1WBZB

Crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Murine Mhc Class I H-2 D(B) and K(B) Molecules in Complex with Ctl Epitopes from Influenza a Virus: Implications for Tcr Repertoire Selection and Immunodominance
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN PREC
total genus 17
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wbzB00
2Q76B 3E1F1 4I48B 2O5XL 4ZO9A 5IWLA 1K8IB 4NZUL 3S88L 2E9IA 5H94A 4YH6A 2IH3A 4FQQB 5IVXF 25C8H 3VXQB 1L9NA 5IFAL 1QO3A 3HUJF 4F58L 4IRJA 1IZJA 2ATPA 3MRFB 3MRBB 4NZJA 2PXYB 3GB7A 4EI6A 2ITDA 3E6FB 4YHOL 4LPXA 3H9SE 4B0MM 2ZZUT 4JY5L 1M1SA 3ARYA 2V9TA 4ISVA 3PP4H 4KTEH 5I1HH 1GZQA 3MRRA 4MD4B 5EUKA 1OM3H 2APVA 2XKSA 3DSFL 2CIIB 2C9AA 4QRQA 3RKPA 4ZTOL 2P8PB 3LZFL 2C3HA 3QA3B 5I76B 4G6MH 3TA3B 2DLTA 4NDMB 3V8CA 5DS8A 2DS4A 1DQML 3HAEH 5HHOD 5K59F 3GIZH 2YXFA 3C5JA 3IKKA 2QHLA 1MIEL 2EEAA 1NSNL 4F33A 4QHKJ 5DMIL 5JOFB 2FD6L 3VXSD 1QSFD 2QSVA 3X14B 4TULH 4X9IA 1WT5A 4U4BA 4HHAA 3P2TA 4QXWA 3RBSA 4KRLB 5C2BL 2L7JA 5D7JB 4PRNB 3OL2A 4U1LB 5HGAA 2BVPB 1OSPH 4JFEA 4PRBB 2VDKH 1U91A 3SJVA 5C0NC 5CSZB 4PJ9A 1E4XL 4EQ2A 1I7ZB 1KB5H 1AJ7L 2Y72A 3MV01 1MQ8A 1JF6A 5FA4A 3VGFA 4P9HH 4WY7L 1GHFL 1A02N 4LLUB 2DD8L 5ITFB 3VXPA 5C08B 2FLRT 3GUTA 3KPRA 1QRNE 2EDYA 1BD2A 3I6LE 2XZZA 1NQBA 2ARWA 4R6UA 3T0EB 4P57A 4BH8A 2ARJQ 5FO7B 4G5ZL 3BSZH 4N68A 3VXME 3RWGA 1QR4A 2RGSA 1F11B 5KZCD 1RIVH 4P5KB 1F4YL 4IRZH 5F7KC 3KLAA 5F96L 5D7KD 4OT1H 1FNAA 4WEBH 4L4VA 2ADIA 4K94L 4MA7L 5DR5H 4U49A 2DKUA 5GIRA 2PW2A 5I1AA 5JOPD 5D7JC 5JR1H 4ENED 4HXBH 4MMZC 5TQ0L 4OGZA 2DM2A 5H8DA 2V7NA 4P2CG 3VFNA 3L7FB 2G60H 4U6YB 4PRHB 4RZCA 3MUHL 3LPFA 3KLDA 3UBXA 1JPFB 1PD6A 2VABB 1DANU 4OFPA 5IVXB 2HN7B 2V5TA 2V7HB 5IBLC 1UH2A 5HYIA 2FEDC 3UPRB 4I0PC 2XTJB 5GS0L 1UJ3C 1R3IL 4ISVB 2MCPH 5EZJA 3V4PH 1U8NA 3Q3GA 2NY3B 3VGDA 4OLXL 1FV1B 2WLYA 5F9WB 4UV7H 2P8PA 4XVUC 3I84A 2EDRA 5DURB 5HYJE 1TFHA 4YHLL 1CFQB 1LO3L 4P46C 5EOTA 1S7VA 2D31A 4OCYL 3V0WL 4Y19D 4Q6YA 4CN4A 3T3PF 1FL3A 4LNRB 4JFHE 2CLZA 3BQUA 3IDNA 4K8RD 2YEZA 1ZSDB 4OCRL 4GW5A 1NMCC 4OCNC 1EXUA 4X80H 4Q9RL 1U8LB 3LMJL 1GGBH 4TRPH 4OSUH 1UCTA 2EDTA 4QHUB 3JTTA 5KSUA 3MLXL 4WCYH 4F2MA 3I02A 2F53B 1ZTXL 3N1GC 4JFQB 2P5EB 1A6UH 1I3RB 4M1GL 1BZ7A 3KYOA 4R3SA 2X05A 3P4OB 2Q8BL 3VG9B 2YXMA 2XN9B 2D03L 3KYMB 3ULVE 3PHOA 1CXHA 4LVNC 5F3HA 4XC1L 3LY6A 2YPLD 1VGEH 3KYAA 4KJWD 4OKVB 2QADB 4BSJA 1QLEL 1OCWH 4CAGA 3CDGB 4PS4L 3MXVH 4FFWD 5GQBA 3S96B 4I2XE 2EDBA 4MXVF 4HUVA 3QCTH 4LLUA 5KSBB 1OGAE 5L8JB 3RKDD 1P7QD 1IC1A 4NGHL 1TJHL 4P2RA 4PRPD 3WLBA 3F12A 1UC6A 4M7JH 2GT9A 3QJHA 3RI5F 2I5YH 3BSZL 3RGVD 4L4VB 5C86A 4YDKL 5CJOL 3LVEA 1CD8A 5ALCL 3SHSA 1YPZF 4TRPL 2R0KL 5AUMA 3RWJB 3BEVB 5JW4R 2COQA 5ESAB 3M45A 5EOCL 2YN5A 3S8WA 4KJYB 3FB5B 5GSVA 5IWLC 3WBDA 5L2JA 1NUNB 3LQAC 3OHXA 4X7TB 3RGVB 3WN5C 2V5YA 4R97B 4HAFA 1HHHA 1DDHA 4U2ZA 1WZKA 3F5WB 3RX8A 4YHIA 1CGWA 2H9GA 4JVPA 1P4BH 2VL5B 1SJHB 1IQWL 5INCA 3QHZH 4F37K 3NTCH 1BREA 1FV1A 2UVEA 5JORA 3GJFH 2IPTH 2HJLB 1QFOA 2X70A 1IAOA 1CLZH 4JO1L 3EDJA 5GGSB 3SDCA 4XTRD 4S10A 1T6VN 3R06A 4ZODA 3VFGL 2PR4L 3MJ9H 2FBOJ 4HBCH 4EDWL 2P5WA 2VLMD 3GSOB 1A6VH 1NGYB 4ZSOA 5JA9A 4GG6B 4YDIH 3G6JB 1T03H 3G5XB 3VXTA 5HYQA 3QUML 5IK3B 1HXYB 5FO8A 2R0WH 2VDMH 5K9QI 2V9RA 2OZ4H 4X6EA 3QT2A 5E2UL 2BVQB 4P49A 3DUHA 4PRIA 4QXGH 1QNZH 4OF8A 3OAUH 3EYFA 3X17A 5CJBA 4YHPA 4J6RH 4KI5C 3PWLA 4OZGA 3P9LB 5I19L 5HBBA 4NQUA 5ADPH 1ADQL 5JNYB 1U8JB 1BFOB 1A47A 4UB0H 4DAGH 5AZ2H 3BAEH 4XPAH 2FX7H 3QG6A 1WUNT 3CK0L 4M43L 4XBPB 4EIZC 5CINH 4ALAL 4MB5A 1IT9L 3WFHA 5DJ6A 3LHPL 5FYKE 3OKOA 1M4KA 5TQ2L 1OAUL 1MCEA 3LKRA 5DJ2A 4OCSH 1D5IL 1Q9WA 2BRQA 3QJFB 3MACH 2QQNH 3I50H 3BW9A 3UTTB 3UTSD 2DL2A 4Z7WA 1AI1L 3MJGX 3QXAB 1QVOB 3O2DL 1DE4A 4LHUG 4LQFL 5GSVB 1NC2D 4HX1B 4WFGE 3DX6B 4KDVA 3DARA 3BKCL 1FO0H 1H3GA 5C07A 3AU1A 3L5IA 3HRZB 4H5SA 1AKJB 1N64L 1NCBH 1RU9L 3D39E 3SEPA 3I75A 2R23A 4YPJA 4KK6D 3TJEL 1WSST 4D9QE 2NTSP 3RHWF 2VLJD 3U1SH 4OCWH 1FYTD 4PG2A 4Y4KA 3KPNB 3ZYIA 1JHKL 1P6FA 2X4NA 4AQOA 1OGAB 5D7KE 3WNMA 4JZJB 4YQXH 4E0RB 1KNOB 3GSNL 2ADGB 3AXLB 4FNLH 5GS2D 4R26L 2Y23A 4X5LA 3K4ZA 2QLVB 3BIAX 4Z9KB 1XIWD 2V2TA 4GKZB 4HJ0C 3VFSA 1AH1A 4I18B 3NA4A 4PG2C 4DVBB 1CFTA 3W0WE 2F8XC 2X7LA 1KLUB 4ZXBB 1MCQA 1IQDB 1U93A 5T1LA 3BZFB 3LRGA 1WGOA 5C0DA 5C8JB 2FL5A 4OM1H 5IK3A 3FO0L 3DETD 3CXDH 1XMWA 1PKOA 1Y0LB 5D93C 3M8OH 5DJCB 4K2UL 3IS0X 1Z3GH 2XQBL 1FDLH 2DM3A 1YN7B 3X3FH 4ZFFB 5E8DH 4KK8D 5DMGD 3TV3L 1CFVH 3IDJA 4PJ5D 1QSEE 5IQ7H 5DQJA 1MUJB 2HRPL 4XXCC 5HHMB 2DWEA 3L7EA 1CFSB 4U0QB 2HRLA 4U1SB 3VMNA 2BHUA 4JHAH 1MCOH 1FGNL 2CK0L 3GSVB 5J89A 4LARL 1FZJA 2XTLA 4X8XA 4EN3D 4HKBB 1TQBB 3WS6A 3UMTA 3OAUL 1MLCA 2GTWA 1JHKH 3O11B 5F7UA 1CLYH 2LU7A 1XGYL 5HI4D 4NZTH 3BRDA 4PLJC 4HKZB 2JK5A 5B22A 2BRRL 1PQZA 1Q9OA 1KB5B 2CGRH 3NGBC 4PJBA 2AXGB 4PJHF 3SDDB 4XH2B 1NH6A 4X4YB 4RWYL 1R5WB 3G6JE 3IJYA 4G9FE 5GZNC 5HI3C 5D1ZD 3T4AB 1QSEB 2F19L 4ELME 5F8QC 2F74B 5K33A 5BVPH 2BSRB 1Q9WB 4N9GB 3H42L 4XX1G 4TUJA 3A6CL 3QJFA 4GSDL 4UOJA 3SDAA 1X4XA 1L0YA 