4L3CB

Structure of hla-a2 in complex with d76n b2m mutant and ny-eso1 double mutant
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKNEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Class I Major Histocompatibility Complex, the Trojan Horse for Secretion of Amyloidogenic beta 2-Microglobulin.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 100
sequence length 100
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X, Z, b
ec nomenclature
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l3cB00
5T1DH 1F58L 2YHGA 4D0BA 2GTWB 3RWDB 3TO4B 4BH7A 1X6NA 3OHXB 5D2NE 1JE6A 3ULUE 3ZE0F 5CZXC 4BM7A 1QKZH 1A4JB 1CE6A 2EKJA 4X6EA 3RTQB 4Y2OA 3GDBA 3ZYOA 4IMLB 5F8RC 4XNXH 4I0PA 4QTIH 4OJFL 5DJ8B 4IRZH 2VLKE 4HJGB 1MRCH 5IFHH 2BOCB 4G5ZH 4MDJA 4NC1C 3O3EB 1MY5A 2D7TL 3MGTA 4MAUL 2CK0H 3F7YB 3QUYD 5CGMA 4LNVA 1TIUA 4QY8B 2BDNH 3HMXH 5GHWL 2FR4A 4HPOH 5GRXG 2YBRA 1J0JA 1YYLL 4XP1L 4P2YA 2NPLX 3IB4A 3LKRA 2JB5H 4W6YB 3Q3GB 2FB4H 5EA0L 1WZ1H 2VDPL 3BO8A 4QRUB 1IC4L 1UB5A 1ZHKA 4RAVB 4YFLF 5CEXB 5DVOA 2AAVA 5FUCC 3LIZH 1FE8H 1U3HC 3GMMB 2PW2B 3QXUA 1UQSB 3AS2A 4N0FA 4UBDC 1CFVH 2DLIA 2O26U 3HS0A 4IRSD 1JRHL 5EN2B 5DXWA 4XP5L 4DKFH 3DYPA 4PJXB 2XA8H 5F3HB 4E41E 2HT4D 4HZAA 3K3QA 5DQJB 5GS2D 4ALAL 1FAKT 3PJSB 1X5KA 1N7ML 1IL1B 4HS6B 5JW4M 1HYRC 4UINL 3ARUA 4F7CB 4ELKB 3HPJB 3R4DA 1Q38A 5B8CB 2NX5E 4QHNA 3LKSB 3KXFE 3L5IA 3WUWB 4OF7A 3ULUF 3DX8B 1TJIH 3HNTL 2Y9RT 2J7LA 3FB5A 3VXUA 5JTWA 1EAJA 2B20A 3VRIA 1A47A 2APTA 3H0TA 5JIPA 2I5YH 3T0EE 4JLRA 2FSEA 4NQCD 4D0CB 3TBWA 1UM6H 3O8XD 2N1KA 4K94C 3C60C 3MSPA 5EIIA 1MCWM 1FRGH 1FYTE 1U8NA 1E4KC 1U3JA 2FCBA 4JG0H 5DEZA 2YN3A 3WEXB 3FB8A 3P0VH 4HFWB 3SDDC 5SV3A 3QJHB 3D3VE 1XZ0B 2Y5EA 1P7KB 3T0EC 1DZBA 1BOGB 3IDUA 2R2EA 3FN9A 4U1KA 3W5MA 4HWZB 4UB0L 3HI1B 4KH2A 5DJXB 1N2RA 1S8DB 3QUXC 4YWGH 3DSFH 5IB2A 2J5LB 5AD0B 2VLLA 4OTXH 3KPLB 2AJYH 3HC0A 4X7SH 4HMCA 5HY9A 4OCXL 3O2WH 4JB9H 5LBSL 4R2GD 1YEIL 2AJXH 3GJEB 3X12A 3TM6A 1OTTC 1QBML 4JO1L 1H8OA 5T1KB 2X1XR 1RZ7L 1F4AA 3PWLB 1CXKA 3QQ4B 3CCHA 3CZJA 4UTBL 1OLLA 3JV4B 1M71A 4GFTB 3MLYL 4O58H 3TLRA 4CKVX 1GAFH 2H32H 3LN5A 1NJ9A 5TE7H 3TVMC 3BIKB 3NCJL 4JN2A 1HDMB 4IRJB 5FK9B 4WO4B 1MEXH 5F1KC 5HHXL 1FAIL 1T80A 1N0XH 2Q7YA 3BAEL 5F9WB 4FFYL 1KIUA 3D2UA 5DK0A 3CLFH 2CLRA 3DWTA 4JFEB 4XXCC 2BNUB 3GSXA 3QDMA 5TDPB 3BE1L 1S7WB 3TH2T 2R1XB 1G7MA 5A2KH 4UTAH 3FO1B 5I19L 1DL7H 1ZA6B 4K8RL 4FFWD 4LHUB 3O4LD 4X5WA 2X9YA 5ENWA 1R3KB 4AQ1B 1BF2A 4JPIA 3QDGB 4XVUD 4PJ8B 4YBQC 5ERWA 3MCKB 4I18B 4XVSH 4RISH 4MJID 1GC1H 1T1WA 3LQZA 3SPVA 4FHBD 5DJYB 1FVDA 4NO3B 3V6FB 3X3FH 4PV9A 2MTPA 1WJ3A 2HRPL 2ZSVA 2XFXB 5J6GA 5FGSA 1FZKA 4OAWB 4DN3H 5I0DA 3KPRB 4JFXA 4Q0XL 4MCZB 3GHBL 3KLHD 4EDXB 4R8WH 3TO2A 5HYSB 1JYWA 2LTQB 2AXFA 4JJ5A 3B9KD 4HHAA 4PD4J 3ULVH 1KIRA 5GS3A 3UTTD 3TH4T 1XIWA 1IGFH 5F7DA 1B4JH 1OM3H 4XCFH 4FXKB 5IVZB 4EUPB 4YHNA 3VXUE 5KSAD 4A6YL 1WTGT 4XVTH 2XWJA 3U82B 4AZ8A 1RHFA 2PYFA 1AE6L 4X6DA 4XMPL 5CP7A 5IESH 4RAHA 3I75A 2Q76B 4CNIA 4OSUH 1HHGA 3HMWH 2ZG2A 3DX9B 4LARL 5HHOB 4Z78B 2P8LB 5GGUB 4LSVH 3IYLW 2D7PA 4UILL 1EJ6A 4F7PB 3E6FB 2DQGL 3BJ91 3MRMB 4LPYA 1UZ6E 4ZS7H 4ZNEA 2R0WL 2D03H 2GIYA 2JF1A 5J1TC 1ZT1A 4I3SL 4WHTA 3EFDH 4LPWA 3WJLA 4BFEA 1BIIA 2EC9U 5IF0B 3U0TB 2ICES 3DV4B 4WI2A 5EORH 4QWWC 3RDTC 3HZYA 4KQ3L 3EYFA 4NRXA 1A02N 3K4AA 1FL6A 3KPPB 1AJ7H 3GMRB 5IQ7L 4Y4KB 2F5AL 4ZUVB 5C9JB 3LB6D 1G7HB 2HWZH 1JGDA 1SHMA 2ZUYA 4AYFA 2GSGB 5ACZA 2XQYK 3BXNB 1UYWH 3L6FB 4LLMB 1TTGA 1TENA 5C07A 2AW2A 5DHVH 3HE7B 3WBDA 4OF3A 1SEQL 2H8PB 4KJQC 3MNZB 3TC9A 1E28B 4TPRL 3WIHA 1NMCB 2V17L 3GB7B 4UQ2B 3CX5K 4Z7WA 4M8QB 1IQDA 3CDFA 1MNUH 1EEZA 4X4MA 1AGBB 3BGFC 4ENED 1A9BA 1VFUA 4NQUA 3MOBH 4QRTA 5T1MA 4QRPA 2XZCL 5DQ9A 3AC0A 3L1OH 4FZEL 4MLIA 3AY4C 4KJYA 1NKRA 5CGYD 1LGVA 5L6YH 4HUUB 5DD3H 1BPVA 3MOQA 3QO0B 3VXPB 4RFNC 3GMQA 1D9KC 5HGGS 2R39A 1GGYA 3WNPA 2FRGP 3FQNB 2AJVL 2VIRA 4M5YH 5I17A 1H0DB 3BZEB 3V0VA 1UZ6F 4K9EC 1YY8A 4HKBB 3KHOA 4DOHE 4GLRI 1T5XA 3DX6B 1PEZA 3HUJE 4CMHB 1IC5L 2FZ3B 1WSST 5DD6A 2V7HB 3T3PE 1WC7B 3W0WA 2QQNH 5JLZB 1A6VL 1OCWL 3CAFA 1BQHA 1L0QA 2CR3A 1CDCA 1VKXA 1MRFH 3H9HB 4LEOA 4EN3A 5AYUL 3PWPB 2EZ0C 4JY6B 4JHWL 4K7PY 1AR2A 3WKNA 3JUZA 3W5NA 1CL7H 2ZZUT 1ONQB 4HIIB 3RP1A 4FFVD 5MERA 4YX2H 1TJGH 4D8PB 4FNLL 4PB9H 4PP1C 4JY4A 3DYMA 3MRCB 1P69B 3OKOA 4ONFL 5DLML 2Z8VC 4JFFB 3AREA 4YR6B 3GRWA 2BVOA 4NO2B 2VLRA 4MMXC 3BWAA 5T1DL 3OX8A 4JO2H 3V95A 3JWOL 5ESAB 3QH3A 4J3SA 1BZ7B 1IC1A 4LCWD 3KNBA 4Z7UA 2R9HD 3BQUD 1UC6A 3MUZ1 2APBA 3FAWA 4ZXBB 1RURH 2FJGA 3FKUS 4CVXB 3O3UN 5KVEL 4R26H 5DHXB 2NXYC 2HMIC 2ICWJ 3OJVC 4HGMA 4XNXL 4MA1C 2BY3A 4LSUL 3C5JB 4KK9C 5FDYA 3UJTH 3VWJA 2E7CA 2OQJA 4K94H 2GQHA 1MRCL 5CKAA 2CGRL 2P8PB 2D7QA 4WUUD 4ZNEE 5CZVL 4HAFA 4MD5A 1A1OB 3TA3C 2JJVA 3WNNA 1MI5D 2AJZA 2CK0L 3VGDA 5HYQB 1HXMA 3GSNA 3WFHB 2Z0BA 5EU6D 5SWZA 3RWHB 3T3PF 1EBPA 1ADQH 4XB7A 1SYVB 4TN9A 2WBJC 3KYNA 2JB5L 2R0ZL 3NOIA 2W60A 3IGAA 4M6MH 1WZ1L 4S2SB 3BHBB 4ORZC 4K3EH 1GGTA 3QEQA 4UQ3B 5IFJB 5C0JB 2X4PA 4Y8DC 5DZLA 4F15C 4L29A 4ONGL 2VRAA 