1WBZB

Crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN PREC
publication title Crystal Structures of Murine Mhc Class I H-2 D(B) and K(B) Molecules in Complex with Ctl Epitopes from Influenza a Virus: Implications for Tcr Repertoire Selection and Immunodominance
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wbzB00
1ZTXH 5L6YL 3DHMA 1OTTC 5H8DA 4YDLB 2VERN 4GXUM 3RUGA 3T0EE 1NLDH 2D7PA 1QBLH 1J0IA 3SO3C 4BH7B 1TQBC 2GFBA 1T4KA 4YHIA 4XPGL 4RGMC 5H37G 3V79C 2H26A 3MRHA 2R29H 3QCTH 1IQWH 4QXUH 5HYJE 1F00I 4PJ8D 3SOBH 3V0WL 5I73B 3MRLB 5FHAL 1XT5A 2PXYA 2Z93B 3NN8A 1O7VA 4FQCL 1CFTA 2AXGA 3VU2A 5DJDA 4PJIA 5M95B 3AM8A 5F7DB 5ID1A 3KYNB 2UWEB 1CE6A 2DBJA 1IRAY 1DQLH 5DMIH 3SDAA 1JNJA 5T1KD 4KK9C 1R3KB 2Q8BH 5H94B 4YDKH 3IDNA 3IU3B 2Y5TA 4J7RA 3T0VA 3IFLL 4K7PH 1JGUH 3GNMH 1T03L 5DSCA 4KKCD 2FO4A 5EIIB 1YY9C 2VZ1A 4P2RE 3EUUA 5F3BA 2HKHH 3PJSA 3ARED 1QUNA 3S9DB 4YHKH 1HQRA 4CVZA 2W9EH 2XG5A 4NN6B 2PXYC 4NCDA 3H42H 3RBGA 5L2JA 4JRXE 4RNRB 1X6LA 4UIKH 2VZUA 4AG4H 4PJHE 3ZDXF 3TO2B 2DTML 1GVIA 4HX1B 2FD6L 5T33L 4JPIB 3L5WB 3ORJA 4U1KA 3RAJH 5HDLA 1OD7A 4U3CA 1YNTB 3LH2H 1FSKB 1CE1L 1IC4L 5KJRH 2C3GA 4JFDB 1RJYA 3IB4A 4NNPL 3GSVA 4OB5L 2RQ8A 2R2BA 2XZAL 4K9EL 3DWTA 1KXQE 2H3NA 3C5ZB 4HJ0D 4LMQI 2G2RB 4KAQL 3C6SA 3V6ZA 5C0GB 1OARH 3MUHL 4X5XA 3F58H 3F12A 4WI6A 4NQDE 1LE9A 3JWDH 4U3HA 4PJ9B 5EZLB 1D9KA 5J12B 2DICA 3MRIB 3MV9B 3VG9C 3WNMA 3OR7A 3CVIL 4QY8A 1LHZA 1M4KA 4JM2B 2EDBA 4HCRH 2XG4A 4JFFA 3GSWB 3X14A 4AEFA 5D6CA 1AJ7L 5DA0B 5E8PB 3KLHD 5CINH 3H7BA 3SGJA 1H3UA 3S3SA 2A6KA 2XNAA 4DKFL 5T3ZH 5JORA 3V6OA 5KSAA 1ORSA 4G8IB 1GGCL 3DXAB 1UXWA 4NQVA 2XV6B 1VFOA 5FGCE 3UEZA 5HVHB 3B8YA 4WJ5B 2CKNA 3AAZB 3V4VL 2DQHL 1YEHL 3QG6A 5E94B 5GHWL 4XCEB 5BZDA 2FRGP 3HI1A 1Q8MA 1JNLH 3EAKA 3G5ZB 3SDDC 1IEAB 4NCC2 1KELH 5LBSH 1RURH 3OKNB 4AIOA 1AKJB 4X80H 3SDXA 4QRRB 5D2NA 4F58L 4F2MA 2CXGA 1I9JH 3KR3H 4P2OA 2FL5A 4QRUB 1R3IH 2NY2C 4JFDD 5DDHA 5BRZB 4R3SB 1TPXC 3QI9A 4LSQL 3GSNB 3NAAL 3C5ZD 1G6RH 1QHPA 2YKLH 1IGIH 3SO3B 4BH8A 3LEVH 4DVRL 4RGMB 1NFIA 4L4TE 3DX9B 1RZJH 2R0LL 5CEYB 2DLGA 2CLRA 2ZWLT 2EYSA 3QBTB 2WWMC 1P84K 3ILQD 4LP4A 1C5BH 2PCPB 3MRGA 3QP3A 4JM2D 4OCSL 3V95A 5CAYB 4Z0XA 5FHBL 4M8QA 1EEUA 1NFDF 3N1PC 1FHGA 3OGOE 4LSSL 4ELME 1CBVH 3QI9C 1ZV5A 1B0RB 3WIHH 3O6FB 2P8LB 2F19L 3DETD 1AFVH 1ZK9A 3KYKL 1R5IB 5IG7A 4CW1B 4WHYH 5CZVH 1JK8B 3GRWH 1OF2A 3NCCB 4PJGE 4LSRH 4WWKA 4UAOB 1CFSB 2UZYB 3L3IB 5E8EA 4TRPL 4M7ZC 2XKSA 1YC7A 1WBZA 1XCTB 1BQLH 4G5ZH 2HP4A 1N3NB 3HRZB 4QHMB 3MOBH 3BZ4A 2WQ8A 1F58L 2BHZA 4P2QA 4PLJC 3CK0H 5IFJB 3ZKXC 2XWJA 3ULUH 3QIUA 4NP4H 2JIXB 4A6YH 4NRXB 5C08D 4DZ8A 1AKJD 3MBXH 1BLNA 5J6GA 3VXOB 4DW2L 1ADQA 4QRRD 4GRLB 4R0LA 1HNFA 1EHXA 5SWSA 5CLWA 4J8RB 5FUZH 3VRIB 3P0YL 2R1YB 3SKJL 1E4XL 4IDLA 4XC1H 5BRZD 5HHVL 3DSNA 4N9OB 3TBYB 5BS0A 3QAZB 3BH8B 3QR2A 3KLAB 4MQ7A 4PB9L 4FABL 3OB0K 2VDPH 4R9HA 1T2QH 1VCAA 3PWPE 1S5HB 3ZE0E 4JFZH 3H2WA 3KPQB 5EBLB 4OQTA 4MJ6A 3S34H 3VG9B 2C3WA 4UIMB 4YQXH 2OMNA 5K9JL 4K7FA 1V7MH 5CSZB 1DLFH 4TULL 1FLRL 1CK0L 4QYOA 5DQJB 4K71B 3GMLB 5ESVB 4G6JL 1YYLH 3EJYC 1FJ1B 3REVB 4X4XA 1XR8B 3NTCL 1S7WA 4KK9D 1QTYT 2E7CA 2VC2H 3BH9B 3O6FD 1MRFH 3BN9C 1WK0A 2XFXA 3RTQA 3BW9B 1TCMA 5JO5B 1FDLL 2MPAH 2UUDH 3DOSA 2X70A 1YY9D 2F74A 4OLXL 2CO7B 1I3UA 1ZT4B 1WIOA 2C3VB 3Q2CA 5DJAB 4M61A 2BFVH 2PR4L 3OAUH 4BFIB 4X83A 4UT7H 3MYJA 4OUUA 2IADB 1FFNB 3VD9A 3ECBA 4X0KA 5IB3A 2FJGA 4P9ML 3CIQA 5D5ME 2JIXD 1EHNA 5EOQL 1CGSL 2HLAB 4WHTA 4JY6B 5C0BB 4GRLD 2ZZUT 5EZOL 4HMEA 3BD4A 2C26A 2OBGA 2X10A 1EMTH 3RU8L 2FGWL 4M9OA 3IXTB 1OWWA 1WITA 3ARDC 1TZHB 4QOKB 3W39B 3GHEL 2ZKHH 3RUGF 3GGWB 3L5XH 3CD4A 3GJFA 3QDAA 2IANB 3CJJA 3SBWC 4PP1C 2F8VA 3VFGH 2CKBH 2X5PA 4M03A 5F9DC 3JV4B 4AEEA 5DD6A 1X5IA 3AB0B 3U36B 4JZOB 4JPWL 3JZ7A 3WFZA 3BKCH 1KCVH 4YGAB 3W9DB 4PJIF 2R1XA 2VDKL 4H8WC 3C8HA 4GG6A 2VLKD 4O2EA 1T20B 2ESVA 3FB7B 3PWNA 4G8GB 4JJ5B 4P9HC 4Y4HA 1FIGH 4B53A 5EO9B 5EFIB 4I0CC 2HRPH 1BIIB 3BQUA 3VFPB 1X4XA 5DS8A 1JGLL 3H9YA 4JO4L 1KLGA 2YA0A 5TFSH 5D7SL 5I1LA 2ZG1A 2NY4B 1LEKA 5CBAB 1GOGA 4GS7B 5GISH 3BIBX 2YC1A 5FF6B 2CRMA 1AXTL 5DR5L 4CADB 4R2GB 3ZL4H 4TSCL 5F93C 3ZKXB 3EOTH 5GIRA 3CVHH 4JLRA 4G42A 3SDDD 1MHPH 4Y4HC 3SE4A 3MUJA 3V0AC 1LDSA 5HHQA 1RUQL 5I19H 1BM3H 4OTXL 1M71A 5E7FA 1AXSA 1GIGL 1HHIA 5C0BD 4OLEA 4DOHE 1WZMA 1W0WA 3RNKA 3QEHA 4M5YH 4LLMA 1T1WA 4QOKD 4NKDA 1CGVA 4K3EH 4ERSL 1NKRA 4HKZB 4L3EA 5DK0A 3VCLA 4AQ1B 2E8ZA 3TBWA 2IAND 3MO1B 3FHQA 3DROB 3X11A 1NDGB 1J1XL 2YOCA 1FZKA 4NUGH 3T3ME 4LPTA 3UPRB 5EBWB 3S5LA 2WWMD 4HW6A 3ARFB 4WU7A 5LGKA 3CXHJ 1HHKB 4RAUB 5KN5A 4I2XE 3QJFB 4LF3A 4NIKB 2ADJA 2VLRA 2HG5A 2BNQE 3N9GH 3LIZH 1IEBB 4G8GD 2H1PH 2WBJC 2APFA 4YGVA 1N6VA 2CIIA 5DJ2A 3SGDI 3IDMA 1KIQB 1IC1A 3G6JA 2LTQB 5I1DB 1UJ3C 2ITCA 4QLRA 1DN0A 4ORZC 1XGQA 4XAKE 1CG9B 5LG1A 2YD5A 4XPFH 3T65A 3OJMB 5FYLD 2YR3A 3O11B 3T2OA 1IGJA 3OWEA 4AENB 1ORQA 4OV5B 2R2EA 3T2NL 4MSWB 5E4EB 4PLJD 4PJDE 3RGHA 2FLBT 5E99L 2EKJA 1Z9SA 4R2GD 2X1XR 4XBPA 4N0CD 5E70A 3SDXF 4IDJL 3I6LD 4P2CG 