1WBZB

Crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN PREC
publication title Crystal Structures of Murine Mhc Class I H-2 D(B) and K(B) Molecules in Complex with Ctl Epitopes from Influenza a Virus: Implications for Tcr Repertoire Selection and Immunodominance
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 17
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wbzB00
4EIGB 5C0RL 4LQFL 3W2DL 2G5RA 1OP9A 2V2TA 5EU6E 2AK4A 3PWLA 3L3JA 3SQOL 3RHWK 1JV5A 3K8KA 3QUXD 1AGEA 4D9LH 5D1ZA 2DICA 5ISZD 1ZT1A 2ZSVA 3NTCH 4ZO8A 5ECJE 1P1ZB 1NANI 4M4RA 3DETC 4MNHA 2GJ6B 2X4NA 3TLRA 5C6TL 3L3OA 4MAYA 1LE5B 1DBAL 2XTJC 1XF3A 5I1JL 3T8XA 1I9IL 3P73A 5EU3B 2AJUH 2RFXA 5BRZD 5ACLA 1A8JH 1FDLL 1FBIL 3GIZL 4NC1E 2YA2A 4UU9B 1Z9OA 3V8CA 3CU1A 3VFGH 3C09B 4P2YA 1A3QA 2CDGA 5CBEB 3GMNB 4IRJD 4K2UH 5D7SH 1ZS8B 5J1TC 4QHKJ 1BFOA 4M1CC 1VFOA 3VXRA 1EZVY 1KGCE 3OKKB 3VXSB 4HZAA 1TENA 1CE1H 4KQ4H 3RDTD 4ETQA 3DGCR 2W0FA 2XWTB 2DYPD 3LN5B 1FNGA 4HAGA 3ZE1E 2A6DA 1ADQA 4NBYB 4PJBE 1I9EA 3VH8G 3UPRB 2OZ4A 3HI6L 1ZHLB 4IMLB 4E5XB 1PG7L 1W0WA 1KNOA 2H1PH 1BF2A 2W0KA 5I16A 3SGKA 3V0VA 4QGTA 4XTRC 4XVUC 4Q58C 1N64H 1D5ZA 3O4LE 1Q9KB 4LNVA 5AZ2H 4DOHE 4OQTL 3P4OA 3ES6A 3HE7B 3FB8A 4PRHD 1ND0A 2H3NB 3UTPD 3P0YL 3U46B 5E2WH 1FAKT 1A6WH 2V9QA 4EJ1C 4XP9H 5DMKB 3UJJL 3O41A 5DEGB 3FONA 2APFA 2FSEB 3MCLH 1AKJB 4PJXF 4UAOB 2OK0L 5I1LB 1T1YA 4KVNH 4XBPB 4NKOB 5E5UB 4S11A 1H5BB 2I5YH 5I1DB 2VISA 5D5MF 4OB5L 2X5PA 3EYSH 4MJIE 4K7FA 4BZ2H 2K3TA 2A74B 4J3SA 5EU7E 4LPXA 5JOFA 2FX8H 3UYPA 1QLRA 1XGUB 2ZNXA 1BQLL 2J1KA 4A6YB 4NJAL 4HXAH 5FM4A 2I07B 4ZSOB 1T22A 5DVOA 5TGBB 3RVUC 2X4UA 4KTYA 5L2KB 2I9TB 4WI7A 4XNMA 5T33H 2DM7A 3HLAB 3PWJA 3VRLF 1Y0LA 1MI5A 2NY4C 3HMWL 2IALA 4HBQA 5HD8D 3KPQB 1T4KA 3MRJA 1CD1A 4P3CH 4AIXA 4WV1B 4MDIB 4Y1AE 4GS7B 4TTDD 3NIGE 4M6NH 4W4NA 4ODHH 4I77L 5IHUL 4DFIA 4XCEA 3CK0H 5DD5H 2GT9A 3BI9X 3F7YB 3QDMA 2BJMH 3T08A 1F4WL 2VTFA 3UJIH 3WUWA 2VH5L 4NQDA 3UDWC 1YEDB 2EXWC 4PJCA 3PQYB 3IFOA 1S9VA 2XKNA 5IR1B 1JF1A 1WIUA 4AJ0A 1G7HA 1UM5L 5FUCC 5JPNA 5DURB 2XICA 4HS3B 4AENA 5TQ2L 4JY6B 1X4ZA 4FQXB 1A3LH 3SEPA 5KVDL 4U6TA 3I84A 3BN3B 1DEDA 3NPZB 1F97A 3HPLA 2A77H 5DC9B 1NDGB 1Y18A 3ARZA 1P7QD 1R5IA 4PJ8C 3UJTL 3JWOL 5ESVA 4AT6A 3IXAA 2PTVA 5DJDA 1G7LB 5IB3B 1YZZA 1C5DB 3BE1L 3RNKA 3UTOA 3OXRA 4KMQA 3VU2A 1H15A 5ESAB 2BOBB 1CICD 1G7QA 5DC0A 2F54B 4PG2C 2WIIA 1L0YA 3VWJD 3QJHB 3BGFC 1E4WH 4OCMC 5GGRA 1CE6A 4QO1A 2YA0A 3UEZA 2JB6B 4DTGL 1HHHA 5EOTB 4AEHH 3BESR 4HMCA 4EQ2A 3ARQA 4Y5VC 4JDVA 4ZUVB 2J8UA 1LO3H 3KPRB 3M17A 3FL7A 3CFCH 1MCCA 2DQDL 5ILTH 4KPHL 1H3UA 3O8XD 3VXQA 1QVOA 3SE9H 2GSIA 2OL3H 4LSUH 5E8DH 2HLAA 5TDOB 4PJHE 3LZFL 2V2TB 5IHLB 2AK4B 2CLZA 3L3JB 3R4DA 1X9QA 4PRPA 4APQB 3V6OE 1JV5B 1ZVHA 5JW4N 1AGEB 4JO4H 4R26H 5D1ZB 1ZT1B 4K71B 2V2WA 4N8CH 4O02H 2UY6A 4LNRB 5D7IF 1FGNL 2XY1A 3KJ6L 1J8KA 3TGXA 1KIQA 1LILA 4JFDE 2X4NB 2F58H 3MUY1 2D7TL 5GZOD 4F7CA 2I25N 1CDBA 2QQNH 4L9LB 1WCBA 1XF3B 3T8XB 4RQQB 3P73B 4X7FC 3AS1A 2RFXB 4D9RD 5CGYC 4UOW0 1U8JA 3P4LA 1CXIA 1V3MA 1CG9A 3I2CH 1P9MA 3TYGH 3N1PC 1UH3A 5E2JA 4Y19E 1KEMH 5EOCH 3MODL 1FNSH 1PKOA 4OLUH 1YEKL 5GZND 4I1NB 5IBLC 2R1WA 1BFOB 3LSOA 4G3YH 2A9NL 2NNAA 1BVZA 3K2MC 3VXRB 3G9VA 2MQ0A 3V4PH 5JQ6L 1YY8A 3AROA 1T2QL 4ETQB 3QG6A 3LAFA 3K2UH 5TF1L 5D9SA 2A6DB 4PJEA 5HGDA 2BSRB 4JQVA 2A9ML 1JHKL 5LJYH 4EN3A 1KNOB 4S0SD 2R29H 5I16B 4F7MA 4LVNC 1AIFA 1IEAA 2O5YH 3SE4C 2F19H 3V0VB 4PRID 3UTSA 3UP1A 2Z8RA 1QBBA 3OR7A 3VFMB 1D5ZB 3GMQA 4NZDA 1VEPA 4N0CD 2LU4A 4WEBL 5C0CB 3P4OB 4ZFOA 1N6QL 1CFVH 1FAIH 3U9UA 4Q7DA 2PYFA 3FB8B 1DJSA 5J8OA 1ND0B 4RGMC 2AQ1A 1A7QH 2GJZA 4XNUH 4GG6A 4P4KD 4OGAD 3OG4B 1RZKC 3H42H 3O41B 3FONB 5CD3A 4R8WH 4GAJL 4TQEH 3I50L 3MUHL 4V2BA 4Y2DA 2C1OA 2EYTA 1TZGL 3ULUL 1T1YB 2AXHA 3AC0A 1A4KB 3K8LA 3DX9A 1WT5C 2XI9A 3MACL 3SDDB 2DMKA 2VISB 1IKFL 2QEJA 2BY1A 4URTB 3TN0C 4WFED 4K7FB 4IDJL 5HYFA 2R4SH 3TO2A 5IEKA 2ZP0T 5FK9A 5ENWA 3QIWD 1TJGL 5EU5B 1QLRB 4NN7C 2OP4L 4I2XE 4UOJA 2DI8A 4PGJA 3GBMH 3ULUE 1VFAA 3LQZA 1I9JL 3OJDA 1T22B 5C0AE 2X4UB 2RQ8A 3WJLC 4MJ5A 4XNMB 3N85H 4FQIH 5ANMB 4DGIH 3PWJB 3T0DA 2YRLA 1D5BA 1Y0LB 1MI5B 3QUYD 1I4FA 4ALAH 4I3GA 1W8OA 5F7DB 4M02A 1T4KB 2ZNWA 4PJ7A 5FO9A 2HH0L 1CD1B 1I85C 5KVEL 3HB3D 4LKCA 3BEVB 4YXLL 3IKCA 5C0NC 5KSVB 1RULH 4GKZA 1YMHA 3A6CH 1V05A 4XCEB 2ZKHH 1I75A 2WW8A 2GT9B 1X5FA 3LPFA 3BSZH 4JPWH 4BUGA 3X12B 3QDMB 1F2QA 4HLZH 4OGZA 3WUWB 4LLAA 4NQDB 3NCJL 1NFIA 12E8L 4PJCB 4TSBH 3IFOB 3PGFL 2XKNB 4Y8AA 1JF1B 3VFTA 4KUZL 1HZHH 5JPNB 2V17L 3KG5A 3RZCA 4AENB 4NGHL 5GS1C 3U7WH 3HNVL 1MSPA 5FIEA 4GSDL 3BRGC 2IG2L 4OF3A 5J9PA 3FRPA 3KXFD 3HPLB 5CJBA 3LD8B 5GGTA 1OAQH 5ESVB 3PWUA 3IXAB 5DJDB 4Y4KD 3UPAA 5J4MA 4RWHA 3RNKB 2SEBA 3OXRB 3S37L 1H15B 3UBXI 1G7QB 5DI8B 4PLOB 2WIIB 3RGVD 1TITA 4QTHA 1F6FB 2DLGA 2FX9H 2DWEA 5GGRB 1CE6B 2AJZB 4XI5C 3U83A 1HHHB 1QSED 1FVEB 2CIIA 4OF0A 3DIFB 1Y6MR 2EDWA 3DGGA 4JDVB 1CZ8H 1C1EH 2J8UB 3S88H 4FP8H 1NCAL 4GXUM 4OLWH 3GBNH 3U2SA 3ZE0E 3U0WH 2AK1L 3GHEL 4IOFC 1BQSA 3VXQB 1QVOB 1GGIH 2ZCHL 