3QRFM 4LF3B 1P2CA 4YK4B 3BPOB 1Q0XH 3CVIL 5C07E 1L7IL 4NO5B 4ZMAT 4ODVH 5DDHA 1HNFA 3ARVA 3QXWA 4NPYB 1TNMA 1J05A 5BW7A 2ZCKH 3ZT5A 2Y7QA 1RZJH 5E8PB 2FD6H 5KANG 3U0WH 1KCRH 4Z7WE 3OR6B 5D6CA 4HH9B 1G0DA 3SE3C 4RX4A 1DVFA 1HZHL 5C0EB 1WT5A 4YQXH 3NBNA 2OJZH 2IANB 5F6IB 4CL7A 1BM3L 4ELMB 4F7MB 3WDHA 1BIHA 4XAKD 1VEOA 3BYYA 4D0DB 4BFGA 4FS0A 4MMZC 5ITFA 2EXYC 4G7VL 4MX7B 3S88L 4X6DF 5HHQB 1ZVSA 1CTOA 3VD4A 3NCYP 2NZ9C 4O51B 3GSUB 5ADOH 4U05A 2NTFB 3PWNB 5IG7B 2QLVB 2RGSA 1GGBL 1J88A 3FOMA 4KV5F 4K23L 1XGUA 2MHAA 4AT6B 1OF2A 3BRDA 1NCUA 4KGLA 5E9DA 4BQCA 1FRGL 5CJBA 1JPTH 3TIEA 3GIVA 3IFNH 5DUBB 3LSOB 5EUKB 5B39B 3W0WE 2EDFA 2OK0H 3CU7A 1TVHB 5JR1L 1K4CB 3IU3A 1OW0C 4R90L 3NA9H 1U8MA 1MHHA 1QSEB 2EYSA 1ZHBB 3MACL 4OZHB 1CGVA 3ARFB 5D93C 4IBLT 3UCRA 5I30H 4NKOB 1EEYA 3SCMB 5BVJA 2PO6D 3RVXC 2X41A 1AKJA 2HVJA 4OCRL 5EU7E 1WWWX 4LAJH 4FA8A 4WU5B 1MJJB 3IFPB 3CH1B 3N06B 4RA0C 2H2SC 2Q86A 4PRPA 4YWGL 4PGJA 4L8DA 3MV01 4Z7WF 4PJDB 2LABA 4P2OD 3CFBA 5IW3A 4JM2B 2VLRE 1VERA 4JGJA 5D6DA 5DJZA 2ARJB 2AJYL 4TVPD 4X7SL 2IBBA 3R06A 4KROD 1Q9OA 4F3FA 1D5BA 5FDWB 4PPTA 4JB9L 3PP3H 1MAKA 1A8JH 4Z7UE 1R3JA 5GRJL 1HHHB 2RQ8A 3B8YA 2WWMD 3SBWA 5JMOC 4NZUH 2X70A 1A1NB 4U1LA 1T0PB 1F4XH 5FB8B 2FECL 3WMSA 4L8BB 2VXTL 3GGWB 1EZVY 4WW2B 5DURB 1A1MB 1JVKA 3SE9L 1O7SA 3C5ZB 3EHBD 4YDJA 3REVB 2VQ1A 1U41A 2XPGB 3UPCA 5JPMB 1AXSB 4D9RD 4PJGB 3RGHA 1FVCB 1GAFL 4LLYA 4QRRD 1ZT4A 5F7LB 3C6LD 4HWBH 3QCVH 5TE7L 3K8KA 4Y4FA 2IFGA 2EDTA 1MEXL 4UU9B 4S1SL 1N0XL 3DRQB 4F9PA 3EOTL 5SWZE 2VL5B 1ZGLM 3T04D 1J1OL 4N90E 3SDCD 5CBAA 3GKWH 4TSBH 1KN2H 1CN4A 1ZLWH 3HC4L 1S7UA 2UV3A 3QULA 4LSDA 4R9HA 5I66B 3QAZB 3QEQE 1RUQL 3UAJD 5D1QC 1MJ7H 5ICYB 1DL7L 2VABA 5CP3A 3LD8C 2R8SL 3RZCB 4LRNH 1L4IA 3Q6GH 4M1DH 1UM4H 2C4FT 3FQRA 4M7LT 3RX8A 3SKOB 4XVSL 4LSSH 1F6LL 4K3DL 3H9SD 5FKPA 3OXSA 4J7RA 1J8HD 2KPNA 1TZIA 1MCLA 1T04B 3STLB 3BDBA 4TSAL 4NKDB 4P46C 3MRKA 4R8WL 4WV1C 3EJJX 1KTLA 2NY0B 1GOGA 4NOFA 5K59E 1EFQA 4PRHD 3H7BA 4PG2C 43C9A 1IKFH 1PG7X 4Y5XA 3QFJA 1S9VB 1IGFL 4JGMA 1F3RB 4WWID 2ICCA 3EBAA 1OM3L 5JNYA 2AI0H 2BXYA 2EEAA 3DURB 3HB3D 1UCBL 4EJ1C 3QO1A 2YUZA 4XVTL 4GQ9H 1ED3A 2B39A 2O5YL 4ODXA 3PL6C 4OSUL 5J6HB 3T2OA 3P77B 3HMWL 3JWNC 3P11H 4K9EH 2W9DH 5E9DE 4HIHB 3R0MA 5BQ7A 3OKKA 2VNCA 4NO0D 4PY8J 2GI7A 4FQHA 4XPBH 4FXGB 3JBG7 5KW9H 3T4YA 5HD8D 1EVUA 2DQTH 1N8ZA 2K3TA 5IKCB 1NGWA 4DVRL 4A2LA 2R0LH 1D5MA 2KQNA 3BKYL 4TRPL 3WHXB 5IBLD 3VFSB 4MA3A 4YFEA 2X42A 1AJ7L 5KBNC 1NAMH 1PY9A 5IB1A 4UI2A 1WAAA 2AABL 4XMLL 2DQEH 1VESA 1DBKL 4PRPE 2IG2L 1KJMB 3PHQA 4OV5A 3LN4B 3FB7B 1RHHB 2PN5A 4JO4L 4LCYA 2NNAB 1I1RA 2G2RA 3GBNH 4P23B 1JGUL 4LSPH 4YIQB 1QFPA 1ERNA 1YYMH 4JDVB 4OM0H 5BJTB 1MNUL 2B0SH 5HI3D 1HOCA 1I9RH 4ZFGH 2VLJB 3MOBL 4X80H 4AM0B 3SE8H 1KCUH 1AP2B 3L1OL 4Y2DB 3ARXA 4DFHA 3W39A 4LSRL 1QLFB 4GBXD 1C5DB 1ZGLP 3O9WB 1DDHA 1O0VA 5L6YL 1F4WL 1UENA 2XXMB 5DD3L 3UBXG 1F4HA 3PWJB 2LAGB 1MCIA 3VXQB 3NN8A 1J12A 1W0WA 4M5YL 1JTPA 4KKAC 3ZKSD 3TO4D 1DEEB 2VYRE 5C0RL 4NWUL 1B0RA 4LEXL 5DI8B 5DYOA 2EDXA 1HHIA 4PJIB 1O5DT 4YHZL 3U46B 1KLGA 3RTQD 5IBUB 3KLAA 1T0NB 3IJSA 5E2VL 1SQ2N 5FYJH 5DRWB 1HK6A 2QQNL 5KG9A 3BZ4A 4XCCL 4JVWA 4PP2B 4LSQH 3G6JA 4B7LA 4XC3H 2ADIB 2BJML 1RK0A 2A73B 2ZUXA 2ZG1A 1T6VN 3TWCL 3C8KA 3K2MC 4NHUA 4Y4HB 4C83A 5GGSA 1OPGL 1S78D 2YD8A 4KRLB 5DRZA 3QPQC 1FL3B 5IROA 5IFAH 2QADC 1AQKH 1A7RH 1TJGL 3UBXA 3L9RA 4PB9L 1FGNH 1UKSA 1T20B 5TQ2L 2DLGA 4V2CB 3O3BB 3BKMH 1KJVB 1YMMB 3O2DA 5MEQA 4XNQA 4G8EB 2P5WD 4U4BA 4YXKH 1T66D 3VXNA 4S0SD 5FYKD 2BSTB 4RGNE 2BY2A 2D31B 5ESVA 3VFGH 1RURL 3OAZH 1M7IA 4DAGL 3MLVH 2HLAB 5DJAB 5AWNH 3F62A 2X1PA 3QIBB 3UJTL 1DR9A 3CFDA 3VI4E 2CIIA 5GZOC 3HG1E 4NRZB 3MO1B 5FO7A 5I1EH 1UJ3A 1AHWB 4ISVA 4RDQG 5FOJA 3MZGB 4OD1H 1YEFH 3REWA 3CVHH 1KTKE 5DMKA 5F1NB 1ACYH 2OI9C 2RB8A 4O2FA 1ADQL 2YA0A 3T2NL 3TP4A 5DMIL 1NAKH 2BXZA 4LLVA 1T4KB 1BQLH 1RK1B 1CS6A 4K3EL 2UUDH 4HGKC 1ZEAH 2HP4A 4UT7H 5K9QG 4RIRA 3NIGF 4LPUA 4AY0A 3X13A 1WAAE 2RHEA 4YUEL 1A7QL 1T0MA 3MGAA 1EV2E 4I2XA 4JZNB 4LLDB 1JI1A 1Q0XL 3M07A 4G8FA 1G1CA 2J8UE 1RZFL 3SKUD 3V79C 3RGVB 3V0AC 1J86A 2ICWA 1UWEH 5H35B 1NGYA 1MWAL 2ZCKL 1PX4A 3U0WL 2QKIB 1SM3H 4HT1H 4JG1L 3O6FC 3V6ZA 1INQB 4ODTH 4G9DB 5FO9A 1ZANH 4YQXL 1X5FA 2OJZL 4X9FA 4U7SA 1S7XA 1A7NH 4PJ9B 1I1YA 1HINH 3ZHDA 4HSQA 4WFFD 3I6KB 2B1AL 2IFFH 4NKIH 4EBQH 4LRIC 4HC1H 1A9EB 3V6OA 3MV8A 3FTGB 1RJLB 1WCBB 2YPVH 2D0FA 2VTFA 3VFRB 1BVKB 3RAJH 5CIPA 1BD2D 5M7QA 1TJHH 5ADOL 3VI4F 4U6XB 2WIIA 3VD7A 1YC7A 5HHMD 5D9SA 5D4QA 3IXAB 4YPJA 3TJHC 5ADPL 1X4XA 5IMLA 1KNOA 4OF8A 3QUKA 1JPTL 4Z76A 1FLTX 3IFNL 4WJ5B 5DS8A 3V5HA 4P4RA 3TPKA 3JTTB 1MVUA 2OK0L 5E8DH 3O3AB 2GSIA 3UO1H 4AIXA 1AR1D 3G6JE 1C5CL 4C55A 4NNYB 1KEGH 3DO7B 3TBYA 2W9LA 4FQQA 1MFAH 4IRJD 4FQJH 5J06A 3TBVA 3ZTJH 1WAAF 2R23A 2DL9A 1UB6B 4P5TD 3C08L 4WW1B 3MQIA 2A77H 4JFED 4JKWA 4ODHH 2BNRA 1GGIH 5HHNB 1KF9B 4LL9A 2VLKB 1D5IL 3KG5A 1NFIA 2CH8A 4L4JA 4IOIA 5DMYA 4Q6IA 3RJDA 4E5XA 1U3HB 3KPOA 1MHPL 2NCMA 3F7RA 1F3DJ 3MV9D 4FTVB 2JE8A 3QDGD 5MENA 3SGDI 3KYOB 1A7OH 4HUXA 2Z92A 