4L3CB

Structure of hla-a2 in complex with d76n b2m mutant and ny-eso1 double mutant
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
b'MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKNEYACRVNHVTLSQPKIVKWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Class I Major Histocompatibility Complex, the Trojan Horse for Secretion of Amyloidogenic beta 2-Microglobulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 14
structure length 100
sequence length 100
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X, Z, b
ec nomenclature
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l3cB00
1JHKL 4EOWH 4HMCA 4WHYG 2HG5B 3CDGA 3TGXA 4OV5A 1INQA 5C0RH 2XZZA 5A2LH 1YEKH 1AR1D 4U0QB 4NM4H 1RQ5A 1XGYL 2VXTH 4PJDA 1D6VL 4NHCH 2VLMD 1QFOA 1OW0A 3BH8B 2VRAA 4HZLB 3FO0L 4F57H 2ATPA 1TETH 5DYOA 2W9LA 4HGKC 5DA0B 3KLDA 5E2UH 1Q9OA 4JFHD 4JY4A 5DEZA 1B0RA 2A1WL 2DICA 2NYYD 4HKXB 5FO7A 5BO1L 5E9DA 4XCYA 1AFVL 1IKNC 1IL1A 3L5IA 3P11H 4QHLA 1A3LL 3LDBB 4GMTH 1YQ2A 3Q5YA 1FFOB 2FB4H 4PG9A 1MCOL 4WFED 2NXYB 4JM2A 3P4LA 3QFJB 4FFVD 4GT7A 5EIVA 1OW0C 1TQCC 1YPZE 4ZSOB 2PR4H 2ZUSA 3JTSB 4PRID 1MSPA 4JPVH 5D2NA 4HX1B 3OJDA 5T3ZH 5TDNA 1IGTB 1XGPB 4M7LH 2XN9B 4MCYA 2KL6A 4Z7WF 4R8WH 1FNEA 1FN4A 3NIDF 4I2XE 3B8SA 5J57B 1M71B 3QWQB 2RIKA 3STLA 1HIMH 1J1OL 3I75B 1P4LA 5EORH 1RURH 3L6FB 1G7QB 5CZKA 4P5MB 4WCYH 5JW5A 5JDJA 2V2TA 4JFOA 3SEPA 1KJ3L 3MRQB 2QQNH 1UWGL 3ECBB 1Q1JH 3GMNA 3X12A 3QAZC 3OB0H 4HGWA 1RU9H 4U1LB 1KG0B 1UM6L 5JLZA 4BH7A 4EVNA 1ODAA 2EECA 4JR9H 1DN2A 5CIPA 3RUGE 2QQLH 4APQC 5DRZA 5F7FA 1QLRA 1EH9A 1MNUL 4JFQB 2B0SL 3KDMA 4ODWA 5E03A 4OZFA 1KENH 2XXCB 4NZRL 1IE5A 5EBMA 1JI2A 5EZLA 5B38A 5BS0D 3O3EB 2AJZB 3GKWL 1TCRA 4PREB 3WUWG 1IKFL 1B6DA 3F12A 4YIQA 3I6LD 4RWHA 3TVMB 4JRYD 1T4KB 3MO1A 3D39A 4E42B 1Q0YL 3KPRA 2WBJA 5ESQB 5DJDA 4ELMA 2PW2A 5CZVH 4X9GA 1CR9L 4XWGL 4QO1A 1WBZA 4ZAKA 3HNVH 1HKLH 2AXGA 4NO2B 4PB0H 1RJZB 4AEIL 3C5ZA 5DD5L 4QT5A 3QUKA 4P5TA 2OI9C 5D7LD 3QCVL 4M4RA 4KH2A 2PO6C 4P2RA 3P30H 2CQVA 1U8IB 1MVUA 4HFWB 5HD8D 3T1FA 2ZUVA 5GGRY 1I8MA 3BD4A 1YECH 5A2JH 4KK6C 4G6JL 3O6LH 1R3LB 1ADQH 5DHYA 5I18L 2WWKT 2LTQB 4HJGB 3SKNB 2HLFC 4NWTL 5J56B 4I2XB 1AIFA 4KJYA 1E4WH 5TQ2L 5I1AA 2WBJC 4C83B 1KTLA 3NCMA 3RWIB 3PNWB 5CJQH 4F33A 3RY5A 3H9HA 1LO3L 4NNYB 1L7TH 3ZE0E 2HRPL 1N59B 2BERA 5DJYA 4GKZB 3O4LA 4DK6A 5J6HA 2DBLH 2DOCA 4P5TC 3LZFH 5KVFH 4P5KB 3HLAB 15C8L 1TITA 4WHDA 3SKOA 4UT6L 3VFGL 4G8EA 1EMTH 4G7YL 4KV5E 4OFKA 3RUGB 1YY8B 4RA3A 1U92A 1JV5A 2EXYD 3TBYB 1FZMA 1PD6A 2VABB 4LKXB 4ZUWA 1UZ6F 2J8UF 4JCMA 2IH3B 4R0LC 3B2VH 2GUOA 4R2GC 3IFLL 2C7UB 5IHUL 3MXWL 1DN0B 1HH6A 1I3GH 5HHME 4U4BA 5DTFA 5F44A 4PJ5E 4MJ6B 5KN5A 3NCBB 3WKNA 1QLEL 4L4TE 3JWDL 1BIIB 3VXSA 2PTTA 4FP8H 2ERJC 5E99L 4YHNB 2X5PA 3BH9B 1E4XL 3DGGA 2AQ2A 3F7YA 1FGNL 4XCNA 2ZCLL 4PY8J 1PKQB 3SJVD 4LPCA 5JW3L 3TO2A 1MFBH 1MCLA 3OB8A 3P9LA 3BO8B 3PIQA 3KLAA 1V3JA 1D9KA 5MEPA 1Z0NA 3U36B 2MCG1 3QEUA 2C1OB 5IROA 4JPIB 2MKLC 1NUFA 1CXKA 3CFJA 5BCAA 3N1FC 3S36H 4CW1A 3IDXH 2FGZA 2DWEA 4PJ9D 1RZ8A 25C8L 3QEHB 3HR5A 4TVPL 1GOGA 5ILTH 3BN9C 4MWFB 5DMJB 2P8LB 4PJEA 3IRPX 1S3KH 5C0AA 5FO9A 3SKJL 3V4VH 1NGZA 3MACH 2ESVA 4MNGA 2P5EB 4X7CC 4K3DH 1I9RL 4CMMA 1WZLA 2I5YH 1A21A 4LOUC 7FABH 2NY1C 4GKOA 1CLOH 2DLTA 2J6EH 1AP2A 4JB9H 3V0VA 3NAAH 1L7IH 2XICA 3AMLA 4LF3A 2NY6D 4EUPA 3GMRA 4CVXB 1AGDB 3Q0HA 3HZYB 5IROC 3BDYH 4QXTB 4E0RB 3JV4B 5A2IH 4JKPH 2BHUA 1BFSA 5CP3A 3MLVH 3IS1X 1IFHL 2X4RB 4GBXB 4HCRH 1LO2L 1EAPA 5I1KH 1HHHA 4J12A 1KFAL 2MHAB 3IDJB 4S1RH 4PJ5B 4ZUVA 3PWNB 3IFNL 1BFOA 2DIJA 4KUCF 5JHLL 3GZKA 1YNLL 1YYLH 5CKAA 1KCLA 4OZIE 5C09D 1H15B 2G5BB 2X7LB 3FZUC 1TZIB 4F7MB 3MNVB 3BIKA 1FDLL 1QO3A 5EU4B 4J3SA 3QHZL 5CBAA 2GTZB 3HR6A 4BFBD 5I6XB 1I1FB 2EH7L 3ULUE 3FO2A 2OZ4H 4LSPH 4JO2L 1UB6B 2YBRA 1T22B 5EOCJ 4J3UA 1AE6H 4OF7A 3IFOB 5DUML 2ZKHH 5KS9B 3K3QA 1HH9B 2AV7B 4D9RD 4ODHL 2DQEH 4KRPC 1TTUA 4OD2B 2WW8A 3LKOA 1F5WA 4RZCB 5CHNA 2B5IC 5IQ7H 2XWJB 2BDNH 4KI1A 2DQUL 4YHML 5GRVK 1JNHB 1QA9B 2J5LC 1HE7A 3HG1D 5DSCA 4WO4A 3ARDB 2NXZD 5BRZD 3HCVA 1HZHL 1GOHA 3O3BB 3RRQA 4U6VH 3SCMB 3O2WL 4GAJL 3MOAH 1U42A 4B7LA 1A7NL 2B1AL 3RL2B 4HUUA 3R0NA 4RFEB 4FZEH 3D3VD 3IFPA 1MEXL 1S5IL 2P5WD 5EBWA 4U1GC 2JELL 2GQHA 1I1YA 2B4CL 5GGSA 2YR3A 1TPXB 4LVNC 5ITFB 1CGSL 4HC1A 5D1QD 1N5YL 1GAFH 3QDGE 5E9DE 2O5YH 3OKEB 4HDIA 3T4YA 2APBA 4JFFE 4OF8A 2F53A 4AK1A 1WFUA 4K23L 3EJYD 5MP6H 2R15A 3KPOB 5JW4N 2IQAB 2AK4D 2L7JA 1A7BA 4ZO7A 2H9GB 4ONHB 3KXFA 1AY1H 3TH3T 1Q9KB 3IAGC 1OD9A 3DETC 4NFDA 3EOAA 2IBZY 2OBGA 3O9WA 3DV4A 5GRUL 3LD8C 5D2NE 5EC2A 5E5MA 1ND0B 3VXQA 1A6PA 3MFFB 5DQJA 1CGWA 5HXMA 2HKFH 4JDTH 1CZ8H 2CRYA 2R1WB 2VL4A 4O2EB 2VDOL 1U91A 3HAEA 4NJ9H 2GY7B 1XCTB 4NWUH 4NN7C 4FG6C 1MFAL 1YJDH 4BFEA 3U30B 1ZHLA 3H0TB 4KHXH 2FDBP 1NGXB 4U6TA 2GCYB 2Y06H 2Q87A 5CUSL 2VDPH 1GH7A 4MAYD 1PLGL 4OV5B 3NPSB 1SBSL 4ZFZB 3DUSA 4OT1L 3LAFA 3GIZH 1BQHG 4UV4L 3G6JE 2A0LD 4PG2A 5KOMC 2V7HA 3BISA 4PJDB 3G9AB 5I2IA 1EJOL 5HDLA 1CD1B 3MRHA 3SE3C 1EUTA 1PYWB 1PFCA 3UTPE 1ZAGA 4GG6A 1H3TA 1BBDH 3WJLA 1TZGH 