2Q86B 5CEZH 5JLZA 3LKSA 5I75C 4F7EA 2VQTA 5A2LH 4PRBA 5DHYB 5I1CH 5TF1L 3BRDA 2QQQA 3ARDB 3RY6C 43CAA 1U8NA 3O4LE 1OAZH 1A6VH 1KTDB 4GXVL 3O3AA 4KUZL 4QRPB 3K2UL 3OPZH 3CFCH 3HCVB 2IPUG 1RZGB 3VFNB 3CXDH 3LHPL 4LCWA 1LE5B 5CUSH 3BUYB 5MERA 5CJOL 5MI0C 2FIKA 1CDJA 1DQJB 1MWAB 3RWHA 1S7VA 2XYCA 4AIZB 4WFFE 2NZ9C 3X17A 2R0WL 2C4XA 4OBRA 3ARFD 1NGQL 3PHQA 2BSSB 1FNGB 1T0MA 3CVHB 5ILTH 4KWUA 3MV7A 4UUJB 3EJYD 3DHJA 3CDFA 3LQZB 4UB0H 3LZFL 2EH8H 2NY5L 3TBVB 1WCQA 3WLWC 1U8KB 2ZCLH 1N2RA 1YY8A 5DJYA 5EU5B 4D8PA 1H8SA 4QTIH 3FQXA 1F02I 4HZLA 2X89A 3MXVL 1U93A 5CBEB 2P5WE 4N0FA 2GYSA 1L0XA 1GSMA 4OZHE 2P8PA 4EIGB 2KQMA 1SJVA 4CKVX 3VXUD 1Z9LA 3OAZK 3UYOD 3E1F1 2HTKD 3BVNA 1D5MB 3P4OB 4GT7A 4F37F 1KENL 3L3GA 4YUEH 5F1NB 5CJQH 1KEGL 2BSTA 4XH2B 5CGTA 5EC2B 4BZYA 4D0DA 4M48L 1B4RA 5DEFA 5DO2C 1W72H 4W81A 3T77A 2WQRA 4YZFE 5DQ9A 5CLTA 4P5TA 4NT6B 1NGXB 1MCOH 1I3GH 1QFHA 4H25A 3ARDD 1DFBH 1KPVB 4CMMA 4M7LT 3CDYA 4UTBL 1FV1B 3QFDB 5KVEL 4PRAB 1VACA 1I1YB 2W65B 1JYVA 3WN5A 4QRPD 3QFJD 2XA8L 3TN0B 2NNAA 4PP1D 5IFAH 3DURA 4M02A 3EYQC 2LABA 1F4YH 5ICYB 3IAQA 1MH5A 4R8WL 2X2YA 2W9DH 4YHZH 1UEMA 5FB8A 1BZ7B 3V7MA 1UZ6F 3MQIA 2DQTL 4KK8C 2IG2L 5IJKA 3TF7C 4Q97A 4OGXL 1HK6A 3DX7A 1GZQB 2EDHA 3SE8H 2ZCKL 5IHUL 4BJLA 3QUMH 1WF5A 1GAFL 4GLRH 1UJ3B 5EU4A 3WN5C 4ZUVB 1S7SB 4XNYL 3L7EB 4GOSA 1CXEA 1Q0XH 1HDMB 1ZEAL 3VFTB 3INUL 5C0NC 5GGQL 3UTTE 4OLZL 4JEGB 3EYSL 4GBXB 2N56A 5IJKC 4LRIC 4JJHA 5T5NG 2X4SB 1TJGH 1NMAH 4OCRL 1E4WL 5CILH 4XNQB 3W0WB 2CPCA 3FCTA 3REWB 4FQPA 3C5JB 4UOJA 2DM3A 4ISVB 4ZSOE 1DBKL 3RP1A 4J3VA 3P0GB 4JPKL 4OGAD 3D69B 2VKXA 5TH2B 3GBMH 5I1AA 2E7LC 4WW1A 4MNQB 5FOJA 4NBYB 2GUOB 4AT6A 4XXCA 2ZJSH 3STZA 1IKNC 3TN0D 1OAUH 3BDYL 4UQ3A 1P7KA 5INCA 2PNDA 4HXAH 3ARTA 4RA3A 2NXZC 2QHLA 3L7FB 4FQXB 3HE6C 1DBAL 4RFEB 1MCWM 2H9GA 1N0XL 5EUOE 4JFPB 3LKNB 1DSFL 2ZNXA 1TETH 3OHXB 1HI6B 1QP1A 5GZOC 1OT2A 2WBJD 3TEUA 2Z31C 3WBDA 3U0TA 1W72B 4M7JL 2JELL 5J06A 4N9GB 1YDPB 4X9FA 5KVDH 4XVTL 4F7PA 3FONB 1KBGL 1BZQK 2DJUA 4DAGH 1RJLB 4HEME 4NM8H 5K59E 1A5FL 5MHSE 3GUTB 3FT2A 4ZFFA 3VXME 4Q6IC 2UYLA 2FYYA 5L7XL 3VXRB 3BSZH 3T1FB 3C8KB 2I9TA 4MVBD 5E8OB 3S3PA 4G43B 4OD3L 3BWAB 4O2FB 2EXWD 2F53A 5CSGA 1F97A 3FO1A 3BEWB 4U6HB 3CFKB 2IPKA 3CZFB 1WZ1H 2Y06L 4XMKH 1KB5L 4ODBD 4OZGA 3E8UL 3QCUH 3MRNB 1BOGA 3C5SA 1DE4B 1A1MA 3I02B 4JQXA 4X6DE 2VWEE 4U1LA 4Z95L 4E5XB 1YQ2A 3W0WD 3WIFB 3ZT7A 4PR5A 2A77L 3NOIA 1R3HA 1B0GA 1AGCB 2XQYG 3MRFA 5E6IC 4OIIL 4HDIB 4YWGH 3DI2B 3BPOB 1PD6A 1RD6A 1BAFL 1IGMH 3X3FL 1KIPA 2KBGA 1QFWL 4KY1H 4MNQD 2QJDA 2QLVB 3QWOA 4PJEB 1UH2A 4X9GA 2VE6A 5B4MC 1A6TA 4U3XA 3KJ6H 4YO0A 5MP6L 1YUHA 5I71B 2DLIA 1IC5H 4JRYA 5LGHL 5DJXA 2NZ9D 4FQXD 4HWBH 3QUYB 2R1WB 3RWCB 3Q3GA 2Q76A 1YZZA 3ZT5A 2ADIA 3FAWA 3O4OB 1P9MA 1YMMA 1SY6H 3BGMB 3EKCA 3LPWA 2DQEH 1NCUA 1I4FB 3MRQA 3WLWD 1PY9A 5C6WH 4UT9L 5DHVB 3VD3A 3O2DL 1N7ML 3D0VA 5DFVD 5ETUB 4EDXA 3TV3L 3PWJB 4PGCA 5AD0A 5J1SC 3NBNA 1BQHA 4LHUB 3L1OL 5HHXL 4Y5VA 1IGCL 4DVBA 4Z7WF 1IFHL 5ACLA 3VXRD 1P84J 2LU4A 3N85L 1MPAL 3VE0A 3ZKND 5HPOA 4NO0B 1PZUB 1B88A 1DBMH 3LQMA 2VJXA 1J0ZA 1XF2A 4GKSA 3U83A 1G7JB 4G9DB 1JWMB 2IGFL 4YHNA 5HGDB 5DO2D 3CFEA 4L8SA 2OZ4A 5SWZE 1G6VK 2UZXB 3B2VH 3WUWA 5I8EB 2QSCL 4BQCA 3QO1A 5LWYH 3K0WA 1FORH 4DN4L 2EEAA 1MOEA 2W38A 5CKGA 2YHGA 2XZCL 1WTGT 4KGLA 4GAFB 4BZ1L 1SYVB 1UEYA 5MEOB 1NMBL 3EYQD 4WFHD 4G9FE 2QR0B 4D9LL 3SGEI 2L4OA 2NXZB 3BJ91 1IEHA 4HUUB 2E6JA 2FLRT 2VDQL 4WGWB 3N50A 5C92A 2YZ1A 1AR2A 4HIIB 3HE6B 1AC0A 5DZNA 1Y18B 1ZE3C 2EIZB 3K7UA 3UTQA 2R4SH 5FO9B 3D3VA 4HPOH 5ISZA 3V0VA 1CDBA 4G8FA 5CP7A 3HB3D 3TNMA 1EUTA 1V7NL 2Z31B 3BKJH 3VH8G 4ZNEA 3D39B 4Z5RB 2V17H 3E0GA 5CIPB 3MJ9L 4PRPD 4G6ML 4EJ1C 3C2SA 4CNIB 1DBJH 3GSOB 1U95A 4Q6IB 2LQRA 5I18L 3UJJL 1SMOA 2PO6B 4E41A 4MA7L 3S36L 4BFGA 3G5YB 1FVDB 1UM4L 5C0ND 3VI3F 4UV7H 4P4KA 3LKQB 1A21A 4NO0D 3OZ9L 1RK1B 1JFQL 3AMLA 1EJOH 3U48A 4NN5C 3ILPB 4G7YH 4JKMA 4Y16B 4ODTL 5E2UH 1LK3L 3B6SB 4K3JH 4ZAKC 3IVKB 3KPRA 5E6IB 1WCBB 4LNRA 4NQCB 4P23C 4FP8H 3SDCB 4TYUA 5EPMA 3EYOA 4YE4L 3PWVA 3LRGA 4JZNA 3OKDA 4TN9A 3G6DL 2A1WL 4WGVB 4ZUTA 4P4KC 2DYPD 4GFTB 3UTZA 1REIA 3OX8A 2C4FT 3O3BB 2AEIT 2NXZD 1JI1A 3I2CH 3DBXB 4NKMB 1A6ZA 3HE6D 3MRDA 3DTXA 1YMHA 3NZHH 2X4PB 1DLHA 2NY0C 3MNZB 2BP3A 4W6YB 2GSGA 1N5YL 5GGRB 5GZOD 1HH9B 5IB5A 1C5DA 4Q2ZA 4K7PY 2Z31D 1E6OH 2EC8A 4WI4A 1DN2A 3D39D 4Z7QE 3VFUA 2B5IC 1I7ZB 5CJ5A 5A43C 3IJHA 1DL7H 4V1DB 5E95B 3BOVA 3AC0A 4NO5B 2PO6D 3FAXA 3NPSC 1JZ7A 2V5RA 2Q8AH 3H9SB 1I3VA 4XP4L 4I3RL 1PJ9A 3GI9H 5JTWA 4MNHA 3NIDF 4JGJA 5IOPB 3VFVB 3BAEH 1G7QA 1VADB 4KJPC 4FFYH 3F7YA 1IQDA 1YEIH 3WKMH 4Y16D 3PHOA 3CMOL 4L5FL 3LVEA 3I50H 2F54A 2DQUL 5E6ID 4NQCD 1A6AA 1CGWA 1EO7A 4GRWE 1A9EB 2J3SA 2WANA 2OJZH 3SDCD 4JKPL 3ZT6A 4F3FB 5DD3H 4AIXA 1CLZL 5T1DH 5I15H 4PPTA 5B4MD 4NWUL 3HZKA 5SWQB 2BRRL 3WDIA 4KKBC 4MB5A 1J1OH 4EUPH 1QHOA 4ONFH 1CD9B 2AQ3A 4LLDA 2CMRL 2E7BA 2FX7L 2LVCA 3ULVF 3O6ML 4K7PX 4OV6F 1FE8H 3LRSA 3GMMB 3QEQE 1SYSA 3MUGA 5JUEL 2BRQA 4QHKJ 4F7MB 4MJIB 1QSFA 2RFXB 5EZJA 1QRNB 1MHEA 