3UZVB 4F7CA 4GRLA 4X83A 3QDGE 4LSSH 4UQ3A 5F6IC 5HGDB 3T09A 4RSVA 4AM0A 2C1OB 4JHZA 4GKSA 3DX6A 4K8RL 1JN6B 4M8QA 3GDBA 3HRZA 1INEH 4QRPA 4HWEL 4OD1H 4KK9D 2NY5H 1M71A 1QBBA 4TQEL 3U7YL 4RNRA 1KTRL 1NGPL 4JFPA 4G6FD 4JPIA 4NO5B 3BFOA 1A7NH 4FOMA 1EBPA 3QBTB 4KKCD 4HEPG 3QHTC 1G7MA 4LCCB 1UZ8A 4FQLH 4Y5XA 1PG7L 1IMHC 4G9FA 1FP5A 4F80A 1KPUB 4WU7B 1ADQH 4HAGA 4UBDD 3OXSB 3FT2A 3LEXB 1MFEH 1G7HA 1UQSB 3K74B 2OP4H 4HPOL 4LSUH 4K3JH 5FUOL 3KPSE 4RBPK 5FV2A 4IRSC 5C2BH 4DK3A 2FX7L 3SE3A 1O7VA 5IFHL 4M93C 4XB8A 1MQKL 2Q8AL 4RGMC 1RUML 3ELAT 4LPCA 4R9HA 4YHNA 1MVFA 3L95B 5FAAA 3BD5A 3DJ9A 4Z7VF 3EFDH 1AXTH 3MQIA 3QIUC 4LASL 9CGTA 4QRSA 3NFNA 3SKNA 3C2AL 2ZSWA 4OB5H 1U36A 5CS7A 1P4IL 2RCSH 4WFHE 4YPGA 4WWKD 2PTVA 4UU9A 4MWFB 2GJZA 1ACYH 4M7LL 4J3VA 4AIZA 3IDJB 4QHNB 1BM3L 4NSKA 2AERT 3T77A 3IB4A 2IANB 5JMRA 3VA6A 3QCVL 2HTLC 3GK8H 1MFNA 3LD8C 1BLNA 3MV8D 3EOAA 4QCIA 1OAXH 1RV6X 4ODWA 5DA4A 4H8WH 1T7ZA 3ETBF 3AAZB 2A6JA 1UA6L 3FN9A 4NNYB 1GOFA 1YEDA 2VXUL 4NBXB 4JRXA 4ZXBD 4HG4K 4JREC 1XFPA 4WV1A 4HXAH 1A9BB 4YQXL 1H8NA 3TIEA 3H7LA 5T1DL 1PQZB 2Y36L 4EJ1C 1MCFA 5TPWH 4WGVB 4I2XA 4PGCA 3S37X 4P5MA 4WW2B 2E8YA 3WNKA 2VLJE 3LQMA 3T4AA 1U3HD 2ZJSL 1RUKL 5CJQL 4JANA 3WXWH 5IT2H 1H0DB 4NO2B 1EMTH 4N9GA 2G5BB 5LGJA 4LIQH 2MHAB 3JWNC 4LCWA 1FFPB 1IAKB 3IETA 1CE6B 4V2CB 4L8SC 4LEXL 3QUZC 5C0BB 1LD9B 3LOWA 5DFTA 4XP4L 5IMMA 4AM0B 1W0YT 1MNUH 4LCIL 2ERJC 4OLZH 3ROLB 4ZMAT 4LVOC 3MZGB 1R6VA 1S9VB 5CIPA 1JBJA 4QRPB 4L3CB 5ADOH 4R7DA 3DUSA 5DFVC 1HHKB 5CGTA 3QZWA 3CC5A 5FKPA 4JFPB 4JPIB 1INEL 2IANE 5EA0H 4L8SA 3QXDB 1CE1H 1KT2B 2ORBH 5ICZB 1K8DA 4YO0A 3GKZA 5J6HA 3DO7B 5I16A 3MYZA 1AKJD 3I6KA 1MJJB 4MJIB 2F5BL 5E2VL 1Z9SA 1MPAH 2ZCHL 3R8QA 3PWPB 5IB1B 1GC1H 3TJHC 4EI5D 3WJJA 2Z35A 2GY7B 1YYLH 3PWNB 5ELIA 1WTLA 4HUNB 5B8CA 4X6DA 1ZT4B 3BKYH 3MJ6A 4Y1AD 2X4UA 4NOFA 1OCWL 1RUMH 1KJMB 3GJFA 1D6VH 1CTOA 1LE9A 1PY4A 3L5XH 4OFVA 4N0CC 2DQHL 3AC0A 1BD2D 5C08E 4YDJA 5D1QD 3TBVA 2BNQD 2VL4A 3EYVA 5DD0H 1C5DA 1WBZA 4YFLI 2CRYA 5D2NC 5ADOL 1DVFA 2X44D 2W60B 1EUTA 5L7XL 2FH8A 4WTXA 3MCKB 4G6JL 3W9DA 2WP3T 2WUCL 4UDTB 5DK2B 5LBSL 2XXMB 1KJ2A 1QRNA 1WWBX 3GMMA 2VDLH 3AAZA 5GGTA 3WS6C 2UYLB 4G8EB 4XCYA 3TBWA 3B9KA 3OKKB 3UX9B 4ODXA 2X4PA 1A6ZB 5D2NA 1LE5B 4YFLF 4HLJA 4GRWH 2IF7A 5DHYA 1UB5A 2EIDA 3FFCA 4GAGL 2IH3B 4FQQA 2H41A 3SE9L 5I8OL 1CU4L 3MLUL 5IROA 3SGJC 3K46A 1BJ1J 5D4QA 1TTGA 1OPGH 4DKEL 4WU5A 3QCUL 3C9NB 1JNLL 4EZMA 2DQTH 5DJYA 1IAKA 4AJ0A 4BSWB 3QDGD 5EUOE 4KJQC 4JGMA 1JPTL 4P5TB 4XTRC 3MMEA 4Y2OA 1P4IH 2RCSL 2KPNA 2VKXA 3U2SB 3H3PH 4BFIA 1S7SB 5GGVY 5JA8B 4MXWH 1J87A 2AAVA 1CICB 5HDOA 3MRGA 5TDPB 2PYFB 4BSVA 5KVEH 1K5NA 3MOBL 2JE8A 3QUXA 5F96H 1KT2A 2ATKB 4R4BA 1S5IH 2R2BA 1K8DB 1DQMH 4OZIA 3VWKD 5KS9F 1CD9B 3HNSL 5LWYL 1RUAL 2C3VB 4JM2D 4XC3L 3MODL 1R5IB 1RZIB 3PQYB 2OS7A 4WFFD 4NQDD 2FJHB 1FPTL 5IB5A 1AQKL 3AROA 3RNKA 3FCTA 1EEYA 5E6ZA 4KY1H 4BZ2H 5BMFH 5CWSB 1VCAA 1JRHI 3FO1B 3IFNL 3O6ML 4WUUA 1CDIA 2AKRA 2DF3A 3TFKC 4RRPA 1BAFL 1K2DB 1U91B 3UO1L 2BK8A 5CEXA 1U6AL 1LE9B 4G43B 2O5YL 3BWAB 3OGCB 4UB0L 2DDQH 3VWJD 4NQXA 1TJGH 3GBNH 4YDJB 4PJ8C 5ITFA 1FC2D 5F9DC 3S35X 2FRGP 4OIIL 2JB5H 4IHOA 5ECJE 3SDYH 2E7HA 3RIAF 5IVZA 1M6OB 3BXNA 3CSBA 2FHCA 4P57B 4BH8B 1JF1A 3SGKA 1GAFH 4P9HC 5F6HJ 4DKFL 4ZQKB 5CIPH 1KJ2B 3V4UH 5HYSA 1PVHA 3KLAB 4LOUC 1L4IA 5JR1L 2WIIA 2ADIB 1RUAH 3RWDB 1BVKB 1CBVH 1KEML 2J88L 3LRSB 3VGEA 3QRGL 1KIQA 1A64A 3QPQD 3GSUB 1I7TB 4X9GA 2AK4E 3VXRE 2NTFB 3WUZA 1KYOJ 4Y4KD 3NFPB 5GPRA 3JTSB 1MFAL 4RZCB 5TF0A 5EC2A 1JPFA 1ZHLA 1N64H 1RZKL 4Z7VE 4QY8B 3RAJH 1Q0XH 4WU5B 4OI8A 3O8XB 4M6NL 3CIQA 1F42A 2CKBA 5DWUL 5CLTA 4J2XA 1AO7D 1YEFH 2XZCL 1MCDA 3D3VB 4P3DA 3W9EB 1JI1A 3HMXA 1WFOA 1XGRB 2XZAH 4OJFL 4LDLB 1WAAE 5T33H 1NLDL 3QFDB 3OR7B 4HV8B 4ZAKB 1JGUH 1ADQA 3QUZD 3O2VH 1UWEH 1K4CA 4S1SL 4R96B 5ACZB 1NFIA 4ORZC 1HEZB 1XF3B 1F3JA 2VDRL 5EOTB 1EGJH 1UJ3B 3KPOA 4JJ5A 1IGTA 3I6GB 2EIBA 3OKMA 4PJEB 1U3HC 3TO4A 1JTOA 2W07A 4RIRA 2A1WH 3E6HA 1U9KA 3RBGA 1UXSB 2IQ9H 2FEDD 2VXQH 2OI9B 3U4AA 4DZBB 2PO6C 4KVCH 5KANI 4H1LB 3VXMA 4BM7A 2DKMA 3VFOB 4G6KH 5FA3B 4AMKL 3GHEL 3QG7H 4PG9A 5CD5D 2DB8A 1TXKA 3MNVB 2NXYB 3PIQA 1MHPL 5CWSA 4FQXB 2MWCA 5D1XC 1HSBA 1N0XH 3P4OA 4QHMB 3VFRA 4FTVA 2D0HA 4PRID 2XWJA 4Y5VB 1EHAA 3U79A 4JPKL 3PHOB 2EYTB 3X12A 1BIHA 1OGAD 5SX5K 3QIUB 4Z76A 2NNAB 4X7DC 4QXTA 3TN0B 1D9KA 4NPYB 3FHQA 3ZSSA 4PR5A 4ZO6A 3RFZC 3V0AC 3IDGB 4XHQA 5KVGH 1QPXA 4QYOA 3QIWA 4ZUVB 2VDOH 2FX9L 2J6EA 1Z6JT 2NX5D 3FTGA 1I8KA 5DZOA 1LO3H 5SX5H 3CLFL 5D1QB 4OLUL 1D6EB 1U41A 5EO9A 4UINL 1S9KC 1UXWA 3WXVL 3W0WB 1A7QH 1BVKA 2HVKA 3HS0B 1N8ZB 4U7KA 5JW3L 1TTUA 1C12B 2VLME 3C5ZA 3GZKA 4NT6A 2OTUA 3H3BC 1JZ4A 3ARDA 2P7TB 3O2WL 5IW1B 3DYMA 2Y36H 3MV7D 1GOGA 4TQEH 3ARRA 1KOAA 3B2UD 1P4BL 1T7XA 4WTZA 3ROOB 4M1DL 3TC9A 3C5SB 3L3IA 4OZHB 1I1AD 5GSRA 3D3VA 4P3DB 2YPLE 2QQKL 2VL5A 2MKWA 1NGWA 3KLSA 2YD4A 3DRQA 3GEWB 1WQVT 5F7NC 2JCCB 1X4YA 1TMCB 4O5LH 1M05A 2X70B 3X11A 4YHMH 4URTB 3O2DA 3LZFH 1VEPA 4K7PL 5MENB 4JZNB 3UJTH 2ZCKH 4KDWA 3QIBC 1B0WA 