZB 3WBDA 5KANI 4PJ9D 1S5IH 4NQDD 5BCAA 3MCKA 1HHIA 1Q0YL 1MLCA 4KJWC 4MNQB 2VXQL 5I1EL 1VENA 2FSEB 4POUB 3IDYC 4YDKL 5IBTH 2YPLE 3FOLB 3I3BA 1H3TA 1AC6A 1XMWA 3GIVB 2FL5A 1MOEA 3VXUB 2QQNH 2R2HB 4XGZA 1GCFA 2VXVH 4PTTA 1U92B 5INCB 2Y06H 4HCRA 1FPTH 4K2UH 2I27N 4F2MB 3OR6A 4JFOB 5KS9B 5GRYA 1UCBH 4NFDA 3WS6C 1A6TB 1GGTA 2W9EH 2P5WB 1LMKA 3VG9B 4OGAC 1KPRB 1Y18A 3EW3B 5DFVD 3F7VB 1EXUA 4C56D 1B0RB 3OAZK 3VW3L 4Y1AE 1ZT7A 1AO7E 5EN2B 1R3IL 2BVTA 4DKFH 3GJFH 3FB7A 3DGGA 2FZ3A 3G5XB 1HEZB 4LSTL 3K4ZA 4WO4C 3MRCA 4XI5D 4WFFD 4GG6B 1V7NL 4PRAB 5JHLL 1Y0LB 2IQ9H 5EOTA 4PJ5B 1UWXH 1OARL 5B39G 1D9KA 1IQWL 4YE4L 4LVHB 5GS3A 1JPGA 4HAFA 3P11L 1C5BH 4MDJA 3FB8A 2Y5EA 1UQSA 3VXNA 4A6YL 5F72S 2VLLA 5DR5L 3M17B 2CRMA 1QEWA 5BRZE 1T5XA 3O3UN 1N5AA 4KHTH 2EIEA 3B9KB 3ZTNL 5TDOA 4K7PY 3MLUL 3U46B 2B1HH 1FNHA 2L7UA 43C9A 2NZ9C 4LL9A 4WHYG 5DJZB 1KFAL 5C09A 5JLZA 3Q6GL 3T65B 3RWIB 3BWAB 1YY8A 4N0CD 4Z0XB 4PJGA 3LKPB 4KV5E 3FFCD 3RPIA 3EO9H 2M8XA 2OM5A 4PJ9C 5HDBE 3W9EA 3AREA 2CIIB 3HI6H 1CD1B 2JCCF 3I6KA 4FTVB 1F42A 1ACYH 4NKOB 5C92A 2GEEA 3PGFH 5A3ID 2F5BL 2VL5B 1CFQA 2L7JA 2E9BA 3I6GB 3M1BB 5BV7L 4Z8FL 5A43C 1MHPH 2IPUK 2PW2B 4NJAL 3WNKA 4HGWA 3L5XL 4FQCH 5DMYA 3BUTA 2PYFB 4I77L 4TUKL 2QBWA 4LIQH 1T2QH 4I3RH 5HGDB 1AXTL 3BAEL 5DFVC 1RK1B 3SDXA 1S9XB 4LK4A 4G8GD 4JANB 1RIHH 2VKWA 4JR9H 4QWWD 3IDGA 2DJUA 3U6RB 4EIGB 3CXHK 4FP8L 1S9KC 3PL6B 1HQ4B 3EAKA 5CP3H 4YEFA 5D2LF 1PSKH 1KCLA 2W07A 2C3XA 4XI5C 2V6HA 2Y5TA 5E2JA 4XAKE 1FVEA 1KLUA 3EYQC 1B88A 3PNWA 3T2NH 4L4VB 4PGEB 5FGBC 1G7IB 5GZND 5MHSE 2WP3T 4UIKL 2MJWA 3RWHB 4NN7B 4EKXA 1J10A 1T7YA 4R3SB 1P7QB 3RUGA 5GRXG 1X4YA 2X4OA 3GNMH 3SE9L 1TVBA 1MRDH 5CCKH 4QT5B 3GKWL 2R0LH 2CJUL 2KQNA 1XR9B 3OXSA 5CHNB 2YSSA 3BKYL 3QCUH 1XGTA 3QIWD 2HG5A 1OVZA 3VFOB 2R39A 8FABA 5DJXA 3L5IA 2A6KA 3NFSH 3P0YH 1N59A 4N0CC 2VZUA 1A9BB 3U7YH 3GSWB 3OR7B 3SKNB 4WUUA 2J5LB 3GSQA 5E8PB 3PWLA 4NIKB 2DN7A 4JVWA 3N1PC 3VJ6A 1U6AH 3QO0A 4I0CC 1BZ7B 4WW2F 5A3IC 1SEQL 2NTFA 1IGCL 1VDGA 3LHPL 3H9SE 5F6HI 4G8IA 1J05B 2ZG2A 4EBQH 4AIZA 3MV9E 1YPZE 1JJUA 4K55A 2YRLA 3W0WD 5AWNL 1G7MA 2UY7A 5CD3B 1BP3B 2WQ8A 1RZKH 4PGBA 2H8PA 3VRJA 3CX5J 2ZG3A 5D7IF 1JGDA 3FTGA 4LCWA 5DJ6B 5FYKU 1K8IA 3CXDH 3R4DA 2X1XR 3H7LA 5TDNB 4AMKH 3WFBH 5K9QG 3S35H 1I1FA 4WY7H 4QOKB 5HYFA 4KI5D 4H20L 4PRIB 4LF3B 4AY0A 4ODSH 1O7SA 2VNCA 3FQRB 3FO1A 4PRBA 4JKKA 3TC9A 1J12A 1S8DB 1YJDC 3WJJC 4XPFL 1LGVA 1J8KA 4QWWC 3RUGE 1OAYL 3CMOH 4HUXA 5I1CH 2CLVA 3GSUA 4LSSL 4F7TA 3B4NA 3U7AA 4LSQH 5C0GA 2DYPA 5JQHC 4J8RA 1VFBA 3B2UC 4RFEA 2IPKB 1INQA 2J8OA 4P2RD 2LV4A 1P6AB 1S3KL 4YHLL 2H3NA 4KWUA 5EFIB 4UQ2A 1KB9J 1KIPA 1HXYB 3T0EE 5DWUH 3DO7B 4OCNC 3D3VE 4JFHD 3QIWC 4U1NA 5FF6B 5GGUA 2A83B 1JYWA 1U3HB 4JAMB 2QKIB 5J1SC 3CSGA 3CAFA 2VDNH 3K2UH 3NIDF 4ZNEE 5IWLA 