1WBZB

Crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Murine Mhc Class I H-2 D(B) and K(B) Molecules in Complex with Ctl Epitopes from Influenza a Virus: Implications for Tcr Repertoire Selection and Immunodominance
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN PREC
total genus 17
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wbzB00
4FP8L 4LGRB 1T1XB 1R3HB 2C3VA 3QNZB 5FYJE 3RVWD 3WIIL 4UQ2B 2HLAA 1QO3B 3Q48A 3ZDZE 5F7NC 3ULUL 4XBGB 5DS8B 2PO6D 1EDQA 1XGPA 1MAML 3NCJH 1T20A 1U6AH 5DD6B 4ZD3H 3MQIA 5IIEA 2NLJA 1P2CA 3BPNC 1OTSD 2VN7A 3IVKA 3KHQA 2IBZY 4LRNL 3MJ9L 4JQXA 4JRYE 5F93C 2A73B 1SMAA 2QBWA 3LKQA 4L1HA 4X9BA 1S7UB 4HUKB 1NCDL 2A1WH 1YZZA 1I7ZA 1Q9OB 1F6AB 1OT1A 1ZLUK 4EI5C 2R1XB 1GHFH 3MLVL 4XPAH 4Z77B 1DANU 3RVWC 3NABH 1FORL 2CR3A 3J7HA 4Z0BL 3KYNB 3SDCA 2AXGA 2NR6C 4U6TA 4PGEA 4GAYA 1IC1A 3LD8C 4H1LA 4RNRA 1I1YA 3BI9X 3MRBA 4XP4H 1NGQH 3RIFK 1V3MA 3I2CH 3KDMB 2DM3A 5HPMA 2ICWA 2UUDH 4YHYB 4I18C 4PIRF 3G04A 1KCSL 4HAFA 2XZCH 4QRPE 1ADQA 4Q2ZA 4M7LT 4IS6A 4IOSD 3KYKH 4A6YB 4DVBB 4O5LH 5I8CA 1E4XI 4G6JL 3WE6B 2AAVA 4OD3H 5BVPL 2P24B 4H20L 1N0XL 3VFVA 1J11A 1JPSL 2IANA 4M9PA 4ZS7H 2HKFH 4HK3J 2A6IB 4F8QA 2B20A 2O5YH 5BO1H 4PBVC 4D3CL 2YRLA 4U0QB 5DFVC 4K3DL 1HN1A 1LO4H 4H8WH 4BQ9A 4NOBA 3QDJA 2FEDD 4NC1C 1G7JA 4AEIH 4MJ5B 4K7FA 2OTWB 3FFCA 3TNMA 5T3XD 1CFQA 4RGOL 3AS1A 5I1IL 4XMLH 1YEIL 3LQAC 3OJVC 5HHMD 1NC2A 2V5MA 3EO1B 5HHPA 3QJHB 1D5BA 2JB5L 5JIHA 1I9RH 1T2QH 5C09D 3LS4L 2BVEA 1HHJA 3IDIB 3NTCH 1DEEA 4K23L 3U0PA 4PJXA 1DBKL 2RJMA 4LEOB 1EV2E 3RZCB 5IGXH 3FMGL 1XCTB 5CIPA 4C56B 4QY8B 2EDBA 2ZOLB 1BIIA 3NZHH 3MOBL 4OIIL 4G8FA 3S35L 4TULH 2CLZA 5GRZA 43C9B 1PG7X 5EU4B 2FCBA 2GK0A 4MD5A 3TBWA 2VYRE 3BZEB 2RFXB 1N64H 2AEIT 2VLRA 3BD4A 3PWUA 4KKCD 3QHZH 1P7QD 1WICA 2BVPA 1ORSB 5LGJA 5EBWA 4RFNC 2DQEL 2CIKA 4PJDF 1I75A 2XV6B 3CX2A 4JFXA 4OLYH 5JNYA 3MUHL 1CFTB 1N0LA 4LEOA 4UTBH 5C0DA 3PWPA 3SGJA 1MVFA 3P3YA 3EYQD 5L8JB 4NCDA 4O02L 3FO2A 2DQTH 3RL1A 3MV7A 4HJ0C 4YK4C 1HHJB 1SEBB 1HXYB 3BDXA 3S96A 3ILPB 4JFFD 4UOW0 4I18B 2BVOB 5E8DH 15C8L 1JWUB 1NC2B 4XNMA 3U30C 3N1FC 2X4TB 4NQEE 1ZSDB 1T0MA 5INDB 4WDIB 4JM2B 3IXAB 3O6KL 4N8VB 3GMOB 4YC2B 1DL7L 4XBGA 5DS8A 4U6XB 4P2RA 4LEXL 3TBSA 1FO0B 3ZT7A 4XP9L 3WHE1 3VD4A 4LCUB 4PJAE 4Y4HC 3VRLE 2H2PD 2ZWLT 5CKGA 5FDWA 5D5ME 1ZGLB 2J5LB 4YDJA 1EZVY 3C9NA 2ZUTA 4WTZA 5C08B 4PRAB 1VFOA 3VXME 4XB7A 5CWSB 3UEZA 1M05A 4ZUSB 1EX0A 3QXDA 3CJJA 1YNTB 1MHHA 4X9HA 1GC1H 2OM5A 5LAXB 5KTEH 5MENA 2X4UA 1P69B 3MV9A 4M62L 1Q94A 1XIWD 4C54A 4H25A 2BZDA 5D1QB 3JWOC 4U1GC 1T83C 3VGAC 2H32H 1KTRL 3B6SA 5AZEH 3GK8L 4NUJB 5HHME 3GJFK 5TF1L 4W6WB 2FJFB 3GSVB 3LKPB 3HPJA 4YHZL 2FEEL 1D9KD 1MF2L 3MLWH 2E5EA 2Q20A 4L5FH 2G5BB 1FG9C 1UXWB 1DBJL 2V5RA 4IMLB 1CR9L 1SHMA 3BP4B 3CSBA 5TGBA 1J5OL 3RI5K 5I73B 1R5VB 2HKFL 1FIEA 1KC5L 5D1ZA 4HDIA 3RVUD 3T09A 1EFQA 4LAJH 2FBOJ 2B4CL 3C6LA 4HF5L 4LHUB 5IBUG 5F1KC 2OL3L 4LCWE 2A6IA 4PB0L 2IMMA 4Z5RA 4AT6A 3VXMD 1TZHB 3D39B 2WNGA 1NGXA 3RY4A 3R8BB 1EXUA 4YX2L 2PKDA 3WL9B 5EO1B 4FMFA 5DFWH 5LGHH 1M71B 1Z9SA 4HG4J 5TE4H 2BY2A 4KZDL 3LH2H 4RFOL 3WNMA 3SKMA 1II4E 1MQKL 2RBLA 3ARUA 4N9GA 1U6AL 4YIQB 2ZOKA 4AEFA 1NAMB 5KVFH 4MLIA 4X4YB 5KSBB 1TLKA 4YHIB 4LSTH 1U3JA 4JKMA 2VLJD 3OKEA 2VN4A 1OW0A 4HQQH 1WFTA 5BZWA 3WFHA 4TULL 4DGIH 4JFFE 5F89B 1HHIB 2R1XA 5F72S 4PTTB 5J3HD 4WFFD 4XCNB 3IETB 1RIHH 4QXGH 1KN2H 1R24B 2R2HA 3ALPA 3DRQB 3WMSA 3LKQB 4R2GD 4O2EA 1P5VA 5GXBB 4AT6B 5CILH 1JUFA 4ZQKB 5C6TH 3GRWA 2UWEF 3QBTB 1E28B 3TCXA 5KSBE 1K3IA 2R0WL 1KEML 1AHWB 1J1PH 3EOAB 2VAAB 5CGMA 1U3HA 3LKSB 2QQLH 4LSVL 3NIDF 3FRUA 4XNYH 3RL2B 3DXAB 5SWZB 5TFSL 3ARBD 3CSYA 3VE0A 2HFTA 1KIRA 3CFEB 5F89A 2EDHA 4JQXC 5IHUL 2IBZX 5KSAD 1X4ZA 1MAMH 1ZT7A 4UV7H 3ZKMC 1V3LA 3OKEB 4QXWA 5DMIH 5DA0B 3VG9C 1T03H 4FABH 1D5XA 2JELL 4F3FB 1NAML 1F3JB 1YQVH 4KROC 4X4ZA 4P3CH 5I74B 1C5CL 5CEXA 4LNRB 5FM4A 1RV6X 1U0QA 2YWYA 2ESVD 3QSKB 3KWWB 4P9HL 4H0GA 2IG2H 3MRJA 4POZD 4PJCF 1JWSB 4KTDH 5DRWB 4PJHE 4U3CA 4OLWH 3OX8A 1NCBH 4PRID 3N1GC 1Q9WA 3CFBB 4LLWA 5FDWB 5I9QC 2DQJH 4YFLF 4Y89A 2EECA 5J1SC 2RR3A 3NTCL 1BBJA 3TBYB 2WWKT 1KIQB 4ZAKA 3SGDH 3JWDH 1IGML 4LHQB 5EUOF 2CKBB 4K3EL 1SYVA 1RIUL 2DIJA 2AXHA 1KCSH 3MOBH 3EO9H 1BQHG 3WKNA 4E9LA 5BS0D 5I1HL 3FOLA 4X9GA 3DV4A 4N1CA 3FRPA 3ULUD 1FE8H 3P0YL 4DUVA 4LSSL 4TSAL 3ULVH 2XTJC 5F6IC 1KELH 3RTQC 1WEJL 5HYQB 4UV7L 4LCIH 1MCLA 3GNML 1F90H 4WU5B 3RWCB 1KCRH 4P2OD 4R7NA 5MI0B 2EEBA 2JJTA 1R3KA 4NN5B 5FUOL 4JFXB 4MXQD 4ZO6A 4PREA 2FL5A 4M3KB 3SE3C 1D5ZB 4JREB 5AZ2L 2PXYB 2HT2C 1KPRB 2B2XL 5CEYB 2YWZA 3DYMA 3G08B 3OKOB 4NRYB 5EBMA 3WDIA 3TNNB 1CG9A 4JZOB 5ECJE 5I1KH 3LDBC 4LLQA 5E8NA 3ETBF 1D9KC 3TFKD 3MROA 4YEFA 3W2DL 1Y6MR 1YYLH 3O4LB 4JFDA 5D93B 4OZFH 5DSCB 4QF1B 1Z9LA 3B5TA 1X6NA 4MS8C 1D3CA 2FJHA 4KQ3L 1U95A 3VWJA 3T2NH 3V9FA 3QQ9D 5HYQA 1CLOL 2A6KA 2WBWB 2NY4C 1JGLH 1FNEA 4TSBL 3BKYH 3C5ZA 2YD2A 5C0BE 1NDMA 2EC8A 4XX1E 2VDQL 4NRZB 5E2VH 4OM1L 2NY4B 1ZGLM 4HKBA 2PR4H 1BAFL 5GRYA 1DR9A 5IHBA 2GSGA 1F02I 1UM6L 5KBNC 1BZ9A 