1RK0A 4M6MH 2IH3A 4WU5B 2EECA 1N59A 3FL7A 3TBTB 3QO0B 4R90L 4Y4KB 2PETA 4DKAA 4LDLB 3AROA 3PV7A 4F9PA 1ZGLM 1KC5L 2NLJA 1I8KA 1A4JB 1ULVA 3U6RB 1QD0A 5BQ7A 1MAKA 4V1DD 1I1AA 3M17A 2ORBL 1EGJL 3STBA 2HVKA 3G08A 4YPJA 3AU1A 5IKCB 3NIGF 1LO3L 4FXGB 5IEHA 4PRHB 1NSNH 2XN9A 2C1PB 3B5GA 2V9RA 3GB7A 4GRMB 3CFDB 2ADGA 4NN5B 4OZGF 3SKMB 1OTSC 2GT9B 4I5BA 5TE6H 2A83B 2ED7A 3GFUA 5E00A 2AJZB 1MHHA 4ZAKB 3FFCB 4XPHH 3KXFB 2DLTA 3KAAA 2MQCA 1MI5B 4Q9RH 5JDSA 4HIXL 4PJBA 2UWEE 3RWEA 4NQXA 4YDIL 1FFPB 1P1ZB 4LLQB 5DD0H 1YEGL 2JCCA 4K9EC 4DEPC 3MA9L 3LOWA 4JHAL 3DPBA 1LP9B 1A6WH 1BBJA 3HR6A 3EJZC 3WJLA 3BIKB 1W2KT 2YD8A 1WV7T 5E5RB 3TVMA 1G1CA 2JB5L 3SJVB 3AY4C 4K94H 4LAQH 2FX8L 2NY0B 4OZFA 4U6YB 1CZ8L 6FABL 5MEPA 1MCEA 32C2B 3EOAB 4PREA 5JW4R 1QRND 1Q1JL 2BDNH 3P77A 5EU3A 4M93B 1DQQA 2ARJB 5C86A 1PG7L 5FDYA 2B5IB 4Y4KD 3LN4A 3A6BH 4NDMB 4X6FB 4HK0B 1A3RH 4JFDE 1MFEL 3O3EB 3MLZH 4LFHD 4UI2A 1D3CA 3WNPA 3NPSB 1NCCL 4ODHL 3GMOA 3ARYA 1MLCA 5EU7C 3T0XA 3C87A 4PJXA 3HAEG 2Y25A 4XP6L 3TVMC 2ZUQB 3CLFH 5J6HB 1RZ7L 3P11L 2AK1H 5F96H 1MY5A 3P30H 5KS9F 1SJHA 1HHGA 2KZWA 3LRHA 3SGDH 3MV9E 4U2ZA 4JQIH 4OF5A 4ONHA 5EDXA 5BXFA 1A6UL 5JXEC 4ZAKD 1U8IB 5ADOH 2P42B 1VFAA 1YJDH 3KXFD 4BKLA 2EYTA 4MMZC 4U1JA 3PGDB 4P23D 3V5DB 5JW4Q 1MI5D 1G7HA 1OGAB 4JG0L 4Z8FH 1NKOA 4M5ZL 1NGPL 1NFDB 1XF1A 3DXAE 3PP4L 4HSQA 5T3XE 1NBYA 4MA8H 4TQEL 4NKOB 2OR9H 3PWLA 1P53A 3S37X 1JP5A 5JHLH 3SJVD 4F80A 3B9KC 2NY0D 5F7KC 1WFTA 1BGXH 2O5XL 4PJCA 5HYQA 1CF8H 1Y0LA 2IFFH 2L7JA 2P8MA 5GZNC 5IM7A 2R39A 4HT1L 4QRRE 3QRGL 2GK0A 1KNOB 2VABA 1L7TL 5F7NC 5BRZE 3IKCA 3UROR 3DYMA 4LIQH 4APQB 3QDGA 1MAML 4S1DC 4QWWD 1G9NH 4WI8A 1E4KA 4AEHH 1NJ9B 3PNWB 3R1GL 5E8NA 3L3KB 3DRTB 1KFAH 4XVJH 4YPGB 4XRCB 4KJPD 3HTLX 1CU4H 5I1KL 1QR1A 2GJZA 3MV8D 3NABH 5IMOA 4EOWL 1N4XL 1K5NB 1X7QA 3RGVC 1I75A 1XIWC 4YHLL 2HT3D 4GW5A 1YN7B 3GK8L 3QDJE 1AGEB 1NCDH 4I18B 4L3CB 5DJ6A 1E4KC 1OGAD 2BSED 2AQ2A 3THMH 4M6OL 1QNZL 4DEPB 1MREL 1CR9L 1V3MA 5E9DA 4MD5A 5DMKB 4KKBD 1MIEL 1SEQL 3S35X 2MQ3A 4UOW0 2VLMD 3DUHA 4NHUB 1CXKA 4M3JA 4O02L 1CFBA 1NAKH 2XRAL 1RZKL 2ICEB 3LQAL 2LAAA 4NBZB 1A7PL 1W8NA 3WDJA 3D9AH 4G6KH 3V4PL 1JPTH 4H5SA 1GOHA 2EO1A 3RY4A 2EYRA 3MJ8B 2BOCB 4Z7UA 3VFMA 5L9DH 4U7MA 5IBUG 5I8CA 1OPGL 4NNXA 5I16B 3S6CA 1SM3L 2R0KH 3BHBB 2HKFH 1S3KH 2J7LA 4XCFH 4DUVA 2YN3A 2AJXL 3QEGL 3UZEA 1KJ3H 4WI3A 1QBAA 3CDGB 4IMKA 4APQD 3SY0B 1RFDL 3OXRA 5J3HC 5I2IA 2IF7A 2X4QB 2VQ1A 2F8OA 5F9OH 4GQ9L 3MXWH 4HUMB 3WV0A 3S7GA 1H3PL 1BBDH 5AZ2L 1OTSD 4KC3B 2FEEI 4QXGH 1BZ9B 1HXYB 2GTWB 2H26B 1B4JL 3VWKA 3ROOB 1F3DH 2A73B 4HD9A 5IP4A 3NN8B 2J88L 2LU3A 4G7VH 1G7PA 3HC0A 4D9RD 3U0WL 5M94B 1I8MB 5E08H 1SEBA 3ZDYE 4S1RH 3FOLB 3MX0A 5I1IL 1WVZA 5DEGA 2QQNL 4X6CA 4FZEL 2AABL 5I1GH 3EJZD 4ZXBB 3D48R 3W2DL 4LPYA 1U0QA 2DWEA 5E5MA 2XWBB 4L9LA 1CGUA 5F3BB 1TJHL 3PJSB 4HWEH 1V05A 4HULB 3OKOA 4PLNC 5MENA 1Y6MR 4XCNA 3NGBC 3BGFB 4QCIB 5TGBA 1CQYA 1O0VA 4MNGB 1FGVH 3OKYA 4TNWK 5HYSB 4PG2A 3OKMA 4HJJL 1A7OH 5B3JF 5C0BE 5CKAA 4MHHG 4MDJA 4MQSB 4ODWB 2EIDA 3MLYL 1EZVX 1FH5L 1KJMA 3MGOA 4A2MA 4HS6A 1UG9A 4XPAL 5FM5M 4RAVA 5JW4M 1H0DA 4QOKE 4HQQH 3KG5A 2AP2A 2MCPH 4L9LC 3GSVB 3MLWL 4HLZH 4LSVL 1MUJB 2IANE 2H3NB 5DI8A 5CJXA 3WJJA 1MFNA 4RFOH 4LKCB 1MFBL 4HIHB 1A7RH 4NZRL 1U8JA 5ITBL 5DRZA 5A16A 2UY7A 4XNXL 3GIVA 4GG8A 2ED8A 5AYUH 1OLZA 1JHLL 2DQGH 1ND0A 3RGVB 3IS1X 5IB2A 3BXNA 4XHQA 2I9LB 5EA0H 1XIWB 5FUOH 4TVPD 5JXED 2AERT 3MTRA 3BP5A 4PJBF 1NBVL 1TIUA 1X5ZA 1F11A 1LO2L 3ULUE 4CVWA 4G8GE 1ADQH 4JFFB 1HILB 4KKNA 1A4KA 2JCCF 3O81A 3BZFA 2CJUL 2VDOL 3QH3A 1YQVL 4WI5A 3IETB 3WDHA 4KZDL 5C0EA 3WJJC 1KN2L 1ORSB 1OQOA 1A6PA 2FDBP 5FYLE 3MLXL 1GGBH 4ZXBD 1NANI 1L0QA 5FAAA 4IRZL 4OQTH 3TH4T 3B9KD 5GJSH 5HHPB 4MD4A 4O5LH 5BZDB 4ZUSB 1H15B 3HI1B 4LQ1A 1A7QH 3I6LE 1AGFB 3KLDA 2BVOA 5GZND 2EDJA 5ANMA 1GCFA 2DB8A 4U1NA 3SDXB 3NACL 5KSUA 1DVFB 4PS4L 4PJXF 1B3JA 3TA3A 4QGTA 4C56A 1OGTB 4S1DD 5DDHB 2IC2A 4QT5B 3WHE1 3C9NB 3KGRA 1CT8A 2H45A 3L5HA 1T5XA 2MOVA 1A7NH 7CGTA 1Q9WB 2FCBA 3UXFA 2G9HA 1NPUA 3DMMC 1XGYH 2B4CC 4KTEH 3EYUL 3QUKB 1CDYA 4LPUA 4WEBH 4MJ5B 5AUMA 4OZ4B 3RGVD 2BZDA 1XIWD 3MODL 4PBVC 2EYSB 4CN4A 1QKZL 1F4XH 4QTHB 3WSQH 4F33B 4X4ME 3TA3C 3KYMA 4Z7VF 1JN6B 1J0YA 4JFFD 4K23H 3Q0HA 3LEYH 4AL8L 3MLRL 1TENA 3C6LC 3X13A 4I0KA 3JV6B 2EDLA 3D18A 3RDTA 3WXVL 5HHOA 5IG7B 2MJWA 4GW1A 4GAJL 3GJFH 1JPGB 1OF2B 1JUFB 3I9GL 1Y6KR 4DGIL 1KPUB 1V3KA 2BJML 4PJCF 2Q3AA 5J13C 1G9MH 1KGCD 4O2CB 2VL5A 1UACL 2XQBH 4LARH 3HI6L 3C2AH 2MWCA 1IC7L 2V5TA 4IOIB 4ZUWB 4KH2A 2OCFD 5K9OB 3FB6A 3SGEH 5GS2H 5HGHA 5IVXA 2AV1A 5LXGH 2W60A 4GMSL 4R0LB 3QIBC 1E28A 1DVFD 1EK3A 2YBRB 4JDTH 1C08A 2ZUVA 1EHLL 3QIWC 4PGDA 5J3HD 3M07A 4QRPE 4ODXA 2VNCA 1A3LH 1ITCA 4RAHA 2CGRL 1NGWA 4WHYG 1BIHA 3HR5A 4WHDA 3VI4F 1F3JA 1PQZA 1EAPB 4NQUA 2A0LD 5DT1L 5GJTL 4EI5B 5EBMB 3T0EA 4FXLA 3KDMB 4WO4A 4YHOL 4M7KH 3P40A 5I6XB 4K7FB 1DZBA 1MFDL 5HYJA 2BSRA 1ZLWH 2YA1A 1LO4L 5BVPH 3WD5L 1WBXA 2FBJH 3BWUC 2V2WA 3CFIC 1H3XA 3EYFA 1EFXB 5E1AB 1K6QL 5DD5H 3RQ3A 3KHQA 1U6AL 1SVZA 