2BY1A 1PVHA 3V5KB 3B8SA 1CFTB 3BH9A 4WO4B 2PW1A 4PYGA 3HNSH 4X4XB 4GAFB 4O51B 1PEZA 2DM4A 1A6VL 3O0RL 5BMFL 4WDIA 4PS4L 1AHWA 4XPTH 1VFAB 32C2A 1NLBH 1CL7L 3GMRA 1A4JB 4Y19E 1YNLL 3G6JA 3OKNA 2C5DC 3ZKQD 3ULUD 2WM0A 3GJFA 2ZOKB 4OIIH 4ZFFA 4YX2H 4KK5D 1JPST 4KI5C 1CE1H 2BJML 1UB5A 1XAUA 2J8HA 3G6AA 5FHBH 4OFIA 1NCCH 3DTXB 5T1MA 2VZOA 1M1SA 2E6JA 1NEZA 4TVPE 2DLHA 5SWZE 1CLOL 1HKLH 1A4KA 4UOJA 2XKNA 3WUWG 4HWBL 1SYVA 2EC8A 1G9MH 2DM7A 3BHBA 1J1PH 4QRQA 3TVMD 43CAB 3KDMB 4P9HL 2HFFB 2WUCL 4WHYH 3KXFE 4ODVL 4O9HH 4PJ9B 2LVCA 2YXFA 3O2DH 4NQDB 2FX9L 2FYYA 4AENB 3R1GL 2ADGB 1B0WA 3O3AB 2YD7A 2DKSA 2FEDD 1BGXL 5FKPA 2OR9H 3BT2L 5SX5K 3NTCH 1HH6B 4R7DA 2CXGA 5L6YL 5DJ0B 3ULSA 5BZWA 4BQ6A 4IHOA 4MJIE 4XBGA 1R3KB 1RQ5A 2CGRL 2OMNA 4M62H 1KJ2H 3TYGL 5MEOB 1NKRA 4B0MM 2FGWH 5D7LA 4GOSA 2CKBB 2R1WA 1MCEA 3MLTB 1EVTC 1S9YA 3MBXH 4F37K 3IKCA 3KPOA 4JDZB 3H42L 4C56B 1NSNH 5DF0A 3D9AL 1D9KC 4FXLA 1TZIB 2N7AA 4BSVB 5BVJA 1OAUL 1OGAA 2XTJE 4LPCA 4Z7NE 1SMOA 3IJHB 5T3XH 4TNVF 2JJVA 4IS6A 2PYEA 2GSGB 3VFWB 3REWB 4F7MA 1JHTA 3HE7D 5L8JB 4PRNA 1I1AA 1EEZB 2VLRE 5KS9F 5DVLA 1FVDA 3FQXA 5AZ2L 1ZVSB 4HUUA 3HPLA 4NGHH 2OI9C 3ULUC 2F74B 1HHGA 3QNZB 4PP2B 3SKMA 3CD4A 1MHEB 3QB7C 1DDHB 5GIRB 3VU2A 4X5WA 4JFDE 4WHTB 4HKJA 4JLRB 4WW1A 5CP3A 1H8SA 4WEMB 4KK5C 2IQAB 3P4OA 5HHMD 1T22B 5FGCB 4Q9RL 2HN7B 1LQSR 4XNYH 3TM6A 3D25B 3I2CH 2UVFA 2VDLH 4NQXB 1CQKA 3QT2A 5ESQA 1HILA 3ZL4H 4NO2B 4QGYA 1IL1B 4GG6F 4L8CB 1JNHA 1V05A 2DQUH 1MWAH 3V52L 3HE6A 5HYSA 3PV6A 3TVMC 4FRWA 1KCUL 5IVZA 5B3JF 5FO8A 4DK3A 3FFCB 4LDEB 4U1HB 4CDHA 1P1ZB 5D7LE 4G43A 2FGZA 3QXVA 3DXAD 4Y16A 3ILPA 2FEDC 1FN4A 4KTYA 2AKRB 3MRPA 2EEAA 2Z91A 5C0CE 5I8OL 1NBVH 4X80H 4ZSOB 1TTGA 5HVHB 4LARL 1WTGT 3I9GL 2UZIH 1OGAE 4M7LH 4J12A 4YDIH 1GZPA 3N0PB 1SHMA 3VG0H 1DTUA 4BZ2L 2HKFL 3FN9A 1UH3A 1A1NA 3N1GC 2JJUA 5EH1A 5L2KB 2CKBL 3IS0X 4JO2L 3L1OH 3CFJA 4KUZL 1OAKH 3BMWA 2DBLL 1IGJB 5EZIL 2VQ1B 5EIVA 2FX8L 2XWJB 1HIML 4JO4H 1WCBB 4G8GB 2ZSVA 3F7YA 4Y0GA 2O5ZL 3C60D 5CKAA 2O5YL 2NY7L 2UZXB 3CFDB 4GAJH 4PJ8D 3WXWH 5HYJA 3B5GA 3O6KL 5K9KA 3WNMA 3LB6C 2X09A 3FAXA 3QXDA 3HCVA 1KXTB 3JWNC 4HJGB 4H1LG 4U6VL 1QACA 4HKZB 3SPVA 2IFGA 5IIEA 4KPHL 1CFSA 1TENA 1OW0A 4U2ZA 3RAJH 3IXAA 2DLGA 4LCYA 4YHOH 2OTWA 5EA0H 4U6TA 1GC1H 5ESAB 1N3NB 3L9RB 3QXWA 2EDKA 3IDIB 1JV5B 2R2CA 1BVZA 1UM4L 1KTDB 1OAXH 5EUKA 5T1DH 1FE8H 1RJZB 2NY6D 5T3ZE 3EOYG 1IJ9A 4J1UB 4F9PC 5EDXA 3ZO0A 2CDFA 5BQ7A 4ZAKD 3RU8H 1L0QA 5AZEH 1MJUH 2A6DA 3MLVL 3QIWB 4M5YH 3RTQD 1IKNA 3V5DB 5ADOL 1D7FA 4Z5RB 5IBUG 2I60L 2FATH 1O5DT 3FN0H 4HIIA 1KNOA 5DK2B 5IT2L 5I1HH 4OM0H 4LU5H 4NHCH 4UB0L 4JZOA 3HNVH 1W8OA 4JN2A 1EO8L 5CEXA 1MQKL 4TSBL 4R96A 4DK6A 2H6PB 3O8XA 4ETQB 3EYFA 5DMIH 3WIIH 1LK3L 3WFHB 1F00I 3W0WB 1EFXD 2VABB 5E2TH 1ZANH 1FYTA 3MUHL 4KMTL 