3V6ZA 2ATPB 3GRWH 4NN6B 4KMLB 5DYOB 2A6JA 1LWRA 2CKBB 3FAWA 2YUWA 4NQVA 1ZVHA 4HPYL 1B0RB 1A5FL 4Y4HA 1BZ9B 3EOBA 3QDGB 32C2A 5AZ2L 5FO7B 5E9DB 3D9AH 4XCYB 1IL1B 2ZG2A 4Y89A 2X4OB 4QHLB 4YHIA 4LPXA 1G9MC 3F62A 3VG0L 3VWKA 4U3XA 2OP4H 3P4MA 1T03H 5D5ME 4PG9B 1QSZA 1ETZB 4JM2B 1N4XL 4DFIA 2Y9RT 3FN3A 4PJGE 4IMLA 1Y6NR 1ZVYA 3BE1H 4K8RH 3W5MA 3W9EA 2PCPA 2C26A 4WTXA 4UT9H 3CXHJ 1R5WA 1SY6H 4Y5YB 2A6DB 1RMFH 5D2NB 5TDNB 2DMKA 3OJDB 3U79A 1CGTA 4ONGL 3DIFA 4MCYB 2RGSA 2ZP0T 1FNEB 1FN4B 2D9CA 4ZMAT 1QHOA 1MLBA 4IRSD 3PL6B 1P4LB 5AWNL 4XPAL 3AU1A 1JPSH 4P9MH 4YDJA 1S7WB 3GJEA 5JW5B 2V2TB 4JFOB 3CX2A 1E4KA 1HCVA 4MJIA 1NMAL 4IRJD 2DM2A 3GMNB 3X12B 4HGWB 3IT8D 2RB8A 4NUGH 2Q86A 4U1MA 4EVNB 1BEYL 3U7WH 4L4VA 3FKUS 2P8PB 5CIPB 3PV6A 3ARGD 1QLRB 4PGCB 2YD2A 1U3HB 4HBCL 3KDMB 1RY7B 5TE4H 3R8QA 4OZFB 2VLKA 5EBMB 4LQFL 5EZLB 5EUOF 4PYHA 5B38B 5C0JA 2XWBA 3KPTA 3LEYL 1TCRB 3NACH 3T0DA 2FEDD 3F12B 4X7SL 4UINH 2J3SA 3N85H 1MCKA 2R8SH 3D39B 3LRGA 3KPRB 1UXSA 4OM0H 5DJDB 4ELMB 2PW2B 5HY9A 3VXSE 2MQ0A 3RTQC 4OKVA 4ZAKB 4TNVK 3MV9D 3BD3A 5EU6D 5FA3A 2VKXA 5F96H 4LPYA 4F9LA 4A6YB 3VFRA 3C5ZB 4QT5B 5KSAD 5D6CA 4DKFL 2V5YA 1CL7I 1KC5H 3CCHA 3ULVF 3GDBA 4P2RB 3SDAD 3MR9A 3T1FB 1I8MB 3S5LA 3N9GL 5GSVA 4PJBA 1KYOJ 5DHYB 5J06A 3OPZL 2IBGA 1RIVL 4DVRH 1A6AA 2E7LA 1A4JA 4KUZH 2RQ8A 1AIFB 4KJYB 3OAUH 5I1AB 1KTLB 3TNMA 4WHCA 4KQ4H 3DSFL 1C7TA 4F7CA 3RWFB 1OTUD 5DC4B 3U1SH 4F33B 1H3WM 3H9HB 2DLHA 3MBEB 5MENA 5IVXF 2ESVE 2WINA 2YRPA 4YR6A 2VOTA 4XC3H 3A6CH 3O4LB 5J6HB 3MX0A 1T0NA 2Y6SD 4M62H 4HUXA 1PG7X 2VL5A 4WEMB 3SKOB 4S0SD 3FRPG 1UJ3B 4G8EB 4LPTA 4QXGH 3BW9B 5EA0H 5HGHA 3WLBA 4ZPTA 2YHGA 5C7XL 4JZJA 2Y5EA 4Y19A 5TE6H 2X44D 3WIIL 5CMAA 1U92B 5E1HB 1JV5B 1FZMB 1T6VN 3V4UL 4H8WL 4KK8C 1J8HD 3U7YL 4QRQA 3TZVA 3AS1A 4CKVX 5AZEH 2NY3B 1T20A 2DL2A 2GUOB 1JGEA 1XR9A 3HB3C 4HJ0C 4OQTH 1IGML 1FO0H 3Q1SH 1A6VL 3QO0A 5DTFB 2ZCLH 1WLHA 3V52L 4LEOA 2EDJA 1WSST 4U6XA 4OSUL 5JW3H 4M9PA 2KDGA 4TSCL 4I0PC 3VXSB 2PTTB 1O0VA 4I0CC 1B4JH 3PGCA 1Y0LA 1N7ML 3F7YB 5GGVY 3X3FL 1BQLH 4XCNB 4JFXA 1T3FB 4OV6F 3MROA 1KB5H 4ORGA 2DTML 3QYCA 5GRXG 4RNRA 2YZ1A 3TO2B 1JHLH 1K2DA 3C8KB 3U7AA 3U4AA 3P9LB 3WIHH 3PIQB 3KLAB 4LIQL 1D9KB 5MEPB 4YWGH 5H8DA 2OJZL 2AJ3A 1UKTA 3QEUB 4XT1C 1F3DJ 1MCEA 2WWKO 4JQIL 4LVHB 3CFJB 4X5LA 4YC2B 2OTWA 2DWEB 1UACH 1TFHA 2UVEA 3JXAA 1RZ8B 4LNVA 3HR5B 3HN3A 2SEBA 3NTCL 3I50H 4LAJH 4PJEB 1KTKE 4S1DD 1A7PH 1K8DA 3EFFB 5C0AB 1NGZB 3CSBA 2X89A 2ESVB 5BV7C 4DVBA 5ADOH 1W72H 4CMMB 3MRCA 3F6IA 1B0GA 4MJ2A 3A67H 2WUCL 5ID1A 5L7XL 3L5WA 2DF3A 1AP2B 3V0VB 5JOEA 4GMSL 3MLYL 5SWSD 4LF3B 4Z7NF 1KFAH 3GMRB 3QUYD 1F8TH 2YKLH 4LRIC 1SJVA 3WKMH 2NY4B 5D70L 4HQQL 3WCYA 4JFEA 1CGXA 2J8HA 3HFML 1EAPB 2IFFH 1HHHB 1BFVL 1WZMA 3IJSA 5H94A 3KXFE 4URTB 4L3AA 2ARJA 4ZUVB 4X4MA 1GC1C 3KPMB 5F1OB 4FZ8L 4PP2A 5BVJA 2CDFA 1RHFA 3GGWA 5IK3A 3QDMD 1BECA 2OTPA 3CFKA 3EJJX 5IKCA 3BIKB 5TE7L 5CGYD 5FYKE 1TDQA 4LASL 4YBHA 5CBAB 3FN0L 3T04D 1GRWA 3FO2B 4OLWH 3ZTNL 2DI7A 2YN5A 2YBRB 3I9GH 2AK1L 2Y07H 1ORSA 4G6FB 2BFVH 5D7SL 4RMWA 3ROLA 5JXED 3MJ8A 5CEZE 3IDYB 4E41D 4LGSB 5D1XC 3G5ZA 1AO7D 1II4E 1HZHH 2EDKA 4RQQA 3LKOB 2B1AH 5EC1B 5CHNB 2HJKA 2IH1A 4R26H 2I24N 3GI9L 4OCNC 4CMHC 4PJXA 3S97C 1OAXH 4HWZA 1K4DA 5DSCB 4WO4B 4Y4KA 3ELAT 5BW7C 4HFUL 1CGSH 3UAJC 1GGIL 3OV6A 1IEAA 3HCVB 4FQJL 1PJ9A 1XH3A 1KIRA 2YWYA 1G9NC 2Q7YA 5JW4Q 4HUUB 2JB6A 2W0KA 4B50A 2ZG1A 4J23A 2IADA 1KLFA 2GAZB 3IFPB 1CICC 5HYJA 1IAMA 1I1YB 4FQ2L 3RI5F 5GGSB 4P49A 1KB9J 4JN1L 3JUZA 3SE9L 5EZOL 4JG1H 4YNYA 2CD0A 3RI5K 4WDIA 3IETB 3T4YB 5A2FA 1CFSA 2F53B 2OLDA 4XC1H 4NQEE 1QG3A 4CVWA 1S78D 4PJAE 1UEMA 3PWVA 2Y4SA 4WU7A 5TF0A 5JIKA 2IPUK 5AYUL 1XIWA 4YBLB 2BCKA 3NGBB 4OM1H 3VD3A 4N8VG 3KXFB 1MRDL 3CSYA 2MQ3A 1URLA 1P1ZA 1M7IA 4Y1AE 3EOAB 2KBGA 3EYQD 3I6GA 4WY7L 4K7FB 2IEPA 3O9WB 3DV4B 5EC2B 4ISVB 5E5MB 4CU7A 3VXQB 5IW1B 5DQJB 1S9YA 4X6FA 5DHXB 2D3VA 1A1OB 5JXAH 3KJ6H 3BDXA 5SWZE 1D5BA 2VDLH 3TBSA 2RFXB 2QSVA 4P99A 5LCVL 1LMKA 1U91B 4P46D 2LAGB 3EO1B 4ODVL 2R0LL 3WN5A 3S37L 3H9ZA 1AQKL 2PYEE 3C2SA 1NEZG 2AV1A 5T1LA 3QEQD 2BY2A 1A7QL 3UTOA 1BIHA 4JJ5B 5KTEH 4XB8A 1T1YA 4NHUA 1J0YA 5BMFL 1LP9F 4NRXA 3LH2H 4OQ1A 3RZCC 3UBXG 2V7HB 3HPLA 4XP6L 4N0UA 4LSSL 1WWBX 5I2IB 4R7DA 1OB1A 4NGHL 3MRHB 5EOCH 3UYPA 2R2EA 4GG6B 4YE4H 2QHLA 1F4HA 3NH7L 3V6ZB 3KS0J 3CXHK 3OMZA 4LSUL 4PJHF 4GKNA 1NMBH 4ONOA 2P49B 4WFGD 3BKJL 4K7PX 2DQIL 4Y4HB 5F9OL 32C2B 1MHHA 2R4RL 1N4XH 3GBLA 2VDKH 4YHIB 2XZAL 4I18A 3CVIH 3O6FC 2IPUG 2ZJSH 3VWKB 2WZPD 5IUSA 5M7QA 4HKBB 1RZIA 2HJLA 2EIDA 2VAAA 3HI6L 4LHQB 1X7QA 4IMLB 5EU7C 5B4MD 3EDFA 1R5WB 4ZS6D 1CK0L 1HHIA 2V5RA 3P77A 4WFHD 4YDKL 1QNZH 3UTTE 4HWNA 3HUJE 2XRAL 3WLWD 3DIFB 4A2MA 2GT9B 4HIXH 1ITBB 4KJQC 2XACC 4GRWF 2CIKA 3FMGH 2Q8AL 5DWUL 3AU1B 2MTPA 4YDJB 5MENE 3GJEB 3R1GL 3UTSA 3WO4B 4MJIB 4HBCH 4K94H 3MLUL 1HOCA 3TWCL 3DX9A 3DBXA 1A9BA 3T0WA 4U1MB 4D0CA 4BJLA 4F3FA 3MC0A 4L4VB 3QIUB 3QZWG 5JW4M 1QSVA 1VGKA 2MQCA 3PV6B 4ENEC 5HYSG 5IW6A 5DJ6A 3MV7E 1CFTA 1L4IA 1I7TA 5DMYA 3VDBA 5CZXC 2VLKB 3BQUD 4QRPD 2BJML 5C0JB 1JPTH 1KEML 1MCHA 