5SX5H 3R0MA 4IDJH 3B3IA 2BVPB 1BM3H 3ABZA 2NPLX 4MJIB 1W72H 2VLRB 1P4LA 3R06B 5GGUB 1UB6B 4MX7B 5IG7B 2YKLL 3RBSA 3DMMD 4MA7L 4DAGH 1S9XA 3X11B 4CADA 2EDXA 1FN4B 2Y23A 4PJ7E 3IAGC 4LHUD 4WO4D 1ZXQA 1MREL 5DMJB 3SY0B 1LEGB 2CGRL 4FQ1L 3L7EA 3H7BA 5E8PB 4PRDB 4RX4D 1LEIA 5C07B 1FC1A 1QQDA 3DROB 1J0JA 1K5NB 3ULUE 3F12A 3CVHA 4NOFA 4U1SA 3D0LB 1KYOK 2YSSA 4LAQH 4P23C 1EBAA 3QCVL 4JO2H 3IU4H 5ADPH 5CJXA 3ARBC 4AQ1B 5L9DH 4OCYH 4KQ4H 1BEYH 4KVCL 1YPZA 5ALCL 1KACB 3HZKA 5F6HI 4FZEH 3TT1H 2D4FA 3OKKB 1FGVH 3P0VH 3BAEH 1S7UA 3SE3A 5I19H 4G43A 4WNQB 1WT5C 4HHAA 2FGWL 5E9DD 4P4RA 1EO5A 3TT3H 4EXKA 4Z7VB 2HFGH 5TDNB 2H9GB 4BQ8A 4FNLH 5CGYD 35C8L 4GRWF 3MCKA 3RX5A 4HQQL 4QRQA 1EBPA 3S3SA 1TCRA 4QHLA 1BX2A 3KXFD 2FYYA 2HWZL 4TRPH 1CD1B 5C09A 3ULSA 4TNVK 3WFHB 3EKCA 2DQEH 2I9LB 3PGFL 3ZE1E 1UCBL 2ITDB 4KDTA 4OZIF 1PKQE 3EDJA 3IFLH 1INEH 3CLFL 1UVQB 4OSUL 4EN3D 5L6YL 5CEZD 5E24E 2OL3H 1DQJA 2NY3D 2Q1EA 3P4MA 3MBEB 4LLYA 2AGJH 3BH8A 3MLXL 3QA3B 1MFCL 4TUKH 1GGBL 3PDOB 1IARB 5LXGL 1T1YA 3DPBA 1AQDA 4O2CB 4A6YL 1KIUA 2VIRB 1KIRB 3UP1A 5EBGA 1D9KA 2CSPA 1ETZA 4P9ML 3ZL4L 4ZSOA 1ZLWH 3GSOA 3E2HB 4C56E 4L8DA 2Q7YB 3CH8A 1NGXB 3NN8A 4LSUH 4PYHA 3JWOH 3RVTC 5IB5B 4CKVX 5E2UH 1CL7I 2MOVA 3ARSA 3HAEB 3T0VA 5D8JH 1HYRC 2XN9B 4BUGA 1TDQA 5TE7L 1S9KC 1KJMA 2EDDA 5KW9L 2CIIB 5F8QC 4F7EA 5DJ6B 1HNGA 2P8LA 1DN0B 2EH8L 2RCSH 1QO3A 2ICES 2XNAB 2E7MA 5D7JC 2QKIA 1B90A 1EO7A 1RU9H 2H2SC 3D69A 3MV7E 2HFFB 1FNLA 1MJ8H 5GGRA 2EICA 4FS0A 4JRXE 5K33A 1YJDC 4U6HA 4CAGA 1GC1L 5EZLB 1BLNA 4YHLH 5DYOA 4OZGE 4ODVH 1BQUA 5E99L 5C0JB 1JTPA 4YQXL 2UV3A 3VGGA 3QI9C 4WGWB 1PD6A 2AK4B 3IKCB 3QUXC 4WFHD 3U7YH 3MMEB 4LIQH 3W0WB 4WWID 1AC0A 4X0KB 5IW3A 4U7KA 2OJZL 3TIDA 4Z7VF 4JHAL 5LBSH 3DO3A 2CR6A 5B39B 1KPUA 2DB8A 4GFTB 3ZL4H 4QGTA 2DLGA 4M5ZL 3TYGH 5CZXC 1ZA6B 4MAYB 2XWJA 2R0KH 2X4UB 2AV7B 3MGOB 3QUZB 4EDWH 2ATKA 1YA5A 1NBQA 2FIKA 2VWEC 5C09B 3CU1A 4S1QH 4HUXB 2V2XA 4HWEH 3MLSL 1OF2A 4PJ9D 2ADFL 4G9DA 5BXFB 1WC7A 3L5HA 5C3TA 1T0MB 2VITA 5INDA 1S9WA 4PJDA 1WIOA 5DQ9B 5IB2B 5C92A 1FIGH 1CI5A 1NFDB 1QLRB 1J0KA 5E00B 1JNJA 4F15B 3DOSA 3ES6B 1P4IL 4ZUUA 5TE4L 3F7RA 5ALCH 1EEQA 5E5MA 3NABL 1A7OL 1LHZA 4NP4H 4GS7B 2X10A 4S2SB 1YY8A 4CVZA 1LO2L 4G7VH 4KU1A 3IFNH 3IKKA 4U4BA 5DURB 4I3RH 2A83B 2APWA 2YMXL 1FO0L 5I1CL 2IANE 5T1DL 3B9KC 1G7MB 4WUUE 4M3JA 2A6KB 3BKCL 5DZNA 5DLMH 1PDKA 1UWGH 3R0NA 3GSXB 1KCUH 4O4YL 4WI6A 1VGEH 4JQVC 1WEJH 3F7YB 3GJFB 1N6UA 5JNYB 1JGUL 1IAII 5IJKA 3GIZL 4M7ZC 5F88A 4UDTA 3N85L 5FF6A 4JFZH 1EJOH 1X6LA 4ZUVB 5ETUA 1K8DB 4U1KB 5TH2A 2DIBA 3VXTA 2XWTA 2H8PB 3PGDA 3QIUA 3RX7A 4JDVB 5MERA 4AMKL 5CBEB 5DMKB 4L4TD 1EHXA 3VXUD 1ZHNA 4O2FA 4XPGH 1XGUA 2QQNH 3PV6B 4XPFL 5I66A 2I5YL 4JFQB 2DTMH 2DLIA 2FSEB 1J5OH 3C60D 1QPPA 2A83A 2YHGA 1NCNA 3ULUH 5IW1B 5IKCA 2D31B 3UDWC 4JG1H 2GIYA 3BHBB 1IZKA 4QOKA 4KVNH 5IROC 1NAKH 1NC4B 4HAGA 5EU6B 2FLRT 3FT4B 3HUJF 1I7RA 5FCUL 5DD0H 4BA8A 2DMCA 5KW9H 1NCTA 1M7DB 1WZLA 3QUML 5TF0A 5I8EB 1HYSD 5FYLE 2XFXB 1PG7W 3KPNA 2YD5A 5IFAL 1NCDH 2A1WL 4LPYA 4NYLB 3TA3A 4PTUA 1IGJB 2G60L 3TBWB 1IFHL 2O5XL 3B83A 5GSVA 5D7IA 3AM8C 5ETUB 8FABA 3C5JB 4CN4A 3T8XB 5T5NG 1MCIA 2W65A 4CGTA 1NGPL 3NOIA 3K74B 1SQ2N 2NY0D 4K3EH 4APQB 4H0HB 4OZFG 4W81A 5I8OL 5JOFB 5HBBA 5BW7A 1NLDH 1KT2A 4UTBL 4KK6C 4RIRA 4X6DA 2O93L 1UZ6E 2FGZA 3O3EA 1B0RB 1LQSR 3HPLB 4L29B 1OARL 3TZVC 4TUJA 3QEGL 4NHCL 1ZVHA 1JP5A 4QRPD 5BVJB 1YYMH 3S36H 5DEZA 3BWUC 5I30H 1FFPA 4G42B 2W0KA 4RRPG 5DR5H 4D0CA 1A1OB 2D7NA 3X3FH 1BOGA 4Z7UB 3IF1A 2PO6C 1MIML 4BSVB 4NUGL 5BS0B 6FABL 3MXWH 3WFDL 5DRNB 5FOBA 3SJVE 4NKMA 3H9SE 1BMGA 1ITCA 3GSWB 2P44B 4F37K 1JCKA 1OB1A 4LMQE 2HH0H 1W8NA 5A16B 4HLJA 5D1QC 2V7HB 4M61A 3QNXA 4ZDHB 1T2QL 4GW4B 3MGOA 2NY1D 3I6LD 3CVHL 1T1ZA 4XC3H 5D2LA 4BFBD 5IMMB 4JHWL 1U8LA 1G9NH 3TCLA 4M7LH 4F3FA 1A4KA 4HUXA 3NN8B 4O2EB 1AH1A 3FQNA 1LO5B 2HFEB 4Y2DC 3ZE0F 3QUYB 2VC2L 2EH7H 4H26B 4GJTB 3EDFA 4YGVB 3DI3B 4BFEA 1DQDH 3S36X 5ADOH 4M8QA 4NSKA 2Z31C 2GT9A 2FH8A 5D9SB 3P9MA 1WTLA 4Y16C 4XRCB 3V7AE 3BMVA 5HSFA 2YPLB 4Y2DB 3UTSD 4YR6B 5SWZA 4JFPB 3MR9A 2J6EA 3OGOE 4ZUTB 4MVBD 2B4CC 1UADC 5EUKA 5L7XL 2F5AH 4KH2A 1QR4A 5SWZE 5LGKA 1NBVH 3FZUD 4MHHG 3EFDH 2X05A 4HV8B 2VOTA 3STLA 5DD6A 1ZHKB 4Y2DD 5E1AB 4OZHF 3BP5B 4JO4L 5DK2B 3RDTC 2CDGB 1JPFA 3ARFC 3TVMD 1MCOH 4XB8A 4I4WA 2V17L 1P7QA 3FT2A 4XPFH 4XT1C 3KPQA 4OAWA 4RAHA 3BXNA 2VXTH 5D2LE 1ZLSL 3TO4A 1KYOJ 4Y4HD 3NA9L 1CZ8H 1FQ9C 5E6ID 4RA0C 2BRQA 1FSKC 4RDQF 2A9MH 2IH3B 2Y06H 1NAMA 5FKAB 4PLKC 4C4KT 2VKXA 3RNKA 4LKCA 4P4KC 3C8HA 1KLGA 5FO8A 4RZCA 4LEXH 3F7VB 5C3LD 3H9SD 5F7DA 1OAQL 5D7JD 1FHGA 2ZUUA 3WL9A 1DBAL 3LPWA 1EK3A 4HFUL 1MJ8L 1F4WH 4R9HA 5L2KE 4F15C 3CFCL 3LEYL 3MOAH 1I3GH 2D7MA 4NKDB 4U1NA 2HRLA 3L7EB 4JO1H 3C60C 1CVSC 5SX5K 4K2UL 3QHFH 4Y16A 1QG3A 1A4KB 5DD1L 1TTUA 4LVNC 5LQBL 3C6SA 4HJJH 3U7WL 5C7XL 3P77A 4OQTA 1DFBH 1RUKH 5E2WL 3VWKA 3KPLA 3NFNB 4JREC 1Q9LA 2IBGA 5EC1A 2Q87A 3SQBA 4QHNA 5IVXA 1MJUL 4FXGB 1R3IH 4RMTA 3JV4A 4G5ZL 3VH8A 3UJTH 4ERSL 4K94C 4PJBA 3CU7A 3VWJC 2LVEA 4PV8A 2VQTA 