1WBZB

Crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN PREC
publication title Crystal Structures of Murine Mhc Class I H-2 D(B) and K(B) Molecules in Complex with Ctl Epitopes from Influenza a Virus: Implications for Tcr Repertoire Selection and Immunodominance
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 17
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wbzB00
1DFBH 5GS2H 5EO1B 2CDFA 3MV9A 4D8PA 4AIXA 2A0LD 5IFHL 3HC3L 1YEGH 3K8KA 1W0WA 1RJZB 3T09A 4JZJB 1NCCL 4DTGL 2VISA 3C5ZA 1KCRH 1CFNB 2GJZA 5D7JA 1W72H 1F8TL 1D6VL 3LQAH 5DHYA 2DM3A 4IM8A 2X89A 1AD0B 4Y2DC 3WHE1 3W9DB 3MC0A 4NQCD 1MFBL 2WIMA 4WHYH 3GRWL 1FYTD 1HYSC 2I9TA 1QEWB 4Y2DD 3QEGL 2WQRA 5BVJA 3MOBH 5F9OH 3T08A 5DVOA 1D5XB 1JNNH 1PD6A 3ARED 3NA9H 1C08B 2MHAA 1ZHLA 5BW7C 4JM2C 4X7EC 1WZLA 3HPJB 2HJKA 2P8LA 3CVIH 1J18A 1FBIL 3KYKH 4OGZA 4U1KB 4LP5A 1NDGB 1RK0B 3H9HA 4N0FA 2HTLD 4JM2D 1BLNA 1IGYA 5CJQL 1ZK9A 4PJ5E 4NRZA 2DB8A 4MSWB 2MKLC 4GAJH 1NGXA 5IMKB 4MMXC 4UT6H 2CLZB 1G0YR 1KG0A 2CUIA 3EJYD 2PO6D 4MNGB 1LEKB 1EHNA 1LNUA 4FQPA 4PRBB 1NLBH 4LFHG 4NQUA 1A21A 4J12A 2G9HA 4P2RA 5GRVL 3SDXF 2EICA 2YEZB 5T3ZH 3E0GA 3O41A 3QRGL 4S2SB 1N5YL 1TZGL 4N90E 1ONQB 3VI3F 5DJ0A 4POZC 7CGTA 2A9NH 1BQLH 1OWWA 3WD5H 3S35L 4J3SA 4MHHI 1A6UL 3EO0B 2ZCLL 3MYJA 3ZTJH 3B5TA 4OUUA 2GTWB 2XIDA 2PXYB 3X13B 4W6YB 3TV3L 4D94A 1CLZH 3SGEH 4F2MB 1T7ZA 3QIBC 4PGCB 5F3BA 4WWKB 3OF6A 2EKJA 2W0FA 3VFTB 5KBNC 5FEBA 2EDFA 2JK5B 4QTIL 1UA6H 3L95A 4FQJL 4I18C 2Q76A 3RGVD 3B2VH 5D72L 2VSCA 1TJGL 4TVPE 4LGSB 2Z91B 4EDWL 1N2RB 3TBSA 3EZ8A 3VFMA 2I9LA 1LO5A 2P5WD 4J3WA 3RAJH 4M6OH 2P49B 5MI0C 3V8CA 5E94B 1E28B 2DI9A 3TH3T 3EJZD 3IB4A 2IFFL 3ISWA 4U49A 3FT4B 3OXSA 1DE4A 2L7JA 4RBPK 1AI1L 3U9UA 5D7LD 3GEWB 1U8KA 3MGOA 3KPTA 3L6FB 4LBEB 2VYRE 1QFUH 3NCJH 2ZG2A 4ZOAA 3FZUC 1E27B 3P4OA 3EBAA 1A7NH 3TA3D 1LEGB 4UDUB 1AP2A 2EDLA 3H3PH 4HIXH 3PL6B 4OBRA 1G0XA 1OTTD 4KZDL 1E4WL 1Z2KA 4GBXA 2VXQH 4QHNB 1AR1C 2VH5H 2YRZA 4NRYA 1PW3A 1QSED 2JJSC 5T33H 2RGSA 2C1PB 2FIKB 3WYRA 4QCIB 2N1KA 3HZMA 3SO5A 2AEIT 1A7OL 1NLDL 3F12B 5KTEH 5BJTA 4AH2A 5I8OL 3X3GH 3RVUD 3MACH 3T0DA 5FO7A 3L3OA 5C0CD 1RUQL 4MJIE 5I1DA 2GYSA 1BVLB 3MBEC 2CR6A 2ITCA 5DR5L 5FCUL 4QXGL 3SY0A 5HYSG 4XCCH 3MGAA 4MAUL 3RIAK 5IWLC 5HHMD 4JO1L 4KVCH 5C0BA 1RZGB 2XZCL 5BXFA 3VXPA 4WW2C 5IBUG 2X05A 2F5BH 1S78D 3O4LE 1OP9A 2DKMA 1XR8B 1G9MC 2A73A 3MBED 4GKNB 2F9BT 4FQ1H 4G8FB 1IKFL 1H5BA 3X11B 3SCMB 2VL5A 2NY3B 2X4QA 4L4VD 3ZHDA 4M3KB 2YZ1A 4DGIL 4FXGA 3B9KB 3BGAA 5EPMA 4OIAA 1KJVA 3LKSB 2AEWA 2GAZA 1QBML 2BOCA 4JPVH 1CDJA 1BD2A 4XAKD 3AMKA 4HSQA 4X0KA 5JOFB 1FNFA 2GSGA 2PNDA 4P2YA 1A6WH 3MMEA 1CT8A 3SKJH 1KIUA 2G75B 4A6YH 4PJXB 4EDXB 1GVIA 1H3VA 3U6RA 4GXUN 5FYLD 5IHZA 1MELA 1MHEB 5TDOB 1L7TH 2WIIB 4DGYH 3REWB 2YWYA 4HZLA 4PJ7A 4LCUB 2B1AH 1Y0LA 3ZL4L 1R6VA 3C8HA 4PB0L 5IB3A 2A6JB 1AIFB 3VFSA 4PJ5A 5KANI 3CDGA 4MVBD 3BDYH 4KK5D 1A3QA 3LKNA 2HFFB 3CFKB 4EJ1C 1MCJA 5DJDB 3MXVH 3V6ZA 5M94B 4G9FA 3T0EB 2ED9A 1A0QH 3QXWA 4NWUH 3L1OH 4OZHF 5MEQA 3KLDA 5IT2L 3MNZA 4AYFA 5IP4A 1UWEL 4JVWA 3K0WA 3Q0HA 2R1WB 4ZYKA 5T3XL 3MLZL 1XF4A 5JXAL 3O3DA 1S7QB 4XI5D 5EU7E 1IGML 3L3JB 3H42L 3OR7A 1TZIB 5JW4M 3VFRA 1NKOA 3D48R 4MJ6B 2NY2D 1N59A 2XACC 4Y5XA 2CD0A 1FL3A 5C0DA 3C09C 2XXCB 4PGDB 3NCMA 1R3KB 1WTLA 4R2GC 1T2QH 3GI8H 3TJEH 2QSTA 4RMVA 5T5FL 3M45A 4KI1A 5DRZB 5HYEA 3ILPA 4EOWH 1KXTB 3QEUA 5D5MF 3BZFA 1YQ2A 3F65A 1BGXL 5HD8C 1TNNA 3QT2A 1KYOK 3T65B 4R2GD 3MRFB 3UPCA 3LN4A 1JPGB 4IDJH 5JIKA 3RWEA 4JGMA 2NLJA 2OTPA 2CIKB 4M62L 1DLFL 4QRUA 4QOKD 2WK2A 2JJUA 2VE6A 4HIHA 2DL9A 1S7RA 5CZVH 5F7EH 3RWGA 3D2UB 1A2YA 3OKKB 2W65B 4NJ9H 5INCA 4LSSL 2DN7A 2CGRL 3U2SA 1BFVH 1HZHL 1BFSA 2HWZH 3PGCA 4I2XE 2QQKH 1BIIB 3FQUB 4YHZL 2IPKB 3VRIA 5D1XC 4X9HA 3LQZB 1WBZA 1OF2B 5DJZB 3D39A 5DJ6A 1ROWA 1FVCA 1DUZA 4OFYD 5TFSH 3RNQB 2IAND 2JELL 2VXTH 5EU5A 5EORL 4UQ2B 3ARBB 4NPYB 2YOCA 4QXUH 4RDQF 3VGFA 3QEQD 1WT5A 3O2VL 3D9AH 3S6CA 1NFDE 3MUZ1 4HK3J 4LAQH 4Z5RA 4U1JB 2BVTA 4ZS7H 3VWJB 1SYSA 1H3TA 5FM5O 3WN5B 1FPTH 4OJFL 5L2JB 5F96H 4M8QA 1R0AL 1OGTA 1DQMH 1KOAA 5CZXD 3WFEL 4HUVA 4MCZB 4U4BA 2FLBT 3GZKA 1P1ZA 2JCCF 1CICA 2H9GB 3OPZL 4OGXL 4U6HA 3ZTNH 5GIRA 4Q58C 3EO1A 2VLME 3C6LA 3PWLB 5E24E 2J8UB 5CS7A 3QPQC 4HF5H 5GGQH 1TENA 1NJ9B 5MHSE 1JGLH 3O4LA 5DD1H 4J8RA 3RWHB 4HPOL 2NTFB 3PHQA 5EU4B 5KG9A 4OB5L 1T22B 4RIRB 3T0XA 3U46A 4W4NA 3I6KA 1FIGL 4RBPH 3QH3A 3R8BB 1J05B 4XBEH 5HY9B 4OZFH 5C2UB 3VXRA 3UZVB 4KHXH 5E99H 3FOLB 1AD9B 5CMAB 1N0LA 2EXYC 1BZ9A 3E2HB 4DZBA 1T5WA 4QWWD 4AIZA 1IT9H 2R2HB 1U3JA 2YKLL 5ESVB 2C3VB 3K2MC 3LEYH 2Y36L 4U7SA 3WUZA 2NY1C 2C4XA 3MV9B 1SJXA 2CDFB 4D8PB 2EXYD 4PUBL 5EWIH 5T1LA 4N0YL 4LKCA 4ZNEA 1F2QA 3V4UH 5E6YA 1TLKA 2J1KA 4LSRL 1AQKL 2W91A 5D7JB 4XNUL 2H2SC 5DHYB 4WI7A 1I9JH 3MLSH 1PDKA 1K4CA 2Z9TA 5ERWA 5TE6L 3IXAA 3KPOA 1FCCA 2GJJA 4XMKL 4M93B 4TVPL 2H2SD 4ELMF 3MRNA 4G42A 5EA0L 5IKCA 1F4WL 5HYSA 3HC4H 4CVXA 2MHAB 5I0ZA 1ZHLB 4OKVB 1A1MA 4MGXA 3VFVB 2N4IA 4XVJL 1AGEA 4MMZC 1EEZB 5HTSA 1FE8L 4U1IA 1J11A 3H9HB 1JGUH 4N0FB 