3VW3L 3WEXA 4XCFL 4OD3H 5DUPL 3CVHL 4KFZC 3F58L 3H2WA 3GMOA 4PRAA 5J7CC 4NKMA 1ADQA 1KYOK 1UXSB 3FQXB 5IB3B 2FGWH 2B2XH 2OQJA 4EI5A 3HRPA 5HY9B 1PG7W 4RFOL 5AG9A 3SQOH 5A3ID 4OKVB 3IGAA 4TSAL 2WLYA 1OCWL 3N9GH 5FA3B 3O3UN 3SPVA 3WUWA 4LSVH 3H7BB 3VMNA 2ZUYA 3VFRB 5JR1H 3OJMB 5D6CB 1KJ2H 2DQGH 4D2NA 1QTYT 1FNHA 1AI1L 2BP3A 5KOVC 2W91A 3JBG7 3CCHB 4J3OC 5FYLH 4Z7VE 5FYJD 1RIHH 3MR9B 3S5LB 5GSVB 1FAIL 5DVLA 4DUWA 1U8OA 3UTTB 3UTZA 3QDAA 4U0RB 3GB7A 4JHBA 1K8IA 3EJZD 3AB0B 1A6AB 1A4JB 1EFXA 1YEIL 4YPJA 2VNCA 3TNMB 4V1DE 5J1AB 2OL3H 1BZQK 4X80L 4JZOA 1QFUH 5J4MA 5MENB 1DQTA 1VEOA 2UVFA 3GSNA 4YR6B 5KANI 3B5HA 1OHQA 2UWEF 4POZC 1JK8A 1T0NB 5IF0A 4WWKC 2HVKB 1FFPA 2P1YA 4HUXB 2VL5B 1IM9A 4MB4A 1I75A 2Z91A 3WLBB 1NFDF 4ZPTB 4JZJB 4Y19B 1JGLL 4WUUA 3QUZC 2EIZA 5CMAB 1P7QA 1EFQA 4PJIA 3U82B 1JRHH 1QSEE 3K7UA 3MV7B 3T0EA 4QRQB 1OGAD 3TZVB 1DBJL 4NQCD 1S7RA 4H20L 1U58A 1VADA 4F2MB 1T20B 5JIHA 2Z8SA 1JGEB 2EICA 1XR9B 4ZTOH 3CFCL 3KR3L 1FPTL 1LILA 3PQYA 2E5EA 1J0KA 4XBPB 3QO0B 1CBVH 2F54D 4OUOA 4X4ME 1GHFH 4X98A 5EO0A 4FFYH 4LEOB 3OZ9H 1O7SA 3JWOL 4U6XB 5JA8B 1OT2A 1AGBA 3FT2B 5DVMA 5CINH 3VRLE 2EDRA 3GFUA 3JWNC 3V7AG 5IG7A 4PLOB 3O81A 5C0BE 1U95A 2ZCHH 4JFXB 1CFNA 1NCBL 4XHJC 3MROB 4ORGB 2BNQA 1RJYA 4RNRB 5K9JH 3VWJA 4UTAH 1IGIL 1K2DB 3ZSTA 1VPOL 5T3XD 3BZDA 4EJ1C 2IF7A 2VLRE 4QRTA 3H42H 2J6EA 2NTFA 1X3DA 2FH6A 4P2OC 3OG4B 3QDHA 2OTWB 3MGTA 1JHTA 4QRRE 4YXLL 2H2SC 4M43H 4JQXC 2SEBB 4V1DB 5IMLA 1PG7L 2WUCH 1AH1A 5L7XH 1P53A 1CXEA 1K8DB 3MLYH 4S1SL 4WEBL 4PS4H 4DVBB 1RFDH 1YYML 1ZV5A 1JP5A 3MRCB 4GSDL 4EDXA 5KSBA 3FOMA 5HYJE 1B0GB 1RK0A 4APQD 5I71C 1WICA 1NL0L 2D7NA 2E9JA 3TJEL 4UTBL 4XHQA 4RRPG 5AUMA 1RZKC 1QSEB 2IGFH 3ESUF 4KTEL 4S1QL 5K33A 1MJ7L 4LNRB 2WBWB 3WL9B 1KBGH 4JFEB 2XZQH 2HRLA 1OPGL 1IAKB 2EDOA 3IJSB 2EZ0C 5H94B 5ACZB 2VQTA 2ARJB 4PP2B 2NX5A 4ZO6A 1QPXA 3KPNA 2CDFB 5BVJB 2F8XC 1CE6A 2JCCF 4JM4H 3GGWB 1JF6A 5IK3B 4YGAB 4N8PA 1G6RL 5DA4A 2JJTA 3CFKB 4H5SA 1GZQA 2JJUA 1YQVL 2YPLE 5IKCB 1FYTE 1BVLA 4PJ7F 1B4RA 4JG0L 2WWMC 3LMJH 1BAFH 1Z2KA 3K8LA 4EBQH 2PO6D 4G8GE 3T2QA 3ZKSD 2C4FU 1DZBA 1UKSA 1JZ3A 4GXVH 1C8PA 5D6DA 4L8DA 5J9PA 4KK6D 1NLBH 1ORSB 3ROLB 1NC2B 3MJ8B 2HLFD 3G5ZB 3QXWA 1KB9K 2WBJD 1SYSA 2HJKB 2IH1B 4NUJA 5MERB 3C8HA 2WV3A 4PJXB 4HWZB 2HTKC 1K4DB 3OAYK 4Y4KB 2JJTC 3TIDB 3EOTL 3DRTA 1T04A 3MRMA 4KTYA 1IEAB 1MCNA 4F80A 1E27A 1S7XA 1KIRB 1XH3B 4J8RA 4Q9RH 4P5TD 2Q7YB 2HFTA 4JANA 5C0CA 4JY5L 4RAHA 2IADB 1EGJA 1F3DH 1BX2A 5T3ZE 5HYJB 4Y88A 4LRNH 4HD9A 1T7ZA 5D6DC 2BZDA 2IFGA 4YNYB 4WDIB 5IJVA 1CFSB 3BEWA 2AAVA 5EOQL 3HC0A 1FBIH 5GIRA 4HWBL 1CVSC 5H35A 4R2GD 3EYUL 4G5ZH 1Z9MA 1P4IL 3VI4F 4WU7B 1PBYA 1BQUA 1XIWB 4U05A 2BCKB 4OGYH 3D2UD 1H0DB 1XF4A 3WFDL 1MI5E 1Q8MA 2C1PA 3CSYB 1NCTA 1M7IB 1NMCC 5HPMA 1FRGL 3C60C 4P3WA 1ZS8A 2ADJA 4MZ2A 1RAMA 1C08A 3L9RA 3IXTA 4XWOC 4OGZA 3VA2C 2OTUA 1S9YB 5GGSY 3S37H 3SGJC 1JWMB 5EIIB 2CXKA 1FYTB 2KUTA 3CLFL 2Z31C 1D5BB 4IRZH 2F5BL 3PV7A 2OMBA 3AAZA 5ISZA 5DUBA 1F58H 3UC0H 3WN5B 4OAWA 5FDYA 3MRJB 4NSKB 5T1LB 2C4FT 4BFGA 1T1YB 4NHUB 3MLXH 3CSPA 4FTVD 3ZDXE 1C16A 5H37H 4KGJA 4PB9L 3BN9D 4NRXB 2DIAA 1QBBA 4HUWA 3BPNC 3S6CA 1J88A 3HPLB 4N0UB 2Q8BL 4R7DB 1OB1B 2DLFL 3BKJH 2DQIH 5IT2H 1AJ7H 4XGZA 5FHBL 5F9JA 2KPNA 2R2EB 1N0XL 1MUJA 4R90H 4LOUD 2NY1D 1YEFH 5CGMA 3PWJA 1PY9A 3VXMA 1EHLH 4P4KA 4GKNB 1BQHA 4DGIL 3MV8E 4KZDH 5FIEA 3QIWC 2J1KA 1H3UA 1MHHB 4M7KH 4MXWL 4HWUA 1MPAH 4YBQC 3WIFA 1LEIA 2FJFA 2W07A 4I18B 5I16A 4LGRB 4Q0XH 3ULVL 1N2RA 4P2QE 1RZIB 3K4AA 5IMOA 2HJLB 1DQML 2ILLA 3MNZA 1X7QB 4RWYH 5BQ7A 2R0WH 5ICXA 2UYLB 3HMXH 1HHIB 1HILB 3P77B 5D7IE 3QISA 5TF1L 4K3EL 3PDDA 4LSDA 2K3TA 3FZUD 1YMMD 5CLWA 5B39G 5HHOD 3PP4H 4P3CL 3ZE1E 1SVZA 3OAYH 2G60L 3NA9H 2XY2A 4M3JA 4UOW1 1HHGA 4H0IA 3BKYL 3GSVA 3OKOB 4HHAA 2AJVL 4OCWH 4X7TA 2Y1VA 2AQ1A 5IBTL 3CLEH 2CIKB 4TQEH 2X9XA 2I60L 5JHDA 2IBZX 4BQ9A 5I1DB 5E8PB 4U2ZA 4DUVA 3LKRA 3RUGF 3UTSB 4HK0A 2YPVL 4ERSL 1MRFL 4KRPD 4K71C 1HOCB 4LLMB 2E3VA 3DRQA 2EDYA 5D71H 1A9BB 4Z7WE 5HI4C 1NPUA 5FGBC 4D0CB 4LBEA 4F3FB 3HE7C 1QRNE 3I2CH 1U8HA 1VGKB 4KRLB 2Q76A 1S9XA 3F58H 4X5XA 1U0QA 4MGXA 3LS5L 5DJ6B 5FO8A 1CFTB 2G5RA 4A2LA 3T0EE 2W0PA 4E9LA 3SGDH 4Z7QF 1KXQE 4Q6IA 4W4OC 4K7PL 3EGSA 3PABA 1VGEH 3C6LB 2XQYK 5CGTA 5HHVL 1GGTA 3GMOB 3E0GA 4PRAB 1J0IA 3X3GL 3OGOE 4QOKD 2OQJB 4B7IA 4EI5B 3J8F7 2BC4A 2UZIL 4XPHH 3KPSA 3CK0L 4HUMB 3WUWB 3SPVB 1N64L 3REWB 2R2BA 3KLSA 5EWIL 5JIPA 2XXMB 4P2QB 5JO5B 2BNQE 3QNZA 3DETD 1EEUA 3KS0H 2XG5A 3TN0C 1AGEA 4CU8A 3CDCA 1CTNA 3FFCE 3QXUA 3UTZB 4JO3L 4NZUL 1ULVA 2R56L 3GB7B 2DQDL 1K8IB 1EFXB 4G9FD 1LEKA 5E6YA 5HI3C 5LXGH 1AKJA 4E5XA 4KHTH 3V4PL 2D0GA 4FG6D 1DBBL 3W0WA 5D1ZA 2W9EH 4JZOB 5I75B 1DEDA 3ZE2F 3MBXH 1TXKA 4KV5F 1FO0A 5CILH 1WEJH 1DQJA 4O58L 5FHAL 5E2WL 3T3PF 3MODH 3GSNB 4EDWL 1A6ZA 1TQBC 3V6FB 5IF0B 1C5CH 1FFPB 4DN4H 2VISB 5KSBE 5FOBB 1IM9B 3MJ6A 5F21B 2RBLA 2Z91B 4OJFH 2VXVL 1T83C 5I1CL 2EIZB 3RWEA 1P7QB 4HIIB 4OGXH 4PJIB 2HA1A 2BY3A 1DSFH 4IOFC 3T0EB 1KB5A 2HH0H 3LQMA 4O5LH 3GM0A 4ZXBA 3JWOH 1CWVA 1S7RB 1WV7T 1U58B 1VADB 2J12B 3F8UB 