1DBML 2Z4QB 2A6IA 1FNHA 1VA9A 1Q0YL 4J2XA 1KC5H 1QBBA 4I9WD 4NZUL 4F80A 4Q9CA 5IOPA 3F12B 1NGXB 2CIKB 3QJFA 4D2NA 3U4AA 1YN7A 4C56A 5I18H 4Y1AA 3BKCH 3IRPX 2IMMA 4P4KA 2WP3O 1CFSA 3ZYIA 3BJLA 1XF5A 3V52H 4D9QE 1F11A 8FABA 3QCVL 4YXHL 2P48B 3T2PA 3EO9H 3UYRH 4HDIA 1P9MC 1OT1A 5I1DB 4BQ9A 3SKNB 3MTRA 4L4TA 3QQ9C 2DJSA 1MQ8A 4TSBL 3OB0H 1KN2L 4MDIB 1ZSDB 1MCJA 1WICA 4ZFOA 1MPAL 2VLMD 3C60B 3G6JF 2BCKA 3MREB 4TSCH 2XTJC 4PV8A 4G6JL 3MRJA 1MJ7L 3HZMB 4QOKA 3HAEH 4LRNL 2FJHA 3Q6GL 1L6ZA 3ZKMD 1EO8H 4I2XE 5I73C 1UM4L 1WZLA 3SDDB 1YNTB 2YN5A 5L8LB 2J8OA 4H1LH 4WHCA 3WD5L 3JWDC 3LEXB 3T0EB 2NW3B 1N6UA 2NY2D 1R3IL 3QHFH 4XGZA 2APVA 3LQAC 4OGYH 3DXAA 2F53B 4ZYKB 1UWXK 1WIUA 4NUGH 3VWKC 4O5LH 4Y4KD 4KKCD 1JFQH 3QUXB 2C7UB 1HEZA 1XGQB 1H5BA 4LMQE 4ODUB 2DWDA 2VKWA 1XR9B 2X6MA 1G7JA 5E1HB 3V6OE 1I8MA 3MV8E 2H3NB 2FX7L 5M95B 3BRGC 2ZPKH 1NCAH 2E6JA 1U8HB 3MR9B 2UYLB 5JPNB 5IK3A 3MRDA 3V8CA 5EUOB 4MA8H 2IADA 3LRGA 3QUZA 1RUKH 3QWQB 1QPPA 2P5ED 5C7XL 5GSVB 4DZBA 2CDFB 4JZJA 1OTSD 3CC5B 1S9KC 4F58H 1BWWA 4H25A 2ZCHH 4PLJD 3MNWB 1K6QH 4XPBL 3V6OC 2WLYA 2XXCB 4GW4B 4MD0A 4KK8D 1DLFL 2DQTL 3GBMH 1UXSA 3N85L 1J1PH 5D7IA 3TVMB 5L9DL 2R0LL 3PWUB 5HHVL 1HQ4B 1G7QB 3B9AA 1NAML 1DANU 1FNSL 1CD1B 2BK8A 2NY5C 3ZKNC 2BNRE 1K8IA 4XHJD 5IHUH 4HKJB 2YSSB 2BRRL 4GMTL 1RJZA 3PQYD 5TE6L 2Y25A 4LVOC 5KVDH 2MCPH 3DNKA 3CUPB 4KTEL 1MFDL 3EJYC 4JVUA 1RVFL 5JO5B 2EXWC 3SY0A 4LSPL 5MENE 1YYML 3PWPD 5A3ID 3KPMB 2B0SL 5EU3B 1NFDA 1JWSB 4MNGE 3T2QA 5JOPE 2VAAB 3UROR 4ZFGL 4X80L 4M6NH 2Y23A 3SE8L 5DD0L 5C0FA 1ND0B 4L4VB 2O93L 3JTSA 4C56E 1FC1A 5FHAL 2N56A 2VITA 4Y1AE 4K8RD 3IS0X 1IZKA 1IM9A 5CGTA 5JW5A 3MC0A 4MS8C 5EOCH 1H3VA 4EVNB 1FG9C 5HGBA 1TETH 3OZ9H 1J0IA 4NYLA 5E00B 3IF1B 3MLXL 4L4TE 1XEDA 1CD0A 2JCCB 4N5UA 1XFPA 3MMEB 2YPLB 5E6IA 2V5TA 4H0GA 3D87B 4LLWB 1ZT7A 3BD4A 4U0QB 3AMKA 2VDKH 1DUYB 4N8VG 4QOKE 2ADGB 4JY5L 4IJ3C 3ZT7A 4LSQL 1Q94A 3IU4H 2VE6A 4R97C 3OG4B 3WFDH 1OAZH 1QEWB 3Q1SH 3IDNA 4JFDD 3VE0A 2DTML 2VQUA 1DE4B 4LLAA 3D85B 3PHSA 4LIQH 4U31A 2F5BL 3KPSD 4NQEA 3RDTB 3X14A 1D6VL 3M17B 5I76A 3DXAE 1FGNL 5EU5A 3EYQD 5FUOL 4JPVL 2NY4D 4LCCA 5ETUB 1IGJA 1SJHB 1PG7L 4E9LA 4DEPC 2XY1A 3Q6FA 2VL4A 3HA0A 4QYOA 3BUYB 5J11C 5D7LB 5FKAB 5F72S 2X4SA 4XVJH 3AU1B 1KCLA 2R29L 1OWWA 3QIWA 3ISWA 3MLVL 5HYEA 4MZ3A 3LZFH 5GRZA 1IM3B 1QSFA 4WNQB 5AWNL 2FBOJ 5T3XE 3BGFB 1VACB 3G5VB 3VXSB 3VH8B 4JRYD 4U6HA 1NGZA 1PZ5B 1UT9A 4R7DA 1EGJA 1AI1L 5DO2D 1P7QA 1M05B 1YEJL 2Q20A 3HE6C 5I1EL 3CFJA 3T4AB 2F15A 3C2AL 3THMH 2DLTA 4LU5L 3CVHL 3GKZA 1JZ8A 4RFNB 1D9KB 2ESVB 4WTXA 3O2VL 4Z7NE 5BRZA 1KLFA 5D7IE 5KVMC 4EXPX 1NAKL 5ALBL 5GGQL 3RA7L 5L88L 5DFTA 1BQLL 4ZUTB 4L8CB 2J8HA 5IJVA 2HFEA 4UT7L 4OGAD 4OQTH 3DX7B 1FYHB 1JJUA 1I1FB 4MB3A 5FO8A 3MLRH 4UT9H 3QWOA 2HRLA 3MYZA 4BSVB 1KN4H 4Y5YC 1M71B 4R0LC 2PXYD 1QHOA 2VDQH 3SDXA 1A0QH 5DK3A 1NJ9B 2XWBB 2HKFH 4RAUB 2A83A 1A7PL 1PAMA 3RL1B 3OKLA 3SDAA 5CMAB 2IEPA 1AGCB 1UWEL 2ZSWB 1QSED 4HT1L 1MIMH 1NFKA 1NAMB 4ODTL 2DQJH 3ARFD 3QDJB 1ZANL 1NFDE 3QQ3A 4P0DA 3FQTB 3SCMD 3HUJB 1CFTB 4DKAA 1U8QB 3BKJL 4M7KL 3ARGA 3E8UH 4Y19A 1A7NL 12E8H 2DM2A 1VEMA 4KZDH 5HYJE 1CR9L 2IFFL 4TNWK 1AD9B 3AROA 4NKIL 3TV3H 4YO0B 4ZPTB 4QHLB 3DARA 4JZOA 4L3EE 1QRNA 1CGWA 3U83A 4AL8H 2GK0B 3GRWL 5C08D 5F7UA 4AIZB 4MNQD 4JM2D 1V3KA 3BUTA 1TJHL 2IF7A 3WYRA 1FZMA 2EDLA 3FQUB 3MRFA 3NFPA 2D7MA 1BHGA 2H26B 2DYPB 1V3MA 4JREC 3C6LA 2NXYB 1A6ZA 2EE2A 1T89A 3OSKA 4MA1B 2R1WA 3U9UB 2A6KA 4Z0BH 4TYUA 4XP6L 1XF3B 4Z7NF 5ID1B 5IIEB 5D7IF 3OKNB 1BVLB 3C5ZD 3MRBB 3VG9C 5FA4B 1AIFB 1YY9D 3S6CA 3TA3B 1JZ5A 5CWSB 1L6XA 4NT6B 4YHNB 1WZKA 2Y72A 2VR5A 3DI3B 2CKBH 1MFAL 3NVQA 3DUHA 3H8NA 1DJSA 3RVUC 1HILA 3JWDH 3HKFA 4NQEE 2WBJB 1BREA 5CD3A 3QXVA 5C0ND 2A77L 3S96A 4HXAL 4J1UA 5E99H 4OB5L 4G43A 1GGIL 1S9YB 1VADB 3TFKD 2X4UB 5GZND 2UZYB 1WBYB 3LQAH 1LP9B 2WQ8A 5HGHB 3CSYB 4LFHD 4F15B 2Z8RA 4TUJA 4D9LH 1IGTB 4WHTB 1JN6A 3DSNA 4KJWC 1NFDF 5F9OL 1HI6B 5EIQA 4Z8FH 4JRXB 4FMKA 5GJSL 2DF3A 2IH3B 1KC5L 1NBYA 1I1AA 3WE6A 3DVGA 4GKSB 1LNUA 3GUTB 1FGVL 1QSFE 4U33A 4J4PA 4GRLA 3FHQA 1W2KT 4KI5E 5DJ6A 3ARDA 1XCQA 1IAOB 4XRCB 1OAYH 3O41B 5ILTL 5I18L 4PGBB 3VFVA 1BJ1J 5IQ9A 2NY0D 5IMOA 2JIXB 4XCYB 1T7VA 4XHQA 4WGWB 5GS1A 5FEBA 4Y16C 2WMPA 1JF5A 2DAVA 3EO9L 3UYRL 2X89D 4NRYA 5B38G 1R3HA 2GJZB 4QHMB 1YN6A 3WHE1 4LDEB 5BRZE 4NQXB 2V2WA 3RJQB 3EO0B 4LHJB 4F7TA 1RUPL 4Q2ZA 2DM3A 4KMTL 2M2DA 5C09D 3MLTB 4AH2A 2ENSA 1JYVA 1K8DB 1PFCA 2X4QA 5I1GH 4G8GA 4YBHA 5DWUL 2NY5H 4KJYB 3BW9A 3CZFA 3G9AB 1XGTB 2Y36H 3MA9H 3IDGA 4GRMB 2EIZA 2K1MA 3CVHB 1EO8L 3DETD 2R2BA 2W9EL 5KSUA 2BSRB 3SDXE 3UDWC 3L3GA 2FHFA 3C9NB 2SEBB 4OFDA 1BQUA 2ICEB 3QNZB 3GMOB 5EZOH 1J5OH 4Z95L 4GS7C 5D93B 4NNXB 5AAMA 3GI9L 3SKJH 3DGGB 3C6SA 1Z5LB 1NEZG 3RVVD 5F6HI 1N59A 4U6YB 5H2BA 2VDML 4Y19E 4KY1L 5T3ZE 1A6AA 1IAIH 2V5RA 4UNVA 5B38A 3HNSH 2BFVL 4JQXC 5E8EB 1LO2H 2UWEA 3QI9D 3MLUH 4CVWA 1QRNE 3HR6A 1NMBH 4YDVA 4MVBD 2ZPKL 4JFQB 4GBXA 2NR6C 3LS4H 4DFIA 1A4KB 1GGCH 3OXRA 4KI5F 3U2SA 4BA8A 2IBZX 3LS5L 3JVGC 2ERJB 3ARBA 1C8PA 4YE4H 5F9AC 5D8JL 3BEWB 2JK5A 