3NCJH 3NPZB 4LGSB 4ZSOE 4M8VA 3GSOA 3DV6A 2V2XA 2HFEB 1YQVL 1GC1C 1T20A 4NKIL 1UCBH 4GRWE 2XZQH 1X5LA 1OP3H 1N26A 4K23L 4ZFZA 4XPHL 4PGBA 1HXYA 1DN0B 5F7LB 4U1MA 5CJXA 2APBA 2AQ3A 2F5BH 5E2VH 2HT4D 1X5HA 3KNBB 4MJID 1JWMA 5DGRA 5BZWA 4A2MA 3DUUB 3CAFA 4Y4FA 4NP4H 1MRFH 4PRPB 3HE6C 5FEBA 3HMWL 1FZMB 2CJUH 4YFDB 4TTGA 1KJ3L 2HT2D 2NY4B 3TBYB 1NMCB 5GGQH 4HUUA 1RK1A 2MSPA 4L4JA 1A7NL 1P2CB 3QHZL 5DEZA 5KJRL 2D3VA 3C8KA 1S78D 1U8MA 2OR7A 1I8IB 4KQ3H 2VIRA 4WFGD 1RZFL 2A6DA 3HG1E 1ZK9A 1QSZA 3EYSH 3W11D 5BW7A 5E03A 5C09A 3D2UD 4H1LH 5T3ZD 1ZVYA 4OIAA 1NBVL 4DVRL 5CCKL 2VB5A 4X6CA 5IQ9B 5CD3B 1BVZA 2QADC 1U8QB 5D6CB 3GI8L 3RUGB 1FNSH 4WNQA 2VITA 3MA7B 1KN4H 3WXVH 4JQXA 5I1KH 4I1NB 4N9OB 3QEQA 4ZFOB 5FHAH 5LCVL 3O6FB 1WIPA 5TE7L 2Q86A 3S7GA 3QUYC 1VKXB 5IM7B 1U2HA 3AU1B 5E0QA 5J0BA 3HFMH 1LQSR 5EA0L 1IKFH 4PTUA 4KTYA 3G9AB 4YR6A 4MJ6A 3BYYA 4WO4B 3QUYA 2EDHA 1DQLH 1NCAH 4G3YH 1F6LL 4GUPA 1MELA 5E08L 1MI5D 1JGLH 1XGPA 5FYLL 3DECA 3I9GL 4IOIB 1HILB 3OJDA 3P77B 5K9QG 5DK3A 3FOMA 1Q94B 4MNQA 3ZKND 3DROB 4Y4HA 4QRRE 3K8MA 4YNYB 1RJLA 4PRAB 4U6VL 2AK4D 1SYVB 5C0GB 2JJSA 4RMRA 1A7QL 5D71L 2AJYL 3FONA 5C0BD 2BNUB 1IEBB 3G6JF 3VWKB 4F15C 2Z93B 1T89C 3RX5A 5J56B 2AVGA 3KNBA 4U6XA 5T3XD 1X5FA 5IJKC 4MMXC 1HOCA 3FQWB 5JQHC 1KEGH 1B0RA 1KPRB 3CFKA 4XP6L 1A6AB 5F9OH 5IG7A 3HR5A 3O81A 3Q5TA 4L8DA 5BV7L 3PG2A 4KROB 1V05A 2JJSC 3U7YH 5IF0A 2Q20A 1HDMB 5J12B 1U3YA 5IHUH 1RK1B 4O00A 3BO8B 5D6DC 4APQD 3RDTB 3SO3C 1T5XA 3MLVL 3GNMH 4N1HB 5D5MF 4FMKA 1I1FB 3U9PH 4OIIH 1WCQA 4Q0XL 1NBZB 1GGIH 1R3KB 5JDSB 1K6QH 3F7YA 4M7JL 1GZPB 1SM3H 1A1MB 1ZAGA 4AY0A 4W4NA 1QHOA 4WNQB 1D5XA 4NCC1 1VACB 4NUJB 1L7IL 1QEWB 3EAKA 4KU1A 3VFMB 3HPJA 1MCRA 4HUXA 4XXDB 2AJVH 5DXWA 2O61B 3MV7E 3O6KL 2HJKA 4XAWL 3IFLL 1JNNL 5TE4H 3NOIA 3BGFC 1ZT7B 3FT3A 1ZHKB 4NWTL 3OG6B 4P46B 4G9DA 3QXTA 3CFEB 3WIFA 3FO9B 4BQ9A 4KUZH 4EOWL 4M5YL 4AK1A 3ULUC 1KBGL 4L29A 1M71B 4HS8L 1X5YA 1SHMA 3HG1D 4KKAC 5E5MA 4NO5A 5E9DD 2DICA 3NA9L 3CDCA 1WAAF 1DFBH 5ESVA 1HQRA 1UZ8B 2P42B 3MNWB 1GGBL 2CUMA 2NLJB 4M5ZL 2NX5E 3G5YB 3OXSA 1JYWA 3O0RL 5I30H 1YUHA 1I3UA 5EZIH 1RZGA 5JHDA 3AMLA 3S35L 1V7NL 2YSSB 4JR9H 4BZ2L 2X1WL 5L0QB 2APXA 4JFFB 5DEFA 5IHZA 2WZPD 4WUKL 4XMPL 4LLQB 3BRFA 2G75B 1YEHH 3IYLW 3PWUA 4PRIE 4PRAA 4KPHH 4DN4H 1A6VL 4JFOA 1JNLH 1BEYH 1SEBA 1JF5A 2CDEB 1JYVA 3CU7A 3H42H 4Y5YB 1VERA 1Y6KR 1ZT1B 3D3VD 1X44A 5FOBB 4OFKA 2LVEA 1HE7A 4U6XB 2C7UA 4LF3B 1U8IB 5JOEA 3OKNB 2E7MA 4C56E 5DDHB 5K9JL 1NANI 4EXPX 3QCVH 3HR5B 2XKNB 3VGHA 3QO1B 2Q7YA 1YC7A 4F37F 4ODVH 1N5AA 1HDMA 4M62H 3WNNA 5D1ZB 5TGBA 4F8QA 1VFAB 1ZLUK 3TVMD 2KL6A 2WLZA 1QYGL 1MFBL 5E00B 1NAMA 2XTJC 1FZKA 3Q1SH 1C16B 4D0DB 1NMAL 3ZHLA 5HI5D 1MREH 5I74B 1FIGH 2PCPA 2VXUH 3MGTB 2YD8A 2AJSL 3HUJB 5DMJB 4HPOH 2ZJSH 2ZUTA 2W0KA 3EDKA 5D7LE 1T21B 3SPVA 2R9HD 4PJBF 4KUCF 1VENA 2DI8A 6FABL 3KAAA 5F9JB 5DWUH 1A4JB 2GEEA 3MFFA 4OCXH 1QHPA 2VSDA 1HYSD 2XZAL 3NCMA 1D5XB 4NO2A 1IM3A 3QEGL 3ARXA 4Y19E 5B21A 4X8JA 4PGDA 2VLRE 3IETB 4HUXB 1MLBA 5BVJB 5C0BA 1BVLB 5F89A 2D7MA 3TO2B 4LU5H 3QA3A 3TF7C 3PHSA 3HC4L 5JW4M 3HI1A 2HFFB 4NO3B 3QEQE 2WBJD 2B5IC 4JKWA 1O5DT 5I18L 3NVQA 4KRPC 1RIHH 1OT2A 3A6BL 3ARDD 4KK5C 3DYOA 4MDJA 1UWXH 5DS8B 1HHKA 2J1KA 7FABH 3VDBA 2OSLA 3QXDA 2E6QA 4L4TB 5I1JH 1JWUA 3LIZL 3JWOC 3VG9C 1PDKA 4QRTB 4PRPE 2X9YA 4U33A 3RQ3A 2WBJB 1YUHB 1UEMA 2X09A 1XIWB 2VLRB 4OGAC 4F7PA 1YYLL 3PWPA 3P9WB 5J11C 1YMHB 3X14A 3SE9H 4EBQH 5JW4N 3T2PA 3S35H 3B8YA 5D8JH 4C83A 3QIWD 3V95A 3O4LA 5ICYB 4JPWL 3JV4B 25C8L 3QFJA 4F57L 5KS9E 2X2YA 3LCYA 4G80B 1YN6A 1YEGL 3GRWA 4MLSA 5IESH 1AD9B 4XMPH 5JZ7C 2P4AB 4WGWB 4NKDA 3ZT5A 2AXFB 3JV6A 2YRLA 3IDYC 4X9BA 4OM1L 5FOBA 3GMOA 1FO0B 4WFEE 1NKOA 5HY9B 3BX7C 2I24N 4X5XA 1EO5A 2RFXB 2CPCA 4X6BA 4NC2B 2X9WA 1JGVH 3NCEB 5CMAA 3QQ3A 4RGMB 2EDDA 5FO7A 1JJUA 3MCKA 1QBML 5EBWA 3QQ4A 3U48A 4ZPVA 2HH0L 2X10A 1MFCH 1PSKH 4BKLA 1TQBC 2ZUYA 5CZXD 5LXGL 4XCYB 1JGEB 4N8VG 4KROD 4P2YA 4XBGA 3QDJA 1XF4B 2R29H 3VXOA 3MGTA 1ZVSB 2HKHL 3BJ91 4MS8C 1QLRA 3P30H 3EKCA 4XP5L 4RMWA 1BBDH 4OZIF 2C3XA 3LN4A 3OKEB 1LDPL 1DANT 4UZGA 5D7IE 4XNUH 5FK9A 3CFIC 1C5CH 3MLWH 2A74B 1Z9MA 2QV2A 1A14L 2ZUVA 4XCNB 4LSTL 1ZA3B 4X8JB 1U8NB 3MV8A 3A6OA 2OI9C 4C56A 1BECA 3MRHB 4WFFE 3RWIA 4KJPD 3ARBC 3JV0A 3N1FC 4GBXD 2IBBA 2DD8H 4N0UB 5GGUA 1AY1H 2K3TA 2BMKB 2D31B 1RFDH 3RRQA 4D9LH 1XGQA 2YBRB 3MLYL 1KJ2L 1BWWA 5KN5B 1EUUA 3VXSB 3IU4L 2X1PA 5I18H 2Z92B 5C0AE 1IC4H 4XMKL 5DHVB 3QUXB 1DTUA 3RIAK 5CHNA 1J9CT 3DURA 4MQ7B 3AY4A 1CDUA 4HJGB 2HA1A 1EGJA 4LVEA 1W0WB 1FGVL 1FBIL 3OBAA 2ICEA 4JY6B 3HB3D 2VH5H 3V7AG 2Y5TB 1WC7A 1OP5H 5EO1B 2W65B 1MHHA 4F7TA 3L1OL 2ZPKH 4F2MB 4LLWA 4NN5B 3LN5A 2P5EA 4MB3A 4GMSH 5FYJD 4Y2DD 3BIKA 3AM8C 1DEEB 2GITA 1FNLA 2N4IA 3K2UL 2QSCH 4G8GA 5MEOA 1Q1JH 3MUGA 4X4ZA 1ORQA 3EJZD 3FKUS 1OP5K 4CDGC 4OQTA 2DLHA 4UIKL 5J06A 3GMOB 3CDGA 4KKBC 3GBMH 4NQXB 3IJSB 4P2OD 4HUVB 4U1KB 3WFCL 1JHLL 4K7FA 3G6DL 3D6GA 3QWRA 4GRLD 1AGFB 1F90H 3WLBB 5IVZB 4CW1A 4GQPH 2H3NB 2GT9B 3KWWA 3LV3A 4YHKL 5EBWB 5I2IA 1XZ0A 2AV7B 3WKML 