4L3CB

Structure of hla-a2 in complex with d76n b2m mutant and ny-eso1 double mutant
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKNEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Class I Major Histocompatibility Complex, the Trojan Horse for Secretion of Amyloidogenic beta 2-Microglobulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 14
structure length 100
sequence length 100
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X, Z, b
ec nomenclature
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l3cB00
1SEBA 2CDFB 4PB9L 5A16B 2FLBT 2F8XC 3QUKA 4PJFF 1OAXL 3OKNA 1H8NA 4O2EA 1QFUH 4FA8A 4RX4A 5DQJB 1H15A 5FM8A 1BX2A 4LCCC 1BD2A 5SV3A 3DI2B 2YD1A 3S5LA 2OJEA 3UCRA 5C0EA 5D6DC 2UYLA 2F58H 2P49B 3QDMD 4OZGE 3FZUD 4QGYA 4IS6B 2PUQT 1U8PB 2BVOB 4LPYA 2VO5A 3ET9F 2DIAA 1RIVH 5F7EL 3L95B 4J4PC 1YQVL 4LDEB 4YDKL 5DMGC 3BKJL 5FO7B 4XWOD 4R96A 3K46A 1F11B 1Y18B 4R3SA 35C8L 2C3HA 1AQKH 3OF6D 1VCAA 5KAQG 1PKOA 1ZGLP 4NQCE 3FOLA 1CF8H 4N9OB 3T0EC 1F4WH 2D9QB 3MNWA 1TNMA 4GS7B 4PY8I 5HI4D 3MOAL 3P30H 2Z31A 5AWNH 3RWCB 4EN3A 2C4XA 1YEIL 5EU5B 1P84J 1RUPH 2VDMH 4HF5L 5EU6A 1VKXA 5DJYB 1IT9H 5FEBA 3FB7A 3FB8B 5ERWA 2DS4A 1ONQA 1TQBB 4R8WL 3ZTJH 1Y0LB 3U30B 1R3LA 4F9PC 3KPPA 1I4FB 1N59A 1VFBB 5F93C 3TVMD 5HHOA 2XA8H 4PLNC 5KBNC 1KIUA 4P48A 1A4KB 3ZYOA 5BRZE 1YNTB 4HWEL 5LJYH 1ZSDA 4JRXE 3KYMA 3NFNA 3LCYA 4EVNA 4IMLA 4GQ9L 4FQLH 3SDDC 4QRQA 3B5TA 1D6EA 4QXUL 1PJ9A 1VSCA 3LN5B 1ZKAA 4YEFA 4KZDH 2DQJH 3ARPA 2VL4A 1MCWM 1AGFB 3LRGA 2Y36L 2VABA 3SE8L 2UWEF 2HT4C 4U7SA 2FL5A 4AL8H 2MWCA 1JPSL 4BFGA 4ALAH 3H9SB 5C71A 2WM0A 4I2XB 4PJEE 2D03L 3VGGA 5D5MB 1GGYA 3TN0B 4WTWA 3VWKD 2V2TA 1SJHB 3GJFB 3MODL 4WJ5A 3BDXA 4YQXH 4X5WA 1AD0A 4AENA 3QFJB 5FXCH 4KK8C 4YNYA 3UTTB 4OF6A 4Y2DD 3MOAH 2H32H 3UPRB 5F1SA 1T22A 4YDVA 2R56H 1CF8L 2XWBA 1DVFC 5DA0B 2BOCA 4QWWC 1UM5L 3EOBA 1TJHL 3BZEA 1KJ3L 5GJTL 5TDPA 2CIIB 2VXTH 4UINL 4F7EA 2VB5A 4Z7VB 2V9QA 2R0LL 5DK2A 4X9IA 4L8CA 2HJLB 3ZE1F 1AP2A 4OZFH 2ICWA 5D1XD 4Q9BA 1OF2A 3DXAD 1T20A 1JP5A 3HC0B 4P5TD 5C8JB 3EDJA 3MJ6A 1UKQA 2GTZA 4XAKD 4LRIC 3ETBF 4EIGB 3VFRA 1GGUA 2YUZA 5GGVY 3I50L 3FOMB 5DT1L 3IDGA 1UKSA 5CHNB 3WFZA 2C5DC 4OCNC 4WFHD 4HEPG 3RX8A 1I9IL 5BXFA 1DL7H 1KLGA 3OWEA 3ZKXB 2CLZB 1MRDH 2ZPKH 3VFUA 3M8OH 3BWAA 3ES6A 2YN5A 5DHYA 1KIPA 3PWLB 1TJIH 3GMLA 4G6JL 3U4EB 5K9JH 1XF3B 1CGSH 4K07A 1IAOA 1SBSL 3K80A 3EO1B 3KYKH 4U1GB 4LHUD 1C1EH 1WICA 2VSCA 2HH0H 5K9OA 1MCPH 1AGCB 2Y06L 1WIUA 2ERJC 4N68A 3VI4F 1Z2KA 2B5IB 2YK1L 4JGMA 2C1OA 1GGCH 4NYLB 3EKCA 1VHPA 4G7VH 1UH3A 5E6ID 5IB2B 2FR4B 3HAEB 5LAXA 2FIKA 4FXLA 5I66A 2DTMH 4PIRF 3BVNA 4GOSA 2NW3B 3ARRA 5ID0A 2C3VA 1M7IA 2P8MB 4M03A 4OCWH 1NCWH 2XQBL 3RJDA 3NH7H 5E1AA 1J7VR 1DEDA 4OUUB 3MGTB 4UV4H 3V5KB 3RBGA 2BNQE 4HJ0D 4L3EA 1CICA 1OSPH 1P9MA 4LSTL 1U8KB 4UV7H 3ZT5A 3HI1B 2O5XL 2VNCA 1KN4L 1CL7H 4K7FB 2YMXH 3B3IA 3I85A 4HKZB 4GBXD 4WFFD 4BZ2H 5C0AB 2H45A 1KB5L 3W2DL 1J8HD 4NKIL 1BEYH 1F2XK 2CMRL 4X4ZA 4PTUB 3S35L 3H3PH 3L6FB 2WQRA 1MJ8L 3EO0A 2DJ4A 4LPTA 1HYSC 1AGEB 2NY3B 2UWEE 4NZUH 5F9AC 3VXUA 1LK3H 2CKBB 5DS8A 5E8PA 1C12A 2F74B 1SEQH 3TZVD 5FYLH 1ETZB 1YECH 2UVEA 3D1MC 5DHVH 1JIBA 4YWGL 1R24B 4O58L 1K3IA 2EXYC 4HPOL 5D7JD 4ELMB 1UXWB 1T5XA 4EUPH 4U0RC 3KR3L 1NANH 3DVGB 4OM0L 4MNGE 1JGEB 1G6VK 4DAGH 4MQXC 3V52H 2DLIA 1R3JB 2GTWB 4I0CC 1CXFA 1FJ1A 3WS3A 3N06B 4OD3H 1GIGH 1LEKB 1YEFH 1QFOA 3EYSL 2MMXA 1LO2H 5GS0C 4Y4FD 4QWWD 5EIIB 4XCCL 2J7LA 4BA8A 2VR9A 3PWJA 5FYLE 4CUCA 3QWOB 1M71A 2F54B 1MHCA 1NBYB 5GSRB 2VDQH 4L4TA 1KJ2B 4TSBL 2DQDH 2DI9A 4XX1G 4B5EA 4ZAKD 2NTFA 2K9UA 4KTEL 4R90H 3ILPB 5CEXA 4X7SH 4RDQF 3QO0A 3U9UA 5EBWB 5ICYB 2VLME 3FO9A 4OZGF 2P8PB 1W8NA 2GJ6D 4IIQC 3C5JB 2D7PA 4X6BB 4NQXB 4CAGA 5IP4A 4F7MA 2ZUTA 2B1HH 5DSCB 4OLVL 3SY0A 4DCQA 1C5BH 3MOBL 5EOQL 1ZTXL 4ZUWA 1FVCA 4ETQB 4FQHB 4YHIA 3VFTB 1A6AB 5EWIH 3TO4B 1JRHH 4IOIA 4X6DF 4D3CL 5HJ3A 3GUTA 2F53E 1A1OA 5CP7A 3B8SA 5KVGH 4EUPB 3BJLA 1JZ6A 3BYYA 3L3JA 3VXTB 5I1CL 2HFFA 3S8WA 3NACH 4MD4A 1OOAA 2FEDC 2NXZC 4XBPB 3U9PH 3O2VH 5I6XB 1HSBB 2WK2A 4WUKH 1NFDE 2HG5B 3NMEA 4PGJA 3QUZD 4H26A 3W39A 1FNEA 1F90L 3TT1L 3VRIA 4ERSH 3CIQA 2VXQH 4LLWB 4NHCH 2PKDA 3FO0H 1IZKA 2WBKA 2EE2A 1MJJB 3WKML 1RUAH 3VXRB 3HNSH 2CRZA 2K7QA 2Q1EA 1NCCL 3SDDD 1NGXB 4U49A 5FUZH 1XGUB 3IB4A 4EXPX 5I76B 4LVOC 2DF3A 2X4TA 2K3TA 4M61B 3DVIA 3VFMB 3MCKB 1JPGB 5I0ZA 4PJ9D 2VQTA 5JR1H 4XNMB 4AEEA 4FXGA 3VE0B 1P4LA 5EC1B 2GKIA 1PKQB 3MUGB 1X9QA 5JQ6L 2GEEA 3TVMB 2LU4A 4YHOH 5IBUB 4WEUD 3K7UA 2IMMA 2HWZH 3DOSA 4J7RA 4OIAA 5IBTL 3VFNA 3OV6A 4PY7A 8CGTA 4TOYH 4X98B 5ESAB 3ZDZF 5ABDE 4QLRA 1JWSA 3MRJB 5JDJA 4BJLA 4LSRH 1FBIH 1S9XB 3GSOB 1A7PH 1OAQH 3PWPE 4JFED 4XCNA 1F4YH 2ZCLL 2Z91A 2Z35A 4Y5XB 2PW2A 3MBXL 3O9WD 1WAAE 4RWYH 2OL3L 1L7TH 4FZEL 1OVZA 3PWUB 4F7PB 1KJVB 4QXGL 3VFSB 4MDIB 3QG7H 1SYSB 3M07A 5F7NC 5HDLA 1REIA 3REVB 5HD8C 3NAAH 1KPUB 1KELH 1YEKH 5F9JA 1NEZA 5DZOA 3K81A 1P6AB 3K2UL 4IJ3B 5DRXB 3DO7A 1HYSD 4KMTH 1CE6B 3ARGC 3W9DB 3QNYA 3EYQC 4X6FB 5FGBA 1II4E 4FFYH 4WY7H 5IQ7L 1E4WL 4EBQH 5BW7C 2J8UF 