3V6ZA 3RWJA 3B43A 4WTZG 1CDCA 1TPXC 3RWIB 4FG6C 2XT1B 4U2ZA 3DX6B 3SDXF 3SE9H 3DX8B 2Z92A 5F1NB 5DMKA 4MA3A 5GGTL 5FV1L 1OAXL 1CGTA 1AGCB 4NP4L 3EGSB 1F4WL 1MY5A 2OK0L 1PY4A 3EIFA 4NQTA 1FO0A 2GY5A 3RU8H 3O0RH 1R3LB 1FLRH 2PYED 3C09C 1AP2A 4NN7C 4YHKL 3K2UH 5TE7H 4Q6IB 3WS3B 1KXQE 4LVEA 1LP9F 3FAXA 5CJQH 5I16B 2F58H 4OBSA 1P53A 3R1GL 4PRAA 3D0VB 5FCUH 2Q6WA 3GSRB 4L4VE 2EE2A 1SYSA 4HH8A 3ZDXE 3B9KD 2QLVB 3VXUE 1IZJA 1TJHL 4QEGA 5I8KL 5JQ6L 5EU4A 1M7DA 5JHLH 3B3IB 3BJLA 2O61A 4KMLB 4LKXA 5F3BA 1NBZB 1IT9H 3O6FD 1IGJA 2Q3ZA 3MV7B 5EU6A 4MX7A 4CJ0A 5IG7A 4UBDD 2J3SA 3T0EE 3HNSH 1LEKA 4R4NC 4PJEF 4CU6A 3MLRH 4MA8H 5IFHL 2GTZB 3FT3A 3VI3F 2MQ0A 1JF5A 3MFGB 2GSGB 1E27A 3C08H 3P2TA 1LE5B 2LABA 5E00A 5ENWB 5ICXA 3UPRA 2J88L 4NRZA 4WUUD 3N0PB 1HSBB 3MCLL 3UMTA 3WLWC 1NLBL 3QQ3B 2ED9A 1YECL 1N0XH 4GMSL 5DF0A 5J8OA 1GGYA 5GRXG 4P2RD 5GZND 4WI2A 1BD2E 1OCWL 1UGNA 5CZXD 4ZFOL 3EDKA 5BMFL 2AJSL 3P40A 4RA3A 1XCTA 5CIPB 1DQQB 5E6ZA 1FBIH 3K2UL 3IB4A 2Y06L 3GGWB 3BISA 4GBXB 5A1AA 4MD4B 1JGVH 1FCCA 1W0VA 1Y0LB 2F54D 2AQ2A 2JKXA 4PB0H 1WISA 3WXVL 5FGCB 1WZ1L 4Z7OE 1JHTA 3K8KA 3RWIA 3SGEH 2N7BA 3RZCD 1R3KB 3CGTA 3T0AA 3UTTE 2KDGA 2GY7B 3IJHA 4JDZA 1B2WL 5I8EA 4FFZL 3CDYA 4UT9L 4AL8L 4OV5B 4NM4H 1BJ8A 1CLZL 4OLEA 2X41A 4NNPH 2Z93B 5D7LE 5E5RB 1BOYA 3FT4A 1QR1B 4OM0L 1K85A 4F33A 1DQLL 3V79C 4LSTL 3V0AC 5TF1H 3WFEH 2CMRL 3O11A 2NY0B 1YY8B 4CVZB 4K9EH 4LLVB 5F9OL 1IC7H 5IV2A 2NTSP 2FB4L 2VXQL 1KCUL 1QYGL 4O4YH 1DBJH 2BMKB 3NH7H 3D3VB 3PL6B 4WFGE 1I1RA 1H15A 1YYML 3S36L 2CLRB 5F1IB 5T5FH 4OZGA 5EU7E 4NC1E 2CK0L 1XR9B 4XGZA 1UJTA 4PJFB 5HYEA 4DQOH 3V4UL 1I1AA 1S7QB 4E41B 4JY6B 3HC3L 3AREC 1ETZB 3GMNA 1JV5A 2CKNA 4JQIL 4X0KA 2GI7A 4NQVB 1V3KA 4LVHC 4Q7DA 3VRIA 3VFOB 1NMCC 2RAMA 2VKWA 3D18A 1QHOA 2D7QA 2HAZA 5FGRA 1P1ZA 5FM5O 4PJAF 2R2EB 3ARDA 3SKOB 1EO8H 4ZO9A 2I9TB 2WK2A 1BVKB 4MGXA 3S3PA 1T80A 3OXSB 2X9WA 3UYRL 4P3CL 5HGAA 1CXEA 4PS4L 1Q0YL 1J8HB 5D1ZD 4AIZB 4JKPL 4J3OC 1XF3A 5DWUL 3ZE2E 3GO1L 2PN5A 2ZG1A 2Y72A 2VMFA 1CFNB 3L5JA 5ISZB 3OJ2C 4ZQKA 3MACH 3O45B 1E6OH 5F7LB 2DS4A 5CEZL 4MA8L 1RSFA 1DN2A 1ZEAL 3BDBA 5DQJB 3QXUA 3BEWB 5C8JA 3WNNA 5D7IE 1IAIH 2DTSA 4NN5C 2I9TA 4XRCA 5I76B 4IMLA 4PJCE 1WFNA 4R4BB 4IDJL 1QD0A 3KLDA 4NQDE 4M8QB 4WU7B 3T4AB 3TC9A 4E42B 4I0PC 2AVGA 3F58L 4MAUH 2YK1H 1V05A 2NTFA 2XRAL 1DQJB 3MBEA 4LLYB 1GSMA 2NY5L 1OT2A 1Z9OA 4QOKE 4Y5YA 2AJSH 4XCFH 2R2EA 3PV7A 4KPHH 4D0DB 3DBXB 1VB9A 4JLRA 2YR3A 1D6VL 1QSFA 3CXHJ 5C0ND 4XBPB 4OAWB 5CZVH 3LHPL 4G6FD 1CFNA 3FB6B 2VXVL 1EGJH 4BSWA 3N9GL 3V6FB 5T1KA 1RU9L 1H15B 1JRHL 3CFJA 2W38A 1IKNC 1S7QA 1T5XA 5HI4C 1UFUA 4P4RB 5F9DC 2CIIA 1BD2B 3GMLB 4OZIB 1IGFL 3MCKB 5E7BA 3VDCA 5ITFB 4D0CB 5EORH 1LNUB 2A6DA 1BD2D 5J13B 1WSST 2YC1B 1RHHB 2FNBA 4PGBB 3BPCB 5DD0L 4HXAL 3RBGA 5JO5A 4JFHD 3O41B 3HC0B 1A6AA 4DKFH 5DO2D 3VD7A 3QWQB 4I9WD 2C1OA 5A2FA 2WBJC 2F53D 2UY6A 2G60H 4M1DH 3VRIB 4MXQC 1MELA 4P23A 4YUEH 2O5XH 5EIQA 1QYGH 5T3ZE 2F8OA 4OQTH 4EUPA 1T21B 2K9UA 2MQCA 4G9FB 4I2XB 4JRYD 5GS0D 2BNQE 1WT5A 2NCMA 1LEIB 1ACYH 3CFIC 4JFED 4JPIA 5IB1B 5C0AB 1A1MA 2NZ9C 4ERSH 2KH2B 3X3GH 2R0WH 1IRAY 1H0DB 5CWSA 4N90E 5JQHC 1S9XB 3ROOB 3MJGX 4YC2C 4ODWA 4DGVH 1FP5A 4FZ8H 3REVB 4YNYA 4IDLA 4RX4A 1AIFB 1KCVH 1ZVSA 4PP2A 2BMKA 2HRPH 4ELMF 3CSGA 1KTKE 3Q1SL 4QRQB 25C8H 4MNQD 5DRNA 1WJ3A 3HTLX 1DJSA 2J8HA 3UJIL 4PG9B 2IBBA 3IDMB 3RVXC 1SBSH 5FGBA 4BQ6A 4LSDA 3C5ZB 2BVOA 1SBBA 4C4KO 2EDLA 4XVTL 3GSQB 5FB8B 3HKFA 4JM4H 4X6DF 4YHOL 3FTGB 1C08B 4P99A 1Q0YH 4F7PA 3MRKA 4M1DL 5FYKD 5B4MD 4JO2L 4PRPB 4PV9B 5KZCB 3GMMB 4QRPB 5EUOE 5GJTH 1JRHI 2DLHA 1NCAH 4MJ6B 2WWKO 1T5WB 4RWYL 3NA4A 4ZPTA 1L7IL 1OWWA 1Q8MA 3HE7B 4K94H 5LXGH 3HN3A 3SCMC 1BHGA 5CD3B 1U8JB 4JRXA 4EKXA 5GS3A 3RVVD 1NGQL 3VXRE 3SY0A 5BV7C 5IEKB 4KDWA 1PSKL 4L1DA 4IRJC 4JFDD 4GRWB 4WV1C 3X11A 5HI5D 2DWEB 3MCLH 1AIFA 5E8NB 4E41D 5GGVH 4QY8A 3LOWA 5ALBH 2NY6C 4UV4H 1AGFB 4CN6A 2WIMA 3RGVC 4PJXB 1KBGH 4KK5D 1N59A 4PY7A 3D85B 4QWWC 4JPIB 5IB1A 2E7LA 1NCWL 3VI3E 4C56A 1RUPH 4ODXB 4P5TC 3RTQA 2HTLC 1IEHA 3RX8A 1LDSA 5LCVL 4UU9A 4G6ML 1Y18A 3WUWG 2I07B 3ARFB 3MNZB 4TPRL 3GSQA 1Q9KA 2B8OT 1P6FA 1A0QH 3FO0L 4UAOC 4OF8A 1AC6A 1PFCA 5IOPA 1TQBB 4JY5H 3HG1E 3O81A 4WIQA 3QUYD 3VRJA 5GGRY 5HHVL 2VZOA 4NT6B 1PGRB 1FZOA 1NEZG 3C60A 1HIML 1UB5B 4KUZL 5J1AA 1DQML 4XMKL 2M8XA 2ZUQB 1OSPL 5ILTL 1P6AB 4FNLL 2ZJSH 43CAB 4JFEA 4Z9KB 3ARQA 1K2DA 3V5KA 3WLWD 4C58B 3O2VL 4OIAA 3BO8B 3QCUL 3KPLB 3GBML 4OD2B 1J9CT 1FRGL 1AXSA 2MTPA 4TVPL 1KLFA 5IMKA 3MRJB 4HT1H 5SWQB 4XH2A 3F7QA 3DLQR 2VDLL 4MAYC 4KXZI 3V4PL 1E6OL 2NY1B 3FL7A 3AVEA 1A6ZA 4HH9B 2VABA 3EZJB 3QHFL 3F5WA 5D96C 3CK0H 4EUPB 3WFBH 1SEQH 3IXTA 4XCYB 4YH6A 4C55A 1DLHB 4PRHA 1T7XA 2VDKH 3K4AA 2DKMA 3F8UB 2N7AA 1PG7H 3JV0A 5HYFA 4NFDA 3B9VA 4M03A 1FZMB 3O3AB 4PGEB 2VLLB 2DQHH 3I02A 4G8GE 2JK5A 2MKLC 2AXGB 2DQDL 4NFCA 2YD3A 1G7PB 4R0LA 4LDOB 2HJFA 4WU7A 2VDNL 2DICA 4Y4FB 4PG2C 3ROLA 1WWBX 5ACZB 1TZIB 5FHAH 3NCJL 1CD8A 5H37G 4M7JH 1CS6A 1EO8L 3O3DA 3INUH 1UJ3A 2HG5B 3MUGB 1QKZL 1VADB 4P2QE 2DQCH 4UQ2A 1CD9B 