2XQYG 1IC7L 1PGRB 2FD6L 1LO5A 2BVYA 1PQZB 3FRPA 3PQYB 1CL7L 4YFLF 1DANU 5EO0B 5I66A 1EO8H 5MI0B 5IHZA 4P0DA 3TEUA 1AGBB 1UZ6E 3VMOA 2D7PA 4S0TD 4N0FA 1B6UA 4LSTL 5IG7B 1U95B 5KS9F 1MCPH 3FQNA 1CFNB 4Q2ZA 3RVTC 2BNQB 3ZL4H 1RJYB 4ELKA 3VWJB 4GO6B 4I3RH 3QUXC 4XTRC 1CG9A 5DEFB 4KVCL 4HLJA 5J12C 3S34H 1WK0A 2GHWB 5EG6C 3VGGA 1IAII 3IDGA 2FO4B 4QRTB 5JQHC 2NTFB 3PGFH 3MJ9L 1DL7H 1JBJA 3B9KC 5B22A 2FJHA 2OSLB 4UB0L 2GJ6D 4PTUA 5FOJA 1JHTB 3IU4L 3AS0A 1DBAL 2Q6WA 4XAWH 5I1IL 5C0IB 5E00A 4M5YL 5IMLB 3D85D 1ZHNA 1C5BL 5IEHA 3BGFB 3LN4A 2F5AL 2FX9L 3T2PA 5TPWL 4JVUA 3EYFA 5E7BA 4BK5A 1MREH 5TGBA 4EDXB 3SDYL 2HFGL 5KSBB 5F3HA 1FV1B 1RK0B 4TN9A 3MLZH 4RISH 4NNPH 3ESVF 2VXSH 4O4YL 3T0XA 5ERWA 5CSZA 1MIEH 5FECA 1BGXL 1ZT1A 2EDDA 4PRIA 5KG9A 4KXZI 3QQ9C 4ACPA 3DX6A 2XZCH 2KH2B 1KN4L 4M4PA 1RVFL 4K9EH 4EI6A 3RX8A 3I02A 4PR5A 2D31A 2CJUL 3GBMH 2GJZA 2KZWA 4EN3A 4M6NL 2OR8A 1U3JA 2NX5B 3HE6C 3KPNB 3UYOD 1CE6B 5E2TL 2VQ1A 2VLLA 3ULUF 2V2XA 3RTQD 2XPGA 2PYFB 1DANT 4BUGA 4MA8H 4H5SB 1GZQB 1EA9C 1BVLB 1L0XA 1MHPH 4Q9QL 3TT3L 4ZPVA 4AH2B 4YFEA 1PVHA 5AG8A 5CJOH 3STBA 4BZ1H 4LLQA 1NCUA 4QHMA 5J13B 3FQRA 4GAYA 2R23A 5EZIL 1DTUA 1JFQH 5GHWH 3K1DA 3ZYOA 4N90D 4L8DB 2E9WA 5BS0A 5J9PB 4PJDF 5T1MA 1F90L 3V0WL 1RZJC 1R3IL 4EN3C 3M8OL 1HXMA 1T66C 3TNNA 3UJIH 1CS6A 4JRYA 4TRPL 4GW5A 4NUJB 2BY0A 4QKXB 4JE4B 3U0TA 4U7MA 5F1NA 5IW3A 1JGUL 3CDYA 1BJ8A 3UPCA 3MA7A 1IBGH 5LQBH 5ACLA 3DRTB 1T04B 1EK3A 4KVNL 2Y72A 3MRMB 3GHBL 3BPOB 3CZJA 5L9DL 2B4CC 1ZVSA 1E27B 1S7XB 4J8RB 1R24A 3WMSA 5C0CB 4AYFA 5ESVA 3Q5OA 4HWBH 3LS4L 1I3UA 4HEPG 3VXME 1OD7A 3EYUH 1BX2B 5D7LA 4OF5A 3WSQH 2CRZA 2Z8VC 1IRAY 4KK8D 4KKNA 5IJVB 5GJTL 4JM2F 3DI3B 3BEWB 1WQVT 3HC0B 3L7FA 5GIRB 5H35B 4HXAH 3HB3D 4PBXA 4HJ0D 4YHLH 1X5KA 3FB8A 3IVKB 4BQ8A 4OCYL 4UT7H 1PY4A 3UYRL 4KPHH 3IF1A 4CJ1A 1XF4B 3VFOA 2YRZA 4RMUA 2C1PB 5I73B 4WI3A 1P6FA 3L3OA 4I0PD 4GJTB 4ZOEA 1ZS8B 2ADJB 35C8L 1C08B 3L9RB 3VXTB 2OTUB 3F7VA 2AS5M 3B5TA 5FYJH 1NBVL 3MRKA 5IFJA 2EEDA 1IARB 2E9BA 1WAAA 3BWAB 4N8VA 5A1AA 1FFQA 2HFFA 1AGFA 3LHPL 2IANE 2X4QA 5C07E 5IVOA 3AAZB 4U31A 5DUBB 2YPKA 2VXUL 4OAWB 1ZGLP 2NZIA 3WS6C 4F37K 1NGPL 4POUB 1CGVA 4JFDE 4NQSB 1FSKC 1A6WH 3S3JA 1YEDA 3WJJA 3BIAX 2BSRA 2O5XL 1OAYL 1C16B 5D96C 1FQ9C 4HUWB 4BKLA 4YUEL 4L9LA 4LVOC 3HRZA 5I0ZA 2NW2A 2YS4A 4XGZB 2P44B 5DS8B 1NEZA 5F9JB 3CFBA 4ELMF 1MUJB 4O9HH 1KCRL 3SJVA 4W68A 3PWJB 1C5DA 2DWDA 3VXMB 4NJAH 2DQJL 2ARWA 3MSPA 3S4SG 3ZDYF 5JQ6L 3FOLA 5IJKA 4RFNC 1NGWA 4P4KB 1DVFC 1JYXA 2J88L 3OR6A 3UBXA 3QSKB 5KAQF 4HWEL 2CLZA 1WUNT 3WIFB 1LEIB 3KPSE 4FQQA 5TDPA 1YNKL 2FJFB 4XPTL 3MCLH 3WFZA 1N2RB 4DW2H 4PJ9A 1HYRC 2AJYL 1D5IH 2A73A 1RUML 2VR4A 4WNQA 1LO0H 3VMPA 4L9LC 2I9TA 3DYMA 3MNZB 1A14L 5BQ7B 1C7SA 3KWWA 5ICXB 1KIUA 2ITCA 5EZJA 5IBTH 3S98A 2C5DC 2V17L 5E56A 1G9ML 3A6OA 5T3XH 1OSZA 4XPFH 4C4KO 1YEEL 1HHGB 3VFWA 3GSVB 3GI8L 4HHAB 4F15B 2J7LA 5ANME 3W0WE 5JHDB 1FGVH 1HYSC 3OGCA 2C3XA 1OAUH 3LKRB 3AY4A 2FL5A 3QI9C 4GH7B 4HK0B 3MGOA 2ZPKL 4PJ9C 5I1EH 5D1XD 5IB4A 2O61A 2BSSA 3INUH 5BVPL 3SDCC 1NC4D 2EYRA 4LBEB 4U1NA 4OTXH 5L88L 1BP3B 1U8HB 4MAUH 2Q76B 1S9XB 4XZUA 4X5XB 1UA6H 4LARL 5BZWA 5FO8B 2PTUA 3UAJD 5GS1C 5C09A 1KJ2A 3TH4T 5IBUB 4Q6IB 1U6AL 2RHEA 2FYYA 4NNXA 5IB1B 1SEQL 4DEPC 3EGSB 2GJJA 2IPTH 3PABB 5DRWA 2ADGA 4ZS7H 1CICD 5C0EA 3NPZB 3GHEL 4XP9L 3HC4L 1LDSA 3LKPA 5HYSA 3MUGB 3Q6GL 5DRNB 2XTJC 5GISH 3RZWA 5F7UA 1NAML 4J2XA 4FFZH 3ARFC 4JO1L 4OIIH 4UDUB 6CGTA 4WVRA 3KPSB 1XR8A 5F89B 4M1DH 4TPRL 3TYGH 3UDWC 2R2BB 4PRHE 3LKNA 1UGNA 3IXAA 3VFUA 1SQ2N 4XX1G 2R56H 3OF6D 1UC6A 1MRCL 3HG1A 3GJFA 5CIPH 4CVZA 1TMCB 7CGTA 5FYKU 1F4XH 2CGRH 4WHTB 5BRZA 3RIAF 1AGEB 1DBKL 2XY1A 4OZFH 3SBWC 2UY6A 4YDLB 1NDGA 3RIAK 1CT8A 2NY0B 2WAHA 4XP4L 4Z77B 4LLUA 4J4PC 4PJEF 3TIEB 3S88H 4F7PA 1FL6A 3KAAA 4V2CB 3RL1B 4IEFB 2P5WA 3RGVC 1LEKB 1RUKH 1WWCA 4HPOL 4JDZA 2BX5A 1NDMA 1AKJB 5D1QA 2EDLA 3VXRE 4DGYH 3X13A 4GFTB 2ENSA 4GAGL 3K0WA 3MLSH 4KJPC 3W0WB 3T8XA 2ZUWA 3BAEH 5D1ZB 2DLIA 4G43A 1FO0B 4FA8A 5J6GA 1DQJB 3BGMA 3W82A 4BQCA 5KZCD 3NOIA 4MNQA 4ODSH 1A6ZB 3ZKXC 1OSPH 4RGMB 1TJIH 4WJ5A 2R1YA 4WFEE 4H8WC 1ZLSH 3O6KL 6FABL 3HMWH 3QFDB 5F97E 3FFDA 3TBVA 3WS3B 1F4YL 4QRUA 5IESH 3RZCD 4YX2L 2D03H 3BXNA 3L3KA 5CEYA 3RWEB 5HYFA 3EDKA 4LVEA 4PRIE 1I3RA 3Q3GA 1ZEAL 1KB5B 2R1XB 4MD4A 12E8H 3CU7A 3QG7L 4ZXBB 3CMGA 4XB7A 2ZSVA 3BP5A 2Z9TA 5DMIL 1LO5B 5EULV 5EBLA 5F9WB 3WXWL 4BUHA 3QXDA 1PAMA 4LSTH 4N5UA 1IEBA 5C3TA 5FFLA 1A0QH 1I1RA 2W9DL 5I66B 1NANH 2QLVB 2ZOLA 5FF6A 3NZHL 3V95A 1LHZA 5IHZB 3WNOA 5AAWA 4G3YL 1GGBH 4G8IA 4JKMA 2DQHL 4BSVA 3O6FD 1IGCL 4JRXE 2FECI 4JLRB 2CO7B 1WFNA 5ECJE 4N0FB 5HYIA 4MAYA 4ZNEA 3RVWC 4Y4FC 3FQNB 4Q2ZB 4XXDA 1X4ZA 1HQ4B 4I3SL 2EKSA 4ELKB 4IHOA 2R69L 2VERN 1MLCA 4KY1H 5ALCH 1CG9B 3C09C 4ZQKA 3OXRA 1I1AC 4OLUL 4AG4H 3IDGB 2RR3A 4WW2A 1MCSA 4L3CA 1BQSA 3L1OH 3WDJA 4KTDL 5HHMD 2FJHB 1RZ7L 3MTRA 2IWGA 4PTUB 3QG6A 4KJQD 3GBNH 4L4TD 3QBTB 1ZLWK 3WXVH 2Q6WB 4GQPH 5DFWH 5E00B 4HJJH 3GSUA 1ZHNB 4XMKH 4HG4J 5IEHB 3NA4A 4NN5B 3LN4B 3L7EA 4LLWA 1NJ9A 4PBVC 1MQKL 4OZGA 2CDEB 4NKDA 3EYFB 4MZ3A 