5GGQL 3REVA 2GSIB 1FNAA 5CP3A 3P40A 4POZC 1IGFH 2HLAB 4PJ5E 1NCBL 1FSKB 3QUZB 5GSRA 1V3JA 2B1AL 1OL0A 2CLZB 1AI1L 4DWHA 2IFFH 1EK3A 4PRPB 2GKIA 2D7QA 2ENYA 3JWDC 4HUWA 5D72H 2DLTA 2V2WB 3T3MF 1S7SB 5JHDE 3T4AA 5D2LA 3RI5F 4L4VA 1KIQB 1I1AC 2CRMA 3WV0A 4X7TB 1CCZA 4UTBH 5DK2A 4F7CB 2ARWA 4K94L 5LCVH 2QR0A 1WCBB 4KRLB 3OAUH 5EFIA 3SDCA 4PGBA 3P0GB 3QNZA 1B3JA 2R0ZH 1PG7X 3OXSA 1R24A 1U8JB 4XNZC 3V0WL 4NKIH 5DJ8A 4E41D 4E9LA 3P4NB 2E9JA 3UZVB 2AERT 1XIWC 2BY3A 4FQJH 2EDDA 2R1WB 3LSOB 2NNAB 4WW2F 4KDVA 1YY8B 2BRQA 5I17B 3QG6B 3LH2L 4PREA 4DCQA 4ZQKA 5D9SB 4LEXH 4KMLB 1C8PA 1UWGL 5HGDB 4NJ9L 4H1LH 3CDCA 5JDSA 4EN3B 2PYEE 2YZ1A 4HIXH 3HNTL 4F7MB 4HKJB 1IEAB 2ADIA 3QI9C 1NCWL 3MV9E 3OJMB 2HT2C 4GBXD 3ARRA 3VWKC 5I8EB 3UTSB 4K3DL 3OR7B 1GIGH 3WNLA 3GMQB 3IU4H 3EOYG 1KIUA 3IDYC 3BW9A 1BJ1H 4CVZA 3NH7L 2DQHL 3WO4C 4V1DE 3U9UB 2DRUA 5HVHC 3D0VA 2PYFB 3QPXL 5IOPA 3M8OH 3MNWA 4HBCH 3BKYL 4JFEE 2AEQL 3H3PH 4UB0H 4LLVA 1DR9A 1OW0C 4GG6B 5ETUA 2VAJA 1RUPL 4RX4A 4Q9QL 1EHLL 4CKVX 5CD3B 3N1GC 3FOLA 1MHHA 1MY5A 3NIGF 4GMTL 4Y2DB 2C1OB 2EYTB 5HYJE 3UC0L 2OXHA 3DX9B 1IM9A 2GUOA 3WNPA 4QHNA 4J6RH 1QTYT 1DUYA 2WWKO 1WV7T 4R9HA 4JM4H 1R3KA 3G9AB 1LO4L 5IEKB 5FK9B 5E2VH 5ENWB 5F7LB 1C12B 5GGVY 2BFVH 4C83A 3SKOA 4WEUD 1RPQA 2BVPA 4KKNA 1JNJA 1MJ8L 3LQZB 1MCPH 3OJDB 3C87A 3LY6A 4XAKE 4MXQD 4R7NA 3KYNA 4MJ5B 1WZ1L 1U58A 3S7GA 5FM8A 4HS8L 5SV3A 1QLFA 2QV2A 3PDDA 3LOWA 1PKQE 4ZTOH 1YEJL 2JB5L 2JCCE 4PJ7B 5FO9B 3D2UA 2AGJL 4N0YH 4LKCB 4OLVH 5L0QB 4OFDA 3MLUH 5EOCJ 3IKCB 4YEEA 1SBSL 2YPVL 4L8SB 3TH3T 5EPMB 1NJ9A 3EUUA 4WO4D 3UROR 4DQOL 1A7PH 4CMHB 3MLZL 4UINL 2R2HA 1ZWIA 4XP4H 5BVPL 3IDXL 1WIOA 3BKJL 1DBJH 4PV9A 2BMKB 4NZUL 2I60H 2CH8A 2W65A 3SGEI 3VFTB 4H5SA 3RZCB 1T3FA 4G7VL 5DFWH 3ZSTA 1U91A 4NCC2 1PG7W 4BELD 4ZUUB 1IFHH 5D8JH 1OSZB 4LSVL 5J9PB 2VC2L 4M43L 1DBML 4U1IA 2K1MA 2P5WD 3F58L 3C09C 1YEIH 4WWKB 2HP4A 2X05A 2XZQH 5E9DD 1KJ2A 2X6MA 3SDAD 3ARPA 4FRWA 4Y4FA 4N1HB 4XVJL 5F8RC 4PY8J 1RSFA 3PV6A 3B5GA 4Y16D 4JR9H 4QTHB 5EUKA 1DANU 4ZYKA 1E6OH 4XRCB 4FMKA 3E6FB 1C7SA 3MR9A 4R96A 2EEBA 2YMXH 2EYRB 1UWXK 2NY3D 3EYVA 4GAFB 3DGGB 4YK4B 4JFHD 2UZYB 3AREA 4KJPC 4Q0XL 3U2SB 4UT9L 4YDVA 2YD7A 2Z31C 3VXOA 4KRNA 2HKHH 1F2XK 5T1DH 4WWID 4M4PA 4HXBH 3O3AA 4TRPH 5GSRB 1GC1H 2FIKA 4LAQH 1KJ3L 4RMWA 1P4BH 2C4FT 2UWEE 4EDWH 4OIIL 5F89B 2DKMA 3BD4A 4PFEA 2NY1D 5FM5M 2Q86A 3O6FB 5D2LB 3M1BB 1INDL 2NY0B 4L4VB 5DHYB 1KN4L 3VGBA 4U1JA 4MQTB 1A0QH 1JP5A 1T89C 4OT1L 4UAOC 4Z95H 4EVNA 1M4KA 5DK2B 4LPWA 1N3NA 1E4XI 3JWOH 3SDCB 1FYHB 3OL2A 4WU7A 3QNZB 4XPGH 5E00A 4QY8A 4R4ND 1Q72L 3OXSB 1R24B 1AJ7H 1BGXL 2K7PA 5DJ8B 2YXMA 1J1PL 1YN7A 3F62A 4OCXH 3LRSA 3NIFE 3UTTE 4M7LT 1MWAL 1J8HE 5LXGH 4KZDL 1OCWL 4KDWA 2JK5A 4Y2OA 5J6HA 1H3WM 5GS3A 2YWYA 5KAQG 3BKML 1KTLA 1P84J 4Y5XA 4NWUH 5I6XB 3V4UH 3GMRA 1TTFA 3DX8B 3BD5A 1EH9A 4AL8H 2LVEA 4PREB 4DCQB 4ZQKB 4I48B 3OF6A 4Z7VA 5JDSB 4X8JA 3AU1A 1CFBA 4OFYA 4NO5A 4LHJB 1TDQA 2C3XA 2ATPA 5GXBB 4GRWF 4GS7C 1QOKA 3NCYS 2CGRL 4TTGA 4MJ2A 4XXCC 3RTQD 1VEMA 3S35L 3BQUD 3BW9B 1H9VA 4XCFH 5KSUA 4J3TA 4CVZB 4NQCE 4DEPC 3KJ6H 5I1IH 3D0VB 1X5JA 4YC2C 1BD2A 3MNWB 1YDPA 3DUHA 4LLVB 4FQXC 5ETUB 4KVCL 2VXQH 3ROLA 5HGGS 3SGJA 5FO8A 5L2JA 3DVNA 2IH3A 4XMLH 3T2NL 5DHVA 1MHHB 4LCWD 1NLDL 1NFDF 1WZMA 2BHYA 2OR8A 5GRVK 5D1XA 1UZ6E 2IH1B 1ZLWK 1JTTA 1IM9B 2GUOB 2ZUWA 3FQXA 4M62L 4QHNB 1DUYB 4YAQA 1MAML 2EDFA 1AGFA 1K6QH 1R3KB 3CXHK 4LPCA 5C0DA 1T1WA 1BWMA 4EUPB 2KUTA 4HUVB 4C83B 3SKOB 1DFBH 4G7YH 5IW3A 4I13B 4FZEL 1I1YA 3C2AL 4S2SA 5MEQA 5BW7A 4R7NB 3KYNB 1U2HA 5I0DA 1QBMH 1CWVA 2Z4QB 1QLFB 2F5BH 4JZJA 5GJSH 1LO0H 4WI8A 5KAQF 1IILE 1NC2B 4J4PC 4K07A 3D2UB 1EAJA 1F8TL 3NFPA 2E27H 4YUEL 5F7FA 1MCKA 1X4YA 1FNHA 5CWSB 4JQXC 4APQC 3WJJC 1NJ9B 1ONQA 2ESVE 2ID5A 1MCWW 4K71C 5KJRH 2R2HB 2DQUH 2NXYD 2ZCKH 5LGHL 1ZWIB 5GGVH 1WBXA 2R4RH 3SOBH 5FKAA 5EG6C 1WEJH 5L9DL 4K3EL 4DW2H 1J10A 5D6DC 1IGTA 4H5SB 5HDQL 4DK6A 3BP7A 4L9LC 4PTUB 3A67L 5JZ7D 4WI9A 4NZRL 5L8LB 1U91B 3IFNL 2VLRE 5F71A 4KZEL 5C08E 3B83A 4RGNC 2VSCA 3GSNH 35C8H 3I3BA 2KQMA 1MFEL 4PJXA 4C56E 4FQ1L 4PRBA 1EAPA 4KI5E 5T5FL 4H0HB 1S9KC 3SO3B 1M71A 3ARGC 5EUOE 1KJ2B 5AZEH 4G5ZH 1EFQA 5IJKA 1LK2A 4Y4FB 3RU8H 1ITBB 4HIIB 1PY9A 4NNPH 5D5MA 3U4BL 1FLTX 2X4TA 3PV6B 1BBDH 1NGQL 4U0QB 3QHFH 1G9NH 4LLYA 4F37F 1K8DA 4ZYKB 4L4JA 2W07A 2YKLL 2MCPH 4OLZH 5KOMC 5F1OB 2AJVH 3MR9B 4BSWA 4R96B 1F00I 1JN6A 2VDML 4X4MA 1PW3A 3MJ9H 1OD7A 3EYVB 3EFDH 2E6JA 3CJJA 5E94A 3UCRA 4FTVD 1J05A 3QH3A 4RWYH 3VG9B 3X17A 3FO1A 3VXOB 1MIML 3BZFA 4R4FH 4J2XA 4ZS7L 4HH9B 2DI9A 2GK0A 2FIKB 3LQAL 3L5HA 1BFVH 1T83A 3BXNA 4K8RL 4OJFL 2P5ED 4WCYL 3VH8A 5TQ0H 3U36A 4D9QD 3MRKA 2B7DT 1CF8L 2Q86B 3DURA 4JFFB 2WLZA 2HFFA 3HG1A 5FB8A 1O0VA 3ARFD 4M8QA 5HHMB 1I1RA 4U1JB 1JGUL 4IEFB 4MD4A 1HKLL 4XBEL 4EVNB 1KTKE 2BVEA 1A14L 4NKQB 1N3NB 3WFEL 1WTGT 3HE6C 1OM3L 1P69B 3GSRA 4LIQL 4WU7B 3SDDC 5E00B 2Q3AA 3C5JB 4QY8B 3ARUA 4Z0XA 4FFZL 1QPXA 4JFZL 1K8IB 1CGYA 1YN7B 3RIFF 4NIKB 3QT2A 4PS4H 5F7KC 2GYSA 2BX5A 2Z92A 1S7QA 4WDIA 5J89A 5J6HB 4Y89A 1BM3H 