3V0WH 1WTGT 3IDNA 4XZUA 1QFWH 4F9LA 4AEHL 4AEFA 1BLNB 1IGYB 1Q72H 5I15L 5HGAA 3MRMA 3U79A 3SDAA 4NRZB 5DZLA 3Q5YA 4QKXB 3EYOA 5FAAA 1AKJD 1NGXB 1MQKH 4FFVC 5H37G 1C5CH 4PJEE 1LNUB 3ALWA 2WNGA 5D7SH 3MRPA 2YD2A 3NFSH 4O9HL 1PLGL 1U8IA 4U33A 3K81A 4P2RB 4C56D 1K4DA 4FFVD 5ETUA 5M7QA 5HI5D 4OM1L 3LS5H 3O41B 3TV3H 4BSVA 1MY7A 4G8GB 4HS8L 5IVZB 3KDMA 1QSFA 3OKLA 5J89A 4LPCA 1A4JA 3KLHD 1NMAH 2PYEE 2FB4H 5C09E 3RY5A 1F58H 3MYJB 4N1CA 4FQJH 3JWDL 3MR9A 4LCWD 4X9IA 1FNEA 5FHBL 4EDWH 2KZWA 3GMQA 3LSOA 5K9QI 4UBDC 3GDBA 1Z0MA 1OY3B 2ENYA 3IDGB 3SKNA 5KN5B 1NFDA 3D0LA 4Z7OF 3G5YA 5F3BB 1M7IA 4JRXE 1PYWA 2ZZUT 1OT1A 2W0FB 4YHIB 1HILB 2CK0L 5C0FA 1TVHA 3WHE0 4KI5F 1ADQA 4L3CB 4D9QD 3MRKB 4FFWC 4LVOB 4DW2H 1YJDC 2Q76B 3BX7C 3HI6L 1U3HD 3TBSB 1JYNA 3O6LL 2I9LB 1LO5B 5GS1B 3UYRL 3RVTD 4Z95L 4PJ9A 4Z7QE 1CLCA 1H3WM 4KKBD 1BWWA 1DE4B 2HJLA 3E8UL 3WUWB 3U9UB 2CDEA 5FHAL 5F7YC 1PQZA 1Q0XL 3MGOB 4L9LA 1CGYA 4ZPTB 4NO3A 3P4OB 1TQBC 1AP2B 1LK2A 1UCBH 5GRYA 4R26L 1JF5A 5D6CB 3WE6B 1KXVC 4GBXB 3PHSA 5E8NB 2J6EA 1P7QB 3U30B 5L6YH 1DBBH 4L29B 4Y4FC 4NQCE 1QVOB 3HZMB 5FM5M 3TIDB 3WFCH 2Z31C 2V9QA 4RFEA 3FO0H 5BJTB 5DJAA 5DT1H 1T89A 4TQEH 2AERT 5FO7B 3L3OB 5CJBA 5I1DB 1IM3B 1NGQH 3AAZA 4PV8A 1RIUL 2FSEB 5ITBL 5A40E 2WINB 2YWZA 4NNYB 1MCSA 3VXPB 2IG2H 2AJUH 3O3AA 1I8LC 1J86A 3EOTL 3KYMA 1H5BB 1URLA 4X6DA 3NZHH 2X4QB 5TE7L 2OI9B 3C2AL 3TNNA 3F58H 3HE6D 4FXGB 1Z5LA 5EBWA 4IS6B 5EPMB 4PG9A 1A7RH 5FECA 2H26A 1KJVB 2BOCB 3RVXD 3O6MH 4KK8C 2V5SA 5F7FA 3CFEA 4X0KB 5C92A 3RRQA 5HVWA 2QLVB 2HMIC 3BP4A 3P0GB 4GQPH 3SE8L 4M1DL 1CT8B 3QO1B 4NUJA 2VC2H 2ZKHH 2VNCA 4FQ2L 3QUXD 4HT1H 3N9GL 3MCLL 4H0HB 3U6RB 2BSTA 4MDJA 1WWCA 2QQLH 2HN7A 5IHZB 2X7LB 3QDME 3MPCA 1R5IA 2IH1A 5DEFB 4HZLB 5FGSA 1RULL 3MLZH 4GG6E 1FZKA 1JPTH 1IEBA 5C9KA 5DFTA 3TO4D 3VFSB 1GH7A 4PJ5B 4Y1AD 1MRCL 4LHUG 4UAOC 3BP5B 3LKNB 4U1SA 4EZMA 2AEPL 2MQ0A 2MCPH 4KFZC 1ADQL 4LQFH 3MV8D 5MEQB 4JREB 4G6FD 1RIVL 4X99B 3DX6A 1CFTA 3DJ9A 3RUGF 4R9HA 5T5FH 5FV1L 3RBSA 4M1CD 5FA4A 3O3DB 1T1YA 4P4KA 2BZDA 3I3EA 3OR7B 1ZWIA 3P30H 4OFDA 3VFRB 5A2JH 3L5IA 2ADGA 1MWAA 4Y5XB 3SGEI 1FL3B 4HJGB 2Y5EA 1RHHA 1D5IH 4XP5L 2ZSVA 2X9WA 5CEYB 3ILPB 4NSKA 3OB0K 1T0MB 2R0KL 3QEUB 3MGTA 3BZFB 2CMRH 5E6IC 2ZUXA 1FNSL 1SM3H 4YHNB 3KJ4C 3RWEB 4CU8A 4NN7C 5CD5D 4AIOA 2NLJB 4JRXA 2J6EL 3EYQC 2D9CA 1YN6A 5D7LE 4YC2C 1BZQK 1M71A 4HIHB 1S7RB 1RV6X 3RWGB 5DTFA 4S1DD 1CG9A 1A2YB 4QTHA 1VFAA 5BRZD 1CDHA 4D0DA 43C9A 4XC1H 5IQ9B 5D93B 1WBYA 4IRJB 3IDXH 4ZFGH 5HHVH 3PGCB 2EH7L 3VG9B 5DD3H 3VRIB 1DQLH 1QSEE 1AE6H 1WBZB 3S98A 1W0VA 1AFVL 5DJ6B 1L7IH 3B8YA 2NY4C 1DUZB 3BIAX 2XFXA 3LVEA 5D71L 1R0AH 3GM0A 4UZGA 3JTTB 5EU5B 3ZDZE 5ISZD 3V95A 2RCSH 5HPMA 4P2QD 1WJ3A 5DI8B 2VKWA 2YZ8A 3ARYA 4NO0B 4ZUWA 1MIML 5HHME 4Z5RB 1MH5A 4PD4K 1SYSB 2VLLB 4WUUA 3GJFK 3QXDA 4M8QB 1NKRA 1TZHA 1T2JA 4L4VE 4Z9KB 1OGTB 5C3LD 4F8QA 5AAWA 4HUVB 5D6DC 1CQYA 4Z7VA 4BM7A 3QCUH 4Y2DA 4MJIB 4LVNB 5GIRB 3EO1B 3C6LB 2Z92B 1V7MH 3NOIA 1UJTA 2AW2A 3T2QA 4V1DD 4HEME 4OKDA 1WBXA 3O4LB 3DYMA 1NAMA 4J8RB 1D5ZB 3MRIA 4MAYC 1I7ZA 3BXNA 2A1WL 1MCQA 3PHQB 5FYLE 1GXEA 2KL6A 2Y36H 2VO5A 3GBNL 3I6KB 5BW7A 4JM2A 3Q6FA 5FV2A 5JIHA 2DLHA 4B50A 1JNJA 4YIQA 4YDKH 5EZIL 1F4HA 1BZ9B 5F70A 2NZ9C 3K80A 3RWJA 2HKFL 2GEEA 4KTEL 1EFXA 4AK1A 4TSCH 4OT1H 3BP7A 4NC2B 3ULUF 3INUH 4EUPG 3HI5H 3NIDF 5T1LB 4NO2B 5FO9A 3QDMA 2ADFL 3KAAA 4LKCB 2YD8A 1CDBA 3ARFB 5JPMB 4X98A 4GG6A 3HN3A 3GSOB 5BZWB 3GMLA 4YXKL 4LSPL 3ZKSD 1UYWL 1K4CB 3CXHK 1Q0YH 3KPOB 4L8DA 3RWDA 4XVJH 3AM8C 5J4MA 1T04A 2NY6B 4WEUD 4TN9A 3KPRD 4PJDA 3MRNB 4G42B 2UZIH 5E8PA 2P46B 2X1PA 2HT4C 5HYSB 3VD3A 1C12A 1CXEA 1FAKT 5LXGL 1KYOJ 5GRZA 3FO2A 5TGBA 1A1MB 5IIEB 4ODSL 5DRWA 3JV6A 1XCTA 1AGEB 2EO9A 2HT2D 3DRTA 3RNKB 3QIBA 4UOJA 4OLUH 3G6DH 4F33A 3GFUA 3QHTC 4Z76A 2O5XL 3IDNB 4PS4H 4ZOEA 4XZUB 3U4BL 1ZGLP 3UJIL 2AV7A 4FTVD 1NFKA 4I18A 3EYOB 3U4AA 2DOCA 4I48A 2QEJA 2NYYC 4L8SC 3BRDA 1MCPL 4R90H 5ANME 2BNQD 2R56L 3MRPB 2IANE 1U8IB 2MQ3A 3F62A 4KROC 5K9OB 1ZKAA 1MIEH 4YX2L 5ETUB 3QEQE 2NYYD 4BSVB 1IM9B 2WWMC 1QFHA 1D5MA 3SGDH 2A6DA 3KDMB 3OKLB 4WY7L 4KJPC 5IBTL 4I2XB 4M4PA 4F8TA 5ID1B 1XGTA 3C5JA 4LHUA 5D8JH 5B3JE 1P7HL 3RZCC 2NXYB 2WANA 4PJFF 1GGBL 5JZ7C 3MR9B 4TNWF 3LN9A 3I50L 2IAMA 5DS8B 1FNEB 5I8CA 3FCTB 1BZ7A 3M1BB 4YNYA 3GMQB 3LSOB 1EZVY 2JJSA 4OF3A 3BPNC 1MCBA 4RISH 2OBGA 4S1SH 4N0CD 3TFKD 2V9RA 3RZCD 1RUAH 4JDTL 3UYRH 1NFDB 1LK3L 3D0LB 4ZUVB 3BJ91 1YEJL 1M7IB 1QRNA 4LSTL 5C0FB 4I5BA 4B7IA 3A6CH 5FYJH 3CH1B 3MBEA 2ZOLB 3VFUB 2EDXA 5JOPD 4XPFL 2XY1A 1KCSH 4L4VA 5L7XL 2EIZB 5INDA 5IWLA 4WW2A 3IRPX 4DN3H 1JPSL 3WXWH 5J13C 32C2A 3ARGD 1TTFA 4DUWA 1A7PH 1BEYH 3GSUB 5GGSY 4PJ9B 4ODVL 4R26H 5EIVA 1T20A 3QA3B 5EBMA 2ZUYA 1IVLA 2AJXH 2HJLB 4ONGL 3MLTA 5DMKA 4QEGA 2VLKE 1UB5A 2Z8WC 4NO3B 1BP3B 2OL3H 3MO1A 1LK2B 1IL1A 3MV7E 1JZ3A 3O9WD 1F97A 4LLMA 2VQTA 4MZ3A 1T80A 4K71C 3RA7L 2OR7A 1RIUH 1UJ3B 3MODL 2F8OA 4K3DH 5MEPA 4GT7A 4MQTB 2VDKL 3L3IB 1RJLA 4X5XB 3G5ZA 1UACH 1M7XA 1MPAL 5E5MA 4RFEB 1SVCP 5DJAB 1YEFL 4CU7A 2Q8AH 5C6TH 3GJFH 5GQBA 