5ISZA 3MA9L 3GSVA 1FG2A 4PJXA 1CDUA 2FBJL 3O6ML 1LP9B 4C57C 3KYKH 3ZDZE 1FNGA 5F1IA 3WFZA 1XIWA 1RSFA 2YZ1A 3CCHB 2RCSH 1I7TA 3DX9B 5JPMA 4NT6A 4QXUH 4OFKA 1J9CT 1R3LB 3UTPE 5E5MB 3RY6A 3JWDH 1NCAL 1YJDL 4FFWC 4LVNC 3MCKB 3C60C 3EO0B 1MLCB 3L5HA 4PREA 3U9UB 5B39A 1K85A 1F3DJ 1HCVA 2ERJC 5ILTL 1WBYB 4J3SA 1VGKA 4XP5L 4PJ7E 2YWZA 3O45B 4WENB 2BSTA 5ITBL 3BP4A 5F89A 2C9AA 1UZ8B 5DUMH 1HINL 2FJGA 3WNPA 3IU3B 3K80A 4DGYL 4P2RB 2Q6WA 3MRQA 3V8OA 5JZ7D 2IBZX 1BBJA 2YKLL 1QTYT 2AJUH 2DKMA 2NY6C 3ALPA 2UYLB 2GTWA 4PTUA 2GW5A 1DQJB 1OCWL 1ZHLA 2VDQH 1I85A 1A14L 4ZOAA 2DMCA 4UT7H 2I9LB 4JPKL 4KTDL 4TRPH 4ZAKC 5KOVC 4G6KH 2BP3A 2X4UB 5IWLC 1E6JL 3RWGB 4DOHB 4KZDL 4P57A 4WFGE 3RTQC 3VFVB 4WFHD 3RNQB 4XWGL 1TVDA 3ELAT 5E2UL 1XF1A 1YEIL 3MOAH 3K7UA 4BQ8A 1L0XA 4PD4J 4PJXE 5KVDL 1LDPH 1WSST 2X4QA 1AHWC 2D03H 2OBGA 3U1SH 4EI6A 5AG8A 1NFIA 1S7UA 1I1AD 1XZ0A 2FJHA 3RVTC 1RAMA 3S36H 4MA7L 3CVHB 1UC6A 1ODAA 1CXFA 3P4MB 4ZYKA 3FB8B 4XAWL 2R15A 5D1ZB 3EHBD 4NZUH 1Z5LB 1Q9KB 5ITFA 1JBJA 4XXCC 5FYJH 4LFHG 4OCSH 4G5ZH 4KC3B 2J4WL 5TDOB 5FO7B 3GMMB 1BFSA 5IW6A 3SDAA 4K3JH 2VSCA 5JLZB 4JZJA 4BSWB 2DMKA 2X4NA 3KPQB 1BFOA 4Y5YC 1FGNL 4O2FA 3HE6D 1QLEL 3CSPA 4U6HA 3QQ4A 5D6DA 3CLEH 1GGUA 4U7SA 1WQVT 2ZUUA 4LNRA 3WCYA 1MI5D 3G5VB 1R5WB 2FIKA 4BH7B 3MRDB 1FGVL 3IGAA 3VCLA 4DW2H 2XZZA 1JHKL 4KAQH 5MENA 1SM3H 1AGBA 3TVMB 5H2BB 1E0OB 4UT9L 5I1KL 1EMTH 1LEKB 2D7QA 5M7QA 1UENA 1YQ2A 1T2XA 4P3CH 1JUFB 2ED9A 4CMHC 1JGUH 4IJ3C 3TBYA 1TETL 3NCEB 4LLDB 2HJLB 3QUYD 4HCRL 5GJSL 5GPRA 1JGEB 1IKFL 2DTSA 3QULB 5JZ7C 1YEDB 3LKSB 1C08A 1I7ZA 2ITDB 4O4YH 2EIZB 4LSRH 4Z6AT 1R0AH 5IMKA 5D72L 1MWAA 3HC0A 1MCPL 2DOCA 3RWCB 2Z35B 5EBWB 3NIGE 4AL8H 3MRGA 4HLJA 1FH5H 2I5YH 2WZPD 1GAFL 1F8TH 3MFFA 4ZPTB 1LO0L 1IAKA 5HYJD 2E7MA 5ID0B 4MX7B 3MR9A 1JZ7A 5GS0D 4WNQB 2AS5M 1D5IH 4W4OA 2AW2A 5IFAL 2XY1A 1S7SA 4LPVA 1I1AC 3OXRA 3WFCL 1RZGB 9CGTA 1F4WH 2GFBB 4S0SD 3HC4H 2C1PA 3DSFL 1CGTA 3MBED 4RCAA 3H2WA 4CW1A 3TBWB 3IDJB 3HE7B 4DN4L 2X4OB 4G80A 5HI4C 1SVCP 2CR3A 4H1LH 5HGHA 5FA3A 1J18A 4H25B 1DUYB 3QFJA 5F88B 1J5OH 3ULUL 4OCRL 4NRXA 3VRLE 3TPKA 2VXSH 5HHMB 4F57L 1VPOL 3HI1A 4NO3A 2AI0L 2B2XH 2NPLX 3HE6C 2X41A 5TE7H 1FZKB 4XC3L 3G5ZA 2O5XH 2ID5A 2ZSWB 2DQIH 5FCUL 3AU1B 1A7NL 3KPNB 4U7KA 3GSQB 4UMGA 4G3YL 3VGEA 4PRDA 2QV2A 1MQ8A 3AM8A 1L7IH 4LASH 4JRYE 1R3HA 3O8XD 5KJRH 5DRXB 1S7WA 3G08B 4G8IB 1OWWA 4OI9A 4B7LA 2KH2B 5BOZG 5E6YA 1CI5A 2VN7A 3NA9H 5KTEL 3P4LA 1RMFH 3DXAB 4OB5H 5BVPL 1C5CL 1TJIH 3MUGB 2P1YA 5ISZD 5IW1B 3MLXL 5BOPA 4NNPL 5E9DD 3QUYC 1K8IB 5E8OA 1N0XH 4NC0B 1UM5L 3ZKXC 1YMMB 4LDLB 2X1QA 3TWCH 1BVLB 2F58L 2R29H 4FQHA 1BMGA 3BQUA 4YH6A 5IG7B 1QNZL 4HFUL 5LWYL 1WJ3A 3WDJA 4HUXB 1XR8A 4F9LA 1DBAL 4LVOC 1AE6L 1R6VA 1H3PL 2IMMA 2M26A 3IYLW 4L1DA 5IB3A 2YXMA 1HYRC 3C60B 4X6CA 