1CFTA 3OZ9L 1KTLB 4Y5XB 3VMOA 5ABDE 3GMRB 3C5ZB 2VABB 4LIQE 4G80B 2OQJA 1U2CA 4TNVF 1UCBH 4QGYA 3TYFB 2EDYA 3K4AA 4WI4A 5IVXE 5K59F 1W72B 4Z7VB 5IMOA 3SE3C 3EDJA 4IMKC 4X8JB 3X13A 2ATPB 4CW1A 1QSVA 4PRIB 1CS6A 1KC5H 3MOBL 1B6UA 3RJDA 4FA8A 3BT2L 1AE6L 4LSSH 2HTLC 3T3PF 3CCHA 3B3IA 1B2WL 4BSVB 4FQLH 4QRRD 4YDKL 2DJSA 1AFVL 2XOTA 2DDQL 2WWKT 4CADA 1I3GH 1BD2B 1AHWB 1E4KA 5CJXC 5HHNA 3TESA 1NBVL 3ROLB 2NR6D 5FO8B 5E95B 3V52H 5D7IA 3CD4A 4X80L 3DVNB 2IH3B 5DEFA 1IEHA 5DHVB 5FGBA 4RA0C 3O2DH 4JDTH 2V5SA 3LD8C 3U4AA 2YEZA 5IM7B 5BV7B 1MCRA 5D1XB 2EDQA 1G6RA 1JWMB 1EGJL 2VLME 1ZHKA 3T0EE 3FQXB 1XR8A 4EI5A 3X3GH 1S5IL 4YAQB 2E3VA 1AGFB 1BLNA 4XPHH 5DMIH 5EZLA 1GGCH 4Z7OE 1C08A 4Q97A 2ZUTA 5BMFH 4HGMA 5C0DB 1T1WB 3DRQA 3A0OA 1II4E 4I3SH 3E2HC 5C0FB 3KYAA 1DN2A 1RJLA 4BQBA 3QDGA 4FG6C 4LEOA 3T0WA 4HWBH 1MCOH 1I1YB 4S2SB 5MEQB 3I02A 4P9MH 1G0DA 1IEBB 3QUYB 4OV5A 1JBJA 4PLJC 2ITDB 5D7LA 3B8YA 3QDHA 4JZJB 1MCIA 1FCGA 3SN6N 5CFHA 3NFPB 4MB3A 3WKNA 3IT8D 4LCYB 3QUZC 4PP2A 4EQ3A 1MNUH 3QDJE 1RUAL 4JO3H 1UM4H 3H9SE 4Y8DC 4HG4K 4K7PY 1ONQB 4HIJA 4AIZA 4FQ2L 3SJVE 5HHOA 3RWDA 1NC4A 3JTSA 5KW9H 4R97B 1WBXB 3GJFK 1KENH 4TVPH 5FKAB 2X44D 5IBUB 5SWZD 3MXVL 5DK3A 1IGTB 5FUZL 3DVFA 3BP7B 1MRFL 1R3IH 2EC9U 2WNGA 3QEGH 2HT4D 4Z7UB 4PJXB 5MENA 4PRBB 4MZ3A 1EAPB 4NCDA 5F7NC 1YMME 3X11A 1M71B 1B4JL 4ENED 2W9EH 1AXTH 1LK2B 1OAKL 1BPVA 5D5MB 3WD5L 5D7KD 1A7OL 1TIUA 3VDAA 1RU9H 5I71C 3LN9A 3S96B 1K8DB 3D48R 5DQDL 1ZLUK 4BSWB 4KHXH 3WFHA 1XF4A 3PP3K 1WFNA 3FQTB 2NLJB 3BWAA 2HTKD 1MJ7H 1T04A 1LP9E 5IB5A 5ALCH 1QSFA 3FT4A 3NIFF 2LVCA 2ORBH 4RCAA 1A7NH 1DE4A 1J05B 1WLHA 4LHUD 3QH3B 4MCZA 4JKMA 3VRIA 3RWCB 3LEYH 4NZJA 3FO1B 2JJTA 3BZFB 3QNXA 4Z0BH 1PJ9A 5DMJB 4N9GB 2E8ZA 3HZYA 3RY6A 2A0LC 2GK0B 4LLMA 5IMMA 4ONFH 3O2VL 1F3RB 4F15B 3IDNA 3VH8B 3CGTA 3U36B 4UV7H 3MRKB 5DJYA 5JW4M 4TUJB 4PLKD 4GRMA 5D2NE 3DURB 4JRXA 2HFFB 3HG1B 1OSPL 3D3VE 4GW1A 4M8QB 4UILH 2FBJL 4Y2DC 4JN1H 1EMTH 5MEPB 3F58H 4I0PC 2VDNL 4OLXL 3L3IB 4HULB 2QHLA 2Q7NA 2WBJD 3KYKL 4WI5A 1GGTA 3GSRB 2CLVA 3MRHA 3O81A 4LRNL 4Z0XB 3MV7D 3ZL4L 2M8XA 5EU6A 3DX7B 5E5RB 4JVPA 4QHLA 3CVHH 3NCFB 1EO8H 1JZ5A 3FO0L 2Z92B 1S7QB 5DR5L 4WDIB 2EIEA 5GJTL 5T1LA 1FN4A 4GW4A 5C0GA 2A83A 1F90H 1O7VA 1NCCL 3CVIH 5F44A 1KLGA 4OCLC 3S35X 3QCVH 1OAYL 4J3OC 5LVEA 2DB8A 4S0TD 5CIPH 4YX2H 2R2CA 2OQJB 4L3EA 4LLUB 4YXHH 4P3DA 1SYSA 4J3WA 5E99L 4XMPL 1JPTL 1HSBA 2J6EA 3CDGA 1S7UA 5IMOB 3SE8L 3MC0A 1PFCA 5GGSY 1CN4A 1WQVT 3C60C 5SX4H 1QFWL 1BECA 3FB5A 5DUPL 4CW1B 3VD9A 3MXWL 3V5KA 3D39E 4BSJA 1H3GA 4L8SC 3VXUA 4DKFL 2D3VA 4I9WE 1I3UA 2JTDA 3CLEL 4ZFFA 3CCHB 1OGAB 1WFUA 3B3IB 1SEBA 3OKEA 3VG0L 1CDYA 4OFPA 1NGYB 2HRPH 1OY3B 2DIJA 4PYGA 1KN4H 5HHVH 1IQDA 3SDYH 3ZDXF 4LP5A 4X5XA 3RVTC 3QUKA 4JFPB 4XGZA 3CFBA 5F96L 1NGWB 1KULA 5EBLA 2FX7L 2IMMA 5D7IB 2VLKE 1AO7D 5DEFB 2IANE 4HUNB 2YEZB 2PTTA 4WWKC 3OHXA 1EXUA 3O4LA 1G6RB 3N06B 4KZDH 4N0FA 4EI5B 1XR8B 1DQLH 1UFUA 2J88H 1BLNB 1UZ8A 1C08B 3HI1A 5ITFB 2ICES 3MFFA 3DRQB 1CLYH 2Y7QA 4V1DD 4U7SA 1UENA 3S36L 5KSBE 5L6YH 2P8LA 4HEME 2VAAA 4LEOB 2Y72A 3TH2T 5I74B 3MROA 3FCTA 4JDZA 4QRPB 4WW2A 3FT3B 1NUGA 3R1GL 3HMXA 5BJTB 3I02B 4OQTA 5IK3A 3TVMB 3EJYC 3V7MA 5JXEC 1RAMA 1KB5H 4FABH 3P11H 3SQBA 1FZKA 5D7LB 2CGRH 3GZKA 5DYOA 2NW2B 5HYJD 4UDUB 1X5HA 5FYJH 5FO7A 5JMRA 7FABL 1AR1D 1CTOA 2YD4A 2X4OA 5K9QG 4O4YH 3QUXC 4PP2B 2WIMA 1OP5H 4GLRI 4X4XA 4Z8FH 2AJXH 2CUMA 4HIJB 1JK8A 4KTEH 4TVPD 3NZHL 2VXVL 5HHOB 4MA7H 4WIQA 1LWRA 3RWDB 4POYA 1NC4B 1YEHL 2APVA 3JTSB 4LVHC 3O6FC 4WW1A 1UQSA 3D18B 4G42A 3K4ZA 4Y88A 4LSTL 4AM0A 4PJDE 1Z9SA 2EDKA 3MJ8B 1S7VA 5D70H 3MLWL 4Z6AT 1IVLA 2FATL 5BXFA 3K80A 4MA8H 3HR5A 4Y1AA 4GO6B 4EIZC 4IRJC 3DXAE 1MRDL 1MFNA 3KDMB 3X11B 5FUOH 1BQUA 1PY4A 1DN0A 1WF5A 5KS9E 3SDXF 2AXJA 1QO3A 3RX8A 3Q5TA 1JI1A 2OR9L 2YC1A 4OCRH 1MFDL 1S7TB 3B9KB 3FFCA 4K7PH 2YK1H 4JQIH 3NAAL 3ZE2E 1K4CA 4HKZA 4D0DA 1XF4B 2CRIA 5KTEL 4NBXB 3WHXB 3BWAB 4KK5D 1T04B 5IB5B 3TEUA 3FT4B 3FFDA 5AG9A 1YYML 3G6DH 4L4TD 4N0RA 1DE4B 4PGZA 1K4DA 3ZDYE 2EH8H 4MCZB 2FIRT 3VRIB 2W9DH 2H6PA 4KV5F 2CMRL 4QYOA 4JHAL 5D93C 1A6VL 3MLXL 3QNXB 2X9WA 5DHXB 1ZLVH 1V3KA 3BH8A 1J7VR 4NWTH 2O5ZL 3PHOA 4LLMB 2VWEE 5IMMB 1JYWA 3QO0B 5JA9A 2ICWJ 4NQSA 4XVUD 3OKLB 3IDNB 5E2UH 3RA7H 4ODBD 5DD1H 3ZKSD 4R2GB 1YQVH 3LS5L 5DJYB 4EEEA 4GRMB 4WTZG 3ZDZF 3GSUA 4K3JH 3U0PA 4S1SL 4OGXL 4NM8H 4HIHB 3Q5YA 4GW1B 4OGYL 3WFCH 5IB1A 1C5CH 3T0AA 1FL6A 3OAZH 2GY5A 1MPAL 1D5IH 2PW2A 1CLZH 2CLVB 4WHCA 1MEXH 5EU6B 4QHLB 3MGAA 3FRUA 3V6OA 5T1LB 1FN4B 4GW4B 5C0GB 2A83B 4KI1A 2FEDD 1RIVL 1KLGB 1U8QA 3ZKXB 4M7KL 1RZ8B 3MLYL 1XT5A 3MRNA 2DLHA 4JFDA 3JUYA 4J23A 5AAWA 1T7YA 3TA3A 4P3DB 1SYSB 4QOKA 5HD8C 1HSBB 3CDGB 1S7UB 1RI8A 4UT7H 4MVBD 3H3BC 2R69H 2BHZA 4JJ5A 3RWEB 4WI6A 4PB9H 4TTDC 3RVUD 3PIQA 1EUUA 1D6VH 4I5BA 2XA8H 5C71A 3V5KB 1S5HA 1NL0L 4Y19A 3VXMD 4NP4H 2A6KA 4YDJA 4ZFFB 2A38A 1I3RA 1SEBB 3HC4L 3OKEB 1ZHBA 1KB9J 5EA0L 3H7BA 4QTIH 5TE7H 1IQDB 2Z35B 2L0DA 4R4BA 4OLYL 4X5XB 4PJBB 2R0KH 2WSKA 3HI5L 3QUKB 3VXRE 1A3RL 3CFBB 5EBLB 4HUMB 