2CKNA 4P2OA 3TPUA 1SM3L 3K4AA 3MZGB 3MYJB 2F5BH 1TMCB 3DX7B 4UT6L 5KSBB 4OIIL 4MXVF 4YR6B 3QQ3A 3TC9A 4M5ZH 4Y1AE 2MCPH 4JRYE 5T3ZE 1U2CA 4NRXB 3GI8H 3BDYH 5K59F 2FSEB 3E3QE 3O8XB 5IIEA 5EBLB 2CGRH 5ALCL 3WIHA 4MB3A 3O3AA 3PP3K 2GAZB 4U1KB 4GJTB 4YPJA 2D7OA 1OAKH 1FVEB 1Q9LB 1EGJA 4NWUL 4PGZA 3N1GC 2CDFA 4PV8B 3H7LA 4ZOEA 2N56A 4CBPA 1FYTE 4JFFE 1OGAA 5IBLC 2YC1B 4RNRB 2D4DA 1BOGB 4ZFOA 1DVFA 1BX2B 4WW2B 1JF1A 1F97A 3VG0L 2WMPA 4Z77B 4MNGA 3VFVB 2P5WD 1MAJA 3LQAC 2DBJA 5KTEH 4LHUB 3U48A 3QH3B 5HHPA 2DD8L 4EI5A 2X70A 5IWLA 4M62H 1JNJA 5D2LE 1PQZA 2GW5A 4ORZC 1T1WA 1WTLA 3O6FD 2APWA 4OZHB 2NX5B 3B2UD 4KK9D 3PHQA 2FJHB 4GRWE 2A83A 5IVNA 3BXNB 4ONHA 1NBQA 3C2SA 5FGCB 4C83B 5GGSY 5C2BL 4KJWC 3MNWB 4S1DC 1MCOH 2VLJB 4LNVA 2JELL 5DHVB 1MVUA 4NN7C 3T1FB 5IGXL 2XWTA 5EU3A 1KCUH 4U6YA 4D94A 3I6LE 3UX9B 1AFVL 4HIXL 4JM2A 4OFIA 4L8SB 1KIRB 1TTGA 2EYRA 1E28B 1A2YB 1QD0A 1Y0LA 3I6KB 2GI7A 2A9ML 5B38B 4UNTA 5MEPB 1MFNA 2J5LB 3T0BA 1WLHA 5E5MB 3ARBB 3KS0H 3GSUB 2HLAB 3OKEB 1T03H 3BT2H 3LRSB 2FB4H 1EEUA 3FMGL 5DRZA 2D7TL 4L8BA 4EOWH 3DMMD 2BSTB 4FQCH 5IB4A 4C56E 5C08D 3QEQE 4HIIA 4IRJD 1JV5B 4PP1D 2F9BT 2HKHL 4C54A 1F58H 1TQCB 5ANMB 1EK3A 5C0AE 3ZE1E 1BF8A 4K23H 1O7VA 4YHLL 3H9SA 4C4KT 5J57B 4TVPD 2AQ1A 3QUMB 3ZHLA 4CADA 4P5TB 3RPIA 1HHJB 3P11L 4NUGH 4Y16D 4X5WB 2G5BB 5BMFL 5D7SH 3L3GB 3TYGL 3DMMC 4M7ZB 3TBSA 5I73C 4JN1H 2YBRA 5LQBH 5IQ9A 3QIBB 1W8OA 4WW2C 1FN4B 3J8F7 4NZJA 5IMKB 2CIIA 5GSVA 1E27A 1CLYL 3HR5B 4CJ0A 3WFHB 4P2QB 1KJMB 4F7TB 3LMJL 3ULVH 1XCQA 2H6PB 2KQMA 3X11B 5B21A 2ICWB 5FUCE 1MFEH 1J8HA 5BVPL 1T20B 1EBAA 1I9RL 1N6UA 4X6CA 4Q9QH 1RUQL 1WCQA 2UY6A 3W11D 5HPMA 3QXDA 4HUWA 4HS8L 1QVOB 3P0GB 5E4EC 1DQLL 2R0KH 4JQVC 3VDCA 3KLAB 4HUVA 5D2NE 3VFUB 4AY0A 1MCFA 3JWOL 1G0DA 3ZHKA 1M1SA 4N5ED 3KNBB 2Q6WB 3ES6B 4H1LA 5AAMA 5DJ6A 5D7IB 2ZUXA 3LEVH 3CVHA 3RJQB 4ZTPH 2AV1B 4Q2ZB 3PQYE 5HYJB 4PRHA 1XF3A 3PL6A 3G9AB 4XNXL 3CMOL 5F7YC 5TE6L 4PD4J 5F9OH 5L8KB 5LXGH 3FN0H 4E42B 3DRTB 1ZWIB 3MV8A 3GMOA 1I8MB 3WMSA 4IEFB 5B3NA 2EDFA 4GBXB 5MEOB 1U36A 3QDJB 4NNYA 2XOTA 3BMVA 1IAIM 1FLRH 1T7YA 2YHGA 5E4EB 3NPZB 3HAEA 5LAXB 3C2AL 4AEHL 1SJEA 3MLZH 1C16A 3IGAB 1ITBB 3UPCA 5FGRA 3FQTB 1M7IB 1ZLWH 4POYA 1KCVH 3GJFH 2R0WL 2P5EE 2X4OA 5DC9B 2I60H 3MRDB 4OM1L 4WHDA 1F8TL 5E1AB 3GBML 4UTAH 4NQSA 2FEEL 5JUEH 1PG7H 5EOTB 4DFHA 1AJ7L 4JFXB 5CD3B 4OGYL 3RVTC 1H3WM 5ITBL 2BNQD 3EOAA 1GGIH 3ULUF 2ED8A 5DFWH 3UYRL 4DGIH 1VENA 2EC9T 4YBQC 2XXCB 3RVWD 1VDGA 1N2RB 4LIQL 2PETA 1GC1H 4DW2H 4IMKC 3B3IB 4GT7A 4MD5B 5KSUA 1J18A 4KUCD 3G9VA 3MBEC 5GJSH 2ZZUT 1ERNA 3HCVA 4PJ9B 2BSSB 3L9RB 3RDTC 4C56D 5DEZA 1J0HA 1OSZB 3NABH 1NCBL 3MX0A 3WLBB 3SCMD 3SHSA 3QDGA 3V79C 4KROB 4KI5F 4DFIA 5I8KH 1D6VL 3EO0B 3ORJA 1YJDH 2C1PA 3NZ8A 3FQNA 4OZHF 2GJZA 3SDXE 4QTHB 3QHFL 5DS8B 4G9FD 1C12B 5E8PB 2F74A 3EYOA 5L2KB 5T3XL 1VESA 2IQ9H 4MAYA 3QUXB 4G8IA 1ETZA 3QDME 2W60B 4NC2B 1TXKA 1MJ7L 2R1XA 4LVEA 3EYQD 3QJFB 5DD0L 5E95B 2X7LA 4ODTH 5DUMH 4J3XA 3EGSA 1DQQA 4JDVB 1BIHA 4FQJL 1BP3B 4P9HC 5AZ2L 5C07B 1KLFA 4B7IA 1M7DA 4R7NB 1Q1JL 1CT8A 5J4MA 1IC5H 3KLHC 2P44B 3ARBC 4OD2B 3RTQC 2JTDA 4P2CG 4D0DA 1V8HA 1LEKA 2IPKB 5I1IH 4J1UA 3DGGA 1T21A 3EOTH 1Q9KA 2DRUA 5DI8A 2HTLD 1U3HD 2A9NH 1I1RA 1WZ1H 1CFVL 2AK4E 1K2DA 1CFQB 4MD0B 4QHMB 4S1QH 4YAQB 4PJGA 4RBPK 2XZQL 4HGWA 15C8L 3BKCH 4L5FL 4P23D 3ZT6A 1EVTC 4NPYA 4L4TB 1KJ2A 2FD6L 4N8CH 1CGXA 3ARDC 3VD9A 5KAQF 2V5MA 1PKQE 1HDMB 2SEBA 1W2KT 4Z7UE 1XT5A 5INCB 2C9AA 4LIQE 4WHTA 1ZVSA 5EBWA 4WO4B 4GSDL 3UBXG 1EZVY 1FO0A 1I3UA 2IANA 2CK0L 5FOBB 1LGVA 4MA3A 3GSVA 1HHGA 4OLXL 1CE1H 1QLEL 4ZFOL 1KCSL 1HQRA 2F8OA 2I9TB 3AAZB 3N9GL 1F3DJ 1N7MH 4KMQA 1RZJL 1IL1B 1PGRB 1YEHL 2WUBL 3PWNA 1IKNC 2ATKB 1FNHA 5FUOH 3SGKC 3F12A 1HXMA 3VW3L 3AB0C 4FTVA 3H6JA 3OX8B 3L3JB 4JZOB 1AQDB 5DF0A 3UTSA 2NR6C 5J11C 1HSBA 4QNPF 3BIAX 3M1BA 3MXWH 3VJ6A 3U6RA 1TZGH 1CXIA 2CKBL 2W0KA 5I75C 2DQTL 1CLOH 1FNEB 2EEAA 3FZUC 1IGIH 4XTRD 5DJXB 4YK4C 1P4BH 3O3DA 3FAXA 5I71C 1H0DB 1QEWB 2AK4B 2NZ9D 5J6HB 1HEZB 3C60B 5EC2B 2APFA 2VAJA 4FQ1L 3IETA 5CSZA 2ITDA 4LGSB 4WU7A 4GMTH 1WITA 3ECBA 4HPYL 1WAAF 4QGTA 3MCKA 2FX8L 2HFGL 4FXGB 4ORGA 2VLRA 3JUZA 2V2WB 3LIZH 1RK1A 4LSDA 3WL9B 5IJKC 2DQUL 3MRIA 1M05B 4B0MM 2W9EH 5DMKA 3LV3A 3HUJB 4IIQA 1HNGA 5E8NA 2P43B 3VMNA 5HHOD 5FO8A 4HK3J 1TVBA 5T3XE 4S1RH 3STBA 2OL3A 2FCBA 1YNLL 3MROA 3O4LB 1BGXH 1JGUH 4Z7VE 1HHKB 3MRNB 3DMMB 4M7ZC 4PB0H 4JM2F 5KZCB 2BHZA 1VGKB 3BEVA 2DYPA 4EJ1C 5ESAA 1IEBA 2AXGB 1UWXH 1ORSB 3LKPA 4H8WC 5GGRA 5CMAB 5D9SB 4V1DE 5LCVL 1RZGB 4FMFA 2GCYA 1YUHB 3L7EB 3JZ7A 3MA7A 3UYOD 1YC7A 4E0RA 2FJGA 4XWOC 2IFFH 1X6LA 4HBCL 2HMID 4C59B 3GM0A 1IC4H 4HBQA 4GKSB 2BY2A 5HYEA 4WNQA 1I7UA 1KCKA 4O2CA 4OSUH 3LEYH 2W9LA 1NFDF 1H3PH 1I75A 3RVUC 3TIEB 3EYFA 1FFPA 3QUZA 3QIBD 1WFOA 2IF7A 4P2OB 3TPUB 1RVFL 3EHBD 3RFZC 1DJSA 3OXSA 1XZ0A 3DX7A 1RZKC 1UWGL 4JFYB 5JW3H 4LLMA 1VACA 1A7OL 4PJDE 1DZBA 5F7DA 3RVVC 2ZSWB 1MRCL 2EDXA 3GSWB 4PRAA 4NRXA 5D2NC 3FFDB 5BS0B 3TJHD 4AYFA 2KZWA 5IIEB 5C09D 4K8RD 1RVFH 3L5XL 3H42H 4MSWA 1UEYA 1A7NH 4M1DH 5KSBE 2FBJH 3JTSA 