3PV6A 3QHFH 1GPOL 1R24A 3WNOA 3DGGA 1U8PB 3Q48A 3SKOA 2X70B 2B39A 1PYWB 1G7MB 4J3OC 4Q9BA 4Y7MA 3T0EC 3MCKB 4TUJA 3UJTH 5DTFB 4YEEA 3EYVA 4CU6A 3MYJB 4Z7UF 4P2RA 1OP5H 3TLRA 4MXVE 1J05B 1ZAGA 5DD1H 2LFGA 2HJKB 4M43H 5IB3B 2R9HC 4DN3H 3MRJB 1JRHI 3GSXB 4LU5H 2J8UA 4K8RC 2CRYA 3K1DA 4FTVB 4PJHA 3JWOL 2Q7NA 3ROLB 3QJHB 5KSBA 1UWEH 5C1MB 3BKMH 2VR9A 4LEXL 5FYJL 1D5XA 1KOAA 1JTPA 3QUZA 3SCMA 2QHRL 4PTTA 5EIQA 3DMMB 1UXSA 1VGKA 3KPPA 4JFHE 3SE9L 4HPYL 3ET9F 5F1KC 3HRPA 5D9SA 2CR6A 3O41A 4OFKA 1M7IA 1H8OA 3GMPA 4LEOA 3B83A 4X6EA 4EI5D 4ODUA 4FQ2H 5IVZA 4IOFC 2APVA 3IFPB 2WIIA 4M1GH 4Z7OE 1MCWW 1XCQA 5CEZE 1L4IA 2ESVB 2HFTA 3C6LB 4FXKA 3BGAA 3PWNB 1VFMA 4QNPF 2F58H 2FGZA 3IXAB 3MRPA 4MJ4A 4EI6A 2EH7H 2GY7B 4X6CF 4PD4K 1EFXD 4IHOB 1QVOB 4QHKI 1WZLA 5E6YA 3HA0A 5C0IA 5EO0B 2EICA 2V5SA 1FNLA 1ZKAA 3I3BA 4W70A 3VW3L 1I8IA 4OLYL 2EE9A 4NZDA 5C0JB 1K8IB 1N6UA 1YNKH 3FQTA 4EVNA 4OLWL 2IBBA 1LK2B 2RIKA 1JPFA 4ZFZA 3H0TA 1ACYL 4GSDH 1AH1A 1JPSL 1DCLA 5BZWB 1ES0A 3W0WE 1KB5A 5HHQB 4U2YA 4FRWA 1NH6A 5D96C 1KV3A 3PUCA 3QIBB 4FTVD 1GHFH 4JB9L 4P4RA 5EWIL 2VDRH 1GZPB 1F3RB 2DQCL 1TITA 2BVUA 4MNQE 2YEZA 1F6LL 1XGUA 1T89C 3MNVB 4OAWB 5GGRY 3TIDA 3BP7A 3MACL 1INQB 3DMMD 1R0AL 2X42A 5DK0B 3Q1SH 5EN2A 4OCYH 1AIFB 4JFYA 3X11B 1T7XA 1EEYA 4NUJB 5T5FH 3WXWL 1DBBL 3MREA 3EO1B 3VRLE 1S7XA 4L4TA 1QPPA 4Y8AA 3QQ4A 3GMNB 3LCYA 5D1XA 5DRWA 3L3OB 5KN5B 1C1EL 2HRLA 1WICA 2YD4A 1YYMH 3C6LD 1AP2A 3Q6GL 5D72H 1UB6A 3WIIH 4YFLI 5HHMB 3O2DA 1F2QA 4FZ8L 1K8DB 3VXRE 1DN0B 4L8CB 1XGQB 3BZEB 1NL0H 4HC1L 4OM1L 4UNTA 2NY7H 2OTWA 3ES6A 4Z7WB 2Z35B 4NWTL 1H3GA 3LEXA 1CXFA 5DVLA 4P5KA 4N8VA 1RJZB 3HNTH 1M7DB 5TQ0H 3O2VH 3LKSB 4OGYH 4S10A 3QIBD 4PRBB 3V4UH 4LLUA 2JJVA 3QIWD 2KZ1B 1NAMB 1Q9LB 2HYMA 4HXBL 4PJEE 3O3AB 4WFHE 1BVLA 5TDOA 3FN0L 3GSNL 5JHDB 3UTPD 1J1PH 2B0SL 2D0FA 1WWBX 4PRID 3FB5A 1KXTB 3OSKA 1PLGL 5IESL 4X9BA 1RUMH 2XPGA 5AWNH 2VDMH 5F44A 4KDTA 5MERB 1LGVA 3RWHB 4LBEA 1FZJB 1OL0A 3PHQB 1X6NA 2QQKL 3PG2A 1T0MB 3VMNA 1JGVH 3JUZA 3MV7B 3T04D 3EOYG 1VFBB 1T7YA 3MRMA 4LLVA 4UOW1 1MFCL 1JWUA 1N2RB 3MJ9A 5JNYA 1MHCA 5HHMD 2GCYA 2EDNA 4OFVA 5LQBL 2VDLH 1KT2A 2CQVA 3I6GA 3FT3A 4XNUL 1U93B 2F5AH 2W0PA 3G5VA 1FNEA 2P8PB 5SV4A 4HIEA 5DMYA 2DQIH 3QEUB 1IGYB 5IHZA 4UILH 3UC0L 3ULVH 2BSTB 2HN7A 2R9HD 3QXTA 3TWCL 5IVXF 5D96B 1FRGL 1S7RA 3GM0A 4K8RD 4Y2DA 4KVNL 3RI5K 2AK4E 4UDUA 4NHCL 2P43B 1VSCA 5D5MA 5D93B 1CDIA 1XF5A 1R3LA 1OAKL 4HV8A 1WIPA 4KTDL 3S4SG 2AEPL 4YAQB 2N1KA 2OQJB 5JHDD 2NNAB 3NABL 4X4YB 5HYFA 1V3JA 3SKUD 3TZVA 4GKZB 4JRXD 3R0NA 1V3LA 1LEGA 1YNLL 4PJFB 4C4KT 4IOFD 4QHNA 3D85A 3ZHLA 4HUVA 1F8TH 4ETQB 1E27B 3D39E 3MLTA 1Q0YH 4XMPH 4NJAL 2E3VA 2UZIL 1RUPL 5C0DA 1IAKA 4M1DL 3IFNL 4KU1A 3HLAB 3GHBL 1DQDH 4RWYL 5EU4B 3GIZL 4XXDB 3RL2B 5IVNA 3TBSA 2VZ3A 4XBEH 2C1OA 1L7IH 4TOYH 4R7NA 4WVRA 5D1QA 1JIBA 1QSEB 2X4UB 5GGTL 4NQDD 3EIFA 5IV2A 4LCCA 1RZFL 4XMLH 5FCUL 2DAVA 3HKFA 3OR6B 4G6AC 2Q6WB 2J8UF 4PJHF 2DI7A 4LSPH 4TUOA 5MEQB 4RMVA 4E42B 1XF4B 4NQCE 1CIDA 5KSBF 2DDQH 3ULSA 3DLQR 4LMQE 3GBLA 4Y0GA 5DK3A 3ZDZE 4ETYA 4CJ1A 2P7TA 2YD1A 3IGAB 1EIBA 3UYRH 2FATL 4TSAH 1UM6L 5I1AB 3S88L 4Q0XH 1AD0A 5I1JL 1KACB 3NCYP 2Y6SC 4Q7DA 4WW1B 1BBDL 3LDBB 4S1SH 3F7VB 4WY7H 3S37L 4KI5F 1JJUA 1DUYA 5EOCL 1CLYH 2XOTA 1B2WL 3I75B 3CC5B 3NFNA 1PEWA 4H88H 4Y88A 2I5YL 1YEJH 1WBYB 1HCVA 2FH6A 2OZ4H 5HY9B 2WINB 3DVGB 3FT4A 5BMFH 4WTZG 35C8H 4CVUA 3OKKA 4M6NH 1WAAA 1AXIB 1HXMB 3F5WA 4HBCH 5GGVH 3U0TB 25C8H 1WFUA 1JWSB 4I3SH 4F7PB 1IBGL 2WUCL 5IJVA 3L3DA 3DO3A 1HHJA 3H9SE 3HNSH 4S11A 1XF3A 4LHUG 3A6OA 1EGJA 4LRNL 5FYLL 4H0IA 1QSED 2AEQH 4KZEH 1WFOA 2GK2A 5GGSA 3ISWA 4HWZA 3WE6B 4S0SD 3MLUL 3GO1H 4OKVA 3RJQB 4XTRC 1YEDB 4YXKH 3T0BA 1GC1H 5C0FA 4OZGB 1DEDA 1KCUH 2P1YA 4X6BB 1A1MB 2ZOKA 5DLML 3D5OF 3KNBA 3LSOB 2HAZA 5TDPA 4NRYA 3MRFB 4QRQA 1CD8A 3FFDA 1P2CB 5GRYA 3S35L 4MX7B 5F7EH 3V9FA 4GAYB 2R2HB 3DX6A 2VLJA 4MCYB 2YPVH 1RV6X 3O4LA 1T66C 5I30H 5C9JB 4X5WA 3VFSA 4DKEL 4J6RH 3MRBA 2R8SH 4FQIH 1ZLSL 1XMWA 4MJIE 2G60H 2CIKB 4YC2B 1QRNE 1RUAL 5EUKB 4Y4FA 5FXCH 1OM3H 5IGXH 2Q7YB 3LKPA 1KG0A 3Q3GB 1QLRA 2DD8L 4ZOAA 1UWXH 2QTEA 2H6PA 1YMMB 4KMQA 5IFHL 3ZDXE 3OV6A 4EIZC 5DF0A 3PQYB 1DANT 1FBIL 1GGTA 2E27H 3D0VB 2GITA 3WHXB 5BV7H 3VFRA 2OR8A 2RB8A 3MNWA 1SJEA 3ZTJH 5IW6A 2VISB 2PW1B 2VIRA 8FABA 4PRDA 4PRHE 4KK5D 2PTTB 3KHOA 3RVXC 2P5WA 1N64L 4OZHA 3FB8A 4M4PA 1NLBH 4UQ2B 3PGCA 5KS9B 3FFCE 3G5XA 3QXDA 3WFEL 1VA9A 4YHNB 3KXFE 2E6PA 2X09A 3EO0B 1XH3A 3CFEB 1MI5E 1MRDL 4L8SB 2ZUSA 3I84A 4UT6L 5ACZB 1NANH 2AQ1A 3TPUA 5I66A 5DJCB 1U8QB 4MHHI 3MRRB 4TPRH 1FL3B 4NQTA 2F8XC 1ONQA 1HH6B 5GS0H 1S9YA 2W1NA 2A6IA 3VGAC 3RWGA 1IM3B 4HIJA 1LP9E 5L6YH 2X7LA 5B38B 1Z0NA 1Z5LB 3U9PL 4R26L 4OD1H 1B6DA 4YR6A 2AAVA 4F9LA 1A22B 3NCYS 1T0NA 4XPGH 3RJDA 3ZYIA 5FM8A 1AD9B 4IS6A 1MWAL 4ZO7A 1J87A 3UTQB 3V0WH 5GS3A 3NFPB 4H8WL 5FHAH 1A0QL 3D3VB 2B8OT 1INDL 4P9HL 3KVQA 4FQCH 3FTGB 3R06A 5H35B 2DI9A 5ENWA 5B39A 1UGNA 1OAQL 4PIRF 2IEPA 4E0RB 4POZC 1DUZB 3QA3A 3L3HA 4XVUC 3PQYD 5AAMA 1TTGA 1WISA 2NQCA 4J4PC 4JPVL 1S7QA 