5MERB 4ZAKA 1OLZA 5EFIB 1A6TB 5JUEH 4JY4B 2WZPD 2X10A 2GTWA 1WUNT 3RWDA 5D1ZD 4Y2DD 3W2DL 3TO4A 2Z35B 1MREL 3OHXA 1K6QL 2EO9A 2I07B 3NABL 2F54B 4GRWF 1S7SB 5CHNB 5GS0L 1A4JA 3FZUC 3BN9C 5E94B 1J1PL 1CLOH 3ZHLA 3BPNC 4IMLA 4Z7UB 2FO1A 4NSKB 2C3HA 5B4MC 1JZ3A 1OP9A 3DUUB 4HJGA 3GHEH 5JHDD 2FWOB 2BOCA 3OKEB 4KUCF 2EC9T 3O3EA 2E27H 4FQ1H 3F7YA 1B0GB 2D0HA 5IJKC 2NMSA 4QY8A 5D1QB 1LD9B 5EBMB 3LD8B 1V5JA 3LPFA 4JFPB 5FYLH 3VFNB 2XKUA 5K9JH 4XNYH 3DMMC 3Q3GA 2JB6B 4QRUA 1QFWL 4CW1B 3BESR 5CS7A 4RAVA 1OGAB 5CEXA 4GKZB 4R96B 2LAAA 5IR1B 4Y4HD 4U1HB 3N1MC 5DZNA 4MZ2A 1G6RH 1I7TA 3GMMA 3QUMH 2PW2A 3BH8B 2ZUTA 1UQSA 4DW2H 1K5NA 2XI9A 2C1OB 4P46B 5HYIA 1URLA 4WV1B 4YDKH 3F58H 1OHQA 2ZCLH 2BVPB 5EN2A 5DD1H 3VA6A 4LP5A 3OAYK 5IMMB 3FO9B 4S1QL 5F3HA 1CLYH 3SDYH 5DQJA 1YMMD 3PJSA 2EDJA 1IL1A 4HS6A 3BISA 4Z77B 5C2UB 4F7CA 2AJ3B 4ELKA 3C8DA 4TUOB 3HPJA 5B8CA 4HUWB 5EOTB 5BOZG 3LKSA 4O4YL 3WUWA 3PL6B 3C87A 4P2CG 5GGSY 4BJLA 2FO4B 3DX8A 4J4PC 3N1QC 3NCYS 4D94A 4WEBL 4EQ3A 3QIBD 5LVEA 4G8GE 5E8OB 4JQIH 2VDKL 2VOTA 4U1NB 3VA2C 3IU4L 1CICD 1U6AL 4KRNA 4U7KA 3GMPB 2IPTH 2OLDA 3RY6A 2YD4A 1MH5B 2L0DA 4QRSB 4UIMB 4MQXD 5DJ2B 2J1KA 3QIUC 3WEXA 3GSOB 3D48R 1RJCA 1IC7H 1K9TA 1QHPA 4NQTA 3VGEA 4HFWA 3KGRA 3QJHA 4HLZG 5T1LD 4HD9A 4GG8B 1XZ0A 2X40A 4NDMB 2HH0L 1P7KA 2NYYC 2AJUH 3T0XA 5FGBC 1BOGA 2WP3T 2AK4B 4H1LB 1TZHB 1SBSH 4HWZA 2UWEE 1UEYA 3HI1A 4XVJL 5DJXA 4APQD 3ARRA 4RWHA 3P4LA 3LZFL 5BVJB 3WFZA 2DIBA 4MXQD 2WW8A 5HDQH 4XBEL 5AD0A 1TVBB 3HFMH 4MD4B 1TNNA 3KPLA 5D1XD 1TQCC 5EC1B 2AQ2A 3GJEA 1FZOB 3S3JA 5TQ0H 3T8XB 5AYQA 4HWNA 5EO0B 4M1CD 4DZ8B 5T1KA 1A3RH 4RSVA 3PWLA 1YUHB 3QQ4A 1J0ZA 4Y88A 3P4OA 3GNMH 6CGTA 3ALPA 1E4XL 3JV4A 5F97E 2HTLC 2HG5B 5DK2B 2VZTA 5KZCB 4OQTL 2FJFB 3U6RB 5HYSG 3HZVB 5K33A 2FIKB 3BIKA 3LQMA 3R1GH 1HDMA 4IRJA 4NUJB 2Z8WC 5FK9A 4W81A 4WO4A 3WO4C 4AG4L 2R69L 3MV7D 2VDQL 4H8WL 2HKFL 1A2YB 4OKVB 1NDGB 2BNUA 5TDPA 1UKQA 1S7WA 4MNHB 2R2CA 2R1XA 4DTGH 2G5RA 2PCPB 3FO1A 3KR3L 2X44D 2A9MH 4Q9QH 1E6JH 4GJTB 3ULUD 2UZXB 1H3WM 3TZVD 1DBBL 5JDJA 1ZA6A 4LHUA 1R3KA 2A74B 2EYTB 2QADB 2B4CC 1NBVL 1HCVA 4PJ8A 1N5YH 3MCKA 4I18A 2UWEF 9CGTA 2VLKD 2ZJSL 4KKNA 5FYJU 5MI0C 5DJYA 3V6FA 4XCNB 2EH7L 3O2DL 3BPLC 4XP4L 1U3HD 2XFXA 2DDQH 5E0QA 2KQMA 2NXZC 5SX5H 3T08A 4OAWA 4PRBB 3QZWB 3KPRA 4BZYA 2VSDA 4MCZA 2GUOB 4C4KO 4EDXA 3KDMB 5HYSA 1D7FA 3EYUH 5I1HH 1O7VA 3DHMA 3A6OA 2QHRL 1IGYB 1K2DA 4H5SB 3ZYZA 4FXKA 4EI5C 5IVZA 3V5DB 3WDIA 3UYOD 4EUPA 1OAKH 4FQXD 3TN0D 3W82A 1UJTA 3VDBA 3K46A 2AEIT 1FPTL 2Q76A 3K74B 5CEZH 3O81A 1LVEA 1LO3H 3DX9A 5HHOA 4KGJA 3HR5B 5GGUA 1CI5A 2OI9B 1NEUA 4HUNB 4E41D 4F7PA 2DQHH 3OV6A 3E6FA 3MRMA 5GGTL 5D70H 5DD5H 3MLZH 4X6FB 2VDRH 4WHDA 3HG1B 4HXBH 5IF0A 3LQAL 3U0TA 3DV4A 4XPTH 1N6QH 5MEOB 4YAQB 2NX5D 3GMLB 3KXFD 4LHQB 1OARL 4D9LL 4X7DC 1KOAA 2YC1B 3LEYL 2Y6SD 3QNXB 3KPPA 4MAYC 4HCRH 3A6CH 3GMRA 4M7JL 1AFVL 4HWUA 4Y4KA 1NGWB 3ESVF 3NZHL 4PB0L 5DZOA 4ZUVA 5C9JA 1G7HA 1D5MB 2GSGA 1ZAGA 3BXNA 3T0ED 3L6FA 3O6FB 1RQ5A 4LLMA 3TH3T 2Z31C 3HE7A 2B7DT 3DTXB 1J9CT 1SVZA 5IB1B 1KT2B 3ABZA 2VXSH 3MNZA 1E28A 5DJ0B 1FYTD 3EYVB 3GB7A 3HC3H 5TDNB 4UQ2A 4M8QA 4OV5B 1B4RA 2J8UB 1KELL 4FG6D 1HIMH 4M1GH 5DQDL 4OCSH 3TYGH 4RWYH 3D3VD 1AGBA 5K9OB 1GZQB 2E8ZA 5FGCE 2FX8H 4DK3A 5HI5C 1Q9LB 2EE6A 3R0NA 4KK5D 3S4SB 1I1CA 4BZ2H 3R8QA 1Q9WB 4EOWH 4WFGE 4NWTH 3G04B 3BYTA 4X83A 3P4NB 4L5FL 4HUUA 1GZPB 4HLJA 1RZ8B 1MAML 2CKNA 3QO0A 3VXPA 5I1GL 4QLRA 2NY5L 4Y7MA 2APFA 1Z3GL 2EDQA 3FQNA 3MA9L 4KWUA 5GGRB 1H0DA 3BZEA 4HKBA 3KPQB 1PVHA 3FRPG 3RWEB 4BZ1L 3VGGA 3G08B 3DX6A 3WNOA 3NN8B 2YZ8A 3EDFA 1J5OL 3NH7H 2V7HA 1WC7A 2G5BB 1ZMYA 1EJOH 5JLZA 1J1XL 4M3KB 2CD0A 1NH6A 4HIXH 2GJJA 2EDWA 2V9RA 2VN7A 1Z9OA 1KLGB 1W72H 4TQEH 4RFOH 1B3JA 3VXMB 3H9HA 4MQ7B 5J0BA 3PWPA 3HNSL 5KG9B 4JY6A 1DQML 3VXRB 2AXHA 2VUYA 5C0CB 3F65A 1FH5H 1RK0B 3P9MB 3P73B 1X6LA 1F4YH 1N4XH 3MLUL 1ONQA 2BVUA 4HIIA 1TCRB 4N0RA 3MXVH 3KPRE 4D8PA 3S98A 1V7NH 1IEAB 3MRCA 5L0QC 4LOUD 2MWCA 5CEYB 4WWKC 4JFFA 2FGWH 4YR6A 5KAQF 4NO2A 1U9KA 3L9RB 5JUEL 3SEPA 2D4DA 5ESAA 4QXUL 1BZ7A 3FRPA 2E9JA 3EAKA 3S34H 4ZXBA 4XMKH 4CVXA 1Y0LB 5E4IA 2G60L 3FOLA 1IAKB 1MCQA 1SMAA 2AV1B 4ESKA 1LEIB 3KJ4C 4KRMB 4MXWL 5JDSB 1WWCA 3C5JA 3H9ZA 2DMKA 5HHOE 3GHEL 4R4NC 4OCMC 3O4OC 2P8PA 3U0PA 5AZEL 1ZLVH 1YNLH 2OX5A 2GFBB 3VW3L 1A1OA 3KLSA 4I0KA 2E27L 3SQOH 4JPWH 4FQ1L 4JGUA 4PJCA 3FFDB 5HYQA 1CLZH 2XTJB 3MYJB 4AEIH 2QQLH 1F3DH 3WFHA 3O6LL 3RWHA 3ALWA 1REIA 4O00A 1SYVA 5I73B 5K9JL 4XNYL 1T1XB 2CKBB 3BHBA 3G5XB 4S2SA 3JUYA 4H88H 3VXUD 2HN7B 4UQ3A 3V0WL 5IFJA 4XPGL 5GRUH 5C0JA 3BZDA 1A3LH 2CLVB 3FFCB 1N6VA 4ZFZB 3IFLL 3QUML 4LF3A 1WIPA 4U3HA 3RDTD 4DW2L 3CFKB 2WLZA 4ORGB 5F70A 4NO5A 2QSVA 1GYAA 4WI9A 3VWKB 4RMUA 4YDKL 3F58L 2ZCLL 3MJ8B 5DD1L 4HS3B 3P9WB 4NPYA 3LPGA 5E8PA 4X8XA 3DGCR 1XF1A 3OR6A 4HH9A 3QUYC 3HNVH 4ZUSB 1GSMA 5C0EA 4PYGA 3TBSB 3QB7C 2ICWB 2IANA 5AUMB 1NGYB 3WLWD 1NUNB 2LU4A 4ELMA 4F7MA 1MRDL 1U3YA 5C6WH 4OLZH 4D0DA 1OP3H 4MX7A 1EMTH 4CVZB 4OM1H 4P5KB 4P2RB 4JQIL 1P5VA 4HEME 4O51A 3GSUA 1WF5A 3HCVB 2NTFA 3PWNA 5F44A 