2Y5TA 2SEBA 4U6VL 5HGDB 3AAZB 4NQDD 4PV8B 3VMPA 4TSAL 1T1WA 1J0JA 1FDLL 2FEDD 4KI5C 4KDVA 2BNRD 4XPAH 3NACH 4O58H 2R69H 1A6VL 4OCSL 2BP3A 4L8BA 1JE6A 2AGJH 3SE8H 4RRPG 3KYMB 2ITDB 5HDQL 1K2DA 5L2KD 3TNNB 5SWQB 1Z5LB 4KRPB 5EBWB 4PG9B 4F3FA 5JNYA 2X70A 5FECB 3TBVA 2H26B 5F7LB 3MZTA 4UNVA 1KJ2A 1B4JH 2EYTB 2YPLD 4JM4H 1LE9B 5GJSH 3S36H 1XGRA 1O7SA 3M8OH 3CX2A 1PFCA 1QFWI 2F19H 4WDIB 4XVSH 1SHMA 4MDJB 3VXUA 4C56E 3UYOD 2HN7B 4U1GB 5J1AA 3QIWC 1F90H 3NH7L 3TGXA 2IH1B 4C58B 1FFOA 5SX5K 4H20L 3F7VA 1FZKB 4YJZL 3D0VB 1BBJA 2UY7A 4JFFD 1H3UA 5GGUB 1RZ7H 1ODAA 5LGJA 4U1SB 3G5XA 4PJEB 5FKAA 5C0EA 1AGBA 4CADB 2D03H 3G9AB 5ANMA 3GBLA 2IANA 3AU1A 4LCWE 1CFTB 5D1XA 1FH5L 2AP2A 4EUPA 5FA4B 4JHAL 1G9ML 1LP9A 3QUKA 1YEKL 4P4KB 3MFGB 4F7EB 1ZWIB 3J7HA 1FNSH 2ADGB 1HHKB 1F00I 2VSDA 3IXTB 2PYEB 4X7SL 5C09B 1YN7A 4TUJB 2A2QT 1IZKA 1QNZH 4G80A 4H26A 5GRWA 1IEHA 2PTUA 2ZSVB 2IPTL 5FYLL 3JTSA 3MGTB 1SEQL 1LO2H 5C07E 1PKOA 1VFOA 3SO3C 4JRXB 1V3MA 1YN6B 1UVQA 3RVWC 3BKCH 5CGTA 3RPIA 2J88H 1EEYA 4KPHH 3CXDL 5HHOA 3GSQA 1M71B 2W38A 1LWRA 5JPNB 5FUZH 1IGTA 1WQVT 1T6VN 3BIKA 1UM6L 4QTHB 1MHPH 5SWSA 3GHBL 1FL5B 4D0DB 1QLEH 4Y2OA 3F7YA 1BVZA 1WBYB 3ARDC 1O5DT 5FF6A 3LKPA 4NWTL 2P42B 3FONB 1ED3A 1KELL 3CK0L 5C2BH 1YECL 2XQYG 3HRZA 4LU5H 1W0VB 2C9AA 3DRQB 2J8HA 1J88A 3DX9A 4X9GA 2GTZA 1EO8H 2XFXB 1BM3H 2P1YA 4ZPVB 3UROR 4BH8A 4ZO8A 2VLKA 1DBMH 2C1OB 1ZMYA 2X1QA 1XFPA 4YHPA 4NKDA 4EKXA 5J0BA 5L8JB 1UB6A 3MV7A 1KJ2L 5GGRY 2C7UA 2BK8A 3ZE0F 4QHKJ 1MH5B 2GQHA 5HYJE 1WZ1H 4WUUB 4PJHA 3NFNA 1Z9MA 3QXDB 3HUJE 4YAQA 2E9BA 3SJVD 1NBVH 1G9EA 3IDJA 1JFQL 1TZHB 4AEIL 4ALAH 4B5EA 1T21A 3IU4H 4OM0L 1R5WA 4ZFFA 4NQCB 3LS4L 2ADIA 4YHKH 3AS1A 1OCWL 4NN6B 2QTEA 3UO1H 4Z7VB 3WFHA 5GRUL 1JPST 5CLTA 4Y2DB 1GGIL 1RPQA 2IPUK 4FQIL 2VLRE 4W6XB 1KPUB 1MRFL 4GQ9L 4U1LB 3BDXA 4QRPE 3AREB 2DIJA 3KR3L 4PJXF 5DO2D 4P2OC 5CBAA 2UUDK 5HDBE 2WUBH 2YK1H 1WBXB 1F4XL 4MQ7A 5C08E 1U8OA 4K7FA 2VDLL 5CSZB 4L4TA 4AY0A 3R06B 1W0YT 2HKFH 4K9EH 4KTEH 1YA5A 1FN4A 4Q6YA 3CLEL 5EOCH 4PGJA 1LHZA 2QADD 4JM2B 5B38B 4IBLT 2EIDA 3C8KB 4OLZL 5ALCH 2ADFH 3GSVA 3KGRA 5D4QA 4N8VG 1CGSL 4YIQB 4FZEH 2C3HA 4HEPG 3ALXA 3RWJB 3MV8E 4LSPH 1MNUL 2D2OA 1EFXB 25C8H 4M48L 4O2EA 2AXGB 5DFVD 4C56A 1OM3L 3VA2C 4TVSa 2LE9A 5FO9B 4BFIA 3Q5TA 3QDMB 1GL4B 5AZEL 3HNVL 5IFAL 1IC5L 4GG6B 1S5HB 1M7DA 3UJTL 2XZQL 1CE6A 3HAEG 3ZKND 3GMLB 3V5DB 5LXGH 4DGVL 2JJTC 4L8DB 3RWDB 1QOKA 3EDKA 1RD6A 3KJ6H 4O2FA 3O6FC 4PJCE 4XBGA 5E8PB 5ICYB 4U3CA 4XTRD 1IKNC 1SY6H 4J6RL 4M9PA 5J8OA 1KIRB 3FO2B 1PZ5B 1DBJL 5DRWB 1XCTB 4MDIA 1YZZA 4OCNC 1NCAH 4OD1H 3DRTB 2UY6A 4JZOA 2R56H 3QIBB 4RRPA 4UDTA 4APQC 1V3JA 2I5YL 1RZFH 4Z76B 4CNIB 2BJML 3CX5K 2APFA 3NIGE 3T0VA 4RNRA 1N5AB 2AV7B 3VXQA 1KGCD 4I18B 4Z0XA 5D70H 2BCKA 3K8MA 4WTWA 4HUMB 2DQEL 3AB0C 5C07A 3VRLF 5GJTH 1RIHL 3MA9H 1IBGH 5SX5H 2BHUA 3FTGB 4EEEA 5I19H 4NOFA 5D7LB 5I6XC 3QUYD 1P4LB 1J8HD 3JVGC 1UM5H 1FFNB 4G6MH 3QJHA 3UAJD 4XVTL 1D5MB 2HYMA 2A6DB 1SJEA 1VACA 4P4RA 1P53A 2NY0C 2YMXH 4PP1D 3SDXA 3RWCA 1IEAA 2FNBA 2EEDA 4GW4A 2Y06L 4PD4J 3C5JB 4LHUB 1QSEB 2NY7L 4H1LH 1XIWD 4WI6A 1U8NA 5ILTL 1H8NA 1J5OL 3ZYOA 1N0XL 1FGVH 1FZOA 1KACB 3W5NA 5L7XH 1BZ7B 1FHGA 2JB6A 4Y4FA 3AS2A 2YD9A 2ZPKH 3RWFA 4OI7A 5ICXB 2OCFD 4R4BB 2Z31A 1DQDH 4CN1A 3KXFD 4V1DE 4WU7A 2FH6A 5HYJA 4I5BB 4RMSA 4DUVA 4N5UA 3PWVA 4HXAH 1XZ0A 3MBEB 3CFJA 1EXUA 4QXTA 4MHHG 5GS2D 3PWPD 4TTDC 1F02I 3LQAC 3QQ9C 4L4VB 1G84A 4P5TD 5INDB 4M5ZL 3SQOH 3PP4L 2Z93B 1WFNA 4XHQA 5E5RB 2BRQA 4LPYA 4WW2B 3VJ6B 32C2B 5F7MC 5BOPA 1I8LA 4RQQA 6CGTA 1HDMA 2VLRA 4HC1H 1GZQA 1Q9OA 1YMHA 1VA9A 1T20B 4QRPA 5EBMB 4ACPA 4XPTH 3MODH 3HCVA 5DMKB 2DLFH 2OZ4L 2VDKH 5C08A 5TDNA 4PRDA 1UB5B 2DBLL 1YYML 2V2TB 2NX5D 2B1HL 3PV6A 3N1MC 2O26U 1YEFH 5K93A 4B53A 5DZOA 3DO7A 4LLMB 1AGFA 3JWOH 3TN0D 4I1NB 5GGVY 3KYOA 2E3VA 4FFZL 4Y7MA 4LRNH 1DLHA 4HH9B 3DETD 4LK4A 5C9JA 3G5ZB 3MV8A 5BQ7B 1AXSA 5E5MB 1D9KC 3UTTD 3CXHJ 2EDEA 2P7TB 3KPRE 3O2DA 1D5BA 4NO5A 2JB5L 2GJ6D 1T1WB 1VCAA 4X7FC 4CGTA 5B8CC 1YJDL 1FGNH 5FYKU 3EYUH 5E4EC 2QSCL 1IGCL 3EYFA 1KEMH 2KQNA 4UOW0 1G7JA 1NUNB 4L8BB 2WZPD 4Y16D 4G43A 5T3ZD 1K2DB 4L8CA 5EIQA 4JQVC 4F37K 3PWJA 4F3FB 2UUDH 3WS3A 2X70B 4OSUL 2E7HA 3QSKB 3KPLA 4GRMA 3OXRB 4FTVE 2ZOKA 3VD4A 4R4ND 3LD8C 2P8PA 3EDEA 4H20H 4R2GB 5DGQA 2GW5A 3DX7A 3U7WH 5FFLA 1EHLH 2AJSL 3W2DH 2BSRB 4CMHC 4GRWE 5GSRA 2ZNWA 3WXVH 2ATKA 1UWXK 3MUHL 5E6IA 4UTAL 4JFZL 5I1HH 1ITBB 1FFOB 1CBVH 2N56A 1HK6A 3MBXL 3J8F7 1OP5K 3OHXB 3H7BA 5CHNA 4FA8A 2OR8A 4YDLC 1YEKH 5LGJB 4N8VA 1P5VA 1NCUA 3I9GL 4KY1L 5FKAB 1NMBH 4L3ED 1JWSA 5C0EB 1AGBB 2OMBA 5DK2A 5ANMB 2IANB 3SGDI 2C3XA 4WVRA 1EUUA 1LO3L 3CLFL 3QEQB 2O61A 4NM4L 4OZHA 1FORL 3QUKB 1EAPA 4ELME 1G6RH 3TPKA 5E03A 5KANG 2YXMA 1DUYB 3HAEA 1CD1A 2LFGA 5JOPE 3KPPB 1YN7B 1YY9C 1CI5A 5TH2B 4G80B 5JOEA 4OCMC 3MYZA 2AJYH 4YQXL 4JFOA 4UV4L 2XA8L 3TESA 1QD0A 1CTNA 1KB5A 4UINL 4GXUM 4Q9RH 2DYPA 4U6TA 1S8DA 1VPOL 2IQ9H 3U9PL 4MNQD 2FJHB 5D6DA 3DI2B 4XNZB 4V1DA 4KH2A 5D5MA 3RPIB 5EOCJ 3FMGH 5CZKA 4HWBH 3GSQB 2VLJD 4LSUL 3TZVC 