4UDTA 3IFLH 4EBQL 5ESQA 4QRSB 5EH1A 4LLAA 3GI8L 1T03H 2NW2A 4JHWL 1P5VA 2OM5A 4GW4B 1KTRL 3O9WA 1P69B 1T22B 2D9CA 2X4RB 5D7JC 4F15C 2DQFA 3IDYC 4OQ1A 5JQHC 1XEDA 4KJQC 5DJ8A 4ODSL 3WS3B 4OD2B 4MD0B 2BNQB 1XGTA 1BFVL 5D5MF 2DTMH 2FD6H 5T33H 4LNRB 1OGAE 1KPRA 2VXUL 3FRPA 2R23A 2FWOA 4FQJL 1CE1H 1FFQA 1IC4H 3EYOB 4JZNB 1LEIA 5IQ7L 1NFDE 3BPNC 4ZSOA 2Y6SD 1D5BB 3UBXA 1IM9B 4JCLA 4NNPH 1D6EB 4QXTA 2WZPD 4OB5H 5BV7B 4K9EH 2XZAH 3UTOA 2D4FA 2V7NB 4KAQH 1TZGL 3HNVL 4PV8A 5C0RL 3IDIA 4PJDB 2FJHA 1F45A 4OI7A 3DIFA 5IMMA 1A6ZB 3FO0L 1YMHB 1XGPA 5L0QC 1YECL 3CVIH 3GZKA 1GJIA 2D7MA 2Q87A 5IB5B 1JNHB 1C5DB 2CXKA 5EUOA 3VH8A 2Z0BA 3MFFA 2X9YA 4LVHC 5F7HA 5IIEA 3VFUB 5F7LB 1P4IL 1AJ7H 4LFHG 4WW2A 2IMMA 5CEXB 1KIRB 2FHCA 4DKFH 3M1BB 1GXEA 1GGCH 5JDJA 1RZKC 2LE9A 4R4BB 3V52L 5C8JA 3VXMA 4PTUA 3UJIL 2VQUA 3P73B 4IIQC 3FMGL 1FG2B 4OZFH 3V4VH 2DQHH 4XCYA 4AH2A 1YEHH 5GHWH 4PD4J 3T08A 1B90A 1IQDB 1DQML 5C7XL 2VXSL 2OP4L 2BNQD 2WBWB 4D9RE 1EXUA 4WW2C 3IFOA 3PABB 4EN3A 1X5KA 3VA2C 2ID5A 4X6DA 4F58H 2WUBL 1NEZA 3WYRA 4JAMB 1A6AB 1U8OB 1R5VB 1K3ZA 3LAFA 3VGAB 4JY4B 1EJ6A 3LD8B 3NA9L 1IM9D 1T66D 4LSQH 2FSEA 2OMBA 5LAXB 3NAAH 1AR1C 2SEBB 2O5ZL 4XP9L 1K2DA 1FVCA 4DVRH 4DQOL 3MUGB 5KW9L 1HHHB 2IQAB 2R0LH 2BVQB 4OLUL 2XKNA 3Q6FA 1WAAF 4EN3C 1BD2A 1N59B 3D0LA 2J4WL 3TCXA 4DZBA 1CTNA 4OCSH 5L2KB 2O5YL 1HWHB 5FHBH 3R0MA 3AXLA 1OCWL 5L88L 4QHUA 3BPCA 4LSSH 5EU7E 1FGNL 2P44B 4JZJC 5BQ7B 2F19H 5ERWB 3HZVB 3KYKH 1LO5A 4X8JB 3EOBB 5F1IB 4YDVA 3G6AB 3FO9A 4KXZH 1C7TA 2JJUA 3RVXD 5D7JB 4TRPH 4EUPG 4XVSL 2IALA 3G9AB 3LMJL 3IDYB 2DL2A 2XN9B 1INEL 2ADGB 5DUPL 4WFFD 5JW3L 1T04B 2YSSB 1F58H 5GRJL 6CGTA 4HUKB 4L4VA 1MHHB 1P4LA 1OAYL 3ARGA 5AAWA 1VERA 5DQDL 5GGUB 2AI0L 3RWIB 5JOFA 4HKJB 4U6VL 5FA3A 3QQ3A 4IRSA 2VXVL 5SWZA 4DW2H 3BPNB 4HGWA 5F7FA 4G8EA 2R69L 2FX9L 3P0YH 4P46B 3RVUC 3SKJH 1E4XH 1IKFL 3TPKA 4U33A 1AQDB 5HHVH 3QNYB 4PB9H 4NSKA 4FABH 3C60A 3RKDD 9CGTA 3NIFF 2FJFB 4G9FA 3BO8B 4RFNC 5L0QB 3NCBB 3ARGC 3HMWL 3OTTA 2OLDA 4HAFA 3H9ZA 1X5HA 1AGDB 2I26N 2YMXL 3CAFA 4I48A 3P77B 5K9JH 2ZCHL 4IRSC 3D25B 5HTSA 4TULH 1FLRH 4B5EA 1CK0H 2E8YA 4LVHB 5K9KA 4PGJA 1R5WA 4G6JH 1CL7L 5L2KD 1XZ0B 3NA4A 3GJEA 3TNNB 3NCFB 1Q9KA 3NTCH 3CSYB 1LMKA 4M8VA 4K3HA 4Y19B 4J4PD 2VH5L 3C60C 5FV1L 2BVYA 4AEIL 4MLIA 4TTGA 4RCAA 1U3HA 4IMLA 1FDLH 2ITDB 4OLXH 3JTSA 4IIQB 2AGJL 5GXBB 3QB7C 2PR4H 4H1LH 5D7JD 4HFWB 3UAJD 1SJHB 5DRXA 5DRNA 2ICWJ 1RZ8B 4KJQD 5J1TC 1CGTA 1RVFL 2O93L 5F97E 3MBEC 4DWHA 5HJ3A 4ONHB 3RL1A 1NCAL 4O58L 4ZS7L 4ORGA 4JFFE 4P9MH 4JO3L 2DIBA 5C07B 4YZFF 2FIRT 2W0FB 1RU9L 3L3JA 5EOQH 5CD3A 1CGSH 1BMGA 5A40E 3HC4L 2OX5A 5EZOH 1IGTA 4YEFA 3RU8H 4Z7VB 2FGWH 3BP4B 1CQKA 4NRZA 4P46D 3GHEH 1AHWC 2EXYC 4HMCA 4C57C 1ZT1A 3WS6C 5JOPE 3AFLA 1ZLUK 4TNWF 3UTTD 3SPVA 2HVJB 4MCZA 4QRTB 3RWFB 4DCQA 3OKLA 4L29A 1KGCE 2ADFL 4U31A 3BPLB 2G75B 3HS0B 4FNLL 4Z18A 3QYCA 1I1FA 4HKXA 4JPWH 4PJCB 5HYQB 4JFEA 1C5CL 3MRKA 4WV1B 3RWDB 4PB0L 2VDKH 3TJEL 1SHMA 4WTWA 3SDXE 5D4QA 2CSPA 1FCCA 3ARBA 2HT4C 4JZJB 5BW7A 3WUZA 3UDWA 2YZ8A 3IKCB 3OAZH 3QHZL 2PKDA 4I0PA 4Y19D 5BOPA 1JHTA 2H32A 1JGLH 2XIDA 2BVPA 4JO4H 3MA7B 3ZLQC 3W5NA 5E8NB 5D7SH 2VR4A 5F1OB 3TIEB 4OF6A 5IROA 1UVQA 1HINL 4FA8A 3U46B 1QFPA 1OSPL 1QR1B 1AXTH 5DR5H 1M6OA 5A1AA 4JDVB 4TSCH 4GKNA 3FN3A 4MDIA 5T1LA 4PJ8A 4MXQC 5FO7B 2K9UA 4PG9A 1YPZB 1A2YA 2H8PA 1RUQH 4GW5B 4OTXH 5B8CC 5C07D 3OG6B 1RZIA 1GIGH 1NGZA 43C9B 2D03L 4WWID 3DV6B 5T1KA 1CD1A 4MD5B 5BJTB 5IROC 4ERSH 4HWNA 5I1HL 1MJUL 3BP6A 1HSAB 1T3FA 2YXFA 2X4NA 4L3AA 1J11A 1MEXL 3QXAA 1NQBA 4RFNB 3VXPB 1HQ4A 5IK3B 2GKIA 3AREA 2EDKA 1J1XH 5H37H 4H1LB 5KSVA 4OFIA 4P2QE 3U2SB 3NH7L 1NMCC 5EUOF 1EDQA 4Z7UB 4YXHL 3VFMB 3QPXL 4NNXB 3ARXA 1T1XB 5EO1B 5JXAL 2YPLB 3B3IA 1FAKT 5TPWL 4H26B 3P4MB 2PYFB 4OJFL 1JYXA 3V5KA 3WFCL 4QO1A 1OW0C 2ATKA 2OK0L 3AREC 3KPSB 2PTUA 4JCMA 1I85C 3LPFA 1S7UB 2RCSL 4XI5D 4LQFL 3RZWA 5FYKD 3F62A 3T2NH 4BH7A 1OWRM 2D9QB 2N7AA 3V8CA 3VWKB 4ZPVA 3JTTB 4LLYB 3U1SL 2BMKB 1I1RA 1ZA6B 1FAIL 3MR9B 4X6DF 4IDJH 3MRLA 1UZ6E 5FOBA 4YHPA 2BCKB 2Z93A 3GBNL 4MLSA 2D31A 5TF1H 2HFEB 5F7DA 3RVUD 3KYNA 3C8DA 4K3DL 5D2LB 2JJSA 4BK4A 1AHWB 1PY4A 3QQNA 4GXVH 4N0UA 3DSFL 4PY7A 1EBAA 2QKIB 1R3KA 2ED9A 4KUZH 3WFDL 5H94A 3K2UH 4YDLC 2F5BL 4N0RA 4HEPG 5JW5B 2OI9C 1UKTA 1G0XA 4M6AA 5EIIA 3LHPH 3MRCA 5J1AB 4JDZB 3O3DB 1A14L 5CJOH 5I73C 2P48B 3HC3L 4OFYD 4PGZA 1I9EA 5MENB 1A1OB 3S8WA 2R0WH 1IGFL 4ZPTB 4RNRA 5FO8B 4ODVL 1NGQH 3L5IA 2PYEB 3OAYH 1WWCA 4FTVE 4CUCA 1T83A 4GQPH 3OKMB 3A6CL 3LZFH 4HX1A 4ZTOL 1JZ5A 2JJSC 2NY5H 4JPIA 4NC0B 2YPLD 3L5WA 3MGOB 4NQSB 3VJ6B 5JPMB 3AS2A 1MJJB 5CZXC 3GSUA 4RAVB 2V2XB 1T5WB 4JFDA 3V5HA 2P24A 5C2UB 3CSGA 4NPYB 3N1QC 3VMPA 4MYWB 3MXVH 3X3GL 5IMLB 3PP3H 3KPSD 3C5ZA 3GSRB 1U8JB 5DRZB 3VWJC 2EC9U 1E0OB 5D71L 1KENH 1PSKL 1KEGH 3MV11 3MBED 3P9LB 2JKXA 4MA1B 1T83C 2XZZA 4M48H 3MRIA 3NZ8A 4O4YL 2ESVE 4JM2A 2EE6A 1G7IA 1V8HA 1U8MB 1A4KB 2MKWA 3HAEB 2RAMA 2DLFL 4QF1B 1X3DA 1K4DB 1EO8L 3T0AA 4C83B 1VDGA 4YJZL 3QUXC 5E8PA 2W0KA 5C0EB 1D5IL 4UTBH 2EXYD 1ZVYA 