5TGBB 1TVDA 3FT4A 5I30H 3CH8A 4ENED 3LQAL 3QDJD 3QPXL 2ICCA 4H1LG 5CSZB 5ERWB 5FECB 1ZT1B 4MD0A 5CZXD 4PRIB 4Y0GA 4O02H 5KG9B 3MJGX 1QUNA 5FM4A 3DX6B 5KVGH 4Z95L 4EI6B 4AEHL 3G9VA 1DLFL 1K9TA 1UFUA 1YEJL 2FX7H 1XAUA 3I02B 4IRSA 4Z5RA 4PR5B 1LO4L 4ZFGH 1UCBH 2D31B 3I3BA 3CXDL 3DO7A 4BFIA 1C1EL 5DD1H 3K2UH 4RRPA 5A16A 3BKMH 4UI2A 4Z7NE 2VQ1B 4RDQG 3S3PA 2VLLB 2P47B 2V2XB 3O0RL 2XPGB 1RUQL 2NR6C 1CU4L 4XPGL 3NFNA 2Y23A 4X9FA 1RUPH 2HTLC 1R3IH 3ARGA 1F4WH 1RV6X 4R4NC 5I17A 1GC1L 5JOFA 4LLQB 5HGAA 3EO0A 4QHMB 4EUPH 3ZTJH 3FQRB 4GAYB 2R23B 2R9HC 5GRYA 5BS0B 2NY5H 4OCRL 2YMXH 1RK1A 3K1KC 4OBSA 4XNUL 5JUEL 5T1MB 3RA7L 4YDIH 2R4SH 3SGKA 1LQSR 4XNXL 1HXMB 5CP3H 1KT2A 1UENA 4GG6F 4JRYB 1EEYA 1YMHA 4GLRH 4M5ZH 1BPVA 3U0TB 2DDQL 5F1NB 1CQKA 1BF2A 4XMPH 3MA7B 1QSFE 2WBKA 3W9DA 4POZD 2DQTL 3MV9A 1ZVSB 4WWKD 5EU6A 5GJTH 3WFEH 3I84A 4X6DA 2XOTA 5F6IC 2PXYC 3SJVE 1Y6MR 5ESVB 5KSAA 2W92A 2K7PA 2APFA 1T1XA 5EH1A 5D7LB 4AQOA 3O6ML 3QUZD 1BM3L 1OY3B 3ARXA 2NLJA 1HEZA 1JJUA 5J89A 4PUBH 1BWMA 2RCSL 1OAQL 4NZDA 3L7FB 5HPOA 2AJUH 1YN6B 1YEGL 4X83A 3S35X 3FB8B 4GG8B 3DXAE 4M48H 4PP1C 4N1CA 5GGTL 3IF1B 1BWWA 3VH8A 1NLDL 1NCWH 3NZ8A 1H5BA 5E8EA 2ZSWB 3MUHL 5F93C 1XGUA 3E8UH 4R97C 1T2QH 1I8LA 2HJFB 3THMH 4LCCA 5TFSH 1FH5H 2DM7A 1ZLWH 3F7VB 3HI5L 1UM4H 4RBPK 4WUUD 4XHJD 1T5WB 4NCC2 3DX8A 3MRKB 5IFJB 3LIZL 1KCUH 1U8JA 2DKMA 5GGVL 1ORQA 3KHOA 3MRFB 2HFFB 4JFFD 1AGFB 1CDGA 4HC1H 2D4FA 1J8HA 2P43B 2X4QB 5HGBA 2YPKB 4OLYL 1UXWA 5E8NA 4P2OD 3MYZA 5JORA 4J3XA 2QQKL 1E6OH 3JVGC 3PWLA 5E95B 1H5BC 2VDQL 4CRPA 1YEDB 3F7QA 2BSRB 1UJTA 4IMKA 5KW9H 2H2SD 3MOBH 2E9IA 4MMZC 3IDUA 4L29A 1NCAL 4MS8C 4BKLB 3G6DH 3HRZB 2NW2B 4WI2A 3AFLA 2BMKB 1NEZB 3CFBB 3WD5L 1SM3L 1DBMH 5FYLE 4F7TA 1M6OA 2E27L 3SJVB 3OKKA 3W39A 3HMXA 4C58B 4OLVH 1BZ7A 1C5DB 2DWDB 3VXUA 2CK2A 4YXHH 4XNMB 1XFPA 3O2VL 1DUYA 1NGWB 1LP9E 2VDRL 3OR6B 3HAEH 4X5WA 3RPKA 3IDIA 1ZTXH 3QRGL 43C9A 4ODUA 5EFIA 3ETBF 1UH3A 4G80A 2CLZB 3MLWL 1P4BL 3RAJL 5TDPB 4FQQB 1FNGA 4IMKC 4NKOA 2J8UA 5I19H 4KDTA 1G7LA 3DXAB 2LU3A 1JMZA 2XV6B 5EO1A 2EZ0D 2A73B 1QYGH 4FABL 1PW3A 5C6TL 1QBMH 4RGNE 4WNQB 3IJYA 2D7OA 2QSCL 4PJHE 1CGYA 5BRZE 2DD8L 4I77L 3UTPD 2GY5A 3BPLB 3KWWB 4WFFD 2ITCB 1QR1A 4UIKL 4AL8H 3TT1L 5F7EL 1H8NA 3CVHA 4JRWA 5HHXL 3S9DB 2R2HA 4MQSB 3D3VE 3DI2B 1OSZB 1G7MA 2FSEA 1FIGL 2WWMD 3VFWB 1KN2H 4M6OH 3U2SA 4Y5VA 5SWSA 2NY6B 2EC9U 3QUYA 3IYLW 3OGCB 3P3YA 4YAQA 2FL5B 2YA1A 4PJCA 5EU3A 1UWEL 3SE8H 3MGOB 5F6HJ 5J0BA 5B39A 5IB4B 2AK4E 1GPOL 2VB5A 2BSSB 5E2VL 1H8OA 3U46A 2WIMA 3L3HA 3AM8C 1SEQH 2EYRB 3SE4A 4NOBA 1FZKA 3L5XH 4U1NB 3DHMA 3SHSA 1VCAA 2HTKD 4D9LH 4F8TA 4WWID 4NO3A 5BZWB 3QDMA 3ZHLA 3GHEH 1MCFA 4LLVA 3HC4H 5GXBB 4LHJB 5C09B 1KJ2B 2Z4QA 4TNWK 1XF1A 2P7TA 2FYYB 1K4CA 4FN0A 1B3JA 3IDMA 4Y5VC 5DRWB 4Z78A 1RZGA 3EBAA 3EDEA 2QR0A 3TP4A 3UTQA 4HK3N 4TPRH 1ACYH 5I74C 1RULL 3MBED 3LKPB 4EQ3A 5HYSB 4RBPH 4K3JL 4XVJL 5D93C 1QFWH 3N1QC 4M1CC 4PRPD 1A7RL 3V2AR 2OS7A 5M95B 4E41A 1AO7A 3EYVA 1KPRA 1XR8B 1ZWIA 4WI6A 3EZ8A 4AY0A 3UJJL 1LD9A 1U93A 3CFIC 3LKNB 3VFUB 5GGQL 1T7VA 4XMLH 4LP4A 3HG1B 5HI5C 3GJFB 4CVZB 5HGGS 5LG1A 1X6LA 2NXZB 3ZT6A 1FJ1B 5BRZB 3C60D 1H3VA 1MFDH 4BELD 5JPNA 1MWAH 1NDGB 1CT8B 4XWOD 4LLUB 4G6ML 3P2TA 1FL6B 5KSUA 1J0ZA 3D3VB 4LCWE 3V6OE 2P5WB 2Z31D 1U8MA 3RWJA 1H3PH 2VZTA 3SKMA 4JDZB 1NDMB 5D1QB 4N0RA 4ZUUA 1CVRA 4ZD3H 5KANG 3RY4A 3T8XB 5SV4A 2QKIA 2D0HA 3L3IB 5CAYB 2OMNA 4G43B 5J6GB 2ZG3A 2ZCKH 3NCCB 3BGMB 4L3EE 1HQRA 2GSGB 1IT9H 4WJ5B 5F9AC 2AK4B 3EYOA 3TBTA 3NIGF 1L6ZA 3KJ4C 5EIQA 1HNFA 3VGEA 3FFDB 3TBVB 4QRUB 2ZUQB 5BZDA 3L3KB 5CEYB 1BD2E 4XP1L 1I3RB 4M1GH 4C59B 3Q3GB 2XQBL 4P9HL 1U2HA 3E6FB 4MD4B 2W9DH 5DFTA 2FX8H 2MOVA 2CMRH 4XBEH 5F7LB 4JGUA 2ZSVB 4HMDA 3BP5B 2WANA 1KSRA 1QBLH 4UQ2A 3VRLF 2FNBA 1UVQA 4KROC 3BJ91 5ISZD 2D7TL 2DJSA 4LCIL 3ULUL 1M7DA 4P46A 1IEBB 3QIWD 1MFCL 3CH1A 5FF6B 4YBQD 4I3SH 4IIQC 3P0YH 2Y36L 3QEQA 1DUZA 4YQXH 2JIXD 3C2AL 4K8RC 4G8IB 4PYGA 1KCSH 4BSVB 3HTLX 4UQ3A 1U8PA 3JTTB 5E4EB 4MAYB 4ZFOB 1KTRL 2KZ1B 2V7NA 2HP4A 3O8XA 4DGVL 3ZHKA 3WFCL 2BHYA 4XXDB 4XVTH 2IQ9H 5MEQA 2EKSB 4HG4K 3UPAA 4IHOB 4Z7UE 1MLCB 5DT1L 3RU8L 2QADC 3MLRH 4L8SB 4QGTA 5KVMC 4ZQKB 3OXRB 4PJXF 3QHFH 5E5RB 5SX4I 4WW2B 3E6HA 4L3CB 3T1WA 5CJXA 2KKQA 2CKBL 2YD9A 2B1HH 4KZEH 4IS6A 1V3MA 5C8JA 3QG6B 1AXTL 3Q6FA 3ARUA 5E2JA 2A9MH 5KVEL 1XEDA 4JEGB 1S7QA 1G6RA 2ICWI 5F71A 5HTSA 1JE6A 4QXUL 5IFAL 4XBGA 2DJ4A 3GSUB 3MV9E 2VXQH 4XXCA 3VXNA 2OR7A 4PGBA 4TYUA 3L7EB 4XNYL 3O8XC 4LLWB 1NJ9B 2I9LA 4KK5C 2I25N 4DN3L 4Z95H 4UAOB 5HI4D 4OZGB 1IILE 3VFTB 3VI3E 4NKDB 5BV7H 3HE7D 2B8OT 2D7MA 3FT4B 4YHKL 3MJ7A 3RWCA 3OKDA 3HC3H 3BESR 3LKSA 4X6BA 4MD0B 3QULA 2DI9A 4LU5H 5E8DL 1EBPA 4H0HB 4IDJH 4K2UH 5DK2B 3T0BA 3SDDC 3ARYA 3EFDH 4M7LT 1MAML 4AQ1B 1LK3L 5IGXH 4X6CA 4IRSB 2H8PA 4Z5RB 4J6RL 5DVKA 3SO3C 4LDOB 3P0VL 1NBYA 5HDQH 3DO7B 4BFIB 3QWOA 1KJMA 4ZUTA 1IAIL 5CBEA 4NQDE 4IRJB 2BY1A 1GC1H 1JGVL 4YHOL 4XVSH 2EH8H 4L8BA 3H3PL 1S7TA 5EBGA 2ORBL 4HS3A 2OX5A 5FCUL 3K8MA 4J1UA 2A38A 3DYOA 5JDSA 5JUEH 3ARGB 3E1F1 1IC4H 1DQLL 5I17B 5JOFB 1DDHB 3TN0D 