5EN2A 3E8UL 4PTTA 3GRWH 2OX5A 1T1XA 2C3VB 3QNZA 3QIWB 2BOCA 3GMPA 4XPTL 2IAMA 4LQ1A 1U3HC 4N8CL 4X8JA 3T1FA 4X9FA 3W9EB 5FKPA 5KSAB 4P23D 4LOUC 3OKDA 3RWHA 1FL3A 4KJYA 4Z7UE 1OWRM 5DD5L 2AJVH 4KHXH 4OGXL 4ZTPL 5HHOA 3U48A 2YPLA 3MBXH 5I17A 5F6HJ 1QEWB 3SE4C 1GIGH 1UA6L 2Z91A 3MYZA 4MHHI 2ARWA 4NFBA 5CSGA 3U4EA 1CDIA 1I8MA 4X7TB 5I74C 5IF0A 2HFGL 3CAFA 1WAAA 3RWGB 1U8MA 1Q0XH 4QT5B 1J05A 3WN5A 5I0DA 3O2WH 1TJHH 3T08A 5JQ6H 1WCBB 2XACC 4OZIE 3S4SB 3MRHB 2GW5A 3SBWA 4P5TB 4X8XA 4YUEL 1HOCB 1QTYT 1NGYB 1QSFD 4IHOB 3QHZL 5E1AA 1B88A 2JTDA 1QNZL 2A6JB 3QH3B 2BOCB 3IFLL 4XCEA 4I0PB 1U8LB 4E5XA 3INUL 2MCPH 3DETC 4UQ3A 3VXMA 3BP4A 5TGBB 4HCRL 3TZVB 5CSZA 2BHZA 3CFKB 5D5MA 4R97C 4LARH 4PJAA 3C2AH 3OPZL 2LU7A 4BFIB 5I2IA 4N8CH 1WWWX 5FFLA 1R5IA 5DHVB 2PETA 1IQDA 2DQFB 4APQC 3WIIH 4PRHB 3T3MF 1RZ8A 3PWPB 15C8H 3QWOA 1T83A 3C8DA 4QHMB 5D1XC 4ZFOB 5KANG 3I02B 4OT1L 4B50A 4NQEA 4CL7A 2VZVA 2E6JA 1KT2B 1HCFX 1TIUA 2QSVA 4RGND 5KG9B 1FN4A 2OJEB 5EULV 4N1EA 4JHBA 2GAZB 5EOQL 4ISVB 3C9NB 4F7MA 2V5SA 1RK1A 4MCZA 4ALAL 5D7JB 1CICD 4U33A 4YHNB 3X13A 2DYPA 3VFPB 4B7IA 2XI9A 4EVNB 4MZ3A 4XPAL 3U0TB 5FYJU 2G9HA 5E8EB 4LCWB 4NKMB 1YEDB 4KRLB 1ZT4B 4XVUD 3H3KA 4N8VA 3L1OH 5DJXA 4OGYL 2WBJA 2R69H 1AD0B 3HI6L 3MGTB 1H8OA 2XKUA 2Z35A 5EU5B 2MFNA 3X3GL 2H2SD 1F42A 3WSQL 4M1GH 4Z7VA 3TPKA 3KLAB 1ZWIA 4MQSB 3MV01 3BPLC 3NGBB 1MPAH 4RWHA 1BBDH 3GHBH 3PIQA 4G43B 4WNQA 3BKML 4LLUA 1ZHLA 3TN0D 4LLVA 1ZT1A 1IGTB 5I73C 3BWAB 1AGEA 1NANI 3ZYZA 2BNQD 3TYFA 1OLZA 4JFQA 2DRUA 3U6RA 1JMZA 3VFMB 5FHBL 3B6SB 3QUZC 3G9AB 1TTFA 3IFPB 2EXWC 3MGTA 4HZLB 4WFGD 32C2B 1CF8L 4ORZC 1PX4A 4P2QA 4RMWA 1PLGH 2P24A 4JM2D 5DHXB 3IDXH 2FEDC 3MJ7B 5C0NC 3Q3GA 3QDGA 4GAGH 3C5JA 5AWNH 4XPTH 5L88H 3S5LB 1JGDA 5GSVB 1CLOH 1A0QL 4TTDD 1UWXK 3O8XC 3U9PL 5FECA 3GUTB 1AKJD 3LS4H 4HK0A 3VI4F 1IJ9A 4TQEL 4LCUA 4G8GA 4IRZH 4LASL 4WUKH 3GKWH 4P2RB 3MRPA 1JK8B 1ZTXL 3VFMA 1G7QB 3HRPA 2YPKA 4AEEA 5E8OB 3FT3B 2X9XA 1PVHA 3VGBA 1D5BB 4XPBL 1MRDL 1ZSDA 2EE6A 3A0OA 5CKAA 2PXYC 2ZCHH 3C5SA 4MCYA 1T89C 1P84J 1R5IB 2Y6SD 4JRWA 1IM9B 2FSEA 1T5WA 1B3JA 2O5ZH 4FQJL 4U0RC 4WI9A 4XWOD 1F8TL 1SYVB 3QJHA 4P5KB 3SO3C 3DX7B 1QBMH 1U95B 1I7UA 3V7MA 2FEEI 1NSNH 3MZTA 1CXIA 2VL4A 3LV3A 4Q9QH 1RHFA 4BKLA 1WWAX 2HTLD 4XP6H 3TN0A 2XTJE 1BFTA 1XAUA 4I5BA 2PYEA 5CJOH 3KLAA 1GCFA 1NCCL 1H3GA 2DM2A 2JJUA 3KXFB 3MRMB 5DJ0B 3MRHA 2R2CA 3Q5OA 1C5DA 3OPZH 4JPVL 5EZJA 3M1BB 2IADA 4LCWA 3AREB 2HH0L 5IHLB 3HG1A 3QI9B 5JA8B 5D4QA 2D4DA 5JORA 1AD9B 3EYOA 2HKHL 4DVRL 3WYRA 5L2JB 2R1YA 1MNUL 5K59F 5JIPA 2W0LA 1CIDA 1SBSL 4GBXD 2FGWH 4ZFFB 4XHJD 4HWUA 4HD9A 3GMQA 4LQFL 1WZMA 3MPCA 4DCQB 4WI7A 3MRCA 3K3QA 3PL6C 5FYJD 4Z76A 1MRDH 2YA0A 1JI1A 3L95A 4QRRD 2JJSA 3RWHB 1GYAA 2ZPKH 3BE1L 3KYNA 3SDCB 3VXSB 1X5IA 1S8DA 3QWOB 2VSCA 1DUYA 1G6RB 4LSSH 1JE6A 2QHRH 4OF0A 4FQCL 3OKNB 1S9WB 4PJDB 1YEGH 3MV9E 2CH8A 3BEWA 5C8JB 1DVFC 5JXAL 5MENE 1U8OB 3HR5B 1U91A 2XG4A 2IQAA 3WKMH 2CDEA 3AC0A 4EI5A 1RZ7H 2XQBH 2CQVA 3TO2B 2HFFA 4P5MB 1UM4L 1IAIM 1Q9WB 4K7PY 1OPGL 2Q7YA 4YDIL 4YAQB 4S1SL 4P2OC 4NBXB 4DVBA 2HJKA 1CXLA 4FP8H 1EHNA 5CAYB 4NCC2 2EKJA 4LU5L 4X99B 5EUOA 2Z8WC 2E7CA 4PRIB 4OB5H 5AYUH 4HS8H 3M8OL 4WCYH 1A7NL 1YN6B 1WCBA 3NA9H 5DO2C 1A6ZB 1ZKAA 1RZGA 4NBZB 1F6FB 4XBPA 4G7YH 1F90L 2D7OA 4JLRB 1MCPL 3D2UD 5D8JL 4R90L 3BRFA 5HDLA 3VH8G 3NAAL 2WLZA 2AS5M 5GHWH 1MRCH 1A9EB 4POZC 5D7LD 3V0VA 1A7RH 3HG1D 4MB4A 3O2DA 4TSBH 3TO4C 3QO1B 1YEEH 1CD1A 4I0KA 4NCC1 5EN2B 5GS2H 3EYVA 1W2KT 1A7QL 1TJIH 3VGDA 1N6QL 2DD8L 3FQNB 1UA6H 5DJZA 3NFSH 2VDMH 3D39A 3FN0H 3RDTA 3W2DH 4M48H 5ERWB 2R23A 5LKNA 3MRDA 1H8SA 2W9LA 2J4WL 1DUZB 4OFYD 3VCLA 1XGPB 2OCFD 3OSKA 4BZ1L 4X7SL 3UC0L 5I1AB 1Q9KB 2BNQA 4ZSOB 4P49A 4E0RB 4U1MA 5IBTL 2F8VA 5HHOE 4FQHB 1EERB 5IVOA 4Q9RH 3PWPD 4Z7UA 5BVPH 1KSRA 2CUHA 4YFDB 5LAXA 3EW3B 3HI6H 1TCMA 1A7PH 3QPXH 3RRQA 2NW2B 1KV3A 5T3XL 2VLJB 1Z3GH 4N8VG 1NDGB 4K3DH 1YJDH 5EIVA 4LVOC 4I77H 4ZDHA 1P9MA 3BO8A 2DQDH 5EC2A 3SE9L 3OAYK 1OB1B 2WP3O 5JOPE 5IBLD 3FAWA 3MA7A 4PFEA 5IHUH 5GS1B 1RZJL 2ICEB 5CZKA 3L7FB 3PP4L 4ONFL 4YBQC 3TCLB 4KFZC 5EZIH 4F9PC 1LMKA 4FABL 4WW1B 3G5VA 3TEUA 3QEUB 4PRHE 1N8ZB 3MO1B 4HDIB 4A2MA 2VXSH 3SE8L 4JFYA 4U1JA 2A77L 4G42A 4QCIB 2WZPD 4QRPA 2DLEA 4GAGL 3GI8L 2PW1A 4HUWA 4X7SH 3C87A 4TNVF 1A21A 4G6KH 4K3JL 4PB9H 2R1WB 1MCJA 3ULVD 3BKCH 2KBGA 3KPSB 3IF1B 4NZTH 4WVRA 4OJFL 1I4FB 3MV8A 3O3BA 1FFOB 1EVTC 3CVHB 1UWEL 5T33H 3SDAB 4YHLL 5DGQA 4DCQA 5HD8C 5L6YH 4H25B 4K2UH 5DQDH 4GH7B 1FVEB 2AJXL 4JFEE 3MRFB 5HPOA 3QUZD 3L5XL 1ORQA 3QEHB 2ICCA 4HKXA 3SJVB 1NANH 1V8HA 3UZQA 1CXFA 3RWDB 1WWCA 1OAZL 4HFWA 4NQCB 1KXVC 4AH2B 4Y1AE 3RUGA 2UZXB 3HI5H 1W72A 3ZDYF 3IS0X 1QHPA 3E6FA 5C08D 1MHCB 5HYJA 1JHTB 3EYUL 3QPQC 4Y4FD 1A7NH 4FFVC 3MREB 3QUYC 3PUCA 4KMQA 1CBVH 3QNYA 2B1HL 4WJ5A 5GS2D 1VFUA 4U7MA 4MQXD 5E2JA 3LKNB 2NY7L 5FUOH 1T6VN 3QUKA 4I2XA 1RVFH 1PG7L 3S34H 1IEBB 3CSPA 1LD9A 3TNNA 2DOCA 1DVFA 2LFGA 1I3VA 1MY7A 1EAPA 2LU3A 4ZNEE 3G6AB 3PQYB 3G5XA 3BFOA 4HUMB 3RZCC 5CBEA 1I8LC 5GZOC 2BXYA 4RWYH 2YC1A 4OLZL 5A3ID 