5KVEH 2ZSWB 2XA8H 4NGHL 1QEWB 1RI8A 1TVHB 4G8IA 4GLRI 4HAGA 3VD4A 2R4RL 4HLZG 4R8WH 1U91B 5CP3A 4HC1A 1FO0L 4PJ9C 1VKXA 4JFQA 1NMCB 3L5JA 4WJ5A 5J12C 3AAZA 2HLFC 1UC6A 5MEND 5E94A 1VGEL 3F6LA 5ICXB 2BVTA 4XCEA 4OI8A 1IILE 2DQTH 4G3YL 2IG2H 3A67L 5C0CB 2XA3A 5FM5O 4OGXH 4KROC 2PYED 3G5ZA 4KRNA 4G80B 1IEAA 2HT4D 1RY7B 2ZCKH 3DV4B 4U1NB 2FECI 3OKNA 3MJ6A 5C08A 1AKJA 5IHUH 5KSUB 1LNUB 4QRRA 1GAFH 1CDCA 3QXUA 4C56B 4XNYH 3UTPE 5KVGL 4OSUL 5BRZA 5HPMB 2JLLA 4FMKA 1U3JA 1T5XB 1FNSL 4UU9B 5EOCJ 1QBBA 1ZEAH 3GSNA 3QXWA 3INUH 2AVGA 4WI9A 4X7SL 5KTEL 5GGQH 4OLZH 5FKPB 3EYSH 1KYOK 3ZKMC 5SV3A 4MXQD 2MQ0A 4OCRH 1E4WH 3QNZB 4IEFB 1ODAA 2PCPA 3ALPA 3KYMB 2EIBA 5IB4B 4TVSa 1DBKH 4JPKH 3HMXL 4I77L 5HD8D 3D18B 1B0RA 4D0CB 5HGAB 3O6FA 2P8LA 4OD1L 1MIML 1R5IA 2QADB 2OI9B 4WIQA 3N1GC 1K9TA 1JK8A 3BDYH 4Z7WE 1OQXA 1CFSA 2QBWA 2ZOLA 5D70L 5DUBA 4NBXB 1XCTA 2GHWB 4NOFA 1N3NA 1DBAH 3HRZA 3EO9L 1N0XH 3V6BR 1J0HA 1DSFH 5F7WC 5C0CD 5CMAB 1EA9C 2JIXA 1CS6A 4NRXA 4M7JH 2JELH 3UO1L 3O6FC 4XVTH 3VXOA 1KBGH 2Y07L 5DURB 3WO4B 1A5FH 3KPOA 4J8RA 3VRIA 2AJVL 4NOBA 4ODXB 2R1YA 5JHDE 3HE7B 2XXCB 1ZOXA 5L7XH 4UAOC 4CBPA 3SN6N 3FQUA 2KH2B 3TBYA 3BH8A 2V2TB 3OJ2C 3QEQD 4ACPA 3VWJB 1UQSA 3KLAA 5DWUL 4OD3H 3GKWL 1S5HA 4J3UA 5IBUB 1MCSA 4WRLA 3JWDC 1JV5B 3KPQA 1P6AB 3TCLA 5EBLA 4NFDA 2Y06H 1KB5H 4K07A 4UIMA 3E8UH 1KJ2B 1IMHC 3MV7E 5CSZA 4Z95H 2XTLA 4GRLC 2VLKA 2A77H 2Z92B 2Y7QB 5DQJA 1FZMB 3GMLA 4F7CB 4Z9KB 4QXWA 5ESVA 1P4BL 3Q5YA 2D7OA 2V2WB 1ZHLB 3QUXB 2XWTA 4OIIH 5FK9A 1FJ1A 3EYFB 3JVGC 2DI8A 3REVA 3QDMB 3CCHB 4ELKB 4ZOBA 1PDKA 1XR8A 2NW3B 4U1HA 1BAFH 3QAZC 4JQVA 4OZIA 3X3FH 3TO4C 1QBML 1QFWH 3BH9A 3PV6B 1R24B 3DGGB 2QADD 7FABL 3BW9A 4D0BB 2HJFB 3RX8A 3KPNB 5ID0B 4S1QL 5MP6H 3VFOA 3VI3E 4TUJB 1WWWX 1ZT4A 2C3VA 5GGTA 1BWMA 5DJAA 5GGVY 5LGHH 4BFIA 3QISA 2I60L 1FFNA 1MCNA 1AQKL 4FG6C 4J3TA 4K71C 4KROB 3B43A 3SDDA 1A1NB 2J8UB 3VRJA 1UWXK 4EKXA 4JQVC 5ALBL 4L4JA 5CZXD 4UT9H 2HLAA 5KSBB 3LKRB 3O2DH 3ESVF 5C0BA 1N7MH 5DURD 3TV3H 1D5XB 2M26A 3L1OH 1MCHA 1BEYL 3SCMB 5HHXH 2A6DB 3HE7D 4MZ2A 3EDEA 2BNUA 1IGCH 4QOKA 3W39A 1IFHH 3N85H 3CFJB 1MPAH 3GGWA 3DO7A 1F6AB 3O41B 3VWJD 2IANA 5D6DA 3MLPA 4N8CL 5HHNB 3U0PA 4NZTL 4PJFE 4LEOB 2I25N 4X6EB 3JV4A 4TVPL 5GQBA 4OIAA 1D6VL 2IGFH 4PLOB 4HJGB 1RIVL 3U36A 5E56A 1MLBA 2QSCH 1XCQB 1P6FA 1ED3B 4DN4H 4BSVB 3FB7A 4EI6B 4G8GA 4JJ5A 2X1QA 4L1HA 1CFVL 3QUXD 2PW2B 2XZCH 5F89B 2FZ3B 4Q74A 2BOBA 3QDMD 5EFIA 5EO9A 2R56L 1BIIA 4BZ1H 4KHXL 5C0IB 2FB4L 5BO1L 2IBZY 3UCRA 3VFPA 5D6DC 1NMBH 1AGBB 4WNQB 4I4WA 1JZ8A 1QSEE 2A74A 4D9LH 1I8IB 1YN6B 2B1HL 3RI5F 3FQTB 4PJ9D 2VDQH 1MQ8A 4UZGA 4HS8L 3MV9D 5CBAA 2J5LB 1OTUC 2HLFD 1B9ZA 3NIDE 3AB0C 3ARVA 1JHKL 1JPFB 4LSTL 2CUIA 2OTUB 2GAZB 3K1KC 4CADA 3QDJB 4KROD 1MCPL 2D7NA 3ULUC 1V7NH 3ESUF 4IRJB 4WDIB 4MAYC 3MJ9H 2YRPA 4G6MH 4GO6B 1CGXA 5I18H 3DXAD 5T3XD 3UJJH 2VTFA 5C9KA 5D1ZB 3E2HC 1SBSL 4IJ3B 4MA7H 4Y1AB 2NTFB 5TDNA 3S36H 4NZJA 3BP7B 2NY4C 3SCMD 1UM4H 4GS7C 4ZDHB 1IVLA 4HKZA 1FZOB 2CRIA 1JZ2A 2NY3B 3MO1A 1DEEB 2IMNA 3OZ9H 4POUB 3ZKMD 4R2GC 1JFQH 3DROA 4HUWB 1D7FA 4KI5D 4LASL 4N0CC 4JM2F 3TT3L 3UPRA 5EBWA 1CGYA 4ODTH 1U8HB 5FGBC 5HDQL 1LK3H 3ARFA 1PZ5A 1HHKA 4RAUA 5L8LB 1IAIL 4X4MA 5EOTB 1IEBA 4YE4H 2YUXA 3TO4B 4YX2L 4B50A 3G6DH 1KIQA 2A1WH 4M9PA 2XZQL 5J57B 5I1DA 1TNMA 3SE3A 2HWZL 1CG9A 1PKOA 4L9DA 5C71A 3VXUA 2XACC 3NIGE 1RIHL 1HEZB 3O11A 4YHYB 1OB1A 2X05A 4AENA 4OV5A 3ARFC 3LEXB 2ZUXA 3QHTC 4OZGE 3QCVL 2NXYC 3CUPB 3B9AA 3CSPA 1N5YH 3QNXB 5DA4A 15C8L 5J9PB 3QDJD 4MAUL 1MCQA 4IRJD 2HFFB 3B2UD 2AXJA 4RX4D 2Q86A 4EXKA 4XAWL 3BN3B 5A2IH 5DHYA 2LTQC 4FS0A 2ICWI 2R2CA 2NYYD 4P3CL 3ARDA 3SE3C 3EHBC 5D1ZD 3VGDA 3E3QE 4Y1AD 1G6RB 3H9HB 1KTDA 5IQ9B 2E9BA 4J3XA 4I3RH 4XP4H 3SBWA 1KCRL 2HTKC 3QFJA 4QRPA 3HG1B 3FB5B 4JRYE 4X7CC 3HCVA 3VGEA 5E4EC 3ZSTA 1RZGA 1N26A 3OKEB 3VFNA 2NY3D 5CGYC 3N0PB 2B20A 4NKQB 1LE5A 3BUYA 2HA1A 2YK1L 5F8RC 3L6FB 1DQJA 4LBEB 4DGYL 1MWAA 1G7LA 4AIZA 1CXIA 1YMME 3CMOH 1Z3GL 4L5FH 4FOMA 1FNGA 1Q72L 1UM5L 3FJTA 3BRFA 2DQUH 4UUJA 3LQZA 1JWUB 3PQYE 5DMJB 2JK5B 4JKPH 3TBVA 4ZS6C 3TO4D 5JNYB 5T3ZD 3B5HA 1CLZH 3IJSB 2A9NL 5EU5A 4NWUH 1EBPA 1SVCP 2BRRH 3MMEB 4V2BA 3FT3B 4MB4A 5EB9A 3AMKA 2AJSL 2IJ0C 4HH8A 4LCIL 2CMRH 4HIEB 2FX7H 5CBEA 3O6MH 3W9EB 5CWSB 4JG1L 5JUEH 2Z4QB 5JIPA 4NC2B 5KS9E 4Q58C 1D5MA 4RBPK 3P4OA 4FG6D 5IWLC 1RPQA 2HN7B 5F1NA 4M1CD 4XH2A 5EC2A 4A6YB 4XX1E 4Y2DB 1EPFA 5F72S 4R90H 3TM6A 4MAYB 2CDGA 5D7IB 2X1PA 1KC5H 1KF9B 4LLWB 4ZQKA 5IBTL 3E2HB 4HUNB 2VITB 1NGXA 4WI7A 2VAAB 1TJIL 4NN7B 2ORBH 1EGJH 1KPVA 3QWQB 4Z77B 1FV1A 2DQJL 3QFDA 4PRAA 3H3PL 1I1YA 3HG1D 1LO3H 4KFZC 5ICYA 5KBNC 4ZFOL 3MOAL 4WCYL 3ELAT 3D3VE 2DMCA 2C9AA 4QHNB 1BZ7A 3ALXA 1ETZB 4KQ3L 4HUXB 1U2HA 1FYTA 4OGAC 4JREB 5I8OL 4HIXH 2WBJA 4OZIF 4YDIH 1IAKB 1NC2B 1VEMA 3FRUB 3ZDYF 4JN1L 1YEGH 1UJ3A 3TN0C 1IAOB 1S7SA 3MA9H 4JHAH 1L9NA 2A38A 2OSLA 5D8JL 4R7NB 3UX9B 3L7EA 5D1QB 1N5AB 1U58A 4RISL 1HDMA 1OTUD 2MHAB 5IV2B 2JB5H 2BXZA 1MCIA 3RX7A 1G1YA 2FX8H 6FABH 1CZ8H 5IVOA 1XR9B 2NXYB 1J8HB 3QZWB 2WSKA 1Q1JH 