4Z7QF 1B90A 4OSUL 1XF2B 1P7QD 3I6LD 4O2FA 1BIIB 3KPMB 1UVQA 4PJXB 4NM4H 2BRRH 1EHLL 3BPLB 4Y5YA 4WV1C 1I85A 3WIHL 3QFJD 2YC1A 4RNRA 1N6QH 2IFFL 1EFXA 4KHXL 4WW2A 1BD2E 3UZEA 5F1IB 1W72L 1A7QL 2PTTB 4Z77A 1BVZA 4MNGB 2ESVA 5ALBL 5BJTA 3PHSA 4R26H 2E9WA 4WUUA 3QDMA 1QRNA 2OM5A 4KRNA 1R5IA 3VWJD 4MXWL 3D2UB 1T1WB 2ZG2A 2ED7A 1AKJD 5FYKH 4PBVC 3K3QA 2AJSH 4PB0L 2NX5A 1JI2A 5HGDA 3CSYA 2Y6SD 4UT7L 3LKNB 3DECA 3RGVD 3BXNA 5IB5A 1T5WA 3CLEH 2EIEA 4P0DA 2EH8L 4PJCE 4B50A 4CRPA 1AO7B 2VLJA 5CFHA 4WO4C 3BPOC 1HQ4A 2VE6A 2N4IA 3V7AG 3S36H 3T1FA 4DKAA 2XWTB 1BBDL 5EU3B 2D9CA 4KKBD 1MI5B 4UQ3B 5L9DH 4YXKL 2X5PA 4U6XA 2FX8H 3HLAB 2ADIB 3I6KA 2AQ2A 4NDMB 4M3JA 4X9FA 5CINL 4HUNB 3DPBA 4MA8L 3DETC 1A9BA 1A6WL 2WWKO 3HS0A 1KTLB 2WBJA 5IHZB 5E7BA 3ARBA 5MENB 3OKEA 3NIFE 2ID5A 3HZKB 1UWEH 4K3EH 4Z95H 1FE8H 1FCGA 1YEJL 3KXFD 5T3ZH 1I1AC 3RNQA 1JYXA 1RI8A 4OCYH 3PGCA 1MQKH 1RJZB 2GY5A 5IHBA 5D8JL 3EFFB 2X4UA 1TENA 1WC7A 3PL6D 2NXZD 4R4FH 3SBWC 4HIIB 5F7MC 4U31A 2DWDB 3BPNB 3TT3L 1VGEL 2L0DA 3IDIB 5ANMA 5DURD 5H35A 1FGNH 3EJYC 3IJYB 2EDOA 2A77L 2ARJA 2WUBH 4V2BA 1PYWA 1CGUA 1DVFD 5JIHA 2HFEA 1BREA 1GZPB 2CJUL 3BZ4A 4BQBA 1WWAX 3MV01 5I1EH 1FC1A 3R8BB 1H15B 3L3IB 5HHME 4HIEA 3INUL 1NEUA 4KK5C 5HVFB 1NSNL 3LY6A 4OD1L 3QPQC 4XBEH 1L9MA 3FCTA 3DLQR 3H8NA 4Z7UB 2ADFL 3QNXA 4KHTH 2YPLA 2X4NA 1GOFA 3DHMA 5ISZE 2VLMD 3BN9D 3R0NA 4GSDH 4JFDD 1X5ZA 4OLWL 1I8LA 3TIDB 5EUOE 1E27B 5FK9B 1DEEA 2IH1A 4OV5A 5CJOL 5C3LD 4QHUB 3V0VB 1KJMA 4ZS7H 3LHPH 5J11B 4FQ2L 5DMYA 3SGKA 3P77A 4AQOA 1HOCA 5DVNA 5EULV 4U6VH 4NQED 1PD6A 5DDHA 3AB0B 5I30H 1UA6H 4OFVA 3MLYH 1RZFH 3JWOC 3CGTA 4TULL 4OZIF 4OI8A 3BH8A 4EN3B 4Y5VA 2MCG1 4LP4A 3CX5J 4OLYL 5MEQA 2A9NL 1FL5B 4KY1H 5GGTL 3O41A 4PJ7E 3IRZA 2XG4A 1WWWX 3LS4L 5I1IL 5JTWA 2NY7H 2PYED 1VFBA 4M48H 2GT9A 5D6CB 4WO4D 4ZAKC 1G0XA 4EXKA 2Z8VC 3KNBA 3REWB 1LDSA 1YNTA 1R0AH 4MX7A 1A0QL 3RRQA 4PJAF 3PDGA 1BQHB 5D70H 3F7QA 1DBAL 4GW1B 3SDAA 3SE9L 3UTQB 1BJ1J 4QRQB 5AYQA 5SWZE 1HI6B 5IEKB 3STLA 4ODTL 3GMOB 1I8MA 3MFFA 4XBGB 2ZG1A 5FA4B 1Q9OB 4NNYB 4ZFGL 5IROC 5DGRA 5HHVH 4YDJA 5GS3A 2VABB 5CKGA 4JE4B 5F7FA 3V5DA 1A6TA 3QHFH 1LO3L 1XIWA 2EICA 1VPOL 4I2XA 4BSWB 4JDTH 4PJCA 1IQWH 4CDGC 4FFVD 1KV3A 2Y07H 3RA7L 4ETYA 5A3IC 5I2IA 5D5MA 4U1SA 3TN0A 1DUYB 3UAJC 1Q72H 3RTQD 4LCWD 1AD0B 3CPLA 5E99H 5SX5K 1KSRA 2AKRA 1AD9B 4GXUM 2YXMA 1LNUA 5GZNC 5DMJB 3CAFA 2AAVA 2FX7H 3V0AC 4WUUE 1OL0A 2V5RA 2BOCB 3OJMB 4RA3A 4HAFA 4M6OL 32C2B 3PP3H 4HJGB 3QQNA 4DGIL 4C58B 2OSLA 2QQNL 5C07E 3HZYA 3L9RA 3MNVB 1CXHA 1U8IA 1FIGH 4LRIA 4NKMA 3OGOE 2B20A 4EKXA 2LU3A 3GBMH 3UMTA 1EHAA 3B9KB 4X6DE 2CUMA 4OM1H 4ZQKA 3SJVA 1U0QA 1LO3H 2YUVA 3ILQC 5J06A 2EC9U 4JFFD 2J6EH 3NGBC 1LMKA 4PGDB 1IAMA 5C86A 1A8JH 3NZ8B 1RIHH 4UIKL 2EYTB 3FOMA 4M93B 3IDGB 5CHNA 4CW1B 3MLSH 4OBSA 5SX4I 3W0WD 2YPKB 4DKFH 5ICXA 3ALPA 2WIIB 3UXFA 4EDXA 5CLWA 5MHSE 3QJFA 1GPOL 3E8UH 4RGMB 5ILTL 3AUVA 3V6OE 5I1AB 5IVZB 3PWLA 3GMLB 2C26A 2F5AH 5EH1A 5SX4H 2ENSA 4U33A 4R7NA 1O5DT 3EO1A 2NY7L 1JMZA 3ZYZA 4QNPE 4X6EB 4ZUVB 4HUXA 1KPVB 4Q58C 1N5YH 3JWOH 3OXRB 5E8DL 1FYTB 2Z4QA 2ICES 2IPKA 3VFGL 4JJ5B 4LQFH 1TLKA 1Q9KB 2Q86B 4TULH 1AHWA 1RZFL 4QOKD 4JRWA 2AV7B 1UACH 5E2UL 1BFOB 2C3VB 4OCSL 4RBPH 3QRFM 4F2MB 2O61B 4HGWB 1S7TA 2JK5A 2Y5EA 4MB4A 5JW4R 4U1LB 5C7XH 4I13B 3MSPA 1U8KA 2EECA 2HVKB 1OCWH 2Q7NA 3MJ9A 4Q6IB 4U1IB 4ZAKA 5FGSA 1OPGH 4ACPA 1ZT4A 4XBEL 3MJ8A 3SO3C 3G6DL 4Z78A 3TNMB 1FO0B 3BPLC 4HKZA 5GGQL 2P48B 1F02I 4N0FB 1OWRM 3CFCH 3MLXL 3FQUB 5I1EL 3NGBB 4ZUTA 4QRUB 3GSVB 5EG6C 4LCCB 1HQRB 4FZ8H 4HFWB 5T33H 5INDA 2I9TA 1B6UA 2WLZA 4TSAH 5L6YL 3IKKA 1IFHH 4UNVA 4Q9RH 1YYML 2G9HA 3MV7D 2NY2C 4OCMC 3LH2H 1UT9A 4RZCB 3WDJA 2X9YA 1F58L 4K94C 3IDJB 3SO5A 2X4RB 3X14A 4P2OC 4P23C 4MDJA 4XPFL 5I18L 2RQ8A 4Z7WB 3QSKB 1H0DA 1QEWA 1A6WH 4GKZA 1NFKA 4XI5D 1GRWA 2R15A 2BY1A 5EO9A 3BT2L 4NQVA 1HEZA 3C60A 5C0RL 4CJ1A 2GTWA 2GITA 2R1WA 2YPLE 3FQXB 4DQOH 3SDDA 5GZOC 5B8CB 3FJTA 3SDXF 1M4KA 5HDBF 5EUKB 2EXYD 3A0OA 5I16A 4JFOB 3VI3E 3ZKND 4KVCL 4S1DD 2VDPL 1AFVH 3B5GA 4N0UB 1KOAA 3SDYL 3HAEG 4DN4H 1MWAB 1RZ8B 2X41A 1Q0YH 3DARA 4HCRL 2F54A 1XAUA 4HKXA 12E8H 2B5IC 5C0JB 3V4UH 4M6MH 2BXYA 1INDH 4WVRA 3G5XA 3RGHA 1LO5B 1A6UL 4ZODA 1GAFH 1GXEA 1HHKA 3MRNA 4N0UE 1VGKA 4P4KC 4DKEH 4JREB 2BOBA 4YPGB 5DQ9A 5F97E 1B88A 3U9UB 4F33A 3BSZL 4HH9A 4JY4B 3SGDI 5GS2H 2BFVH 1A7QH 1FAKT 1P7HL 1VEOA 2QR0B 2VR4A 5AZEL 1T4KB 4KHXH 1RZGA 5IMMA 1FZJA 5JLZA 5F8QC 4EN3C 1DCLA 3EO9H 5DSCA 3VG0H 4D0BB 5HD8D 3ZKXC 3F5WB 3EO9L 4G8GE 1PX4A 4FQHA 4NM4L 3PNWB 4KI5E 4LPUA 1S5HA 2LTQC 4I4WB 3CZFB 1CS6A 4GKSA 2YPVL 2FBJL 4YBLB 3MJ9L 3BSZH 4GUPA 3CVHL 4NN5B 4G9DB 4E41E 2NY4D 3Q5OA 1A6UH 3VXTA 1NMBL 2NMSA 1QYGH 2BHYA 3V4UL 4QHKJ 2VLJE 3EYFB 5I71B 3EHBC 2IFGA 5JOFA 5CIPA 4ZSOB 5ALCH 3ZKNC 2HG5A 4OCXL 2YD3A 4L1DA 3BDYL 3GI8L 4JFYA 5JW3L 5FCSH 2X6MA 3HG1D 1K8DA 2VZ3A 1N0LA 1S9WA 3EDEA 5GGSB 1FL6B 4KVCH 4OIIH 1MAKA 3FT3B 4U05A 1MH5B 1B0RB 3BAEL 3QYCA 5EB9A 4YZFE 1XGUA 3ARFD 4DQOL 1YMMB 3NN8B 3QEHA 2X4TB 4M61A 4FN0A 3R8QA 1Z0MA 4BQ9A 3T0EB 4O4YL 3EYVA 3QP3A 1JPGA 