4CUCA 1OW0C 3R06B 5DD1H 4R90L 3WLBB 3L6FA 4G6JH 3ARSA 4PJ8B 1OP5H 1PJ9A 4N9GB 1W72H 5T1KD 3MXVH 2ERJB 5D6CA 1HXMA 1KXQE 3EYUL 3X3GL 1AC0A 4PRPE 4QNPF 1CDHA 3T4AB 2ADJB 2AXGA 2QSQA 2BNQA 1P84J 1ZHKB 3MLZL 2P8MB 2X1WL 2YC1B 4C59B 4HW6A 3UTSA 1WIUA 3CVIH 5SX5H 1Q9OA 5IFJB 2NY6B 2IFFH 1P5VA 1R3JA 2OZ4H 3LQAC 5C6PB 1IKNC 2ADIA 5BS0A 1IEHA 3TJEH 4ZAKB 5FYKL 2K3TA 2EZ0D 2OSLA 1FIGL 2H45A 3WUWA 2R56L 3BJLA 1P4BL 2E7HA 3QPQD 1PLGL 5IBLC 3RTQB 3LEXB 2XZCH 1BQLH 4ODBD 2VN4A 5FGSA 1LWRA 2ARJA 3O8XC 5I1DB 5H35A 2D7OA 5KVEH 1F13A 4OUUB 4E5XA 1G9NH 3C8KA 4PJIA 3D2UD 1BM3H 2I9TB 2JTDA 1I9RH 2JK5A 4Q6IB 3GGWA 1OAQH 2GTZB 4PGCB 2G9HA 5IVXB 2EDQA 1IARB 3SDAD 3IFNL 3IB4A 4X6CE 1EFXB 2W59A 4TOYH 2AXFB 3FO0H 3G6DH 5IKCB 25C8H 1A5FL 1DLFH 2FJFA 3QUZB 2HJKB 5E94A 1AFVH 3IDXH 2EYRB 3PF2A 4GRWE 3S4SG 2QADD 1KLGA 4QHMA 1T1WB 4YDJB 2BNQE 4H8WL 1U3ZA 2X7LB 3OAUH 4Y5YB 5DJ8B 4S1DD 3GRWH 4HWZA 5MEND 1D6EA 4QRQB 4ZODA 2IADB 3ROLB 5JQ6L 1H3WM 12E8H 1M7IB 1QFOA 1YEHL 2YZ8A 3QUKA 3WEXB 4U1KB 1KCVH 4NQEA 4RIRA 1JPTL 1RIUL 5IJVB 4O58L 2GIYA 1WISA 1A6AA 2XN9D 2P8PA 2PETA 2OS7A 3MLWL 2B20A 1G9MC 4CMHB 3QEGH 1BFTA 4Z7OF 5B38G 4IJ3B 2NLJA 5J3HD 4XMLL 35C8H 4JO1H 3T77A 4BKLA 1P7HL 4MXVE 5I8EB 3A6OA 1S5IL 2FNBA 2P49B 4XP4H 4KI5F 2YD6A 4ERSH 3KWWA 4PJIE 4X5LA 4JQVA 1BX2B 4C83B 2EZ0C 2L0DA 2QQNL 7FABH 2RJMA 2VWEE 1MJ8L 5J6GA 3QPQC 4U1SA 4OZGE 1XGRB 2Y06L 4M7JL 1QUNA 5E99H 1FPTL 4K2UL 3VH8G 3AMKA 4K8RD 3LCYA 3EOAA 2ATKB 3H7BA 1UCBL 4WV1A 2WP3O 3VFMA 3VWKD 3WXVH 2VR9A 2W9EL 3F62A 4F7MB 5IP4A 3OKOB 4LOUD 4TULH 1BIIB 3C8DA 4DJMA 4F7EB 3R8QA 3ARDD 1BJ1H 3MXWH 4GW1A 5GGRY 4DKFL 5D7KE 5CSBA 3SDAC 1U8PB 3DIFB 4JFXB 2NTSP 3MNZB 4GXUN 4PIRF 4XNUH 1F45A 3ZLQC 5C9JA 3KYNB 5JNYB 1K3ZA 1BAFH 5D6DC 1T1XB 1A3LH 2QADC 1HILB 4GH7B 3LN5A 1IM3A 4JG1H 4EDXB 1C5BL 3RWJB 3HE6B 3MNWB 1SBSH 3IFOA 4PGZA 4YHKH 1RUKH 3FO2A 4H1LA 4ODHH 1QSFD 1MI5B 5GRJL 5I1AA 2WSKA 3HUJB 4KHTL 5GS2D 1CYGA 4PJCB 5AYQA 5IB1B 1T0PB 3FRUA 1GZQB 3MMEB 4ALAH 2B1HL 5BO1H 4HK3J 1DVFA 1CF8H 3QJFB 4MWFB 1BVKA 4UQ3A 2EE2A 3ULUF 5J3HC 2NCMA 3CFCH 5ETUB 3QUYB 3IDNB 3EO9L 1N2RA 7CGTA 1ZSDA 3HI6L 3T2QA 3ZKXB 3MRJB 1ACYL 4DZ8B 3PGFL 4PRHA 2UWEA 4AH2B 5TF0A 3P9MA 2CRZA 5J9PA 4HF5L 2CUIA 5CEYA 1JWMA 5CIPH 3V6FB 3PHQB 2GT9B 4LVOB 3VXOA 5HYJB 5K9KB 4FQCL 4K8RC 1ZLSH 5F7UA 1EBAA 3U7WH 1H9VA 4LQFH 3VWKC 4LIQL 5C08D 3V95A 2PO6D 1BOGB 3M45A 4I3RL 2QR0B 3MV8E 5HJ3B 5DD3H 2W0FA 3ARDC 1EO7A 1RIHL 4JDVB 1RK0B 4JR9L 2NY4D 5I75C 1MCLA 3MBEB 4JRXA 1GJIA 5DJYA 2I24N 4ZUWB 4JFPA 4MQTB 4NQTA 4APQA 1K4CB 5HHPB 5K33A 3FJTA 4FQJH 5BZDB 3E8UL 2BCKA 6CGTA 2AEWA 3OQ3B 2FO1A 1E4XH 3T2NL 1NGYA 1UEYA 1S9WB 1W72A 3MUY1 3IDMB 4RAUB 1JWUA 1R5IA 3BUYB 4LLVA 5GRZA 2VKXA 4XCFH 1CVRA 4Y88A 3N85H 1UFUA 2G60H 2RHEA 5I19H 5EWIH 3RNKA 5HI3D 4WUKH 1CXLA 4XCNA 