4L3CB

Structure of hla-a2 in complex with d76n b2m mutant and ny-eso1 double mutant
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKNEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Class I Major Histocompatibility Complex, the Trojan Horse for Secretion of Amyloidogenic beta 2-Microglobulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 14
structure length 100
sequence length 100
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X, Z, b
ec nomenclature
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l3cB00
4LLUB 5DJ0A 2W9EL 1MH5A 4M7KH 3MLYL 2HMID 3RAJH 1WAAF 3P3YA 1FORH 1G1CA 3GBNH 3SGEI 2VAAA 4Z6AT 2P48B 1ACYL 2A73B 1LK3H 5FHBL 3NIFF 4PJFA 3ARED 4JCMA 1MLCA 1A6UL 4Z77B 2D0HA 2EDFA 4KZEH 3INUL 3EZJB 4LCWB 1DDHB 4AH2A 4OCSL 4PJFF 3O6LH 3LHPH 5ALCH 3PJSB 4PBWD 1I7UB 2IC2A 3LZFH 2A9MH 3FT3B 3MFFB 1FFNB 4IHOB 1X44A 5A2LH 1XGRB 4AQOA 4J3XA 4PJAE 3L3KA 3PGDA 2Z35B 3LRSB 4R96A 1SJVA 3JZ7A 4UIMA 2PTTA 1KCRH 4NKMA 3QO0A 3ARPA 5IKCB 5HHOE 3VXRB 1YEGH 4E42B 4JHAL 3MV11 2W0FB 1SVZA 1TETL 2W91A 1MFAL 2APVA 3AS0A 5EIVA 1MCIA 5JNYA 1OW0C 3BDYH 1I7RB 2OMBA 4P4KB 3LQZB 1BEYH 1LD9A 3F7RA 5IMLA 4FQHB 5I2IA 5F7YC 2JJTC 3DSNA 2FLBT 5IW6A 2IGFL 3IXAB 2YPKB 3O45A 1HOCA 1IBGH 4FNLH 3RZCD 1F5WA 5E2WL 4YO0B 5LWYL 4ZUVB 3SDCC 5B38G 5B4MC 1CGWA 4B41A 2G75A 5J1TC 2FWOB 2C1PB 5ICZA 4KV5F 1KELH 3NFSH 2ZUYA 5FUZL 3QEUA 4K23L 4ZPTA 3Q1SH 1BZ9A 1J0YA 2BHYA 3P4NA 4FZ8L 3VGFA 3OX8A 2W9DH 3P73B 5IB2A 3QDJB 3DO7B 3MV9A 1QBAA 1Y0LB 2YUXA 3QUKB 4J3WA 4WI3A 5TDNB 1AXSB 1FSKB 1V3LA 3B2VL 3BSZL 5EORL 4RFOL 3L7FA 4XNUL 4PGDB 3BP7B 1ZSDB 2XZCH 5IVOA 2ICWJ 3IKCB 4UZGA 3GMRB 3UO1L 1JE6A 3KPMB 3T0BA 4NZUL 1W72A 1JPTL 5D5MF 5EPMB 5KVFH 1DUZB 3EFFA 4M48H 4PRHB 1K4CA 2BNRA 5EU5B 2IADA 2ESVD 3DGGB 1R5WB 5FOBA 3UTTA 4NFDA 1LEIB 1L7IH 2IAMD 4FOMA 3L7EA 1MJUH 3ALWA 3GSNA 5DHVB 3MOBH 3VCLA 4H26B 4X83A 3DXAA 5D1QB 4UOW0 1G1YA 4XVTH 4PJ8D 1BD2B 3THMH 2AXFB 3F7QA 3AXLB 4NN7B 2H45A 2BNQA 1ZE3C 5F7UA 2V5SA 5D2LE 5HHPB 3LPGA 3KR3L 1MIML 3TO2B 3MCLH 3U6RB 4NPYA 3G04B 3QEHA 3BZFB 4WI8A 4TSAH 1MWAB 4QHNA 4JPKL 1T2JA 4XCEA 4LCWD 4K07A 4YDJA 1IC4L 2VC2H 4PJXB 2H32B 3GMPB 2DB8A 3IDMB 3LEXB 4FQXC 4L4VA 5FYJE 2HJKB 4DZ8B 4EIGB 4CUCA 1YEJH 1DEEA 1ZHKB 3DPBA 1FFOB 4YHOH 5ALBH 2ADJA 4OLUL 3WFZA 4JPVH 3BUYB 25C8L 5HI5C 1E0OB 1QR4A 3WNOA 4Y2OA 1KJ2L 1MCEA 3VXRD 1RJCA 3D69B 5C0RH 3VE0A 2QADC 3MRIA 4PLNC 5E5RB 3CSYB 3EO1A 1V7MH 4JDZA 4AMKH 4DKDC 4F3FA 4I0PB 1CD8A 4P4KD 4OLXH 2DQJH 3EGSB 1FE8H 3VI4E 5IF0A 3D5OF 4MA3B 3SCMA 1A5FL 2J1KA 1R3IH 4OGYL 3V0VA 1MQ8A 1A7PH 1MJJB 1YEKL 2HKFH 4L5FH 1NCWH 3BPLC 4HKJB 1WGOA 3SDDC 4R0LA 5IBTL 5KSAA 4XNYH 3RWIA 5C09E 1RJYA 4U6VH 4LBEA 3GBML 4C56B 1UFUA 2F53E 2WWKO 3QUMB 3S37X 3MV8A 3CLEH 3IU3A 1HH6A 5I16A 5IBUG 1AIFA 2DM3A 3QDJD 3MYZA 4K3HA 4W6WB 2I07A 3VFPB 4PJIA 3V0WL 5JMRA 1F4YL 3NACL 5C0DB 2ZSWA 4XXDA 5JOPD 3ZYIA 3RZWA 3QDMA 1IKFH 4GRLC 4JFYB 2XACC 1P2CA 5T1MB 4U1NA 2APXA 3CFDA 4JFFE 4HMDA 3PP3K 1OGAA 5F9OL 1YC8A 1A4KB 5CJOH 4ZTOH 4PRHD 1FNLA 1J8HE 3CSBA 2X41A 1WTLA 3P0GB 4UIKL 3V5HA 4K8RC 5ITFB 4ZD3H 1IGJB 3QT2A 4AZ8A 3CVIL 1YDPA 1IFHH 2AJUL 3FB8B 5ICYA 5DJCA 2EKSB 4I2XB 3MLXH 5FUOL 3ARYA 5D1QD 3C5SA 2GAZB 5DK0A 3C8HA 1I75A 1BD2D 1FH5L 2CDGB 1G7HA 2UZIL 2FBJH 4XP9L 3LRGA 1H3PL 2SEBB 3ARVA 3SE8L 5J6HA 3SDYL 4NP4L 4LPUA 3S4SA 4OF8A 1MCBA 2CKBH 3LV3B 4CMMA 2K3TA 5JZ7D 2DIAA 4DVBB 3O3BB 5K9OA 3CLFH 4JO2H 1XGUB 5HYJB 4TOYH 4MA7L 1T5WB 1O7VA 1FORL 5CP7A 2ENSA 4XBEH 3CIQA 3OKMB 2M26A 2G9HA 3C2SA 1DN0B 1N6QL 1XEDA 3SEPA 1SJXA 5T1DL 2VWEE 5DUBB 4OFYA 4TUKH 3JTSB 3HG1E 4PY7A 4KVCL 4KPHL 1B2WL 3WFHA 5I8KH 3IVKB 2VDML 3ES6B 4JLRB 1KTDB 1CQYA 4FQQA 4KK9D 2OK0L 2P24B 5IGXH 4LLVA 3K0WA 5ESVA 1VKXB 5L2KB 43C9B 3LEVL 4JZJA 3PV7A 5L88L 5E2UH 1YZZA 3FQWB 4AENA 2GJ6B 4I0PD 3X13A 2OM5A 5DWUL 3DO3A 4MQTB 1GGBH 1H5BC 4POZD 5CBAB 4LVOB 4LLYB 1YY9D 2AGJH 5CBEA 3ILPA 2BVQB 1A6VH 3VFTB 3B4NA 2EDHA 1VEPA 2BVPB 1HYRC 5E6ZA 1ZOXA 3GM0A 4KGLA 2F5BH 3A67L 3NH7L 4K9EH 4CU7A 2ATPA 1EO8H 2C7UB 1BEYL 3ARWA 4NM4L 1MHPH 4GW5A 3W39A 1NCTA 1IAIH 4N1HB 3B83A 4OZGF 1FHGA 4FQIL 4MWFB 3RKPA 4C56D 1VPOH 5JPNA 2VXUL 3HNTL 1CD1A 1TDQA 4Y7MA 1TTGA 4X4MA 4X6BA 3BEVA 3EYVA 2FO1A 5D2NB 4PRPA 3H2WA 5FYKD 3KYNB 1LP9E 4WWKB 4IBLT 3H9ZA 3ZMRA 4QNPE 1SQ2N 3CDGA 4D0BB 1UWGL 4BJLA 1YPZE 5DHYA 2VISA 1KN4H 2Y1VA 4ODVH 2CDFA 32C2A 4KROC 4CVZA 3T65A 1VFMA 1NGPH 1IARB 3DYPA 3HRPA 5EFIB 3RP1A 4H5SB 4DZBB 3L3IB 5INDA 2V9RA 5T3XE 1QP1A 3OPZL 3C5JB 2PW1B 4ONHB 3AS1A 4WV1A 2FIRT 2IPKA 4JGJA 4S1DD 2UZXB 4L3EE 3CFJA 4M1DH 1Y6KR 4D3CH 1UH4A 4C83A 5CMAA 4G8FB 2H9GB 3DECA 3U9UB 3DTXA 3MJ6A 3QCUH 2Z8WC 5E70A 3LQAH 3GJFA 1OW0A 4G9FA 2PO6A 5F88B 3UTZA 5E9DE 1UCBL 1XAUA 1CE6B 2JJTA 1JPSH 5F7HA 1U8JB 4XWOC 3IDYB 4TQEL 5D7IE 3RPIA 3VRIA 3RVXD 3TCXA 1H8NA 5HYJD 4PV8B 4X6CE 5DT1L 3P4OA 4HUXB 4Z7NE 4GUPB 4J23A 1SY6H 2ICEB 3FQUA 4K94H 5LGHH 2V17L 4G80A 1IILE 1UZ8B 3RHWK 4LVNB 3LB6C 2EIZA 4Q97A 5DC4B 5DS8A 1KPUA 1ULVA 4DN4L 1JRHI 3ZKMC 3P40A 2HG5A 4LHUA 1CBVH 1T22A 3B9KA 3Q6GL 2CRIA 4CJ1A 1I8LA 1N7ML 4XP4L 2YMXH 