1G7LB 4PGEB 2AI0H 1OGTA 3V4VL 1IC4L 2IADA 4UQ2B 1N4XL 3MV9B 4TQEL 4JLRB 2RB8A 3UZQA 3W5MA 2YRZA 5GGUA 2A6JB 5HBBA 4A6YH 2XN9A 2XI9A 3P4NB 3KAAA 4XCEA 4RWYL 4GG8A 4DVBA 1HILB 2GUOB 1G7HB 4HJJH 3GKZA 4FRWA 2P5WA 3TH4T 1IFHL 1J8KA 2BY3A 2VXVH 3FKUS 2H9GB 3WE6B 1EEYA 2K1MA 1MNUL 1V3JA 1F3DH 4MAUL 4NT6B 5D1QC 4NN5C 2PW2B 2ZOLB 1JFQH 5IBTH 2XRAL 1ED3A 3KPQA 5FUCC 2C3GA 2EZ0D 5D1ZD 1R3KA 2J12B 2Q3AA 4LHUG 4IJ3C 3O4OB 3CFIC 4KDTA 5ISZA 3REVA 1WT5A 2FECL 3T0VA 1WISA 5EBGA 1YY9C 3PDDA 2Z92A 4LCWB 1GOGA 3G04B 3HFML 5C0ND 2GFBB 1CE6A 3PHOA 5JR1L 1UYWL 2XZAL 5FB8B 2PCPB 5I17B 4LFHG 3NA9L 4HWBA 4QRRD 2WBJB 3GB7B 5IHZA 3P9MB 5DC4B 3RWDA 3WKMH 3X3GL 4WFFE 5ESQA 4ISVB 2BNRE 5HYJE 1WFUA 3LEXB 3MXWL 3OJ2C 4Z7QE 2VXQL 1C8PA 5IK3A 2CLRA 1D5ZA 1S78D 4JKWA 3WFEL 3O2VL 1G7IA 2BMKB 1N5YL 4JJHA 4X7EC 3QCTL 3GBLA 2ITCB 1Q9LA 4I0KA 1U8JB 1DBKH 4X5LA 1LWRA 3OKDB 2H41A 3IJYA 5F8RC 1A6PA 2DM3A 4G8GA 3WN5A 4D3CH 3G5VA 1JRHL 4WHYH 2FHCA 5ILTH 1IQDB 4RWHA 4ZFOB 3TFKC 5DUBB 3MBED 4XMPH 1JF1B 3HPJA 4P4RA 1T66C 4J3VA 1FHGA 3UP1A 5FA3B 2ADGA 1BQLH 3MJ7A 4OKVA 1RIHL 3E6FB 1T7XA 2AEIT 3JV0A 4NBYB 1QRNE 2X4NB 1ZV5A 3FONA 1IGTB 1PQZB 2LABA 4ZO7A 3TIDA 5KSVA 4Z0XB 4QHUA 3B43A 1L7IL 1FIGL 4R90L 4FQQA 4CMMA 3PHQB 2XZQH 2F8VA 3F7PC 5JQHC 3MXVH 2DQDL 4ONHB 1F6LL 2QQNH 4NO5B 4YZFF 1CFVH 2OBGA 5KVEH 5T1MA 1ITCA 2DQCL 2EE6A 1U93B 5IJVB 3P40A 4Y4HA 4HWZB 2V6HA 4P46D 2CLVA 2FX7L 3HG1E 4TUKL 3I6GB 3QCVL 4HX1A 4YUEL 3VMOA 3MV11 4GRLD 2DLHA 1V3LA 2H8PA 4U6HB 5CBAA 1KIRA 1A1NA 1CIUA 1K4CB 1QPPA 2H32A 3P73B 4OZFG 5B38A 2J1KA 3ZTNL 2EYSA 2GT9B 1Q72L 2C4FU 4Q6IC 43C9A 5F7HA 2DQGH 5HYSA 2HLAA 3S37X 1VFAB 4QRTB 4HAGA 1IQWL 4JCMA 4FHBD 3CMGA 4L8BB 3AM8C 3SQBA 1R3HA 2FLRT 4KV5E 1BQHA 4WEBL 4M5YL 3MO1A 3RUGF 5EOCH 2JJVA 3WSQH 1WBXA 3WYRA 2RGSA 3MRLB 5IEKA 5HHVL 2A6KB 4IRSC 5D96C 2BX5A 4PD4K 1Q9OA 3OKLB 2NY5L 4WEBH 4UDUB 3VD4A 4G80A 4X80L 1YJDL 1XGPB 2ADJB 5I8KL 1U3HB 4XP9L 4PJDA 5L2JA 2DQGL 5I15L 4JANB 1MLBB 3LSOA 3NABL 3Q6FB 4YBQD 4HS6B 3VFPA 3L3HB 2DJSA 3WDIA 5ACZA 3QCVH 3QIBC 1Z9MA 2CDGB 4NZTL 5C2UB 4LIQH 4RGMC 3ULSB 4KJQD 4OLYH 2Z31C 5DFVD 5IQ9B 5E00A 1CL7L 3O6FA 1KN4H 4IRSD 5CZXC 2OS7A 3LKSA 3MLWL 5IMKA 1DSFH 4P5TC 1IC7H 4M93C 4HJGA 3HR5A 5JUEL 1MFAH 2L7UA 5E94B 5D1XC 2OSLB 5CLTA 3HZYB 1UQSB 2X4PB 1OTUC 1XCQB 2CO6B 1U8IB 5DJCA 1J8HB 3NH7L 1BQLL 4OLWH 4AEHH 5E5RB 1IGCL 4PGDA 3U46B 1FNGA 1EEZA 1QQDA 4JM2D 5HPMB 4HUWB 5C0GA 3SDXA 1UM6H 3I02B 1NSNH 2AABH 4FQXA 2VH5L 4PP1C 2FWOA 1P2CB 1UJ3A 1OAUH 2DLGA 4O51B 3MRPB 5IFHL 3FQWA 2APBA 3VXOB 4PLKD 4XNXH 4WGVB 2CJUH 3BZFB 3MMEB 1EFQA 1CDBA 3ARDB 3LDBC 5F9WB 5I1AA 3IT8D 4KROC 3LEVL 4F8TA 1SBSH 4KUZH 3OSKA 3ZMRA 2AV1A 1AR2A 4LVNB 4BZYA 5H94B 5CD5C 2EH7L 1C7TA 4E42A 5I8OL 2OLDA 1PSKL 2YUXA 4OFYD 3RWEB 4RAVA 2X1XR 4HFUH 4HS3A 4R4FL 4JZJC 1QSFB 4RGNC 4WTZG 4WV1B 4Q9QL 4HUUA 1SJEB 1MQKL 1TCRB 5DT1H 3KDMB 3VXNB 5FV2A 1RQ5A 2Z8SA 5HVWA 1GL4B 4D9RE 3TN0D 2HRPL 3GSNL 2O61A 1NKOA 1U8HB 1K3ZA 1JHTB 4APQC 5E8OB 1CDYA 1X4YA 5EOTA 3VXUD 1KB5B 1FGVH 1X6NA 2F54D 5I1GL 3MV7B 4GMSH 1D7FA 5KZCD 2HVKA 4Q6IA 4ZAKB 3TZVA 1P6FA 5LVEA 5CS7A 1XF5A 3OJVC 1QLFB 2E27L 3U7WH 3B9VA 4P3CH 2R56L 1KBGH 3DVFA 4N0FA 4LBEA 4XCFL 4ZUTB 4QRUA 1NCUA 2IAMD 4LCCA 1P7QA 2VXUL 1DBBH 2HTLC 2VXVL 4W68A 1I3RA 1MAMH 1YZZA 4I5BB 4HJJL 3DXAE 3QDGB 3MZTA 5FHAH 2APXA 3OKKA 1UGNA 1ZS8B 5K9KA 3A6BH 2HKHH 1JPSH 4AL8L 2CDEA 3I2CH 3EYOB 3V5HB 1JF5A 5L2KA 4RZCA 1W72H 4BSVA 3L5IA 1SY6L 5C9JB 3KLDA 4F8QA 4RFEB 1RD6A 4TQEH 2X7LB 3OB0K 4HG4K 4QCIA 4DKDC 3HC4H 3EGSB 4JDVA 1S9YB 2FB4L 4PRHD 1OB1B 5C07A 4MJIE 4Q97A 1BLNA 4U4BA 3LKOB 4GKZB 2BNUA 1FZOB 2W0FA 1CT8B 5FGCE 5EO9B 3F7YB 3FQXA 2AJ3A 4IRZL 3VXRD 4NFBA 4K3DH 4OI9A 4B53A 5EU4A 4M7JH 4AT6B 1ZHNB 3V6ZA 5I16B 5DI8B 4Y7MA 1PBYA 3BPNC 4OCXH 3JVGC 4P5KB 1RUPL 2VDML 3EZ8A 2OP4L 4FP8L 5IR1B 5AWNL 1U42A 3WD5L 1OGAE 4KI1A 3RZWA 1DQTA 2WBJD 3B9EA 3RVXC 3DVNB 5JXEA 4HKXB 4D0CA 3DI3B 1EO8L 1AQKL 5DA4A 3G5XB 5JIKA 3R4DA 2LQRA 5D7LB 3V8CA 5INCA 5JOEA 2BOBB 4YPGA 5DQ9B 5F89A 3X3FL 5JDSB 2DM4A 3QDGE 5BOPA 1P69B 1JWUB 2BVEA 4ZSOE 3VCLB 4OUOA 2P47B 1AKJB 2QR0A 4NQDE 4HZLA 5T3XD 4HGMA 4PJAB 4TVSa 4MMXC 2G75B 4ONFH 3D85B 5CAYB 1JL8A 5AZEH 3ARGD 2DJUA 1ROWA 1FO0L 1UCTA 3Q1SH 4UIMA 2VZOA 4LKCB 3BH9A 5BVJA 5T1LD 1S5HB 4I4WA 1CTNA 2NY3D 4O5LL 5E8EA 4NWUH 3T0ED 5HYQB 3TBTB 1INDL 4M6ML 4OAWB 4PB9H 2OTWB 12E8L 3X13A 1ADQH 4HCRH 5HY9B 4M00A 4HSQA 2OTPA 2N1KA 1Q0YL 1ZGLM 2OX5A 4M9OA 2PYEE 3JUYA 5TGBB 3SDYH 3VJ6B 1IAKB 4DN4L 5JOFB 4LRNL 2VDPH 3V6OC 1B2WL 4N8PA 1XGTA 3NPSC 2Z8WC 3UYPA 4NKOB 4WGWB 2XA3A 2JF1A 2NZ9C 3FHQA 3O3DB 1HWGB 2NXZB 1KG0A 5JIPA 5J6HA 2A6DA 1INQA 4BH8B 1MH5A 3NA4A 3CC5A 1B0RA 3OKMB 4HPYH 3HI6L 4OGXL 5F3BA 1RV6X 1YEDB 4U1HA 2NY0C 1C5CH 1EZVX 2KPNA 3GZKA 4FQ1H 1K5NA 1TQCC 1ZK9A 1TFHA 5FYJL 1QSFE 4PRHE 5EPMA 1G7LA 3NIGF 2I5YL 3D6GA 5I18H 3H9ZA 1EUUA 4J3TA 4QXGH 1P4BL 1P7KA 3Q48A 1L7TL 5D2NB 5SWSD 4P23A 4IIQB 2FHBA 3EJYD 5DHXB 5CEYB 2A6JA 2CKBH 3LH2L 4OFKA 3N50A 4GW5B 5FO8B 2OL3B 4YFLI 3MROB 1OAQL 1VADB 5EO0A 2EDTA 2DWEB 4XCEB 1NGQL 3DMMA 3I3DA 4OZGB 2N7AA 3V6FA 