3GNML 1EEYB 4Q7DA 5CCKL 2R0LL 3QRFM 4OCYH 4PRHE 4IIQA 4R26H 3O8XB 1LVEA 1EJOH 1JFQH 4AK1A 3QCUL 1U3YA 4GRLD 4E41D 5JW4M 4OZIE 5B8CA 3NFSL 4GLRI 4WJ5A 3P0YL 1AGEB 2DQDH 3HG1A 3PIQB 4NWUH 1F4AA 5E56A 3SE8L 5ISZB 3IDUA 5E9DB 5D5MB 3O4LD 4XMKH 1OP3K 3OKLB 1U6AL 3C08H 4F9LC 3IVKA 1PGRB 1QO3A 4U1JB 4EBQL 1EJ6A 1PG7L 2RAMA 3UDWC 1M6OA 3STLB 3GJEA 2DQCH 5GGVH 3RVWD 3TYFB 1RZKL 1A2YA 4U0RC 4OF3A 1U2CA 1FFRA 5A16A 2GJZB 1JGVL 4HZLA 4V1DD 3CXDL 1ETZB 2DJSA 4U6YB 3V5HB 4AMKL 3WFBL 3S35L 4WY7L 5DJAB 1HSBA 4ODSL 4RGND 4QYOA 4NQVB 4ZTOH 2Z4QA 1JK8A 5T1KB 3T8XB 3UO1H 2O61B 2P5EE 2VITB 1JGLH 1NAKH 2NY4C 3EDDA 3CMOL 4C54A 2DLIA 5I1CL 3GRWA 2DIJA 3VXQA 5HGBB 1ZHLB 4LLYB 2FD6H 4MMXC 5DYOB 4M1GH 4LSQL 3NFPA 1AO7D 3SBWA 2V9QA 5TDPB 2BY3A 3UJIH 3WO3B 2GSIB 4PJFA 3LQAL 3CIQA 1F97A 4XPBH 5DTFB 3L95B 4YHZH 3TIDA 4MQXD 5DGQA 1HI6B 1KJ2B 1PY4A 2R4RH 2YS4A 3MV11 2YRPA 5DWUL 1ZWIA 1MHHA 4JFEE 1IM9D 3BPNB 5BRZD 4RMQA 3SGDH 4R7NB 3CH1B 3D2UB 3F7QA 1UT9A 4LEXH 4CL7A 1UG9A 4G7VH 2M2DA 2VDNL 3K2UL 1AR2A 3Q0HA 4NYLB 1MEXH 3LRSA 2VZ1A 3ULVE 3QI9A 4F8TA 4XVTH 3MJ6A 1Q9LA 4P4RB 2Z8WC 1K3IA 3JV5A 5I76B 3HNSL 3JV4A 3ZT6A 4LKXB 3U2SA 3OZ9L 1LNUA 3EDKA 4X6BB 1YNKL 4XPTL 3O3BA 4GMSH 1F58L 3RWFB 4ZOEA 1NLBL 2QADB 3N1MC 1WBZB 4XBPA 3RVWC 4M93C 2FIKB 4MJ5B 1NL0H 1EUTA 1DQQA 5CSZB 5LVEA 4AZ8A 3PGCA 1BPVA 1DE4A 2XICA 5IW3A 4OIIL 1OAZH 3LMJH 4YX2L 3VXTB 4DQOH 1CE1L 2ZOLA 1EAPB 3T0XA 3VA2C 4RGNC 5ANMB 2EO9A 5FHBL 3DHMA 1NCCL 3NCFB 5IVXF 1J0HA 4DFIA 4OTXH 3H0TB 5K9JH 2VIRA 2XN9B 4QGTA 5ALBH 5L88L 2MWCA 3KPSA 1UXWB 2EXYD 1HKLL 3OJ2C 3KPPA 2Q87A 1G9ML 3P4NB 4FFVC 3TO2B 1MWAB 1J1PL 1TPXC 1B2WH 4LCUA 4Y5XA 1OD7A 4HJJH 4O9HL 3P0VH 3O2DL 5IJKC 1ZAGA 4QKXB 4NC2B 3TEUA 1YMHA 4ONHA 3MFFB 3BH8A 1KTRL 2CIKB 2AV1B 1JF1B 2OR9L 2PKDA 3NTCL 1CXIA 5EUOB 4F7CA 2CXKA 1CXEA 4WV1C 2EDOA 1VB9A 4JJ5A 1BJ8A 3PQYE 5C3TA 4MAYA 4MQXC 1JTPA 2E6PA 4LAJH 1KV3A 2VO5A 2WBJD 3ARXA 4M62L 5FUZH 1KJ2L 1M7DB 3U0PB 4BZYA 2VLJD 5AD0A 2FGWL 1HH9B 5DK0A 2ZCKH 4QXWA 3VWKB 4AQOA 1DR9A 2XWBB 3OB8A 3AUVA 5KSVA 3MBXL 3E0GA 1QA9A 2Q7YA 4U1MB 3ARDB 4B7IA 1NSNL 1WT5C 3FT3A 4L29A 2DQHH 2R1XB 1KIQB 1YN6B 1FAKT 1LE9A 1U8QA 5D2NA 4EVNB 4WFED 4M6NL 1CDIA 1D5XA 5T3XL 1TVHB 5TQ2H 4D9RD 4L9LB 2XZQH 3DUSA 1MJ7H 4J3OC 1HSAA 2QHLA 4OF7A 3VMNA 3KPSE 4YAQB 3PABA 4N5UA 3I50H 1XF4A 3IETA 2EYTB 3QQ9D 1CD8A 2UZYB 4NGHL 3T08A 3SDCA 3BDXA 1WEJL 3DRTA 1S7WB 4NPYB 5F7DA 3MV9D 2Q86B 4I48A 3CFIC 3MRLB 1UB6B 3GSXA 3W5NA 4EJ1C 3RGHA 3QXTA 3ES6A 4JFFE 1QSFB 1T5WB 4QRPE 3BPCB 5BXFA 3D0LA 4AJ0A 1FYHB 2H1PH 4NZJA 3WLWD 2J8UA 5ICXA 5C70A 4XNYL 3HB3D 3I2CL 2VDLL 2GJ6B 2EXYC 4P2OA 5MERB 1MIML 3AY4A 2Z93A 3MYJB 2DQUL 1MWAL 3QDGA 4FQHB 4HMCA 1NBZB 4P3DB 5CJBA 5D9SB 4HG4K 2ZP0T 3WKMH 2ZZUT 4Y2DD 1I7RB 4K23H 4QHKI 2WINA 3TO4D 1D5BB 4HUWB 5CP7A 