2NXZB 3OB0H 4OFDA 4NDMB 2AK4B 4YNYA 5L2KD 4JM2B 2GJ6D 1J10A 2VDNH 4P2RB 4X9IA 3WIHL 3T2NH 4EXKA 3UTSB 3IFOB 2OR7A 4Q9QH 2FB4H 2UZYB 4JM4H 3U1SL 3DBXA 3BYYA 3X11A 5JW4Q 4YFLF 4M1GH 3KLHD 3SE4C 5F3BA 3BRGC 2WWMD 5FYJU 5D93C 1RZFH 5DRWB 4QYOA 4I77H 3RWDA 4AIOA 3WUWB 4J6RH 5TH2A 4CNIA 2FZ3B 2GTWB 1CL7L 4JFPB 1GIGH 3V6ZA 43CAA 2R4SL 1T80A 2BNUB 4OQTH 4I18B 4MQXD 1OY3B 2WSKA 4ZS7L 4ZFOA 1N2RA 3SDAB 1BX2B 3OTTA 3ECBB 1MELA 4WWKD 1OD9A 3VRLE 4RQQA 1OSZB 4U0RB 5IVXF 1D6VH 2MPAH 1NDGA 3K4DA 2VN4A 3CLEL 3ARSA 1ADQA 2CJUH 4HJGB 4KDTC 3BFOA 2Q7YB 1E27B 4WDIA 4M6NH 1JP5A 2LFGA 4YXLL 4JRXE 4Y5YB 3TJHC 1ACZA 5BW7C 3DX8A 1HKLH 1P7KB 4LLMB 3UPRA 1OL0A 4UTBH 4DVRH 1EJOH 4FFYH 4M43H 1S7TA 5FO7B 4AJ0A 4DGIL 2XWBB 2HLFC 1PY9A 1TJGH 4I8DA 2IPUK 2X9XA 1D5BB 5F96L 3AB0C 3BKYH 1N64L 3IDGB 3FB6A 4JKKA 4NQDA 1UJ3A 4NKOB 3DMMA 3EAKA 3MRBA 5SWZE 4KI5D 3T77B 1JF1B 5D72L 5GRVK 2OL3A 2AJVH 3QDHA 5HI3D 4HPYH 1NCUA 4NKIL 5B38A 3OAYK 5GZNC 2DRUA 4F33B 3IDXL 2A6JB 4WENB 2EYSA 4GAJL 4NO2B 1U6AL 1SEQH 3C6SA 2DQDH 2UWEE 2BVEA 3KYMB 3GUTB 5CFHA 3DURB 5HGBA 4N0FB 4N8CL 3EOBB 2PXYA 5C0GB 3HE6A 5CP3H 1TCRA 4MJ5B 3LKRB 2AK4D 4JM2D 1WWCA 3FQTA 2WINA 3VXTA 4U1GC 5FGSA 2F9BT 5HY9B 4FZEL 3BO8B 4P2RD 1QFWI 1CXHA 3KYKH 4PJBF 4MAYC 3UTSD 3HZKB 3QQ3A 3FQRB 1F6FB 3ZE0E 1CFNB 4A2LA 3NN8A 3O2VL 3BKMH 3C6LA 3WDJA 2KQNA 3BAEH 1I9EA 1R5VB 3HPJB 3MRCA 3HNVH 1VFBA 2Q7NA 3BWUC 4N0CC 1HHKB 3PHOB 5BCAA 2N7AA 4J4PD 2OTUA 1P4BL 3I6GA 1G9EA 4OZHA 3WL9B 3L3OB 5BQ7B 3MXWL 4WW2A 1OM3H 1OSPL 1DANU 4LVHC 1T0PB 3D85B 2PW2B 3KPSE 2VZOA 3SDAD 1C5DA 1EO8L 2QR0B 3KPPB 1GHFH 1IAIL 1KSRA 2O61B 4NNXA 3FN3A 2EEBA 5C0AE 5KSBB 2RCSL 4GRWF 2P5WA 4P23A 5EU3B 1EXUA 3W0WE 1ZEAH 4WCYL 5BS0B 2HVKB 4G6KL 3W5MA 1RUML 5MEPB 5E24E 2EXYC 1T2QH 4PTUB 3NVQA 4OZFB 3QWRA 4ODXA 1W0WB 3E8UH 4Y4HC 5EOCL 5C0CB 1A6TB 3SGJA 4JKWA 5ISZE 1CD0A 2F58L 4ODVL 5AWNH 3WFEL 4R7NB 3BT2H 4EBQL 3CZFA 5HBBA 4PP1D 4Q9BA 2HMIC 1VFAA 5LGKA 1BIIA 1ORQA 4GH7B 4ODHH 4XVUC 1M7IB 3KPLA 4NC1C 1NUDA 3C8KB 1I3GH 4HIXH 4FFWC 1BHGA 5GIRB 1X5HA 2HT4D 2X4UA 4LPWA 3QIUB 2F5AL 1FC1A 1T21A 4NQCE 5I30H 2DJSA 3QJHA 1FGVH 3HC4L 2DQCL 4LIQE 4IM8A 4MDIA 5TGBB 3OG4B 3G5YA 4OZIA 3IDJB 3MTRA 3TO4A 4I4WA 3HS0A 4M61A 3P0YL 1U92B 4OZIF 1BBJA 3RX8A 4MA1B 1RZKH 3DRTB 4X7SL 1SY6L 2V2XA 4X6DE 5TE6H 4LCUB 2CRMA 3PWPB 2OJZH 4A6YH 1D5XA 3QUXB 2X4OA 4MNGA 5HHOB 2E3VA 3V6OE 4YWGL 3IJSB 3VWKB 3I3EA 2MOVA 4N68A 4RGOH 1Q94B 3TIEB 5EUOF 4EI6A 4HFWB 3JWNC 1OWRM 3FO0L 3PGFH 1SYVA 1J0HA 4O5LH 1HK6A 5HSFA 3MUGB 3MRHB 3MACH 4WHTB 4DUXA 4XPAL 2XQBH 4NQVA 1Z3GH 4EUPA 2VYRE 1ZMYA 5ID1A 1IGTA 5CIPH 5L7XL 5B3JE 2ICWI 3ETBF 5IG7A 3C9NA 3F8UB 3L3DA 5DD5H 8CGTA 5C2BH 2Q20A 4QRPA 3VGGA 3WN5A 3O6FC 5DEGA 5IB4B 5L0QC 5T3ZH 4HIHB 2VDPL 2NY5C 2YBRA 3NCEB 3D85D 1MHEA 4HUUA 3SDXE 4LRNL 1CIUA 3PL6A 5HHNA 1U8NA 3QSKB 4NCC1 5EOQH 3G9VA 4YBHA 2B4CC 4PRNA 4XBPB 3O3EA 3C5ZC 4OQTL 5E2TH 1HXYA 1T4KA 3MJ8A 1I85C 4ONGH 3V52H 3SE9H 3N9GL 5BS0D 2BSRB 1XF4B 3JUYA 3O6MH 4X7FC 3L1OL 3WFCH 3QA3B 4HK0A 1JPST 4LNRA 1PQZA 4UTAL 3ZT5A 2HAZA 4HMEA 1CDBA 1D6VL 4X6EB 3QEGH 4V1DA 5D7KD 5DQJB 5C0CD 3OHXA 4YHPB 4PJ8C 2B0SH 2CJUL 4X4YB 5IV2A 3I6LD 3N85H 1U3YA 1YECH 4X7CC 2P5EA 4B53A 4MMZC 1UZ6F 1AFVL 4GMSH 3FQNA 1HKLL 1QYGH 4WUUB 3SKNA 2EH7H 5D2LB 1J0IA 4DVRL 2XPGB 1YNKH 2NZ9D 3RY6C 4FXKB 1H3WM 4D0CB 3H0TA 4U1MA 4W70A 3W2DL 3MUJA 3LIZL 3QIUD 1J12A 5KVEH 1J8KA 3SKMA 3I02B 4PYHA 2GTZB 1L9MA 1U8OB 3X12A 3OKKA 2G2RB 1R0AH 1HYSD 5FDYA 4Y4FC 2B1HH 4P3DB 4F7TA 1MI5E 4AIZA 1D5MA 5I75C 2CPCA 2ZG2A 1HI6A 2HFFB 5JDSA 4QRSB 3N1QC 5I18L 3F12B 3EOTH 4HHAB 1JF6A 1HHJB 3PWPD 4XPHH 2ZUWA 3LN4B 3QUXD 5HHOD 4HKBA 4G6MH 3OKYA 1WV7T 5EN2A 3VWKD 1FJ1A 5CGYD 3DHMA 1R3HA 1CDIA 1T1YA 4Q7DA 1MJ7L 2VQTA 3IDIB 5IBLC 4BQ6A 2ADGB 2XKNA 5E2JA 3VFUB 3HC3H 1U91B 6CGTA 2APBA 4K7PL 3A6BL 1OPGH 1DE4B 1ED3A 1QRKA 4PJFE 2OSLA 4QHLA 1EPFA 2IALA 3GSQB 3RWJA 1BAFL 5C09B 2YD8A 5DRZB 5IQ9B 2X44D 2DMKA 4ORGA 3BAEL 3C60B 3R8QA 1FNSL 1FSKC 3MREA 4M62H 4I5BB 4LPCA 4WEBH 4CVUA 4EZMA 2NNAB 4G6AD 4MXQD 1WUNT 5JIKA 5DMKA 1LMKA 1CICA 5IIEB 1FLTX 4RMUA 5LXGH 2X70A 2XWTB 4U31A 3DIFA 4GAGL 1MY7A 1S7VB 5GHWL 1T20B 1EBAA 2Z91A 4JFFB 1KB5H 1U8PA 3O11A 3GJEB 2B20A 4S1RH 2HWZL 1J8HB 1MCPL 5KTEL 4O2EB 1BZ7A 4OI8A 3LKOB 1AD0B 3NBNA 1ZEAL 2DDQL 5E2VH 5IHLB 4GW1A 2XZAL 4HEPG 1T2QL 2DTMH 4GW4B 3NA9L 5HGDB 5FXCH 3VG0L 4KJQD 3ARBA 5MP6L 4X80L 2Z31B 2BVOA 4D94A 1WBZB 2A0LC 1U95B 1UWXK 1F02I 2XKUA 1N6VA 5C3TA 3BT2L 4WUUD 5HHVH 2YRZA 3B2UC 4NBYB 3DVNB 4BH7A 2IF7A 1KPVB 2EYTB 1D6EB 4PGBB 4RSVA 4OIIH 5FO9A 3MV9E 4PREA 2QSTA 2VZ1A 3KWWA 5DC9B 5FK9A 3VFMA 4C57C 5C0NC 2VSDA 4EDWL 1JUFB 4HF5L 3KLAA 4XPBH 5JO5A 3TT3L 3U7WH 1JN6A 4I9WE 5E94A 2YSSA 3G6JF 1DBBL 4X4XB 4OGAD 5FYJD 1DZBA 1PVHA 1YYLH 1AR2A 1G9ML 5I30L 3SHSA 5DI8A 3EDFA 5E99H 4KK9C 1NSNL 3HG1B 2BNRE 1N3NB 3HI5L 4CMHB 1PW3A 2RHEA 1HSBB 1DQDH 1G9NH 2JE8A 3DGCR 3PWJB 3KJ4B 4UV7H 5E6IB 3UTTE 5JR1H 2GFBB 3QUYB 4OTXL 4POZC 1YY9C 1JHKH 4GSDH 1S9XA 3DXAE 1RIUH 1RZKL 4Q6IA 1P4LA 4NKQB 3C08L 3UEZA 2OJZL 4A6YL 2BNQE 4GS7C 4K3EL 1KENL 1MAMH 3QUML 2D7PA 