4UNTA 1L9MA 4MA1C 4UT9H 2NPLX 3WFZA 2BFVH 1IGTB 4Y4HD 4XC3L 3MUJA 2YN3A 5DYOB 3O2DL 5F6IC 5HHNA 4KK6D 1YEIH 3BDBA 1HEZB 3LKPB 1NEZG 4MAYA 4UV7L 3RY4A 5K9KB 2PXYC 2Y7QA 1CZ8L 5EC2B 3GJEA 4HGWA 3HRZB 4G6KH 3UTPD 3DX9B 3MZGB 2GTZB 4RGND 2B2XL 3MRJA 4U0QB 1Q94A 3X14A 4KMLB 4OD3L 4BH8B 4FQLH 2EO1A 4X4XA 1S3KL 2VLKB 1CDIA 1OCWH 1JYVA 4O5LL 2OP4H 4NQDE 4NZTL 4YHPB 4NKDB 5GRUH 4NQED 1UB6B 3MV7B 3HKFA 5TQ0H 1NDMB 2FEEL 2C7UB 3BQUC 4IJ3B 2BNRE 2DTML 2DF3A 3H9SD 3GIZL 1LE5A 1DVFD 5TF0A 5D2NE 1CIUA 3NFNB 4E41A 1HH6A 4YAQB 5KVDL 3IDJB 5AYUH 1R5WB 4BK4A 4G6JL 1MJJA 4ZFFB 4GFTB 4OV6F 1XGQA 3CZFB 3EO9L 2ADIB 4KI5E 3OJVC 3WSQL 4ODWA 3QUMH 5JW4N 1C1EH 2L4OA 1WF5A 3IGAA 3FOMB 4DKAA 5DJCB 4PJBE 5GXBB 5GRXG 4OLZH 4HJJL 1ZS8A 5L88L 2JCCA 3AM8A 1JZ6A 4CL7A 3PL6C 3LEXB 2YA1A 3FFCA 1X5ZA 3G6JE 4JCMA 5EU6A 1FN4B 4XPGH 4KRNA 1T5XA 1OLZA 4QNPF 3WEXB 1LD9A 2I07B 1KCVH 3D25A 2BY1A 4Y19E 1V5JA 1IAIL 4HCRA 2VMFA 1NMCB 1X4ZA 3IS0X 1NCTA 5F3HB 1XR9A 4WFEE 1I8IA 2YD5A 4FQQA 4JFFE 4K8RD 4Z7NE 1QLRA 3TCXA 2CRZA 5CP7A 1MI5D 3HNVH 3D85D 1WWBX 4QF1A 3BWAA 4L5FL 4QRRD 1K6QH 5I1EL 2V2WB 5E70A 4HWEH 4YGVA 1A22B 1GGCH 4DGVH 1CU4L 2R0LH 3BN3B 4WFFD 2FL5A 1BF8A 1B6DA 3SDCC 4C56B 3B9AA 4OQTA 2COQA 3S96A 3MLXL 1AQDB 4QRTA 3LB6C 4BFIB 1I7TA 1K8IA 1NGWA 1KB5L 1S7UA 3SCMC 2F53D 4GMSL 5J9PA 5E8OB 1M7DB 1R5VB 3KPMA 3N85L 3B9KC 1FRGH 1CE6B 3ABZA 1MFEH 4QRQA 2QKIB 1N4XL 2B0SL 3UP1A 3LB6D 3GMNB 4NQSB 1C5BH 1LVEA 1PSKL 3QAZB 1Z6JT 1CN4A 1OB1B 4LCWB 3Q6GH 5E08H 1UH3A 2I5YH 2XQBH 3HC0B 4HPYH 1IGFH 2F58L 4KAQL 4YFLI 3RZCA 1P5UA 4ELMA 4WO4C 3O2WL 5GRJH 3ORJA 4BQCA 1ZHNA 4LAJH 1NC2D 2CKBA 4JZOB 4UDTB 1TJHH 3PHOA 1RZ8A 1U3HB 3MLUL 5JDSB 1UENA 4DKFH 2N7BA 1ZANL 5JW5A 4RNRB 1OAUH 3D5OF 4JR9H 4KUZH 4DN4H 2BVEA 3LKQB 4M1GL 1UWXH 1VGKB 2NCMA 4XVTH 4Z0XB 2BCKB 4MX7B 4I3RH 1M05A 5C07B 1UZ8A 1GIGH 3BZEB 5E8DL 2R0ZL 5GGSA 2Y06H 3QNYA 1OP5H 4E9LA 4OD2A 5EZOH 5DMYA 2XWTA 1MJ8H 2R1XB 4ZO9A 4UT7H 3QJHB 1Z9SA 2K9UA 2E8ZA 1JV5A 4KC3B 5LWYH 1SJEB 2VL4A 4P4RB 2CDGA 5JW3L 2R8SH 5EOQL 1EK3A 1IEAB 3SDDC 1A3RL 2KDGA 5CKGA 4YDIH 3TBWA 4LDLB 1V7NL 3DYPA 4XGZA 5HHQA 3OJMB 1GYAA 3O8XC 3W0WA 1F45A 1RZIA 5I30H 4M7LL 1T2XA 5E9DD 3MUY1 2JB6B 4HCRL 4KUCD 4Y4FB 2K1MA 2VR5A 3O8XD 4WU7B 3P9LA 5HYJB 1WFTA 5KSAD 5A2IH 4OQ1A 5AZ2H 1FJ1A 1JYWA 3PWVB 1XZ0B 1EXUB 3HUJB 1KB9K 2XKNB 5DUMH 3UC0L 5ALBL 3EIFA 4JHWH 1YYMH 1YMMA 3ZDYE 5AYQA 1KIPA 4OF5A 4HLZG 4RQQB 5HHXL 3CZJA 4UTBH 1HDMB 5F8QC 2VLRB 1GZQB 4MLSA 4XMLL 4PJBA 3ARBC 3CVHL 4QRPB 3KWWA 1Z3GH 3B6SA 4ZUSA 4PYHA 2P43B 4XPBL 5C08B 4EI6A 3QUXB 1Q9WA 4AG4L 2EE6A 2PR4L 4BQ8A 1HIML 1N8ZB 3OAUL 1WVZA 3EHBD 3BRGC 3B2UC 4TUKL 4LPXA 1UCTA 4PRIA 4Y19A 4PJ8D 1AGFB 2CRYA 5HSFA 5GZOD 3KYOB 3TO4B 5HYQA 4NKQB 1NEZA 4TUOB 3T1FA 2DMCA 4EI5C 2HT3D 2YA2A 4EVNB 5MEND 4DKEL 3QIWA 3RP1A 3VI4E 1I7UA 4KRLB 2L0DA 2ORBH 3FT2B 1IGCH 1J8KA 4PJIE 3MV8B 1AXSB 2Y9RT 4G6FB 1DL7H 3V4PH 5DD0H 4TSBH 4IOIA 3IFPB 1RQ5A 1CF8H 5LGHL 5H2BA 3NPZB 1YNLH 3OZ9H 4M7KL 4NO5B 1OQXA 1HCVA 4LQ1A 5F1OB 2H6PB 2WWKT 3BKJL 3PABB 2J12B 2FLRT 1S9XA 1G7JB 4WIQA 4PFEA 2AJSH 4P5KA 3E1F1 4JPIB 4LSVL 4ORZC 5JW4R 4AL8H 3T8XA 3O3EA 2EZ0C 4HMCA 4YXLL 4L8CB 3NAAH 2F8VA 3PWJB 4UTAH 4JFZH 2AJZA 2ICCA 3E2HC 4FZ8H 2Q6WA 3WS3B 2IGFL 4GRMB 2CKNA 2ZOKB 3T2NH 5DMGD 3CX5J 4PJCB 5HXMA 3S34H 3PGFH 3O6KL 3MBXH 4MD4A 1JN6A 2EZ0D 3VDBA 3O3BB 4QRSA 5GSRB 1BOGA 4D9LL 3LKOA 3BHBA 5I17A 3QCVL 3PNWA 1HHGA 2ATKB 1J8HE 5E6IB 3B3IB 1FV1A 3IFNH 5C0GA 3EOYG 3V7MA 3KJ4B 1CXIA 3CC5A 4NN7B 1ZLSH 1J1OH 2XZAL 4YC2B 2RJMA 4AQOA 4NM4H 4TULH 3H7BB 1FORH 1QPPA 3OV6A 3K1KC 4LLYA 3HPLA 4PP2A 3RVVD 3VFOB 2OLDA 3W11C 4ODTL 3DSFL 4N8VB 2DQTL 4Z78A 1I7RA 4ZFOA 1JHTA 4X9BA 1JNHA 1JWSB 5E6ZA 3RIFK 2VDPL 3ARDA 3BVNA 3BGMA 5CILL 1NFDF 1TVBA 3JWNC 1MF2L 2H1PH 2DLGA 2XA8H 4MXQD 3JV5A 1EAPB 2LQRA 4PV9A 2I26N 1I1AD 3KXFE 5HJ3A 2BRRL 3BMVA 2EIEA 1WAAE 1XF3B 4UB0H 1CD1B 4YK4C 4BH7B 5JORA 3PWPE 2Z8VC 1WCBA 2XY2A 4JQIL 1OTSD 3KNBA 1ZAGA 5I16A 1OP3K 4ODXA 3MUGB 4JFOB 4NCC1 1CLOL 4H88L 5EOTA 2JIXA 12E8L 1KB5B 5IMLA 2PF6A 5D1ZC 1YQVL 2DWEA 1S8DB 2RFXB 4Z7UE 5IHUH 4P57B 4K2UL 5KVGL 1F11A 4UV7H 1MCDA 3ZTJG 1OAXL 4V1DB 4RMTA 3PWNA 5J12C 5E00A 2ZUQC 2YUXA 4WU5B 1JGDA 5DRNB 2FX7L 1S7SA 4YEFA 2DAVA 1NBYA 4OD3H 4P2OA 3MXWL 2H2PC 4YFLF 3TIEA 1NGPL 5HHNB 2A74B 3CMOH 4O5LH 3BT2L 4MAYB 1JYXA 2GITA 1DBKH 3DXAE 4P9HH 4HGWB 3BAEH 3GIZH 2H2PD 1ZGLA 3LN5A 2D31A 2O5YL 3MRJB 1T1XA 4OZ4A 3VXNA 2HFGH 3C87A 4PREA 5KVDH 5I1LB 4NGHL 2GK0B 3TJHD 3WFDH 4NZJA 1DEEA 4G6JH 4X4XB 5ICZA 4M7LT 3FB5A 4YE4L 4NZUL 1MAMH 2EEAA 2DBJA 2GJ6E 1B2WL 3EGSA 1GGUA 5ACMA 3TT3L 3LKRA 3F7RA 1LE5B 3BPCA 4X6EA 4XCNA 4ENED 2BX5A 5IW6B 2DQCL 1HH6B 3G04A 3UTSD 5GS1C 1Y6KR 2GY7B 4H0GA 1NUFA 1CFVL 5T3ZE 2O5ZH 1MJJB 3FB6A 3LMJL 1IC7H 1XGQB 5F89B 4U05A 2CRIA 4OCYL 5K33A 5IG7A 3DTXA 5F72S 3KPRB 3MRBA 3IGAB 1HNGA 2UZXB 3MLVL 2JJTA 4PJAE 3GSWA 3LRSB 4K94H 2E6PA 5L0QC 2WBJC 1F4YH 1UEMA 3O6FA 1P4IL 1U6AH 4JCLA 1JRHH 4G5ZH 4ZFOL 4Q0XL 1XF5A 3FFCB 3HE7C 4P59L 3ECBA 4OLVL 5D7KD 1T5XB 1IKNA 1LD9B 5HGBA 1MREL 1CU4H 4UIKH 3D69A 3U30C 