4YHYC 2Z93A 2DYPB 5FUOL 5T33L 3QULB 4Q7DA 2P5WB 5GGRB 2ZOKA 4QF1A 3FB6B 1N7ML 5HGAB 2IPTL 3SKNA 3UBXA 2CRIA 3CFCL 3MLXH 1ZVYA 3WV0A 4MA7L 4Y4HC 4Z18A 1LE5A 1CE1L 4GRMB 4X0KB 2IQAB 5CP3A 3O6MH 5DTFB 3VXRE 1R3KB 4B41A 4UUJB 2DI8A 1CFTA 1CFSB 5D2LB 1DDHB 1SJXA 1T1ZB 2DQHL 3P0VH 2IEPA 1D5XA 1HCFX 3N1FC 2XKNA 3BI9X 4HV8A 2B4CH 4N0YL 4O2CB 4WWKA 4CL7A 5DK0B 3JV6A 1HCVA 3O3BA 3MRMA 1KLUB 5DQDL 1RUAL 2YOCA 1UACL 3S34H 5JO5A 3IFPA 3D87B 5I1HL 1J87A 1P1ZA 3LEXA 3X12B 4BK5A 4P2RE 2BCKA 3WKNA 4KJYB 2CLRB 4HHAA 4ZPVA 4KQ3L 3TA3C 4MSWB 1CL7I 1ZLVH 5KVGL 3ZZ1A 1ZMYA 3PDOA 1U8OB 5E56A 3JTSB 2O5ZL 4IM8A 4BM7A 4PYGA 1BIIA 3QXTA 3KPMA 1ORQA 2OR9L 5IMOB 3D25B 3T04D 3U2SA 5HHQB 3U1SH 3E6HB 3U0WH 2R29H 4FQJH 2EDRA 1KEGH 5FF6A 1EERB 5DD0H 1J86A 4K7PX 3O6FC 4BSJA 4GRLB 2JB5H 2NLJB 2PTTA 4U0QB 4P4RB 4PGCA 2IWGA 1YPZB 1I1AD 1X3DA 2ESVB 2CIKB 5TFSH 1UCBH 4X7SL 4X7TA 2BVOA 1ZXQA 1D6VH 5KANG 4KTEH 2YPLD 3QRGL 3L95A 4JPVL 3G6AB 4LOUD 3HKFA 4TSBH 1NCTA 4JFDA 4KVNL 2ICEB 1Y18A 1U8LB 4CKVX 3B9KD 5JOPD 5TQ2L 3RVWC 4LF3B 5F1KC 3TESA 2A2QT 5FCUL 3SQOL 5IJVA 4OFPA 2H26B 1OLLA 5LKNA 2ENYA 4GQPH 4PJFA 3JWNC 4Y4HB 3O45B 5E99L 5FV1L 1YEFL 4F15B 3UYRH 4OD3L 3IS1X 3G5ZB 4U6XB 3SKOA 1K4CA 5IHUL 4QYOB 3RA7H 1R3LB 2BVYA 1AJ7H 3ALWA 4QRSB 3S7GA 4OM0H 2NZIA 3KPLB 1MIML 1G7QB 1A4KA 4H20H 1J0ZA 4QRTA 4JZJB 2R23A 3GIVA 4HPOH 5IEHA 4EVNB 2H2SC 4LMQI 5IFJB 4ELKB 4LEXL 4P57B 2YSSA 3MLZL 2KKQA 1X4XA 4LSUL 1WC7B 3C87A 3MRLA 3GRWA 1LK3L 2O93L 4HK0A 4NZUL 1AGFA 3G08A 1GYAA 1FNAA 2XTJD 3PXJA 3S35H 5L2JB 3A67H 3GNML 3BQUC 1NC2A 2LAGB 4N8VB 5TDNB 3MRGA 1MLBA 5EZJA 4ZNEE 1FV1B 2R4RH 5AUMA 4M48L 2ARJB 1HSAB 3F58H 3GHEH 5J3HD 3QDJE 4PJ8A 1ZHBB 3L3HA 5GGVH 1NJ9A 4MGXA 4YE4H 4Z7VF 4AENB 4BZ2L 2QQKH 3BEWB 3UJTL 3RVXD 2YMXL 4YNYB 4FTVE 3RX7A 1I7TA 1CXKA 5T1DL 1ZEAL 1T22B 3HR6A 4Z7UA 1UA6L 2YUWA 2IAND 5E00B 2IH3A 5TDPB 2P8LB 3LHPL 2NX5D 2X9XA 1U3JA 1HH6B 3IAQA 1DN2A 2QADD 2FDBP 5FYJD 1CDHA 4HXBL 5DDHB 2VRAA 4KHTL 2ADFH 2MOVA 2GHWB 3MRRB 1G9NH 4OD1H 3BH8B 2GTZB 5D71L 4G7VL 4UZGA 1EEZB 2OZ4H 4KI5C 4UU9B 4Y16C 5DUPH 4QO1A 4YXLH 4X4ME 3QUYA 4NNPH 1P84K 2FWOB 1E6JL 1GSMA 2MNUA 1MCPL 4OCRH 2V5YA 1J8HE 1PZUB 4P2YA 4NQEE 2WQ8A 1GJIA 3BZFA 2PYFB 5CJXC 3REWA 1RIUH 4MNQE 3OGCB 3CK0H 1YN7B 3BP4A 4JFPA 4LPWA 3R06A 3QUZC 4C57C 1AIFB 2ZPKL 1IAOB 5C07D 3ARGB 4WI6A 3G5YB 1DL7L 3GMQB 2AJVH 4ODVH 1PZ5B 4XI5C 3RIAK 4W81A 4GO6B 4S10A 5BZWA 1M6OB 3VXSD 8FABA 3JWDC 1EJ6A 4HS3B 4N8VG 1FLTX 5C0DA 4L3EE 3V5DB 5IB2A 1BZ7B 3QA3A 2FIKB 1XGRB 4IHOB 5KJRH 5CWSA 4ODSH 3P4LA 2G60H 1Q0XL 2DMKA 2NW3A 4MA8H 1EMTH 3DUUB 1T03L 5D72H 1ZGLA 2YZ1A 1MPAL 5E8OA 4F9PA 3DWTA 2WINB 3MGTA 3RUGE 1KB5A 1UWXK 4M7LL 5IT2H 5GJTH 3KLSA 4CVXA 3LVEA 4JFHE 1CVSC 3HB3D 1C5DA 3HI1A 3LN4B 4PLKC 4YK4B 3CLEL 3BKML 2HA1A 4K7FA 3Q6GH 32C2A 3FB5B 4E5XB 1AO7E 4UT7H 3I9GH 4LCIL 4JN2B 1ND0B 2VLKA 3U79A 3MODH 3F8UB 4G6FD 3QG6A 5AYUH 2VDNH 1IM3A 5JNYA 2PNDA 3ZSSA 2D03H 1A3LH 3BKYH 4K3HA 3F65A 3SJVB 3BP5B 2NXYC 4L3CA 2QKIA 2IBZY 5IMLB 3QFDA 2Y4SA 5DD6B 5KOVC 3KPOA 4FQXD 5HXMA 2EYTA 1PLGH 1YY9D 3HA0A 2E6PA 1N6QL 1T2JA 4RCAA 4NM8H 3WIHH 3QZWG 1GOHA 2NY2B 2R2BA 3MRFB 4HWBH 4JREC 3Q2CA 1U3YA 4NQCB 1AY1L 4FQLL 1JHLH 1R24A 4QCIB 1I9EA 1RSFA 2FJFB 3OR7A 4BK4A 1PX3A 2HVJA 5IFAL 3KYOA 2MHAB 2QV2A 1BLNB 4GRWB 3OKOB 4YHPA 5IESH 4X6EA 4RGNB 4HUXB 4ZUVA 1KPVA 1F2QA 3W0WE 1SVCP 4D9LL 1QBLH 1ES0A 4JHAL 3PV6A 5HI4C 1IT9L 1Q94B 2O5YH 4HF5H 3TO4C 2AJZB 1XF1A 2UV3A 3ARFC 3WUZA 1UWGH 5J8OA 4J8RB 4GAYB 1CU4L 5D7KD 4YJZL 4Y1AA 1QR1A 4TUJB 3QWRD 5IR1A 4WFEE 3CDCA 1H3PL 2F5BL 1EPFA 4W6WB 2HT3D 3L1OH 1S7TB 2JK5B 3DVNA 2KQNA 4EBQL 4RAUA 1BMGA 3S6CA 3GMRA 3ME0A 3SKMA 3WLWC 2DLEA 3BO8A 4CMHC 5F7EH 3V4PL 3ARSA 4TPRH 1IC1A 1K8IB 1FIEA 3QO0B 4MWFB 4OJFH 2AJUL 4U2ZA 4XC3L 4ZFZB 3VGAC 3P9LB 5DXWA 2BSRB 3QG7L 2W38A 1GGBH 4WWID 1RHFA 4JFQB 4FZEH 3D85A 3MV7E 5M7QA 1OAXH 1Q9WA 3K8KA 2PO6B 5GPRA 2X1PA 1B4RA 4WIQA 3DROA 3OAZH 4URTB 1MQ8A 4KROD 1HE7A 4YHIB 5D1XB 5I19L 3PGFL 4IOIB 2W07A 3BYTA 4I48B 4MVBC 4PJHE 1MFDL 3PQYD 3O9WC 4TOYL 4J4PA 4BFIB 5FYKD 3V8OA 1AC0A 3EZJB 2HWZL 2M8XA 1QSEA 5H2BA 1NCAH 1CR9H 3T4YB 4MDJB 3RI5K 1YA5A 4MS8C 5IB3B 3T4AA 2UZIL 3TCLA 3VRIB 3D69B 1A64A 5IJKA 4Z8FH 4AZ8A 1JGVL 4HULB 5KVDH 1MJUH 3IDYB 3LKRB 4LSPH 3DV6A 3T8XA 3PE9A 1D5MA 5MP6H 2MQ0A 5DEGA 4NQVB 3V6BR 4WHYG 4G3YH 1OW0C 3BP7A 2D31A 4XVTH 1LK2A 3IJHB 2LE9A 2YA0A 2ZUSA 4PJ8C 3VFMA 3G6JA 5EPMB 4K7PH 1I9JH 5EU6D 1JPTL 1WFTA 3FO0L 1P4LB 1T04A 2D0FA 4O02L 2HJKA 3MUGA 4I77H 4DZBA 5IM7B 3TT1H 1FDLL 3ABZA 3TVMA 3QI9B 1NFDA 5D4QA 2Q7YB 3BOVA 4JZNA 1EVUA 5DWUH 3GK8H 1U6AH 1VADA 4Z5RA 5I1CH 3WNNA 1YEHH 3FRPG 3BUYA 4PJIF 1J05B 2R1YB 5EO1A 5GS2D 4HH9B 3D0LB 1KCSH 3FB6A 1KCRL 3GSOA 4QKXB 3IS0X 3UTPE 2Z91B 5EWIL 3VXQB 3T2OA 4EQ3A 5JZ7C 3D2UD 5IMMB 5JLZB 5E2TH 5C0AD 2CK0H 2DQIL 5DJAA 4I9WD 5C0NC 3ROOB 4Z7WF 2GYSA 4Y0GA 3KJ4B 1CFTB 1CFSA 4NP4L 5D2LA 3RDTA 4HK3N 4YHZL 1J1XL 4KZEH 4PP2B 4H5SA 5JZ7D 3N85L 4GUPB 3NCFB 4N8CL 3JV4A 4CNIA 3JVGA 4PJAE 4DOHE 4P5MB 1FVDA 4G9DA 2QLVB 2ZP0T 4WWKB 2J8OA 1IKFL 4GAJH 4M1CD 4NQUA 2Y25A 3MRMB 3QUXC 