3HB3D 2HTLD 1GGYA 1MHCA 3L5JA 4ZXBB 3CFKA 4YC2C 3CXDL 3ARXA 3UJTL 4RGOL 1H15B 5DJ8A 4Q58C 1NFDA 3HMWL 4KH2A 3SOBL 3VGAC 5C0IA 4YLQT 4JPIA 4M6OL 4OD2B 2BX5A 5C09D 4UT7H 1GGIL 4UB0H 4O5LL 1CGYA 1NFDF 1I1AC 3MACL 4PPTA 3C60D 1E4JA 1AGFB 4LSSH 5DSCA 3QQ4B 4W6XB 4L4VE 5F44A 1TZIA 1J0ZA 3X14A 1C5BH 3OJDB 1E4XH 3IJYB 1EEYA 3QHFH 1LP9B 1MNUL 4ZUWA 5BV7B 1NEUA 5GS0H 2FECL 2D7MA 1EDQA 2BY0A 1K6QL 4NRXB 5TQ0H 1A6PA 1SEBB 3OZ9H 2R39A 4JN2B 1HDMA 4PY8J 4LU5H 5MI0C 5CKGA 1GJIA 3X3FH 3TN0A 2FJFB 2EE3A 2BRQA 4JFFD 5I1GL 4G43A 3FN0L 4HG4K 4KAQH 4N1EA 1QSVA 4EN3A 1LE5B 1J8HD 2VDKH 5E2TL 2CIIA 1UXSB 3S34H 2OMNA 3MLTB 1OTSC 1LO0L 4IOFC 5DD0L 2FD6L 3WFCL 3RL1B 2ED7A 3BYTA 3NFNA 1RK1A 2PR4H 4LKCB 3TH4T 1J11A 4YXKH 2Z31D 3VWJA 4QF1A 3D3VE 3LH2L 2FHFA 4EDXB 4G8IB 3H9HB 3JWDC 3H42L 1IAIM 5E9DB 5DFTA 4DOHE 1NAMA 2C1OA 4OV5A 2XI9A 1FO0B 3FB5A 4ACPA 5JW3H 4PJIE 2DM7A 4JDTH 1W72H 3OGCB 2E7LC 4HX1B 4JRYA 2ARJA 4U7KA 1YNKL 3B5TA 3QDME 4L8DB 5IHBA 3MROA 5D6DA 1WCQA 2CLZB 3WJLA 3EYOA 1IAKA 1RIVL 3T04D 2H26A 5GPRA 3TIDB 3I50L 3BKJH 1OGAE 4YHIB 1AE6H 2PCPB 4HIJB 3LS5L 4CN1A 3HG1D 3EJZD 1R0AL 4F58L 4XNQA 4NQEA 3O9WB 3BUTA 2AV1B 1KNOB 5E6ID 3C5ZA 3QUYD 5A1AA 4DUVA 1KPRB 1IGML 1I3UA 1MFBL 3UJJH 3MYJB 3U79A 4F80A 3MXVH 4WWID 3GMOB 1T2XA 3QI9D 2P42B 4UINL 5CD5D 3SGEH 1AJ7H 4ZFZB 4ZPVB 1FVCA 3L9RB 2OJEA 5DVOA 3KAAA 1MCJA 4G6ML 4YHYC 2FSEA 4ZXBD 1S7QA 3HZVB 3S96B 3F58L 4K7FA 5SWQA 1Y6MR 4IEFB 4FG6D 3EFDH 5D2NC 4CADB 3PDGA 2D7OA 5AZ2H 5IB5B 1R3LB 4OIAA 2X7LA 4P3CL 4WWKC 4W68A 1P84K 4PJGA 4AEFA 4BFIA 3RVUD 6FABL 4NBZB 2Y06H 2Y6SC 2NY0B 1OPGL 1S3KL 4KRPB 3RY6A 2C3XA 4F9LA 1S5HB 2ZCHL 3FOMB 2DBLL 3BPNB 4B50A 5EO9B 2VITA 3TBVB 5E5UB 1X5XA 4WFHD 2IH1A 2V2TA 3WE6B 5GS2D 5CSGA 4PJCA 1ZGLB 3L5IA 5T3XD 5JW5A 2XZQL 4LEOB 4ZS6D 1IAMA 3ZKNC 2DQUH 4YHKH 4ELMA 4URTB 1BGXH 4RAUB 4F57H 2GK0B 5E5MA 2AXGB 1MFNA 3ULUH 3FN9A 2GSIB 4JN1L 2OBGA 5DJZB 1Y18A 1FZJB 4OJFL 1EAJA 1IZKA 4OZGE 4KFZC 2WUBH 4K2UL 1U93B 2MHAA 5KSVA 5IM7A 1ZVYA 2AJSL 3FT2B 3F7YA 3IJHB 5F1IB 5E2VL 3KJ6H 2AQ3A 3CH1B 2WBJC 4X4ZA 5E9DD 4X4ME 2OXHA 5EA0H 2VTFA 3IFNH 4Y4KA 1ZLUK 3BE1H 5C08A 4PRPE 4B0MM 2A1WL 4P48A 4ZQKA 4X7TB 3VFVB 1ORSA 4Z8FH 1OOAA 5I73B 1C8PA 4LVNC 4MB3A 4NO0A 2NY1B 4NQXB 1EHNA 1NMBL 5JHDA 3BDXA 2GW5A 1HHIB 3WEXA 3E3QE 2NZIA 3VFNB 2UWEB 5C0JA 1IQDA 3MRRA 3QNYA 5DTFB 1I4FB 3LS4L 2NXZC 4MA8L 1PZUB 4ODBD 4JM2C 3U7WL 3O9WD 1S9YA 5JW4N 4WO4C 2EE9A 5HHME 1CS6A 4MD4A 5EC2A 1G7LB 1YYLL 2DOCA 3FL7A 3U83A 5J7CC 3QJFA 5E99L 1IC1A 3SPVA 1WT5C 4QEGA 5CS7A 4ZUTA 3D0VB 1I7ZB 1ZKAA 1G9NL 3PNWB 4O02H 4UQ2A 1U2HA 2KL6A 2VKXA 1UG9A 1KCVL 4GXUM 3G5ZB 4KTEH 4Y16A 5TDOB 1NCBH 1RIUL 4F7MA 3DUUA 4Y19A 1HXMB 3RVVD 4YAQB 4RMQA 2HFEA 1F3RB 1I9JL 2FR4A 4I18C 1HKFA 1UXWA 4M9PA 1OCWL 4NCDA 5CZXD 2GQHA 3IF1A 5FUCC 1C7SA 2D9CA 4WEUD 3ZLQC 4ZAKB 2AEPL 2NY0D 3KPSB 4MXVE 5CIPB 1XZ0B 4KRPD 4ZYKB 3OKEA 5DA4A 4XB7A 2L7UA 4RRPG 4BSWA 4LF3B 3O2DL 3TFKC 3TBTB 3WIIH 3BWAB 3VW3L 1WEJL 3WS3A 1EMTH 2BRRH 2NTFB 5GGTL 2P7TA 4R90H 1I9IL 4JY4A 3FQXB 5JOEA 5IMKA 4I3SL 1F4AA 2OLDA 5GS0L 2DQGH 5I8EA 2F74A 3WJJA 4KZDH 5FO8A 3OZ9L 1WQVT 4AEIH 1CI5A 4IRZL 4HUMB 5F9WB 5KOMC 3RBGA 1A7QL 4XB8A 3NZHH 2VZSA 1Q9OB 1H0DA 1J86A 4GG6A 3KG5A 4WU7B 1AGDA 3QIWB 2CDEA 2GIYA 4R9HA 3CJJA 4GG6F 1QLFA 3ZHDA 5MEOA 1NKOA 3VXOA 2GT9B 3D2UB 3PHSA 1F90L 2PR4L 5HDBE 5IVXE 4DW2H 4OIBA 1U2CA 2ITCA 4P2OA 5MHSE 4EQ2A 4QCIA 4NN5C 3WHE0 3ZZ1A 1LO5A 3TPUA 5DDHA 1A14L 2Z4QA 2X42A 5DUPL 2NTSP 3VG9B 2NY1D 3IU4L 1M7DA 2NY4C 3H9SA 4HIIB 3LN5A 1I1AA 5DJ6A 3JTTA 4JPWH 1QFHA 4YFLI 4OZ4A 1DFBL 1YEHH 2ERJC 3FRUB 3LPFA 4X6DB 4H1LA 1TVHA 1MRDH 3UAJC 1O7SA 3GJFH 1FFQA 2IPUG 4YDLB 4GKNA 3UTQA 3CDCA 3OXSA 5I1DA 1E6OH 5L9DH 1T0MB 2J8UF 1R3KB 3W11C 1KCSL 4M5YL 4L9LC 4V2CB 4NQDE 1E4WL 5FAAA 2EIDA 3U0PB 5DVLA 3OWEA 1P7QB 2D7NA 4OLYH 2JF1A 1AJ7L 1TZHB 1DL7L 3S5LB 4TSBL 4A2MA 3V6BR 2O5ZH 1CG9A 1WTGT 1UT9A 2GJJA 5HDQL 4DN3H 1YMHB 3WLWD 3MRKA 1WIPA 2V5TA 1D9KC 4ZAKD 1UVQA 3KPSD 3SDXB 2E7BA 5D70H 2R8SL 3GMQA 5L2JA 8FABB 2X1XR 3MR9B 1FZOA 4NT6A 4U1KB 3W5NA 3UMTA 4Z7WF 2Z92A 3UX9B 2NW2B 1BIHA 4LQFH 1TJIH 4X5WB 2ORBH 5F7NC 1H3XA 3IDNB 2QQKL 1RUKH 1T7VA 4JHWH 3JXAA 3HLAB 3CSPA 1E28A 1P5VA 2DLEA 1LDSA 4FQJH 5DMJB 1JF5A 1CFQB 1M71B 5CEYB 5T33L 3E6HA 4IJ3B 2R29H 3QEQA 2DJUA 2BSTA 3ARFB 5I74B 4XBGA 1MCFA 2FBOJ 3QIWD 1RSFA 2NZ9C 2ZOLB 4OZHE 1G7PA 1WICA 2DQIH 5F3HA 1MVUB 5I19H 3HUJA 3B8YA 3D2UD 4RX4D 5J57B 3O6KL 3Q0HA 1ND0A 1S9VB 2JIXB 5JDJA 1HYSC 1UH3A 4KUZL 5BVJB 1TQBC 3S8WA 3B9DA 3HNSL 3RVWC 3PHQA 3WXWL 2E9IA 5EU6A 4KHTH 4LFHG 3G6AA 1KLFA 2HJFA 4MDJA 5EA0L 1CGXA 1MI5B 3BE1L 4IRJC 5DK2B 1A6ZA 1T6VN 1KTLB 1RI8A 3PDOB 2DI9A 1NBVL 3UDWA 4JREC 5J9PB 2FNBA 4JHZA 4WHCA 3VWKC 5GISH 3ZL4H 2HP4A 4KK6C 1CFSA 4JY6A 3C2AL 1FZMB 4MB4A 3TZVC 4E5XA 1RZJH 5EZIL 2ZJSH 4UAOC 1J88A 4ZUSB 4P5TA 4U1IB 2VERN 4OLWH 1T1XB 1FPTL 4IMLB 4RZCB 4GG8A 4PRAA 3U0WH 2RFXB 3GSWB 5F7EH 3F62A 2OL3H 5DJ0B 2DBJA 2BJML 4GAYA 1P7QD 3EJYD 1MAJA 2VAAB 2MNUA 4QO1A 3RDTC 3PGCA 2YRLA 4IOSD 2YRPA 3U7YL 4PJFB 4Y5XA 5EBMA 3ET9F 1ZLSL 3EKCA 4MXQC 4WI9A 4KY1L 2V2WA 