3D25B 4Y5VC 1QRKA 4FTVB 4PJEF 3HE7D 1I8IB 4FQQB 4BSWA 1A1NA 1QLRB 3RKPA 5CP7B 5DRXA 5GZND 5KSVA 4XBPB 4QF1B 4TNVK 4APQA 3WLBB 1GJIA 4L3EE 1I1RA 4WWID 1GC1H 1WK0A 4GRWB 4EIZC 2B0SH 5EC1A 4ZAKD 3QUZC 3LDBC 1PSKH 4HQQL 1A6TA 1J8HA 5FM8A 1WEJL 3JUYA 1VSCA 3ARTA 4L8SB 2VQ1A 4QRTB 4HS6A 3GBML 1I7TB 5KSBE 2OJZL 2BSED 3B83A 1S7UB 5J9PB 5C0RL 3KPMB 3CVHB 3MJ6A 4KROB 3JVGA 3SDYH 5C7XL 4QRQB 5CSGA 4N5EC 3NTCH 5C8JA 5JIIA 2VITA 1R3IL 2IFGA 3RKDC 4G8IA 2EC9T 2YC1B 4D0CA 3K8LA 3CSPA 1OSZB 4OZGE 3O0RH 3S5LB 1MFAL 3OG4B 1LEIA 1JI1A 3VWKC 3MRDA 4KMTL 5IROC 3QWRA 3ARQA 3D3VA 5I1GL 1KTRL 3RZCB 4MNQE 4ELMB 4BUGA 3IJHA 3KXFA 3V4VL 1I8KA 2H3NA 3MFFB 1K3IA 4P0DA 2FBOJ 2VLJE 3BPNB 4NKMA 2R2EA 3HI1A 3X3FH 1OLLA 2A38A 4Z77B 3PHOB 4ZTOL 1RZ8B 4UIMA 4X4YA 3HS0A 5IF0B 4KZEH 5JW5B 1AO7A 4Z7QF 2AJVH 5LAXA 1VGEL 4F58L 4JREC 4JKMA 1W72A 4F7MA 4X6FA 4OLYH 1QFOA 4FG6C 3SPVA 1UZ8B 4Z7UA 4OV5B 3W9EA 2JJVA 1I9EA 3WIHH 4NJAH 3MCG1 2I27N 3QNYB 4K7PH 4FNLH 4OD2B 4R96A 3KLAA 2MPAL 4ZUTA 2HG5B 3Q1SH 2XWTB 2CO7B 4OTXL 3MLYH 3FN9A 4NQEE 2Q86A 1W8NA 5D96B 3LV3B 3STLB 1JV5B 2DQHH 1V3KA 3BOVA 3H9SE 3MA7A 1QR1A 2G5BA 3S3SA 5CJXC 1L0QA 5LBSL 3DXAA 3QQ4A 3TBWB 1IAMA 4GAFB 4XGZB 1RUKH 4I3SL 4JPWL 1CXLA 1BX2A 4M5YL 2D7PA 4K71B 4GRWH 1AY1L 1RZIB 5IW1A 2EDOA 4WV1C 3FKUS 3TYGL 5F71A 2EDWA 4NQDB 5F1SA 3NIFF 4GAGH 4N0UA 2B5IC 3SHSA 1D9KA 1OP3H 1G7LB 2BNRB 2FD6H 3P9LB 2AQ3A 4XMLH 3A67H 1FJ1B 5D2NB 5E7BA 4JLRA 1VKXB 4IRJC 4JM2F 1OGAD 4BZ1H 2BVPB 2QHRL 4K3HA 1KJMA 4J7RA 5B8CA 1X5AA 3RDTC 1ACYL 4XNXL 4LLQA 1KIPB 4NFCA 1TJIL 1QUNA 1MI5E 1WZKA 1MVUA 4HKXB 4PJBB 4PJAA 5DLML 3VRJA 4QRRE 4JQVA 3B6SB 4WI8A 4J4PD 4ZUSB 1X5XA 3VXTA 4YHLH 4K23L 3GB7A 1F6FB 4DAGL 1Q9WB 4OCLC 4WFFE 3G6JB 1FO0L 3QWQB 5EO1A 4GG6F 4KKCD 4HIJB 4XAWH 5D7IE 5GGTH 5LGHH 4Y19B 2R1YB 1J1PL 1I8MB 2F53E 5TPWL 5DA0B 5HYQB 2F74A 1NEZB 4CDHA 4JFFB 1HXYA 4HK3N 5DMIL 1JIBA 5DD5L 2YD6A 1I7UB 3BKJH 3SEPA 1AD0A 3W9DA 5IMMA 1RUPH 1DFBL 4OZFG 1MWAH 4NIKB 5FYJU 3NMEA 1G7IB 1OSPH 4HIEB 4JRYD 3PXJA 3LQAL 1C08A 2ARWA 3O6KH 4G7YL 3UYPA 3P77B 3C6SB 3V0AC 4GRLD 3QWOA 3O3EB 2XWBB 1K8DA 4OZGA 2VDOH 5GS0H 3V6BR 2WAHA 1HOCB 4OGAD 2Q6WB 1T7WA 5EO9A 1EUTA 1XH3A 3MOBL 5F9OL 1JNNL 2RIKA 3NA9L 4MD4B 2JF1A 5IMKA 4IEFB 4MNGA 1LEKA 1BOGB 3V6OC 5ESAB 3BHBB 5I17B 1C7SA 3PNWB 3CVIL 1KLUA 4MYWB 3KYKL 2YSSB 1HHGB 3U0PB 4DCQB 2VLJA 3V0VB 1E0OB 2CLVB 5I1AB 5CEZD 1FV1B 3MJ8B 3UJJH 3DHJA 1XAUA 4PLKD 3T04D 3SO3B 2D7TH 2XTJD 2YEZA 5DJYA 2YHGA 1QYGL 4GAJL 2W9LA 3TZVA 1ONQA 4UT6L 3AROA 3HPLB 4PP2B 2AI0H 2NY6C 5DDHA 4B7LA 5C0NC 4U0RC 4Z78B 1I7RB 1NLBL 1PEWA 1ZVYA 3EDDA 4JG0H 4L1HA 4ZFOB 5DQJA 3ZDZF 3ARDB 3EO0A 1DN2A 2EKSB 1JVKA 3BGMB 2GTWA 5FGRA 5T3ZL 2PXYA 4ISVA 3X13A 1HKFA 5IGXH 1A6AB 1CLOH 1F13A 4F2MA 2Q87A 2A9NL 1GOFA 1I9IH 5FK9B 1RK1B 1BQLL 3WD5L 5HJ3B 3EOAB 4I0PD 4DKDC 3VFTA 2BDNH 4A6YA 1CDCA 4WI4A 3VXSE 2JK5A 3GUTA 2DICA 4WW2F 5JORB 5I75B 3WLWC 4NBZB 3WS6C 1WCBB 4XWOC 4QYOA 4MWFA 3U7AA 5IBLC 3KNBB 3GSNH 1NCBH 5I16B 1KB9J 3BQUA 4ODXB 1CLZL 2FX7H 1VEMA 2Z91A 1YNTA 1N2RA 1I1CA 5EOTB 1NAMH 2IBZX 5EIIB 2JIXB 3MXWH 3GK8L 5IMLB 2YUZA 5E94A 5IJKC 3NN8A 4S10A 2NXZD 3ULUD 5A2LH 5AEAA 3T3ME 1FVDA 3LEVH 3PWNB 3B2VL 2DIAA 3QI9D 1JGDB 1REIA 6FABH 1B3JA 1S7SB 3SKUD 4LBEA 4LMQI 4P2OB 5CGYC 5TDPB 3TIEB 1LEGA 3RAJL 4M6OL 4UDUA 5C0AD 5LQBH 4YE4H 3PL6A 3RTQD 2NXYC 2KBGA 3BH8B 4X8JA 5FUOL 2GITB 1JWMB 4XMPH 1JMXA 2IWGA 5MENE 2QQNH 4LSQH 4P46D 4YBLC 5B4MD 3TT3H 4C55A 5DXWA 3RY6C 4X6CE 1ZGLB 3LN5B 2C1PA 1GOGA 1JHLL 1T1XB 3U83A 3VXNB 1QFUL 4EN3C 3NCJL 2FECL 4PREB 4YPGB 1DEEB 3RZWA 5ICZB 2OTWA 1A7NL 3FB5B 3LMJH 3HNTL 3H3PL 4HIXL 3B5GA 3LRHA 1P4BH 4O02H 3GGWA 3IJYB 3EGSB 2R4SH 2VXQL 3A6OA 2VH5L 5E5UB 1MAKA 4NN5C 2PN5A 4X6EB 4XCNB 3SDCA 4M7ZC 1XR8A 1P4IH 4QHMB 4WFGD 5KTEL 1JF6A 1CD8A 4KHTH 4PJIB 3X3GL 3SCMA 3MACL 3FAWA 3B9KA 4PTTB 3EYSH 1WSST 3MRBB 2XWJA 3LKSA 2NY5H 4OI9A 4KVCL 3TT1H 2ADJA 1CIDA 2BVYA 2F5BL 3BEVA 2VUOA 4KDTC 3PIQA 1ZHKB 4LEOA 4OI8A 4OLXH 3DGGB 4PLJC 1XF5B 3OJ2C 5FGCE 4EDXA 1RMFH 1UJ3C 3WIIH 5HGBB 2FX9L 4WO4A 4I0CC 1HI6A 3EYVA 3QDGD 5TDOA 2WIIA 1FAIH 4JPVL 4BA8A 4LCUA 4BSWB 1A1NB 1U8MB 4ZXBC 2DQDH 5KSVB 1A6WL 2CQVA 4GW5B 4ODHH 4N1HB 3MLWH 3SKJL 1X5FA 4A6YL 1LDPH 3GO1H 5KVFH 4PBWD 5EC1B 3I02A 1I1FA 3QUYB 1A6TB 1JGVH 1J8HB 1S7WB 1L7TL 4ZXBD 3AB0B 4M43H 3TEUA 4DGYL 5HVHC 5JIPA 2FBJL 3F7PC 3L3DB 3T0WA 1MJ7H 1V3LA 2B1AL 2VQ1B 3FHAA 2D4FA 1U36A 3DIFB 3LPFA 5I1CH 4R8WH 4E5XA 3BDYL 2MQCA 1TZIA 3ZE2E 5B3JF 5HPOA 1X6LA 1EJOH 5EO0B 3MXVL 3PDDA 2VITB 4RMWA 1A0QL 4NWUL 3RGHA 4G8IB 3L1OL 4Q9BA 1TCMA 4PGDA 4D0CB 4RA0C 3IDUA 1R3KA 1FO0B 5JQHC 1A8JH 2NY0B 1ZLVK 1CR9L 4NQXB 1LEIB 3SDDA 4OZFA 3MX0A 5DRZA 3MRDB 3HB3C 4MS8C 5IUSA 3VA6A 1ETZA 1ZVSA 4JFDD 3O8XA 3T65A 3MRFA 2Y6SD 4K8RL 1MJUH 3IJHB 1JPGA 3KXFB 3WUWG 5T1DH 1I8KB 3N1FC 2H3NB 1EGJH 1Q1JH 2CIKA 2H32B 3NFPA 4MS8D 4NKMB 3VXSA 2R2EB 3HI1B 1T2QL 3PWPB 4OFPA 3GI8L 4WUKL 3TJEL 2AAVA 3GRWA 2V6HA 4P49A 3D2UA 4EOWL 4X4YB 3HS0B 4JFQA 1CFBA 2Z0BA 4HK0B 2W65A 5DHVB 5LAXB 3BP6A 4F7MB 4IDJL 4X6FB 2WBWB 3SPVB 4Z7UB 2IPKA 3FQWB 