1NPUA 1QD0A 5ID1B 5JOFB 2CLRB 1F6AB 4Z7UB 1NBVL 4X80L 3MREA 3BZ4B 3RI5F 3NPSC 4PJCF 4U0RB 4N8PA 1RJYA 4OFVA 1XGUA 3ARYA 4UIMB 2UZIL 2WBJC 4M7LL 5D2NE 1X5YA 4OAWA 3LKRB 4S2SB 4YDIL 5TE6H 3VG0L 1HXMB 1EHLH 4K8RL 5HVWA 5J1AB 1JYNA 4MMZC 3L1OL 4WI6A 5C08B 5J7CC 3WDIA 2PO6B 1OAKL 5EB9A 1JNLH 3VE0B 1KCKA 5KSAD 2BC4B 3T0ED 3M8OH 4HS3A 4JO4L 2WNGA 4MA3A 2IJ0C 3H9HA 3MCG1 3D3VD 2NXYD 2NY4B 5CBAA 3PWUA 2PTTA 4PJEB 3TNMB 4JHAH 2P8LA 4GAJL 3WXWL 4JCLA 4B41A 1UADC 3QIBA 1FLRH 4NNXA 2DS4A 3QDJA 3S4SA 3HAEB 4PJAA 3H9ZA 4HUMB 3VXSA 4MXQD 4L4TE 3RAJL 3QZWB 1AGFB 1OQOA 5EA0L 5BW7A 3O6FA 2HFGH 2W0PA 3VWJD 4NUJB 3QQ9C 1OWRM 4K3GA 2BHZA 3QDGE 4LCCA 4IIQC 3L3GA 1OAXL 3I84A 5T1DL 1FE8L 3ZZ1A 1YYMH 3OAYH 2P46B 4AIOA 4Y19D 3QUMH 5J06A 3GFUA 3FN3A 4NKMA 5B8CC 4OZ4B 1U58A 3RU8L 4NKQB 4QXTB 4EEEA 5AZEL 1NBYB 3W39B 3WLWC 5J11C 4KKLD 5B38A 3WIFA 4GW5A 2AJZB 2DI8A 4M5YL 4MJ2A 4GRLB 4E41B 4IMKA 5IVNA 5DFWH 3F6IA 3OKDB 4NDMA 2VE6A 2FATL 3MJ7A 1UCTA 4KJPD 1E4XI 1CLYH 3P73A 4UILH 3FN0L 3ET9F 4YR6B 5I1HL 4OM0L 4D8PB 3RBSA 4LU5L 2NY2D 4NHCL 4YHPB 3HNVL 3VDCA 4Y2DC 3O4LB 5FYLE 3FONB 4LCIL 3TO4C 1NFDE 1WAAF 1X9QA 4LLMB 3KXFD 5DMIL 3WIIL 2QTEA 1FL6B 1BFVH 3D18A 4FG6C 1GHFH 3NMEA 3VH8A 5E2TL 1CFVH 1ZANL 4JHZA 5FDYA 3ARFA 3QDJE 4MDIA 3VFNB 2IANE 4V1DB 4PG9B 5IROA 1S7TB 1BREA 1V8HA 4QHUA 3MROB 3KYKL 4M9PA 1I8IB 1AR1D 5ESVA 2R23B 4MJID 3DV4B 4RGNB 2RCSL 1NJ9B 3F7PC 3OJDA 3T0EC 5KSAC 4QXUL 5E4EC 1TXKA 2H26A 4X9FA 5EO9B 3JWDL 2BSSB 4KFZC 5D5MF 3BP5B 2HFEB 2V2XA 2X1OA 4P4KA 2ESVA 4WWID 2FR4A 2YPKB 3V6OE 1KG0A 4UI2A 1RD6A 3FO9B 2MMXA 5JHDA 2CKNA 2A1WH 1AO7B 3PDDA 4MXQC 4X4YA 4MAYD 4UV4H 2FHBA 3AC0A 5DUML 3FT2B 2JJSA 4OZHE 2FX7H 3VFUB 3VWJC 1B3JA 4HH9A 2APWA 3VFMB 2AJUL 3GK8H 2VLRD 1QBMH 4NQCE 2VDQL 2X4RB 2ORBH 3MGOA 4Y4FA 2A9MH 2EDLA 5HI5C 3LSOB 4UT7L 3TA3A 4TRPL 2R0KH 3IAQA 4HIHA 4G6KL 1SYSB 4GRMB 5DZOA 4IMLA 1U3JA 1J8HE 4JFDD 1IM9B 2ICEA 4GKOA 3QI9C 5GGSA 5BRZB 1C8PA 1UH4A 3MOAL 3AROA 4D0CA 5GJTH 4TUOB 5HGAA 3RIFK 2A74B 2D03L 3ZDYF 3U1SL 2Z92A 4QTHB 3LQZB 4OFPA 2NY2C 1D6VH 1FZOB 4MB3A 3QG6A 4UTBH 3S36L 3O9WD 3OL2A 1H15B 4U1GB 1WWWX 1KBGH 3DPBA 5CAYB 5C0DA 5EU7C 4UUJA 4LKCA 4NZUL 4UINH 5CJXC 2W9DH 2ESVE 5FYJL 1CLCA 4OCSL 4G5ZL 1PKOA 4NSKA 1TZHA 3SGDI 2W60B 4MNGA 5CWSA 5C0CD 4K3JL 3VXMA 1C12B 5F7HA 4F80A 4EN3D 1AR1C 1CGVA 2QQLH 1G0YR 3RL1B 3MRMA 1TDQA 5FDWB 4Y5XC 2EXWC 3ROOA 1A64A 4Y5VA 3CLEL 2Q8BH 1WUNT 3MNVB 3MYZA 4KDTA 4I2XA 3EJYD 4DW2L 3TH4T 3MJ8B 4KAQL 2EYSB 5EBGA 3DUHA 3LS4H 3NFNA 1EMTL 4MCYA 5E08H 3K4AA 5D1XA 1WFUA 4P3CL 3CUPB 2AEQL 4MAYC 1T04B 1JGUL 3TT1H 5DXWA 3HZYB 2DI9A 1KJMB 3HR5A 3BO8B 4HBCH 4LSRL 4O4YL 4CNIA 2MNUA 4OLXH 5ACZB 1R0AL 2YN5A 1GXEA 2JCCA 1QLRB 2GK0A 3UTTE 2WBJB 1QRNA 5GGTH 3SO3C 4KK9D 3CDCA 3N06B 3TNNB 5HY9A 4AL8L 2VLJB 2X5PA 3VD5A 5CUSH 