2OTWA 5IESH 1ZTXH 4KTEL 4RCAA 2IJ0C 3PQYA 3BZ4A 4BZ2H 2E27L 1NCBL 4OZIE 3A6CL 4M6AA 5FA3A 4JANA 1JRHH 1Q72H 3K2UL 4BSVA 5DJAB 4UNTA 3NIGF 1DP0A 4Q2ZB 3D39A 4L8SB 4JEGB 4R96B 4OI7A 3IS1X 4YR6B 4XRCA 2PTTB 3QO0B 4MNGE 4MB5A 1Z6JT 3W9DA 4KK5C 2UUDH 4TVPE 4MHHG 4MZ3A 2GCYA 3RBSA 3GGWA 1KJ2A 1LD9B 1AR1C 5IMLB 2PF6A 5J06A 2VZUA 3WNKA 4KJQC 4KVNH 5JXEC 3MUZ1 4KKBD 5IW6B 4RFEA 5B39A 4QGTA 3ARFD 3O45B 2XXCB 1HOCB 3ARGC 2N56A 4HWNA 1G7IA 3LN9A 1NCDH 1AQKH 4JM2F 5D9SA 3TEUA 4HG4J 4PRBA 4XP5L 4I48A 1X4ZA 3ILQD 2CSPA 2IFFL 1YEDA 1UC6A 2K9UA 4QRQA 3PP4H 4QRPE 2VN7A 5BO1H 4PGEA 3QEUB 3TNNA 4ZPTB 4M5ZH 1BZ9B 2ZUQB 4NUGL 2C5DC 4LCCA 2OR9H 3OX8B 2JIXD 1Q9WA 5FYJL 2D3VA 1FGNH 2JB6B 3NGBC 3MV9B 4PLKD 2XTLA 4Z76B 3SJVB 3DX7A 1NFIA 5KAQF 3IAPA 3MPCA 4H8WL 5KVDH 1BF8A 4Z7QE 2VH5L 3P0VH 4HIEA 2R56H 1NCAH 3ALPA 5D5MB 1MI5D 4JVWA 1I1FA 3P2TA 3V7AE 4DW2L 1EUTA 5DMYA 2EH8H 3ULSB 4LASH 5TQ2L 1DQLH 1WVZA 5GS1A 3CK0L 3AU1A 3GIVA 4JCLA 4ORZC 3EFFB 4DCQA 4V1DE 1QO3A 4UU9B 5B8CA 5I1CH 4QRRA 2ARJQ 4BQ8A 2HVJA 3L5WA 3LKPA 1UWEL 3RX5A 5FOBB 3UYRL 4EI5B 2A74B 4YHNA 2A6KA 3L7EB 3GSNB 3KPOB 5EC1B 3VFWA 1UA6L 2P5EE 3DXAB 3QPQC 5D7SL 3VD5A 5B22A 4OGXL 2NLJA 3K4ZA 3ZT6A 2BNQB 1MQKL 4LPTA 3U0TA 4R7DA 1T03H 5IB1A 1U3HA 1BF2A 3L3GA 2ZUSA 4NPYB 1K5NB 1JNNH 4PY8I 1PZ5A 2D7TH 4K9EC 3KPRB 5TPWH 4XCEB 1A6WL 1QSZA 4HBQA 3FCTA 3EO9H 3GFUA 5JLZA 2VL5A 1YEIL 4Y1AA 1G6RL 3E6FA 2W0KA 3MGTA 5AYUH 2B8OT 5L8JB 4F2MA 1WZMA 5D7LA 4JVPA 5KSUB 3IB4A 3UP1A 3I9GL 1UM5H 1DEEB 1T3FA 1FVDB 4K7PY 3T08A 3GI8L 5E8DL 4TVPH 5HGAB 4RWYL 3MRPA 1P84J 1Z0NA 2NXYB 4ZNEE 3MRIB 3GO1H 4HQQL 4JB9L 4TTDD 4YE4H 4JDZB 4P57A 2G60H 4EUPH 4ZDHA 1KLGA 1JJUA 1QLEL 5DD6A 2I9TA 2VIRA 3BGFC 4P4RA 5IF0B 2Z31C 3UPCA 3RVTD 1A2YA 2UYLA 3V0VB 4MNHA 5T1LA 4R0LB 5FKAA 4DQOH 1T83A 5IMMA 3MBXH 4FQJL 4MD5A 2FIKB 1RJYB 3D3VB 4LBEB 3LQAC 2R29L 3K8LA 1CL7I 1BLNA 5HI4C 3JV6B 4DOHB 4L9LA 4QXGL 1LGVA 4XWGH 5I16B 2GYSA 2Z93A 3MV9D 1QBLH 2I07B 3SJVD 2ZSWB 5CEZD 1XIWB 2GJZA 4I9WD 3QDMB 3U36B 1KFAH 2FO4B 35C8L 3EJZC 2F8VA 2WP3T 3CFDB 4K94C 1D9KA 1OGAB 5IEKA 2NW3A 4G7YL 4LGPB 4KHTL 1IKNA 1PLGH 1BQHB 1F58H 2VXQH 3QUYC 4PJHA 2XKSA 1UACL 1DVFC 5KSBF 3NOIA 4KMTL 3HPLB 3T3PF 4EI5D 1II4E 5CD5C 4PJHF 1YDPB 1OQOA 3K8KA 5ICYB 1BVKA 3RU8H 2VE6B 3DX9A 3S35L 4PJEF 3T4YB 3DXAD 3EIFA 3F5WA 1ZWIA 4P46B 1G7HB 2MFNA 2CR3A 2BNQD 5ESQA 1KN2H 2J4WL 1ZXQA 2ZJSL 4FG6C 4WHYG 5J6HB 4MVBD 4I13B 1A22B 1UYWH 1OP5K 3QCVH 4NZJA 1BBDH 4ONFH 4LRIC 4YQXH 5K9OB 3RVUC 3KPRD 4G42A 3OAUL 1U8IB 5BV7L 3G6JE 1BP3B 1MIEH 4NUJB 5K9QG 3GB7A 5CP7B 1XGQA 1I8KA 5FB8A 2X4PA 5J12B 4FABH 4E0RA 5GRUL 4C59B 3SBWA 3TH2T 3D9AH 4ZTPL 1IGCH 1JNHB 1QFUH 2B1AH 1B3JA 1EZVX 5T3XL 4ELKA 2YUZA 5DRXA 1JZ6A 4PY7B 1ZHLA 1JGLL 1XGYL 3VFRB 2JJSA 4OCYL 1I1CA 2E9BA 1JRHL 1Q72L 4FQQB 4PJ9A 4LLVB 2NXYD 1CVRA 1YYML 5ESVB 1LDPL 2HA1A 4XVJL 3UC0H 4AENB 2R0ZH 3X13B 3FO1A 4MXWL 4PJAF 1ZK9A 1OAZL 3OB0K 5H2BA 4BKLA 3ILPB 4UOJA 4J1UA 1OP3H 3WIHA 3PXHA 5HYSA 1OLZA 5IQ7H 1JV5A 4OZGB 1FO0L 2VXVH 5BZDA 2YHGA 3F6LA 4R8WL 4LLDA 3OKLB 1NFDE 3AC0A 2MCPL 4GW5B 5EO0A 3W39B 3OR7B 4LLQA 3D3VD 5GGQH 2DD8L 3EO0A 1CD1B 4JY5H 1RURH 5AAMA 4OF7A 3IGAA 5ID0A 3BEVB 1LEKB 1YJDH 3EYVB 4F9PA 2GY5A 5I0ZA 3BP5B 4NC1E 3ELAT 2J6EH 1EEQA 4NM8H 1RPQA 4YXHL 3RGVC 3RDTA 2DLTA 3AY4C 1LNUA 5GRJL 1AKJA 2YKLL 1XIWD 1A21A 3CDGB 3QRGH 3RWEA 5FDWA 1BFVH 1BVLA 5DHYB 3QDMD 3WKMH 4P59H 2FJHA 32C2B 1WBYA 2J88L 2XFXA 3R0MA 3T65B 2WANA 3PWLB 4Q9RH 1R24A 1OGAD 4JFXA 4GBXA 4U1SA 5KVDL 3WD5H 3U9PH 3WDHA 2ADIA 4AM0A 1T89C 4UV4L 4NWTH 1RHHA 3JV4A 4WV1B 5INCA 1N5YH 3U82B 3ULVH 3QIBA 1F4XL 4JGUA 5HHMB 1T5XB 5L8KB 3VD9A 2DLGA 4LCIH 5L8LB 1F45A 1HE7A 5I71B 2BMKA 1RUAL 5EWIL 1XF5B 2BDNL 2GITB 5AG8A 2GK2A 4MHHI 3DTXB 1QR1A 5I1CL 4P46D 3GJFB 1C12B 3ROLA 2PO6B 1I8MA 5E95B 1J1OH 5D96C 4HCRH 3UTZB 1JHTA 4J2XA 3M17A 4WW1A 3KHOA 5K9KA 4X7DC 1TIUA 5IVNA 15C8L 1HINH 2W65A 2LU4A 3QG6A 4LKXA 3S35X 1PG7H 12E8L 3KDMA 4KRPC 1CZ8H 4JRYE 3BQUC 1CWVA 3GNMH 1CD9B 1LK2A 3FQUB 3RNKA 3HCVA 4AG4L 1FNGA 4JG1L 3IXTA 3MJ9L 4CW1A 4XPFL 2EIZB 3LY6A 5I1JH 1EIBA 5DS8B 5C0EA 1KPUB 3VA2C 5KANG 1YEFH 3MJGX 4LHUB 4NQEE 1T22B 1FL3A 5F7KC 3I3BA 3FMGL 3I2CH 3GK8H 1OWWA 2HYMA 4XMPL 1KF9B 4OD1L 1VESA 1HWHB 1FNAA 3QZWA 5J13C 4X8JB 2X9WA 3BHBA 4PG2C 3CAFA 3KXFB 3MOAH 3OV6A 1QFWL 3GI9L 3X11B 3QAZB 5I8OL 3STLB 4KK8C 3C09C 2CLVA 3MNWB 2OZ4L 1A6AA 1GGCH 5IR1B 1MRCH 4O9HL 3RWDB 4CNIB 3O3AA 4P9MH 5TH2B 1CCZA 3V6ZB 3RX7A 4LSTH 1D5IH 2VLME 3IYLW 2XRAH 4LSVL 3VI4F 1SM3H 3CC5A 4PJGE 2X2YA 3WNLA 3VH8B 4PFEA 4TPRH 3TBYB 5I17A 5IVXB 3H3KA 2NY1C 2ICCA 2AJXL 4QXUH 4RQQB 1HH9A 3SKJL 3MNZA 1FP5A 1NDGB 2EDTA 3SQOL 1YQVH 1UM4L 1NBQA 3BPOB 5EBWB 1DLHB 2VABA 1JL8A 4PJCE 1QBLL 1ZS8A 3G5XA 4FQXB 2YEZA 4NZTH 1NLDH 4RFNB 1KJVB 3PWUA 3MO1A 4RBPH 4ELME 1G0XA 1Q0YL 4BH8B 1JNLH 3FTGA 4IS6A 2X4NA 5HHMD 3MA7A 4XHQA 3KYOB 2FATL 1WCBA 1UENA 3UPRB 4K3DL 1NGWB 3I3DA 2AABH 2Z8SA 3K7UA 3M1BB 4HXBL 1PLGL 5F1NA 4JAMB 1NDMA 1V7NL 1EK3A 1NAMH 1S7TB 2VXQL 3BIBX 3IDUA 4XPTH 1H8OA 1KULA 1TXKA 3NCCB 1HILA 1HHGA 3VMNA 4MSWA 1FV1A 4YUEH 1OARH 4JQVC 