1BOGA 1A6TA 5C07D 3SKJH 1HE7A 4WTWA 3BFOA 3L9RA 2PTTB 1OB1A 3OHXB 1EXUB 1G7PA 3O4LB 3T65A 1CICC 2F53E 3C2SA 4Y0GA 5ISZA 4DOHB 2FZ3B 2D03H 3VWJC 1UZ8B 2D9CA 3WIIH 2DMBA 5EBWB 3HI1B 3HHRB 2VERN 2LAGB 3KPMB 3MFFB 5GRYA 2Y7QB 2EEAA 4UMGA 2OSLA 2P8LB 5B22A 2VAAB 5KVFH 3MROB 3FCTB 3QXVA 4WW2B 3L1OH 1X7QA 5IK3B 2VZSA 4JM2D 1C5BL 3O8XC 1YC7A 4W6WB 4QXGH 5FYJD 2EE9A 5DWUH 3V5DA 3OMZA 5F9WB 5I73B 5DYOB 5EN2A 4ONHB 3G5VA 5CMAB 1G6VK 1J86A 4WFHE 4MJIB 3FO9B 2X4OB 1JGVL 2PR4L 4DUVA 3ULVH 3MMEB 2YD5A 5CEXA 3RDTA 1UA6L 4X4XB 3DX6A 3NCBB 5EIIA 4I2XA 1W0VA 1EEZB 1KIPA 2BDNH 4X83A 5C0AA 2X89A 4WW1B 1UQSB 4PJGE 3QZWG 1F3JA 4DK3A 4G42B 5GZOC 2RAMA 4X80H 3VA2C 3LKOB 4AM0B 4ODVL 1S7VB 4P5TD 4QNPE 3MV8D 1Z9LA 5BO1H 3WXVL 2DBLH 1H3XA 5JDJA 1YY9D 2EICA 3FTGA 2FHFA 3HR5B 4H25A 4X9BA 4ZXBD 4Y1AB 1WC7A 2AEWA 1MIEL 1UACH 4FFYH 1UC6A 1MAJA 5GZNC 5EZJA 5EWIL 3F6LA 3TIDA 1DN0B 2WUBH 4JFYA 2EDBA 2JJSC 4KRMB 1TJIH 1SJVA 2DQGH 5CSBA 1H0DA 1J5OH 2YOCA 2YC1B 3C5ZC 4YHOH 3V6BR 4NRYB 1U42A 1U95A 1K4CB 4HKZB 3LMJL 3QUML 1RIHH 3WFZA 5IROC 1UGNA 5DUMH 2KZWA 3ETBF 3DSNA 5AYQA 2XZCL 1LDSA 3NCMA 3ET9F 1TNMA 1SYVA 1XGRB 3FFDB 4JCMA 3DBXA 4N0CC 1K4DB 4J3XA 1UXWB 2H6PB 4RFOH 4WRLA 4QYOB 1P6AB 3TZVD 2OJEB 3BGAA 4JKPH 2CSPA 3BH8B 3IDJA 3PHOB 4F58L 3RJQB 1AHWC 3MXVH 3VFOA 4EDXA 5IEHB 4OZFG 3D25A 5HYIA 3ECBA 4LVEA 3Q6GL 5CILL 3U0PB 3GSUB 2X1QA 3BEWA 5CUSH 3BHBA 2X9YA 1J1XL 3CDFA 3IJSA 2J5LC 5IB1B 2ARJA 1M1SA 3M45A 1FL6B 1JJUA 3U9PL 1FORL 3VFVA 2XTJE 2PW2B 2IPUK 3BUTA 2R56H 4PJHB 3QIWC 4KUCD 5FCUH 2BRRL 3JUZA 4F9LA 2HKFH 2NY6B 5DJ6A 1XGYH 5LBSH 1RIUL 4OKVA 3GIVA 3PL6A 2HFGH 4O58L 1K85A 4XWGL 1EJOH 3DYOA 1T2JA 1U8QB 2GTZB 3GSWA 3TN0D 4CU7A 1FPTH 4Y4HA 3MRNB 3GMLB 1MELA 4TULL 4PRPE 1IC4H 4JFDB 5C7XH 4JN2A 3QUYC 3OPZL 2D0HA 5AYUL 2IAMA 3H6JA 2GEEA 4M48L 4QOKB 4UNTA 4PJAE 5L8JB 2XQBH 3VXTA 2QSTA 3HB3C 3EYUH 4JJ5B 4U6VL 3IJYA 1X5KA 5FGSA 1OARH 1DQTA 3C5SA 3RQ3A 3IF1A 5I2IA 1G7JB 1N4XL 2XQYG 3P77A 4MZ2A 1S5HB 2YD8A 2VLJE 1NBYA 1K3IA 4Y19B 4GRLA 3WEXB 3RFZC 5KSBF 2A6KB 2G60H 4YDJB 3BJLA 2B20A 1I3RB 2KBGA 3FQWA 4BQ8A 4ELME 4BH8A 3GDBA 2ILLA 1EDQA 1ZHBB 2BNQD 3KR3H 3ZTJG 2N7BA 1U8IB 1IC7L 3H7BB 5D7JD 5DJXA 4KROB 2XPGA 3WIHH 3MOQA 5EO9A 2FBJH 5DLML 4QRUB 3W11C 1I1FA 1WWAX 4HFUL 1T0MB 3S36X 2PYEA 4M7LL 4MB4A 1ZK9A 4UNUA 5FECA 1PGRB 2CXKA 4D3CH 1A6TB 1OTUD 2ED7A 4XT1C 4LRNH 4ZAKA 3MV9A 5L88H 4PJEE 4Y4KC 3L9RB 2X70B 1DDHB 3ARDB 1OB1B 4ZFOL 2UY7A 3BAEH 1G7PB 5GJTH 3T65B 4ODWB 5IJKC 3BO8A 3RGVC 1IGCL 1A64A 3TBTA 4TOYH 3SGDH 5I75C 4G9FD 4GAGL 1QFUH 4X7DC 4N8VB 5IFHL 2E7CA 3U7YL 4PJDF 3QEUA 1OAUL 4R7DB 2OSLB 4XMPH 3L3GA 1IAOB 2EZ0C 3FAWA 1X3DA 3TH4T 4F3FA 5MEOA 2VZVA 1N8ZA 3JV4A 4JZOB 8FABA 1BEYL 4F33B 4OCNC 4BJLA 1V7NL 1X7QB 2YA1A 3CC5A 3CFKA 4JAMA 2IBBA 5J7CC 3BDYL 4H20H 1JFQH 5ACZB 1CQKA 3H9HA 3RIAK 1P2CA 3MJ6A 5EN2B 4QHMB 4XI5D 3G5VB 3P30L 3ULVD 3F6IA 1TFHA 2W0LA 3U0TA 5MP6L 3VG0H 4NO3B 4LSQH 3U82B 3EYOB 4HSQA 4IRSB 1F4XL 1U3HB 1XR9A 4MJ4A 5TPWL 3ZE2F 1SM3L 1QA9A 3DX6B 5EIIB 2NX5E 4I2XB 1S78D 4F15C 4RISH 1W0VB 1KIPB 5C0AB 3EOTH 4ONGH 1FHGA 2DMCA 1F3JB 5J0BA 4I18C 4FZ8L 5F7EL 4ZFGL 1IC5L 1RFDL 3GO1L 1FE8L 4U0RB 5SWSA 1NMAH 3J8F7 3UYRL 4U7KA 1PKQA 4YDLC 5IB4A 5KSAA 3INUH 1M05B 1OD9A 1AP2B 2JCCA 2QQLH 3FTGB 1GZPB 1DCLA 4DGYH 3HAEG 4H25B 1WC7B 2LE9A 1A5FH 1I1AD 4LPUA 4HC1L 5EZJB 1IQWH 3I6LE 4LPTA 4JFYB 2MKLC 1H0DB 1FL3A 4P4KA 5K9QI 5LWYL 4DFHA 5BVJA 3MZTA 4HCRL 4P4RA 2IADA 5DDHA 1V8HA 4ERSL 4P2RD 1U95B 1AQKH 4DN3H 5IQ7H 5JXAL 4HZLA 3O4OC 5F6IB 3BZEA 3CXDH 1HEZB 5E6ZA 3NGBB 3VFWA 3LRHA 4JO2L 3PWPD 4GBXC 1SYVB 4YXKH 1CGSL 4QCIB 4A6YH 4OZ4A 3DBXB 5IB2A 2R0WH 5B8CB 2DF3A 3U79A 5E8PA 1X5LA 3IRPX 4U49A 4BZ1L 3L6FA 4N5ED 3BWUC 2ZUYA 3DMMA 3IDJB 5I1EL 4YHKL 1HIML 3AB0B 3B2VH 3VWKD 2EDEA 3EYFA 3MLWH 3VFOB 4YHZH 5HHXL 4D2NA 4EDXB 1E0OB 3D25B 1N7MH 1WSST 3ECBB 4G8GD 5DK0A 2N4IA 1A02N 3FN0L 4M5ZL 3BEWB 1EFXD 3BHBB 4IRZL 2NY2B 5DZOA 4ISVA 4S1DD 4ZO6A 5B3JE 4ZUTA 2CJUH 5GGRY 1IRAY 3MLVH 1QZ1A 5C9JA 2CD0A 3IU3A 5C86A 3GNMH 4X9IA 4YFDB 3VFVB 2W91A 4RGOL 4W68A 4PJ5B 5F97E 5C09D 2VDLL 5CZVL 4XXDA 4KAQL 5CJOL 1RUQL 2CLRA 1ZEAH 5DJ6B 4MNQD 1EO5A 3NMEA 4OKVB 3GIVB 3PL6B 3QFJD 5CP7A 4MXQC 2I26N 5I74C 1I3VA 5JHDB 4CRPA 3GSWB 4XPTH 4Y4HB 1Z3GH 4C54A 3TVMC 2D7PA 4JN2B 4LSPL 2Y07H 2IAMB 3KXFA 2UVEA 1A6UL 2X40A 5HGHA 3VXTB 1S9XA 1A6PA 5D2LE 5E6IA 2QSCH 5IGXL 5JIIA 3V2AR 3IJYB 4CBPA 4U6XA 2KDGA 2QBWA 2X10A 3QQ3A 3C5SB 5TDNA 1NLBL 2J4WL 5I2IB 4WO4C 3UTTA 3P77B 2IF7A 4ELKA 1YNTB 4GRLB 3KYMB 4LASL 2Z9TA 2N56A 4K9EC 1YC8A 2WBWB 3BJ91 3O2WL 4OCWH 4AMKL 3FQWB 1RZKL 3HC0A 4G6AC 4YHNB 4LARL 4N68A 3F7QA 1L7TH 4BQ6A 5A3ID 2YUXA 3H9YA 3NCYP 4IIQC 3CSYA 5I1CL 2HJFB 2MHAA 3ZKMC 1K5NA 5EO9B 3AY4A 1HOCA 2UZIL 1I1FB 4TSCH 2PCPA 4TPRH 2PYEB 1MWAA 4ZUWA 2CDFB 4ZAKB 3FQNA 1U8NA 3MCKA 3MV9B 3PXJA 5CEYA 2GJ6D 4J1UA 1S7XA 4ORZC 2VDPL 1QLEL 4KKAD 1RHHA 4Y16C 3DUSA 4PJGF 1OLLA 4NQCA 4R0LA 1VESA 4U1HA 3B9KC 5I19H 3WLWD 4JFEB 25C8H 4ZOBA 2NY3C 2DQIH 4G6ML 4WHYH 4F3FB 1ZGLA 5MEOB 1N8ZB 3JV4B 3STBA 4XPFH 8FABB 5J13B 3IYLW 1VKXA 