1T3FA 5FA3A 1H3PH 2FATH 1JFQH 3WO4C 2P5WB 3GKZA 4RGNC 3X12B 2BC4A 2OMNA 5FDYA 3E6HA 3KS0J 4IOFD 3GB7B 2E6QA 3RJQB 5IESH 4LSRH 4G8GB 4DK6A 4I1NB 3K7UA 3RGVB 3ZKQD 1Q9LB 4HK0B 3MLYH 2RFXA 1HH6B 5JHLL 1V7NL 4WI4A 4NRYA 1U8QB 1GGTA 2HWZH 3MLWL 1OARH 4W70A 5JW5B 1FL6A 1EFXA 3HLAA 3LSOA 4HW6A 4IS6B 1QFHA 5FYLD 3HE6B 4MXVF 5IFHH 4PGDB 5F71A 1S5IH 4L8CB 1CXKA 4J6RH 4ZAKD 1A9BB 3IJSA 2X70B 5F96H 4EBQL 1I1CA 3KPMA 1NUNB 1HWGB 3NIFF 3QZWG 2Y9RT 3S97C 3HE7A 3WNLA 2DQGL 1UKQA 1T7WA 1ZA3A 3DVNA 5F8RC 4HUVB 4CDHA 5B3JE 2ADGB 3RGVD 4MAUL 1CTOA 2FJGA 4Y7MA 3UTTA 3IDYC 3F7VA 1RZ8B 5E8DL 1G0XA 4B0MM 2HVKB 2AV1B 4NC0B 1GGIL 3GJFH 4HLZG 4UILL 5H94B 4XNXL 4ONFH 1X5ZA 5IIEB 4LLUB 3B4NA 1K4CA 1LO2H 5D1QD 1CGXA 5KAQG 3CVHH 4XC3L 5E2TH 1PEWA 3QRGH 1G9NL 1ZWIB 3OR6B 3O6KH 2VXUL 3TBYA 4Y19A 4G3YH 1Q72L 1IGIL 5FK9B 4KY1H 3FQTB 2VC2H 3OKLA 4XCCL 4K8RL 1BD2A 3GMLA 1A7RL 3LHPH 5F7HA 4JKPH 4CVWA 1DQDL 5ADOL 5GS1A 2X6MA 4V1DA 4LIQE 4OCRH 4F7CA 5DD3H 4Q97A 2VNCA 1ED3A 4QXGL 2XZZA 2JB5H 1K6QH 3S4SA 4X7TA 1XIWB 3NFNA 1D5IH 3H3PL 5BZWB 5CCKH 3DECA 3HAEA 3RIAF 1ZLVH 2QQKL 1A9EA 4NPYB 1DBKH 1H3VA 4YHIA 1A2YA 2HT3D 4X7FC 4KK8C 4KRPC 4DKEH 2EDKA 3ZDZF 2GFBB 1S9VB 2R2HB 4O58L 1HH9A 5TDOA 2CRIA 2VUYA 1X7QB 1XH3B 5KS9A 1REIA 1I9JL 2QJDA 1A3RL 4MB3A 2V2TB 5MP6H 2EYRB 4GRLD 3L3OA 4G6JH 4QYOA 3SPVA 1HK6A 1MCOL 3QISA 4ZODA 5DLML 3ZZ1A 4NZJA 4X5WA 2B0SH 4U3HA 4Z0XB 4HKZB 1S7SA 5F7MC 3MODL 1NKOA 2P8MA 3SOBL 3EYSL 4AEHH 4P5MA 5DR5L 1J1OH 3VXMB 1QSFE 1LO4L 5KOVC 4XPHL 2F9BT 2IH3A 2P5WD 2R4SH 1I9EA 2R9HC 4HF5H 4UT7L 1ZLVK 2X4QA 4HIIA 3ULSB 4HUNB 1C1EL 2CXGA 1CGUA 5IFAH 2X1OA 4XMLL 3ARXA 2RGSA 3CVIH 3IDGB 3T65B 3QFDA 2XN9D 4JKKA 3HCVA 4HV8A 5ESQB 4Y4FA 4XCYA 2EYRA 4FG6D 4FQXD 5DD3L 4KUCD 3NFSL 3V0VB 4EI5B 3W82A 2CDGA 3HE7C 3PWLB 4NQDA 4MXWH 4PJCA 4CVXB 3MR9B 1FNSL 1YMME 4PJBE 5FUZL 3BW9B 3MLPA 4P46B 3U83A 4MNQA 5A2LH 5ABDE 2DIAA 4MZ2A 4MNGB 4JZNB 5CFHA 2VJXA 3GSNH 4DK3A 3EO9L 5KS9B 4JM4L 3D18B 2PYFB 4NZUH 1ADQH 5AG9A 3FCTB 4IOIA 2EC9T 1NMBL 1YPZF 1B6DA 5EIIB 5EWIH 1W0WA 4JM2C 4KZEH 2D0GA 3RZWA 5I76A 4HS6B 5C0EA 3GMNB 5DJYA 5BRZE 1LK3H 1U8NB 4BELD 3FO1A 2B4CH 2FH6A 4NT6A 5GS1C 5D2NE 1I1FA 2NNAB 1YEFL 4YZFE 3TO4D 5B3NA 2GTWA 2IFFL 4YXKH 1KTDB 4MDJA 5EOCJ 5J3HC 2RIKA 2J8UE 4JB9L 1I8LA 2AJ3A 2APVA 1C5DB 2VQ1A 4R3SA 4JHAH 5TFSH 3QAZC 1MF2H 5CEZE 4ODXA 5T1MB 4U6XA 3FB7B 4MQTB 2EIEA 2NY5C 1RIVL 4WEBH 2MJWA 1BECA 2XICA 4PRNB 2I07A 1KGCD 3NPZB 5KSUA 3T2OA 1G7IB 3IJHB 1DL7H 2AV1A 4W4NA 5LJYH 2JELH 3LN5A 1MVUB 4YWGL 4GKZB 4LKXB 5L2JA 3GI8H 4GLRH 5TPWH 3LEXA 3VXOA 2BJMH 5C0GB 4P3DA 1EAPB 4LPXA 1S9YB 3FQUB 4Y8AA 3PWUB 2PF6A 4MCYB 1OGAE 5IB4B 4OLUH 1JNNH 3H3BC 5KS9E 1WBXB 1NMBH 1U8JA 4NN7B 1MWAH 4D0BA 1AGDA 4XNUL 4JFOA 5ITBL 2AEWA 1CK0L 1NGPH 4EI6B 4NKIH 1NEZA 2BC4B 3M07A 1VFAB 1RI8A 3TWCL 4BKLB 3LN4A 2CXKA 4LLDA 1ONQB 5D7LA 4OUUA 5DUBB 2W65B 1Z0NA 2Z92B 3UTTD 3VD3A 3PABA 1N5AB 5GISH 3OB8A 5D7IB 3ARFA 3MNZA 3X12A 5H37H 3CIQA 1FL5A 1PQZB 3W81A 1MCSA 1OM3H 3RTQB 5F6IB 1VFBB 1TVHA 2DQIL 1MQ8A 4U05A 2WINB 3SDXE 2OBGA 3RAJH 4IRSB 5C6TL 1OP5H 1BGXL 3OJDB 4PLJC 4UB0H 4GRWH 1KEGH 4TPRH 1DSFH 3BWAA 1M7IB 4LVNB 5EOCL 3LN9A 4AH2A 3QUXB 1WVZA 2FO4A 4MDJB 4QXUL 5IQ9A 3O4LA 4Z7QF 3K1KC 3QDGB 1B2WH 4GKSA 4TQEH 4ORGB 3X13B 5F88B 2FX8H 3NPSC 3QEHA 3SJVA 3IGAA 3KDMA 5JUEL 1TENA 3FB5B 2NXZB 2M1KA 1VFAA 5DC4B 1RUQH 1YEDA 4LLAA 1KB5B 3QI9D 5LWYH 3O2VH 4RNRB 4LBEB 4GXVH 2H6PA 3VXNA 3NPSB 5LG1A 3DURA 3MFFA 2YD8A 1CDYA 3OKMB 3FB8B 2WV3A 2C1PA 4IBLT 4FRWA 2FL5B 3VXSE 2ZKHH 4MNQB 4I3SL 4ZTOH 4DKDC 3FFCB 2LAGB 1KOAA 5HDQH 3RNKB 2VDLH 3VG9B 2AK4A 5C0CD 3SDYH 4OV6F 2H3NB 3KPRA 4LCCA 1YEJL 3QEUA 2I60H 5EZLA 1MVUA 1T5XB 4QTIH 4XNQB 5GRUL 2VWEE 1I4FA 2J4WH 4X6FA 5D2NC 1N6VA 2VTFA 2NX5A 3IDJB 1LNUA 4HSQA 3BKMH 3HC3H 4Z18A 1EEYA 2EEDA 2IALB 1D7FA 4K71C 4U6VH 3SKUD 2W92A 3HHRB 3SDDB 2D9QB 4LSPL 3RY6C 4Z7WE 3WD5H 3AXLA 1BQLH 1KJ3H 2NMSA 4GKNB 3O6FC 3PQYD 3V6OC 1MHEB 5FHAL 4UILH 2KKQA 1YNLL 2BNRD 5IB2A 5D7KE 5F9AC 1MEXL 4LNRA 3JXAA 2BNRB 1G7HA 2FX7L 5GSRA 1MCKA 1CXHA 4IM8A 4PJIF 1FVDA 4JG0L 3M17B 4ZUTA 3ZTNH 4QTHB 3OX8B 5F9JB 2QADD 5IB3B 4Z6AT 4GKOA 3LVEA 4MWFA 5HYJE 5E9DE 3H8NA 2F53E 3DUUA 4Y0GA 3ZLQC 3W11C 3QCVH 3G6JA 4X98B 1S3KH 4N0UA 1JTOA 3BVNB 1S7XA 1BQHA 4B53A 4U6YB 5EZIL 5IF0B 5EOTA 2PR4L 3MRDB 4NO0B 2MSPA 2ZNWA 4R4BA 4EZMA 1F3DH 1JJUA 2NXYB 5C70A 3KPQB 2XZAH 5FGBC 5DQJA 2XXMB 4LSRL 2V7HA 1T89A 2R0LH 3PWLA 2J88H 2P48B 5GGTA 5D7KD 2YXFA 5KJRH 2GJ6B 2YZ1A 4KGLA 1I7TB 4P5TA 2G2RB 3T4YA 3R4DA 1GJIA 2OXGA 1MI5D 2IAMD 4LU5H 3H9SB 5D6CB 5ELIA 5ACLA 2DAVA 2YN5A 4ZAKC 5BMFH 1DN0A 1VADA 3K2MC 4FQ1H 1FZMA 3O3AA 1F3RB 3JZ7A 1CFBA 2OI9B 4G6AC 5IR1A 1AXIB 4RDQG 3X14A 2X1XR 3QXVA 3DXAE 4Y2DA 3AMLA 4DZBA 3VFNB 4QYOB 3SPVB 1X4YA 3ARDB 1BM3L 3FQRA 2IPUG 1VDGA 1BQHB 3O3EB 5CLWA 3ZSSA 3WFCH 3G5ZA 4AENA 2Y5EA 3VI4E 4U1SB 1S78D 4LK4A 4PGJA 3EOBA 1FNGB 2FBJL 2VISB 1OY3B 1RJYB 2H26B 4J8RB 3BAEL 4UT9H 1JI2A 3F65A 4UDUB 2XA8L 3P9LB 3ZYIA 1YEKL 3QZWA 1XF4A 4RAVA 4D8PA 3V5DA 5SWSD 1RVFL 3GRWL 3MLUH 2CMRH 3O45A 3V0WL 4KY1L 1LWRA 