3KPQA 2GIYA 5CZVL 1UWGH 5F7EL 3MOAL 4WEMB 4R96B 3KLAB 4ZUTB 4WHTA 1IGJA 3BGFC 4W81A 4NJ9L 4UQ2A 3ARBA 1H9VA 3ME0A 4NPYA 1AY1H 4K9EC 5DA4A 4J3UA 2Q86B 1HHHA 1BFVL 2HWZL 5DJXB 4KGLA 2QQKL 3DUSA 3DMMC 1QR1B 1N7ML 4U1JA 4DQOH 3QIUC 3DXAB 3O11A 1F3JB 4LASL 1HN1A 5KS9E 3QQ4B 2BY0A 2HRLA 3UTSE 4D9RE 5TFSL 1KFAH 3N1GC 4X6CA 1FFRA 1BX2B 4QXUL 4U7MA 4EI5A 3FHQA 3GIVA 3D9AL 4BQBA 1ACYH 4Y4KD 3FN0H 4LAQL 1G7QA 2H9GA 1FLRH 2GJ6B 3LH2H 2VABA 2H45A 1D9KB 1A3LH 4URTB 1SJHB 5F96L 2LABA 3EZJB 4CUCA 2Q1EA 4PRPD 4JLRB 4Y16B 5D7KE 1KJMB 4KKAD 5EZLB 2NTFA 4K23H 5B8CB 3STZA 5EU4A 4S11A 4RIRA 4LVEA 3DUUA 3ZTNL 4WJ5A 4G6AD 1J05A 5HY9A 2HJFB 4HF5L 1MVUB 5GGQL 8CGTA 1AD9A 4PJAB 1DQJB 3VRJB 2OSLA 1JGLL 2A0LC 3ILQD 4N1EA 5DD1L 4JKKA 5DMIH 4WWKD 4F7TA 2VAAA 3O4OC 3TBTA 3VXTB 3RU8L 4H8WH 4JJHA 1Q38A 5KJRH 1ERNA 5ESVA 5H94A 2H32H 1FCGA 3P0VH 1GPOH 4LEXH 1E6OL 3QCTH 3P0YH 4XBEL 5A3ID 4CMHB 4KHXL 5E99L 3ZO0A 5DGRA 2LAGB 2F74B 5DHVH 4NN6C 1HXYB 4YEEA 5I66A 2WWKO 4MA7H 4QY8A 3KPNA 1IT9L 4G7YH 2VKXA 1MFDH 3LEYL 4L3EB 5IMMB 3RX7A 2Y23A 3AREC 4OCRH 1A64A 4YDLB 2N7AA 3X12B 1NGYA 5EWIL 4N9GB 4Z0BH 2CXKA 5A43C 1U0QA 3V4UL 4JFYB 5KSBB 1T7VA 1WFOA 1HH9A 3VGAB 3DARA 5BMFH 1I9JL 3MLSL 4JPKH 4OKVA 2HTLC 2LTQC 1QKZH 4UUJA 2EDNA 3VFVA 5ADOH 3QWOB 1B0GB 5FO8B 1EEZA 1K8DB 4U6XB 4OZGB 4DK3A 3EJYC 2PO6C 2CRMA 5EO9B 1XH3B 5DUPH 1VFBA 4GLRI 5ADPH 2CJUH 1K3ZA 4QNPE 3UXFA 2GCYB 3HC4L 1QYGH 2Q3AA 1RUMH 2XN9D 2VZOA 3V7AG 4IIQB 1KLUB 1MHHA 2HRPH 2VLJB 4LLDB 5D1ZA 1JGUL 3V0WL 4J2XA 1QFWL 4X7TA 2NY3D 5SWZE 5C1MB 1Q72L 2WBKA 5DJYB 4BKLA 3G08A 4G8GA 5IVZA 1MQKL 3TZVB 3NCYS 2ESVD 1C5CL 4MA1B 4POYA 5DDHB 5E1AA 3S36X 5D7SL 5LVEA 1QPXA 2X10A 3NFSL 3P73A 5DQJB 5F6IB 3L5WA 5HHPA 1ES0B 3T4YB 4JY5H 3CDFA 3MRCB 4ISVB 1JHKL 1UKTA 3LS5L 4XPHH 2R0WH 3C9NA 5DHXB 2HLAA 4NQEB 1RJCA 1P7KB 3IDGA 5JHDE 3RGVC 4EQ2A 1NMAL 5KN5A 3GK8H 3HUJF 4RX4A 1ZLVH 2FB4L 3H9SB 3GI9H 4YHIA 1HILA 3JWOC 4A6YB 4L3CA 3BKMH 1F58L 3MRKA 3GUTB 5HYIA 4QGYA 3IDMA 4JQXC 4QYOB 4MWFB 3T0ED 3BQUB 3EJZC 3EOBA 4K3JH 1YNTB 2VDRH 1MCHA 5GS1A 4OZIE 5IK3A 2MTPA 3FQTA 5HDBF 4MCYB 3NN8B 4PRHD 1K5NB 5JXED 5FUOH 1FVDB 4ZDHB 3TA3C 3V7AE 4DW2L 5M95B 3SE9H 3WUWA 4NKIH 3LZFH 1H15B 1C16A 1OTTC 5JQ6H 1JHLH 3NCYP 5JUEH 4ZPTA 3HZKB 2X09A 2WBJA 3QXAB 5BVPH 3HNTH 2NQCA 1JZ8A 3NGBC 4X8JB 2Y07H 4XCFH 5D6CA 3WE6A 2X2YA 4NBXB 1MI5B 4YBHA 5EUOE 5IV2B 3TBYA 3I2CH 3RVUC 3ARPA 5E8NA 1P7QA 4QRRB 4Y5VA 5J1TC 4L29A 3V5KA 2J4WH 2EDJA 1QVOA 4AJ0A 3NZ8B 3TIDA 1MEXH 3UTQB 1GZPA 2OTWB 4P9MH 4CJ0A 4OUOA 2VXVH 1S78C 5IB4B 1UCBL 3O81A 3GGWB 1IM3A 2Z4QB 2K7PA 3RL1B 2FSEA 4JRYE 2WINA 4NNYA 3QUZA 5ENWB 3RFZC 3HG1E 5L6YL 4IRSD 3SDCB 1DBBL 4HUUA 2ZUVA 1KT2A 3WFCL 3FO0L 5FOBA 2WW8A 5DT1L 5I8KH 2GK2A 2FYYB 4PJCF 4TQEL 3ULVD 5ACZA 3NCBB 4GUPA 4IS6A 1NGQL 2FX9H 2XWJB 4HBCL 4TRPH 2VZTA 2ADJB 3IAGC 4LCIH 1TNMA 1U8PA 4JE4B 3BEVB 4PIRF 2IG2L 2AJUL 3UMTA 1KCUH 3PIQB 4LEOB 3VWJD 3VWKA 5IROA 3QO1A 3NZHL 3CCHA 2IALB 3F58L 3LPGA 3NIGF 1I9RH 1ZXQA 1QA9B 1A7RL 4LF3A 4MVBC 2XTJE 3HLAA 4KK5C 1CLYH 2X7LA 3P4MB 1HI6B 1NUDA 3EYVB 2VZUA 4WO4B 3V6OE 4HFUH 5DEFA 4EBQH 3U0TA 3O6ML 2FBJH 4CAGA 5IESL 3HZYB 2ZCHH 5FYJE 5KVMC 3EFDH 1N3NA 2BHZA 4M6NH 3BP5A 3DVIA 1A5FH 1OTUD 2OR9H 2VC2L 2ZKHL 1T4KA 4HT1L 1G7PA 2BY2A 3BO8B 4XI5C 2QQLL 3I02B 3E6FA 1I1FB 5E2WH 4U7KA 5H8DA 4X99A 5F9WC 2VTFA 1CGWA 1F3DH 2NY2C 1CR9H 1DN0A 5SWZA 2X1XR 1GSMA 1JPTL 2YXFA 2E27H 1KN2H 3U48A 1KPVA 4E5XB 1IAIM 2M1KA 1HKLH 4GAYA 2MCPL 5BS0D 3VW3H 4JEGB 1KTKE 4LQFL 4K8RH 4DOHE 4JGUA 2E7LC 5I71B 1N6QH 4M00A 4HJGA 4O00A 1OD9A 4XNQA 4WUKH 5TF1L 4CJ1A 3SDDB 5CJXA 5CEYA 4OZFB 5IQ7L 1T0MA 3WNMA 3G5VA 3MV9D 4F9PC 3AMLA 4M7JH 3P30L 1ETZB 1ZVSB 3JZ7A 4AT6B 3O8XB 5JHDA 1NANH 5DD6B 4YHNA 5T1MB 3VFPA 3FRUB 3C5ZD 4GOSA 4NFBA 2DM4A 5CJ5A 4C57C 2DJUA 4WV1A 3NFPB 5D7JD 1D5IL 1RY7B 3VXSB 2ZG1A 2X89D 1BWMA 5MP6H 4NHCH 3ZSTA 3MOAH 2IH3A 4JFQB 3W5MA 1FVEA 3OKNB 4XCEA 5C0AE 2CMRL 3BP6B 5IQ9A 3BD5A 1SM3L 4IRJA 4OZIA 5I74C 1PKQE 4DFHA 4YHMH 3HNSH 3RDTA 2R4RH 4KTDH 1N7MH 3KPQB 2FGZA 3KPSD 3QNXB 4LASH 4FQCH 2FZ3B 3TO2A 5CJOH 1U91B 5KVEH 2Q20A 1YNKL 4WHTB 3BN9D 1IGJB 2YD7A 3JTTA 3I6LD 4XC1L 4NYLA 2XA3A 3RPKA 4ZFGL 3IDXL 2R2CA 1HHHB 1B0RA 3ALPA 5D1QC 5HHVL 5DI8A 1T0NA 3DUSB 4CDGC 2BVUA 3CH8A 4NO0A 5DD3L 5CZXC 1Y6MR 1DQLL 1AE6L 2EH8H 1BJ1H 4BZ2H 2PYFB 3O11B 2FRGP 3QEHB 1F6AA 2VLLA 4Z7WE 1L7IL 5MENB 3FL7A 1KSRA 4WFGE 3BISA 1RVFH 4CW1A 4X6CB 5D1QD 1AXTH 1FL6A 3HR5A 2ZJSH 4CRPA 2RCSL 4EI5B 3GIVB 1G6VK 4XNZC 3LHPL 4P2RD 4JY4A 4U3XA 2DL2A 3AY4C 1G7QB 4MJIA 5IVOA 2VABB 2F54E 5L8LB 2Z92A 4BFEA 1JMZA 3HG1A 1D6EB 3OQ3B 2WM0A 4RWHA 2AXHA 3FQXA 1SBSH 3OKEA 3SE4C 1D5ZA 5HVFB 4HAFA 3RU8H 3QQNA 2F5AH 3P2TA 2FJGA 3STZB 1BJMA 3QCUL 3DUUB 1E6OH 2BSSA 1OAQH 4WJ5B 4QWWC 3ES6A 1CDUA 4FN0A 4GXVL 3VFNA 5FCSH 1V7ML 1MCKA 1QP1A 4GRWF 4M9OA 3DVFA 3B9VA 4JN2B 2OSLB 2A6KB 4UU9B 4F7TB 3QRFM 2VAAB 3OF6D 3TBTB 2HFEA 4FFYH 4LOUD 2OX5A 5H94B 1EBPA 4IJ3C 4WFHE 5FGCB 5CBEA 1E4JA 4NO2A 3V6OA 4MB4A 4LPTA 4YDKL 2AXJA 1R24A 3ARFA 5JPMA 2B4CH 7FABH 1RZKH 5I66B 3GSOA 5BZWA 4QY8B 