2PO6D 3QQNA 1M6OA 4FRWA 3FB6B 2R23A 1UJ3B 1HZHH 3MRBB 3WHXA 3AREA 3ARUA 5DJDB 5C08E 3ZDYF 5ERWB 4R4FL 4NJ9L 2QHLA 1OAKL 5KS9A 1EEUA 1S8DA 3BPLB 1P6FA 5B4MD 3SDDB 1F13A 1EGJL 4OLZH 4OCRL 3PIQB 5JHDE 1N5AA 1J1XH 1IEAA 1A7RL 4HEME 5CCKH 2XQYK 3WO4C 4NN6C 1I9RH 3SY0A 4ONFL 2AJZA 3HE7C 3R0NA 4JFZH 3O81A 2EEAA 3QXVA 2ZKHH 4R4ND 5C71A 2PXYB 5JQ6L 2DWEA 4ERSH 3DLQR 4LHUD 3T0VA 3TV3L 4ZNCD 5EIQA 3S97C 4HULB 1KYOK 2O5XH 1E4KA 1FYTE 2R0WH 3JWOH 1IC5H 1TCRB 2DAVA 5C0FB 4GRLB 1NEZA 2YD9A 1CDUA 2WINB 3CFCH 1SY6A 5DGRA 3QDAA 4KXZI 1MREL 1G7JB 2R0LH 4RIRB 1IGFH 1K4DA 4U6YA 3KXFD 4XVSL 3NN8B 1N59A 3QUZC 4W4OA 3C6LB 4XMKL 5DF0A 3UTPE 4FQ2H 5JUEH 2APWA 1B0WA 4Y19E 1OB1A 4PGCA 4G8GA 3IRPX 5HYIA 2OTUB 5SWSB 5DFWH 1MOEA 3HAEA 1FAKT 4PV9A 2R0KL 3CZJA 4J3VA 1KBGH 5IQ7L 3LMJH 5KVGL 1KLUA 4LQ1A 2VXVL 5IFAH 5MHSD 4PR5A 4NRYA 4N90E 4NNXB 3GSRB 2FX9H 2GEEA 3OKDA 1QFPA 3K46A 3CVHB 2EE2A 5DJXA 4U6HB 1KIQA 4K71B 4YH6A 5K9QI 1YJDL 2A38A 5T5FL 4U6XA 1NC4A 1A7BA 2J6EL 2UY7A 4NM8L 3P77A 4OB5L 1NC2A 3GMLB 4FQXD 3KS0J 4HUVA 4OQTA 4PRIA 4BQ9A 3V4UH 1LP9F 3CFIC 4JO1H 3O41A 4XXCA 3O8XA 1V3JA 3PV6A 3WKML 5BMFL 4QNPF 1FBIL 4P59L 2ZUVA 4QHMB 5KAQG 4HGWB 5DXWA 1ZT1B 1YPZF 3MLZL 1R6VA 1S9WA 3OGOE 1S78C 5HI5D 1EAPA 3KPNA 4PD4J 1VHPA 5CWSA 2ATKA 4GG6E 4S2SB 2BVYA 3U9PL 1VFAB 4NWTL 1BIIB 1ORQB 1A9BA 2Y23A 3ZTNH 2V5MA 4Q0XL 1GC1L 1H5BB 2A73A 5E7FA 2PYEB 4FP8H 3CNKA 1GZQB 2IG2H 4Z77A 3RKDD 1YNLH 3G9AB 3BGMB 3QJHB 1A3LH 1IQWL 1LO4L 5M95B 4WGVB 3SDDD 1OAUH 1I7UA 5LBSH 3DV4A 3E0GA 5I0DA 4NIKB 4P9HL 4OZIB 3MFFA 3H9SE 4XNXH 3ZKQD 3HS0B 2L0DA 3V4VL 4N0YL 3S7GA 5CLTA 3LRSA 5D7IF 4DKEH 4LSPH 4YHML 2Y36L 2PXYD 2CUMA 1IT9H 4X6CF 5KBNC 4JFQA 4U6TA 2OS7A 4HXAL 4Z7NF 3BMWA 2BOCA 1D5XB 4MNGB 4GRLD 2JB5L 5I1JL 5EUOB 4P4KA 3LQZA 3T1FB 4TUOB 2O5YH 4JFOA 4IJ3C 4FQHA 2D0GA 3JSSA 3ARFC 5I74C 4EI6B 1JWMA 4BELD 3IXAA 3TA3C 2YPKA 3C6LD 5K33A 4OBRA 1P9MC 1SMAA 4ZUVA 4JG0L 5IFJA 4EUPB 1JZ5A 1ZVSA 2FWOA 2ZP0T 1JK8B 1IGTB 4QTIL 5SWSD 5IG7B 1GAFH 4Z7VA 5FYLH 3L3DB 4XNZC 4QRPB 1PBYA 5DEGB 3P73A 1FAIH 1NJ9A 1MHEB 4Z7VF 2W60A 4IIQC 5TDNA 4WTZA 4X9HA 4OUOA 3PL6B 1AXSA 5HHNB 5GGUB 3VFSB 1U8NB 1IM9A 1SJHA 4YDVA 3OR6A 4X5XA 3BP7A 4PRNB 3O3EB 1SJEA 1NH6A 1T4KB 3K2MC 3V4PH 1I8IA 3MJ8B 3HFML 3GMRA 3KPMA 4YBQC 5EPMA 2EDBA 2Y07L 5DR5H 1AXTH 2AXHA 5HGHA 1PQZB 5DA0B 4F8TA 4TULH 1KTKE 3QWRD 2H1PH 3DGGA 3NABL 4V1DB 3VRLF 1LEIA 5KANI 1IGYB 2VAJA 2VDQH 1JGUH 4ZO9A 1CFBA 4HDIB 4R26H 5DHVA 5D1QA 3QEQE 1N4XH 4NZTL 5I1LA 1BD2A 1TLKA 4LPYA 4OV6F 4WTWA 1GPOL 2XNAB 3Q6FB 4YDIL 1ZANL 4KTDH 4PG2A 3FQNB 2KZWA 3U6RA 3HUJE 1Q0XL 3SKNB 5CEXB 1KEGH 2PYED 3G04A 4RMWA 3H0TB 4NJAH 5TE4L 3WV0A 2UVFA 2CKNA 4M7JH 3SKMB 4YUEL 2AV7B 3GRWH 4JKPL 4PJXA 5D93B 5E6YA 2D03L 1OARL 4OKDA 2HN7A 5EU6E 3X12B 3OKKB 5I1HL 1DQJB 5J8OA 2VRAA 4OZFG 1Q38A 2EE6A 4DZ8A 4F7TB 4AIZB 1ZHKA 1FFOA 1RJZB 1HI6B 1CLOL 1Q1JH 5JDSB 4AYFA 1UQSB 4PB9H 2DQEH 3GDBA 2YZ8A 5CJXA 4JFDB 4TTDC 1WBXB 3CXHJ 4FA8A 3VXNB 2CMRH 4HKBB 1C16A 3ZHLA 5EN2B 1FJ1B 4JFZL 2UWEF 1R3HB 3EGSA 3QFJE 4JQIH 3RVTC 3BH9A 1NCCL 4P2QB 2FX8H 1ODAA 1T1YB 2BY2A 4XGZB 5EUKA 4PP2A 2W9EH 2CR6A 3MLYH 2JCCA 2O5XL 3JWOL 2XKNB 2AJYL 3Q3GA 1I1YA 5C07A 4DGYL 5DLML 3CCHA 3DVIA 2OP4L 1PG7X 2PUQT 1ACYH 5FHBH 3QHZL 3T8XB 1A6UH 4G6FB 4A6YA 2DF3A 2C4FU 3INUH 2I5YH 2OSLB 4QHLB 4XI5D 3RWJB 3MBEA 4C4KO 4OCSH 1TENA 4HAGA 3PWVA 1IL1B 1Z9MA 1ZVHA 4QRPD 5CEZL 5K93A 5MENE 1J0JA 3AB0B 2A2QT 3D25B 5EU4B 3MREB 3BN9C 1ES0B 3PQYE 2VLKA 2CRYA 3B3IA 3UBXA 4WY7L 4NZRL 1F4WH 1Z9SA 2BXZA 4WTXA 5C0DA 3BZEA 1YN6A 2X70B 4XWOD 4DWHA 5T1KA 3VD4A 1FFPB 2ZPKL 3DIFB 2AK1L 3MRNB 5T1MA 1C1EL 1D7FA 5MEQA 5IFHL 4JHAH 5IFAL 3RY4A 3QH3A 2Z91B 5ENWB 3HR6A 1TETH 1MFAH 5GJTL 1U8PB 3O11B 1QFWM 2XG5A 4TSCL 5DO2D 3RUGA 3LB6D 4V1DD 3LAFA 4JFHD 1BZ7B 5I6XC 1JTOA 3N50A 4MQ7B 2EKSA 4I2XA 2IGFH 1IEBB 4GT7A 3ZKMD 4GW1B 2J7LA 1QLRB 3L5HA 5E2WH 5LWYH 1FDLL 3RNQA 2B7DT 2CDGA 3DWTA 3L3HB 2DQTL 4LPVA 4U1GB 2EDLA 2SEBA 5FUZH 3SO3C 4RDQF 4F7EB 4N8VA 4K23H 2XA8L 3LV3A 4FZ8H 3Q5YA 4DVBA 4BUHA 1GYAA 4PREB 3BSZH 3B2VH 3KWWB 4RFOH 1JGDA 3G6JB 2M1KA 4XNUH 3W9EA 4FXLA 4FP8L 2WZPD 1VDGA 4C4KT 2IG2L 4Q9CA 5FUCE 3UO1H 1XT5A 2X4RA 1U8LB 5LCVL 3WKNA 4NZUH 1JPTH 2HTKC 5TF0A 3F6IA 3MA9L 3JTSA 1A3LL 5DI8B 3IETB 3T0AA 3IVKA 5JHLL 4JLRA 2JKXA 4KJPD 4JFDD 4QRRE 1X5LA 5L2KA 2EC8A 43C9A 2YA2A 1AGBA 2A6DB 2BXYA 5IT2H 3GBLA 1E6JL 2BP3A 4LSUL 5KN5B 1TPXB 3LPWA 4LSPL 3SCMC 5JIHA 4P2QD 1P4LB 2R2EA 4N9OB 2BVQA 3DUHA 5IJVB 3WCYA 5JIIA 3VXPB 4X6DF 2BVPA 4Y4HB 5KSAC 3KR3H 4R0LC 1MIMH 3VGEA 3ULUC 2I9LA 1BOYA 3O4OC 3TJHD 2VDOL 5FYKU 3CFKB 4G6FD 3LSOA 2AERT 4H25A 2X1WL 1NFDB 2LU3A 4JPKH 5C0IB 4JPIB 1IC4H 1HQ4A 2HLFD 1MCRA 3RIAF 3ZSSA 5C92A 1T7WA 2JK5A 4HPOL 4Y1AE 5DSCB 5DQ9A 1U36A 3KYNA 1TZIB 3DYOA 3X14B 1PX3A 3HMXL 5D7LE 4IRSA 1EEYB 4HT1L 3T0XA 3PP3H 3QCTL 4OLUH 4BYHA 2P8LA 5CUSH 4KMQA 1UB5B 25C8H 1HDMB 1KJ2H 3BIKA 5EFIA 4DZBA 4H5SA 3DARA 2LVEA 3TNMA 3CSGA 4G43B 2BSSA 3EYSL 3O3DB 3HC0B 2CLRB 3LKQA 4ZODA 4NOBA 3U4BL 3MLWL 3DUSB 1A5FH 4ALAL 4OGYH 4G8FA 2H9GA 1YEKH 5CSZB 2QQNL 5FF6B 1RK1B 4L29A 5IBTH 