2EDXA 3DX7B 4HZLA 3TZVD 4YDKH 3WDIA 2ZCLH 4WIQA 1FFOB 4E42A 3V6FA 2YMXH 4WI9A 4XB7A 1MHCA 4XBGB 4M6OL 2NR6D 3CVIL 4XRCA 5I8KL 2W38A 3ZO0A 4XPFL 2DQUH 3ES6A 4QEGA 2FB4H 4BUHA 4CVWA 2E27L 3GFUA 2O5XH 1U42A 3TM6A 3IVKB 3RGVA 7CGTA 5D7IA 3GSXA 5HHNA 1CCZA 2ITDB 5FK9B 3ESUF 3UTSB 5GJTL 3IDXL 1XR9A 3ARSA 3D39B 2D4FA 1SJVA 1WT5C 1KPVB 1XGRA 2UUDK 5EFIB 2R0ZL 4HGMA 5DJAB 4N8VA 3RZWA 2XZCH 3KG5A 3OAYK 3OR7A 4JGJA 4YHZH 5JHLL 5L2KA 2CD0A 4R4ND 3QDMA 5E08H 1D3CA 2DDQL 2UZXB 2VDRH 1NMBL 1RMFH 1F5WA 1DQJA 5TH2A 2DLIA 1AHWC 3CFDB 4MLIA 2IMMA 1UWEL 5EU3B 5HD8D 3CUPB 4LVNB 1T83A 5F7YC 1R0AL 5MHSD 5B8CC 4OLUH 2IAMD 4LBEA 3C6LC 5C0CE 1EZVY 3V6ZB 3VRIA 1KB9J 4D9LL 3ZL4L 4YHYB 1OAZL 5F7FA 3V4UL 2NY6D 4QWWD 2QTEA 4GG6A 1T0MA 3QUKA 2NY7H 4XPTL 3H3KA 5HPMA 5DJ8A 5FV1L 3V5DA 4PREA 4JM4H 3IU3A 1F58L 1MHHB 2LU4A 2I9LA 3ARWA 4XP5H 1DEEA 2I25N 3D9AH 4LSRL 5HDBF 3QAZB 4M1DH 1H9VA 1ODAA 3U1SL 3IDUA 4H8WL 4OKDA 2P1YA 1QP1A 2G9HA 4PJDA 4OUOA 3T2OA 1I7ZA 1NEZA 4NQTA 1MCLA 3L3GA 4JREB 3OJVC 1NCDL 4PR5B 3IFOB 3H9HA 2EKSA 3QQ9D 3QEHA 4O2CA 5IBUG 2P8LB 5I9QC 3O6FC 6CGTA 4PB9L 2VXVL 1P84K 2AGJL 1OHQA 3WO4B 2X4OA 2G2RA 2XPGA 4JFFD 4ZNEE 1H3PL 3FT4A 5E95B 3B5TA 1EMTL 1I7RB 2A6KA 5EN2A 1KG0A 1A6WH 3TVMB 5TDOB 4OIBA 2YD6A 2B8OT 1CD1A 4YZFF 5DRXB 5JIKA 4XRCB 4ZYKB 5D71H 2XQBH 2P7TA 1DE4B 4MNGB 4JVWA 1SJXA 2UY6A 4NQCD 3GJFK 1TZHB 4ZPTB 3F7QA 5HVHB 3JSSA 4DW2L 4JO3H 5T5FL 4NKMA 1SY6A 3T0EE 3G5ZA 3PXHA 3I3DA 3EGSB 3GGWB 1KXVC 3LB6C 3MXVL 5DJAA 4YK4C 5C07E 4FNLL 3RP1A 5DD6B 2X4NB 3RDTD 4C54A 1DP0A 3OV6A 4PJ7E 4LIQE 4MDIA 4JFDA 3GBML 4XI5D 2VZUA 3MV8E 4FXGA 4JM2A 1NL0H 3S36L 1KIPA 4DZ8A 1RURL 5EB9A 1T2XA 2P45B 3D0LB 1CICD 1MY5A 35C8H 3OKLA 3QHFH 4QRRB 4YXKL 1KLUA 2VDQL 4JRXD 5DRNA 4EIGB 4ZXBA 2VLKB 4HGWA 3BZFA 2DQEH 3BZDA 3GMQA 2X4SA 5C0DB 1T0MB 4KHTL 2CLRB 2CXGA 4ZAKC 2KH2B 4U1MB 4C4KT 2BNRD 5MP6H 2P8MA 2IC2A 3R8BB 3OJMB 4HIJA 3QUMB 4JO2H 4NRZA 3KVQA 1RJZB 3MBXH 3DUUA 3NIDF 4MJIE 4ZFFA 4K8RH 3CXHJ 1AQKH 8FABA 2XI9A 3B9DA 2YWYA 3O9WD 3SCMC 5CLWA 1J1PL 2HLAA 2WUCH 4K7PX 3MROA 1R3JB 5FO9A 5DRZA 1PZUB 3A0OA 4HKBA 1MVUA 3TPUA 5BZDB 4L3EB 2G9HB 1YEGH 4PJDB 1OY3B 5DJ0B 4L4TD 3MBEB 1UEYA 4R8WL 1D5ZB 4Y16C 5FFLA 2IMNA 2BOBB 4O58L 2VIRB 1M7DB 3C09B 1NCDH 4V1DE 3V5HB 1DQQB 1KB5A 3HN3A 2YKLL 1I85C 2PW1B 4YX2H 4XHJD 3BH9B 1J1OL 2G2RB 4W6WB 1YNLH 1ZWIB 5FYKU 1LO4L 2BSSB 1V3JA 5CD3A 4Y16A 4HC1H 2YUWA 3OR6B 2A6KB 1OAZH 2BSRA 4YGVB 1FSKB 5TDOA 5FB8B 3KXFE 5FHAL 5C0JA 1E4XI 4NRYA 3GI9H 3LKQA 5GRYA 1FL5A 12E8L 3O3AA 1NC4D 1HINH 3FB5A 5MEQA 2PYEE 3SY0A 4FG6C 1JE6A 1V3LA 4G8FA 4YDVA 4PJEE 1CGYA 1KCVH 5FM5O 1RHHB 5JOPE 5D2LA 1UM4L 3DWTA 2CIKA 2CJUL 2KUTA 1A0QH 1U95A 4U1JB 2AQ2A 4MJ6B 5D72H 3AGVA 2ZSVB 1JCKA 1XGUB 2AV1B 5K93A 1ZGLA 1EO7A 2FH6A 4JFYB 1HHGB 4M6AA 1ETZA 4JDZA 4O9HH 3T1WA 4BFEA 3E0GA 3IFPB 1QRND 3D0LA 4GJTB 3EYSL 5KAQG 2Z91B 1A7OL 2NXZB 2YRZA 5D1XA 4IOIA 4WHYG 3BPLC 4U6TA 4LPUA 4I3SL 5TQ2H 5L88L 4Z7VB 4ZSOB 3HC3H 4RISH 4F9PC 3JWDL 1CF8L 3FOLA 3LS4H 1IFHH 1FH5H 4ZO8A 1BWMA 3O3BA 3F58L 5FHBH 4N0FB 4ZDHB 3QWQB 5ABDE 2BNUA 1LK2A 2P8MB 4P2RE 3IS1X 3O6KH 2ZSWB 2Z93A 3U9UB 1ONQB 4P2QB 5FKAB 4HIJB 4LP5A 2LQRA 5EDXA 2PYEA 3B8SA 2DYPD 2BVQA 2FGZA 4UU9B 3SDYL 4X4XA 1FO0L 2DAVA 3VD3A 4EEEA 4Z77B 1BP3B 1A7BA 1FYHB 4ZNCD 5AAWA 5MERB 1ITBB 1NDGA 3ULUH 4L8DB 1TLKA 2DYPA 1RHFA 4NN5C 5IF0B 2H8PA 3OXRA 5BV7C 1RIHL 5I71C 5IB3A 2X6MA 4LLDA 2PKDA 1P84J 1IILE 5HVFB 5KOMC 4JPKH 2E9WA 3BKJL 1YEDB 4NZUH 4X7SL 5GS1C 4C55A 5EZIL 1AXSA 1T5XB 2DQCL 1DSFH 2Q76A 2Z31D 3MLTB 3O6LH 3VD4A 2DMCA 4DTGL 4FABL 4FP8H 3TGXA 4U0RC 2J4WH 2J2ZA 4Y5YC 1OTSC 2P24A 4WO4C 3F7YB 1HZHH 4Y4FD 3CH1B 2C1PA 3WS3B 2AP2A 5BXFB 4YE4L 1VDGA 2CUIA 1YY8A 2F15A 5CBEA 4NUJA 4NFCA 3WFEL 2VAAA 4LLVB 4K2UH 3EJJX 1JNNH 3IF1B 4ZUUA 3EYUL 4XXDA 5MEPB 1I9JL 1HKLH 1OAQH 5TE4L 5IEHA 1BJ8A 4M6ML 3CZFA 5FYJU 1SEQL 3D18B 4PP1C 2EIZA 4NDMA 4PGZA 3RL2B 5A1AA 1KJ2H 2XY2A 5DHXB 3I75B 4L29B 1NGXA 5FUCE 1JNJA 4AEHH 3PV6A 4FXLA 1CG9A 1Z5LB 3GRWL 2R1XA 1LO0H 2BERA 1FN4A 3ZTJH 4KKLD 1IKNA 1N4XL 2XN9D 3MNWA 1KGCD 2VZ1A 2ZKHL 4NYLB 2EDLA 3QG7L 5CEZL 4JDZB 1S7XB 5C9JB 4V1DB 2YSSA 1N59B 1OQXA 4PJ7A 1I4FA 1UB6A 4Z7WF 5CGYC 3SDCD 3UTTD 4PJ8A 4MZ2A 1R24A 2Y9RT 5F8RC 5B8CB 2G75A 2GSGA 4NKQB 4Z7VA 1BEYL 3OSKA 1U3JA 5HGAB 3T8XA 2VSCA 3OAZK 4I3SH 3SGKC 2DQFA 4CVZA 3G6AA 3RZCA 1S7UB 3K3QA 1Q72L 3WE6A 1IAMA 4KTEL 4DGVH 4APQB 2SEBB 4MD0B 5H37H 3T0VA 3ZLQC 3TBVB 3HC4H 4L8CA 4Z77A 3STZA 3BGAA 4P23B 4C56D 1JUFA 2W0LA 5DURD 1BD2B 5E2TL 3IAGC 3B9KD 4N8CH 3ALXA 2VDLL 4Q9BA 1RU9H 5IB3B 3W5MA 3KLHD 3PNWA 1WICA 1B2WL 3U4BL 1QRNB 4XT1C 1BQLL 5DVOA 3H9ZA 1N3NB 5IP4A 1PG7W 1FNEA 4ZOCA 3DVNB 1YMMA 1MF2H 4OBRA 3U0PA 1HXMB 1J8KA 4M7KL 2FJGA 3TP4A 3IKCB 2F8VA 4DQOL 1KF9B 1H3WM 3D2UB 1QSFB 5HVWA 3OGOE 4IEFB 4LRIA 3HUJA 3NIGF 1MSPA 5F7EL 1Z9OA 2FNBA 2P24B 4NN6B 3O6MH 4FABH 3CH1A 3EUUA 3H7BB 2H1PH 2BC4A 4RFNC 4QRUB 3C5ZD 2HN7A 4UAOB 1YY8B 5DA0B 5BOZG 1XF2B 3V79C 4YAQA 1YEIH 1JZ2A 1II4E 4PGDB 5DEGB 3PL6D 3BPCB 4DGVL 1CICC 4EVNB 1OGTB 4OQTL 4BSWA 4JZJC 1H5BB 5E6IC 4G7VH 