4J23A 3C6LC 1IKNA 4NYLA 3ROLB 3T77B 1UXWA 1HKFA 1A02N 1INDH 1MHEA 4GSDL 1EIBA 5DTFB 2IPTL 4LPTA 3U2SA 4C83A 4GG6A 1FGNH 2PW2A 4Q0XL 3HS0A 2IQAB 4WY7H 3TN0B 4NNXB 2G5RA 2QADB 3MACL 3IXTB 4B7LA 1XF2A 5B8CC 4L8SB 1JHKH 4L3CB 5INCB 5T1LA 3ZKSD 4O58H 2VDPH 1RZ7L 3D39E 4M4RA 2FZ3B 4DOHB 4DN3H 1DQLH 2OSLB 2C3WA 2H3NA 3KPRB 1EHLL 1M05B 4K7PH 5E2WH 2ADJB 1UM4H 1OAKL 4LNVA 4HUVA 4A6YH 3PABB 3N50A 2PTVA 4LCWD 3OB0K 4MA7H 2DL2A 4Z76B 4GRLC 2IWGA 1Y18B 1C12B 4G8IB 2V9TA 3PGDB 3T0BA 2XTJD 4EXPX 4PRDA 1F4XL 3U46A 2NY5H 1HQ4B 4P59L 3DVNB 5E2UL 1F4AA 4BH7A 4NQUA 1UCBH 4L3EE 4X9IA 3T3ME 1X3DA 2YUXA 3TA3D 3DSFH 3TJHD 3QI9A 3C60B 2GK2A 3QDMB 1HSBA 5AUMA 3WEXA 2J8UF 4FQXA 3EJZD 5EU7C 2GK0B 4G80B 3OAUH 3HB3D 1U92B 1JGDB 4CMHC 4NWTL 2XPGB 5EOCH 3L5IA 4ZSOE 3U82B 4PV9A 3QQNA 2YZ8A 3JUZA 4ZUWA 3FO2B 3O0RL 1L7TL 2JJWA 4L3ED 5FA3B 4S1RH 3CLEL 2ED8A 4OCXH 4PJFE 3WNOA 3IFNL 4XXCA 2J8OA 3GB7A 4OKDA 2Z8RA 1QLFB 3QYCA 4PGCB 1JHKL 5CBAA 1FFOA 5HDOA 1MFBH 1AGFA 5F9OH 3WN5C 4PUBH 1MLCB 1FFNA 1JGLL 1QLEL 4FHBD 4FQLH 3TNMB 4OCRL 3TVMA 3BRGC 3FB8A 4J4PA 3L1OL 4U1JB 4WWKB 2XPGA 5IBTH 4HIJB 1VKXA 3QJFB 1IM3B 2FIKB 2LV4A 2C4XA 1JGUH 3IDMA 2W59A 2NY2C 4FQXB 4XAWH 3MJ8A 3QIUB 3A6BH 3VXQB 5J4MA 1JGEB 1BBDL 4LLWB 2HMID 5EIIA 3VW3H 4MNHA 5DC0A 4ELME 3QFJD 4OI7A 2UZIL 1VGKB 3U6RB 2AJYH 1T66D 3MREA 4IMKA 2XWBB 3PNWA 4OCNC 4WHDA 1QSEB 5KSAC 2FZ3A 1GGCL 3RUGB 4PV8B 4S11A 4D9QE 3KJ6H 4G6AD 4ELMB 1VHPA 1PJ9A 3QDJD 3O6MH 1CYGA 5D1XB 4MS8D 4IRSA 3JSSA 3PJSB 4IIQA 4KAQL 3RIAK 2L0DA 4OFYA 4PJGE 1UM5H 5BV7B 2R1WA 4GXUN 3MUZ1 4TTDC 5D2LF 2BRRL 1WBYA 1U2CA 2G9HB 3JV5A 5I1HH 3SGJC 1G9NC 2BNUA 2VZSA 2QHRL 3LKSA 3QDHA 5TQ2H 3CFKA 2XIDA 2BSTB 4WFED 1R5WA 1HINL 5CEZH 4WUUA 2NLJB 1BFVL 2XWTB 2EXWD 1TETH 1KN4L 3VFTB 5IBUB 4BM7A 1A6WL 3FCTA 3EAKA 4KROB 3FHAA 4UDTB 5B39A 3DV6A 2VDPL 3HZVA 3H9HA 4F9LC 1G1CA 4AIXA 3I6KA 2J5LC 4KKNA 4OFPA 3TJEL 1NFIA 1G6RH 1CE6B 3RTQD 1JVKA 4NZUL 4HPOL 4RMVA 1AKJB 1VPOL 4ISVA 3ESUF 3J8F7 3PDOA 5C0BA 2VLMD 1J10A 2DDQL 4DZ8A 4F2MA 2DQUL 4RFEB 3SGKA 3MRBB 1JWSA 4RMQA 3V6ZB 2JLLA 4XVSH 3UYOD 1INEL 3CLFH 2WANA 5DI8B 1EJ6A 3VGAB 1VERA 5HD8D 3MRIB 4ENEC 1K4DA 1RJZA 1D5XB 4JEGB 5IR1B 4PJCB 2H1PL 1YJDL 1AI1H 2B1AL 3SHSA 6FABH 1AY1L 3RY5A 4P9HH 4X8JB 3UBXG 1NFDA 3G9VA 5D6DA 4KHXL 4OGXH 3RWFB 2K3TA 4GRMA 4HC1H 3BGAA 1ZS8B 4QT5A 1QSFB 3BIKB 1A6VL 2OTUA 2IH1B 5KVEH 4PJIE 1R5VA 4Z7VE 4YHMH 4D8PB 4LLMB 4RAUA 5L2KD 5B38A 4NHUA 1E0OB 2P5EA 1MFEH 5H35B 4DKEL 2J2ZA 2VIRA 5IESL 5E7FA 2COQA 4JRXD 1KJ2A 3MLTB 1L0YA 1CICC 4PBXA 4BQBA 1S7XB 4L8DB 2BERA 1G9EA 2NW3A 4N0UB 1KXTB 1NUDA 5ICZB 1GGUA 4YXHL 4ZOBA 5JZ7D 4ODVL 4YIQA 3KPMB 1R3IL 1TNMA 1YEJH 1IQWL 2D7TL 3HR6A 5JW4N 5I17B 2OTUB 3WFBL 3VFTA 3I3DA 4G6MH 5I1GH 3U1SL 3BMWA 4ZS6C 4JY4A 4WUUB 4DFHA 5C0BD 2OZ4A 3S88H 5BJTB 2VRAA 4LAQL 1I3RA 4PJIA 1DQTA 3PDDA 5IK3A 3D3VA 4PRPD 4F7CB 5I0ZA 1JPFB 3QRFM 3QFJA 1WFUA 3C6LB 1MLBA 3DETD 2VLLA 3AGVA 2BVQA 1JZ3A 3OG4B 5I1JH 1IC5H 3WCYA 1FGVL 3P0VL 5BO1L 2VXTL 1ZLSH 3L3GB 1W0YT 1OLLA 1EA9C 3VFUA 2KZ1B 1KUMA 2X89D 1P5UA 3S8WA 2Z93A 2NY2D 1QOKA 4CU7A 2IEPA 4G9FE 5DMGC 5HHOD 5DJ8A 1UCTA 2D2OA 4YR6A 4JDZB 5DEFA 5C0BB 3MRQB 3KYOB 4MJID 4NZTL 3KXFE 3TBVB 4WW2A 5C09E 5HYIA 3V4VH 4NSKB 1BJ1J 1P7KA 5D93C 4QLRA 1A9BA 1X7QA 1B4JH 4M43L 2ARJA 5L7XH 4TSCL 5HY9A 2MWCA 1J7VR 3MLRL 3P4MB 5FYJL 5JUEH 3W5NA 1J0IA 1FVDB 3CUPB 5M94B 2N1KA 2FHBA 3RA7H 1AE6L 1JF6A 4R7DB 1XR9A 3OAYH 4Y8DC 5IUSA 1R5WB 1PSKH 4FQIL 2DQHL 1CFVL 2UUDK 3KPPB 2YPLE 1LP9E 5GGSB 5CEYA 3S88L 4ODHL 4U1LB 1G6RL 4IJ3C 2CLZB 3MNWA 4YFLI 4X5XB 5CMAA 3VD9A 3HI5L 4NDMA 4HLZH 1BQSA 3U36A 4KKLC 3HB3C 4YDKL 2UY7A 4WI5A 12E8H 1LK2A 4HT1L 3R8QA 3LAFA 3TGXA 4H0IA 5I6XB 1UENA 1BOGB 3L5WB 5ESAB 2PTTB 4JGMA 5LCVH 4U49A 4CW1B 4HHAB 3KS0H 4DGVL 4UT7H 4KJWD 5EB9A 2C9AA 3UBXA 1ES0A 1GPOH 4NQCD 1JZ6A 2DBJA 5JOEA 3PQYE 1DVFB 5JIIA 1I7UB 4JO4H 3SQOH 5I6XC 2D3VA 4DUXA 3BIAX 3OGCA 5HHNA 1QRKA 3ULVE 1NJ9B 1P9MC 3MO1A 3HMXA 3BGMA 1N59B 4PY7B 3RU8L 1YEKH 4LHJB 2X4PB 1KGCE 2QTEA 4U0RB 3TV3L 5JLZA 3UO1L 4GG8B 1HI6A 3TN0C 5C0CE 1NBZA 4NDMB 4TOYL 5JHDD 1MCQA 3VXOB 3TESA 5E4IA 1AJ7H 4PP2B 5JPNA 1FL6B 1PW3A 3Q5TA 4ODHH 4OJFH 5IW6B 1SYSB 1DLFH 4NO2B 1RK1B 1NCAL 3DHJA 1ADQL 1B0WA 5HJ3B 4DWHA 1XCQB 2P1YA 3UJJL 4PJ9C 3MZGB 1I3UA 3LEXB 5H2BA 2Y1VA 1E27B 1EHAA 3RWJB 2W9DH 4NNYB 3QIBB 2FRGP 4GMTH 3UZVB 3ZE2F 2VDKL 1Q1JL 4G9FA 5DJCB 2B5IB 2I26N 1LP9B 1TQCB 3CNKA 3QO0B 1GPOL 3MRQA 4OF6A 5KJRL 3TJEH 1FYTB 4YDVB 5B4MC 3D2UB 5HI5C 4FFWC 4ZUUB 3NMEA 5T3ZD 1E4JA 2H2PC 1FZKB 2GYSA 4PD4K 4U1LA 2X4OA 3QULA 5C9KA 1A3QA 5CSZB 5DUBA 3QFJE 4GS7C 3S6CA 2NXYD 1IEBA 1HQRB 3HFMH 4KXZH 1UKTA 4K23H 3KLHD 3SDXB 4KJPD 4KDVA 5KVGL 4M1CD 1U36A 4JFYB 3I6LE 4LQFH 3UPAA 4KC3B 3IT8D 4Z95H 3FO1B 4KQ3H 2PYFA 5SWSB 5HVFB 2X1PA 1KB5L 2YRZA 3EHBC 3M45A 4Y5YC 3RI5F 1ZVSB 1XGYH 3QEQA 5D70H 4BSWB 4NWTH 3W0WA 3T77A 1RURH 1H9VA 3ULVF 1A64A 3TA3C 1FYTD 3MX0A 3TH3T 3AU1A 2EE3A 3RHWK 1I3GL 2W60B 2OK0H 4ONGH 1D6EB 4IRSC 1CLYH 2P46B 1RHHA 1T7ZA 2ESVA 5EH1A 2ZJSL 1U9KA 4OQ1A 5KVEL 2ADIB 4U2YA 1HHGA 2EC9U 