5IG7A 2IPTL 4Z7OF 3TEUA 4IRSC 5DFWH 4NQDE 4AT6A 2V9TA 3N1FC 1D9KD 4ONOA 3D0LB 2AGJL 5DUBA 5EUKA 4G9FB 5B39A 1X5YA 1U8IB 1SJEB 4EI6B 1XF2B 1TVHA 1K4CA 1BFVL 3UJJL 3OGOE 1CU4L 2BP3A 4OLYL 4O9HL 1QR4A 1P84J 1QTYT 4NGHH 4OBRA 4PGEB 2B4CH 4K7FB 3WSQL 1L7TH 2CR6A 1QSEA 4ETYA 1ZHBA 1PYWB 4OZHA 4QT5B 3ARFA 4LVOB 1SY6H 4NKOA 3SCMA 5I9QC 5GISH 4OD3H 1SBSL 2XT1B 3TBYB 4YGVB 1WWBX 4BK4A 1S3KH 4WU5A 3FO0L 1MJJA 3CDGB 3CH1A 3IFPA 5JZ7C 2DMCA 1KJ3H 3U1SL 4GQPH 3O8XC 1QVOB 4K71C 1QBLL 3CDYA 3D2UD 4FQLH 2VZ1A 3I85A 1QFUH 2FLRT 4JFFE 4M7LH 4PJDA 3RI5K 4XPFH 1EHAA 4LFHG 5CJXA 3BDYH 4JM2A 4YH6A 4KTDH 2ADFL 4UNUA 2ARJA 2NY7L 4WI4A 5C0BB 5FDWA 1SEBB 2QR0B 5C92A 2AKRB 4MJ6B 4PRIB 1UXWB 4XPAH 4XNUH 2MQ0A 5TQ0L 1HHHA 2XRAH 2JLLA 4L9LC 5CZKA 1A1NA 4P57B 2HKHH 3GMNB 5FB8A 4L8BA 5GGVL 4CU6A 3GGWA 4FRWA 4WW2A 1A1MA 3NMEA 4MNGB 5JIIA 3WXVH 1ZLSH 4GAJH 3REVA 4JDTH 2XPGA 5JPMA 5F96L 1AXSA 5JA8B 4PJGA 2I9TB 1FFOB 2B5IC 2AP2A 2NXYD 5CKGA 2CXKA 5HHPB 4PJCE 5MEPB 4JANA 4UU9A 1G9NL 1WBXB 1CF8L 5JQHC 3DRQA 4IJ3B 3ZZ1A 2VL5A 3BMVA 3S5LG 4R97B 4M4RA 3TA3D 1XIWD 5EO9B 4KUZH 4DTGL 1BFTA 1S7QB 5I66A 2OR9L 1EAPB 4XC1H 3RBSA 3RPIB 4XX1G 3V4UH 5ICYA 1JPSH 2BVEA 3I50H 2CQVA 3RZCA 4P3CL 1N5YL 3HMXA 3SKOA 3N1PC 5JW3H 1YECL 2BHZA 2YD3A 4YBLC 1PG7W 3L7FB 4NJAH 1NSNH 4DEPB 1T04A 1XH3B 3ROLB 1HH6B 2DDQL 3EYOB 4Z0XB 3STLA 3SGJA 5E24E 3RVTD 1A22B 2WUBL 4NKDA 4AENB 5B21A 3BMWA 2IANE 1G6RB 4L1DA 2RJMA 3QUMB 4ELME 4OZGB 2K9UA 1WFUA 1W0YT 4Z9KB 4UDUA 2ADJB 2WK2A 5JOFB 2RIKA 4OLWH 1FIEA 1S9VA 3BSZL 1RZGB 4LKCB 4OZFG 3LKQB 4M6OL 4XAWH 3DURA 1A64A 2ZUSA 4N1CA 5C6PB 4FFWC 4XNZC 4AMKH 1JCKA 2WQRA 5FOBA 4GSDL 4Q7DA 4XVUC 5C07D 2AJSL 2VR4A 5J6HA 4J12A 3P77A 2EXYD 1F90H 1KB5L 2YRLA 3MBEC 5EOQL 4HIHA 3T09A 3IAGC 4FMFA 1IFHH 4OCYH 1AGDB 2DQHL 5IK3B 1Q9KB 3MRDB 3TT3H 1MCDA 5DD5L 4G6ML 4PLOB 4B50A 3KYKL 4FXGA 5J4MA 3OB8A 1TQBC 1ZVYA 3KLHC 4HXBL 2DQFB 2AEPH 2FATH 5F6HJ 5IKCA 1N6QL 4G7YH 3WFEH 3B9KC 1M6OB 4DN4H 3QT2A 1JGVL 3OGCB 4Y5YB 1XGYH 4R0LB 1DCLA 3A67H 2A1WH 4KJPC 1YEGL 4OZHE 1GH7A 4QGTA 3VFSA 3WHXA 3QDAA 1UXSB 2YD9A 1EHXA 5KSAC 1E6OL 5CJOH 1HNGA 2YRZA 5BO1H 4OGZA 2YD6A 5LAXB 1KJMA 5IBUG 2PUQT 3LN4A 3FB7A 1RHHA 3RVXD 2VXSL 2NNAA 4PJDE 2OL3H 3WCYA 1FSKC 4P23A 3LEVH 4K55A 3HC3L 1OWRM 5T3ZL 1BEYH 1BFOB 2X9WA 2I60H 4YIQA 1NC4B 3W0WD 4HFUL 4JDVA 4M1GL 1HIML 4PLNC 3BH9B 4OCSL 5BJTA 5BZDB 4RWYL 1KJ2H 1NL0H 1NLDL 4ELMF 1J0HA 1KUMA 2VLJA 4AM0A 4FQ2H 3N1GC 1Z9LA 4EN3D 5FF6B 4LSTH 5L2KB 1AP2A 4Y2DA 1I9EA 4OF0A 1LHZA 1QLFA 2CRZA 3P4MB 1C5DA 1OSPL 2F74B 2RAMA 1GOHA 3O9WA 2IQ9H 4JREB 5CJ8A 2VXVH 1WBZB 3LB6C 4PJGE 4U6VH 5HYJB 1MJUL 2XZAL 3JTSB 3PWJA 2EDEA 3VXQA 5KJRH 4YNYB 1HSBB 1X44A 3Q48A 1C16B 1QSVA 1IM9B 3JXAA 5TF1L 4L3EB 2OZ4H 4OFVA 1DEEA 3VG9B 3DVIA 1TITA 2JJTA 1J8KA 5DI8A 1MCEA 2VLRD 4PJIA 1OD9A 4KU1A 3U46A 2DQIL 3AAZB 1UCTA 2JELL 1EX0A 1T0NA 4NCC1 3EZJB 4NZDA 1IAIM 3QFDB 5DRWA 1P84K 2PTTB 4RMSA 1A3QA 1A6UL 3RHWF 4HIXL 4PP2A 8CGTA 4J3XA 3V4VL 2ADIA 4OZHF 4Q74A 1PQZB 3P0GB 4N1HB 4BFBD 2A73A 1VFAB 2ATKB 3LMJL 5HYFA 5CGYC 4JQVC 3VWJD 1WEJH 1I9IH 3RNQB 1INEH 5IB3B 4LPTA 1BP3B 5ANMB 1I8IB 5D1QD 1FH5L 4QXGH 2XTLA 2BNQB 1FL3A 3DV6B 3MXVL 4PJDF 1T20A 2HJKB 1V7NL 4JM2F 2QEJA 5SWZD 3O3BA 5H37G 3ZE1E 2FGWL 3D0VB 4N90D 3V7AE 1KJVA 4G8EA 5SWSB 3RZWA 2VDLL 2MFNA 2VC2H 5I76B 4G6AD 1CG9B 2BSTA 2X05A 1CDGA 1MHEB 4F9LC 1E4WH 1S7VB 3QEQD 2DB8A 2D31A 4LCCB 2PYEB 2YR3A 4XMKL 2Y4SA 3FN0H 3HI6H 3TNNB 3OF6A 4WW2F 2HLAA 4QRQB 5FV1L 4Y16B 5DJAA 1BZ9B 1XR8B 4X7TB 3QIBA 5I8KL 2Z93B 3BGAA 4PJGF 3MLSH 3I2CL 4NRZA 5E7FA 1AHWA 5CBEB 5IV2B 4ZSOA 5GS2H 1V3JA 4RX4D 1DVFD 4FFVC 1G9ML 3PL6D 1CE1L 4M3JA 3UTSB 5IHZA 4GXVH 4M7ZC 1CGTA 1HHKA 4NNPH 1CLZL 5IVXE 4AEIL 2QQLL 1YQVH 5F1NA 1KBGL 5J89A 4LCIL 1DANT 2YMXH 4NKMB 2BMKB 3PGDB 1KB5B 3MUGB 1T4KA 1RK1A 2GAZB 2R9HC 4WCYH 3BQUC 4BQ6A 1PX3A 4W6XB 5J9PB 1A3LL 4NZTH 3BRFA 3U7AA 4GS7B 4JZNA 1BF8A 4LLDA 3WNMA 1RJYB 4OUUB 1S5HA 5JQ6H 5GSRB 3ZDYE 5E9DD 3RWCB 5C3TA 4X7CC 3RGVA 3B3IB 5H35A 3QEHB 2QKIA 4MHHI 4P99A 3V4PH 1H8SA 3SDXB 1INQA 3HNVL 4G9DA 4XI5D 3ZE1F 2NY3D 1LMKA 5C0IB 2VLJE 5HDLA 3OKDB 3ZKXC 1HE7A 4IS6B 4PJ9A 3L5WB 5D7JC 5E2UL 3SJVB 4M43L 3I6KA 1I8LA 3U79A 4TNVK 4HGWB 1A9EA 4ZS6D 4J3TA 3MOAL 2C4XA 4KDTC 2F58H 3FTGA 1RJLA 1WCBA 4OM1L 3V2AR 1T83A 4DGIL 3VFRA 1BVKA 2NZIA 3NA4A 4PRPD 4U6XA 1VPOH 3JV6B 1UM5H 3W11D 3U36B 1VHPA 1P7HL 3IXAA 3S3SA 3A0OA 1MCPL 2HYMA 3BPNB 4PJIE 4PG9B 4F7EB 4WJ5A 3V8OA 3VCLB 3I3EA 5EULV 4QKXB 3JTTA 4XWGH 1SBBA 2J6EH 3O3AA 3FQXB 2R1WB 4NNYA 3NAAL 3DO7A 2B4CL 3PP3K 4PJ7E 3RIAK 4HPYL 1SVCP 3Q5OA 35C8H 4ACPA 5GS0D 4M03A 3MJ6A 3KYAA 3DMMB 1EFXB 3W81A 1S3KL 2DI8A 2FL5B 4Y4FD 5HHNA 4KVNH 4OZIB 4QXTB 3JZ7A 4NBYB 3U9PL 3NPZB 1W72B 4FQLL 1G6VK 4LAQH 1QFUL 1U3HA 4Z7QE 1LO4H 1CBVL 3BDYL 1PDKA 4FTVA 1T2JA 2L4OA 5EIVA 3I3BA 3MRLB 5TE4H 3GK8L 2HT3D 3KYOA 4LP4A 1JF1A 2Z4QA 4XNUL 4K3JH 3C5SB 4RCAA 4CU7A 5BOPA 2JJSC 1ZLWK 4GMSH 25C8H 2DKMA 3VJ6B 1KCSL 3F12A 2HKHL 4KFZC 1NGXA 1OAUH 2CIKA 4U2YA 5IGXH 4TULH 5LWYH 4HJ0D 2PO6C 3HHRB 3UPRA 3ULVE 4MXVE 2XA3A 4IMKC 5HSFA 4CN1A 4D3CH 2XG5A 