3WO3B 3ULUD 4TUOB 3F6IA 4ZUUB 2X4SA 3N1MC 3KPRE 1PG7H 4XNQA 4RGNB 3ULSB 1IT9L 4MAYD 1QPXA 3REWA 2WW8A 3C5JA 5TE4L 1MFEH 4JN2B 4I1NB 4ISVA 5FDWB 3RY6A 1NCCH 4ODHH 1C16B 5TH2A 5F8QC 2VKWA 1P5UA 2NY4D 4XPBL 5HGBB 2JF1A 4XP6H 4MVBC 1LILA 1I3RB 2K3TA 4KUCF 4MNQA 2B4CL 1RZ7H 1QYGL 3P11H 2P5EB 2CKBB 4KV5F 4BM7A 2EXWC 1DUYB 4GBXC 1BX2B 4ZNCD 3L7FA 5CZKA 4YDJB 3DVNB 4FQXA 1YEFL 1A6UH 4RFEA 2Z8VC 3FT4B 3ZO0A 4JFPA 4J2XA 3LKNA 1GGYA 1TNNA 4R7DB 5DGQA 3OHXA 2DL9A 1HI6A 1P7HL 4RIRB 4JG0H 1NC2D 4N9GA 1YDPA 4PY8J 4M5ZH 1T1ZB 4FQHA 1NGPH 1RJLA 1ZGLB 3PP4H 1BQHG 1XF3B 3GUTA 4OFDA 3U4EB 4TQEH 3VXRA 3M8OL 4MA3B 3T1FA 3C8KA 1CFNB 5E8OA 2AV7B 5K33A 4FQXC 3QULB 3PDOB 3BWAA 4O2FA 3ZHDA 4G6FB 2GIYA 3CFKA 4U6HA 2NXYD 2O5XH 3H8NA 1J8HD 4Y5YB 1MNUL 2ZSVB 2IFGA 4ZOEA 3DNKA 2FEDC 2DN7A 4LPWA 4HT1H 1DE4A 4XX1G 3I02A 5KVMC 3QRGH 4RGND 2UV3A 3WUWG 3X12B 4E5XA 3WIFA 1L7TH 5DFVC 5F3HA 1FVEB 4PJ5B 1AGCA 2A6JB 3DX8B 3EHBD 4HDIA 1MAMH 2M8XA 3DX6B 3ZKNC 4CDHA 1WWAX 3R1GH 4PJEA 4X5WB 1TXKA 3W11D 5B38G 1FLTX 2P5ED 3MRBB 5CGYD 4ZTPL 3PXJA 5I1KH 4XP1L 3VXNA 4EOWH 3EJJX 1N4XH 3WCYA 1KUMA 4R97B 3LKPB 1KG0B 3H3BC 2R1WA 4N1HB 4YHLH 5L2KE 1X5FA 3TJHC 3GK8H 2X4OB 2RBLA 2YXMA 3BGMA 1I4FA 3BPOC 4ZS6D 4PRPA 1I9RL 4M6OH 4LCYB 1QNZH 1MREH 1KEML 1CR9H 3SEPA 4ZFGL 2AXFA 5DHVA 1KYOJ 1NGYB 4OT1L 4BUGA 1UT9A 4HS3B 1MIEH 1SEQH 5ETUA 3PWJA 4XHJD 5IW6B 2AEWA 5I71C 5KAQF 4JGUA 4O02H 2XRAH 1RZKH 3LQAH 1A7PH 2XN9E 2J6EL 5CCKL 4YBHA 2J12B 3VGGA 3V4PH 3VGFA 3QUYC 1AO7B 4LRIA 3O6KL 3HB3C 3PGCB 4G6FD 1KLFA 1QLFB 1PX3A 1CLOL 1G7JA 1RULL 3O4OC 1S9VB 2YUVA 1Z6JT 4K8RL 2AKRB 5HGDA 1OPGH 1ZS8A 1SM3H 4UINL 5I8EA 1OSZB 5GRUL 1N8ZB 5DJ0B 1XFPA 4PJ5D 5LJYH 2AJXH 1NAML 2ATPB 2JCCE 3QEGH 2E7LA 1S9YB 1IE5A 1RFDH 5FYKU 1U9KA 4XNZC 3RWGB 4HIJB 1JTOA 5MEOA 1IKNA 2DYPA 5DFWH 1YEEL 4GQ9H 1FL5B 4TNVK 1PKQA 4OKDA 4XGZB 3UP1A 3ZTJG 1H3PH 1RHHA 1OP3K 5AZ2H 5DK2B 5JPNB 4O9HL 1ZHNB 2ZUUA 3BX7C 5LCVL 4HIIA 2EDOA 3HE6A 1B4JH 5JW4N 4Z6AT 1Y18A 4X7DC 2EIZA 1JF6A 1MCFA 4X99B 1J5OL 4DFIA 2Y72A 4NO2A 5FO9A 5F9JB 2J88H 2MNUA 1H5BC 2X44D 3B4NA 2CDFB 2Z31A 3HUJA 1JGDA 3U0WH 1EUUA 3D39A 3S4SB 5E2TL 1MJ8L 2KDGA 2CLVA 5CIPA 4Y19E 5E0QA 5I1IH 2YPKA 1AE6L 4CNIA 2W92A 2QQNH 3GSOA 4Q6IA 4JFHD 4LDEB 2AJYL 2ERJC 4UDTB 4FZEH 2PO6A 2AABH 4W4OA 3FQRB 1EVUA 4R96A 3W2DH 3G5YA 4GG6F 1TJHH 3TYGL 1Q9OB 1KTLB 1AO7D 3DUSB 3KYAA 2APTA 4Y16A 5CEZD 1XGTB 5C07E 1HYSC 3MJ7B 1ACZA 4P57B 3B6SA 4HJJH 3IVKA 3OAYK 2CUMA 5E6IA 1WCBA 4NQCA 3MLYH 1FH5H 4Z7VE 4F57L 3MCLL 5D7KD 2PO6C 5F9WC 5C70A 4XPAH 1WT5A 4W4OC 4P59L 3E6HB 1URLA 4QXTB 3MLWH 4LSVH 5EC1A 3HI5L 3P3YA 4GBXD 2JB6B 1MFBH 4NZRH 5ITBH 3O3BA 2E9JA 3PP3K 4XNXH 2IQ9L 5J11C 5IMMB 1JHLH 4MXWL 3ABZA 4Y16C 5EU6B 2NR6C 4PJCE 3DBXA 4HHAA 2WAHA 2OXGA 3ZE1F 3FOMB 1UKQA 1NBVH 3MNZA 3QG7L 5E5UB 1UB5A 2OYPA 4OCNC 3U4BL 4F7TA 4P0DA 4Z7OF 3RZCC 1LO2H 2J8HA 1HH9A 3QUMB 1J8KA 3SDCC 1WT5C 4OGZA 2CJUH 2VDOH 5IW1A 1YQVH 3GMQB 3LS5L 2V5YA 1I7ZA 1A9BA 4KZDH 2GSIB 4FFZL 1H3WM 1KN2H 3DUUB 4V1DA 4HK3N 4RZCB 2MMXA 3HPLB 4XBGA 4H0HB 1TVBA 4NO5A 2E9WA 3MLXH 3QWRD 5C8JB 4IRZH 1RMFL 5FYKE 4HH9B 3LN9A 1WSST 2X9XA 5E1HB 3VI4E 3VFVA 2D7TL 1VADA 4OBSA 2EE2A 1YPZE 2FEDD 3G6JF 4KJYB 5I9QC 5FM4A 3D87B 3CH1A 3NACH 3L95B 1NEZB 4PS4H 3BI9X 1WLHA 3WKNA 1I8LC 4Z78B 4XNZB 1A9EA 4Z76B 4F3FA 4PJAB 5H2BA 2FSEB 5C09B 5SWQA 3WFHA 5BCAA 5EBGA 1BJ1H 3RVVC 1JCKA 2B1AL 5F6IC 4N5ED 3EYUH 4FQLL 3GMMA 3VRLF 3TYFB 3LY6A 4WEMB 5EU6D 4OZFG 4F7MA 3MODH 2WNGA 4Z7UE 2AK4B 3MGTA 2RFXA 1BD2B 1H5BB 3LV3B 4WU5A 1QKZH 3TJHD 1MF2L 3TBTA 4X8XA 2YPLE 3QO0A 5AG9A 3OB8A 4Y4KA 3SKNB 1UYWL 4AL8H 3MLRH 4QHUB 1P7QB 4P48A 3VGHA 1MJ7L 4QHLA 2ERJB 4BELD 2W91A 5BVJB 3U6RA 5FEBA 4KQ4L 3WXVH 1HCFX 4GAJH 3KPSE 3P9WB 2HMIC 4YLQT 1OAXL 4ZYKB 3I9GH 4DGIH 3MSPA 2DOCA 2B2XL 2IALB 5IKCA 2BJMH 5DZLA 3QUYD 3RPIB 4FXGA 3UPCA 5JIHA 3T09A 4GRMA 1UACH 3CFDA 3SKMA 2GT9A 4JHBA 2D0HA 1CDHA 3MGAA 4L4VB 1P4LB 3HI6H 2A83A 4Y4KC 2CK0L 1IC7H 4KK6C 4ZAKA 2EEDA 3KXFA 3AS0A 3SQOL 4P23A 1MI5A 5FA3B 4RGOL 2NY6B 4JM4L 5IB1B 5F9WB 3PIQB 4GMSH 4QNPE 4HGWB 4LHUD 3L9RB 5D2LE 1FFPA 1EHLH 1P1ZA 2VSCA 1J86A 4LLQA 2H32H 1WC7A 2HH0L 4PJEF 1KULA 2EDWA 1UZ8B 2CGRH 4NSKB 5C09D 4ONGL 3CX5K 2NX5B 5J11B 1CYGA 1LP9A 1B0WA 4X98B 3BIKA 3AVEA 5MENE 1FO0A 1HN1A 3SJVA 5DT1H 5GJTH 3DYOA 3DRQB 5DMGC 4U6YA 4YHOH 4I48B 5B3NA 32C2A 3EOAA 3RZCB 4BYHA 2AK4D 2PYEE 1MFDH 2UY6A 2J2ZA 4BA8A 1FG9C 3CPLB 1LO4H 3WD5H 4P99A 3GJEB 5JZ7C 2XKUA 4BSWB 3STLB 4NDMA 1UH4A 4CAGA 1ZGLP 1QFOA 1P7QD 4HK0A 4TUKL 3O3EA 1K6QH 3O45B 1U6AH 1GPOH 1BVKB 5JQ6L 4NZUL 5J6HA 4JR9L 2V7HB 1I9IL 5GSRB 4GMTL 4KJWC 3MV8A 3PGFL 4M93C 5I9QB 3HZYA 3PL6C 5HJ3B 2DLEA 3RL1B 5FKAB 3EDDA 1BFSA 4N0YL 1HYSD 4C59B 5DVNA 1J0KA 3C08L 5DYOB 5CD3B 3JWOH 3PGDA 5F88A 3V5DA 2I07B 2MCG1 2NY6D 2GTZB 4R6UA 3ZTNL 2VUYA 4QWWC 1OGAA 4LEXH 3HMXA 4HMDA 2FEEL 2ZUQC 5FYJH 1HE7A 4NRZB 4PP2B 2QHRH 3MROB 4Q9QL 3SE9H 5F6IB 1ZXQA 4HPYH 1ZT1B 3O0RL 2NX5D 4KVCL 3O3UN 4NKOA 3B9VA 2NR6D 1T21B 4H1LG 4GKOA 3VDCA 3OGCB 3NCJL 2HT3C 4UV4L 5KANG 4JFEB 3HUJF 5C0CE 3RZCD 1NC4B 