4RISL 4WTWA 4R4FL 2RQ8A 4N0CC 4XPBH 3TWCH 3UDWA 5AD0B 5J9PB 1SJEA 4P23B 5DUMH 4R8WH 5HHOB 3WHXB 2P5EE 5E5MB 5A40E 5C0FB 4Y4KB 1FL3B 4KJYB 2YD7A 4PJHF 1RQ5A 5IT2H 4IMKC 5EC1B 3N06B 4TVPH 4I4WB 3QIWA 3P73B 5FYLL 2PW1B 3PHQA 1MREH 1OD9A 5T5FL 5DK0A 3KYMA 4N0YH 1N8ZA 3HNTL 4CBPA 4EN3C 2X4QB 4HIIB 3DYPA 3GIVA 4X4MA 5FA4A 3U79A 2UYLA 1QFWM 4DN4L 4ENED 5AYQA 5DDHA 4PJXE 2EEAA 4ACPA 5IVNA 3QUMH 4LP5A 4OUOA 2VR4A 4J4PC 1OVZA 3D39D 4TN9A 4CJ1A 3GMRA 4PJ8A 4WHYG 2FD6L 1VACB 1HHGB 4AL8H 5KOMC 3H2WA 5EU6D 1K3ZA 1DCLA 5DI8A 3TM6A 2F54B 2WUBL 3CMGA 2FX8L 3IKCA 3RIFF 1D6EA 1S9VA 3QDJE 6CGTA 5C71A 4NQED 5EFIB 1HXMB 3U4AA 5KSBA 1C16A 3NZ8A 3WUWB 4AIOA 1QVOA 4L9LA 4D9LL 5ICYA 5C08A 4R6UA 3VXPB 3OAUL 1U42A 4AQOA 2AEQL 1B6UA 1U58A 2SEBB 4WFFE 5F7WC 2E7BA 3VFWB 4NHUB 3LZFH 4XI5D 2WQ8A 4NHCH 3LEYH 4AG4H 4XHJC 5HVWA 1NC4D 3BIKA 4Y5XB 4R97B 5I30L 5ANME 3IU3A 1AHWC 1AR1C 5ISZA 1CVRA 4GW4A 2QEJA 1Q0XL 5A2KH 3GIVB 5GRUH 4LCYB 4P9HC 4GQ9L 3HR5A 3MXWL 3FRPG 1S7SB 3WFEL 1RFDH 3GSWA 3LKPA 4LIQL 3E3QE 1K4CB 3VFOA 1NFKA 1SEBA 2YEZB 3FQXA 2HVKA 1Q38A 3ARPA 2H32A 3WFCL 3G6JB 3AFLA 3WD5L 5IMOA 4FXLA 4OFVA 5E6IC 1AO7E 4N8PA 4UI2A 4A2LA 4G8EB 4IEFB 3PP4H 3GBNH 2BCKA 4Z7WB 4OLVH 3I6KB 1N4XL 1N2RA 1I1AD 4L4JA 4L8CA 1RMFH 4Y4FC 3L9RB 3CFDA 4N5UA 4QTHA 5F9JA 2CIKB 3G6JE 2WUBH 3A6BL 2E3VA 3DXAD 4YEEA 1MCWM 4OCMC 1TZGL 5C9JA 5J56B 4N9GB 1TFHA 4ELMA 4PJHB 3AREA 4HH9A 1D6VH 5C86A 3JV6A 1XIWA 3R06A 4MB5A 1CWVA 1X9QA 3GSNB 5I9QB 2PNDA 1XFPA 1FPTL 3CVIL 5GS0L 3ALWA 2K7QA 3DO7B 3ECBB 2DJ4A 5D71H 1Z0MA 3VFGL 3WHE0 1CU4H 1ND0A 1P4LB 1FZJA 4TSCH 2PTUA 1CCZA 4WDIA 3IFPA 1F97A 4F33B 1MFDL 1XGRB 4YDLB 5F1IA 5TQ0L 1IM3A 43CAA 1A6UH 4X5LA 1NJ9A 2V5YA 2NX5E 3JBG7 1NLDL 2R29L 4TOYH 3OKNA 1PQZA 4XNYL 2ZCLL 1RUAH 3BPLB 3NGBC 3TH2T 1OTUC 3KPOA 3KPRE 1C8PA 2F54E 5AAWA 4RQQB 1QRND 3HE6D 4YJZL 2AABH 5KSVA 3PNWB 1FNEB 3D0LA 3B8YA 4ETYA 5JW4Q 5F1OB 3PGFH 3TPUA 2HTKD 4F58H 1KF9B 4CNIB 1KJVB 5K9JL 4P2RE 3C08L 5T3XH 3W39A 1QBLL 4HWEL 1IAIL 4NNYA 4Y19D 4HKJA 3MUJA 1GGBH 2QSQA 2K7PA 3QXDB 4FMKA 5CMAB 4NZRH 5IQ9B 5H2BB 2XWBA 3QCTL 5HYSG 2JB6B 2FO4B 2BVUA 2F8XC 4G80A 1WBXA 1F58H 1X4XA 2YOCA 2Z9TA 3QUXA 3VDBA 1ORQB 2KL6A 1MFAL 1UB6A 4JDVA 3KJ4B 1RZJH 3G08A 3NACL 3BYYA 4HZLA 1DE4A 5I1JL 4P4KB 4LSUL 2CGRH 2EXYC 3ZE1F 5F7EH 2JCCA 4S1RL 3MJ7A 2FX7H 5I1EH 3UBXI 4KKAD 4M6OH 1UZ8B 2A0LD 2EO1A 3GJEB 3RWEB 1CE1L 2XOTA 5SWSE 4PR5A 2D0FA 2VH5L 5IVXF 2BSRA 2VQUA 3QHTC 5JOPD 4LGSB 4I13B 1CFSA 4RBPK 4NKOA 5DJDB 4GQPH 2FO1A 4NJ9H 5T1MA 2YS4A 4D9RD 3U9PH 2VLRE 3GM8A 3V5HB 4WW2F 4MXVE 2EZ0D 1QLRA 3L6FA 4YE4L 4UOW1 2BSSA 4TSAH 4F7PB 3DV4B 3ULVL 3LKOA 4WV1A 4FFWD 3WS6C 3DHMA 1BBJB 3BOVA 4QKXB 4K07A 1HHKA 4F58L 1FZJB 3C6LD 1KCLA 4HUUA 2GTWB 3GFUA 4XP5L 4HPYL 1KB9J 2YA2A 5KVDL 1ZHBB 3CPLB 4W6XB 3D87B 3ZKMD 1MWAA 2F74A 5DUML 4C59B 4HXBL 1R3HA 4BK4A 4NZRL 1OAKH 3UTQA 5E03A 4ODWB 4DOHE 1MAKA 3ECBA 4IOIB 4U1HA 4RBPH 4KKCC 5GGVL 2OQJA 4HGWB 3V5DB 4GKZA 3KPPA 2O5YL 3P0GB 4MLSA 5GRVK 2DQIH 4NKDA 4U1NB 4JG0H 4QXTB 1S7WB 4DQOL 2YD6A 3NAAH 4HWBA 3E8UH 1KB5H 1IQDB 1RZIA 1CE1H 2DQFA 4KV5E 4TNWK 5C0JA 5DUPH 4BFIA 2YPVL 3DXAA 4C83B 2BRRH 4QHMA 4RQQA 2OSLA 3HC0A 3O41A 3IYLW 2DM4A 3EOAA 4YPGB 1CQYA 5DHVA 1Q9OA 4ZD3L 1BVZA 4KZDH 3HRZA 4QCIA 2V2XB 4P46C 4X4XA 2HG5A 4NRXA 2F5BH 5CP7A 5C2BH 1U3YA 4F7TB 1LDPH 5L0QC 4WW2C 1OSZA 2MPAL 2Z35B 5EU5A 3IFOA 4MAYA 1S7TB 1G0DA 2ZUXA 3Q6FA 4XTRC 3SGEI 5HYSB 1G9MH 4HBQA 5C0CB 1I7TA 2EE9A 1H5BA 5BW7C 3ARWA 5FV2A 4ZO8A 1X5AA 4FQLL 5BRZA 1NFDF 1HXMA 1L6XA 3RWGA 3IDUA 4X4YA 2FECI 2Y7QB 5L8KB 5I18L 1FV1A 2ADIA 3RY6A 3PGCB 1JPGA 1BWMA 2Z8VC 4P46A 4J2XA 2P49B 3EOTH 5FYJH 3TLRA 3D9AH 2APTA 5MEND 1BJ1H 2X5PA 5CHNA 4XH2B 2QADC 1SEQL 3MRLA 2FHFA 4MNQE 2HJKB 3WFDH 2R4RL 5D5MF 3G5ZB 2DQTL 3OAZH 1AI1L 4LCCC 2UZIH 3HMWL 2XTJB 1CE6A 4D9RE 1YN6A 3O2DH 1CDBA 1ED3B 5FO8B 1F6AA 2FYYB 4HEPG 1RJLB 5TDOB 4PJ5A 5E6IB 5L9DL 1KB9K 1JPSH 1TCRB 1SJHB 2XXCB 2G75A 3GBNL 2JIXD 2IFGA 1ACZA 5KVGH 5F7EL 4Y88A 3O6LL 3LY6A 2G5BA 2VXUH 3NCFB 1AR2A 3GEWB 4N0RA 2GJ6A 2ZSVA 2W07A 1CD0A 3BVNA 1PEZA 2XKNB 4RGOH 4S10A 5E95B 5E9DB 3EYVB 4G6KL 1U8IA 4K3JH 4YDVA 4BYHA 1ZLUH 5MHSE 2ENSA 1QFWH 3OAZK 4K8RD 1RJZB 1U3ZA 4HEME 3W9DA 1LO3H 1FAIH 2FWOA 1TITA 3QG7L 4MA1C 2A0LC 3CFCH 4ONGL 1C16B 3NZ8B 1L7TH 2DQJL 1IAOA 4IIQC 4YDLC 2C4FU 5IMKB 3NCEB 4M48L 3MXVH 5D1QA 2GJJA 3MRIA 3ARGD 1NH6A 1A6PA 1FAKT 1OW0C 4MVBC 4OFIA 4OIIH 2BOBA 4Q9BA 1MFCH 1QSEA 4TUKL 2C1PB 3EJJX 3C5ZD 4GKNA 2HT2D 5JZ7C 1ZHBA 2ZSWA 4LBEA 2ZG2A 3T1FB 3BD3A 2NX5D 2MKWA 2VR9A 2X89A 4N0YL 4OCSL 5J57B 1A7PL 3QPXL 3EYSH 3AS2A 3G6DL 5CLTA 2CDEB 1J1OL 2X4OB 1T22B 3GMOA 1IGCH 1S7VA 4RGMB 1J1XH 4Y4HB 1OGAD 3ILPA 5J1AB 4KTEH 1HQRA 4PRIE 4PRPA 1EUUA 3O11B 3WLBA 5GGUA 5AZ2H 4MJ2A 2WAHA 3GI9H 5IOPB 2X4NA 25C8L 1BF2A 4OZFA 1BEYL 2AP2A 2XG5A 2EDEA 2B7DT 2Q86A 3QG7H 4WFEE 1ORSA 4GUPA 1OTTC 3IS1X 3KNBB 1SY6A 5C0DB 1XCQA 3DUSA 3N1MC 1Q94B 2NZ9D 2ZNXA 5FECB 1NUGA 2EH7L 1OP3H 1MFBL 2DWEA 1XGYL 2KUTA 3W5MA 2AEQH 4HGKC 1A14L 2GUOA 2NXYC 4XCCH 5ID1A 1S5HA 5DZLA 4NO2A 4K71B 4GBXA 3IJYA 