1A7BA 4JHZA 4ZSOE 3WS6C 5KVGH 5DJ6B 3EOBB 5L2JB 1XCQB 5I1DA 1KPUB 5HDBE 1LWRA 3SKNA 1MAJA 4QCIB 3G5ZB 4PJIF 5FHBH 4P2OC 2CJUL 1R5WB 4KKLD 4NRYB 4RGND 3L3IB 2KDGA 4KUZL 1ZSDA 4KROC 1MCNA 4DQOL 3RI5F 5INDB 5KVFH 3C60A 4JHAH 3MREA 4JM4L 3ULVC 1U2HA 2OP4H 3UPAA 1E4KA 3V4UL 1JPSL 3QIUB 3HZMA 3I50L 2WWMC 4P2QB 1DQLH 3SDDA 1BFSA 1YNTA 5JW3L 4RMWA 3EHBC 4QXWA 3BW9B 3HG1D 4NJAL 1ADQA 4CMMA 5C6TL 3LEXA 2NW3A 1AD0B 5BV7C 1IBGH 1RIVH 4G42B 5FGRA 1JNNH 4CAGA 4Z7QF 4MB5A 2F53A 2OXGA 4ZYKA 4OIIH 2OJEB 1ZHLB 1NDMB 3SDCC 4KKBC 3QUXA 2C7UA 1XGQA 3ZSTA 4ODUA 3O6FD 2X4NB 3MBXH 1GOFA 3D39B 3HZKB 4XAWL 2H3NA 3UAJC 43CAB 1A14H 1AXIB 1LILA 4L8SC 2DI7A 1BOYA 3FO2B 5IBTH 1U8HA 3AS3A 3MR9A 5JPNA 1TQCB 3VDCA 2EE9A 2NY1C 1VGKB 4MXVF 5EUOA 2N7AA 3FT2B 1QR1B 1F90L 5EDXA 5GSVA 1NMAH 4HK3J 2CDFA 4H20H 2AV7B 4POZD 3CC5A 4OCYL 5C71A 2HFGL 5HDBF 3TT3L 1I85C 4UZGA 3O6MH 2C3XA 3ARBB 3MNWA 1FNGB 1GHFH 1FBIH 1MCOH 4GW4A 4X9IA 2VXQH 1VCAA 5LGHL 3ET9F 4ZAKB 4NC1E 2HFFB 1AGEB 4MSWB 3TVMA 4YHKL 4L3AA 3PWUA 3ALXA 3WO4B 1HQ4A 4OLUH 4P59L 2A1WL 4RA3A 2QHLA 1G7QA 1GCFA 3HB3C 4XXCA 5EZLB 1CD1A 2CUIA 3F7VB 4M9OA 4BKLB 3FB6B 5CJOL 2Y07L 3NCBB 3N9GH 4HKJA 2YSSA 1OTUD 4HJJH 3KPNB 2I9LB 3P9LB 4Z6AT 4WHYG 1NCBH 5FUCE 3CUPA 5I1IH 1OAQL 1VDGA 2OL3L 3SGKC 1X5JA 3LEVL 2H1PH 2Q8BH 4FTVE 1PY4A 5JO5A 3U7WL 4XBGA 2H2PC 1KIQB 5F89A 2DKSA 3KPMA 5MI0B 1U91B 1NL0L 5EU3A 5HD8C 1JF6A 1JWSA 3BPLB 1E27B 4M5ZL 2VAAA 2NXZB 2WBWB 5F1IB 1H3TA 1CZ8L 4UOJA 4LSTL 1F8TH 1ND0A 4FP8H 4PFEA 1CFBA 4L4VA 1CGSH 5IBLC 5D71H 3SKMB 3H42H 1I7TB 5I15H 3ZDZE 3ZTNH 1FORL 4P3DB 4K3HA 5C0AB 2EC8A 1K5NB 1ZOXA 3BVNB 4U6VL 4EVNA 5DVLA 2YOCA 1RMFH 4EI5B 5FM5O 3CIQA 2OZ4L 5E00A 3IF1A 1KGCE 4PYHA 4U1SB 5TPWH 3L3HB 3SGDH 1C08B 2FYYB 2JCCA 5GRWA 2FH8A 4JKLA 1IQWL 1ORQB 2QQKL 2YPLA 3MMEA 3BX7C 4PRDB 5I1CH 4LLWA 4XWOD 1HCFX 1WVZA 2XNAB 5HI3C 3RU8H 4KZEH 1DUYA 2ADGA 4HWBA 3S37H 1YMHB 4PTTA 1FLRH 1KENL 1BZQK 3N0PB 2O61A 2ED7A 1QEWA 2BY0A 3OAUH 1KLUB 3LKPA 3QCTL 1DE4A 1WEJL 3OAZK 3D85A 1INEL 4P5MB 1KYOJ 2A0LD 2KZWA 3QCUL 4OBSA 3RDTA 4D9QD 3KS0H 2VERN 4MAYB 1T2QL 1I3RB 3M17A 1NCCH 3B8SA 4RFEA 3GO1L 5GIRB 2F53E 4OD2B 4HUVB 2Q3ZA 3DOSA 2E7MA 1YNKL 4ZD3H 4Q9RL 5ETUA 1SJHA 1IKNC 2MJWA 3EO1B 5BMFH 3RTQC 4PGZA 1FL5B 2Z31B 1JTTA 3BUYA 3O3DB 5D7LA 5FKAA 5FM8A 2E7LC 3CD4A 1N64H 3AU1A 4FZ8H 3EGSB 1G7PB 3FN0L 3CU1A 3Q5TA 2UUDK 1IM3A 2EICA 4WNQA 1RIHL 3ZDZF 3G5VA 1VACA 5EUOE 2XN9E 3VXSA 3MRHB 3VH8A 1X5GA 1PLGH 1PZ5A 1FDLH 2VO5A 1S9WB 1S78C 3X17A 3MLSL 1M05A 2H6PB 3VFMB 4KHXL 3MX0A 2D3VA 3KJ6L 1MFBH 3AY4A 3T4AA 2NW2B 3PP4H 4PJBB 1AO7B 1DBJL 2VZ3A 1FV1B 1NUDA 4UDTB 3CXDH 2RFXB 2DN7A 1RZJC 4NNPL 1D9KA 2ESVA 1H15B 3QISA 3CLEH 1YQVL 4GG6A 3VMPA 1IE5A 2XYCA 1T66C 4R3SB 3H9YA 5FGCB 4ZUTA 4L8CA 3MV8D 4WCYL 5EZIH 4WTZG 1ZA3B 3DX7A 4RNRB 1BBDH 1I1FA 4XT1C 5IWLC 3OJDB 3P4OB 4BSVA 1GPOH 4F57H 3TT1L 3G9VA 1J87A 3LPWA 4I4WB 1DUZB 1LO0H 1WIOA 5JQ6L 4GAYB 2XWBA 2GJ6A 4RAUA 3SQBA 3RL1A 3T77A 5I16B 5CMAA 4XH2B 1AGCA 4UV4H 5DUPH 5EOCJ 3ME0A 5I8EB 3UXFA 3WFBH 4GRWH 2ZSWA 1FNAA 5M94B 3V4PL 1YPZA 1NAMA 4N68A 3QDJA 2PKDA 3FQTA 3MPCA 3HUJA 1CFTA 1U8QA 2Q6WB 3EJYD 1QOKA 1FO0H 3EW3B 4CN6A 1RUAH 4FQIH 4U1GC 4L4VE 5L0QB 4HULB 4NBXB 1AD9A 4WWKB 1ZTXH 4YO0A 4ZPTA 2OL3B 4QHLA 4I77H 1EHNA 1AXTL 2F58L 2C3WA 2GK0A 2BNRD 5EUOF 4AIZA 1KJ2B 2NY6B 4WTZA 1P4IH 1RFDH 2LFGA 1VPOL 3FQUA 2G75B 1S5IH 2H26A 2DYPA 2HJLB 2O5ZH 3F5WB 1JHLH 2JCCE 3KJ4B 3U9UA 4TVPH 5MEND 2YPLE 3DECA 3ILQD 1MCBA 1XF3A 2P8MB 1F2QA 5ID1A 5IIEA 3OKNA 1BVLA 3O4OB 5JOPD 2I26N 4IDJH 3MRBA 4HS8L 4N8CH 5FA4A 1JYNA 1AIFA 3IT8D 3TA3A 1K2DB 1MOEA 2LQRA 5CWSA 3CK0H 4NT6A 4HWEH 2RCSH 4C56D 5J3HD 1ZE3C 4Y1AD 2VN4A 3ORJA 3IDXL 4P4KD 2WBJA 3WJJC 3GI8H 5BV7H 5C2BL 4TNVF 4LDLB 4YDIL 1S9YA 1VADA 2X4UA 1WBYA 3QXTA 4O02L 2FHBA 1LP9A 3IJYB 4ZPVB 2C5DC 5HGHA 1JHTB 4GOSA 3CSYA 4L4TD 3A6BH 4PIRF 4KXZH 1BBJB 4AQOA 1IGTA 3WNLA 5IHBA 1HI6A 1E4JA 5TE4L 4GW5B 5D7LE 4QEGA 4M6AA 2IAMA 4JRXA 4NM8H 3IFOB 4QOKD 2IH3A 4X6CB 1AR1C 2FBJL 3OB0K 4GKSA 4B0MM 3SE3A 4GMSL 3IJHB 2EDBA 3QUYB 4GO6B 3GUTA 3NPSC 1OAUL 3VXSE 5IGXL 4TULL 4NZRH 1IAOA 1RULL 1D6EB 2DBLL 3O41A 4XRCA 4PGBA 6FABL 2B2XL 4PJFE 4P5TC 5ACMA 3RIAF 1QYGH 1ZWIB 2JIXA 2VZOA 4XCYA 3DVNB 5F7NC 2ZUQC 4OIBA 3TPUB 5TFSL 1ZVHA 5KVGL 1UKTA 3Q0HA 3DXAD 2JCCF 4QHMA 2GJZA 1M7DA 3PGFL 5CILH 2ESVE 1BQHG 3QA3B 4NQXA 5J1SC 4GG6E 3EO0A 2V5SA 5FHBL 5ISZE 5KN5B 5ICZB 5DGQA 3IXTB 1MFCL 1U95B 4IRSB 3MLTA 2FLBT 1K8DA 4JHAL 4EQ2A 4WI8A 5IT2H 5E2JA 3TYFB 2OP4L 4F7TB 1XGTA 4C54A 2DLFH 4GRMA 3TF7C 3CVHA 4R7NB 5T3XD 1KYOK 3DJ9A 3QUZD 2A9NH 2FX9H 1OL0A 2BSRA 4WIQA 2GJ6E 1OW0A 3BFOA 3C9NA 2SEBA 4X0KB 5DUMH 2VDOL 3B2UC 2ICEA 3QNZA 3GMOA 3NACL 2YD2A 2VUOA 1IBGL 5E8NB 4NNXA 1ZLUH 5DVKA 1YPZE 1AY1H 4NQDB 4Z5RB 5I9QB 3DGGA 3BGMB 4J6RL 3QDJE 1Z5LA 4UIKH 4B7IA 2P45B 5E2TL 3ZO0A 4U6YA 1HQRB 4RGOH 4JFHE 1V7ML 3NTCH 5C0DB 4YFDB 1DQTA 4NQCB 5KANI 5DFVD 1P5UA 3O8XB 4K71B 3LHPH 5EWIH 2G9HB 5E8EA 3MBXL 4HBCH 2YWYA 3IETB 1YEHH 2OMBA 1QNZH 5IB4B 3K8MA 1W8OA 5E03A 5HTSA 3AUVA 1LK3H 4JFQA 1DBAL 1A4KA 1Y6NR 3ZKMC 3VXTB 4S10A 