3MCKB 1MEXL 4X98A 1BJ1H 3QXUA 5E8EA 3ZTJG 2Y7QB 4L8CA 3GBMH 4QF1B 1AI1L 3GSUA 4R26L 1FG2B 1XF1A 1CE6A 1HWGB 1U8JA 1NAMB 2C1OB 4OT1L 5C70A 5I1KL 3FB5B 3D48R 5J12C 1F4YH 4HUXA 5F71A 3NACH 2ZOKA 4N0CD 1HIML 1OGTB 2YA1A 2ARJB 3Q2CA 1AY1H 3LOWA 4LHJB 5CLWA 4TNWK 3MROB 5D71L 3O6FB 5L0QB 2QJDA 3EYOB 1IAKB 5F9OH 2ITDB 2H26B 4C55A 1JHLL 1RMFL 3VFOA 2DWDB 3BJLA 4G6JL 1P1ZB 3T3PE 2NY7L 4PJHE 4UIKH 2GUOB 1EO5A 1RZ8A 4JZJC 4NQEB 3SO5A 2X4SB 1LO2L 4PJEE 4NDMA 2AK4A 1P5UA 3CVIH 2AJUH 3C5ZB 4WGWB 4P2RA 5FUOH 3FFCA 3IFOA 1FH5H 4UNVA 2Z0BA 1TVBA 1PFCA 1NBZA 2UZIH 2XWJB 3A0OA 3D18B 4GRWH 5IB3A 4RA3A 4XP9H 1VA9A 4U4BA 2F19L 1H3PH 1FVCB 4Y4HD 1QSFA 5DUML 3SE8H 3TLRA 4JRWA 1KYOJ 3SDYH 5DRWA 3WUWA 1S7QB 1X5JA 4J4PA 2GTWA 4K7FB 2DS4A 2KPNA 5SWQB 4YDKL 1AHWA 1OAQL 4MA7H 2X4TB 2X7LB 3SDAA 3H7BB 4YFDB 4X9GA 5F70A 4XVUD 1N6QH 5FKPA 4GRMB 5ICXA 4FMFA 5T1DH 1LHZA 2I5YL 4K3JH 4FFWD 4PRDB 2D9QB 4GLRI 1R3JA 1SYSB 1KUMA 4KVCH 4KPHH 1B2WH 3E3QC 4ZOBA 2VDMH 3TBWB 4LARL 1MRFL 4HJGA 2OK0H 4TRPH 2IH1B 3HI6L 2V2TB 2FJGB 2Q7YA 4QGYA 3LEVH 1E27A 1F4WL 4WV1C 5L88H 2COQA 4PJCB 4Y4FB 1VENA 4HWZA 5D1XA 3AMKA 5JW5B 5DWUH 3NFPB 5I75B 1G7QA 2C4XA 5K9JH 4ELMB 3VU2A 5I71C 5GGTA 5E5MB 4J3SA 4LEXL 1P7KA 1H3VA 4LLMA 3SKOA 3V5KA 4M7LL 4H20L 1RVFL 1Y18B 1MUJB 1WSST 2XWBA 3A67H 3NH7H 2PETA 2PO6C 1D5BA 4NM4H 1WZ1L 2XN9A 3IDGA 4FQIH 5IM7B 2VXUH 3HNTH 4F37K 3F7YB 1WIUA 4NKOA 4NWUL 3T77A 4JE4B 1JF1A 1MCWW 4XMLL 1CXLA 1LEGA 5C08B 2DKSA 1JTTA 4ZQKB 4ZOAA 3T2OA 5C0BA 1ORSB 2A6JA 1UWGH 1EHLL 4NO0B 1X7QB 5JHDB 3LEYL 3O6FD 4R4NC 3GUTA 2VDRL 2EDOA 5TJWK 4HC1L 3OQ3B 3B9KC 3OPZH 1I8LC 3MRRB 4KMLB 2X89A 1LILA 3QWOA 2HFGL 2R2BB 2IFGA 4NQED 1S9YB 3EDKA 4PB0L 1FYTB 3C5ZD 3BPCA 3MRQB 3F7PC 4MD4B 5EC2B 1A9EB 4J8RA 2NCMA 1T6WA 3HZKA 3QJFB 3FQRA 1G84A 3QAZC 1A1NA 1CFVL 1CFNA 1MPAL 4EKXA 1U41A 3WMSA 3SPVB 3GJFK 5FCSH 4WUKL 3T0DA 4UILL 5EULV 4JO4L 4ZUTB 1WC7B 2VDLL 3DV6B 1PYWB 1BM3H 1U0QA 5FECA 2ZCKL 5IT2L 1UCBH 4UQ2B 3MODL 3UZQA 3PHOA 1EEZA 5DQDL 2BOBB 4QY8A 4F7MB 3DUUB 4TQEH 3DI2B 4Y19B 3QRFM 3SE3A 3WL9A 3L3OA 2FR4B 2HFEB 3RTQC 5DT1H 2NR6D 1UXWB 5DHXB 4KHXL 3O2WH 4FQ1L 2VLMD 3D85A 2PW2A 2YXMA 2V17H 3KPPA 1ADQL 4O51B 4J3UA 3K81A 3BPOC 3OKEB 1VSCA 4DN4H 5EU3A 2BFVL 3ZE1E 4CVXB 3Q6GH 4RFNC 1N7MH 4LLWB 4XP4H 5CILL 4ODTL 4APQA 1QPPA 2AEIT 4Y4FD 3WIHH 1B0GA 1W0WA 4Y5VA 5GGRB 2NX5A 4IDJL 5CUSL 4RNRB 3M8OL 3PF2A 5I8EB 2YWYA 5KW9L 3U1SH 3GSXA 4R7NA 1YEEL 2R1WA 2NY2C 4WFGE 3QISA 2VR9A 3EBAA 1REIA 5EOTB 4GG6B 1RZJC 4XC1H 4RAHA 5E4EC 1AGDB 2LE9A 2NY3C 1CL7H 1JMZA 1UJ3C 2CDEB 3DMMC 4OLVL 2R4SH 2FX7L 1QLFB 3RKDC 2PTUA 3FRPG 5MEOB 1ERNA 5DVKA 3OAYH 3VXOB 1DQTA 2Q8AL 2YD7A 5IBLD 9CGTA 4ZS7H 4GS7B 4GFTB 4PUBL 5C08D 3VXQB 4KGJA 4YC2B 1RU9L 1LO5B 5E8OA 3ULUF 5ESAB 2Z4QB 4NO0D 3VGAB 4D2NA 4ZMAT 4MS8C 4QT5B 4M8VA 3TT1L 5JHDD 1M7DB 2ID5A 2PXYC 1I1AB 3HE6C 1TTUA 1A7NL 3DRTA 1DEDA 3ZE2E 4LCUA 5C6TH 3EOAB 4YXLH 5EG6C 3R06B 4PJIF 4BSJA 3PWPA 1H3UA 1AY1L 4H1LB 4MAUL 2NYYD 1FYTD 3IJSA 3O0RL 3T1WA 2J8UB 2YK1H 1D5ZB 5MI0B 3X3GL 4K8RL 4GKNB 5D1ZA 1RQ5A 4TNWF 4AL8L 2G5RA 4DGIH 3C6LC 3UTQB 7FABL 3GIZL 4X0KA 2OXGA 1RD6A 5F96H 4Q74A 1N64H 1XCTA 1QVOA 4WHTA 1S7UB 2Q86A 3ZDYE 5H35A 3EDEA 5F9JA 4D8PB 4G3YL 4HBCL 3Q5TA 4Y19D 4WW2C 2CIKA 5D72H 3TYGL 2OYPA 3WFDL 1N8ZB 4NKIH 1Z9OA 4UUJA 2XQYG 1TTFA 3IDXH 1T1ZB 4P99A 2A0LD 3CVHL 4GAJH 1U6AH 1QBMH 2IMMA 5LAXB 3MRKB 1MFCL 3A6OA 5EB9A 1UVQB 2DQHL 2X1OA 3P4MA 5JOFB 3B2UD 3UCRA 4IDLA 4P23C 3TBSB 4Z7WB 5L2JB 4K71C 1XR8A 4N90D 3DYMA 4N8CH 3UPAA 5IMOB 1FZOB 2VO5A 4NT6B 3EYQC 5C0ND 3RFZC 2BSRA 1XF4A 2Z92B 1QRNA 2WWKT 5CSBA 1A7OL 4K3JL 3SGJC 3DSFL 4FZEH 4X6EA 4OFPA 5DQJA 2XY1A 1NMAL 3ZT7A 3I84A 1WISA 5FM5O 5HXMA 4HMCA 3V5DB 3O2VH 4TRPL 4Z9KB 1JGVL 4Z18A 1MCOL 4PBVC 3QEQB 2Y72A 2V7HB 2JELH 2BSTB 3O4LA 1X3DA 1VFOA 5K9JL 4G8GE 1P4BH 2CGRL 1TZGL 1DLFL 4WUUA 4Z7UA 3MXWH 1JWSB 1TITA 2XPGA 5F3HB 4HH9A 1OSPH 2FH6A 1RIHL 4GMTL 3HUJB 4D0CA 4X9FA 3MRFB 5BXFA 4FFZL 4KKCC 1LWRA 1UB6A 2FRGP 2GTZA 4DKAA 4YHYB 1JMXA 4GXVL 4Y0GA 3GHBL 4MJ4A 2RCSH 1B9ZA 1NGZA 3PHQB 3TO4C 3WXVL 3MCG1 3G6AB 4P3DA 3B6SA 1INEL 5DURB 4WCYH 4F37F 2MCG1 4RDQG 4AT6A 2HFFA 4G6KH 1I1AD 4QRSA 5CAYB 3F12A 1A6ZB 1RUMH 5I8CB 2MSPA 4HHAA 3ME0A 1JWUB 4PRIE 5EOCH 1HHJA 5TE7L 3FT4B 3KPTA 2F58H 1H8SA 2C3VA 2P49B 3WFEH 2GSGB 4EBQH 5CJ8A 4NSKB 4E5XB 4PJ5A 3QFJB 3IDIA 4PRAB 5E00A 1XCQA 3GHEL 2QTEA 5FM4A 4NGHL 1X5FA 2QSCL 5EBLB 1OTSD 3HZYB 4XI5C 1DE4A 4S1SH 4IOFD 1DSFL 5IVZB 1CYGA 5I1AA 2F5AH 4EXPX 3WN5C 3PGCB 5B21A 3HC4H 3IKKA 2DQCH 5IQ9A 5KZCB 1DQQB 1INDL 1BM3L 3C60A 2V2WB 3FFDA 3PL6C 4I5BA 5JXAL 4DGVL 5MENB 4P3WA 3PQYB 4HK3N 1ONQB 1U8HB 2WBJB 4JHBA 4JANB 5FA3B 3F65A 5LG1A 2Q3ZA 3P0YH 4BSVB 3BKCL 2XWTA 5BZWB 2F8OA 4XAKE 4JFEA 3O2WL 1JZ7A 4KDVA 4X7SH 5BRZB 2PNDA 1G6RA 4M4PA 5DO2C 4Z5RA 4F7PB 4JFFA 4XRCB 4RGNC 5CINL 5CGMA 3GJEA 4YWGH 3K80A 3W9DB 1VEMA 4MXVF 4QWWD 4YHZL 4G7VL 3MLVL 2GCYB 1AD0A 2YR3A 3WBDA 2CUIA 3FO0H 1RFDL 5GJSH 3HAEH 4XPAH 1WZLA 5ACZB 3QEQD 3S5LG 5B39B 1FIEA 2X40A 5HGDA 4XC3L 4WO4B 4MX7A 3PABB 1U95A 5D9SB 5L7XH 4PRBB 4C54A 4ZO6A 4Z7VE 1YEDB 