1EGJA 2C7UA 5K9QI 3V8CA 2Y36H 3ARED 2KPNA 2P8PB 3AS3A 3LIZL 5D2NB 1R0AH 5KTEL 1DEEB 3BKJH 3OBAA 1BZ9B 1L9NA 1JZ7A 4PJXF 4PREB 4X6CE 2FHCA 3GGWA 2JIXB 4L9LC 3T0EB 3IXAA 3L5XH 4M9OA 3QDAA 1GVIA 1MAJA 2J1KA 4KJPC 4R8WL 2QQLL 4TYUA 4JKLA 3BGFC 5EBMB 2OLDA 2BSSB 3DI2B 4KTEL 3PWVB 4YBQD 4H88L 3NCYS 1G7JB 3QEGH 3WO4B 1LE5A 4Z7QE 2DL9A 3OGCB 5HHNB 4HKXB 3ARDC 3D25B 1AGEB 3C5SB 4PG9A 2GTZA 4XWOC 4ZNEA 1IAKB 5IW1A 2AJZA 4UNVA 4Y2OA 1PKQB 1OGAB 5GRJH 1JPTH 2PTTA 1IC4H 1L0QA 5J6GB 2DF3A 3FB7A 3BESR 4EUPG 9CGTA 3MNVA 5DMYA 3U2SB 2Y5TA 4GG6B 2H1PH 1JF1B 1ZOXA 3AM8A 5DQ9A 1DBBL 3BZEA 3K8MA 4U1IA 2VITB 3WDHA 3LN4B 4X6DE 1XF1A 5ID1B 1HYSC 4X5XA 4A6YA 4Y4HA 5A3IC 4M7KL 43C9A 1VGEL 4Z0BH 4V1DD 3S37L 1H3PL 3CFDB 4OCXL 4OZHB 1B4JL 1XF4B 2Y07H 4UZGA 3RUGE 3G5VB 2HP4A 4M1GL 1KIQA 4GLRI 2VZTA 3QDMA 1MCRA 4WENB 5HI4D 3RWCA 4EIGB 2DJUA 5C9JB 5BV7H 2H26A 3WS3A 3MUY1 7FABL 1BFOB 1TJGL 1JMXA 4PJGB 4YXLL 1YMMA 3V52L 2J8UB 1HQ4A 2X4RA 1V7NH 5CGTA 2O5ZL 3P4LA 3VMNA 1BVLA 4LSPH 4QGYA 4XPGL 1KN2L 2VZUA 4P3WA 1F6LL 3CFEA 1F8TH 4QHKJ 5GZOD 2A9NL 2VLJA 4WI3A 4OCSH 5MEPB 4CW1A 4UTAH 3CDGA 4JZJC 4CMMB 1JZ2A 2AV7A 3LCYA 5JTWA 3HZYA 3MRGB 3RWFA 3L3DB 3LRGA 5EBLB 3MLXH 2AJYL 3QCTH 3JV4B 2ATPA 1UYWH 4JB9H 3IRPX 3K4ZA 5D70L 4G9DB 4P2CG 2V2WB 5BXFA 2VDNH 4JPVH 5DK2A 5EA0L 5J1TC 1RJLA 1OHQA 3KG5A 1F11A 1TQCC 1JRHH 1WTGT 1IAMA 3F6IA 3NCYP 3H42L 4MAYD 3VWKB 5C6PB 3OF6D 4K3HA 1JNLH 5T1KD 4QHKI 4R7DA 4ZXBD 3SN6N 2L4OA 3QRGL 5B21A 1QVOB 2V5TA 1QEWA 3UTSB 3U0WH 3THML 1MCCA 3R1GH 1IL1A 2ED7A 4AJ0A 5E4EB 1QPXA 4HBCL 3UXFA 3U4EB 1MCDA 2R56L 5I1LB 1G9MC 5T1DH 3GSNL 2R0LL 1TJGH 2Z0BA 1DBML 1HHIA 4OZ4B 4LPCA 3HCVB 1T0NA 1IT9L 1XGQA 3L3KA 5D1XD 4PJ9A 4CVXA 4DKAA 2CJUL 3OZ9L 5F97E 4LCYA 1YMHA 3RAJL 1ZTXH 2AGJL 2J12B 2Y4SA 5FA4B 5DD1H 1WZKA 3RNQB 1U91B 3NCMA 3MJ6A 3KPSD 3AAZB 2BNUB 4EIZC 4HKZA 5E70A 4LF3B 3BP5A 2Q7NA 3CFJB 1NLBH 4TNWF 5DMGD 4JRYB 4QWWD 4JY5L 5DXWA 1MJUH 1B4RA 1INQB 3Q1SH 4HS3A 4J1UB 3VJ6A 1KFAL 1XH3A 4F7TA 4M5ZH 5HGGS 5C0FA 5EUKB 4XC1L 4POUB 4NWUH 2DI9A 2JCCF 4HCRH 4G7YL 1J88A 4X5WB 4ZNCD 3QXTA 5EZOH 4M6ML 4IOFC 1DUYB 1G6RA 4UIKL 1PZ5A 1NMAH 4BZ2L 4UMGA 3V5KB 4X7DC 1YEEL 1JN6B 3HUJA 2CO7B 1W0VB 1Y0LA 3TT1L 3P9MB 5FK9A 4QNPF 1UQSA 3MRMA 3O6FB 1FC2D 4LDEB 3WKML 3OR6A 5CJQL 3DV6B 4ODSH 2ZUYA 5KSBF 4HIJA 1VKXB 4M00A 4P57A 4AY0A 4F9PA 1AO7B 5BV7L 4AYFA 1RULH 2NQCA 2YMXH 4GQ9H 3SDAD 4GXVL 1E6JH 2X09A 1MI5A 3S7GA 1RFDL 4S1SH 4LP4A 4MSWB 3V8OA 1OAZH 4UU9B 3JUYA 3RGVA 3O8XD 5DC9B 2A74A 4IRSD 3RP1A 2F19L 1URLA 4Y1AD 2PYEB 4XTRD 1NBYB 3TYGL 4PGCA 1KNOB 1N4XH 1MRFH 1UG9A 3IDJA 5CJXC 4U1GB 3A6CH 4KJQC 4QXTA 4URTB 3KAAA 4S1QL 4FQQB 3WIHA 3VXRD 2Q8BL 4MD0A 3MLSH 2JF1A 3BRDA 2FJGB 3UTTB 3CZFB 3PWNB 1KEGL 5K9OA 5JW3H 5I1IH 3D3VD 1N7MH 4M1CC 3QPQD 4U1HB 1C7TA 1F4YL 2CD0A 5EA0H 1I9RL 1P4IH 1ONQA 3EJYC 5C1MB 3P4OA 3VXQA 3FKUS 5LGHL 3F6LA 3LPGA 1JV5B 5JPNB 5JLZB 5KN5A 1K8DA 5E8OA 3MA9L 4Y1AA 3K81A 3LQAH 5B3JF 4HKJB 3ZDYE 4UOJA 5EBWB 1RJCA 1PKQA 5MEOB 4I3RL 1GZQA 1AGBA 2PCPA 1HI6B 4ZXBC 3AMKA 5ILTH 1A6UL 5HYJB 4PRHD 2WBJD 4OZGB 1QA9A 2VLRD 3BD5A 4PTUB 3S35H 5CD3A 1RIUH 5IB4A 1ZGLP 2PYEE 3BN9D 3I9GL 4JR9L 5EDXA 4D9LH 1VEOA 4I3GA 1MH5A 3L6FB 3DX8A 2HVJA 1NL0L 1QLEH 3V5HA 5CGYC 1X5HA 4NM8L 3QQ3A 1XIWC 4OQTL 1P7HL 3A6OA 4LRIA 3KR3L 1PAMA 3B2VH 1KELL 2GKIA 32C2A 3MV8E 5FYKH 1BZQK 3A67H 4OD1H 3RWEA 5KSUB 1AFVL 1EEUA 3U0PB 3EFFB 5ANMA 5BRZD 1RPQA 3QIBA 4JFDB 3SDAA 5JMOC 2HT4D 3AY4A 3CK0L 1HILA 4D9QD 3ARGC 35C8H 2X4SA 3BUYB 4EEEA 4AMKH 4XAKE 3BPOB 5HVHB 1OPGH 4U6VL 4YDIH 4LPWA 1EH9A 3GSRA 3CC5A 4XI5C 3EYFA 4WHYH 3QWRD 1GZQB 1OAXH 3VMPA 5FYLH 3E3QC 2LAAA 3HFML 5IFJB 1K9TA 1OAYH 2ATKB 5E94A 5EG6C 1QFUL 5T3ZL 4N5EC 1J8HE 3HAEH 4S1DC 5E2TL 1JPTL 3FN9A 4JFHE 1H0DA 1X5LA 2F58L 3ZYJA 3MYJA 2PXYD 3Q2CA 2PO6A 4XZUB 3WE6A 4EVNA 4OKVB 1EMTH 2V9QA 2ZCKH 4FTVD 4R26L 5FOJA 3EGSA 1P7KB 1U2HA 1BZ7B 1CLCA 2FECL 5B39G 1HHHB 3LMJH 4WEMB 3I50L 4X4ME 2GSIA 1HINH 2FX9H 1BP3B 3WSQH 3D5OF 3QFJB 3TJHC 2X1QA 4M7LL 4EOWL 4NO3A 2X4NB 7FABH 1G7IA 4FQHA 2GEEA 4EUPH 3HZMB 4RRPA 2LQRA 4PJIB 3D69B 5ITFA 3QQ9C 2ID5A 3VE0B 5ESVB 3ZKXB 4Y16D 5I2IB 5DWUH 3GBMH 5IM7A 4AM0A 4M5YL 5D5MB 2VUOA 3I6GA 1SJXA 1U3HB 3E0GA 1QZ1A 4RCAA 3GSNA 1I3RB 2WQRA 3QUZA 4N68A 4DEPC 1YMHB 5KANI 1S5IL 1F3JA 2A6JA 4FN0A 4XVUC 1OGTB 3QQ4A 4XNZB 1T7YA 1JYWA 5F96L 3STBA 4EBQH 4Y16B 3GM0A 1KEMH 3O4LD 4NQEB 1LGVA 3NBNA 2VAJA 2BCKB 2ZUVA 3PG2A 1C1EH 2VLKD 4M7ZB 4ZMAT 1T21A 5EC2B 5B22A 4F57L 3IDNA 2L7UA 5FGSA 2I5YH 4MA3B 1A6TB 3QEQE 3RVTD 4DZBB 1J05B 1U8IB 3WIFB 2OS7A 4HK3N 3X14B 3CXHK 4RFOH 3QIBD 1DQMH 4N90D 1BLNB 1IGYB 5D96B 5DYOB 3WO3B 2FLBT 2ITDA 1KLGB 2NY2B 5E08L 1JUFB 1NAMH 2DQCL 2Q76B 4NQSB 3JTSB 1IVLA 1NGZA 5EO1A 5EZOL 2BNQB 1RZKC 3O3DB 2QKIB 4J3VA 1C5BL 1FDLL 5E6IA 3O8XA 1H5BB 4OTXL 3WJJA 3QR2A 2DWDA 1UEYA 4UIMA 5DD5H 4RMUA 4AG4L 1XF3B 3NH7L 4X6CF 1A7OH 1I8IA 3OV6A 3IAPA 3L3IA 2C3GA 3JTTB 4KI5C 3WHXA 1LE9A 4NRXB 1ZHKA 2ZUQC 1YMMD 1JFQL 4RFEA 2X7LB 3KJ4C 3EFDL 4GW5A 1NEUA 5I1CH 5AZEL 3TH4T 1X5JA 1FV1B 1MCNA 4PJFF 5K93A 4KRPB 5JIKA