4L9LB 4CN4A 1JTOA 2PTVA 3BEWA 3O11B 4W4OC 2E7BA 5EFIA 1A6TA 3RX5A 1ZGLB 2NY2C 4UT6L 4HC1A 2Z35A 2I07A 4BQ8A 1FBIL 2F54A 5L7XH 1S7SA 2VXQL 5CHNA 5SX4H 4HG4J 4WGVB 4YHOH 1XCTB 2C4FU 2B5IB 4KKCC 5E94A 1C5BH 4HK3N 4UV7H 5HJ3B 5HYJD 2AEQH 5BVPH 4NSKA 3QSKB 1CT8B 3DUUA 2J88H 2CUMA 5A1AA 4Z18A 1CFNB 1QKZL 3FOLB 1IM9D 2C26A 2FWOA 4L3ED 3OKEA 2WM0A 1DN0B 4QTIL 5FYJE 1B0GA 5K93A 4BYHA 1G7LB 1ZHNB 4IRZL 4DGYH 4HJJL 2MOVA 5IFHL 4AEHH 1LP9E 4G5ZL 1LD9A 5D1QA 5EBMA 3U0PB 2ITDB 4JFPA 3AVEA 5KOVC 3VFNA 1MUJB 3VFPB 3H3KA 1OTSC 3V9FA 4PJCB 1JGLH 5E6ID 2JB6A 2BDNL 3HMXL 1B90A 4YBLB 4CW1A 4CRPA 3HUJF 1CDIA 4HPOL 4FN0A 5D96C 4J3UA 5HPOA 1OGAA 5DGRA 4GKZA 4JRXE 4R96A 4U6TA 5IR1A 4KK8C 4U1HA 5TF0A 1MCRA 1HWGB 4JO3H 2FB4L 3BH8A 3VFUB 1UH3A 1D5ZA 1CXHA 3VMNA 2C1OA 4P46A 4WV1A 1CGSL 4YPGB 1MQKH 1U8PB 5D71L 2BVPA 3LIZL 5F1SA 1FE8L 2XG4A 5IMMA 3FO9A 3S8WA 3ZTNL 4NQED 2P44B 1QFWI 4PG2A 2VMFA 4LBEB 1CFVL 4PUBH 4XHJC 5DR5H 1YDPB 2XQYG 3DI2B 1H3GA 4Z77A 4V1DE 1RMFL 2NTSP 2IAMC 4JKPH 2AJ3A 3PDDA 4PJHB 4DKFL 4TUOA 2XA8L 4XNZB 3O4LB 1QPXA 3X3GH 4H1LG 4LGPB 2IBGA 4HUWA 3O45B 5EOTA 1IGIH 1W0VB 3PL6A 3SOBH 2FO4A 3JSSA 4PD4K 5DSCB 2P42B 5BZWB 1MCSA 5FYKH 4MJIB 4N8PA 5A3IC 3MBEB 3E6HB 2GY7B 3RU8L 5E8OA 1FZJB 4CJ0A 1LE5B 3DRTB 1MLBB 4U1NA 1NLBH 3T3ME 3QIWD 1TJIL 1FLRL 3GMPA 1QSFD 1MH5A 1TQBB 3S36H 2EH8H 4KI5D 3MRRB 2DD8H 4QRSA 4UIMA 3UP1A 1P7QD 3B9KB 4K8RC 2WUCH 5DJ2A 4AEFA 1CFQB 2JJWA 3STZB 2I5YL 2YEZB 3GSOA 4HQQH 1UM6L 4N0UB 5TH2B 1LP9F 3VU2A 3PDGA 1UACH 4DGVH 2R56H 1NCCL 5KSAB 4GG8A 4IOSD 1NANH 3PXJA 5BRZD 1R5IB 4NDMA 4JG0L 2YWZA 2XV6B 3P0VL 4EDWH 3UC0H 1OGTB 3WL9B 1RIUH 2EIBA 4YHMH 3AM8C 2AK4A 4H1LA 1TZHA 2GYSA 3BEVB 1J10A 4I3GA 3UJIH 4YHIB 1UA6H 1FSKB 3LV3B 1N64L 4FZ8L 4KUCD 1AC6A 3V7MA 1QRKA 3VG0H 3GSWB 3ES6B 5EH1A 1PLGL 1IGCH 1TVBA 3M1BB 1FDLL 4MD4A 3SDAD 4XCEB 4E42B 3QWRA 5KSBB 2NR6D 3IDJB 3FT3B 3DSFL 3PP4L 3RWJB 3S35H 5EC1A 1BVZA 1FZOA 2F54E 3C8HA 3CXDL 4L9DA 4RRPG 1C1EH 3AB0C 3EYQC 1LDPH 4OTXL 3T8XA 5EO0A 3ARGD 2NY4C 1CCZA 3CLEL 4Y19D 4DZ8A 3MRGA 2EO1A 5T3ZD 3P2TA 1W8NA 1YUHA 3O2WL 4LLQB 1QLEH 2AJXL 4WDIB 2FEEI 3T3MF 2HG5A 5DK2A 3RVWD 1QRND 5EZIL 1OQXA 4XPHH 2FJFA 3U6RA 4POUB 3HZVA 1BBDL 3G6DH 2FIKA 2C1PB 1B88A 4NUJA 4F57L 4MWFB 1LO0L 1OD7A 1I8KB 4O58L 1FVEA 2IGFH 5DO2C 1A2YA 4OKVA 1NDGA 1NUGA 3ECBB 4MNHA 4UV4L 3UX9B 4JANB 5DTFB 1E4XI 1F13A 2PCPA 3MCG1 4BELD 4HLZH 1S9XA 3CLFL 1OGAE 3QEGH 3SGEI 2CLZB 3C2SA 4WUKH 3GM0A 2A74A 1NGPH 2EYTA 4UTAL 1FO0L 1F58H 4RRPA 4LLUB 3IAPA 1J0YA 3AMLA 2ARWA 3HLAB 4XCNA 1T3FB 1MCWW 1GVIA 4RISL 4PRBA 1U92B 3QZWA 1GC1L 4OJFH 3QEUB 2GUOA 2PXYC 3X3FL 4PGCB 1Y6KR 2PW1B 3KDMA 1HXYB 1P4IL 1RFDL 2ILLA 4NQVB 1PEWA 2DQCH 2APWA 1KB9J 1JHLL 3UBXI 4XZUB 1LE9B 4DN3L 1HH9B 4MAUH 4NQSB 4YHLH 2WANA 2VDNH 4OI7A 4TVPL 1IGYA 4HG4K 4H5SA 5HBBA 2EYRB 5GHWH 3V5DA 5SV4A 3ESUF 3ULVL 1I1AD 4Z7UF 4N8CL 2OTWB 4UDUB 5F7YC 1B4JL 5A2LH 5EA0H 4XCFL 3CK0L 4HWEL 4FABH 1IC4H 4J4PD 4GRLD 4M7ZB 3ARDD 2HFTA 5DJCB 3HR5A 3PV6B 1HWHB 5FOBB 4JPKH 5IESL 5BV7L 4MB4A 1I7RB 1LK2B 4X6FA 3I9GH 1CIUA 1XF4B 4LCWB 4ZUUB 3BQUB 3HG1A 3EFFB 1JRHH 4U3XA 4LSVL 4OIAA 4XP5H 4ZS7L 5MEOA 4YAQA 2D03L 3A6BL 3GMLA 4BUHA 3SN6N 4ALAH 3EFDL 5D5MB 1N7MH 2YC1A 3VFOB 3QNXA 5IVXB 2AK4E 1JPFB 2X4RA 1PD6A 3TJEH 4NKQB 2GY5A 5EORL 4G8GD 4NM8L 3WS3B 3C5ZC 2R4RH 4DJMA 3RL2B 2CDGA 2W0LA 4WUUB 1YY9C 1UH2A 3O6FA 1MI5B 4QHUB 3JWOC 1MIEH 3HNTH 3DTXA 1KT2A 4XBPB 2HWZL 5EU6B 5DJ0A 3ZKXB 2IJ0C 3EYVA 3K8LA 4JFOB 5D7JB 4CGTA 1UYWL 5TDNA 1QYGL 5C0NC 1B0WA 3ZSSA 3WLBB 2J8UA 5KOMC 5LJYH 1M1SA 4LRIA 1B2WH 2ZOKB 3TFKC 5K9OA 1GZQA 3PWVB 3QAZC 4X7EC 3VFTB 1Q9LA 3S4SA 2HJFB 5K59F 2AS5M 1U58B 5FCUH 1Q9WA 1I4FB 3G04A 4F33B 3P4NA 4WI6A 4YLQT 1GZPA 4YZFE 1RZ8A 3EJZD 5IT2L 4IOFD 1F6FB 4P48A 2N4IA 1OQOA 4LMQI 4IM8A 4CDHA 1BWMA 2DLFL 1F2XK 3CGTA 5FV2A 5GGRA 4N0CC 2J2ZA 5INCB 1Z0MA 1J0KA 3ARBD 1IEBB 2A9NL 3B9DA 1QA9B 3KPQA 4B5EA 5I1JH 5K9QI 3JV5A 4ZAKD 3RWEA 5DUML 3G08A 4HKXB 2HT2D 2COQA 1MSPA 2G5BA 5CSZB 4RMQA 1IVLA 1AY1L 1BQSA 4N8VB 4OQTA 1TXKA 3HRZB 4MJ5B 5DEGB 1ZS8B 4M48H 3VXMA 4IHOB 4JR9H 3SO5A 4MQ7A 5JW4Q 3MJ9H 1DQJB 4OCXH 1EVTC 3RUGE 1JMXA 2H32B 1UH4A 4LCUB 5EWIL 3VXRA 1UWGH 4GT7A 5C0CA 4Z7VB 1A5FH 3P9MA 1MRFL 3P73A 1QBMH 4PJ7B 3RFZC 5ESQB 1TCRA 1JBJA 1KIPB 4JN1H 1IEAA 2DIAA 1CL7L 5CEYA 2RBLA 5DRXB 1FP5A 4YDLC 3MLYH 1FO0B 4LQFH 3EOAB 1X4YA 4YX2L 3UMTA 3MZTA 2NXZD 2E9BA 3NCJH 1X5AA 1JPGB 4X98B 5CLTA 5HHXH 1JZ4A 2PO6B 3BAEH 3ILPA 1U8OB 3IKKA 4LPXA 2QSCH 5L7XL 4U1MB 1Y0LA 3RVVC 1IAKA 4BQBA 4JO2L 4JRWA 2AV1A 4YZFF 3B43A 2AEQL 1P9MA 4Q58C 1LEIA 5JDSA 5BVPL 4ZDHB 2B1HH 4M93C 1MCHA 2VWEE 4K8RH 4P2OB 4R26L 3OG6B 3QI9C 5HVFB 2GFBA 1YQ2A 1X5IA 4MVBC 3K1DA 2QBWA 4KROB 2V5MA 3FFDA 4K94L 2BC4B 3L3KB 3MYJA 3U7YH 4AEHL 4ZSOB 4G8IB 2HRPH 5IHZB 2UY7A 1JGLL 5EBWB 1T1XA 1HHKB 2CKBA 3G5XA 5D1ZC 4YHYC 3GHBH 3BOVA 3VMOA 5I1LB 4LIQE 4WENB 3H3BC 2HN7A 2VWEC 5GGTA 2V2TB 3QQNA 2CLVA 3FFCA 4QRRB 5BV7B 4ZFZA 3KYMB 4M6ML 4DK6A 3CFKA 1X5HA 5JXEC 4ORGA 5LG1A 3RWFB 3GZKA 3VWKA 1ORSB 1A6WH 3MJ8A 4A6YH 4HS3A 3SDCB 3GSQB 5HXMA 1NCDH 2OMNA 1S5HB 4S1DC 