3VXSD 3CC5B 4JAMB 5H35A 5HYJB 1NL0H 2DQFA 3H9HB 5D1QA 1P2CB 4KRPB 1RVFH 4PG9B 3C08H 3U0TB 2Q8BH 2Y36H 2R9HD 3B6SA 1ADQH 1U8OB 3VCLB 2D4FA 1MQKH 2OZ4H 5DD6A 1QA9B 1N6UA 4X6CE 5F9DC 3LEXA 2NY1C 2VSDA 1OLZA 4WFGE 4NUJA 4XVTH 2B8OT 1FCCA 4CAGA 3JVGA 5ITBL 3CZFA 4Q6YA 3HE7D 5T3ZL 4XHJC 5EB9A 4PV8A 3OGCA 1CXHA 4L8BB 5SWSB 5LAXA 5DA4A 2YPLE 1PKQB 5IB4B 5KSAB 2JCCB 1JHTB 2HT3D 5DJ2A 1KCKA 3VFRA 2CO7B 1GL4B 4MQXC 1AKJD 4J7RA 5FF6A 1P53A 2ESVA 5T3ZE 4XNYL 5HYSG 2CQVA 1HK6A 1INEL 3DROA 3WFBH 3ZKXC 3PE9A 2N1KA 3TWCH 4YDIL 1UYWH 4HDIA 1MUJA 2AABH 3KPNB 1M7DB 3HRZB 5DDHB 2XZAH 1FG9C 2X41A 4M1GH 5F70A 1FZOA 5GS0L 1PEWA 4HZLB 5E4EC 3BZEB 4JRYE 2VUYA 4KGJA 5C08A 4FXKB 2PTUA 2LQRA 3BP5A 1KPRB 5L2KD 1JWSB 3S3PA 3S6CA 1RURL 1U6AH 4C56A 4AG4L 1D9KA 1A1OA 3PP4L 5BQ7A 3JWDL 4TUKH 1IM3A 3BQUC 3B4NA 4Q2ZB 2JIXA 5E8PB 3G08A 4OTXH 1T03H 2RR3A 1ORQB 2AJSL 3DMMB 3DLQR 1QG3A 1OTSD 3PWVA 3P0VH 4I3RH 4PJAF 3GM0A 4HQQH 4KXZH 2ZOLA 3MLRL 1A9BB 1H3PH 1JPST 5FYLE 1QBLH 5CCKL 5I8OH 1FRGH 4XNQA 4ACPA 5DK0B 1J18A 1Z6JT 4NT6B 3K74B 3PQYD 4RAUA 4ZUTB 2CDEA 2VR4A 1OT1A 3BUYA 3LKPA 4ODTL 1S3KL 1XZ0B 5DURD 3IU3B 2D4DA 1OAXL 2MFNA 4FQXD 1MRCL 4ELMF 1NAML 5FV2A 1J0ZA 5IFAL 1VGEL 2MQ3A 2MMXA 4XXDB 4HUXA 1GGUA 3AVEA 3O6LL 2B1HL 2UWEB 2OYPA 2WUCH 5EZIL 1FNLA 2VXUH 4M6OL 5CP7B 1CBVH 3QAZC 4KY1L 3SDXA 3CFIC 3IAGC 2F54D 1DLFL 5EH1A 1D3CA 1VADA 1JNHA 4JO1L 1SBBA 4GXVH 1DVFD 4AEEA 5E6IB 4OI8A 5E9DA 1LDPH 3F8UB 2IWGA 3DYMA 2L4OA 5I1HL 2AEPL 3LN4A 2HA1A 3KPRD 5EU7C 5ICYA 3UTTB 4GMSH 4NZTH 4MA1C 1J8HB 4ELKB 2EDNA 3E8UL 5HHPB 4LCCA 2VXTL 2NXYC 4P46B 3S4SB 1JTOA 2PUQT 4MB5A 3LB6D 3HC0B 3GSXA 4GG8A 1T7XA 5EOQL 2W0PA 2AK4D 2IPTH 3CSYB 1TLKA 2E9BA 2MHAB 2DM3A 4PP1D 1K5NB 4APQD 1AQDA 4L8CA 1HOCB 1YEGL 1N0LA 1WGOA 4QRSA 5D1ZD 2PCPB 4MAUL 1MWAB 1PAMA 4P2QA 1DUZA 4ZUWB 2WMPA 2ZPKH 1SJHA 4DVBB 4YPJA 3FQNB 1TQCB 3AAZA 3MCKB 4XC1L 5CEYB 3CLFL 4MAYD 4J1UB 4OFIA 2QKIA 3DARA 1S7XB 2CPCA 1JRHH 1KCSL 2JE8A 3CMOH 1RHHB 3UO1H 4GH7B 3RX7A 3DUSB 5F88A 5FA3A 4NQCB 1WWCA 4R0LB 2D2OA 5DT1L 2V7HA 1JYXA 4NNXB 1MFAH 1RUMH 5AYUH 4HH8A 2EH7L 5HDBF 4F57L 1ZGLB 4YNYA 5GHWH 2ZUVA 1ACZA 2YR3A 3VXRD 1UWEL 1VKXB 2C7UA 1A7BA 4WY7H 5H35B 3C6LB 4EOWL 5D1QB 5I8KH 2BSSA 3A6BL 4P57B 3T0EA 3GKWH 4C55A 1KELH 1JZ8A 1IBGL 4S1RL 3SO5A 4OM0H 4PRNA 1IL1A 1C16A 3D5OF 2FLBT 2AQ2A 3X3FL 4JM2F 1RJYA 5DRNA 2JELL 3IDGA 3LEXB 2QADB 3MUJA 4LSDA 2DL9A 2BY0A 3JWOC 1EGJA 3PNWA 4NHCL 3DRTA 4BK4A 3CZFB 3O9WA 1BWWA 4UIKL 5LGKA 4JFXA 4PV8B 3OGCB 3CX2A 5LAXB 4C59B 2MWCA 3QEQE 3RTQA 1FFPA 2DQCH 2GHWB 4XP1H 3P4MB 5DJCA 1I1CA 3S34H 4Y7MA 1DSFH 1QKZH 2NY6C 2ZJSH 3H9SA 4FS0A 4PYHA 1BHGA 4KC3B 4NHUA 2ESVB 1U8HA 3WS6A 3SJVA 2ADJA 4F8QA 3SDDD 3DROB 4DN4H 5M94B 3QIBA 4WTZA 1VFBA 4QXUL 3GSVA 4KMTL 4HDIB 2JLLA 1MUJB 4UTAL 3O6ML 3BPCA 3L7EA 1E27A 1FZJB 5I66B 1G0YR 1FZOB 4XMKL 4S10A 1R5VA 1DBBH 2IEPA 1ZOXA 2VLRB 1CLOL 5I15L 5C08B 3CSGA 43CAA 2YRPA 4C56B 4HUKB 4LDLB 4C58B 1D9KB 1EVTC 4LCUA 1YMMA 2PO6A 5BQ7B 1GGBL 1U8LA 1IM3B 1EVUA 1MI5D 1FG2B 2F8VA 4K23H 3G08B 2VDRH 1AD0B 1TVHB 3QP3A 5EBMA 3RHWF 3O6KL 3PWVB 7CGTA 2NR6C 2R39A 3TT3L 2ZOLB 2QTEA 1NANH 3RAJH 5J06A 2RCSL 3QDMD 4XNQB 1T1XB 4I4WA 3HC3L 4NQDD 3PHQA 4RAUB 1JUFA 2CDEB 4G43A 3BUYB 3ARDC 3LKPB 1F58H 2DQEH 2VL5A 2ZUUA 1SMOA 1RK0B 2HJLA 5ADOL 3EKCA 4HUXB 4ZD3L 3VRLE 4ERSH 3QCUL 1KACB 1YEEL 5F1KC 3TO4A 1P4IH 3I9GH 5E5MA 4E0RA 5GGTH 1F6LL 1I8IA 3D3VA 4M7JL 1VADB 4X5LA 2DTMH 1JNHB 1KCVL 3DO7A 3UTZA 3RY5A 2YBRB 4ZPTA 5K33A 4X4ZA 1YNKH 1KCLA 1CR9H 1QYGH 1GOGA 3QCTL 4JE4B 3LN4B 5BZDA 3GK8H 1N5YH 3BYTA 3CH1A 1PEZA 3MUZ1 1U8PB 6FABL 4IRSC 4NQEE 1U3HC 5FHAH 2V6HA 4PLJD 1NBQA 4LBEB 4LCCB 5IBTH 1FNEA 3WFDL 3ULUC 1XF5B 2Q8AL 4GG8B 3GSXB 4GKSA 1FH5L 4AEIL 4HV8A 1MVFA 4OM1L 3VJ6A 4YHPB 4MQSB 3QUZD 4HWZA 2FHCA 1PDKA 1MREH 2LTQC 1LE9A 1VSCA 4PRPD 5CP3H 1AQDB 4UQ2A 5A2FA 5IVXB 2HVKA 4DVRH 4QRSB 2R8SH 5DJ0B 4DZBB 2OM5A 2HT4C 3WXWL 4P2QB 1DUZB 3TIEB 2VR5A 2P47B 5I9QB 1SJHB 1AXSA 2C3VA 3LEVL 4XCNA 4LCIH 4GOSA 3BGMA 3AAZB 3D39A 4HWUA 3WN5A 1G9NC 4ZO7A 1RUQH 2IGFH 5GISH 5BS0E 4OF8A 4UV4L 1KBGH 3K3QA 9CGTA 1J1OL 3HZKA 1WTLA 1RK1B 2ZUSA 5F88B 5FA3B 3QZWA 2V7HB 3ARFA 3MA9L 3I6KA 5HJ3A 3FO2A 2HTKC 3H7LA 4EBQH 4OZIF 2FO1A 4YNYB 4HJ0D 3KJ4C 2VLKA 3NGBC 2LV4A 5KZCB 2IANA 2C7UB 1RMFH 4FHBD 4LGSB 1BAFH 5B38G 2J4WH 4FQQA 3MRCA 5B8CC 4U05A 2HAZA 2BSSB 1YECL 3T0EB 4LVOC 4EN3D 4L29B 3QWOA 4C57C 2X9XA 3H2WA 3SKNA 4PRNB 3K46A 4JB9H 3MBEA 1IL1B 4OQ1A 1GAFL 1BJMA 1C16B 4F9PC 4D0BB 1UM6H 4O2FA 1RJYB 3QWRA 1YEFH 5KSBA 3UTSD 3IDGB 1NMBL 4PLKC 2VDKH 4HPOH 4KQ3L 5JPMA 3T0VA 4M9OA 5FYKL 4P9HH 3OKNB 2R23A 3PNWB 2DQJH 2IQ9H 2OBGA 2NY2C 3O9WB 3ALWA 3NA9H 1AD9A 3QDGE 2A0LD 1BZ7A 2WBJC 3MLSL 4P2OA 3WDJA 3VFNA 1FFPB 2MCG1 2P49B 3QDJB 1ZAGA 5FYKE 1UKTA 4G6KH 2CRYA 4RGNE 1HHGA 1MJJA 4X6EA 4Y2DD 5I1KH 3H9SB 1MHEB 4NHUB 1WFTA 1U8HB 1ZLUH 3SJVB 2ADJB 4MXWH 3GI8L 4OZFA 1HILA 1BX2B 5CZXD 2OI9C 3QIBB 3RWGB 1M7IB 3IGAA 3RVVD 1VFBB 1CL7L 3GSVB 4M3JA 3EDDA 3KLHC 4U6YB 3BPCB 3L7EB 4PJDA 1RZ7L 1TQBB 2VIRA 4UI2A 3LS4L 1R5VB 3ARBA 4LOUD 1P7KA 4O5LH 