4PUBH 3V0WH 4PRPB 2VDQL 3BGMB 1CLZH 2YEZB 3BIKB 4ZSOA 4EDWH 1EV2E 3EDFA 1NANI 4ODWA 3MYJA 2MKWA 2BVQA 5GXBB 3DUSA 3KWWB 4ZG1A 1AE6H 1P1ZB 1NC4B 1BZQK 3BHBA 3GJFK 3FT3A 1G1CA 1DQDL 3O8XA 3LB6C 4ZPVB 3FQRA 4F9LA 4FNLL 2XNAB 3NN8A 4LVOB 3PDOB 3GSNA 1AR1D 5J12C 1J12A 3ZSTA 3EYVB 5B3JF 4ODBD 4NC0B 5EU6E 3VG9C 1IKFH 4Y4KC 1JI1A 1OGTB 3DURB 2ZJSL 4HEME 5EUOF 5T1KA 1ORQB 5D2LF 5IMOA 3D25A 5I1JH 3KPTA 4TSCH 3N85H 4Y4FB 3E6HA 1AGDB 3FL7A 4Y19B 4XCYA 2VL5B 3RTQA 3UPAA 1HH9B 5SWZD 3BE1H 2R2EB 2XN9B 4UILL 4OZ4B 1DVFB 2CXGA 4LCYB 4W6YB 5JHDA 1EHXA 1KYOJ 4GRLA 1AXTH 5I6XC 4XX1E 4JY6B 3RWJB 5E5UB 4APQB 3VFVA 4XNQA 1G7HA 2BVPA 4LHUA 1WCBB 1X4ZA 4H0GA 4X7TB 3C6LA 2OXGA 4EI5B 2X70B 5CZKA 5HHNA 3FRUA 1EEYB 1AC6A 4FXKB 2ZG3A 4JFDB 1CG9B 1JGDB 3FT2B 2KZ1B 1BEYL 1C08B 2R2CA 2FJHA 3NVQA 4ZPTB 5DRWB 3WFBL 4DW2L 4NKDB 2IC2A 1GC1L 4X6DB 4S11A 3LZFL 5ISZB 3S96A 1FPTH 5CSBA 1TETH 3SJVE 5DHVA 3RVVD 1MVUB 4I77L 1KF9B 4O02H 3DNKA 5DJDA 4LVNC 3CXHJ 4LLAA 3UDWA 2X09A 4KKAD 1Y6NR 1KFAH 1JYWA 5C0IB 5DZLA 5JMRA 1A2YA 2JCCE 4JGJA 2J8UE 2R0WH 4UV4L 3DIFB 1JYNA 5MEPA 4XNZC 2HP4A 4QRSA 2AXHA 4XRCA 1U8MB 1T1XA 3QDAA 3LRSA 4LKXB 1F4XL 3GIVB 3U30C 5SWQB 1RZKH 1UZ6F 3RWHB 3BMWA 4ISVA 4P57A 2GSIB 1MCQA 2BSTA 5IB4B 1U41A 4NHUB 4ZFFB 5IK3B 5AG9A 1L4IA 4HQQH 3LPWA 1GGCL 1KGCE 3WO4B 1EAPA 2FYYB 3KHOA 4H1LH 1SVZA 3D3VD 2Q87A 1XGQA 2P5EB 3CUPA 4XH2B 4WW1A 1G7IB 2BMKA 1UEMA 2Y06H 3G08B 3UJJL 4EI6A 1C1EL 2QADB 2VN4A 3KYKL 2VMFA 4MQTB 2ZKHH 1SEBB 3O6LH 4P3WA 3VGFA 2PF6A 3UTTE 4CADB 3QUKB 2R2HA 1HHIA 1EUTA 3G5VB 1NPUA 1HHJA 1WEJH 4PRDA 4FFWC 3N0PB 4YHMH 4KU1A 3CZJA 1P5VA 2APVA 3FTGB 3L3GA 3HPJB 3ZKMD 5C0EB 3TBSB 2ADGB 1GGBL 1IBGH 4J6RH 5DMIL 3VD5A 4KDVA 2GJ6E 3JWDL 1YY8B 3GI9L 4XC3H 5IW1A 3LMJH 2VZUA 5KSVB 4Z0XA 1K9TA 3V7AE 1JNLH 1JHKL 4R96B 3T0WA 6FABL 5D1ZA 4CVWA 2R0LH 3SCMA 1TJGH 5C3TA 4PRNB 5B39G 4JN1L 3MRRA 1VFOA 3QEGL 1IEAB 5ENWB 1KJ3H 3TYGH 3TNNA 1QVOA 5BMFH 5DJYA 1NMAL 2J5LC 4MAYD 2EKSB 4U3XA 1MUJA 3OQ3B 3GIZH 5LGKA 3UJIH 1W0YT 4ZO6A 5E7FA 1FNSL 2FO1A 5MEND 2L7JA 1JK8A 4RISH 2PYFA 4JHAH 3TYFA 5HYSB 3QQ9D 4H1LB 4PG9B 4KK6D 4YGVA 1ZSDB 1CZ8L 3O0RL 4X8JA 5IESL 2F53D 1QNZH 3R06B 3BQUA 4IMLB 3PL6B 3EIFA 3MO1B 3ARGA 3OJDB 5IFAH 1D6EB 3T3PE 1PZ5A 2YA2A 4KRLB 3LN5A 1JPFB 2A6KA 2WZPD 3THMH 3BRGC 5L7XH 4DGYL 2PTUA 3OKLA 1J0IA 3LS5H 1M6OA 8FABB 3TVMC 2EEBA 4AG4H 2D7TH 1XGPA 2ADJA 2FL5B 4QXUH 3WHE1 4NM8L 3QA3B 1XGRA 4U3CA 1PLGL 1C16B 1DQMH 1LDPL 2XZCL 3IGAA 4P99A 1S5IL 4Y1AD 1DANU 4OTXH 4HWEH 2A73A 2EDJA 3SJVD 3DUUA 3L5JA 2FATL 1HINH 4XXCA 3GJFA 3GM8A 4HIXH 2RBLA 4K3JH 2VDNL 4WHCA 1QUNA 5FKPA 3UTTA 1MCOL 4JY5H 1EBPA 4JG0H 4XPGL 1N2RA 3IDUA 5F70A 3BKMH 3PWPD 4JFEE 3BZEB 4XPHL 4BQCA 5CJQL 1EO7A 4U3HA 1F4WL 4L9DA 2Q8BH 1MCCA 1ND0A 2VLKB 4ZUSB 5DK2B 2HJLA 4PJ9A 5AG8A 1MVFA 2BSSA 1HINL 2NYYC 1ZT1A 5C0BE 3GRWL 3QG6B 1AP2B 4M7LH 5IT2L 4U7KA 1LVEA 4F37K 2XACC 5ADPH 5I8CB 5I75B 1EMTL 2QKIB 4KRMB 3NIDF 5DD6A 4JRYD 1T0NA 1BVLB 3THML 3TBWA 1YPZE 3KPSB 4PREB 4BFEA 2R2BB 5F1OB 1P2CA 1Q38A 4Y2DB 4MA1C 5BXFB 5L2KE 4NQCA 1WBYB 4XHJC 1DUZA 5ITFA 3WCYA 3FN9A 3HG1A 4ODVL 2FJFA 3OR7B 4R2GB 4UOW0 5I74B 4KH2A 1I7ZA 4MAYC 5T3ZD 1KN2L 5IKCA 1F4HA 2VDLH 1FRGL 1FFNA 2QQQA 2C7UB 4P3DA 3AGVA 3AVEA 4AIZB 1Q94A 4M5ZL 4OGAC 1IGFL 3PV7A 3VH8B 1KULA 2AJZA 2MJWA 2ATPA 2FR4A 1T21B 4UT6H 1QSFA 3ULVC 4GAYA 4NNPL 4WI5A 5I66B 3MRQA 1SM3H 4JQXC 4TUJA 1UB5A 1XR9A 2OZ4L 5DUPL 1JJUA 4WY7L 3SN6N 1SJVA 5ID0B 5IQ7H 1EH9A 3AU1A 4YAQA 5HDQH 1U8HA 3MLRL 4WFGE 3VXMD 5AAWA 1QKZH 3K2UH 4KC3B 3MV7A 1SYVA 4L3EB 3PABB 4Y16B 1U58A 2M1KA 3HZVA 1YEKL 1RMFL 3CSBA 1T7WA 2SEBB 3NAAL 1K8IA 5CJXA 1WTGT 2ZCKH 4MWFA 1WJ3A 2XIDA 1ZVSB 4NO0D 1ZLVK 2A1WH 1JZ2A 4Y89A 2JB6B 2OL3H 3T08A 3DV4B 4DUVA 3MBXH 5A1AA 4HC1H 1RU9H 5EBMA 1YYLH 5GGRY 3LPGA 3T0AA 1HHGB 1YQ2A 4YLQT 4UTBL 4YC2B 1IM9A 2I26N 1FBIL 4D9QE 1I3RB 5KW9H 1TZIB 3B9KC 3IFNL 3V2AR 4S2SA 2W91A 5BOZG 1IRAY 3OKKB 3HE6D 3L6FA 1OGAD 2Y7QA 3PWNB 4JB9H 2R4RL 4F58L 1MI5E 4J23A 1AGEA 2ZCHH 4HDIB 3F12B 4YDLC 2CKBA 1DLFL 2HN7B 2PN5A 5I9QB 2JJUA 3BD3A 3TLRA 4JZOA 2QHRL 4LSQH 3EDDA 4PBXA 5D96B 4BSVB 5IHLB 5GISH 5C9JA 5JQ6H 3PJSB 2HMIC 1N26A 2OJZH 3SDCD 5ESVA 3RL2A 4RFEA 2YKLL 2EXWD 5MENE 3DGCR 3VWKB 4NZRL 1MRFL 4G8EB 3FO1B 5EUOB 2GIYA 1F4XH 1A7RL 3H7BB 4LSUH 5C6TL 1T5XB 5F71A 5DJXA 1L0XA 4DZ8B 1X5JA 1ZA6B 5FUZL 3T8XB 1D5MB 5BV7B 1L9NA 3HNSL 4S0SD 1FYTD 4NIKB 1IGYA 5TDOA 2B0SL 2A0LC 4LDOB 3T65B 2QSQA 4ZO9A 4XP5H 2J88H 4NHCL 3NFPB 5GZND 2WSKA 4PJBB 3STZB 5IOPB 1J10A 1T04B 4G8GD 4L9LC 1T89C 3ZL4H 3LZFH 4HZAA 1M05A 2HJKB 4R4BB 1YEEH 3D9AH 3LV3B 3NACL 3QEQD 2DQFB 3WFBH 3IDXH 4RX4D 3SQOH 3TM6A 1RFDH 3ULUE 1ZHKB 3TWCH 4JZNB 3LB6D 4K55A 4LU5H 1Z5LA 3U36A 1K6QH 5FAAA 4JQIH 2LFGA 4PJDF 4QXWA 1WF5A 1MEXL 1Z6JT 5CEXB 4KVNH 1V7NH 4M6NH 1IEBB 2AXGA 2VTFA 3HI5H 4JM4L 4DGVL 3VWJA 5LWYH 1NUGA 1YDPA 5JDSA 5ICYA 4Y4FC 1VERA 1KC5H 1S9VB 2FX9L 3MCG1 4X6BA 4TVPL 5TFSL 4H88H 1KENH 2DDQH 4PJAA 3CD4A 4XMLH 4OLEA 4DCQB 1G7PB 4TNWF 5J12B 4R4NC 4ZUWB 4RQQB 1LP9A 2C3WA 4XMLL 5DFTA 3TBVA 4D2NA 4LKCA 3RHWF 5I1JL 1A6AA 3TO4A 4H88L 1KEGL 