3VFPA 4Z7UB 1J8HE 4ZNCD 5HGAB 4PRBA 2NY2B 4HWBA 3BQUA 2JCCE 5DVNA 1LVEA 1RK1B 3HPJA 3UO1L 4HS8H 1P7KA 5IFHL 3PXJA 1KULA 5J11C 4NQXA 1MIMH 4AM0A 4OF6A 1JZ4A 1KT2B 2M26A 5HI3D 5B3NA 1EEYB 1YMHB 4M7ZB 5L2KE 3O4OC 5L0QC 4U49A 4Z0BL 1XGTA 4PJ8C 1JNNL 2YA2A 3O6MH 4LCYA 4PY7A 5ELIA 3W9DB 5D72L 2B7DT 1VA9A 3MV9B 5EU6B 3TF7C 3G5XA 4X6DB 4A6YL 5FYKD 2YD3A 4LAQL 4HLZG 5KSAB 2ADFL 1G9NH 1T1XB 3TFKC 1INEL 3SO5A 4BZ2L 1ZT4A 2W0LA 2NLJB 3UX9B 1HEZB 2G2RA 5I9QB 3SDAB 4IOFD 1MH5A 1ZANH 5SWQA 2ZNWA 2EDHA 5CEZD 1QKZL 2VIRB 2EO1A 1MFEH 5GRWA 4JVPA 1B9ZA 4P59H 1DFBH 4FQCH 3VH8B 2O5ZH 4MQXC 3NZ8B 5HGDA 2P46B 5FUOH 5E8EB 4KQ3H 4LLAA 4MJ4A 3B4NA 3WFBL 1CLCA 4ZODA 1KCVH 1S9WA 4Q9BA 2AABH 1BLNB 3FO9A 5FV1L 4LCCB 1GGCL 1OARH 1ZA6A 3RVTD 3DX8B 3LV3A 1U8JB 1A6UL 3ZKQD 4LSQH 1ORQB 2XN9E 3QUXD 4KKBC 4XTRD 5E6IC 4L5FH 4ZTPH 2OR9H 1J8HB 3ZDXF 1IQWH 4NQED 1I4FA 1OGAA 4NQCA 4TVPD 5FM5O 1UXWB 5E8NB 1PZ5A 5I1HL 4PV8A 5JORB 3B9KD 4XP5L 4X7FC 3ARBC 3PWLB 1IGFH 2H1PH 2Y7QA 5ADPH 2MKWA 4R4BA 2VWEC 4OGAC 2VZUA 4LFHD 4Y1AD 3HA0A 2AQ3A 1D6EA 5T33L 5CD5C 4L29B 1IKNA 5I8KL 4JPWL 3VFNA 3K81A 1H3GA 4M03A 4P23C 1KELH 3BMWA 5JOPE 5HDBE 1UYWH 5SWZD 5IVXA 4F7TB 1FLRH 1M6OB 3W39B 5C0GA 3OKKB 1BZ7B 3G5VA 1JYVA 5D7JC 3TPUA 5JNYA 4QGYA 1CLZL 3S35L 4AIXA 5E70A 1DUYB 3GSOB 1JMXA 3ULVC 2PYED 4OCSH 4X5WB 3IDIB 2VKWA 3QQ9D 2XFXA 4ODUB 4OB5H 5EFIB 1T2JA 5TH2A 3RDTC 5DJAA 4G80B 4I77H 2IPKA 5KJRH 1JWUB 1FNGB 2YUXA 5HVHC 1FVDA 1Q72L 4TULL 1FL3A 4WUKL 5EO1B 5HHXH 1ZA3A 2WSKA 3VGAB 3S4SA 3Q2CA 3ZE1F 3IJYB 3HE6D 4RGOH 1UB5A 5BXFA 1DQDH 1JGDA 4ALAH 1P9MC 2DI8A 5DC0A 1QR1B 1V7ML 1A22B 1CLYL 3CVHB 4OZHA 1YEHL 2PN5A 1R3HA 2FSEB 3SQBA 4APQA 4PGDA 4WHYH 5DR5L 1D7FA 2CLVA 5GRJL 5HVWA 3U2SB 2QHRH 2VDNL 3WHE0 5SWSB 1GL4B 3RFZC 1V5JA 3QUYB 1Q0XH 2AJSH 1ZK9A 4PJCB 4NKQB 5EU3B 5F72S 4OLXH 2W60A 4PJIF 2G9HB 1MELA 1P7HL 4EN3D 5B39B 1T66D 3WYRA 1FL5A 2DQCL 1HHKA 1NGYA 3AREC 1H3XA 1NCDL 3U46B 3L3HB 2P48B 4MQTB 1FZKB 4LSRL 4X6EA 1FE8L 1KIPA 3G08B 1NCCL 4POYA 3QDMB 4LLVB 4Y2DC 1V7NH 3KNBA 4YEFA 2OJEB 3GMLA 4HH8A 2Z4QB 4YPGA 5CWSB 1T6WA 2P7TB 4QHUB 4LL9A 3T08A 5GJSH 1EDQA 1PSKH 3IDMB 4Z78B 2E6JA 4ODTL 2QR0B 3UTQB 5AD0A 3VDAA 4I0KA 1H8SA 2PO6A 5DD3L 4H88L 3AUVA 3LRHA 3MLTA 4QRSB 4YHYB 2X10A 2LE9A 1K6QL 3E2HB 1OAKH 1CE1H 5CCKH 4E41B 1VDGA 3EYVB 4Z7QE 1KPRB 1ZWIB 3CFDA 2WIIA 2A9NL 4HKJA 4XAKE 1LD9B 1U93B 1TNMA 4DJMA 1X5AA 4DTGL 4NZTH 2GITA 3CGTA 2F58L 4XPBH 4WGWB 1J1PL 1R5IA 1NUDA 1PKQE 5JPNB 3D0LA 3QEGH 3M1BA 4RMSA 2CXGA 5HBBA 3MREA 3QO1A 4Y16C 5I8OL 2VO5A 1CGUA 4DZ8A 1J1XL 3PHQA 3AXLA 3VG9B 3FONA 5KSUB 2Q7NA 4PV9A 4MA1B 2I27N 3RWJB 3ISWA 1MF2L 4W4NA 3SKMB 2R2CA 1EHNA 5E6ZA 2AI0H 4ZUUB 2VE6A 1IAOA 5KSBF 3IJHA 5F9DC 2QKIB 3MXVH 4NM8L 4QTIL 4R0LA 4ETYA 2AXFA 3W81A 5D8JL 1EEZA 1GIGH 1KLGB 2A77H 5IB5A 1HQRB 4HEME 2XQBH 5J8OA 1ZGLM 3TBTB 3EYOB 4YK4C 5LKNA 3D2UA 1KPVA 4FQHA 3VE0A 3BP6B 5FKPA 1OM3H 5T1KD 2VMFA 3JV6A 2P5EE 2DYPD 2XWTA 5BZDB 4WW1A 1N6QL 4M7JL 3VGFA 1JWSA 3ZE2E 1DQQB 5JZ7C 3UEZA 1B2WL 3HZKA 3ARTA 4BH8A 3MCKA 3DVIA 3T3PE 2D7QA 1VB9A 4UQ2B 3BZEA 5FYKL 5ESAA 1BVKA 4HT1L 4MD5A 4PBWD 2LU4A 1E6JL 5DJCA 1DVFD 3BN3B 5HJ3A 1I85C 4MHHG 4P46B 1RZFL 4CADB 3CH1B 1UH4A 3SKUD 2R0ZH 1WIOA 4OD1L 2VITA 3QEQB 1DUZB 1FVCB 5CEZL 2F19L 3GSNH 3FQWA 2X4TA 2IG2H 4WV1B 1U8PB 3EDJA 4FTVA 2V7NB 5IVNA 3MRNA 3BGAA 4U1KA 1T1ZA 4NKIH 2R0KH 5MEQB 1I8IA 4HULB 4MA7L 3T4AA 1D5ZB 1LK2B 4QRPE 5I1JL 4N0YH 3GO1H 3E6HB 3KYKH 1RPQA 2W59A 1INDH 1VESA 4N0CC 5LAXB 3H9SE 3FT3A 3FQUA 4IS6B 1IC5L 1WFTA 5C8JB 5KS9E 3AVEA 3E3QE 1VFAA 3Q6FB 4RMVA 2P24A 5I15L 1HYSD 4MXQC 5TQ0L 3BMVA 1FZJA 5DLMH 3UJTH 3QI9D 4QWWC 4ONFH 2N4IA 5GS2H 3HNSH 1OTTC 5C0BD 4U1IA 3VXNB 3B9DA 3GMMA 4JREB 4MLIA 3F7RA 2JB5H 3QCUL 4JPKL 4Z8FL 1FNSL 3SDCD 4JFZL 3RBSA 1Z3GH 2WP3O 4YGVA 3IB4A 5CD3B 1BREA 3MJ7B 3RWCB 2G75A 3OKDB 4TTDC 5FB8A 1C12A 3PG2A 1NSNL 1OQXA 1T0MA 2Z0BA 3DROA 5FYJE 4FNLL 4R3SA 4X6BB 1OLZA 2VLRD 2GK0B 5GGRA 4AMKH 1YMMA 2IC2A 2FECL 5HHOA 5LWYH 1RZKH 2Y5TB 5KAQG 1MJUL 2C9AA 4QRRD 4KRNA 2ITDA 4X6CB 2HFEA 2H8PB 3B9VA 3QIBC 4HIJA 2ORBH 4G7VH 1NBYB 1P6AB 2XTJD 4H1LA 3QWOB 1JPST 1KJMB 4ZUTB 2GTWA 3ARFD 5E94B 4NCDA 5CBEB 2EE6A 1FG2A 4FQXC 4EXKA 3QT2A 4L8BB 1NEUA 2Q3ZA 4HS3B 4J1UB 4FHBD 5ALBL 2V9RA 1UCTA 4FQPA 1P69B 2VN4A 4G6KH 1HINH 2XA8H 1U36A 3FB7A 3RGHA 5C2BH 3A6BH 4Y5XA 3VFPB 1X5ZA 4LLYA 1IM3A 3BQUB 3DWTA 3LOWA 3C08L 4QRPB 4Z0BH 2GSIA 4J4PD 3HPJB 1BJ1J 1RIUH 4GQ9H 2HWZL 3PGDA 4KMTH 4N8CL 5IEKA 4TSBH 5DQDH 3RGVD 5D72H 1ZLUK 4AM0B 2M8XA 4RGNC 3HNTH 2I07A 2F54E 3H9SB 4DQOL 3GMPA 4KJPD 4QOKA 3QCTH 3QR2A 1XGTB 4JY6A 3NCJH 4LCYB 1A3RH 4PY7B 2K1MA 2YPLD 2DS4A 4DKEL 2BNRA 3RWDA 2HMIC 4ZYKA 3G5XB 2W1NA 4KK9C 4QTHA 3BSZL 3CMOL 3S36X 1RZJL 4PJDE 2CR6A 4G8GD 2X9YA 1TJGH 4Y5XC 1OAZH 2LFGA 4JQVC 1O7VA 1TJHL 2MCPH 2X9WA 1ZT4B 4YZFF 5T3XE 3QQ3A 4W6YB 3NFSL 2G2RB 2CK0L 4XCCL 1MH5B 2OK0H 4C56A 5SWQB 4GS7B 4KWUA 1NUNB 1T1WA 2Z8WC 5IP4A 1KIQA 5T1DH 1RUAL 3ZHDA 1XGQA 3PXHA 5DF0A 1QHPA 4G9FA 4AIZA 4IBLT 2X4PA 4LPWA 4P3DA 1K5NA 4FQIL 5DD0L 1BVZA 4M9OA 1JNJA 5HGDB 4PD4J 4MNQD 5C0FB 2PETA 4UV7L 3T2NL 2VC2L 