4P5TA 1BQHG 4YFEA 4GKSB 3QDGB 2B1HH 2UZIH 5EU6B 4O2EB 2IH1A 4LSVH 1KN2L 1ZS8A 3L9RB 1HHJB 4GG8B 5GS0D 3LIZH 1OAXL 1FL3B 1CICA 4BSVB 1WK0A 2I9TB 5KS9B 2CLZB 3BQUB 1EAPB 1JWUB 1O0VA 4XPBL 3MYJB 1P5UA 1CXEA 4G9FB 3T2QA 5I1JL 3BI9X 4M9OA 1K4DB 4YGAB 4LMQE 1N59A 1G9NL 4MSWB 1U8HA 3ALPA 4QHUA 1S9WA 2OP4L 4C83B 3T4YA 3I02B 1XCQA 1VADB 5DO2D 2HLFC 1UVQB 4HUKB 3ZTNH 4WV1C 2BVOA 5EIVA 2A77H 1YPZB 4PJXB 3KYMA 1I8MB 1R3LA 5BRZD 1T6WA 3CX2A 4G8IA 3KR3H 3PE9A 4LSQL 2NY0C 2D0GA 5F3HB 3SKNB 4ERSH 2XXCB 5HHME 5D6DA 4HDIA 4OKVA 5GRJH 3RWFB 4IDJH 3TO4D 5JXAL 5DVNA 2GJZB 2RFXA 3F7VA 1OB1A 2ICWA 2I5YL 3ZE1E 2IQAA 3F62A 3OF6D 2VJXA 4NSKB 4R4FH 5HHQA 3QNZA 4Y19B 3NZHL 1UM5H 3IU4H 1JNHB 2B0SH 2DQDL 1LO5A 1C7TA 4MXWL 1Q9LB 1G6RA 1ITCA 1FNGA 3RVVC 1E27B 3FMGH 3CXHK 3MOBH 1QFUL 4PLNC 1FRGL 1OAYL 2R2HA 4ZUTB 1S5IL 3L5WA 2EZ0D 3U0PB 5IB2B 3MV9B 4U1IA 4J3SA 2GSIB 4AMKH 4WV1B 5SWSE 5GISL 5AUMB 3RWJA 4PY7B 4TTDC 1ZLSL 1HYRC 3F6IA 1BBDL 3HZKA 4LSUL 3C09C 3SOBL 3O41B 3HFML 1KIUA 2V2WA 1QO3B 3TIDA 5GJSL 4KZEH 4WCYL 4JO3L 5T5FH 4LDEB 1H3VA 3SE4C 4YEEA 5HHPA 1MCWW 3FRPG 1OM3L 4GKOA 4K7PY 2ITCA 2CMRH 3KGRA 1G7LA 3NTCL 4HFWA 4X0KA 3QIBA 3MRRB 2CO7B 2YUXA 1FFRA 3IJHA 1WZMA 1LD9A 4HV8A 3D87B 5ITBH 1WWCA 2GJ6A 1EHLL 1W0VA 4JZOA 2G5RA 4L9LB 4X9HA 4R96A 4R4FL 3MRPB 1RSFA 4O2EA 1I1AB 3DHJA 5D70L 3UTTE 2W0PA 4PJEF 1VFUA 3KJ6L 4S1RL 3EYQC 4PYHA 4UMGA 5IMLA 3VXSA 2E7LC 2EE9A 4OZGF 3HLAB 3RVTD 1FIEA 4LHJB 4LCYB 1JRHH 5DQ9B 5F1KC 1V5JA 2RB8A 4MJIA 4R0LC 4JN2B 3MOAH 2CH8A 2FB4L 2R0KH 1IGIH 3ECBB 3UZEA 2IPKA 2NY4D 5ACLA 3FRPA 4I0CC 2WQ8A 3MNVA 1ZGLM 1XCQB 2OCFD 1TCRA 1GH7A 3TLRA 3B9KC 3C6SB 5MHSE 1QACA 3V0VA 1QA9A 2OBGA 4MA1C 3BPNC 5BW7C 4R0LA 2BVPA 2X4UB 1JFQH 4JFEB 1I8MA 2UWEA 2YS4A 4OFYA 2VDNL 3SJVB 3PWLB 1JK8B 1HH9A 3WFCH 2HT3C 1G6RL 5GGVL 3C6LB 1VA9A 3W5NA 4MAYC 5TE6L 4XP4H 4ZOBA 3ME0A 5BOPA 4Q0XH 3D48R 4G9FD 1HH6B 1DVFB 2UZIL 4RMSA 3T0EA 5KBNC 1JNHA 2Y7QB 2RHEA 3D85A 1G6RB 4WEBL 3WUWA 5L6YH 4UDTA 4TUOA 5IVXE 4OCSL 1PG7X 1N2RA 4FQCL 4IMKA 3S37H 4XCCL 2CDFB 5B4MC 4YC2C 2FJFA 2ZUQB 5IB2A 1DUZB 3B9KB 3OKKA 3VXSE 3BZ4B 4KZDL 2VXQL 2GSIA 3BRGC 2CRZA 1EJOL 4QXUH 4ZS7L 5F88A 5AAMA 2ESVD 3O45A 1A3LH 5ALBH 5EU6E 3MLXH 4JY4A 3SKMA 3BDYL 3SDAD 3PF2A 3O41A 4JO2L 1F4WH 1UGNA 2BNQE 3D69B 4JG0H 5I17A 3M17B 4IMKC 4BQCA 2CKBH 4YZFE 5ESQA 1FG2A 5JXEA 2EEBA 4OLXH 2JELL 1FCCA 3NCBB 1MIMH 3I3EA 4PBXA 3HZMA 5CILL 5C0EA 3OKYA 5JIIA 1OGAA 4IM8A 1XGTA 4Y4HC 4GBXC 4RMVA 3SBWA 4JZJA 4P9HL 2GYSA 3SE8H 3MUZ1 1IBGL 1AGBA 1LP9A 1CGSL 1A7OH 1FAKT 2DQJH 1IAIH 3NIFF 3CFDA 2AK4B 4RRPG 4BFIB 1CFQA 3BESR 4OGXH 1OAKH 1FLTX 4NQEA 5JXEC 1T89A 1N5YH 3MGOB 4LNRA 3MRGB 5TDPA 3FZUD 3HCVA 4L4VE 4UV4H 4ZUWA 2DLEA 3GI8H 2NZ9D 1F4YH 4IRZL 1A1OB 3RA7H 2FHBA 1T5WB 2EDJA 4MA7H 2OX5A 2K7PA 2XNAB 1OP9A 4PRHD 3ZKQD 3K1KC 1EERB 5GISH 1Y0LA 1BD2E 1SBSH 3PDGA 1NC2B 1T7YA 4OGYL 4LSPH 3ZYJA 3BZEA 3RWHA 5DK0A 4B50A 1NAKL 2D03H 3B2VH 1T66C 3B9EA 2CO6B 5JO5A 4XNZB 1JI2A 1D5MA 4XNYL 3THML 4NM4L 3V0VB 4OLVL 1FZMA 1MHEB 3SO5A 4HFUH 4Z7QE 1X9QA 1CWVA 5SWQA 1W72A 5T33L 4KUCD 3S5LA 5I1DA 4X99B 4M1CC 1KELH 1RZ8B 5E8OB 4DFHA 5IGXL 1A5FL 3VFVB 3E2HB 3ZE1F 5KSBA 4NZRH 3QEHB 4O2CB 3UTZB 2A0LD 43C9B 4P4KD 3L3HB 1HH6A 1EFQA 2XG4A 2R1WB 5EZLB 1RK0A 3NZ8A 1R5WA 2CRIA 2ZUSA 2MPAH 4N8CL 3IDIB 1FORL 4TUOB 2DQEL 5IQ9A 3UBXG 4O2FA 5CJOH 2WBWB 1A6TA 2IADB 3WFEH 3UTPD 1PEZA 4LLAA 3SDXE 1DUZA 3TVMA 3RL1B 2EC8A 1KIQB 3UXFA 3O9WA 4GW4A 1F13A 4MA8H 4DEPC 1HK6A 5DD1H 4RFOH 1T1XA 1ZEAH 3U0TB 1P6AB 4JFED 4HIXL 3KPLB 3MRIB 4M48L 4WWKB 1N0XL 1BZ9A 3FAXA 1CDBA 1JN6A 3GHBL 4JQVA 1U92B 1DBJL 1JTPA 1XF1A 5KANG 1Z0NA 4RNRB 1C5BH 3MO1B 1MCOL 2CK0H 1LK3L 4YHOH 5F1SA 3JVGA 2Y4SA 3OZ9L 1J10A 2KQNA 2WBJC 1YEIL 1TZIB 1MIML 4JRXE 4POYA 4AZ8A 1AGBB 2OK0H 3QCTL 2VLLA 5JHDE 5GGSA 1HEZA 4YX2L 1J5OL 4YBLB 1AGEB 4G6ML 1BOGB 2CGRL 1VFOA 3EDEA 2Q8AH 3I6GA 1IGCH 4PJEA 2BXYA 1BIIB 4ZS6C 1A21A 3EJYD 3WFBH 5C0CB 4LL9A 4YNYA 1PY9A 3Q6FA 4QLRA 2R9HC 15C8L 1KC5H 3IGAA 3TPKA 4C4KO 3NFNB 5FO8B 3MBXL 3VWKA 4MQXD 4FZ8H 3QEUB 1JGVL 4M6MH 2Y6SC 2E6PA 1ACZA 3GK8L 4AH2A 5H2BA 3NACH 3VFRB 3VRLF 2HTKC 1JZ7A 4Z0BH 1QNZL 2DJSA 4NM4H 1YY9C 1I3GH 3S5LB 3WNPA 5I1DB 2NXZC 1REIA 1NGQL 1QZ1A 1EJ6A 3BP5B 4P2QD 3MRJA 1VPOL 4S0TD 3U9PL 3IDGA 4OZGE 1T3FA 3U4EA 3ZDYE 2O5ZH 3PDDA 1DLFH 4JAMA 3UJTL 2QKIA 2JTDA 1JHLH 3HE7C 3VH8B 2C4XA 4NO0D 3BH9A 4Y89A 4MQSB 4HLZG 2F5AH 1NGZB 1R3KA 2BFVH 2J6EL 4JKLA 2B5IB 3JWOH 4ZTPH 5JDSA 3T0EC 4YXLL 5A3ID 1D6EA 4PJHA 2QQQA 4JFZL 3DV4A 5CBAB 4DJMA 2HMID 1UXWB 4OZFG 1LHZA 2FYYA 1W72H 3RL1A 3FMGL 1AR1C 2G5BA 2ZOKB 3L3JB 1HI6B 1G6VK 4GS7B 4GW4B 2H26A 2CUHA 4F7MB 2A2QT 3ARDB 5F44A 5F71A 1X3DA 1FE8H 3NH7H 3IRPX 4MAUL 1JV5B 3KPLA 1YEEL 3TWCL 3DX8A 4XNQB 2H45A 5DYOA 4LQFH 4HS8H 4XP6H 4YDVB 3DX9B 4U1HB 5T3XL 4XMKH 1FFNA 4KTDH 4MHHI 1KJ3H 4R7DB 4ORGB 4S0SD 4JQIH 3ARQA 2AJ3B 5AYUH 1U95B 2DBLH 4LKCA 3VI3F 1A3RL 5DF0A 3W82A 3MC0A 5ICZA 4NIKB 1XGUA 2AV1A 5ISZD 4OD3H 5DJDA 4MZ3A 3SGDH 1YECL 3CH8A 1MREL 1ETZB 5HSFA 2DQIH 1V3KA 3V6OE 2NW2A 3SBWC 3MXWH 2V2TB 1MCKA 3Q48A 2FX9H 