3F5WA 4EUPH 4WFFE 2VDOH 2OS7A 4TSAL 1DQQB 3EJJX 3V6FA 4OSUL 1FVCA 4LCUB 1YMMB 2PO6B 4U1GB 1U8LB 2R2EA 4WTXA 3DVIA 4OFVA 3SKUD 5JUEH 3UBXG 4CMMA 4XPBH 3NABH 3GMOB 1JNNH 5MI0B 3SPVA 5MENE 5EBMB 5CD5C 3KYOA 4RNRA 4ZPVB 2XRAH 3QQNA 4RSVA 4FMFA 2OXGA 2R0LH 3N9GH 1OP5K 1ZGLM 2NY5H 4M1DH 4I4WB 3L3DA 3WDHA 4KWUA 1JUFB 1VENA 3KHQA 1FIEA 4G43B 1D7FA 1RZGB 5IW6A 2BNRE 2VL5B 4M5YL 3RZCD 3V4VH 3QIUA 2VKXA 5I1GL 4MD0A 3SCMA 1QSFE 5DTFA 2HJLB 3MOAH 3LIZH 4R90H 5HHQB 5IESH 2C1PA 1HYSC 1IAIL 3RWHA 1PLGL 5E08H 3AFLA 4WWKD 3EDEA 4OKDA 2D7NA 5GS0H 3HA0A 3W0WA 3IAPA 3TO4B 1TMCB 2HWZL 2CK0L 3Q0HA 5CINL 5E5MB 4E0RB 1L6ZA 3T4YA 1I8IB 3D3VB 4JGMA 1KJ2H 4PB0L 4CDHA 1E6JL 2BERA 2WV3A 3U1SH 3TT1L 3UTZB 1OWWA 5FYLH 1AR1C 5JOPE 4ZPTB 5T3XH 4KRPC 1KLUA 4JRXE 4OIBA 1JNLH 1Q0XL 3TCLB 4YBHA 5BZDB 5C8JA 4HPYL 2H32A 3EJYD 4MXVF 2HG5A 3GHBH 3WNKA 1DL7L 3BDBA 4MLSA 2RIKA 3OSKA 1FNEB 4HJJH 3BPNB 3BZ4B 2AV1A 3MLRH 1ZTXL 3GGWB 1NFKA 2XNAA 2J6EL 1NCNA 5IHZA 5MHSD 4GKSB 1HHKA 1ZLSL 4HV8B 3VJ6B 2MJWA 4HWZB 1HXMA 4OUUA 4OD3L 2DI7A 1MCEA 4UQ2B 2HVKB 3QRGL 2E7MA 2R1YA 3NN8A 1ZLVK 3FMGH 1AC6A 4OD1H 1YN6A 2DLFL 3O6FD 3VGHA 4L3EE 1AXSB 2C3VB 2NY0D 1KYOJ 4L4VD 5TE4L 4XCNB 3BGMB 1ACYH 3D39B 3WN5B 5AG8A 2CKNA 1C7TA 4G6FB 1A1MA 3S9DB 1LVEA 3SDCD 3CX5J 3QHZH 1CK0H 1FFNB 3OAZK 3QZWB 4FQCH 2BXZA 1Y6NR 3QHTC 3VXUE 2ERJC 2FDBP 5ALBL 3LHPH 2HFEB 4X98B 3I6KB 4KK5C 5HJ3B 3FO2B 3DI2B 1T5WA 5IWLA 2VLKB 3HAEA 2QHRH 5GRVL 4NQVA 3WUZA 4A2MA 2IANB 3MV7A 5C3LD 4M8VA 1U92B 1I7RA 1AY1H 1GOHA 4FQQB 1KXQE 4JPVL 3MRCB 1QR4A 3T3ME 2F53A 4XP6L 3QWOB 4XCCH 3DSFH 5HTSA 3SKNB 1VA9A 3MBEB 1W72H 5F9OH 1FLRH 4M3KB 5LQBL 4NUGH 4O2FB 1FYTE 3X14A 5KSBB 5INDA 3HMXL 4LFHD 4JKLA 1L7IH 2C4XA 1MFCL 5JPMB 1FGVH 4JY4A 1JGLH 2R23B 4L3CA 5GRUL 1CD8A 2DWDA 5IJVA 2B5IC 4NNYA 1SVCP 2DD8L 1U8MA 1BZ7B 3L5XL 4LU5L 1GCFA 1FO0L 4OCSH 1CU4L 4P2OB 3WHE0 5A2LH 4FNLL 4HK3N 2EO9A 1LHZA 5H37G 1UVQB 3VFNB 4MD5A 4RX4D 1NMCB 2FR4A 3MGTA 4KDTC 2VZ3A 2B4CL 4XP5H 3OKMA 1HHGB 3L7FA 1MJJB 4V2CB 4X6EB 5EO0B 2FEDC 3ZKND 5EORL 5CSZA 1ZA3B 2CR6A 1IM9D 1U93A 2G5BA 1GPOL 5DHVH 4J8RA 2OJZL 1FJ1B 3T0BA 3MBXL 2C3HA 4PJGA 4MDJA 5BV7H 3RL2A 5F1IA 4H8WH 4LPYA 2VL4A 4MVBC 4LSRL 4PJDB 4HF5L 4FFWD 1R0AL 2VIRB 1R6VA 1HNFA 4NRZA 3ZKQD 3D9AL 4OAWA 1X5ZA 3ARBB 3QG7H 4YWGL 1P7KB 5CJQH 3F5WB 5DO2C 2FB4H 3HFMH 1DEEA 3DXAB 3VMPA 5C2BL 1BVKB 1FVCB 2GCYA 1PSKL 1ZANL 4XAWH 2R2EB 4P46C 4YBLB 4CMMB 4JVUA 1NC2D 5KS9B 2ZOKA 1A1NA 3D2UD 5LG1A 2MPAH 4GAYB 4BA8A 2WQRA 2FGWL 5FYJU 3KYOB 1FQ9C 4RNRB 1CDHA 1CGTA 4XNXL 3FQRA 5AWNH 5F6HI 2CKBL 5KVGL 4KHTH 3FFCE 4Q9RL 2PXYA 4NPYB 2KPNA 1MHCA 1QRNE 5I18L 2W92A 4N90E 3EO9H 3SBWA 5T1MB 4OCYL 4XH2A 4NO0A 5IW6B 5JMOC 4Y5YC 2Z8VC 3OR6A 3QIUB 4B7IA 2Y06L 3QUMA 2VXSH 4MD0B 3SCMB 5DTFB 2DBJA 3BMVA 3DHJA 1FIGL 2C1PB 5TE6L 3VXPB 4LHQB 1KN2H 3RWHB 3MFGB 4JGJA 5HGBB 1MJUH 2EECA 5E2TH 4Y4FD 3W0WB 4F2MA 1KCRH 1W0YT 4JM2C 4UT6L 4DGVH 1DQMH 1CGXA 2IQAA 3T4YB 3EBAA 5T3XD 1DVFB 3C6LC 1JPGA 3GI9H 4NN5C 6CGTA 4NC0B 3GSOB 1RZJH 3THMH 2P43B 5GS2H 1KLUB 1J0YA 15C8L 1CLCA 1Q9WB 1IMHC 3KWWA 5JIPA 2L7JA 5CEZH 3KPLA 2XN9E 3TV3H 5C8JB 3QA3A 1YQ2A 2H32B 1HINL 3KPSE 1VPOH 1PX4A 1GHFL 4WU5A 2Z91A 2QADC 3QXAA 2F74A 2A6IA 1SY6L 1TZIA 3GRWL 1PX3A 1F4YL 1QNZH 2AV1B 3PWLB 2XNAB 5IHZB 3OB0H 3HTLX 4GT7A 1T0NA 3DPBA 2NZ9C 4P5TC 4OUUB 3BP6A 2ZSVB 1YY9C 5DVLA 4PJAA 4ZXBC 4F8TA 3MLPA 1J87A 5DD0L 3NN8B 4F7TA 4MNHB 1YN6B 4N1CA 1CIDA 4DKDC 5SV4A 4JFOA 4RIRA 4JFFD 3L3OB 4MAYB 5DRZA 4QOKE 2C3GA 3ZTNL 5HHMD 4H88H 5K9JL 2VLJA 5JW3L 4M6ML 4ELMA 1CDCA 2QQKL 2XG4A 3TBWA 2CDGB 2A1WL 5IT2H 4PUBL 3PGDA 4HGKC 2X42A 1Q1JL 1Q0YH 4HWEH 5I30L 1KJVA 5L7XL 2ITCA 1RUKL 4JG1H 2W0FB 4NQVB 3C5ZD 1FNGB 5JHLH 1OAZH 2P44B 1MFBL 1I7RB 4L1DA 1R5WA 1XF1A 1UEYA 1W0WB 3JWNC 4BFGA 3WKMH 1HDMA 2F53B 3OF6D 3TZVC 5HYSA 3B9EA 4YHMH 3GJEA 4OFYD 4JPKH 4ZTPH 5J3HC 2O5XL 3X14B 5ISZE 1D6EA 4YHLH 4WUKL 2AI0L 1RV6X 2BK8A 3PG2A 3BKCL 4JY4B 1DQJA 5IMKA 3ES6B 1A7RL 1H3VA 3OGOE 4L3CB 4NM4L 5DQ9A 3WXWH 3W39A 4HT1L 3SGEH 1V7ML 2DWDB 1U8MB 4MSWA 1BD2D 4JREB 1YJDH 4JKKA 2Y23A 1JHLH 5GRJH 1OPGH 2VDQL 1SHMA 5E8EA 5EZOL 5F7YC 3MGTB 1GOFA 5DEZA 3WNOA 5BZWA 2DIAA 1RZFL 1A2YA 3OKMB 5GRXG 3L7FB 1NBZA 4X6DE 2H45A 2NX5A 5D1XD 3TJEL 3NACL 2AJYH 5CSZB 1EV2E 1UH4A 2G5BB 1U93B 1LO2H 5FOBA 4EKXA 4GRWE 5HVFB 4PJGB 4MDJB 3RL2B 1I8LA 4TYUA 4PR5A 4XC3H 5JOFB 1G6RH 5F1IB 3QSKB 3UDWA 2FNBA 3O11A 4NRZB 2E7HA 2DJUA 4OAWB 2QSVA 4NYLA 3LKNA 4S1QL 5GIRA 1NH6A 1NKRA 2IALB 2GCYB 4CUCA 3MRJB 4PJ8A 3ILPA 1B90A 3AM8A 1A1NB 5IQ9A 4UOW1 2ZCLL 4M9PA 3ARTA 5D7JC 1G9MH 4D0CA 1NFDE 2X4QA 1HH6A 4PG2A 4LAJH 4PRHE 1TTGA 3UTPE 1QFWM 4XB7A 1IT9L 3U6RA 3FQRB 5C0EA 4KTDH 2MOVA 4YHYB 4HC1A 1OTUC 5F9AC 1SEQH 1KCUL 5ADPL 3T2OA 4G6JL 2OMNA 4XBGA 4OZHE 1S9VB 2PXYB 5CAYB 1G7MA 1NCDL 1TETL 3ARVA 3D85A 1G7HB 4TUOA 2VR9A 4Y5VA 1E4XH 3E1F1 4K9EH 4X4YA 1IAKA 4HCRA 4M7ZC 4NO0B 4DKEL 3W11D 1V3LA 3LDBC 1DQDL 3QUMB 3ZMRA 1Y18B 1R5IB 2EE2A 1IGIL 2VN7A 4AT6B 1OOAA 1KTDA 1Q8MA 1I7ZA 2FD6H 1CDGA 3P9WB 3WSQL 1YYLL 5JNYA 4ODSH 4PD4J 2IQAB 1JMXA 5GS2D 1JPGB 