4LVHC 5DR5L 4ODVL 4ZUSA 5C3LD 5E95B 4P49A 4EZMA 1KB9K 2Z31D 3TBSA 4JKPL 5HDOA 5AUMA 1R0AH 3OPZH 1RZJL 2FD6L 4L8SB 3X3GL 1KCRL 1JL8A 2DQGH 3WHE0 5GPRA 1F42A 2MCG1 1IGIL 2D4FA 4HX1B 4WVRA 1T7YA 3SOBL 1Y6MR 2NY1B 4I3SH 2DQUH 5FYKL 2W0FB 3H9SB 1FCCA 4CVZA 1J8HB 4P5KA 4P2RA 4Y4HC 5DHVB 1QFOA 3HCVA 4KQ3H 1JWMB 2WSKA 1JZ7A 2ZG3A 2CRIA 4N5EC 3FQWB 3UYPA 2OTUB 2EH8L 2K7PA 5IQ7H 4UNTA 4PRHB 2MNUA 1TMCB 4GW1B 3D0LA 2A6DB 5E4EC 1QQDB 1L9NA 4G9FA 1U8IA 3MRNB 3MCLH 1UACL 1SJEA 2VQTA 4EI6A 1XF2A 3C09C 4WU7B 5HGAB 5T1KD 3VXME 5E2WH 2V17H 4PGEA 4K7FA 4WFGD 3UC0L 3V5KB 5TJWK 1PYWA 4QT5A 1NQBA 4FQPA 2XQBH 3S3PA 3VXRE 4YHML 5C0CE 2P24B 3NA9L 5GQBA 1UA6L 5E5MB 4YGVA 1L0YA 2XZCH 1GRWA 4NO0B 4S11A 3CSPA 1Z6JT 1CICC 3CDGA 4WO4D 5I30L 3R8BB 3VG0L 1QVOA 5GXBB 5HVHC 4EKXA 4MQXC 1IGCL 5CUSH 2J8UF 3TESA 4K7PX 1MFNA 5EG6C 5C0BA 1SEBA 2QR0A 3S35L 2AKRA 4MJ6A 4PRIA 1B9ZA 1UXWA 1WGOA 2CO7B 4LHUD 1P4LB 3MNVB 4P57A 3GMNA 4PJ8D 5HI4C 1KPVB 4HIJB 1JF1B 1QLEL 4PY8I 3L95B 5DA0B 1JIBA 4MNGA 1A6VH 1OCWH 2EIEA 2NY6D 1CYGA 1F4XL 3E0GA 2I9TA 1FFOA 4APQC 4GAFB 5AYUH 2C3VB 3KPRD 1KXQE 5HHPA 3CPLB 32C2B 4HMEA 5MEPA 3UPRB 2YD7A 1WBXA 2XTJE 4KVCH 4MXQC 1U8LB 2IGFL 5SX5K 4HWBL 1I7UB 3MRIB 5D1XC 5EO9A 1DLHB 1K85A 3MA7B 1Q8MA 4FNLH 1S7QA 1EAPA 4JCMA 3WN5C 3RPIA 4HMDA 3QEGL 4Q6YA 3D69B 3GKWL 3FFCE 4M1CC 3QPXH 4PTUB 3JWOH 3PXHA 5HPMB 2XZQH 5HHOD 4XXDB 3L7FA 4PJAB 5JA9A 4F8TA 1HKLH 5KVEH 4M1DL 1OP5H 5BS0A 1XH3A 1J7VR 3ROLA 1HH6A 3EYOA 1NCTA 5EU4B 4Z0XA 4LSSL 3CX2A 3IKCB 4LSUH 4NZJA 4AENA 1NEZB 4CMMB 1F97A 1G6RA 2CGRH 4Y5VC 3QUMA 2DQCL 1MFEH 5CZVH 4OZGA 3H2WA 4YHLL 2ADJA 2VDNL 5JOFA 1T1ZB 3FRUB 5A2JH 3BPCB 4LKCA 1RZGA 4CADB 3LKQA 5D2NC 4X5LA 3ULUC 3TZVC 1KXTB 3FCTB 3HE6A 4P2RE 2DLEA 1IKFL 2GKIA 2X4TB 3HN3A 3JV0A 2R0ZH 3HE7D 2AI0L 5GRVK 4FABL 1IAMA 5KTEH 4GQ9L 3OR7B 3FT4B 1X5ZA 2CDEB 2P5WB 1AGDA 4JPKL 1Q9KA 4ONGH 2XN9B 4G9FE 2A6JB 3CVIH 1L7IH 2JKXA 3I9GL 3P11L 4K9EL 4KMQA 4QTHB 2PETA 2W9DL 2W59A 2DQFA 4UOW0 5CJQH 2YUXA 1M6OA 2GW5A 1TCMA 3OGCA 4Y5YA 1V3LA 4R0LA 5KW9L 2X9XA 1HZHH 1VEPA 5IHLB 1HYSD 3QBTB 3LRSB 5CINH 3CX5J 3GM8A 3TJEL 4FQXC 2R4RL 3TN0C 4U7MA 3VD3A 1BM3H 1FIGH 3I02B 3B9VA 5LAXA 3K1KC 5T5FH 1MIEL 5BXFB 4HIEB 4G7VH 3GFUA 5EC2A 4NQDD 1X7QB 1CWVA 3S88H 5K9KB 4NHCH 3WIFB 3WFCH 4K7PH 2DQEL 3IAQA 1CGXA 1JMZA 5JZ7D 2E6QA 1BFOA 4U1GB 4WFEE 1NC4A 3DUSB 1GGBH 2VISB 5C0BE 3BH9A 4K23H 1B2WL 4PRIE 5BZDA 5CFHA 3GBNL 1QLRB 2H45A 4WRLA 1TTFA 4E0RB 4G80B 4XBGB 5FF6A 5L2KA 5F89B 5CJ5A 2CMRH 4OM0L 3QNYB 5FCUL 2D9QB 1P6AB 3P4MA 2F74A 4OZFH 2Y6SC 1I9RL 5JR1H 3V6BR 1KCUL 1WBZA 3VD5A 4R90H 5HYJA 3MRPB 3UTPE 2I24N 4YNYA 3MACH 1HSBA 1C16A 2B8OT 2ZUWA 4L3EA 2E9IA 4JFFD 4OCRH 3MUY1 5I1JL 5EZJB 2GCYB 1EZVX 3AAZA 1I7ZB 1PKQB 4FG6C 3QFDA 4LKXB 3SE4C 2PTTA 1EERB 4X5XB 4ZXBD 4TUKH 4I48A 4M48L 3BN3B 2XOTA 1BD2B 4EXKA 4M61B 1PQZA 4JR9L 4KK5C 4KXZI 5FYJL 2NLJB 3D9AH 4MQSB 1VFAA 2ATKA 3RWGB 3MJ9L 1OY3B 4PJ5A 3B6SB 5AG8A 3GEWB 3RNQA 5HHMB 5FYLE 5IB3A 1UWGL 5ANMA 2X4OB 1I8IA 2EKSB 4PTTB 4XC3L 1A5FL 5GRJH 4XTRD 2BNQA 2O61B 4X9GA 5BS0E 3DV6A 3LKPB 2Y5TB 2VXTH 1R5VB 4J3OC 3I6GB 4JN1L 1JNHB 3SE9H 2HJKA 3T0AA 1ZLVK 2KZ1B 3D0VA 1TLKA 5IFAL 1G1YA 1LEKB 4LQFL 4S0TD 5SWSA 4OZGE 1AQKL 3NPSB 1A7RL 3VXOB 3AXLB 4RFEB 4U1IB 1CG9A 1M4KA 1MHEA 1S7VA 1FFNB 4S1SH 2PYEA 3BKML 4P5TB 1S7RB 1EEQA 3EOTH 2QSCL 1WFNA 2UY6A 3PHOB 1J1OH 4YXKL 2ZUQB 3TNNA 4QRQA 4Y16A 4I0PC 1BZ9A 3HC4H 1XR8A 3VRJB 4X7TA 2B1HL 3VFGL 2Z93A 1RUQH 1YEKH 5E6ZA 4L3CB 3NIFE 4OFYA 1ITBB 2R8SH 5CBEA 3MV9B 5IV2A 1NC2A 3GJFH 4J8RB 1VFBB 1ES0B 3QXDB 3UTSA 3UTQB 2XKNB 2IAND 4PJFB 4LOUC 4K3DH 3MBED 3U7YL 3TGXA 5KS9B 4HZLB 3OMZA 4W68A 2F8XC 4OD1L 1YEFL 4K2UH 4NKMA 3T0BA 2BMKA 3PGDA 1KB5A 2GTZB 3MUGA 1P1ZB 4TSAH 3UDWA 2GAZA 4GG6B 1ACYL 2YRPA 5ID0B 5ISZB 4OT1H 3WO3B 5J9PA 4BSJA 4LNRA 1OP3K 1II4E 1K3IA 1OSZB 1RJYA 4KJPD 1ZEAL 2QSTA 4OUUA 3J7HA 1UEMA 5GSRA 1UCBH 3RWCA 1A6WL 3B3IA 4HAGA 3QEHA 1NCDL 2O5YH 5EPMB 4RMRA 4HCRA 5DT1H 4JQXA 2GJ6B 4KMLB 5C8JB 3T77B 1F3JB 4OZGF 5H37H 5C0IA 1F6AB 3MRQB 1R0AL 3OPZL 4BUGA 3OKDA 4IS6A 5L2KE 3L5WA 1SM3L 1BMGA 1YPZB 2OBGA 1A6PA 3PNWB 5I0ZA 3SJVA 5T5NG 5TGBB 3JVGA 2OSLA 1RUMH 4ZTPH 1WTLA 2DQUL 2X09A 4HGWA 3CNKA 3H3PH 1HINL 4DVRH 3ZT6A 2NY2B 5SX4I 1BAFH 5I71C 4S1RH 4ZOAA 3BKYH 4EBQL 5F93C 3NCCB 3NIFF 2HLFD 4HC1L 4TRPH 3JV6A 4KHTH 3MXWH 3U36A 3BT2H 5FA3B 2X7LB 2A2QT 2YPVL 3ARYA 3RAJL 2AABH 4XMLH 4PG9A 4F7EA 1DBKH 3VCLA 2IG2H 3MCLL 1H3XA 5EO1A 4J3WA 4JO4H 1OAXH 3OWEA 3FQXA 3WLWC 1K4DB 3F8UB 4OQ1A 1MLCB 5E2WL 1JGUH 1UZ8B 3KPTA 5IJKA 4PJ5E 5DURD 1XGRB 2AXGB 3DYOA 5E8DL 2XQBL 2P5EB 3UO1L 1KCVH 5ANME 5F88B 1KEGL 2BNQE 3DMMA 1EFXA 2HTKD 5EBLB 2FL5A 4LSRH 4FQJL 4OZIA 3LRHA 5D96B 3X11B 4QXTA 1F4WH 3P40A 4AK1A 1W72A 4LQ1A 2W65B 4X99A 2DOCA 5F7MC 5J7CC 4ODHL 5CUSL 5SWSE 2Y06H 3ETBF 2IWGA 2XKSA 3MRLA 1WZMA 3ULUH 2PYEE 5C0RH 3C5SA 4GXUN 4NWUH 3WUZA 3RZCD 4LEXH 3RNKB 5I2IB 3RKPA 3QDME 3VJ6A 4YHZH 3BP5B 2ZNWA 1H3UA 1A7OL 5E2VH 2IAMB 3PQYB 3CFEB 3BZFB 4XCCH 2LE9A 1INDH 1I9JH 2BJMH 3SO3C 3ELAT 3EOBA 5A2FA 5L2JA 3UTSE 2DJUA 3TWCH 5JW4R 2BOBB 1KPUA 2