3RNQB 4NM4L 5DXWA 4HFUL 2F9BT 4EDWL 4OLVL 1KNOA 4PV9A 4C56E 4LCUA 1I7RB 5IHLB 2X4TB 2E6QA 4I0PB 1QLEL 3K4AA 4APQA 1N6QL 2OJEB 1NJ9A 3IF1B 3VW3H 2ENSA 4OLYH 3PNWA 1D5ZA 3L3KA 3OXSB 1UVQB 2YUWA 4OLWH 4Z0BL 4YPGA 5GRVL 1MVUB 1UWGL 4PGEB 2HJLB 4BK5A 4MWFB 1M6OB 1ACYH 1MCRA 1JPSH 3MLVL 5T1LB 4PJ8B 1K5NA 2G5BB 3LPGA 1KIUA 4LGPB 3UZVB 4CU8A 3LN5B 4JB9H 5JMOC 3IU4L 4X7TA 1T2JA 5EWIH 4APQC 1NGZB 2DQCH 3H9SD 4I18A 4L3CA 2HT2D 5T1KB 2X1OA 1X5JA 3U30B 3O8XC 3EGSA 1OD9A 3MACH 2FBOJ 2IAMB 3RVVD 1R0AH 5ESAB 3O2WL 2X4NB 1K4CB 1NDMB 4NHUA 3TH2T 2ICEA 5E03A 3AY4A 1JNNL 4K94C 3BD5A 3WXWH 1DBBH 1RSFA 3BE1L 4LVNC 1ZT7B 4J1UB 4AY0A 1DJSA 3MJ8A 2BOCA 4JFED 2MTPA 1A3QA 5D7LB 1NC4D 1C1EH 1U42A 4I18C 4F8QA 5I16A 5C0AB 3Q6GH 1OY3B 3T3PF 4WUUB 4ZO6A 5LGJB 1O5DT 3BHBA 4WEUD 1QRKA 5HI5D 4YHML 5J0BA 3V5KB 4Y5XC 2HMID 3FQWB 4FZ8H 4ZD3L 4ALAL 4XP5L 5CP3H 4HC1H 5GS1C 3V6FA 2X4QA 4GUPB 4OM1H 2I27N 2E9IA 4MJID 1HSBA 1IZKA 2IPUK 2VXTL 4PRNB 4XZUB 5IR1B 4NWTH 1RAMA 3HPJA 3T4AA 3PL6B 4NQEB 1BZ9A 2N7BA 1HXYA 2GTWA 1I7UB 4ZPVB 1TCRB 5JXEA 4KK6D 5T1LD 2ICWB 2VR5A 3ROOA 3P4NB 5KVFL 2A73A 3TFKC 1UA6L 1YJDC 3IJYB 3ZYJA 5FOBB 4YHPB 4RWHA 1KLUB 5I76A 5HYEA 2WK2A 4KPHL 4NNYB 1CFQB 2D31B 3QDME 3VXTB 1I8MA 2E7MA 4EUPB 5ALCL 3FOLA 2LV4A 4HXBH 4N0UB 4PY7B 1TVDA 2GJ6B 2C4FU 3BMVA 3FN0H 5ABDE 3GSNH 4PRHD 3P4LA 2B0SH 4CVXB 2IAMD 4ZXBA 5IESH 1PLGH 1NBZB 1NFKA 1TTUA 3WL9B 2XWBA 3MRCB 1F5WA 4KRPB 1GGIL 1CCZA 3B9KA 3FFCD 2B7DT 5DMGD 2XT1B 2PN5A 5ITFB 3ZE2F 4PY8I 1UH3A 1CICB 2EDTA 2GJJA 5I8KL 4QCIA 5FECB 2J8UE 2JJWA 4MNGA 2QQKH 4PGBB 1TZIB 5D7LD 1FCGA 3AM8C 2ARWA 1F4AA 5JZ7D 5HYSA 2IWGA 1WZKA 1CTOA 3SDAC 5KSBE 1MFCH 5C0AD 1G9EA 4WUUD 4ODWA 4NO3B 2VZTA 5AZEL 1JZ6A 1G84A 3GSUB 4JO1L 1CDGA 2VYRE 1G9NC 4ZXBC 3V5HB 5LQBH 3IDGA 4HGMA 2P24B 3W82A 2AJ3B 4XNUH 5FYJD 5HGGS 1MUJA 1S78C 3S36X 5DC4B 3BRGC 1T7VA 4KI5E 4LKCA 4KJWD 4HIHA 5CSBA 4WHCA 3UC0H 4L1DA 3BGFC 3WNKA 2ZUWA 3SGKA 3PL6D 4NQED 2WLZA 1Q94B 3IDUA 3RGVA 2I9LA 1JF1A 1XIWA 3TWCH 4K2UL 1X9QA 1FRGH 3NZ8B 1QQDB 2D2OA 1XAUA 2QV2A 4KVNH 1MCCA 5GRVK 4JVPA 1G7IB 2BNRB 4NHCH 2L7UA 1HILA 2D0GA 1LDPL 2LU7A 1EEZB 4CMHB 3NFSL 4RDQF 3O8XB 1OAKH 4K55A 4L8BB 3IETA 2Z91B 4KTDH 4YIQB 1LP9F 4LHQB 2AEPH 2GJ6D 4PBXA 4XWGL 2NPLX 3VXQB 3LKOB 4J3SA 2V9TA 2IH1A 2C7UB 3K4DA 3SGKC 4NFCA 2Y36L 4LVNB 5HSFA 1VKXB 4JFQB 1KJVB 1D9KC 4KRPD 4JY5L 1YNLH 2LAGB 5EG6C 3AUVA 2VZOA 5HHPA 4AM0A 3KPTA 1CICD 3DARA 2DF3A 4ZUSA 3F65A 1H15A 1S8DB 1AGFA 3GM8A 1F4WL 4NJAH 1MCDA 3MUY1 1A02N 1S9WA 2UZIH 5C2BL 1RUPH 1ZWIA 4LSUL 5C08B 5DJZA 1AI1L 1QO3B 1DVFA 3IFNH 1U8LB 4M1DH 2WP3T 1UCBL 3GHBH 4RWYH 4Y5XB 5E2VL 3SGJC 3V6OC 5KSAC 3GIZH 4Y1AE 5JA9A 1OGTA 5FA4B 5I17B 4AMKL 3V8OA 1FN4A 5GS1B 4QT5A 4ZMAT 3C9NA 4BFBD 3T4YB 1RHFA 5GGTH 4YXLL 1Q9WA 1JRHL 1JGEA 5E8DL 1RZFH 1TQBB 2PUQT 5FCUH 3UTSB 3P9MA 3T1WA 3QUKA 5TE7L 3UZQA 2JE8A 4HKBB 2CLZA 3KYOB 4MJ5A 2O61B 4OZ4A 3MUZ1 3CFBB 1T80A 5D2NC 3WMSA 4FQQA 5TQ2L 1DVFC 4X7FC 4QTHA 1T7WA 4F33A 1KSRA 2BNRD 4TSBL 4P2OC 1JN6A 5GGSY 1WTLA 5T3ZE 4RQQB 2FATH 1UM6H 3GSQB 3S88H 5FIEA 3O8XD 5I1JH 3JV6A 4ONOA 3RUGB 3BKYL 1JPGA 1ZHBA 3S37H 2GFBB 1T4KB 4YHIB 3ZZ1A 1KCSL 4MB3A 1JUFA 3MRHB 4GAGL 3ZYZA 2A0LC 3PDGA 5EOCH 1KPUA 1B2WH 5LVEA 2ZOLB 2PXYB 5DUBB 1YEKL 2I5YH 5HI4C 1CFTB 2AXGB 4O2CA 5DJDB 1EH9A 4PJIB 5ID1B 2DBLL 1CE6B 1R3JA 4IOIA 2KQNA 4ZUWA 3SDAB 3IDXL 1HOCA 5K9OA 1J7VR 3IDNB 2Y5TB 4PUBL 2XQYK 2OL3L 1CWVA 1IBGH 3EDJA 2WUCH 5DSCB 2YBRA 2FO4B 3KPOB 3R4DA 4WWKC 1WEJL 5CD5C 1HQRB 4CVZB 3HG1E 3FQUB 4LRNH 2FO1A 5FYLH 1UQSB 5L2JB 1OTTD 1OLLA 5ICZA 4XWOC 5FYKL 2DM7A 3JWNC 3UTSD 3MLUH 1EAPA 1EERB 3TCLB 4ZFOA 1RQ5A 3LS4L 1JMXA 4EI5A 5EBMA 3KDMA 3QIUC 3TFKD 4U1KB 4OM0L 5SX4H 4R4FL 5DLMH 4R0LC 2VLKB 1RJYB 4U6XA 2CDEA 1NCBL 4OCLC 5I1EL 3CLEL 1HIML 2QQLL 2XWTB 5FK9B 2R2BB 3BT2L 1T1YA 3S35H 4U1HB 3V6ZB 4OZIB 3C6SB 1EFXA 5E1AA 3DVIA 1TLKA 4X5XB 3F12B 2W9LA 1LE9B 1U8PA 4DKEH 3VFOB 1ZLSH 1D9KB 1PYWA 1G7MA 5E2WL 4PJ7A 4EI5C 3OR7B 3MCKA 4QY8B 5DTFA 2PXYD 5I6XC 4D3CL 1RUAH 1RIUL 3F7PC 1J05A 2DD8H 3X14B 1MQKL 2HJKA 3SDDB 5D6CB 3VA6A 4HLJA 1LO0L 3MRJA 5D7IE 2ARJQ 5IFHH 3GSXA 3VRJB 3SDAD 4JO2L 3H7BB 4EQ2A 4FTVA 2A6KB 2XNAB 1PG7X 5JORB 5KSAB 1V5JA 3U7AA 2D7QA 2NY2B 1FBIH 3QJHA 3ROLA 1UXWB 3RTQC 4NQVB 2VXQL 5IBLC 1TPXB 1OT1A 1M05A 2BK8A 3ARRA 2BNUB 1S78D 5AG8A 2DRUA 3QG6B 3DMMA 1FFRA 3DO7B 3DGCR 3VG0L 4GJTB 1N64H 12E8L 5JR1L 4KKLC 3U0PB 4XPTL 3FKUS 2Z8WC 4M4RA 2MKLC 4UTAL 3WFEH 5D2NB 2DJ4A 2QL1A 4F2MB 1MRDH 1VHPA 4UT6H 1MLBB 4OCWL 4P2OB 2FL5B 3IFPA 4ETQA 3BEVA 3C6LA 3QI9B 2ZPKL 3IXAA 5EZIL 2K1MA 1QFUL 3ZKSD 2BOBB 4PFEA 3SDYL 4BH8B 4IHOA 1I7TA 1QVOA 5IT2L 4I4WB 1NFIB 3RA7L 5EO0A 2A74B 2IPTL 4S2SA 2QSTA 3U9PH 2BC4A 4R26H 1MFAL 3QDHA 2CLRB 2NY1C 4M7ZB 1K8IA 2F15A 1D9KD 5C0JA 4RRPG 3Q5OA 1MRCL 1G9MC 1LK2A 1J8HE 3MRGB 1MWAH 3EFFA 5HVWA 4H8WH 4Z0XB 1A0QH 2AJUL 2DQDL 2R0ZL 5FUCE 2WIMA 4M8QB 1INDH 4N8VG 5BZWA 4RGNE 3U7YL 4P9HH 2X40A 4ZO8A 3CX5J 4FQ1L 2X6MA 1AY1L 1OAQH 3QIBA 3BQUC 5KSAD 4XCCL 1GZPA 3QIWA 1MCJA 2NY2D 4WWKB 3B5TA 4BQ8A 1MCKA 4JPVH 5E8EB 5TDNB 5JOPD