3ULVC 4LMQI 1UJ3A 5CEZD 2F5AL 2EZ0D 2XTJB 2FECI 1UCTA 3M17B 1K3ZA 3BVNA 3S98A 1EEYA 3KWWB 2W38A 1JPSL 1MHPL 3HPJA 3KPLB 3QA3B 4JGUA 5D96C 5LKNA 1S78C 5DD3H 4X7SH 2FHBA 4JHWH 2Z91B 4OF7A 4RMQA 4DAGH 2F74B 2A6IB 3NFSL 1TZIB 3UTQA 2EDHA 5TDPA 1MF2H 1NAKH 4JEGB 1BZ9A 1CVRA 4P49A 5HGAA 5IVZA 4YIQA 1BZQK 2B2XH 4JG0H 2APBA 3BP6B 2D31A 4B7LA 4PJAB 1IGMH 5F3BA 4ZO9A 4KFZC 4F7TB 3O0RL 4H0IA 4RIRB 3DHMA 4YEFA 1ZGLP 3HG1D 1ZHNA 4P3WA 4GQ9L 2J12B 3BRDA 2YRZA 2DQTL 2VLJB 3SE4A 3TBYA 1E28A 1LK3H 1B0GA 1REIA 4ELMB 5F3HA 5FAAA 1GZQA 1CG9B 3VD4A 3D69A 4X6BA 3TBWB 4DJMA 1H8OA 3EFFA 4DZ8A 3EJZD 2VZOA 4OFKA 5CJ5A 3PGDB 4HJGA 1SVZA 2NY7H 2IBZY 4B50A 4NQTA 4D9LL 4P59H 5AAMA 3NTCL 1KJVB 3VRJA 2ITCB 3JV5A 3RUGE 1HQ4A 5HPOA 2XWJA 3HUJE 4PJEB 43C9A 1CFSA 2UYLA 2HN7A 1I9RH 3CU7A 3NVQA 4N5EC 1WT5A 2AJUL 4LQFH 1AIFB 5C0RH 3W2DH 3GJEB 1Z5LA 3SQOH 1JZ6A 2XKSA 3NOIA 4KH2A 2KL6A 4BM7A 4OF5A 3VFGL 1RD6A 3RWJA 4K2UL 3T1FA 4ZFOB 1OGAD 4JKWA 4S1DC 3LKRA 5DQ9B 3L95A 3W39B 4GXUN 4PJIE 2ZWLT 1CE1L 4KQ4L 4P23A 5C6TH 3WJLA 1DBAH 2GJZB 2WWMC 4JPIA 4MSWB 2H9GA 2HLFD 1T7ZA 5I1JH 4W4OC 1I9IH 2EIDA 1HXYA 3AGVA 4D9RE 2NY4B 3N1FC 1FDLH 3WIFA 2H1PL 5E8EB 1FBIH 3GIZH 1CXLA 1SJEA 1I85A 1TCRA 2YD3A 1OP3H 4QF1A 3V0AC 1QEWA 5BZWB 1A2YB 5K59E 3TNMA 3OJ2C 1WZLA 2X09A 4X6CA 2NX5B 3S97C 1N64L 3QFDA 4EI5D 5FOBB 1EUTA 2YN5A 4BUHA 5AZ2L 5D2NC 3TO2B 3MRRA 4PR5B 3ME0A 5GGSA 1S9YA 3T3PE 4RMTA 1VFAB 2YPLA 3HI6H 1CDJA 5E2WL 3VFSA 1HWHB 1PG7H 1A6WL 4OZIA 5J57B 4NYLB 4XP9L 3LKNB 4QRPD 5GIRB 2E7LA 5GS1A 3TVMD 3MCLL 1D5BB 5SWSE 1I4FB 1UH2A 3DWTA 4LRIC 5D7LD 3O3BA 4KVNL 4PJ8B 2BCKA 3ILPB 4OQTH 2I5YL 3BPNC 2N7AA 5A3IC 5HI3D 3EYSL 3MRDA 2Y5EA 4BZ2L 4D0CB 2X4QB 4GKZB 1YMHB 2ED9A 4BFEA 5SX5H 3P0YH 4N5UA 3U6RB 5C0EB 2FX8L 1J0JA 3BGFB 3B9AA 5M7QA 4JRYA 4HXAL 5HHOD 1NFIB 3UJJH 1NC4D 4G6AD 4XBGB 1Z0NA 1G7MB 3D85B 4TUOB 4Y5VB 5T33L 2B4CH 2OK0H 1JF6A 1IKNC 4KKAC 3PJSA 1IAKB 3ZKMD 3CFJA 3K4DA 5EORH 4OB5H 1HCVA 4WFEE 1JE6A 4P3CL 3WLWC 1VDGA 1F42A 4TNWK 5A2KH 1B0RA 1VGKA 3PWUB 1KTDB 5A40E 5E8NA 1BQLH 4M6NL 2SEBB 1R3HA 2DOCA 2VB5A 4NBZB 4ODHL 1I7ZB 4NJAH 3CK0L 5DD5L 2KZ1B 2FJFA 1EHNA 2BJML 4N0UE 3BIBX 3UJIL 4HEPG 4U33A 3B9KD 2DWEB 1UJ3B 2CIIB 4GUPA 5F7MC 3HMWH 3L3HA 2R9HC 1A3LL 3BVNB 4PRAA 1X5GA 1EEYB 1ERNA 5DRWA 2EXYD 1TXKA 3HPJB 3MRFA 4YBQD 3IKKA 4I77H 2A77L 1VFMA 1MLCA 3ARYA 5IHUH 3REVB 3JBG7 3HRPA 1N26A 1XIWA 4LFHG 1F4WH 4WENB 2AEIT 2VH5H 2WBKA 2FH6A 3HE7C 1ED3A 1BZ9B 3LV3A 1XGPA 5HGAB 1NAMA 4YIQB 1JZ7A 4HUWB 5B38A 1UM5H 1AC0A 2D31B 2HT3C 3VFUA 2R1XA 1E4WL 5TQ2H 5A16A 3S3JA 3T4AB 4PJ9A 4AEHL 5KVDH 4R2GD 1WBZA 1NMCC 4KJYA 1LMKA 2NPLX 1ZHNB 3E6HA 3KXFE 1LO3L 2RJMA 4HS6A 1H5BC 4XHJD 3PWNA 4LVNB 5TE6H 3UJTH 2QR0B 3VI4E 3CFCL 3QI9A 5EFIB 5IW1A 1JCKA 4PGBB 3TBYB 3BE1H 5ILTL 4ZOEA 3VWKA 3SE9L 5F3HB 1GZQB 2OL3L 1OVZA 4LSUL 5D71L 5E8DL 3D69B 5EU6D 4X6BB 2VLLA 1LEGA 2J2ZA 1CL7I 3B2UD 3EFFB 4MQXD 1EA9C 4HJGB 4EUPG 4DTGH 5T1LD 4R26L 3RL1A 1QSEE 5C3TA 5FHBL 4BFIA 3OTTA 4N8CL 3VRJB 1OW0A 4O02L 3GMMA 1HQ4B 2ZG1A 5C09A 4LL9A 43C9B 1CFSB 2DQDH 4X6DF 2RBLA 4KPHH 2F58L 2UYLB 4IOSD 5F9JA 1DBKL 2HMID 3QFJA 4WV1C 2ADIB 3LZFH 1OTSC 1Z5LB 2XIDA 3HN3A 3I2CL 5J12B 4RRPG 3TYGL 1XMWA 3VFPA 1KEML 4XWOD 2LFGA 5EOCL 3T1FB 4NN7B 4G3YL 2HYMA 1FGNH 3LKRB 1KGCD 3VI3F 3EO1A 3L95B 5IOPB 3CZJA 3V4PL 1FV1A 4P23B 2D7TH 3TBSA 2MNUA 5FDWA 4JPIB 3K2UL 2H9GB 3FQUA 1FZMA 1HXYB 3UBXA 2WQ8A 3WIFB 3FOLB 3QXDA 3BN9C 1L9MA 5K93A 1NUNB 4E41E 1SJEB 1TCRB 1QEWB 4MLIA 3VDBA 2O5YL 2F19L 3TNMB 1IAII 4MYWB 4X6CB 3MODH 3ZHLA 4PUBH 1TZHA 1YEKH 3O4LD 3QFDB 5KG9A 2A9NH 3MLTA 4OZHF 5JQ6H 3MRRB 1P1ZA 1T2QH 2UUDH 5CLTA 5GGSB 5FOJA 1CFVL 1FAIL 5TF1H 1DVFC 1S9YB 3B9VA 1FVDA 2BVPB 5CGTA 2A9MH 4QHUA 1JHKH 2YPLB 3STLA 5C0JA 4XNUL 1A7QL 3QEQA 4UBDD 2MQCA 4UNVA 1U58B 5EU3A 3H42L 1HHIA 1ZV5A 3ZDXE 4R8WL 5HYEA 4TQEL 4QXWA 4UU9A 2XXMB 2G9HA 3LB6C 1NSNL 3O3BB 3RZWA 3FB6A 2BCKB 4WEBH 4MJID 4Q6IA 1N6QH 5FA4A 4RFEA 1JF5A 4PP1C 2R4SL 2O93L 5D1ZC 1F45A 1EX0A 2XWTA 1WAAE 4GRWH 4JRYB 4PV9B 5I0ZA 3GBML 3R0NA 2M1KA 4GAJH 4L8DA 3JV6A 3I50H 2W65B 3N1QC 2XG5A 4MAYC 3N85L 4FQIL 1TZGH 3ULUH 3PJSB 1T3FB 4DGIL 1VACA 3MACH 3PF2A 4OBSA 1IKFH 3TJEH 2GK2A 4ALAL 3FKUS 1WISA 4IDJH 4K55A 2Z31A 4U1IB 4Y1AD 2DTSA 4QEGA 1B0RB 1VGKB 2X7LA 1TJGH 5E8NB 1RULL 1R3HB 2OP4H 3A6CL 2ZKHL 4BH7A 4NKDA 2FJFB 1I9JH 5TFSL 3BSZL 4JPWL 1CGUA 5EUKB 2W9LA 5DEGA 4TSBL 4GUPB 1J9CT 1HZHL 1T89A 5I1LA 1FC2D 3ZHDA 2JJUA 4NKOA 5KVEH 2HH0H 3MYJA 4PRAB 3U7WL 3AREB 3H9ZA 4YXLH 5I1DA 2WANA 3GFUA 3SGKC 3MRFB 3QXTA 4YDVB 1MLCB 2EDLA 2A74A 3QR2A 1OAQL 2VZTA 1XIWB 3NPSB 3O3AB 4A6YA 3NCJH 3RUGF 12E8H 1KYOK 3LV3B 5TGBA 3HUJF 1XGPB 1NAMB 3PGFH 5L2KA 4KUZH 5B38B 5IVOA 2FX9L 2V17H 3SDXE 4NGHH 5A43C 3T04D 3HNVH 4PJ9B 4GSDH 1QD0A 2IG2H 1T6VN 4LLQA 2AVGA 4KJYB 3KPQA 1L0XA 1CZ8L 3E6HB 4PRDA 1C1EL 4NQEA 1L9NA 2WZPD 2H41A 2P5WE 4HS6B 4ZNEE 3PWNB 4FP8L 3S88L 3QI9B 2C5DC 3GBNL 4OLWL 3G04A 2P46B 5E9DE 5HY9A 5AEAA 3U0WL 3S37H 4XXCA 1GGIL 1X6LA 2VUOA 1JYVA 3QISA 3LRSB 4YFEA 1IGFL 3FN3A 4PJIF 2VLLB 1LEGB 2GI7A 2JK5B 1QPPA 5TJWK 3WO4B 