1FH5L 3MRHA 1I1CA 4PJHA 5T3ZD 1QSZA 2I5YL 5A40E 5C0FB 1F8TL 3BXNA 2OJZH 3QIBD 4Z9KB 5A2IH 2ZCLH 4U1LB 5LAXA 5E0QA 1Z0NA 3VXSD 5FO9B 1AH1A 5IQ7H 1D5IL 5EC2B 1X5HA 2Q3AA 1IGMH 3TBSB 1M05A 4CN6A 4X6DA 5EUOF 3DRQA 3LKQA 3H6JA 3O9WC 2MKLC 3RX7A 1F4WL 4NRZA 3HC4L 2DMBA 1I1YA 3Q2CA 3QIUA 2EH8H 1GPOH 4M4RA 5C86A 1SJEA 1N6QH 1QBAA 5D2LA 2QSVA 1J5OL 3H9SB 3OHXA 3QG7H 4G7YH 4NWTH 2X44D 3GHBH 4MQ7B 3MV9B 1YPZB 4BQCA 2VXSL 4P46A 4EN3C 3EGSB 4HX1B 5F3BB 1H5BA 4R4BA 2B2XL 2FRGP 4OLWH 2PR4H 5J11B 1TCMA 1HOCA 5TE7L 1IC4H 2O5XL 2DQIL 1FFPA 2DWEA 4ODXB 2G75B 2FB4H 1JTOA 1L7IL 4LASL 3EJYC 4QRSA 5EC1A 1R24B 5C2UB 5DC9B 4HS8H 2NY5H 3QUMA 1M6OB 3JXAA 1IEBB 3NA9L 4Y2DB 1RMFL 1A47A 3C8HA 1A2YB 4OB5L 4RZCB 1TJIL 3TO4B 3REVA 1PG7X 3JUZA 5B22A 5DVKA 2C4FT 2F5AH 1HQRA 3V7AG 1ZGLM 1U8KB 1N0XL 2NY0D 2R2BB 2SEBA 2AQ3A 4I0KA 4CADB 3E3QC 3K1DA 1ZHNB 3QYCA 1OSZA 4KK9C 4WW2A 4YFDB 5DEZA 3S35X 1INDH 4PJDE 5L2JA 1MFDH 4PPTA 1LK2B 1T4KA 5IV2B 3OKMA 3QIBC 5C0BD 1A9EA 3T0EB 5KSAB 4RFOH 5BJTB 1X5LA 5E4EB 5D7IA 5D2LE 2BRRH 5JHDD 2XOTA 4YNYB 3D3VB 3K8MA 3NN8B 2NXYB 5GRVL 3PXHA 5DD1L 2XACC 2V7HA 4CVZA 2X40A 1AGDB 2BXYA 2AK4A 1W72L 3MXVL 2APXA 3DETD 4YDVA 5FA4B 4Z7UF 5MEPA 1HHHB 5CEZE 2IBGA 3TIDB 3UAJD 1NC4D 4QRUB 1BOYA 1T3FB 2DICA 1G7PA 4LPUA 4Q0XH 3FQWA 5FB8A 1KT2A 2Z31A 4N90E 3VWJB 1BWMA 1KACB 4AEEA 3CX5K 3T09A 2EE6A 5E6ID 1LE5B 4YXKH 4G42B 1PYWB 2IFFL 3ARBD 3FOMA 1HDMB 5IMOA 2OZ4L 4IMKC 2R9HD 5J6HA 1OQXA 4Y19B 2ADFH 1NUDA 1FL5A 3TJEL 4G9FA 5C0IA 2BMKB 1FG9C 4PJEF 4IOIB 4GKNA 1KENH 5C07E 1A7PH 2HH0H 4JY6A 1FJ1A 3MRKB 5IEKA 4PGDA 2XZCL 4NN5C 3EOBA 2DKUA 3JV4B 4EOWH 3MRFA 4ZFOA 5KVEL 3QJHB 4OD2B 4HDIB 5D4QA 2HJFB 1ORSA 2NY2B 1NMBH 1BM3L 3VFRB 1I9RL 4PR5A 2DLFH 1OAQL 3ARFC 4OLVH 3KXFB 4ZXBA 5IROC 2NY0C 4D9LH 4S11A 3HRZA 4X8XA 1TCRA 1VHPA 4OCWH 5AEAA 1KB9K 4X9BA 1IQDA 3FO0L 3G6DL 25C8L 1KGCE 1DLFL 1PG7W 1I9IH 2W91A 4J4PA 1AFVL 4WU5A 2H2SC 1IGYA 4MJIB 3OAUL 4Z7WE 3GRWL 4Y5XB 2AK1H 4PS4H 5EO0A 12E8L 1EBPA 1J0IA 1FZMA 5HYQB 5I6XC 1X5IA 4U0QB 4WI8A 1F11B 1H3GA 3UXFA 1YNLH 1KCVL 2JELH 3L3JA 1OY3B 1D5MA 3DETC 5I0ZA 1QR1A 4TQEH 3T0WA 5IF0A 1EX0A 1J88A 1W0YT 1ZA6B 5FUCE 1G6RB 3UAJC 3QEGL 1Z6JT 4RMVA 1JF5A 35C8L 4JO1L 2BVOA 3BEVA 1NEUA 3TA3C 2B8OT 1G6VK 3OF6A 2EDEA 4XP4L 4ERSL 4GW4B 3ARBC 5JOEA 4YPJA 1DN2A 4HUKB 1OB1A 2VLRB 3U36B 2R9HC 5DA0B 4YIQA 4XPAH 4P5KB 1NLDH 3WS3A 1U8JB 5F8QC 2R8SH 4PV9A 1ORQB 7FABL 1WIPA 5F1NA 5CIPB 3NIDE 3EFDH 4JFDB 5AUMA 2APFA 2E9IA 4B50A 1XGQB 1LD9B 5E99L 3P9LB 4HSQA 3OG4B 1PKQE 1IC1A 3OJMB 3WNNA 1E27B 1KC5H 2CD0A 3AXLB 4K94C 1K8DA 5GGTA 4NBXB 5C6TH 3PABB 4TULL 4JRYD 3IJYA 4KK8D 3Q48A 2R0WH 3TH3T 1X5JA 3O9WB 1ZA3A 2D31A 4GS7B 4GKZA 4P59L 3MXWL 4CMMB 4HUVB 5E8NB 5DMKB 4XNQB 5HHOE 3WN5B 4MNQA 3ARTA 2FSEA 4P46D 3FOLA 5BXFB 4XMPH 4XNUL 3GIVA 3BN9D 