4KKLD 1KPVA 1F3DJ 2VDPH 3MMEB 4BZYA 2R2CA 3TNNB 4PGBA 4ODUB 4LRNH 1MFEL 4LCCB 4XC1L 3IFLL 3MLRL 3T2QA 2A77L 5GRVL 5F21B 2RJMA 1BMGA 1NFIB 2CK0L 5IW3A 4NO3B 1XF2A 1BVZA 4NQTA 4FHBD 1F11B 4XZUB 1Z2KA 3BP4A 3RTQA 3N9GH 5DURD 4X8XA 5ILTL 2YD1A 1I1FB 3L1OH 4KJPC 2H3NB 3LVEA 2V9QA 2G5BA 4HFUL 4UTAH 1K8IB 2R69L 3TCLA 4RMVA 5HDBF 2Y6SD 3NPSC 4MJIE 4LPXA 3CDFA 4U1LA 4DCQB 1KV3A 3VMPA 1QO3B 5B8CB 4FTVB 4QRRB 4KRMB 2GFBA 2HVJB 3L5WB 3LKPB 4S0TD 1XGPA 3QI9A 1BD2E 2R4RL 5C6TL 3VFWB 1ZT7B 3VXUB 4D0DA 2MQ0A 3QFJD 2NLJB 1AFVH 3ZKND 2YUWA 2AI0H 4RMSA 1DCLA 5EZJB 4ZXBA 3HA0A 2YK1L 5F1KC 3U0TB 4R7DB 4BK4A 4YEEA 2I24N 4N0RA 1H15A 3KNBB 3QB7C 5HVWA 5DJYA 3W2DH 3LIZH 5A2JH 4JJ5B 4Z7OE 3L3GB 4OD2A 1DBML 1PZ5B 5KZCD 4DAGL 3QYCA 4LSQL 1LE9A 3G5VA 4BQBA 3CUPB 2A9NL 3L95A 4PG9B 1CICC 3FOLB 5MEND 5JLZB 2VL5B 1IM3B 3PQYD 5J3HC 4ETYA 3E6FB 3U4AA 2EDJA 2WBJD 3BVNA 4F2MB 3ARDC 1CK0L 5I18H 1U8KA 1T3FB 1RZIB 3BD4A 5BRZD 3NTCH 2DIJA 4YK4C 1ZHNA 1G7MA 1QBML 2QSVA 4NN5B 3V79C 4RWHA 5KJRH 1KXTB 2B39A 3MRPB 4KXZH 3AM8C 2X4QA 1MY5A 2NY4B 1A8JH 4P57B 3MLTA 4ZDHB 1MJ7H 2KQMA 2I9TB 2QBWA 5KG9B 2VIRB 2NXZD 2ERJB 2JCCE 3RL1A 3ARBC 5C07E 1JIBA 5HYFA 4K7PH 3ULVC 5HDOA 1XH3A 2UYLB 4WO4D 3A6BH 4HKXA 1R5IA 4KQ4L 4I3RL 1DUYB 4ZFGL 2DIBA 4MMXC 4FQCL 1OP3K 1BAFH 4EDXA 4G8IA 4UT9L 5DEZA 3H9HA 3NZ8A 1FNSH 4OF6A 1FO0A 3DNKA 2JELL 4L9LB 1JPGA 1YMMA 2VLKE 5IOPA 3DETC 1DBJL 4P2YA 2AQ1A 1J1PL 2E7HA 3NAAL 1AP2B 3U4EA 1CLYL 2VLRE 4OZHF 4GAGH 3OJVC 3J7HA 3W82A 5GHWH 4WW2F 3TIDA 3BN3B 4YHIA 5DD3L 2PCPA 5DHVH 1FN4B 2JJVA 3R1GL 4HIJA 1D9KB 2HWZH 3CMOL 5T3ZE 1MCPH 4IMKA 5TFSL 3RUGE 5KTEH 3O9WA 1KNOA 2ZCLL 4PJHB 1A3RL 1TPXC 3V6FB 4FTVD 4QRRD 4OFIA 2DDQH 4ZO7A 5DC0A 4Q6IC 4X5LA 1KPRA 4PJEB 4I2XE 4DKFL 1YN7A 2DQFA 3MRGB 3TFKD 2XZAH 1PSKL 2VZVA 2NPLX 3NA9H 1BVKB 3EDJA 2ZZUT 5DYOA 3VXUD 5MERA 3VG0H 1ZT4B 4D9LL 5MP6H 3AVEA 4X80H 5D8JH 4Z0XB 1EFXA 3L5XL 3P9LB 2FYYA 2P8PA 4L1DA 4EOWL 1PEWA 5J56B 4Y2DC 2H32H 4L3AA 3QG7L 3HZVA 2WBKA 3S96A 3WLBB 4FN0A 4TUJB 3ESVF 3DJ9A 2HRPH 1KEML 1OQXA 4FS0A 5F6HJ 5IB5A 4EDWH 4HF5H 1AC0A 1U8QB 4G42B 3TT3H 1I7TB 2RBLA 4AIXA 1IC7L 1DBBH 1KJMB 4S1SL 1XGQB 1I8KB 3WSQH 2X4PB 5FB8B 4LSRL 1G9MH 2VLLA 4I0CC 2WUCH 4BUGA 4QHKJ 1NSNH 5EO9A 3TN0C 4XNMA 4E41A 4ELKB 2YS4A 5DRXB 1TQBB 3HI5H 3TBVA 5BVPL 1IAOB 1ZHLB 3MJ9A 3MLSL 3TVMA 4EN3C 5L2KE 4OTXH 4PJ9B 4UOW1 1NFKA 2CQVA 2HH0L 2HRLA 4LEOA 4G5ZL 4IOIA 4PJAB 1QNZL 2NY4D 1VFUA 4S1QL 4IRJB 2GK0A 2J5LC 3C08H 4X99B 2AXGA 3FO1B 1SHMA 1CIDA 4XHJD 4JREB 3PUCA 5DJZA 3HHRB 4K3EH 1KENH 4HV8B 4BKLB 3QUMH 4J1UB 3VWJC 3CXDH 4OKVA 2QKIB 5J1SC 3UAJD 3UJTH 1JV5B 5C9JA 1CN4A 3TZVB 3HMWH 3SOBH 5FYKH 4LLDB 3FT2A 5F1IA 4M6OH 4UAOB 4O4YL 3CH1A 5EO0B 1GGIH 5BOPA 3TWCL 2W0PA 4LLQB 1JZ3A 5GJSL 2OZ4A 1RZ7L 1UGNA 3W11D 3IGAB 1CFTB 1ZLWH 4X6FA 4LOUC 5J0BA 4X7TA 3QXTA 4HWEH 1MNUH 5IWLC 4S11A 2NY5L 5E8NA 1ZV5A 4K55A 3RDTB 1K6QH 2HKHH 5D6DC 4EEEA 1LNUB 3WJLC 1AKJB 3V8OA 1FQ9C 3RWEB 1HHIA 3KGRA 4L3CA 4AEHL 3VFNA 2B4CL 2FEDD 1WBYB 5I1GH 5FM5M 3FN0H 4M00A 5F6IC 5E08L 1D9KD 3HR5A 1A64A 3C8DA 1KACB 1NUFA 4G9DA 1TJHH 2ADIB 4AM0B 3RA7L 3EYUH 5INCB 1LO0H 1GVIA 1HEZB 2MWCA 3AS2A 2WBWB 5DD0H 3QIBB 4Z7QF 2FD6H 2VOTA 1P4IL 4RBPK 1EH9A 2BC4B 2BMKB 3CH8A 3AFLA 1QR1B 1WK0A 2XTJE 3LH2H 4HWUA 1QQDA 1CGSH 4U49A 3ROLB 1AGEA 2X10A 3H42H 5TDOA 1AGCB 2J12B 2NR6C 4LAQL 4YAQA 4WW1B 1QA9A 4XX1E 3ARGB 1FCGA 2AI0L 3RRQA 2BHUA 4OLEA 2M2DA 1L7TL 2Z8VC 3KDMB 4ZAKA 3KPSA 1BQHG 3FO9A 4F9LC 1LK2B 4U7MA 3RNKB 3HCVB 3CFEA 1FNGB 1RIVH 3IXTB 1YY8A 3I50H 1J0KA 3OXRB 3B9VA 4LF3A 4NKDA 1MFDL 3LS5H 5C0EB 3TBTA 3NGBB 4F58H 2R1XB 3OBAA 3VRJB 3RVWD 4M3KB 2CKBB 3BWAA 2FGWH 3BRFA 5L6YL 2AK4E 1NMCB 3FQXA 3TF7C 4PJ9D 1IGMH 1MFBH 4XPGH 5ADOL 4P2RE 2D31A 4R97B 2XT1B 3FFCE 4XP6L 4IRJD 3NTCL 3QZWB 4UINH 2DTSA 4DEPC 4YPGA 1XGTB 2VQ1A 5KJRL 2EC9T 5A3IC 1S7XA 1QSFE 4JKMA 3STZB 4ZSOA 3HTLX 4KK6D 1RUQL 4BM7A 3QIWA 3F58H 3TZVD 5C7XL 1A4JB 1RK0B 1DQML 1WWBX 1DBAL 4Y4KC 4P3CH 3KPQA 2VMFA 4UBDC 4RX4A 1S5IL 1XF3A 1F3JA 1N6UA 2GHWB 1NCNA 5EIIB 6FABH 2E9WA 1S3KH 3S3SA 3TJEL 5I17B 1HQRA 2ZCHH 3RDTD 3L3JB 2F53B 2DBLH 2ICWA 3MNZB 3T3MF 1Z9LA 2CRZA 1JYWA 5CD3A 4GXUN 3PWNA 4NNYB 3RI5K 2XZQH 1ZS8B 3G5XB 3DVGB 2NQCA 2YEZB 3MZGB 2NYYC 3PWUB 3ARDA 4ODWA 4F15B 1U3ZA 2DYPA 2J6EA 4JN1H 5TF1L 3QWQB 3QIBD 3V6OA 2VR4A 4OQ1A 4IS6B 2X4NB 1FL5A 4OJFH 3MA7B 3OF6A 1WCBB 1VADB 1KIRA 1BJMA 4K2UH 3AM8A 1NLBL 2X09A 2K7PA 5DMIH 4GQ9L 4KK5D 5DVMA 4XT1C 1INQB 1S7WA 2XN9E 1J7VR 4Y16C 2AJSH 4MSWB 4PJDA 3T4AA 1A1OA 1VGEL 5ITBL 1RULL 4NRZA 1OAYH 1M6OB 2GKIA 5IROA 1AR1D 2E6PA 3U7AA 1BZQK 2H2SD 3BGFB 4PJDF 1AO7A 3WHXB 2AKRB 3I75B 5JXED 1UM6L 2A1WH 5D8JL 2IH3A 3I85A 1MWAL 1NAKL 3ARGD 5C0BE 1U9KA 1V5JA 3BDBA 1V3MA 4H88L 3P11H 1PKOA 3QBTB 5GZOC 2E6JA 3ULVF 4N5ED 1NMBH 5DFVD 2J3SA 2F54A 4JZNB 1HHHB 2HRPL 1U8MA 1IEAB 8FABA 3SY0B 1OP9A 2EYRA 4HCRA 3EUUA 2AJZB 3CU1A 1NANI 3LS4H 4MA8H 5DK3A 2DWEB 4N0UA 1WFNA 4XCFL 3WSQL 1OF2B 4HS8L 5H94A 3JV0A 3IDNA 2HT3C 1NGQL 3WJJC 1U42A 2WUCL 3D1MC 4U3CA 1Q9LB 2ZSVB 1NEZB 3ZO0A 5FV1L 4KUCD 1P69B 2UVEA 5JPMB 1H3TA 2E7MA 2EXWC 