1S9WB 2FBJL 1X6NA 2Z35B 5L2JA 1YN7A 4JGMA 2AJXL 1JNLH 5T3ZD 3RVWD 1WZ1L 2AEQH 4M93C 4Y4FD 3LEXB 3IKCA 2H32A 4P57A 1ZA6B 5T5FL 1EGJH 3LV3B 2MPAL 3K74B 5FGSA 4KAQH 2BVPA 3SE3A 1I1AD 8FABA 1I4FB 2LQRA 3BJLA 4NQCB 2FR4B 2BRRL 3QUML 1JHKH 1T7XA 3PP3K 3ARWA 1PZ5B 4PV8B 4LDLB 5ENWA 1MI5D 1YY9C 3VU2A 2X2YA 2Y7QB 2YC1A 4R4BB 2F54B 1YZZA 1XGYH 2DM4A 5LGKA 4ZOBA 3KPPA 1D6VH 1G6VK 1D6EB 2R29L 3PWPD 1DR9A 1CI5A 3A0OA 5HHNA 4CU6A 1CLZH 3VFNB 3CDGB 1INQB 4HKZA 2ZUUA 3FO0H 4D3CL 3VRIA 2VYRE 3V6OC 4S2SA 4JKKA 3RVXC 3TO4A 1AHWC 3G5VB 4D0DA 2A1WH 5CJ8A 3TPUB 5BO1H 5JNYB 1TQCB 2O93L 5L6YL 3O2DL 1AFVH 4DKAA 1UKQA 2VDML 1MVFA 2XFXB 1A3LH 4PRDA 3P0GB 5TH2B 1Q9OB 3Q48A 5DJAB 4N5EC 4JY4B 3D39E 2IPKB 2AGJL 1MCOH 3KPRE 1ZLVK 1V7MH 2GJ6A 1FVDB 4ELME 5DJ8A 1FL3B 3V5DA 1ZA3B 4MQ7A 1UADC 2ENYA 2M2DA 3MCG1 3ZDYE 5DXWA 3QHTC 3D85A 1UB5B 5BXFB 1JGDB 1ZLUH 4JZNA 4JCLA 3DVNA 2HLAA 3QAZB 4LGPB 3C6LD 3TO4C 2NR6D 4XCEA 4OZHB 4FS0A 3DLQR 4P2RE 4X8XA 1GYAA 1J1OH 2IAMC 1R3HB 2HTLD 4APQB 4PGDB 3MV8D 2CLVB 3MA9L 4R4ND 3ALWA 5EOTA 1NAMA 3UZEA 2GYSA 4Y8AA 1EO5A 2WUBL 4TOYL 2R9HD 2W38A 3D25A 4LEXL 3WNKA 4D8PA 1KJ3H 1FE8H 4HUKB 4U1HA 1UWGH 2VLJA 3STLB 2J4WL 5H2BA 1NCCH 1UM6H 2GIYA 2W60B 5KVDL 3QH3A 1HHKB 1NGYB 5E08L 4FQ1L 1R0AL 3TV3L 2ICEA 5TDOA 3RWHA 3QRFM 1MNUH 4X6EB 2B0SH 3O4LE 1KIPB 4IJ3C 4NZRH 1YNTA 5JLZB 1K3IA 4BH7B 3RTQA 3GKWH 3KNBB 1UM5L 1IKFH 3GMLB 4YPGB 2PXYD 5DRZB 4HUVA 2NNAA 2DTSA 1T21A 2OI9B 4ODWB 4NP4L 1Q0YH 1UT9A 5AD0B 1MWAA 3MZGB 2PO6B 5B8CA 2YD4A 3BRGC 4X99A 2BNUA 3MLTB 1CR9H 4XWGH 2X09A 4YIQB 1KEGL 3MO1B 4F58L 4JHAL 4AEIH 5DD5H 3CFDB 2WIIB 4XNZC 4PP1D 3QJFA 2WBJB 1T80A 1QRND 4L8CA 3QCVH 4MVBC 3P73A 4TNVF 1QBAA 2GITB 3PP3H 1OWRM 1WBZB 1NKOA 2AXGB 3D1MC 1R5IB 3GK8L 4G6JH 5I18H 1NBQA 2D9QB 3D0LB 3QUKB 4P5TB 3M1BB 3U9UA 4NWTH 3H7LA 3MREB 5L8JB 3QO1B 4PLJC 4D9QD 1D5MA 2WQRA 5TQ2H 1U3YA 3AXLB 3PHQB 3FONB 4OFDA 4G9DA 4PV9B 5B8CC 1MVUB 2P4AB 1FFNA 4ZO8A 4HXBL 1MJ8L 1HXYA 1LO3H 1X5YA 1R3KA 2VE6B 2HRPH 4PJ7A 1IAOB 3IJHB 2N7BA 4R0LB 2AXFB 2HG5A 5LBSL 3U0WL 1EEZB 4R2GB 5IB5B 3RHWK 15C8H 4NT6A 4YXKL 1EPFA 1Z9LA 3DUUA 1I9JL 1J05A 4UT6H 3VFGH 4GRLC 4G7YH 2APWA 4PJEE 3L3GA 3D2UB 3ABZA 5JA9A 5C0AE 1KPVB 4FQHB 3VE0B 4O2CA 2EIBA 4MNGE 4EOWL 5DJYB 4MS8D 1F97A 4WENB 3TA3C 1ZLVH 4I0PA 4WW1B 5C0RL 4HZLA 3FFCD 2ERJB 5DZNA 1YEKL 1YMME 5FGRA 4NM4L 3BDBA 3IFLH 3QXTA 3DMMC 4OCXL 2VXTL 5IHUH 3MXWH 3ZKNC 3HZKB 4NHCL 4BH8B 3MCKB 1J9CT 3BZEB 3PF2A 5ESAB 4ZUWB 1BVKB 4HKXA 4LFHG 4MD5B 2E8ZA 1QLEH 5DJCB 5HJ3B 4F57L 3JWDH 5E2UL 2OM5A 4CL7A 5E99H 1SYVA 4WI4A 1HSBA 1E4XH 1HH6B 4G6AC 2VITB 1Y6KR 1JZ2A 1FGNH 3DPBA 5KN5B 3P4OA 2X4TB 3QFJA 3VD4A 2P42B 3P11L 4LHUD 4GMTL 3MRNB 4U1KB 1T1ZB 1I8IB 1XGPA 3T4AB 3DGGB 5D2LA 3VXUD 4CNIA 2PR4L 2NY1B 4RMRA 1MCBA 25C8H 4GRMA 4JPVL 4TVPH 5T3ZL 2V5TA 3FT3B 3FQUB 3LDBC 4M7LL 1WTLA 2V9TA 1J5OL 1VFAB 4R8WL 2VH5L 2P24B 4HV8A 3SKJH 1EERB 4LRIA 1HIML 5D7IA 2NXYC 1FZJB 4CW1B 5EORL 1RURL 3LQAC 1I9RH 4UZGA 4WCYL 3VGBA 5D7KE 5K59F 4YGVB 5FO9B 1Q1JL 1RU9L 2G75B 4MNGB 5FB8B 1C12B 1FNLA 2UZXB 3ZT5A 3DROB 4JR9L 4PREA 1BF8A 2QQLL 5GGRB 8CGTA 3V6BR 1YMMB 5HHOB 1IFHH 1LO2H 1KENL 1UQSA 4Y8DC 1BFTA 4EUPB 2ITDB 3CJJA 1HI6A 2F53E 4HIJB 3IFNH 5JHLH 1YNLH 1NBZA 1WAAF 4H1LB 4M1CD 2GTWB 2FEEI 3DO3A 3OKMA 5D1XA 4KRPB 1KV3A 5D9SA 1J12A 1T2XA 1TVBA 1FDLH 2B5IB 1JRHI 5CZVL 3CPLA 1BFOB 3QHZH 1NC4A 2EH7H 2J5LB 3BI9X 1YPZA 3HNVL 1HKLL 5HI5D 5C6WH 4JO2H 3LSOA 1FCCA 1MHCA 4U3HA 5BW7A 4PB0L 1R3LA 3TVMC 1IM3B 5DUMH 2FZ3A 1QO3B 4AZ8A 3X14A 4I2XA 3WHXA 4ODHH 2GSIB 4ZO9A 3P30L 5E24E 3PGDB 5GGTA 1HDMA 5IEKB 1CICA 4U1GB 3H3BC 1YECL 2DQUH 4OCMC 4YHMH 4LVNB 3O6LL 1ADQL 1F13A 2I07B 3GMPB 4QY8A 4QOKB 2PF6A 4B41A 1E4WL 4JY6B 3O2WH 4P5KA 4GAJH 1A7NH 5CJQL 3WV0A 3RWDB 4ZYKB 1L7TL 1T5XA 3PE9A 4G8FA 1MEXH 1YY8A 1S5IH 1F02I 1X5XA 2JELH 4PD4K 2B4CH 3OF6A 2H2PC 1N5YH 3VFVA 2DBLL 2LTQC 4GG6E 3LZFL 5KVFL 4KUCD 3W2DL 3LD8B 1EMTL 1AQDA 4K23H 3FJTA 5F7NC 5EBWB 1T1WB 1KIQB 1XGQB 5B3JF 2GJ6E 5GPRA 4KROD 4G9FB 4AIZB 4BA8A 4HDIB 3OR7A 1N0LA 3B2VL 4P3DB 1K5NB 1X5LA 2NPLX 4NN7B 5GRUH 5EUKA 1I3GL 1R5VA 4K8RD 4UMGA 1J86A 4CN4A 5L2JB 1U41A 1YN7B 2A6KA 3ZYZA 5C9JA 1BOGA 2H32B 4P57B 4FP8L 4Y2OA 2VDOH 3RZCA 4RSVA 1MFAH 3U36A 2QADD 1AD9A 5T5NG 3TBWA 8FABB 1MFBL 1J11A 1KACB 5CUSH 3L5HA 1I9EA 1PLGH 1SBSH 3HAEB 5ENWB 4OT1H 4NQTA 4QXWA 1CCZA 2YC1B 4UV4H 4H26A 4MJIE 2F8OA 5F1KC 1ZHLB 3S36L 1EJOH 3IDXL 1KXVC 5C92A 3O6FA 4L4VE 3DUSB 4HKZB 4MJ5A 3O8XD 3V79C 2X05A 1VHPA 4KK5D 3VRIB 4DWHA 2XG4A 1F6FB 5KSVA 1S3KL 1ZOXA 1BJ1H 3ALPA 4S2SB 3MACL 4K9EC 1W0YT 2VLKE 4HPYH 2IAND 1A5FH 5C07D 4D0DB 4E0RA 5AZ2H 4FRWA 4K3DL 3JV4A 5IV2A 3D48R 2CRIA 7FABL 1M05A 1CLOL 3JV0A 4N90E 4PRDB 4JFDD 2J6EL 2A6JB 3FB5A 4JB9L 4BM7A 3NAAL 1L7IL 3VG0H 3SDDD 1J7VR 3GJFK 4FMFA 4NQVB 3IDJA 2C3HA 4PJ5A 3BDYL 4UILL 3EOBB 2GJ6B 3VD7A 5DJ8B 4L4TA 4NYLA 3MLVL 3EAKA 4HCRL 5I1KL 4F7MA 3D85B 1TZIA 2FLRT 5LGHL 3P4MB 2GEEA 4JZNB 4ONGH 2EEAA 3DVNB 4S1RL 2HLAB 4QNPE 4QF1A 5DMKA 4XCEB 4JHWL 1QACA 1YYLL 3W9EB 2PCPB 5AWNH 5F88A 2EDNA 4XPAH 3NFPA 5IM7A 5DC9B 4PJBE 3QDJA 5E7FA 5EOTB 5E08H 