3VFSB 3O8XC 4ONFL 3UPAA 4DVBA 2V2XB 5B38B 3ULVC 4JO4L 4RAUB 3QFJE 2BXZA 2I07A 5D7LB 5E1AA 1RZKC 1KN4L 3FOLB 1AD0B 1MEXL 4ODSH 3CMOL 4N0FA 1E6JL 3B5HA 5DJCA 3G6DH 2XA8H 1FL6B 1IGYB 3TBTB 1MRCH 1YNTB 3V52L 3PABB 3BDXA 3U7WH 5DFWH 3JUZA 1FSKC 3FQTA 3TZVB 4LSVL 2EZ0C 1DBJH 1F97A 1GSMA 4MCZA 3RTQC 1FZJB 2B1AH 2HRPH 2OTWA 1WFTA 2LFGA 1GCFA 5CEZD 1VFBB 2J12B 2X4TB 1T1ZA 2BRRH 4XP9H 3TBWB 3RWEB 1U8MB 3VG0H 1QLEH 4GG6F 4OFIA 4K3JL 5FUOH 4D3CH 4N5ED 2NY6C 5DHYB 1IARB 4XNXL 5FIEA 4PJBB 4TSBL 1WWWX 1IGJA 2RQ8A 5DRWB 3SDDA 1CLCA 1FVCA 2IAMC 4D0CB 3NCFB 3K80A 1RIUH 4OF3A 5BQ7B 2NY0D 1ZA6B 1WIUA 5IHLB 2R8SH 3MFFB 3RUGA 3S4SB 2CLVB 3ARGA 2EO1A 2A77L 2MJWA 3E2HC 4XCCH 4XZUB 4GRMB 5JXED 3RTQB 2EH8H 4C58B 4H26B 1HSAB 4XGZB 2E7CA 4ODHH 2B4CC 3IXAA 3V52H 2KKQA 3PWPD 5CP3A 2XICA 1NCTA 2WSKA 5EOCH 4HIHB 5DUMH 4EN3B 4EI5B 2XIDA 2WANA 4HKXA 3WEXB 1OTTC 4M8QB 1MRFL 4LAJH 1LO2H 2J8UB 1A7PH 1OL0A 5B39A 3RY4A 4EUPG 2VZ3A 2GQHA 5TDNB 2OQJA 1RULH 2NY6B 2HYMA 2ZOLA 4LKCB 2FIRT 4W68A 3AREC 3L6FB 3H2WA 5FGRA 2FO4A 2W0FA 4PJCB 3GNML 5C0AD 4H20H 2WBJA 3MNZB 4DUVA 1G7QA 4GUPB 5B3JE 3VXRA 3BT2L 3B83A 5C9JA 2R56L 1PBYA 1WV7T 4YDLC 4LLYA 3VCLB 3X13A 1EEYB 4RFEA 1R3HB 4ELMA 4PGEA 3MLRL 2E6JA 3KPQB 3ULSA 3JWOL 3TYGL 4XNMA 4D8PA 4LASH 5JQ6H 1KLGA 3HE7D 1CDCA 4UV4L 3S97C 1U6AH 3L95A 3VJ6A 3U46B 1ND0B 1F2XK 2EDWA 1GVIA 3HNVH 3QWOB 4OB5L 5H35B 3G6AB 2X1XR 2VQTA 1KYOK 3O3EB 1IE5A 3WE6B 5DD5H 4AIOA 1FL6A 1J0IA 1X5IA 1KPRA 2C4FU 4QT5A 4K3DH 2VXVH 5FYKH 3VRLE 1W2KT 2H6PB 4PP2A 4GW1B 4FQIL 1H3PH 2XTJE 3T0WA 3I6LD 1G0DA 4KTDL 1J1PH 1QOKA 5KAQF 3GKWH 3SGEI 5HHOE 1F4AA 5AYUL 4GAFB 4ELMF 5J9PB 2GTZB 2PXYC 1G7JA 4ZS7H 1PG7H 3REWB 4PUBH 1UA6H 3BDYH 2DLFL 3VXOB 1TPXC 2QR0B 2XY1A 1P7HL 1RZKH 2WV3A 5ANMA 1G1CA 3MRLB 1ZHLB 5FGCB 3HE7A 4ETYA 1OWWA 4NHUB 2J8OA 2JJVA 2PXYA 4NRXB 2QSCL 1A1MA 4WI2A 1D9KD 1D6VL 4M61B 1TVBB 5I0ZA 5FYJE 4FFYL 4DGYH 4EUPA 4POZD 1OGTA 4QO1A 2IPTL 3R0NA 4P23D 4C56B 2B1HL 2CIIA 3BKML 4QRQB 2HJKB 3NGBB 2BCKA 2DQJL 1J88A 2EH8L 2DWDA 1EGJL 4EN3A 1ACYL 2IH1B 3VFGH 5IVOA 1S9VA 2AEPL 4PBWD 4Y1AB 3L9RA 4DCQA 5B39B 4M48H 5T1MB 1DR9A 3WNOA 5J13B 3MUJA 4PJFB 4TPRH 1KTDB 2V17L 1MI5E 1X5ZA 5SWZE 3Q5YA 3DO7A 1JP5A 2Z8WC 3PHQA 5CEZE 4HQQL 2VTFA 5F7DA 3VG0L 5JHDB 4JY6A 2YK1L 3SKJH 5DUBB 2KDGA 5GGRA 1VFMA 4PPTA 4PJDE 2EKJA 2OK0L 1S9WB 4M4RA 4O9HL 4FMFA 4OF7A 2V5SA 4YBQD 5LVEA 4LLWB 5EWIH 3RTQD 1G9NH 4FQXA 2B2XL 3EZ8A 2PTTA 4F58H 1UYWH 3PWUB 5D7JA 3BPLB 2YZ1A 4L9LC 4QHMA 1E4XH 1X5XA 2AJZB 1ORQB 1R3LB 4W70A 4P4KC 1EO8L 2EYTA 5JQ6L 5KSAC 1D5BB 5CSZA 1J11A 1XF5A 4YDLB 1SBBA 3FO0H 2OMNA 3GSNB 4XCFL 2BJML 2VDOL 3TN0A 1XT5A 1CQKA 4GH7B 2VISA 2ED8A 3RNQA 1OB1B 1Q9KA 1C5DB 2XKNA 3KXFB 3WKMH 4IMLA 4TPRL 5C07D 1NUGA 4LLMB 5F7HA 4Z7OE 3RWGB 1LO5B 4YBQC 5SV4A 5TGBB 1XH3B 4LK4A 3BN9C 5C09D 1AFVL 5BS0B 1QKZH 4RDQG 4X6DE 2H2PC 5E00A 4AYFA 1T4KB 3MACL 2UYLA 2GTZA 4CU6A 4XPTH 1C16A 5GIRB 4GAGH 5L2KE 1JZ3A 1FVDA 1F58H 4HMDA 4OZFA 1MJUL 4OLWH 2D7TH 4PB0L 2VABA 3U30C 4WHTA 1F2QA 4H0GA 2RJMA 4NHUA 2IAMA 3GSXB 2Q8BH 3W39A 4J3UA 3I85A 1RZ7L 5I1GL 1BBJB 4MD5A 3ZTNL 4HK3N 6FABH 1MRDL 5DD3H 4LGPB 3QNXA 1XR9B 2VDPL 4NQDB 4EUPB 4MCYA 1KPVA 5EFIA 1IM9A 1S8DA 5BO1H 1AJ7H 3TO2A 4Z0XB 2V5MA 4FZEL 5EBMB 1CK0L 1EFXA 3A67H 4BFGA 5I8CB 2I60H 2NXYC 2FWOB 2NCMA 3MLPA 3ILQD 4RAVA 4PRDB 1E28B 1K5NB 1MAMH 3DV6B 3OAZH 2QSTA 2YC1A 3SCMB 2GW5A 4K23H 1T20B 3LH2H 5GGSY 3SDAC 4KRNA 4PY8J 4GMTL 5KVEL 3BMVA 4UINH 4J7RA 4ZFZB 3MRQA 2IAND 4FFZH 2YPVH 4WHYH 1GYAA 4CJ1A 2XTJD 2VLRA 4P99A 2IPUG 5FUZH 3SJVE 3V7MA 1YY9D 3BOVA 1JWMB 4UOW1 3VFWB 1TCRB 3PGCB 4ZUSB 4OTXH 2PTTB 3C60A 3P0YH 2ADJA 2XT1B 5ANME 2F53D 2OR9H 1NFDA 1SMAA 4D2NA 2Q6WB 4L8BB 3FHAA 2GCYB 4ZTOH 3PUCA 1U3HB 3WN5A 3K4DA 2X4RA 1E4KC 4FQHA 3SE8L 5L0QC 4UOW0 1K3IA 3IFOA 5IMKA 2P8LA 3DMMB 2I60L 3KXFA 5CMAB 2PR4H 3MJ9L 5T3ZL 4Y16D 2YD2A 4MVBD 4Z7NE 4ZQKA 4X6CB 3DVGA 5F93C 5BS0E 4NHCH 4NFBA 4ETQB 1E4KA 3O3UN 4ONHB 4DOHE 3SDCC 3HNTL 3BZ4A 4M9PA 3FJTA 1JRHL 3VE0B 1RZJC 3V6OC 5E24E 4XC3H 5CP7B 5DTFB 4MAUH 5FUCC 4FFVD 3ARED 3QEQB 2Q1EA 5A2IH 3KDMB 3FQNB 3SKJL 4YLQT 3T08A 3SKMB 1A1NB 4JKKA 5ALBL 5I17B 2XACC 3QPXH 4IRJB 1MJUH 5EUOB 4K71C 1OTTD 5FCUL 3IFNH 1AP2B 3MLSL 4YHIB 2CKBB 3EIFA 4V2BA 5DC4B 1ZA3A 4P3CL 1Z9LA 4N0UE 1B6UA 3MJ7B 3HZVA 5IGXH 5C0EB 1L7TL 1T7WA 4XC1H 4Z18A 4BQBA 4LSTH 4AIXA 5EPMA 2ZG3A 4MDIB 3SQBA 5D93B 5F21B 1PLGL 5ACZA 2NW3A 4UI2A 3SDCB 4XI5C 2O5ZL 3R06B 4M93B 3CPLA 5C6PB 2P5WB 4JG1H 1Q94A 4OT1L 5J4MA 1NGYA 3DURB 1G9EA 3GMQB 4PJGB 1UXSA 1RJLB 4XCEB 5D5MB 3F65A 3G6JA 3ZYZA 4H1LA 3MJ9A 2QQNL 3I50L 4MA8L 5LXGH 4APQC 1NCCL 3UYRH 4RGOL 3KS0J 4N1CA 5JOFA 4GQ9H 5EO1A 4PJAE 4QOKB 3H8NA 3LKNA 2MQ3A 3UJIL 2RIKA 4JEGB 5DK0B 3NAAL 3PGCA 5FYJL 3TESA 2WWKT 5A2LH 4QF1A 4OZHE 3S5LG 1RD6A 2Y25A 3J8F7 1L6ZA 5T5NF 5FECA 1EA9C 1MVUB 3TPUB 2YPKA 4JHWH 5SWQB 5D72L 3QSKB 4R2GD 3K2UH 3VGBA 4PJ9B 5L2KD 4YHZL 2BSTB 3TEUA 1GGYA 2FEEI 5BO1L 3O6FD 5TPWL 4N0RA 3ARFD 3MGAA 1DQDL 1M7DA 4M43H 4ZUVA 3NIDE 3X3GL 3ZE2F 1OTUC 3BP4B 4PY8I 3TYFA 2P46B 1M7IB 4NM8H 1J1XH 3KWWB 