1WT5C 3WIIH 3RDTB 3ARFA 4PR5B 1JUFB 1OP3K 5CEZL 5I0DA 3SE4A 4GG6E 2EDKA 2R29L 3QJHB 5BZDB 4R4ND 4FNLH 2HJFB 1MEXH 4EIZC 1S8DB 4NJAH 4ZUUB 2NY1D 4MD4B 5ADOH 1CYGA 3TIEA 3BGMA 1XGYL 3WHE0 3TWCL 4OI7A 1RFDL 5SWZB 1S7VB 1LO2L 2ZNXA 3WUWB 4GG6B 3IDXL 4ODWB 4KXZI 4P9HH 1XZ0B 3EYSH 5KG9B 5B39B 3DUSB 4UDTB 4LLWA 1K85A 3IFOB 4NKOA 1EX0A 3OL2A 3IXAB 1DN0B 4TUOB 2J8UA 1NC4A 1ZA3B 3MLUH 1DQJA 5DEFB 3HMXL 3VXRA 3L3OB 4PJ5A 4GAGL 4PUBL 3V52L 5BQ7B 5J3HC 3S34L 2MSPA 4TTDC 5F3BB 1YEDA 4MZ3A 4JEGB 5DD1L 3GSNB 3KR3H 4FFZH 3S35X 3GKWH 4XXCC 4P46A 1OAYL 3ROLB 4XNMA 1XF2A 4YHZH 2A38A 1J0YA 4AJ0A 4YWGH 3VFWA 1T1YA 4ZO8A 4PJXE 1A14H 1XFPA 1YECL 4OT1H 5FYLL 1MRFH 1TTUA 1HH9A 1NGZB 2OXHA 4GW5A 3AREC 3TH2T 4LARL 2OJZL 3FO2A 2OK0H 2MPAL 4L4TD 4ZXBA 3L3KA 3H3PL 3RWJA 1DLFH 4XXDA 4APQA 2Z93B 1KT2B 5J9PA 4WUUB 2BVPB 1J5OL 2R39A 4WU5A 2IPTH 3MTRA 4XHQA 1X7QB 1U8NB 5F3HB 3NCYP 2JE8A 2Q3ZA 4NRZB 3W2DH 2DIBA 4FXKA 1QSZA 4PTTA 4WI7A 2JLLA 2Z35B 3N1MC 3D0VA 2EZ0C 1LE5B 3T2NH 5L88H 2QTEA 4C4KO 1MHPL 3P4MB 5IB5B 4HC1L 4KJQC 4OKDA 4XZUA 1FAIH 1DLHB 3S96B 1R5WA 1DDHA 1NBVH 3CDGB 4Y88A 3CU7A 5K9QG 1D5XB 1LO0L 5DJDB 2B4CC 4MJ5A 2EDNA 5DRXA 1QRKA 3DO7B 3MRKB 1H3GA 4XVTL 3JV6B 3O3BB 1E4JA 4JHZA 5MP6L 4MQXD 1C5CL 2NY5C 3QHZL 4JO1H 5FO9B 2DTML 5MENA 4Z8FL 5FDYA 3RWIB 3MNZB 1YMHB 3CLFH 1IVLA 3IFPB 3O9WB 4PY8J 3RNQB 1PEZA 2GSIA 1OTSC 4KJPD 4LLUA 1NCAL 3DX9A 3OBAA 5DVOA 4IOFC 1EAPB 2FYYA 5DJ2B 3O3AB 4WW1B 4PRBA 5K9JL 4GRWF 1LD9B 2XY2A 1E4XL 1ADQL 5SV4A 2APTA 4YBLC 3S5LG 3QHTC 3RZCA 5HHQA 1MRDL 2OCFD 4F37F 3DBXA 3RY5A 4L3AA 1EEQA 4JKLA 2FH6A 4O5LH 1A9EB 5F7WC 1I9IH 1F6AB 2G2RA 3ZDYE 5DYOA 2HFEB 1GZPA 3BZ4B 2BRQA 1UXSA 3I50H 5SX5H 4R2GD 1BFVL 3FTGA 4G6ML 3L3IA 5F72S 3UEZA 1L0YA 1A6ZA 5I74C 5J6GB 5GIRA 5DC0A 5F96H 3HNTH 3QH3A 5HHPB 5DVMA 5IW1B 3X3FH 5FK9A 3DTXB 3T77B 1DEEB 2IH1B 4OV5B 1V7ML 3RAJL 1XCTB 1A47A 3KPNB 4LPCA 2VDKH 4OZHE 3CH1B 5D1ZB 2A83B 3GRWH 1HOCB 3NFSH 1EO8H 1RAMA 4HKJA 3RY4A 4P59H 1RUML 3CFDA 4C83A 4LF3A 2Q8BL 3NCEB 3DHJA 5CJQH 1FH5H 4PJFB 4KKLC 3QIUA 2FO4A 2OP4H 4FP8H 3TFKD 4XPGH 4U6YB 3VXMB 4JG0L 4JM2B 3FFCA 4LEOB 3H3BC 3H2WA 4D9LH 1NMCC 4M7JL 2RAMA 1UG9A 5F6HI 2WWMD 5D7JA 1CICC 1P9MC 2FATH 4PG9A 3RKDD 1N64L 2IPUK 4ZDHA 4MX7B 5HHMD 3QPQD 1FSKC 3HZMA 3SE8H 4LK4A 2CD0A 5IFJA 4ELKA 4O9HL 3KYNB 4QTIH 4GW1A 1AY1H 3SDAB 4JO2H 3UTQA 1NGPH 1WBZB 3OJDA 7FABL 5HHXH 4ZYKB 4DK3A 3HC4L 4HWBL 3R0MA 2RHEA 3HUJF 4W4OC 1KXQE 1MWAH 3LS5L 3QQ4B 3MFFB 4XBGA 5FA4A 5HHXL 1NGPL 7FABH 4JFEB 3MRBB 3FHAA 4GQ9H 4O9HH 4NC1C 5EDXA 2VLKD 4XPTH 3C08H 1N64H 4PFEA 4N8VA 1FQ9C 3QUMA 1FV1A 1GHFL 5AUMB 3EJZC 1G9NC 3HB3C 4P5TA 3RPIB 5I2IB 5F7LB 1NJ9B 3LQZA 1FNSH 2V17H 3BEWA 2VXUH 5D1ZC 4I0PA 1LNUB 3CDYA 3MRHA 2YBRB 4KGJA 3SO3B 2QEJA 1AI1H 3NFSL 4PV9B 4P3CL 1OY3B 5GSVB 3B4NA 1XEDA 1TJGL 4XVSL 5ELIA 2X1QA 2BC4A 4NBXB 5D72L 2P42B 4NKMB 1JHKH 3PUCA 1BVKB 1VB9A 4NCC2 4MQ7A 1AXSA 4X6CB 3GSNH 2HRPH 1AO7D 3JWDH 3VFOB 5JW5B 1IBGL 1T0NB 1NKRA 1OD9A 1NAMA 1A1MA 4YO0B 4CW1A 3QUYB 3TBWB 3KPSA 3GGWB 1OT1A 4PREA 5GS0L 2UVFA 4LGPB 4NUJA 1QP1A 4HFUL 3H9HA 1NDGA 3KLAA 1RY7B 1MLCB 1WBYA 5F7KC 2VDRL 3B6SA 1WEJL 1DUZB 1HIMH 2DQEL 4IDLA 5ITFB 1XR8B 5FDWB 2EH7H 1JZ3A 5DJ6B 3CK0L 2GSGB 5IV2B 3NCJL 2WP3O 1RIUL 1T6WA 1I7ZB 4MXQD 4NCC1 5HYJA 3KS0J 4PRHB 1CD1A 3KXFB 3U82B 3OG4B 3UTZA 1I1CA 1LHZA 3TV3H 3GMQA 3ZKSD 5CILH 2DKUA 2W0PA 4X99B 5CZVH 3L7FB 1E6JH 3MV8B 4C55A 2AGJL 1I3VA 3AFLA 2C7UA 4P3DB 3OXRA 4X9GA 4K2UH 4GBXA 4L1HA 5EFIA 5BZWB 3VH8A 1TZHB 3CLFL 1KJ2H 1OAZH 3TBYB 5C0DB 1BJ8A 3BRFA 1MCJA 2XTLA 1PAMA 1RJYA 3QHZH 4JO1L 1AHWB 1M7XA 1XR9B 3TGXA 4PJEA 3AU1B 1CN4A 5DRNA 5A2IH 2JJTC 4R97C 1BJMA 4JFXA 5E2JA 2VLLB 3E2HB 3HPLA 3AROA 3MA9L 1U58B 4XP1L 3U0TA 1GGTA 1MFAL 3G6JF 5CKAA 3O3UN 3F7VA 3LN4A 4U1JA 1DSFL 1BZ9B 4R7DB 1MHPH 4MD5A 5KSUB 3QFJE 2QQKL 5CSGA 1X5YA 2F19L 3Q0HA 4GW4B 3U7AA 5JXAL 3HCVB 1CFNA 1ACYH 5GZOD 5TE7L 1Z3GH 3GHEL 2OI9C 2AEPL 3WLBA 5HI5C 4OZIE 2C3XA 2VC2L 2ZUQB 3A67L 3GNMH 3WXVH 4L3CB 5EN2A 2Y7QB 1IKNA 4EN3D 2EIZA 1IE5A 1WZMA 3FQNB 2AXFA 4XP9H 4R9HA 1CQKA 1S7SB 4UAOC 4OCLC 3MRFA 4XT1C 3QUXA 4X80H 5EZLB 4KQ4H 3PJSA 2NY5H 4HIJA 4W70A 2R1XB 3X14B 3VWKA 2AP2A 1S7WB 1UZ8B 3CCHA 5EOCL 5K9QI 4H20L 4TSCL 1DANT 3OKOA 2V9RA 4YHPB 4LLVB 3RGVA 3GBNH 1YC8A 4F80A 4N1HB 3O8XC 4OD2A 5MERA 5FIEA 4X9BA 1ES0B 2J4WH 1YMME 1EXUB 5IVXF 3BW9A 5K33A 3RL1B 3VGHA 1U95B 1S78C 1H5BC 2VIRA 5EZOH 2W9DH 3NFPA 4J8RA 1KIQB 5DJZA 4CDHA 5IOPA 2BVUA 5B4MC 4N0UA 2PW1A 1T3FB 3MRCB 1XGYH 1CFQA 4QHMA 4AK1A 3MGAA 5ADOL 2B2XH 1OM3H 5HPOA 2ZUUA 3HNVH 1CLZL 4NO3B 5C0JA 1I1YB 2YD9A 1G7MB 5D7IF 3KHQA 5H37G 1JMXA 4F33B 1CGTA 2DLTA 1J1XH 2AERT 2HLFD 1MREH 4KGLA 4XGZB 4KPHL 3ARED 1IM9D 4JQXA 2ICWJ 3C5ZA 3RY6A 4RFOL 1H3TA 1KC5L 2JCCA 3U0WL 4C56A 1LP9B 4XNUL 3TBVB 5C09A 4I3RH 5D1XA 2HLFC 3AMLA 1JUFA 1QSVA 1T2XA 5IF0A 4PJCF 4EEEA 3TF7C 4U6TA 1L0QA 4KAQL 1SMAA 4FTVB 1MOEA 4OB5L 2QBWA 1CIDA 1IGJB 4F57L 3W0WB 1I8IB 3M1BB 2V5TA 4JDZA 5SWZA 1CK0L 5IB3A 4CN6A 1FDLH 4UDTA 2BNQB 2BHUA 1K8DB 1DN0A 4TUOA 4XB8A 3C8HA 3DV6B 3O2DA 4K7PL 3V7MA 1GH7A 5FYKE 1QO3B 1QBMH 