3KPNB 2W0PA 2FJFA 1GGYA 4TSCL 1ZTXH 4OT1L 5FOJA 4F57H 1CS6A 3INUL 2EXWD 5EZJA 3HI5L 1NGYB 4HWZA 3HAEH 4R4FH 5BZDB 1GHFH 1T66D 3WKML 4D3CH 4ETQB 4LIQH 4HHAB 2ZNXA 4MZ2A 4JFDE 2KPNA 1HH9B 3HFMH 5F9AC 1HSBA 1BFOA 4PB9L 4YHOL 1KENH 4UUJB 3QQ3B 5IIEA 1NMCC 5ITFB 2HAZA 1Q0YL 3HTLX 2APBA 3PE9A 1B90A 2OL3A 3RNKA 2UVFA 1G1CA 2BXZA 1NC4A 1VFMA 4GJTB 2UZIL 5B39G 3GHEH 1VFBB 4HUWA 4CMMA 4YK4B 3U7YL 3WS6A 1KULA 5KOMC 5C0BD 5HI5C 4XH2A 3RJQB 1FZMA 1MHHB 1AC0A 4FXKA 3BE1H 2VRAA 1KJ3H 1WZMA 3G6DL 3GJFA 4LRIC 4OLUL 5D1ZB 5IJKA 4I9WE 3WDJA 4KKLD 4CVZA 5K9OA 3KLHC 4PS4L 4X7TB 3ZT7A 3IETB 1QSVA 5J06A 1JHKH 5GHWH 1IM9A 4BKLB 3CSYA 3G08B 5DQDH 5J12B 1KLGA 2ZUQB 4P3CH 3QAZC 1A6ZB 1X3DA 4PRNB 1PKQA 5E1AB 1BD2D 4I2XA 1ZA3A 4R90L 5ID1A 5C86A 4K55A 1KTDA 4GSDH 4RZCA 3DNKA 3P73B 3L5WB 1WICA 4KKNA 1WGOA 1MIEL 5HHPB 3ZKMD 1IZJA 5JHLH 5E2VH 5DS8A 2V2XB 5FDYA 3FCTA 3C9NB 3M1BA 3RY6A 2HLAB 4F15C 3RHWF 3N50A 4EN3A 4BYHA 2XRAH 2Y4SA 3PXHA 3M07A 4LARH 4ZUVA 4TNVF 5SX4H 3U1SH 3ZZ1A 1U3HC 3QFJE 5D8JL 4PJ5D 4PRPE 5KS9B 5I1IH 5F44A 1U8JA 3CH1A 3UTSB 3IDMB 4I77H 2ZOLA 3RVTC 3VFUA 4LPWA 4N8CH 4UILH 4G9FD 2EIZA 3EOBB 4OIIH 5B38G 4RISL 4KKBC 1JPFA 4PJBF 4S1SL 1RUAL 5IK3B 5DJ2B 3FQTB 3VH8G 3B43A 3FQRA 4H1LG 3GSUA 3A6CL 5FYJL 2F54A 4N90D 3QA3A 4RGMB 3G6JF 4YPJA 2W60A 3WJLC 1KCSL 2ARJQ 4ZO6A 5KZCD 1C16B 2E7BA 5T1KA 2K7QA 1E6JH 4B0MM 4DN3L 5L0QB 3WXWL 2WBJB 4KDTA 1KV3A 2DQJH 4XHJD 4Z7NF 1XGPA 1INQA 1A7PL 1BEYL 3FRPG 2WMPA 3HE7B 3AS3A 4OQTH 1UJ3A 1C5DA 4NRXA 2AJXL 3TBYB 2FDBP 4Y5VB 3L3IA 3V5KB 1F3DJ 4X5XA 4X8XA 5JLZA 3CJJA 4ZAKB 1GZPB 2OL3L 1MSPA 1MCLA 4L9DA 2IJ0C 3C60C 1FYTE 4ZXBA 4TVPD 1EV2E 5HGDA 3WNOA 4HBCH 2W0KA 3QUZB 4K3DL 3LDBB 1X5LA 3HE6C 3C60D 4HAGA 4HUUB 3NIFE 4X80H 4JG1H 1KT2B 1UACL 3CPLA 1XGUA 1UQSA 3RVXC 1QG3A 4XB8A 4RFNC 5FOBB 3D39D 5F7WC 2Q8AL 2ITDA 5C6TL 3RBGA 5SWQA 5ACZB 1A9BA 4Y0GA 4GUPB 4LFHD 5CCKH 2BMKB 1ND0A 4N9OB 3QUXC 1CK0H 2EYTA 1U8PB 4XPAL 3NACL 5IESH 2ZWLT 4JFDA 2XN9E 4O58L 2R69L 1LE9A 2FATH 2FHCA 2AGJL 3VWKB 4X7DC 3CCHB 1KCKA 4WDIA 3TO4C 4LCYA 4LF3B 3HLAB 5CSBA 4DEPC 3U0TB 1B4JL 2E9WA 4NNPH 3QB7C 2OQJA 4JM4L 2ESVE 1CICD 2R15A 3KHOA 5GJSL 3D0VA 2XG4A 5IB5B 1N3NB 5GGUA 3S36L 3C6LD 4Q9CA 3M8OL 2CIIA 2F19L 1T4KB 4PJEA 1DP0A 1G7PB 4M1CC 1MHCB 4XVSL 4CADA 5L9DH 3PDOB 3E6FB 3F6IA 1F90L 4B41A 2W9EL 1BJ1J 5TF1H 1DN0B 1R3JB 5SWZB 3CD4A 4ERSH 5IQ7H 1KPVB 1RZ7L 1W2KT 4F7EA 3VXRD 4EXKA 4GAYB 1G9NH 1NCDH 1FC2D 5E95B 1HHKA 1F3RB 2D03L 3IXTA 2PYEA 3NA4A 4O51A 4LLVB 5C09A 4P9HC 4GO6B 4TUJA 1ZA6B 1RU9H 2CXGA 3PGDA 1T03H 4XNQB 2P24B 3DMMA 3UX9B 3QIUA 5CD5C 2P5WE 2WP3T 3G5VB 1BFTA 4NP4H 1S5IH 5T1LD 2EYRA 2W92A 4PRHE 1OAKH 3GMOA 4LLWA 5JHDB 4S1DC 2IMNA 1KXQE 4L1DA 2AK1H 5E2TH 3VFPB 4FP8H 4TPRH 3QFJA 1JUFA 1PG7H 4WV1B 2XOTA 4X5WA 1QNZL 3HMWH 3IAPA 2DQGH 2B5IB 1UXWB 2YPKA 1MAJA 4M6MH 3ZDYF 5JPNA 2IH3B 2G5RA 1YNKH 1FVEB 4XCEB 2DM7A 2DIBA 3IFLH 1FL5A 1LO2L 1JNLH 5B39A 4OZIB 3FONA 3I3DA 4XVUD 3ZE1F 2OTUB 3DO3A 1YC7A 2FECI 2XTLA 3F5WA 2J88L 3BKCL 5LG1A 5TE4H 3DRQA 3BPOC 4KPHL 4K94C 3HA0A 4GMTH 2HLFD 3TO2B 1I85C 5FUZL 1FNGB 4P99A 4JO2H 2DJ4A 4ZPVA 1MHPL 4TOYH 4QHLA 1ZGLM 2LV4A 2P48B 2A83A 5C0CE 1QLEL 4G8EA 4NYLB 2C1OA 3LHPH 1B0RB 1E4KC 4HDIB 1T0NB 5C2BL 3VI4F 4S0TD 4LU5L 3SDAD 2C3WA 4PJIF 1F6AB 5EUOB 3HMXH 1EO8L 1BM3L 4CW1B 3H9ZA 1FL6B 2ILLA 3HR5B 4NQCA 3ULVE 1FIEA 1DBML 1RFDH 1BHGA 1GC1C 1VHPA 4R7DA 3UZQA 5EU3A 2XPGB 1FYTA 1KEGH 4JY4B 5HI4C 2HKHL 5I9QB 3MRHB 3C08H 1X7QB 4XAKE 1KPUA 4JRYB 4U1LA 1WZ1L 4GXVH 3AREA 2OK0H 1QSFD 2CUHA 3MRLA 3WNPA 3O45B 3GMPA 3HG1B 1NBVL 1DJSA 2F8XC 4HW6A 4ALAL 2QR0A 3IU4L 3FQXB 4IRZH 5HI4D 4WEBH 3WL9A 1QBLH 5CSZA 3CFCH 3OKEB 4YHKL 2AEQH 3R06A 2GT9A 3BW9B 3UO1L 4FRWA 2FJGB 1R3LA 1A7QH 4JB9H 2D7MA 1SMOA 1OAYH 1KIQB 2BSSB 3LIZH 5B38A 1T7YA 3C8KA 3ES6B 3VFNB 4OLWH 3SOBH 4LVHB 2G60H 1RZJH 3VH8A 4R0LC 5J3HD 2WUBL 4H1LA 2YK1L 2XN9A 2NR6D 2PO6A 2HFEB 4K9EL 2X4NA 2EDYA 3BJLA 2IF7A 2V5YA 5EOCL 5CBEB 5JA9A 2AXGA 1X6NA 4OCWH 2XTJB 5ALCL 3OBAA 3D87B 3WKMH 2J2ZA 4FZEL 1QZ1A 1R24B 1HXMB 2ESVA 4KK9D 1S5HA 2ED7A 3PJSA 5BS0E 5IVXE 4OGYH 3UZEA 4EIGB 1U93A 4PJ9D 3V5DA 2FJFB 2VLMD 3ZDXE 4PB9H 5JA8B 1DTUA 25C8L 4YHOH 3TWCH 3NABH 1EMTL 5EZJB 5MHSD 4HWZB 1MCRA 3MJ9H 1VERA 4HJ0D 3WNLA 4BFBD 3QZWG 4U0RB 4TNWK 1MCEA 4HC1A 5ICYA 1WAAF 4W6WB 5F7HA 2HT2C 3U7YH 3MROB 5DVKA 1HSBB 3F7QA 1BFOB 5HDLA 1CE1H 1KIRA 4BQ6A 1PZ5A 3UPRA 3TNMB 4QOKE 4DOHB 4JFXB 3KJ6L 2OL3B 3RGVA 4XWGH 2GKIA 1MQ8A 2ZUUA 3D18A 1NC4B 4WW1A 4CNIA 1NANI 4Z7UF 4HUWB 3SE3C 4CMMB 1N5AA 2H8PB 1Q9KB 1X5KA 2P5WA 1SY6L 4JQXA 1TDQA 3KPSE 4AMKH 4XRCA 1T6WA 4XH2B 1NCAL 4H5SB 1FZMB 4LPVA 4OD1L 3FTGA 5D7LA 4FXKB 3GJFB 3M17A 1RZFL 4CVZB 1P4LA 5J6GB 1X5IA 1FFNA 3TA3A 2VAJA 4KRPD 5C0AB 3CSYB 4WRLA 5D70L 1KLGB 4U6YB 2EC9U 2M8XA 1PKQB 5GJTL 3ZYZA 4E42A 3MA9L 4EQ3A 1IBGL 1ZA3B 4P23C 1KTDB 4RZCB 5B3NA 5I19L 1QSEA 3IFOA 1EVTC 1CFSA 4N0CC 4MQSB 3TFKC 4LKXB 3A6BH 1UM5L 3PQYD 4G6ML 4JO3H 3BD4A 4P23D 4YBLB 1TQCC 1IGIH 5CEZH 5C0CA 2A77H 4YUEH 3ULSB 4YGAB 2QL1A 2YMXL 4EN3B 3FB8A 2HTKD 4O2CA 5ICXA 4R4BA 2VZ3A 2DKSA 