1NBZA 3LV3B 1WBXB 5INDB 1QR1A 1UH4A 4XVTH 4ODUB 3D5OF 1FFOA 3MA9L 1HCVA 2HLFD 4KH2A 1FAIL 2BNQA 2MNUA 1WISA 3HZYA 3PJSA 2QL1A 3CFCH 4IIQC 1E6JH 5EORH 5DQDH 1J0YA 4MQTB 5DD1L 5EC1B 5FGBC 4J1UA 4WWKA 3OKDA 3LQAH 3MFGB 1NANH 5IVXA 1JTTA 1P9MA 3UAJC 3P0YL 2EO9A 4JN1H 3C5SA 1J8HD 1F3DH 4IIQA 3GJEA 5GSRB 5CSGA 3D39A 2B1AL 4U1JA 3DVIA 3MJ7A 1S7QB 1I1YA 1BMGA 5I73C 5C0IB 2VLJB 3W2DL 1DQDH 3EOBB 4HJJH 4P48A 1QFWL 5SX4I 5JHLH 1Q0YH 4K71B 4PB9H 1X5AA 2BVTA 3FN3A 4AL8L 5IROC 2J4WL 3H0TA 5I6XB 3IFPA 1S7VB 5L88H 4P23C 1T0PB 1J1OH 4POZC 3O3DB 1IQDA 4WUUE 5HDQL 2BOCB 5FM5M 1OF2A 1IGCL 2R8SL 3WUWG 4S1DD 4KI5E 3HUJE 2OMBA 4FZ8L 2YMXL 2WWMD 1ZT1A 3U9UA 5TE7H 15C8H 3MODH 4HQQH 1I9IH 4LFHD 1NPUA 4KAQH 3LMJH 4U1GB 3WFDL 3LQAL 4OI7A 2HTKD 1TVHA 3HR6A 1OQOA 5LAXB 3KLHC 4G6AD 2DYPB 4EQ3A 4HWEH 3QUXC 4KY1L 1NJ9B 5E5UB 4YXHL 2DBLL 1VFAA 4MA1B 2XKUA 3V7AE 5GS0H 1UADC 1YC8A 3LS5L 5HGGS 3VD7A 3U36A 3IAPA 1EO8H 4MVBC 3VMOA 1P2CA 1VGEL 2NX5A 4HKZA 2EKSB 4P2QE 1I8IA 3MLTA 1S7WB 3R0MA 2VE6A 3TYFB 4UT6L 2ERJB 1UENA 1B4JL 1T21A 3PL6B 4JO4H 4OFDA 4ZAKD 5E7FA 1LEIB 5E5RB 3IJYB 1AQDA 4BH7B 2ZCKL 5FXCH 1P7KA 1T2QH 3BVNA 4DVRH 4KHXH 4PJ5B 4DGYL 4DKFH 1ZHNA 3UPCA 3RJDA 2FCBA 2VR5A 2EE6A 5I9QB 2ZOKA 3L3JA 5CGYD 3MV7A 2BVYA 2VOTA 3IDMA 3VXUE 5ALCH 4F7MA 1CXLA 4ZFOA 2GHWB 1P7QA 4F3FA 3CDFA 1KEGL 1G9ML 3FB6A 5L2JB 3M1BA 1Z3GL 4K55A 3OHXB 3DX8B 5EZOH 1DDHB 3VI4E 5L9DL 4MJ5B 3RDTC 5IQ7L 2YA0A 3BUYA 4HS3B 3U30B 4PTUB 4NFDA 1NGXB 4OV5B 5E8NB 3LDBC 4YIQA 4BFBD 1CG9B 5K9KA 1INDH 4W4OC 4X5WA 3P4LA 3VFTA 5GGQL 1SMOA 5ETUA 1NCAL 3LSOB 1BPVA 1MFBH 2X5PA 3GO1L 2HVJA 1BQSA 4Z95L 1FPTH 3BKJH 3VGAB 2DIJA 2Y1VA 5AZ2L 5T1KA 2NW2B 1NBYB 5BV7B 3T3PE 1XGPB 4KJPC 4F57H 3S36H 3ZTJG 4CN1A 4UILH 3P77A 1JGLL 1CDGA 1DBBH 4OM0L 1SM3L 3O3DA 5GS1B 2JIXD 4Q6IB 1A7RH 2DTSA 2R1YB 2VDQH 4OCMC 1AD0A 3LH2L 4F7EA 1FAIH 1CS6A 2A83A 5F1NA 3RU8H 4CVZB 2GIYA 3CSGA 1EIBA 2DM4A 4APQA 4M1CD 1T1YB 3K8KA 5KVFH 3EO0B 5EORL 2ENYA 2R0WL 4LVHB 3ARTA 4R2GC 4N5EC 2JCCF 1GAFL 3FB7B 3HAEA 1HQ4B 3GMLA 3FQTB 4BK4A 3WL9A 1G7IA 2M8XA 3OX8A 2D7NA 1WJ3A 3BHBA 4XBEH 1BLNB 1U8PA 5BZDA 1IC5H 1MFDH 2J88H 4NCC2 3EDDA 1WIOA 5DZNA 5E2WH 3DVNA 4J6RL 4NNYA 1JGEA 5MI0C 4L1DA 3RWEA 4JRXB 3FRUB 4Q6IC 3OAYH 2LV4A 1A9BA 3QUZA 4HMCA 1I1FA 1EAJA 1Q0YL 3V5KB 2BY2A 4JG0L 4LCWE 1C08B 4LGRB 2YK1H 1RURH 3DETC 3RAJL 3PL6A 2EDKA 3VXQA 3MCLH 3CSPA 1AQDB 5JPMB 3JZ7A 5KSAD 1PKQA 4L9DA 4Y16B 4HIEA 4EI6B 2YPLB 3HNVL 1ZVHA 1HHIB 4NQSB 3G04A 3JVGC 4JLRA 4YDIL 4C59B 4HUMB 3TNMB 1XR8B 4NRYB 4XZUA 4H0IA 1CE6A 3HPJB 3MV8B 5E6ID 2ILLA 1FL5B 2K9UA 3QIWC 1P7QB 2UWEF 3O3AB 2EDNA 3PL6C 5LJYH 1Q38A 4WI8A 2E8ZA 4X4MA 5KOVC 4HX1A 3QDME 12E8H 4YWGL 3MTRA 5DJZB 3WIFB 5FGBA 2VQUA 3CJJA 1XGQB 2YBRA 3R4DA 1CR9H 2A1WL 4JCLA 2ZOLB 5T1KD 1IEHA 5FCUH 2BDNH 1OAYH 1FRGH 4ELKA 4Y4KB 4M3JA 1I3VA 4H20L 1N6UA 2FO4B 4OBSA 5J6HB 1EBAA 3LSOA 2IG2L 3ARDC 3BGFB 1N6QH 5E70A 4FFVC 3IDYB 2ADGA 1WAAA 1I75A 2B39A 1J8HB 4LSPL 1NBYA 3C8HA 1KFAL 4LOUD 4O58H 4AG4L 1FG9C 3LKPA 3MCLL 3MRKA 4CMHC 3T4YB 2Z9TA 2Z35B 4MAYA 3KPQA 1Q1JL 1S7RB 2W9EH 5F7MC 1YNLL 3GSRB 1AR1D 1YQ2A 3OB8A 2BVOB 5JW5B 3N1MC 4G8GB 4B7IA 5MEOB 2IFGA 3GM0A 3U46A 3WDHA 3WXWL 4JFOB 3T3MF 4RISL 4IDJL 1L7IH 1CVRA 1LK2B 1ONQA 4P2QA 5FKAA 2HP4A 5FA4B 2HAZA 1LEGA 2C7UB 2IBZY 2OL3A 3CD4A 1HINL 4QT5B 4LKXA 4R7NB 5AEAA 5MERA 2H6PA 3HAEB 4L5FL 4MXVE 4PJIE 3L7EB 1VSCA 1S3KH 2PXYD 3KPPB 5FDWB 5KZCB 4UNTA 2ZCLL 3QUXD 1JGDB 1YJDL 4Y8AA 1U8PB 4LLDB 4ODVL 3P4NB 4P5KA 1A0QL 1INQB 5JW3H 3VXUD 1SY6L 3TBSA 5FYLE 4AEIH 1ZEAL 2XWBA 1FVEB 1I9EA 4ODXB 2R0LL 1DLHA 2AJSH 1UKSA 3GSNH 2E27H 4PY7A 1Q9OB 1NSNH 1JWSB 3VFUB 3ZKSD 3L7FA 2DMKA 1LNUB 3REVB 2DQGH 4NN7B 2V2WB 3NBNA 5JPMA 4NWUH 5B38G 3NABL 5MI0B 5GS2H 4ZTPL 3D3VE 3DNKA 4B7LA 3GSQB 2R0ZH 1A7RL 3ILQC 3TNMA 4X0KB 1FNSL 1TJGL 3GBNL 3MRCA 2RR3A 5L2KB 1HWGB 2HFTA 3N06B 3EYUH 2Z31A 4WY7H 5E8DL 4HZAA 1CGTA 3QO0B 2DTMH 1JHTA 4RX4A 3WHXA 1WVZA 5KTEL 3CUPA 3ULUL 2LU3A 3ET9F 1NDMA 3UTSE 2QQLL 1MCPH 4PJFA 3H6JA 4LBEB 2WINA 4XNZC 3QR2A 3Q6GL 2Z31C 4M7KH 2MOVA 1KPUA 2V17H 2R29L 4NZTL 4QXUL 4ONGL 4R90L 3ZE0E 1QQDA 1XAUA 3BD4A 1UQSA 4GXUN 3FQXA 2Z8SA 4MS8D 3W2DH 3NFSH 4OAWB 4ZFGH 3UBXI 4K94C 4PJ7B 3MRKB 5ICYA 2R2EA 3C6SA 4NJAH 4GXVL 1C5CL 3GSRA 3MLWL 1A2YA 1EK3A 4G80A 5KSVA 4YHNB 1YEFL 2JIXA 1FZOA 1OPGL 1AD9A 1X7QA 3BE1L 4TVPD 5SWZD 1ES0B 3VH8G 2OL3H 2GUOB 4AT6B 5IV2B 4LRIC 5CEYB 3PWVB 5DT1L 1ZHBB 1PAMA 3ARFC 3LAFA 3T0AA 5HXMA 1BFVL 1VEMA 2YA2A 3RVWC 5T5NG 1L7TH 4UQ2A 4HG4J 4X5XB 2EH7H 3H9HB 3QULA 2VISB 3OF6A 2B20A 1AO7E 3SDDC 5E99H 1MRCL 3NN8A 4QHNA 3VWJB 1TIUA 1TQCB 3S98A 4X6CF 4LSDA 1M6OA 3BN3B 3QQ3B 5E4IA 3QJHB 3RUGE 1CE1L 4Z78B 7FABL 4CL7A 1CD0A 1DCLA 4A6YA 1ZMYA 1B6DA 1UJTA 1EHXA 1YMMB 3HRPA 2H32H 3RJQB 5DMYA 4NQEE 3IKCA 5A16B 2QHRH 3GSUA 3P30L 3HG1B 5ISZA 4ZYKA 1K8IA 3SKOA 1ZVSA 5FM4A 2BNRB 5H94B 4OZFB 4I5BB 3DPBA 4GQ9L 3VDAA 1ZE3C 4LCWD 3W0WD 4BQ8A 2LE9A 4P2OA 4M6NH 4QY8A 4Q97A 2X4QA 3LN4B 4N5UA 1GGUA 2ATPB 4MB4A 3V4VL 4JFEE 2J8HA 2OL3L 4RQQB 1A3RH 4FG6D 3QNXB 4I4WB 2BVUA 4FZEH 5D7SH 