1M71A 5DJ2B 4U6YB 1C7TA 5I15L 3FONB 1T04A 5HVHC 5IEHB 1N59B 4WFGD 2VXTL 1KCVH 1DVFB 4HGKC 4Z95L 3S98A 2P4AB 2H8PB 1I9JH 4G8GB 3ORJA 3LDBB 3VJ6A 3IAGC 1OCWH 1MVUA 3QPQD 4YFEA 4CRPA 1N0XL 3DRQB 4P2OC 3L6FB 4L4TA 4S0SD 1S9VA 5AYQA 4DJMA 2AEPH 4F7CA 4Y2DA 4LGRB 4YHLL 5FCUL 4LHUG 5FYKL 4O2FA 4PR5B 2C3HA 5AD0B 2F53D 3O2DH 1FVEA 5DJXB 1MI5A 3T0EC 1WWAX 5DK2A 1KIQB 3VW3H 1WEJH 5GGTH 1I9IH 4U6XB 1NC4B 4HWEL 5J9PA 4I3SH 3P77B 2X5PA 1NC2B 3TPKA 4K7PX 2DKMA 4HUVB 2HKHL 4PRIB 2NX5E 1YPZB 1X5IA 4IRZH 3O41B 3O8XB 3PV6B 4ZUUA 4OSUL 4PS4L 5EO1A 5SV4A 1A7QH 4C58B 3I6LE 2N4IA 3MOQA 3I6KB 3QULB 4QKXB 4U1IA 3RJDA 4J7RA 1EAPB 1T1XA 4RZCA 4XAWL 1WAAA 3WDIA 1TJHL 2P44B 3EYUL 3VH8G 4XH2B 4H0IA 1A9BB 4L3EB 1W0YT 4MNQA 1DBKH 1JYXA 4QTHA 1K3ZA 3LKSB 1F90H 3QQ9C 5EZOL 3ULUE 4OM1L 3JWDL 1MCQA 1BQSA 1A14H 1CGSL 3OMZA 5DUPH 4OCNC 3WIFA 1FLRL 5I1EL 1J5OL 3IU4H 3MV8E 5H37G 4ONOA 3DV4B 3RWFB 5D7IB 1QFOA 1FRGH 5HI4D 4HWBL 1DFBH 1URLA 5DJAA 1T66C 4X6CB 4Q2ZA 4L8SA 2ZNWA 3EZ8A 2A6IB 5IWLA 4MD0A 1BFOA 4YR6A 3PWPE 3S3JA 1ROWA 1W0VB 4OCWL 4QWWC 4JFQB 3RGVB 4ZOCA 1A1MA 4LHQB 1EO7A 3GSOA 2BOCB 4RMTA 1CE1L 1MF2L 2P46B 2BK8A 3S37L 1NKRA 1S7RA 4JFOB 1FNHA 2LAAA 1QTYT 4Z78A 4WI2A 5ADPL 2FGWL 1KCSH 5HVGB 4M5YH 2VB5A 3CDYA 1JWMB 3WFBH 1E4WH 4XPGL 1DVFD 4GKOA 1KCUL 5HYQB 1AD9A 5IFJB 4GOSA 1QEWA 2IQ9L 2J8OA 4KKLC 3VXMA 5CKAA 5H8DA 4G8GD 1ZVSB 2HLAB 1RJLA 3TYFA 1DL7H 4TSBH 3P30L 5HJ3A 2YPVL 4Z7VB 5HDQH 5DD1H 2HJLB 4NNPL 4DK6A 2JB6A 4GLRH 1NJ9B 2W60B 5D96B 1RUPL 4Z76A 2R8SH 3SJVA 1PX4A 3GMMB 1IM9B 1SJHB 3BZDA 4YDVB 3OR6B 1WJ3A 4OZFH 4GQPH 2EKJA 4X5XB 2MQCA 5I66A 5D5MA 1SJEB 3UDWC 1I8IB 2C3GA 1QRNE 3ULSA 1NC4D 3BQUB 4PJGF 2QQKH 1NC2D 3DX6A 5HHXL 3S88L 5HGHB 1C08B 2BCKA 4PRID 4UU9A 4MJIB 3O8XD 4FQLL 4EI5A 4P5TC 5GGSB 2A74A 5T33H 5IJKA 3KPOA 5EC1A 5I1LB 3O4LE 4PJCF 1NUNB 4JRXB 4I1NB 4KJYA 1F4HA 3RI5F 4XCYB 4BA8A 2OQJB 4ZO8A 4L3ED 4JVUA 4WUUE 4Z7UE 5J13B 4P5MA 4ELMF 4JGMA 1CDHA 2H6PB 2R9HD 4Y5XC 3O6KH 3HI1B 4PBXA 2WAHA 2FL5B 1K5NA 1HSAA 1I3VA 2V7NA 2VZTA 4PLOB 3ROOA 5JTWA 4KUZH 5DMIL 3KPRA 3HNSH 1BFTA 3C09B 3WXWH 1T7YA 4BZ1L 1M05A 2L7JA 2HN7B 2NY6C 1OAYL 3H6JA 5SWZB 1T1WA 1M4KA 5KSUA 1FVDA 3DHJA 1NBVH 3FB7B 4QRUA 2E6QA 4CN4A 1TNNA 4XAKD 5HGAA 1KXQE 3P11L 1U58A 3RGVD 4OAWA 5F89B 3C2AH 4B7IA 2CXGA 4NZDA 5DZOA 5EZIH 2R15A 4RAVA 4XP1L 3BP6A 4PJ5E 1C16B 4M6ML 1FPTH 3RWGB 2VXSL 3BH9B 3QXDA 4HJ0D 5EUKB 5I76B 4PP2B 3CX5K 2JCCB 3NCYP 4FMKA 2BJMH 3Q3GB 1I1YB 2P43B 3QPXL 5E4IA 5GRYA 5C07B 1KT2B 3CCHB 1Z5LA 3NCJL 5FEBA 1NBYB 2IPTL 3U7YH 4A6YB 2FIKA 3KS0H 2IQAA 3MLUH 4OCXH 1ZLSH 3D3VA 4G9FE 4ETQA 4KY1H 3ZDXE 3G08B 4LCCC 5CHNA 3MBEB 5EZLA 3JV6A 3PWVB 2E27H 2RB8A 3MX0A 3A6CH 3DROA 4ZFFA 3U2SA 4XCCL 3K2UH 2VLKB 3B3IB 2RR3A 3UBXB 3GKWL 2ZUUA 1IM9D 1XIWA 4JFEE 3OAZK 3P9MB 5ACMA 2VLRB 1WFUA 1FG9C 4HS3B 5CZVH 1YN6B 3BZEB 5T1KB 3NA4A 2A83B 3U36A 1QOKA 2FO4A 2AJ3A 3MRJA 3HMXA 5GS1C 1KG0B 5MEQB 3BQUD 5C8JB 5JW4R 3QH3B 5B8CC 3BW9A 1F8TL 1BQHA 3MGAA 3DVFA 5C0AB 3QFDB 4MJID 3WO4B 1IJ9A 4NN6B 3RUGB 3LKNA 2PYFB 3JVGC 4EUPG 3HPLA 2VLJA 3HE7B 3RQ3A 3W0WB 4HKZA 2D0FA 2VE6A 5F6HI 3VI3E 2F8XC 3T4YA 1FIGL 4AQ1B 3G6DL 1CR9L 4R2GB 2EZ0C 4LVEA 3RNQB 4XP5H 3REVB 4P46A 4JRXD 1CXEA 3ZKXB 5ISZB 2IFFH 1C5CL 4OUUB 4OI9A 4PJ7A 1LO3L 1U3HC 3MRMA 4JDVA 4LCYA 4QHKI 4N8VB 1A0QL 4NUGH 1WLHA 4PJ7F 4NC0B 5FYJH 3QUZB 2OTPA 1U8IA 4KK8D 4OF5A 4M7KL 4NUJA 1ITCA 5DZNA 3RAJL 3V7AG 4H8WH 1JGDB 3GBNL 1DBKL 3W9EB 2VH5H 5SWZD 5C6WH 1LK3L 2YD3A 4Q6YA 4M3JA 1ZA3A 1JZ2A 4HD9A 4U1JB 1JNHA 1XFPA 1DR9A 1S7SA 4KZEL 2X4RB 4NQCB 3RL2A 4WRLA 5TQ2H 4GKSA 3CK0H 2K1MA 5T5NF 4KRNA 1XMWA 3O6LL 3LHPL 5ALCL 1VGKA 5IK3B 3VFRA 5E8PA 5HGGS 3LZFL 4JZOA 1UWEH 2A9ML 3UYRH 3GRWA 1FRGL 1AGBB 5C1MB 3T0EA 4XHJC 4WI5A 4TTGA 1UA6H 4U33A 4P5KA 5D7SH 4OGXH 1KCRL 2R2EB 2EIBA 1MQKH 1YEGL 5C07D 2J8HA 5ETUA 1T83C 4OZGA 3BDYL 2I9LB 3Q5OA 3BXNA 3OKLA 3ZTJH 1IGIH 4LMQI 1AH1A 3OR7A 3LSOB 4H25B 4NHUA 4U7SA 4XTRC 2ZWLT 1MCLA 3WFBL 5IP4A 3V9FA 1A6WH 1HQ4B 2WW8A 3MBED 4Y8AA 1CU4H 1MLBB 4FNLL 1IBGL 1LEKA 1YEIH 3BP5A 1G6RH 2JK5B 3QDGA 5DQ9B 2VLKD 2AVGA 4LDLB 4J3TA 5AZEH 3I9GH 2E8YA 4QHUA 5D6CA 4IRSB 3K1KC 1KELL 2UY6A 1CT8A 3GI8H 3NFSL 5E8DH 1FNEA 1JVKA 2FEDC 3ZYJA 1RZGB 2VLRD 4OBSA 3Q1SL 4M8QB 2P8LB 5DD1L 4RWYH 1GCFA 5T1KD 4WFHE 2W9DL 3UZVB 3NMEA 3REWA 3BRDA 1QKZH 3PWLA 1IKNC 3BIKB 2HT2D 3TNMB 4HQQH 4R3SA 4JB9H 1QHPA 2BVUA 2BSSB 5C0AD 3GMNA 5T3ZD 2XZCL 3LKQB 1QLEH 1UEYA 2FGZA 3HE7D 1T5XA 1NQBA 2C3WA 2I26N 3W0WD 4MJ6A 5KVFL 4M48L 1XF5A 4R2GD 2GITA 1K9TA 4OD3H 1KIPA 4L29B 2EDYA 1OP5H 5ISZD 1C12A 4X98B 4JKLA 1L7IL 5E8EB 2B2XH 4L8CB 2XTJB 1CTOA 1KB5B 4RGMC 1MHHB 1MJUL 1NGYA 1MJ8H 2WLZA 3GSUB 3MOBL 5AUMB 2IBZX 3HN3A 4XVTL 4QXGH 4X7EC 4M02A 2VUYA 4MCZB 3TA3B 3QUZD 3THML 1YMME 3SDCA 5A2FA 5M94B 1Y6NR 2ZOKB 3SBWC 3MCLL 4NBXB 1J9CT 3VXSA 1P7HL 35C8H 3ZSTA 1ZAGA 4TSAL 3HUJF 4UDUB 4HZLB 4XNZB 4NQCD 3PXJA 4G7YH 4BK5A 5DRNA 2VC2L 3O3UN 3VFOB 2JJSC 4IIQB 3BD3A 2P5WE 4PJ9C 5E1AA 1UACH 4NHCH 5CGTA 1XR9A 1RZ8B 4KMTH 3RWHB 5DZLA 5IHZA 2AS5M 3GSVA 1TMCB 1YEJL 4HC1A 4UDTB 4YHOL 1G0YR 5ALBL 3ZKSD 1K8DA