2IFFL 2NY6D 5HVHB 4KV5E 3RL1B 5D72L 1U3ZA 4BFIB 5DUBA 5GRWA 4FQXA 4F80A 3DI3B 4JFHE 1BJ8A 4U3XA 1NCAH 4JFDD 2ADGA 2YS4A 2AK1H 5BS0A 4YHIA 3GHEH 4QOKD 4UTBL 3BX7C 3AU1B 4P2QE 5F9JB 2ZCHH 5GGQH 4NO5B 5LCVL 3RKPA 3ZDZE 3OAUL 5IB3A 2R0ZL 1NCBH 4GLRH 1F3DJ 5ESAA 2B1AH 1AI1H 1WCQA 4NKIL 1CDUA 4PGDA 3CFEA 1N0XL 4Y19D 5KSUB 3NIDE 4FQJL 5EOTA 2Y4SA 3QRFM 3EO1B 3KLSA 1L0QA 1YDPB 4W81A 3TBSB 4ZUVA 4KROD 3FQUB 4K94H 5IBUG 4LEXL 1FZMB 1XEDA 5L2JB 2VNCA 1RJCA 3UBXB 2NZIA 3ZO0A 3QXDB 3EDKA 3V0WH 4J4PA 5HVWA 5TDOA 1WVZA 3ARDD 4JQXA 1TZHB 4APQA 3WJJA 1GIGL 5KG9B 5KOVC 3DVGA 2X1PA 3MLTB 1KIRA 3IU4L 5JO5A 5IKCA 5DZLA 4LNRA 3LH2H 1QQDA 1QHOA 1FVDB 1HQRA 1UWGH 4NJ9H 4QHKI 3M8OL 4HBCL 2IMNA 4QHUB 3H3PL 3STLB 5C0JB 5D6DA 3QEQB 4UB0L 4L9LA 2V7NA 3HNTH 4RQQA 3ALPA 1HHIB 1NCWH 3BP4A 2M2DA 4ZS6D 2Q7YA 1MCJA 2C4FU 4K3DH 1AGDA 3UAJD 2G9HB 5CGMA 3FB6B 2AV7A 3ARGA 4M93B 1FSKC 3RNQA 4J6RL 3NH7H 2DQHH 4Q6IB 5FA4B 4RFEB 4JM4L 3QPXH 1S8DA 3BKYH 4IRSD 1U3HD 2AEQH 5E2VL 5CS7A 2AXGA 2BFVL 4G8IA 3BPOB 5EIQA 1RUPH 2BSRA 5J11B 3ULUD 1EHLH 4Q9QH 2XKUA 5C0AD 1MCPL 2X89D 3QWQB 4EXKA 4L8DB 3JV6B 1I9RL 1N2RA 1IJ9A 4LCWE 1QUNA 4GMTH 2Y9RT 2OTUA 3UC0H 1VACB 3VD7A 2BVUA 4GKOA 4EI6A 3T1WA 3L3KA 4ZTOL 1P7HL 4NOFA 3VFMA 5JLZA 2Z31B 1P9MC 4N0YL 4OLVL 5C0CA 4DUXA 1LO4H 3MLUL 1EBAA 2X7LB 2J8HA 4MJ6A 4R6UA 3OKOA 5T1KA 4HJ0C 2X4TB 1MJ8H 4NKDB 4BH7B 5FXCH 2P1YA 1A7PL 2H2PC 4LLYB 5DFVD 1WZ1H 4XP4L 3U4EA 5HI4D 1DBJL 3G5ZA 3G5XA 1OF2A 4HS8H 1YNLL 2I60L 4JQVC 3VI4F 1JN6B 4Z7UF 4EN3C 2BNRA 2DS4A 1YEJH 2JB5H 4YH6A 1A4KA 1VCAA 1U3JA 3HE6A 2AGJH 3MYJB 3MYZA 2YWZA 5E94B 3SDDA 1IFHL 5D8JL 1SBSH 2YPVH 5E70A 5JW5A 3EGSA 4HAFA 3WNMA 4F7PA 3V6ZA 4DQOH 1YEIL 2XZQL 5FM5O 4CVUA 3E3QC 5EU5A 4U2ZA 1IAMA 3MLZH 4UINH 5F7HA 5BVPH 3IDXH 3BKJH 2EDXA 3MO1A 5GGUA 4NZUH 4JR9L 3BXNB 2P8MA 5I1AA 2VKWA 5ANMA 2VN4A 1E6OL 3RBGA 4G7VH 5KVMC 2YMXL 4LK4A 4X9GA 5FB8B 4LLQB 4LSVH 5F7DA 3SE3A 2VC2H 4IMKA 4M43H 1DBMH 4MD4B 3RKDD 2NY2D 4PRDB 4NQEB 2E6PA 3BEVA 4Z7NE 1R3LA 5CLWA 5KSVA 5HY9B 3G04B 5CZXC 5F72S 3RVVC 4XVJH 4JRWA 4LPVA 2HKHL 2HJKA 1IC1A 4PJ5D 3X12A 5T1DL 1I8LC 3DO3A 4HXBL 1MCLA 4TRPL 4DEPB 1CFTB 1GC1L 4LAQL 4LOUC 4EDWL 1P4BL 4YC2B 3PL6D 5CJXA 1XAUA 4HG4J 4RBPH 5DUBB 5JHDD 4XB8A 3MUGA 4Y4HD 4Q0XH 3KLHD 2ADGB 3EYQD 3C6SA 4FTVE 5BS0B 1A0QL 2IAMD 4UT9H 4YHIB 4Z95L 5ERWA 3FN9A 1TJHL 3X13B 3AM8C 5L0QC 5MERA 4XPGL 1MLBA 1B0WA 4U7MA 1NGXA 1AJ7L 5DI8A 1W2KT 3PV7A 4XCYA 4HLZG 4PGDB 3WBDA 3CFEB 4OCXL 1KJ3H 2KQNA 3F65A 5LXGL 4GRLD 4CMHC 4OIIH 2P5EE 2IPUG 2APWA 4KKLC 4D9QE 2AJZA 4NWUL 1INDH 1FVEA 3V4UL 3FAXA 2DIBA 3DIFA 4CADB 2IPKA 2DJ4A 5HHNB 5CD5D 4OT1H 2VZUA 4AL8L 1UKSA 3RZCC 3OKDA 5JW4R 5IFJA 5E8OA 4JY5L 2PYED 1EZVX 1Q72H 3GBLA 1BGXH 1J1PH 3UMTA 1JZ2A 4ZAKD 5D71H 1PZUB 3MV9D 1MWAH 1FYTA 1EJ6A 3QUZA 1OCWH 1ZHKB 1WAAF 3BKMH 2YN3A 5EZLB 5FHBH 3DVGB 5JO5B 1KIRB 5IKCB 1JZ3A 4XCFL 3S5LG 1S7SA 1QQDB 1RJLB 1HYSD 3QDGB 1RHFA 2EDRA 5I1IL 1AH1A 2NXZB 1HQRB 1UJ3C 4JFED 5DVNA 4W70A 5IG7A 4X7TA 4Z76A 3V95A 4Z7WE 1DBKH 3WDIA 2V7NB 4YK4C 2VXQL 4OV5B 3PDGA 4XMLL 3BP4B 4RGNB 3Q48A 2Q7YB 3P4NA 1AGDB 3S35H 4Q9CA 1FO0A 1UJTA 2AV7B 3ARGB 4KRPD 5GRZA 3RNQB 4NSKA 1YPZE 4QRRE 1BBJA 3CFDA 3FHAA 1IZJA 1K6QL 4KJWD 1S8DB 3G6AA 3ABZA 3BISA 4AIZB 5I17A 2AXGB 4NKMA 4G8IB 4QXTA 2ICEA 1G7IA 1DFBL 3BOVA 4KVCH 4G7YL 2GJJA 2NY0C 3T2NH 4XAKD 1AGCA 1NKOA 1NLDH 4AY0A 1N2RB 1QBML 1DANT 2YUZA 2OTUB 4HKJA 3CAFA 3SDCC 1MVUA 2F5BL 4YO0A 2EIBA 4M62H 5SWSD 4EI6B 5GJSL 1LO0L 5I8EA 1M7XA 5DMGC 5KSAD 1MAMH 2PKDA 3L3KB 1OQOA 5JLZB 4PD4K 5MENB 1CD0A 2E27L 5HI5D 4MJ6B 4RZCA 3OKOB 3MRLA 2DL2A 5T1KB 5AD0A 5I6XC 4JHBA 5E1HB 4FZEH 3C2AH 4H1LG 5KJRL 2RHEA 4JVWA 4TN9A 2DQUL 2ZCKL 5DJZA 3MRQA 3U4EB 5GGVL 4KKBD 2R4RL 1QRNA 1CXFA 1OF2B 3G5XB 3G5ZB 3MSPA 3SOBL 2XXCB 4DKAA 1WEJL 2YUWA 3SKMA 3WFHB 4DW2L 2BNRB 4HMDA 2ENSA 1NSNH 4I0PA 5JORA 3MV01 1F8TH 3TP4A 3HE6B 4YUEH 1QSFB 1D5MA 2CKBA 3EIFA 1HCFX 4P9HC 3GSNL 5JW5B 35C8L 4E42A 3EGSB 3QB7C 4N1EA 5J12C 3GKZA 4F7PB 3V6ZB 1Z2KA 4JCLA 3Q1SL 1C12A 1PQZA 4BZYA 1QFHA 5AZEL 4G5ZL 3CIQA 3RU8L 5LGHH 3CSPA 4NNPL 3HZYB 3MO1B 5GGUB 1BBDL 5L9DH 3QHFL 3RVXC 4K3EH 1G9NL 3DMMD 4P23C 2Q87A 2P8MB 4CN1A 1AGBA 2AJ3A 5HDQH 5SWZE 5I1AB 4OLZL 2MCPL 3A67H 3W0WE 2AJVL 4NZRH 3MX0A 3IFNH 4KZEH 4JRXB 3MJ9L 3W5NA 3EFDL 4ODXA 1B9ZA 2XN9A 1B4RA 1MFEH 3C60A 1TVDA 4WUUA 4POUB 4FQ1H 3KPSA 3ZKNC 5T5FH 1R3LB 3MRIA 5JR1L 2BHUA 4L8SA 3MRHB 5EPMA 3U4BH 3NIDF 4RWYL 2VQ1A 5D7KE 4R4FL 1NGQH 5TFSH 2HJKB 2ADFL 4FFWC 4YPGA 2YKLH 5DZNA 2YXFA 2IC2A 2BMKA 2X4SA 1BFVL 2VDMH 4O2EA 2LU7A 5TQ0L 1SY6A 3U30B 4L3EB 3MUGB 3GRWA 2E7LC 3MRMA 4ZUUA 1DZBA 1OSZA 3C6SB 3ZLQC 1JZ4A 3RIAF 5IP4A 5ERWB 4WWKA 1MIMH 5HPMA 5E6ID 3OBAA 3FB5B 3NA4A 5MERB 4ZS7H 1MLBB 8CGTA 2FLRT 4GJTB 1NGXB 5DO2D 4OUOA 2NY5C 5EC1A 3VXUB 3EAKA 1OTTD 3WLBA 4XCYB 3UTTD 3LQAH 3F7PC 3DOSA 4PS4L 1J8HD 4K8RH 4OJFH 4WCYH 3E2HB 2P42B 4P46D 4XRCA 1T7WA 3E6FA 1BM3L 3TJHD 1CF8H 3IB4A 2EYRA 5C0BA 2IPKB 1JGUH 1HKLH 4XBEH 1JL8A 4EZMA 5JXEA 1A14H 3OKDB 1CD9B 4IBLT 1UCBL 4N8PA 4XGZB 3OB0K 5ELIA 3WFEH 5E8OB 1OM3H 5IFJB