4D0BB 1H5BA 2Y07H 3MRCB 5HHXH 1G6RH 4Z0XA 1U2CA 4JFDB 4HH9A 3EO1B 5EU6A 1FLRH 2B4CH 2PTUA 4N0UA 2AK4A 1QLFB 3RGHA 5HHOB 1F3JB 1EFXB 3IT8D 3WHXB 3KPOB 1F8TL 1NDMB 4PV9B 3CC5B 4QRRA 4L8SB 4LFHG 3HCVB 5DRNB 5FM8A 4JRYA 1D9KC 5HYQB 3VXMB 4KMTL 2XNAA 5I8KH 4Z7NF 3KYNB 2ICEB 3TT3H 1AI1H 1ED3A 2FIKB 2G60L 3P73A 1NC2A 3VGAC 2HWZH 1EEQA 1CU4H 4OTXL 1C8PA 3P11L 5GJSH 4KZEL 4KRPB 3BZEB 1Y18B 3TZVC 4LPTA 3EZJB 3MRMB 2GITB 1UVQA 2W91A 5J12C 4G6AC 5F72S 3MROB 2UWEE 1MHEA 3IDXH 3LS5H 3MV11 1R3JA 2EICA 5FO9B 4KKNA 5CEYA 3EOTL 5FCSH 1UZ6E 3P9LA 3L3DB 3MBEA 3S6CA 1RJCA 2X4RB 5GRZA 1DL7L 1FLRL 1PX3A 1JZ6A 4S1DC 3VXPB 3F7VB 3EYVB 4QYOB 1F45A 5JXAH 1QFPA 3QNZB 4PYGA 1J0KA 1I8KB 3MV9E 1RK0B 4NHCL 4LHQB 4PFEA 5I2IB 4QHLB 1F11A 1I9RH 2NXZD 4QKXB 4OZIE 4PJHE 5DJ6B 2P5EE 3ARZA 3GMMB 2XG5A 4A6YB 4NO0A 2IADA 2R4SL 4WHCA 4ONHA 4ACPA 4EUPH 4ZUTA 5HDQH 2F54B 3LKRB 5DJ2B 1TZGL 5FB8A 2W9LA 1J18A 4XPFH 1JPSL 4JFHD 2E3VA 1FBIH 2V7NB 2Y6SD 3U0TA 3UTTA 2BNRA 4H1LG 4BK5A 4UTAH 3HZKB 1QVOA 3QXAA 4NP4L 1FIGL 3TV3H 4XVJH 1GC1L 3IVKA 1MCNA 1B3JA 5D7IB 1LWRA 3FQUB 4QXGL 2IGFL 3T65B 1G9MC 3MLUH 1IAII 3UPRA 3K1DA 3L3IB 1I3GL 4S2SA 2F58H 3H9SB 1JYNA 4ZS6D 3GO1H 3HZVB 4D0BA 1YYMH 4HWBL 4N8VB 4JFXB 1BFSA 3ZMRA 4YHML 4P3CH 4HEME 3WYRA 5F3BA 1V7NH 4HMEA 5GHWH 3ARBD 2C3WA 2ZUQC 2NW3B 4LU5L 4I13B 3BEWB 4Y4FC 1BOGA 2VN7A 1P4LB 3RWCA 2VO5A 3CPLB 1UCBL 2A73B 4UAOC 3JWDH 3V6ZA 3VRIB 4WWID 4XVTL 2X7LB 4UUJA 4NC1C 3F58H 1ZSDA 1QD0A 4LCYA 4NQCA 5FHBL 5C8JA 4XCEA 4J3OC 3CGTA 3CXDL 2J8UE 1BF2A 4NUGH 2HKFH 4QHKI 5DJXB 1AC6A 2GK2A 3X3FL 5HI4C 4I0PA 3CLEH 3V5DB 3P73B 5K9OA 3ECBA 4K3DL 3QEUA 4X80L 1NCCH 4RFOL 3IU3B 2YD5A 3OPZH 3FCTB 1I1CA 3T0DA 3ZDYF 3U7AA 5DQJB 3P11H 4OD1L 2CDGA 3BQUC 1BZ7B 1OLZA 2DWEB 5H2BB 1IC5L 1MFDL 4JPWH 2R4RH 3V4VH 1E6OH 3LEVH 3D9AL 3M07A 1KCVL 3T3ME 1C5BL 4WJ5B 4HCRH 1EV2E 3I2CL 4KV5E 3MJ8B 2FSEA 4FQ1H 2A9NL 5ITBL 4Z6AT 1T3FB 2IFFL 5KVDL 5D9SA 4XPGH 3VXMD 4O51A 2AXGA 1S9YB 3RVWD 1YZZA 4QHLA 5I75B 3WUWB 3OB0H 2N1KA 3ULVD 1H8OA 1KB9K 1QSEA 3DV4B 4NO0B 3RA7L 1JVKA 2BHYA 5EN2B 2CRMA 2FJFB 5J1AA 4YJZL 1SY6H 3EOYG 2N56A 1CD1B 5T1LD 2VAAB 3GHEH 5EG6C 3BISA 1CBVL 2WBKA 1SJEB 3AREA 2DJUA 4EKXA 1QFWI 3NIFE 2NY5C 4KK6C 4M03A 1OSZA 2K7QA 5DHVH 4AEHL 3L3KB 4OZFH 3RHWK 5ESQB 5EUOF 3NACL 3P9MB 1T04A 3W9EA 1BAFH 2A6IA 3SQOH 4KXZH 2DQIL 3QFDA 3QI9C 4MNQD 2VLJA 2VDPH 5F1OB 4J3WA 2MFNA 3AFLA 3VI4F 1IAOB 4U31A 5C0BE 2ESVA 2CR3A 3HPLB 4NBZB 4X98B 1S7XA 1HIML 4BZ1L 4AQ1B 5C0FA 3CK0H 2MCG1 3LEYL 5DZLA 4PD4J 1IGTB 3MR9A 1IT9H 3MGOA 3FOMB 4HWNA 4K3HA 5A3IC 4L4TE 4MNQB 3MLYH 1OF2B 1A1OA 2I07B 5D7LA 5I71B 4DZBA 4RX4D 1A4KA 4GXUM 5KW9L 2CLRA 3T8XB 3T0ED 2P5ED 4P4RB 1IEAA 3VW3L 1TNMA 3ZE0F 3VXUA 3WJLA 3WHE0 2NY2B 1LP9E 1U8OA 2VZOA 2SEBA 4I0KA 1MWAA 1DBAL 3CVHL 4MWFA 1FE8L 4WI4A 4LSSL 3CFKB 1JUFB 5LAXA 3EFFB 3D25A 4HKJA 2CDGB 4YWGH 1P53A 3TZVA 3UTOA 4YHYC 3C87A 3WJLC 5DSCB 2AXHA 3VXRD 3KPSA 4XP9L 2OJZL 3MUY1 5HJ3B 3V6OA 5JNYA 1YYML 4HWBH 3VFVA 4TNVK 3IRZA 4HCRL 1J7VR 4JR9L 4U1NB 3V5HA 4TVPH 4CVXA 4UILL 3QG6B 1IAIL 4U6HB 3VWJC 2ZUWA 5GRUL 5CUSH 1ORSB 4FS0A 3IDIA 2EIEA 5EU5B 3MPCA 4ONFH 5HVGB 5I8EB 5J6GB 1F4XL 4QRUA 2MPAL 4JANB 3KHQA 5J7CC 1CT8B 2WM0A 2HVKB 3HS0A 4MJ4A 2IQ9L 3CX5J 5E8PB 5J1AB 3VMPA 2MHAA 1KTLA 1QEWA 4ODSL 5DEGA 3BW9B 3IDMB 1S7TB 1KJVA 2JJUA 3CVHB 1K9TA 2NY4C 2GAZA 3QDJE 2WAHA 3CLEL 3IXAB 2FGWL 1I9IL 5DD0L 3ROLA 4M5YH 2DQUL 1RI8A 3L3KA 5KSBF 5I1IH 1UZ6F 5TDNA 3VWKC 3AS0A 3D39D 4PJGE 4JCMA 4KKLC 4JKPH 3VFTB 2ZSVA 1TZIA 2YD3A 4LMQI 3EYQD 1WFNA 1JPGB 3FQRB 3G5YA 3AXLA 4JB9H 3MV9D 4O5LL 4M3KB 3RGVC 3WD5H 5AD0A 1NBVH 3K0WA 5KSAA 1DBBL 4OM0H 4AEEA 4L3EE 3VCLA 4KJQD 3MREB 2FLBT 4HT1L 4UT6H 1ZLWH 4I18A 4RFEB 4CADA 3FAWA 4DKEH 1FJ1A 4HWZB 3SO3B 4HS6A 5EIIB 4NWUL 4XNMB 3SGDI 2AS5M 1T22A 4FFYH 4PGBB 5F1NB 3O3BB 2GJ6D 4TUKH 5DUPL 4LF3A 3N1PC 3STLB 1N7ML 1T83C 4Y4FB 3OKNA 3O2DH 1EEZB 5C2UB 1NLBH 1DEDA 4LCCC 5SWZA 4P2RD 4PRPA 5I1IL 3INUL 1OOAA 1MUJA 4GW1A 3BKCH 4NN7C 2FX8L 5EZOL 5JPNA 1CFSA 4U1SA 1X5KA 2YR3A 3BQUD 1T66D 1Q9LA 2PYED 5DK2A 3MRDB 4U05A 3G9VA 2R2HB 3BP5A 1CZ8L 1G7JB 2FHFA 4TSCL 2JK5B 3REWA 3QDAA 4WDIA 5F1IB 4B5EA 3U4EB 2A6DB 3EYOA 4LP4A 3SOBH 1CGUA 5C09B 3V5KA 1LMKA 1A9EA 4CVXB 4CN6A 4K7PH 4HK0B 2DKSA 3P40A 1P9MC 4HULB 1UACL 3TIDB 4KRPD 1PKQB 5IB4B 3QISA 3CCHB 3KYKL 4HIEB 2LTQB 5GS3A 3ZKNC 3VI3E 4N0YH 3T04D 1YJDC 4M61A 1H3XA 2FR4B 1G7LB 4YE4H 3FO2A 3MA9H 4LLVA 1AO7A 2XQYK 2DI9A 1W72L 1MLBB 5BVJA 1KJVB 4F7CB 1B88A 3IJHB 1F6AB 2GAZB 5FDYA 1JV5A 3VFPA 4O02L 5DYOB 1K85A 1J12A 4RWHA 2JJTA 3Q2CA 3V2AR 4U2YA 1FFNB 3PV6B 3ILPB 4G42A 2R1XB 4PTTB 2VYRE 4WW1B 3DBXB 5BRZB 1CZ8H 4LVHC 5TJWK 3GRWH 5C0RH 2E7BA 2R0LH 1CLYL 4PJIF 3ARUA 3DI3B 4KMLB 5KJRH 3QI9A 4DN3H 1G7HB 1VPOH 3N50A 3PQYA 3S88H 1PYWB 3RX7A 5KSAB 4RCAA 2N7BA 4ZOEA 3UJJL 1I4FB 2A38A 2IPKB 5B4MD 5AG8A 3T1FB 5E8EB 3MXWL 3SKUD 3JV4A 4MAYB 1GJIA 3VXNA 1R24B 4RAUA 5CJQH 4TOYH 3CSYA 4JHWL 1YN6B 4JHBA 3FB8A 4XX1E 1T22B 5LKNA 3PP4L 1XCTA 1F6FB 5IR1A 1LDSA 1IEBA 1DL7H 3H9SD 2VXSL 3BWAA 1FO0A 2D7OA 3QXVA 1MNUL 1U58A