4MB5A 2OJEB 2R2HA 3OMZA 4JY4B 2NNAB 4KDWA 5C0CB 2IF7A 1BAFL 4Y5VC 1A3LL 1U92A 5INCA 4EN3B 1CGWA 4ZS6D 3BIAX 4Y8AA 4F2MA 4JFOA 4JG1L 3PJSA 3UTOA 3T0VA 1A6TA 1SBSL 3CDYA 4YHKL 2P5WA 1B90A 1IGTB 1RUKL 4P5TD 3F12B 5D1XC 1PBYA 4ODHL 1KPRA 1VGEH 3O6LH 1EDQA 3B5TA 5EG6C 3F7VA 2VLKE 4CRPA 1Q94B 1B0RA 4DVBB 5HDBF 3U4EB 3I6LD 5BO1L 4ALAL 4KXZH 5EN2A 5HPOA 3KHOA 4P5MB 1AI1H 2GCYB 3M07A 1CF8L 3BD4A 3G5XA 4HXAH 3MREB 4L8DB 4NM4H 4JN1H 2MQ0A 3CFCL 5I16B 4GG6A 4PRAA 1Y0LA 2WWKT 4PJ5A 3L3DB 4PRPD 1ZOXA 1TITA 4HBQA 2E5EA 4M5ZH 5JR1H 2A0LD 5HHXH 4TYUA 4HC1H 2V17H 5KVMC 3HC3L 4QCIB 1NGZB 5KBNC 2R2EB 3ZE1F 3M17A 1LO3H 4CJ0A 1E28B 2Y36H 2P8LB 5EU3B 1AP2B 2UWEF 1NAMB 3O2VH 4S1QH 3B9KA 1F02I 5FECB 3KJ6H 4I1NB 3CLFH 1ZLSL 3KR3H 3U46A 4LQFL 5DJZA 2OXGA 3VXSB 3VXUE 1NMCC 3KPRD 4XT1C 3WMSA 5CZXD 5I8OH 5EULV 3T65A 3RWIA 1UWGH 3BWAA 4Z0XA 5HVFB 5DD3L 3LKPA 5KS9E 2CIIA 1Y6KR 1CD1A 2XZAH 1FDLH 2W0LA 4KKCC 2P5WE 4FTVA 1MRCH 1IBGH 1ZS8B 4NKOA 5CJOH 5IEHB 1RZ8A 4P46C 5DLMH 1KTLB 1DBBL 2CR6A 2ENSA 4G9FD 3P3YA 4FQJL 3INUL 2VL5A 2MTPA 3I6GA 3BN9C 1YEFH 1E4XL 3M1BA 4DVRH 1A21A 3MV7D 1BF8A 1EHXA 1T83A 2PW2A 1NC2D 4LHUD 5F7YC 5GZOD 4HWNA 4XCFL 1JPSH 2PYFA 3MJ7B 2XKUA 3N85L 4GG6E 2G60L 4W6YB 3Q3GB 5EWIL 1WWBX 2YUWA 1EO5A 4J23A 3BP7B 4PJ5E 4WUKL 4K3EH 4N8VG 4P5TC 2YA1A 4LP4A 5HGDA 4I0PD 3VFSA 1HK6A 5T5FH 1KJ3H 2RB8A 4NN5B 2QHRH 1RK1A 4OCYL 1S9XA 2Y4SA 4MXWH 4R26L 4MS8D 4JANA 1EJOL 5LXGL 1JFQL 4NCC2 3U6RA 4C55A 3PL6A 1HQ4A 1U41A 1IC5L 4N5EC 2DQDL 4NWUL 2Y07H 1NMAH 2E9JA 4YQXH 1YPZF 3C9NA 3MGTB 4PJ7B 3CDGB 2NY0B 4RRPG 2X42A 4L4VA 4PGEA 1G7IA 4XMKL 2WW8A 1JYVA 3C08L 4ZUTB 3RWHA 3HNTH 2BFVH 2A0LC 3TLRA 3TF7C 4X98B 4R3SA 1P7QA 1F5WA 4JG0H 4D9QE 2DQCL 5GGVL 4F37F 5TGBB 4UB0H 4QT5A 2I07A 2XG5A 3UC0H 5C0BB 5C0EB 3VGAC 4O2EB 5C6WH 1XR9A 1U0QA 1ITCA 5CHNA 1A7RH 2UUDK 3JZ7A 5JHDB 1K4DB 3VFOA 4JM4H 4S1SH 5I6XB 3G5YB 4ZTOL 1WITA 3U4BH 4FOMA 4IRZH 4HUNB 5A1AA 2IBZY 3GSWA 3UO1L 4X83A 2OL3B 3OR7A 1NAKL 3SKNA 2VAAB 5E8PA 1NC4B 1BZ7A 4U49A 2FD6L 1J05A 4M1GL 5I1GH 3Q5OA 3L3OB 5E6IB 5D7KD 1RULH 2IH1B 1YJDH 3QEQE 5C8JB 4LSVH 3UJIL 3ARBB 5CD3A 1G7HA 4PV8B 2VTFA 5CJ5A 5SV4A 1I3RB 4JDTH 4XPBL 5GZOC 1OTUD 2LQRA 4YHZL 4M8QB 5DC0A 2CUMA 4PUBH 5TDNA 4B53A 4OGXH 2E7LA 2HTLD 2QQQA 1I8LC 4QOKA 2Z92B 4PJFF 4PRIA 4GAGH 3FQRA 4I0PC 2R4RL 4CVXB 4L8SB 5INDB 4M1DH 4PP1D 3L3IA 1S8DA 4MS8C 1MH5B 1ZE3C 1P53A 1ZVHA 4C4KT 3FQTB 3S36X 5E95B 4X6EB 4E0RB 2AEIT 4LEXL 2LFGA 3HZKB 4G7VL 4RSVA 1J1OH 2ZUYA 2Q8AL 1MEXL 1SY6H 2CPCA 1Q38A 4XVTL 5E8EB 1KF9B 1X5ZA 3TCXA 1NUNB 1DQDL 4F58H 2XIDA 2IPKA 1FNEB 3QUXD 2QEJA 5FK9B 1YEIH 3KYMB 1ZTXH 1UZ6F 4GMSL 2JIXD 2J7LA 4XCEB 5EFIA 3W5MA 1NL0L 1HXYA 4EZMA 3MACH 4KQ3H 3DO7A 4M00A 3WS6A 3U0TB 4OI7A 1OAZL 3LMJL 4CDGC 5FF6A 5EOCJ 2BOCB 2A83A 2WLYA 1FZJB 1CGUA 1FVCA 1Z9OA