5F7KC 3OB0H 4Z7WB 1U8JB 3ARGC 3OKYA 3P11L 1FGVL 3SGJC 4NN5B 2Z93A 3S88H 1JPFB 3VJ6A 4PJAF 3ZHKA 4HX1B 2ZPKL 4M7ZB 1DQDL 3FQRB 2HVJA 3C5SA 4F7CA 1OOAA 4IOFD 4FABL 4P4KD 2F54B 4HXAL 5IHBA 2W60B 4ONFH 5D96C 3O9WC 3V52H 2NZIA 5F97E 1FG2B 5T1KB 4I8DA 4S1QH 3SQOL 2ICWJ 2BERA 5DJ8B 2V2TA 5D9SA 1J0ZA 4NKOB 1XGPB 1INQB 2DQUH 3IU3B 1G6RA 1M1SA 1VB9A 1DQTA 2MSPA 4HC1L 4QLRA 4FXLA 1NCWH 4ZD3H 2X41A 1C5DB 4XPTL 4NZRH 4U1HB 4NRXB 3TM6A 3E3QC 1AJ7L 2DLFL 2LU7A 4HH9A 1KC5H 3ULUH 5BV7H 4RMUA 5GS0D 5JLZB 5BQ7A 2HVKA 2YPVH 5HDOA 3S37H 2FEDC 5KSBF 1F42A 2I24N 1MFCH 4ZXBB 2CPCA 2ID5A 4FMFA 2P7TA 4E0RB 1SEBB 4Q9QH 3B9DA 1MCOH 5D2NC 3JWOL 1H3GA 4NCC2 5FGBC 4KVNH 4LRNL 5HVHB 3H8NA 5GISL 3CSGA 4KV5E 4HWBA 4OZGF 4R97B 3CPLB 1XGUB 4RAUA 1UQSB 4WI9A 1FLTX 4NHUB 3S7GA 3W82A 1H3PH 4XNYH 1A9BB 4Q2ZA 1ZOXA 1M6OB 4WGVB 1CGUA 2NNAB 4A2MA 5EB9A 3OXRA 4NFDA 1ND0B 4XNMB 2E7LA 1IQWL 1FGNL 2DMKA 3EYUL 2QBWA 4HKJA 1B88A 1GCFA 4JFDB 1EPFA 2R29H 2ZCKH 1KEML 2AV1B 5C0BE 1UM4H 4NBYB 1WIPA 2BSRA 4YFEA 1FNLA 4WUUD 5FM4A 1I3UA 5HGHA 4QOKA 1X9QA 4F9PA 4QO1A 4LCYB 1NSNH 4WI2A 1J0HA 1DANT 3BKYL 4QT5A 2C3GA 2R2BA 2W9EH 2EIBA 5AWNH 2OQJB 3OHXA 3U7WL 3TP4A 4CU6A 1EHLL 5AD0A 1BD2E 3OKDA 3W2DL 4KGJA 1D3CA 4IMLB 2X4OB 2CIIB 3WXVL 3KPSA 4HG4K 2Z8RA 3K4DA 15C8L 3QUMA 4OFYA 1HYSD 5I1HL 1I3RB 2FIRT 3JV0A 1FP5A 5JW4Q 5GGVH 3ULVL 1CBVL 4LMQE 1U3YA 2A9MH 3QEQA 2APXA 2C4FT 3BEWB 4PJ7E 2P5ED 4CVUA 3BGFB 2YBRB 4D9QE 1HHIA 1NMBL 2IBBA 5E56A 5CIPH 1DUYA 4O51B 5FDWA 1T1ZA 3KPPA 4WTXA 1OWRM 5D1QA 4G9FE 5TH2A 1YDPB 3PGDB 2W07A 2BOBB 1UG9A 2X4TA 3DMMB 1EFXD 4Y89A 5EH1A 3QIUB 5SX4I 1U95A 4Y4KB 3QZWA 2LU3A 1G6RL 2EYRB 3QDMD 3GMOB 5DFWH 4LLWB 2FJHA 2GSIA 4NOBA 3QFJB 1JUFB 4X5WB 4PRPB 3AY4A 3L7EA 2AJYL 3T77A 2YPKB 1CL7H 3CU7A 1MCCA 5E0QA 2VB5A 5DYOA 4POZD 4Q9RL 5DK3A 5B39B 1HEZA 2IQ9L 3H3KA 3SE4A 2BC4A 5F1NB 1N64L 3GNMH 5K9KA 5EC2A 3F5WB 2NY5C 3H6JA 5E1HB 3VFWA 3FMGL 3CFDB 1PY4A 4HWBL 4UT9L 3S3PA 4XP1H 3ET9F 2BFVL 5D7IF 4QHLB 5T5NF 2A83B 5CUSH 3QIBD 4G8EB 1FFPB 4ZTPH 1YEIL 5FYKH 1DBAH 3O4OB 5I75C 2VZVA 1H8OA 3GMRA 3DPBA 2HKHH 1NDMA 3VD7A 1YYLH 4G6KL 1GAFH 2J8OA 4JFED 3ZT6A 4HUNB 4K7PX 3OAYK 3D39E 3Q48A 4FQLL 3V9FA 3CZFA 4DZ8A 3AC0A 5DO2C 4R7DB 2OP4L 5EU3B 3JV4B 4HXBL 1JBJA 1ACZA 1INEH 3KYNA 1FYTB 5TQ0L 1OAZH 1BAFH 2J5LC 3FOMA 4PR5B 5DJCA 3MRLB 4Q6IC 3GMPB 2QADC 5DMJB 2QR0B 2DQIH 2IAMC 3THMH 5AYUL 4Z8FL 1BBDH 3LEXA 3FZUD 3WL9B 4LHUD 2GT9B 3QUML 4F80A 1N6UA 1R3LB 1C1EL 3NCEB 5ELIA 2JJWA 3WEXA 2I07A 4YO0B 4PLNC 2LTQB 2IAMD 3DVGA 5TQ2H 1AR1D 3HZVB 3PP3K 5F3HA 5F1IA 4Y1AE 3VH8B 1BQHG 1AKJA 5DFVC 4H1LB 4NT6B 2XN9B 2PO6B 4P48A 1QRND 3S8WA 2V2WA 2X4NB 4NC1C 4XPGL 4ONOA 2ICWI 2XZZA 5IEKA 1U8QB 1DSFL 1EMTH 1KCVL 1XCQA 3VG0H 1NFIB 3ZKNC 4WTZG 5IW3A 1AQDA 3GKWH 3QULB 5FB8B 1OARH 3MLRH 3VXRE 2ESVB 5E8OA 4LRIA 4XP6H 1AHWC 3PJSB 1R5VA 3L9RA 2JKXA 1K6QL 1U93B 4DVRH 5H35A 1WCQA 4HWEL 4QGTA 2QKIA 2X5PA 2OZ4A 1GGCL 4HKZA 4KQ4H 3GMNA 4HGMA 4NQSA 5MEOA 2R0LL 5GRVK 4XTRC 2DLIA 4KUCF 1F4AA 1INDH 1UH2A 1U2HA 1OB1A 3ETBF 4LCWA 4PGBA 1IC4H 1TETL 5DWUH 3HC0A 2V7NB 4ZNEE 3HHRB 1FRGL 5E7FA 1MFEL 3SKMA 1C7TA 3SBWC 1MOEA 3ZKXC 3UPRB 1C5BL 1MCNA 1KF9B 1CGXA 2X1WL 5E8EB 1SMAA 2J7LA 3RGVB 3Q6GL 5E08L 1ZT7A 3D18B 1U3HA 4ODBD 2XQBL 1CVSC 4KRMB 4WW1B 5JDSA 5BRZE 4HPYL 3AGVA 1IGFL 1PGRB 3MJ7A 3WBDA 2AABH 4ZUUB 1BF2A 2X44D 2P5WB 3T3MF 3RIAF 1WIUA 3LKQA 4JJ5A 4OCXH 3SGKC 1VGKA 5IR1A 1WC7A 3QUYC 5LCVL 5GRJL 4MX7A 4PRHB 1JZ4A 4XRCB 4O4YL 4DK6A 3BZEA 4F7PA 2CO6B 3UAJC 2GY5A 1PJ9A 2EC8A 3Q5OA 4HS3A 1TJHL 1HE7A 4JO4H 3M17B 3WO4C 5I1JL 4NNXA 4PP1C 4DKFL 4GH7B 5ISZE 3K7UA 2AJ3B 2R1XA 5E2UH 4NUGH 4ZQKB 1OAUL 3EDJA 4JR9L 4KUZL 4P2QE 3TPUA 3TA3B 4DN4L 1QBBA 3DX8B 1XIWC 3WJLA 5C0JB 4JZNA 5A16A 4I3RL 4NM8H 4X6CF 1GIGL 1RSFA 4E42B 3N0PB 2X1OA 1QR4A 3IFOB 5DEGB 1TCRB 1YY8B 1CFSB 5EZOL 2QSQA 5A1AA 1OW0C 3P11H 1NAKH 3NGBB 3V79C 1MJ8L 3L5XL 4UT7L 2FCBA 4H8WC 5HD8D 3VXUD 1S9YB 2PETA 1BVKB 2BVOA 5C0CB 5LWYL 4WNQA 4AEEA 1QFWM 2QV2A 35C8L 3FB8B 2R8SL 4ZOBA 2VIRB 5DQ9B 4O2CB 4P5TC 2VDQH 1QSFE 5HHMB 5KSUA 4YDIL 4IRSB 5GSVB 3BSZL 3C60A 4FABH 3PWUB 2IMMA 4PRAB 1YC8A 2DDQH 3HUJA 3QG7H 3ROOA 2XKNA 3WFBH 5I30L 4N68A 1XEDA 3CSBA 3HE6A 1ZLUK 1IAOA 3GSXA 5D1XD 2HVJB 3C5SB 4F7CB 4LSDA 5HBBA 1L4IA 1XT5A 2XNAB 4P3WA 5AZ2L 1EDQA 5C6WH 3P9WB 1AJ7H 2Q8BH 4HV8A 5DUML 3TN0C 4OBSA 4AM0B 3QUXA 2VWEC 4MQXC 4JHWL 5D9SB 4MA3A 1N8ZA 3L5HA 4HFWA 3DETC 1J12A 2H41A 4MXWH 1G6RB 43CAA 4UTBL 4S1RL 1BQSA 1ZEAL 3TO4A 4MQXD 4KQ3H 4TUOA 4Y1AA 1Z3GL 4GS7B 4EVNA 1AH1A 2WUCH 5GISH 3FT2A 1Q8MA 3OAZK 3S5LG 2HVKB 2XI9A 3CFIC 5KAQF 3O3UN 5HHOD 1P9MC 1YEEH 1CXHA 3IFPA 4XP4L 3OAYH 5I18H 3ZE2F 3QPQD 1JTPA 2X42A 5SWSD 4Y16C 1ZT4B 1QQDA 4QHKI 1IQWH 4K07A 1VENA 2H6PA 1HSAA 3HC3H 5IFHH 3DGCR 5F9WB 3PABA 1YUHB 2ORBL 5BS0B 5IVXB 2NY2B 4XP9L 4RAUB 1CVRA 1NCCH 4DTGH 4R4NC 5CKAA 1DL7L 3V4PL 4JPIA 1V8HA 1J10A 1J87A 5DD0L 1JTTA 1F8TH 4TSBL 1D6VH 1EFQA 1CF8L 3KVQA 4Q2ZB 1YNLL 3OZ9L 3F6LA 1MFBH 2VLKD 2X4UA 3BKYH 1JWUA 4PJCA 3GRWH 5JMOC 4HKJB 2EDBA 4NC0B 3MV7D 4N8PA 1W0WB 3O3BA 3QEGH 1CTOA 2YRLA