3D3VB 1EJOH 1CDIA 4N0YH 2D31B 3NA9H 1RULH 1R6VA 3ECBB 5MHSD 1N3NA 2GK0A 1I8KB 2VLRE 3U0PB 1MJUL 4ORGB 1J9CT 4NZRH 3HFMH 5TF0A 1T1YB 3BPOB 1JGVH 4JLRA 4MHHI 5IM7A 2NY6B 3BGFC 1JZ5A 5DMKB 5GGUB 5F6IB 3PGDA 3GHBL 4MA7H 2Q7YA 5H8DA 3E1F1 1CR9L 3CSGA 4HWUA 3CFBA 3FO2B 5HHMB 5JOPE 1CDCA 3O4LA 3L3KB 2PXYC 1D9KD 3SDAD 4L8SC 3B2VL 3HRZB 4IBLT 3LKPB 4NFCA 5F3HA 1WUNT 1NEZG 3WEXA 1RU9L 2QJDA 5J0BA 4PTTB 1U8QB 5GRWA 4L8DB 1H9VA 3QIUC 1YUHA 3L7EA 4M7KL 5DO2C 3P4MA 2A1WL 4ELMF 3KPSE 3WLWD 4XZUB 5C92A 4PJXF 4XP4H 2Q76A 2I5YH 4MB5A 1N5AB 1X5GA 4PP2A 2AJUH 4MJID 3VU2A 2Z92B 3QIUD 3T0EE 5A2KH 4P5MA 3O81A 1FVDB 3MRKA 4WNQB 1I7UB 4GXVH 5ACLA 3MLRH 3F7RA 3HI6H 4OGXH 4XVUC 4JKPL 1I3GH 5HDQL 4NSKA 1FZKB 3KJ6L 1H3UA 2YEZA 3N1QC 3GB7A 1TPXC 5E9DD 2F53B 2BVQB 2W65B 1H8OA 1X5IA 2IMNA 1VACB 4LRNH 1QFPA 2ZSWA 4PJ5D 1QTYT 4GXUN 4FQIH 1CU4H 3MFGB 4AH2B 1IZJA 5BS0A 5C09E 4ENEC 2O5YL 3WS6A 3VXSA 2NY6C 2NYYD 3BGFB 1KN2H 1QBLL 5HVHB 2YZ8A 1QYGL 1QPXA 1NMBH 3A6CL 1T2QH 2ITCA 2V7HB 3VGDA 5GGTA 4ZD3H 4P49A 5J56B 1U8JA 3M17B 3GMPB 4PJXA 4GG6F 3UO1H 4MCYA 3DBXB 3Q1SL 3WN5B 4Y19A 4XCYB 5CGTA 1F6AA 5FKAA 4X6CE 4O2EB 4P2OD 1D3CA 2R2EA 4ONFL 5I1LA 1IQDA 5DD5L 2YD4A 4S1SH 3DO3A 5DQJA 3RVUD 5F1IA 2Q20A 4JAMB 1BD2B 3S5LB 3K74B 1NBZA 1CXEA 4N9GA 1EAJA 1UH4A 1CBVH 5BJTB 5AD0A 2JJSA 4N0RA 5ADPL 1WCBA 3JSSA 4P2RD 1D5BB 5CGYD 3C6LB 4JPKL 2CXKA 1D5IH 5HGGS 1YEGL 3MREB 3D2UA 3TJEL 3DTXA 3T77A 3W5NA 5KVFH 1J11A 1A3LL 4JPWH 4YFLF 1IGML 5HGDB 4K9EH 4XPHH 5HSFA 5CCKL 3I9GL 1F4AA 4LCIH 3T09A 4Y5XC 5D5ME 2VQ1A 2FO4B 5E2VL 4FMKA 4Y5VC 3O2DH 4BUHA 1IAII 5FECA 3DYOA 2P7TA 4G9FA 4HX1B 2W0LA 3FFCB 4LEOA 3FB7B 25C8H 1A1NB 5M94B 1ONQB 3DETD 3BN3B 2V5SA 5FM4A 1I4FA 1N59B 1S5IH 2FNBA 4KDWA 1A9BB 4JHWL 1KTLA 2XZCH 3RKDC 5HHOB 1U8MA 1T1XB 2VYRE 3IFLH 1G9MC 4LKXA 1KEML 2OQJB 3WNPA 4AG4L 2Z8RA 5SWQA 1YN6A 1Q0XH 4DGYH 5L7XL 4ZFFA 3EFFA 2X4UB 4DJMA 3WIFB 1WBXB 4ZYKA 3S3JA 3SKJH 4H0IA 3I2CL 3QQ4A 1NGYB 2P5EA 3CUPB 4XH2A 5A2FA 5MI0C 2FECI 3A6BL 3ZLQC 5E6IA 2DMBA 3IDIA 1RZ7H 2VQUA 1QNZL 3VMPA 4RSVA 2AJVL 3SDAC 4M43L 3C5SB 3RZCD 3I75A 4PJ7A 5DJ8B 5H35B 3H9YA 1MAML 3UJIL 4TSAL 1PYWB 3GIZL 5DK3A 4HS6A 5IUSA 2V2TB 1PVHA 4XCFH 3WFCL 5I73B 1NMAH 3LQZB 5LBSL 4FZ8L 5BO1H 4X83A 4CVUA 4R0LB 4HIEB 4Q9CA 3A6OA 5D6DA 4I0PB 5IVXA 1BECA 4NO0B 1S7XB 1WK0A 4YXLL 4Z7NE 5J1TC 3QNXB 2YPLB 1YY8A 5D71H 4PV9A 5I1KH 4F7EB 3PWPA 4N5UA 3TZVC 1JNLL 4Z7VA 3UTOA 3V0VA 5IBLD 5HGBA 1DR9A 3MR9B 3RZCC 1MCNA 3P77B 5JPNA 5TF1H 4J6RL 5HVHC 4PRNA 1FCCA 1MFCH 2ZUQC 5ENWA 1MCLA 3JBG7 5JHLL 1CVRA 3NZHH 2HT2D 4OCSH 3TNNB 3VFRB 5JW5A 3RNKA 5MEQB 5AEAA 4YO0A 3UTSD 4FQXB 2VITB 3O41B 4TTGA 4ZTOL 1MUJB 1QFWI 1IMHC 1UJ3B 3VFGH 3LQAH 4XVJL 1NDGB 4W4OA 2HFTA 1J0KA 5E8DH 4F3FA 1KPRB 2IG2L 3B6SB 5GGVL 3LAFA 1JK8B 4KK6C 4UB0H 3ARDA 3O6LL 2A0LD 5FDWA 1KIPB 3F58L 4X8JB 1INEL 2R0ZH 4HW6A 5CD5D 3E2HC 2Y9RT 3SGEI 9CGTA 1CD1B 3QPXL 4HD9A 1RJCA 2F5AL 3Q3GB 2R9HC 5C08E 5IFHH 4HQQL 4ODXA 1AGCA 1JPFA 4JVWA 5M95B 1T89A 3E8UL 4XNZB 1OTUD 4PJHA 2XTJB 3RWEA 3WXWL 4NYLA 1KUMA 2E7LC 4F9LC 1XIWB 1EO5A 1TCRA 4KV5F 5C0BA 5C0CD 3KDMA 3VXNA 3BVNB 3ULUL 3MUZ1 2X4SA 3QEQB 4FFVC 4LSSH 4JVUA 4KRPB 4PJEB 2J6EL 2PYEB 1R3IH 5JXED 5JW4Q 1TQBC 2HTKC 4U1SB 3Q5YA 3EYUL 2BDNH 2AVGA 4PJ9C 2ZSVA 1WSST 4HT1H 3HPLB 1B4JH 2AKRB 3MBEB 1FC2D 5IHUH 2Z9TA 3WNMA 5FKPB 3TZVB 2NPLX 4Z76A 4TRPL 3UC0L 1MF2H 3C8KB 1XF5B 4KI5D 3WO3B 1BZ9A 4NZTH 1F3RB 4TN9A 1FFOA 3IXTA 5HYFA 5C0AA 5FCUH 4LCWE 2NW2A 2V7NA 1N8ZA 4GW4A 1W72B 2FZ3A 2KUTA 3QUYC 3IVKA 3MNVA 3WJLA 3IYLW 3QIWC 2AEWA 1TVHB 4I5BA 3HE7B 4K8RL 5JMOC 4PTUA 5I8CA 2CO7B 1AXTL 5A2LH 4OLUH 3SGJC 3HE6A 1U92A 2EIZB 1BVLA 4QHNA 5DD3L 1KXTB 2YPKA 1D9KB 2JB5L 3BIBX 4Y2DA 5EZLA 2WIIA 4W4NA 4I9WE 3WSQL 4EDXB 4ZFGH 3T3PF 5TH2A 1I7RB 2H3NB 1X44A 4QT5A 1UZ8A 2X44D 1N0XL 4P9ML 4ELMA 1UXWA 3IRPX 3S88L 3SPVB 5D70L 3LKOA 2XFXB 1TDQA 4HXAH 1JYVA 3CFEB 1OARH 1DQDH 1R3JA 4TYUA 2AJ3B 1A02N 4PJFE 5HGHA 1EXUA 3BW9B 4FG6C 3RL1A 1FYTA 2VOTA 4UT9H 4KQ3H 4WEMB 4JJ5A 4MJIB 4ZMAT 4DUXA 3V6ZB 2Q86A 4KY1L 3MRQB 1DFBH 3GSQA 4AEIL 4EDWL 5I1HH 4GKNA 5KVEL 4XP6H 3V0WL 4GAJL 1WVZA 4LASH 1MHCB 1NBYA 4LSVH 5E9DB 5I30L 4E9LA 3ARWA 4U6VL 3PG2A 1T0MA 3PABA 2NTFB 1G7MA 5CUSL 4TNVK 5IVOA 2B4CL 4NNXB 2VKXA 1ZT4B 4NP4H 3LN9A 4DTGH 4QRPE 4Z78B 3C6LC 3P0VL 4UMGA 2JB6A 4WCYL 1G9MH 1AKJA 1OP9A 1ZHLB 3DV4A 4NQXA 1BF2A 2WWKT 4CN1A 5E2TL 4K9EC 4FABH 3O6ML 2MFNA 3INUH 2C4FT 3C5ZB 4Q6YA 3F6IA 4UIMB 2YD2A 3S98A 3TPKA 1S7RA 1TZIA 1HN1A 3OB8A 5INDB 4X7DC 1AXIB 5KS9F 2VKWA 3QT2A 5HJ3B 5JPMB 4U1NA 2A77H 4RMRA 1U6AL 1NL0L 4HDIA 5C0CE 2OTWA 2NY2D 5DWUL 2HN7A 4ODUB 2E9JA 2HFFB 1IGJA 4ODHL 2CUIA 5F1NA 3IDJA 5ESVB 3TT3H 2X4RA 4OQTA 1IAKA 1ZAGA 4LNRB 1FG9C 3C6LD 3BP6A 4NOBA 1I9JL 3WUWG 4L9LB 4HG4J 2BNQA 3H0TB 4LLYB 5T3ZL 4DZ8A 1H3VA 4FQXC 4LCUA 4RGND 4G3YL 2XXMB 5FYJH 1QO3A 3CC5B 3V6OA 1G9EA 2XZAH 1IGYB 3GEWB 4KTDH 5TDOB 4LSPL 4U1HB 2VLJD 5L8JB 2EDYA 1K5NB 2DL2A 5EUKA 1JNNL 1A3QA 2DKMA 2OI9B 3U0PA 3VE0A 2QSCL 1BWMA 5L9DL 2DL9A 3OHXB 4LAQL 1MWAA 1RZ8A 4WRLA 1EA9C 3VWKC 3VRJA 5EZIL 1I1FA 1B2WH 2XT1B 3KVQA 3QCUH