1Z9SA 1NAMB 1R0AH 3O45A 4GBXC 1NMAH 2YK1L 4U1HB 1MLBB 4RZCA 2OZ4L 1YDPA 2APVA 4LSPL 3FHAA 1WTGT 2Q1EA 3QH3B 2L7UA 1AE6L 1BEYH 2ZKHL 2ICEB 5TDOB 3RWHB 2YD1A 5DHVA 5ICYA 3RY6C 2DQEL 3SCMA 4NP4H 1HWHB 4PJ8D 1FNAA 1I7ZA 5IWLC 5IQ7L 2APXA 1YNTB 2BDNL 4LQFH 2Q86B 1WISA 3RTQB 5I6XC 4O2FA 3LEYH 4Y19E 3VD9A 2H3NA 5HHQA 4X7SH 4HUVB 5ITFA 4FQLL 2NNAB 3CU1A 4LK4A 4U6VL 3TFKD 3FTGA 3MOAL 3I3DA 3OKEA 1MWAB 1CXFA 4FZEL 2XWBB 4X99B 4UDTA 4I13B 4C57C 1M1SA 1TTGA 2IQAA 3OQ3B 1UEYA 1GAFL 1XF3A 3ARDC 2O5YL 4ONHA 3T65A 1WWAX 4DKFH 3QJFB 4NO0D 3FO1A 4L8CB 3SCMC 1T89A 2X4UA 3P73B 3QQNA 4MQXD 1VACA 5MP6L 4OZIA 1JYWA 2HKHL 5AYQA 5E8OA 1AY1L 1TPXC 3OPZH 4I1NB 4WWKA 1RIVH 3G04A 3K2MC 3U9UB 5DK0A 3U4EA 2B20A 2R1WA 1D5MB 1XMWA 3U0WH 5FV2A 5BJTA 2CKNA 2NCMA 3MUJA 3P9WB 4G9DB 3DSFH 1S7UA 3QUZA 4GOSA 4KKBD 5E6ID 1HXYB 4PJBB 2APTA 4OZGF 1R3KB 2HKFL 3OBAA 3C5JA 4JDTL 1A2YA 1CZ8L 2GI7A 3IDNA 1FVEA 3U48A 4ZFZA 4NJ9L 4NWUL 1T89C 4PRHD 4NT6B 3LKQA 3DUUB 1YJDL 3ARBD 4F7CB 1J05B 1X4YA 2LABA 4OGAD 3L3GB 4KHXL 4OCXH 5C7XH 3WIIH 4CAGA 2Y06L 4P9HC 4CUCA 4R7NA 4O2CB 2WINB 2VDPL 5CD5D 1CD1A 3V4UH 3GJFH 3OL2A 1PYWA 4H8WH 3AROA 3U7YH 2RAMA 4I0PB 4P23D 3GIZL 2GK2A 3ULUC 1UWXK 5HGHB 5DDHA 2CKBA 3U9PL 2QJDA 1IGMH 1T7YA 3U30C 1A6VH 1BZ9A 3QDGA 3VXRD 3V52H 5D7JD 1BBDL 1TZGL 3NIGE 4JFFA 4OSUH 2X4OA 3ULVD 3GRWL 4JFEE 4TSCH 3NPSC 3SDXA 1SYVB 2DLEA 3RDTD 1HSBB 4P2OA 3KHQA 4Z7UF 3WNPA 4OLEA 1N7MH 4ZG1A 1ETZA 3X3FH 3P4OB 3MNWA 4HS6A 3D9AL 1U8NA 5BOPA 2DTMH 2MNUA 4JQXA 4PLKC 3SGDI 4Y5YA 2A6DA 4OUUA 2F74A 2OP4L 3STZA 1T03L 4NN6C 3PGCB 4LIQH 1Y0LB 1J5OH 2OJZH 5BV7B 2VH5H 4JQIH 2AEPL 3BE1L 4K8RL 5D2LB 3PL6A 4CNIB 2CIIA 4UT9L 1QZ1A 1SY6L 5HVFB 4DOHE 4GRMB 1RMFL 1MJJA 1S7WA 2FO1A 5GRVL 1L9MA 4X6DF 2MFNA 3NTCH 2AJ3B 4HV8B 3VI3F 1ZT7A 5D7IB 3C87A 4JM2C 4JRXD 4I8DA 1JPSL 4P9ML 2P8PA 4PJXE 3ARED 4Y5YC 2HAZA 1W2KT 3G6JA 4PGCA 5D2NC 1N3NA 1U3HA 4GMSH 4NUGL 2FHFA 4WI9A 2J8OA 5HYQA 2YD5A 4U1SA 4B5EA 4OZ4A 3U7WL 1GOFA 3PL6C 4Y2DD 5D70H 1RI8A 4HQQH 1FYHB 1XCQA 3RQ3A 4LMQE 3BWUC 4UBDC 5ID1B 3NABL 3L5WB 5TE4L 3HFMH 4KC3B 1UQSB 5SX4H 3MRDA 1BFVH 2FIRT 1QOKA 4FZ8H 1HI6B 3NACL 3S8WA 2EDBA 1E28A 1NBZB 4UINL 2BSED 3N85L 2R8SL 4A6YA 3OKMB 2PTVA 5D1XB 5D5MA 5D9SB 1U3HC 2D4DA 4OM0L 5TE7H 1TVBB 4PJGA 4LASH 3CPLB 3RKDC 3FN0H 1NC4B 4CMHB 1YPZB 4N1EA 3ZTNH 3LSOB 5F96L 1MHCB 1WZKA 2AK1H 4MMXC 3FRUA 2FZ3B 5D7SH 2Z92A 1KC5L 3X14B 3WHXB 4AJ0A 4Y16D 5K93A 4N9OB 1HDMB 1CICB 3RWFA 4DOHB 3GI9H 3KPLA 5FGCE 4ZAKC 3MBEA 1UWXH 4FFWC 3U0PA 4DVRL 4QY8B 4HFUH 4GXUN 4KUZL 4YH6A 3C5ZC 1GGIH 4CDGC 3OAUL 4RQQB 2V2WA 4FQJH 4PRPA 5K9OA 4KQ4L 3MUY1 3W2DH 1UJ3A 3U1SL 3BW9A 2X40A 1T5XB 4G8FB 2F9BT 3K4DA 4AENA 4N0UE 4FQ2H 4XC3L 5EU7E 1J0HA 3A6CL 4JN1H 4Y7MA 3SE9H 5EZOH 1PX4A 1TCMA 3VFVB 4M62L 3C60A 2JB6B 4TUOA 4QXGL 5EA0L 4UUJA 1AQDB 4KKLC 5TE6L 1WFOA 5JZ7D 5DJ2A 4Q9CA 3SGJA 3SGEH 5AYUH 3T77A 3MBEC 5GQBA 2Z31A 5IHBA 3CX5J 3C8DA 3OR7B 5AZEL 3C6SA 4CGTA 1MRDH 3L3DA 4J3VA 4OQTL 4WY7H 1QSFD 5IOPA 1FO0L 3PWVB 3Q1SL 5EUKB 1UJ3C 1F3JA 4JJHA 1R5VB 5KZCB 1T3FA 5DJZA 4MNHA 1SHMA 2A6KB 5C9JB 1IZKA 1UZ8A 3VFSA 4PJCF 2QQQA 1P1ZB 1BOGB 3C8KA 3I6GB 3OXSA 2HT3C 1B4JL 2NY3C 5LCVH 4F8QA 3QDJE 3RZCB 1BQLL 4ODVH 2R0LH 1AD9B 4X6FB 5I8CA 1KB5L 1AQKH 3TBWB 1FP5A 3MGAA 3TESA 3QNXA 4C4KT 1A7QH 5DURD 1WIUA 3TBSB 1JHLL 1AD0A 3DXAD 3WIHL 5BMFH 4N0CD 3ZYIA 4LHUG 2GKIA 4YWGL 2XTLA 3UTSE 2FLBT 5FGCB 4H26B 5HDBF 3EFFA 3QIWA 2AV1B 4XP6H 4MXQD 4LSSH 1QQDA 4QWWD 4NGHH 1UACL 1Q38A 2JIXA 1OTTD 3NH7H 3O6FB 5FUCE 3TM6A 4MJ5B 3I50L 3B8YA 5KSVB 3BT2L 1A7PL 1D9KC 2BRQA 2HN7A 4LSUH 2DBJA 1WITA 4JKLA 4TTDD 5ADOL 4UILH 1W72L 5F9OH 4LVHC 5IV2B 2R4RH 4YC2C 1M05B 4I48A 3A67L 2XZAH 3FB5B 4C54A 5LGHH 5HHMB 1F8TL 2CPCA 3KPMA 2YKLL 3BOVA 4OKDA 3WKML 3HI6H 3QIBD 2R39A 4JHWH 4L4TB 4NYLB 1V8HA 1CK0H 3OSKA 4YFLI 4YDKH 4P2CG 2IFFL 2JJWA 3BHBA 4FQXD 2XRAH 3O41A 5FYLD 4RA0C 4QF1B 5DMKB 2VAAB 1SJHA 1A47A 2YK1H 4I9WE 4HIEA 3REVA 5FGBA 2NY5C 3HE7A 2NY4C 5F88B 4Q97A 2DMBA 3NFPB 2Q8AH 3NCFB 5DWUH 5IM7B 3QDJB 5FXCH 1JZ8A 1U8KA 3R1GH 3V8OA 4NBYB 3O45B 4NZJA 1QVOA 4W4OA 1CFBA 4KI5E 2FRGP 2X70A 2AW2A 3MLUH 5EC1A 4OLWL 3TWCH 1YDPB 4X9HA 2AP2A 3S37X 1X5IA 3I9GL 4YEEA 4RGND 2Y07L 1CD0A 2BFVL 5ETUA 3BP7A 4FQLH 5DHVB 4LLDA 5ICYB 1GVIA 1G84A 1I7ZB 1EEQA 4R26L 1NUGA 1F2XK 1YUHA 3DBXB 2BJMH 3DX9B 3K46A 1KEMH 5JW4R 5FYJU 3R06A 43CAA 3VW3H 2GAZA 4OI7A 4O2FB 4XCFH 3T0AA 2HMID 1OAXL 5DUPH 3OJVC 3UMTA 2Y25A 4KK9D 3CVHH 4RIRA 4WUUE 2EDTA 2H3NB 3U4BL 5HHQB 5IW6B 4PJIE 1I7TB 3FTGB 3IETA 1IMHC 1X9QA 2AEIT 3IDYC 4NFCA 1XZ0A 3TN0A 4KDWA 1A64A 3RX7A 3WEXB 4UDTB 4RFOH 3SDXE 2FHBA 4TSAH 3PQYE 3AS3A 3N1GC 5DK3A 2HKHH 3DUHA 1OCWH 1XF3B 4JG1L 4WO4C 4NKMB 3UCRA 3T65B 3HKFA 1J8KA 3F5WA 3FO1B 4XC1L 1AI1H 2X4UB 4K7FA 1VACB 3QWRD 4ISVA 4OZIB 5IW1A 3IGAB 2BNRD 4OM1L 1CXLA 1FAIH 1A1OA 3QA3A 1B88A 5E8OB 1CF8L 3IU3A 4WWKB 5FDWA 3G04B 1HNGA 5DK0B 1J18A 3U4EB 1YEIH 2RFXA 4RX4D 5CSBA 2NZ9C 3GIVA 3B2UC 4Q7DA 5BJTB 2CUMA 3EO1A 4Z9KB 1T83A 1S7UB 3QUZB 4C56D 4X80H 5F3BA 1U8OB 5JXAL 4YBLC 3KJ6L 3C5JB 3NGBC 1A2YB 5DZLA 2VDLL 4JJ5A 3IDNB 4BQ6A 3CD4A 1FVE