1F4YH

Crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
216
structure length
216
Chain Sequence
EVQLEESGGGLVTPGGSLRLSCAASGYVFSTYDMSWVRQTPEKRLEWVAFISSGGGRTSYPDTVKGRFTISRDDAKNTLYLQMSSLQSEDTAMYYCTRHFYAVLDYWGRGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIBODY S-20-4, FAB FRAGMENT, LIGHT CHAIN
publication title Crystal structure of an anti-carbohydrate antibody directed against Vibrio cholerae O1 in complex with antigen: molecular basis for serotype specificity.
pubmed doi rcsb
total genus 37
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2000-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4yH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4yH01
3ISWA 1MNUH 3FFCA 5KTEH 3K8KA 1QNZL 5CSGA 3ZE1E 1MCIA 2JB5H 5D2NE 3EDEA 5EU6D 4BH7A 1P1ZB 3BD5A 2OTUB 1JGDB 3QIBB 2Y36L 4GRWH 1W0WB 5HDOA 4PRAA 1KTKE 1S9YA 3N1PC 4X0KA 2PXYB 4XVTH 4YHPB 5DQDL 3WS6A 3T0EB 1OPGL 3DYMA 4GRWB 1JPSH 4HIEB 3TCXA 3AVEA 4FG6D 4YHNB 2DQTL 5E2WL 3SY0B 1V8HA 3C09C 5B21A 4HUXA 1G7QA 4JFFB 1D5MA 5CZVH 4PJIE 2JIXB 4WW1B 2FLBT 4ZO6A 4L4JA 4M6AA 2ADIB 3T3MF 2Z31D 4Z78A 1LQSR 2Q8BH 2PUQT 3O2DH 4M43L 3S88L 4M1DH 4JG1H 4G80A 3H6JA 1BOGA 2DQHH 3AAZA 4PRHD 2B2XL 4KMLB 3SKNB 2NY2B 3PGFH 1AGDB 1PBYA 2RAMA 3JTTB 4LF3B 2EH8H 1RZFH 3CFKB 2Q86A 5T3XL 3F65A 4AM0A 4TTGA 3X17A 3V5HA 2VC2L 3QIUD 3MFFA 1CDJA 4LASL 4PUBH 4K7PX 3T0WA 4I0PD 1N3NA 4X98A 2CLRB 4JFYA 4WFGD 2XYCA 3FFDA 2V2TB 1JHKL 2JCCE 5LCVH 4TVSa 1LO3H 1CE6A 5E8PB 2XZQL 1KT2A 4MYWB 2HJKA 3EYOA 4TTDC 4HUVA 4NC2B 1KCKA 4K7PH 5ITFB 3GIZL 1JK8A 1YYLL 1XZ0A 4I18B 4BH8B 4QRPE 2NW3A 1YPZB 1I9JH 1TQCB 1UZ8B 1MPAH 4YX2L 2GEEA 5ITBH 5F1NA 2Z8VC 2GJ6E 4KGJA 5HYFA 4OUUB 1ROWA 4G43A 4RCAA 4KKLC 3PWVA 1WT5C 4FABH 1A7OL 4U0QB 5E70A 4CL7A 1PQZB 3LKQA 3MOAH 1WVZA 4QGTA 2XG4A 5GSRB 3C8HA 5INDA 3BRFA 4NGHL 2ZPKH 5EA0H 3FT4A 5BW7C 3V0WL 4WEUD 2A2QT 1UGNA 3QG6B 1MIEL 3GJFH 2MQ0A 5C0BE 5DC9B 3OKKA 3QDJE 5HPMA 5LGHL 2VB5A 4RFEB 4ZFOA 3WD5L 4YDLB 2ARJB 5EU4A 3GJFB 4JM4H 4OD2B 4Z7UF 1UCTA 4L3EE 4H26B 3MGOB 3OPZL 2P5WB 5DD5L 1I1FA 4MXVF 2YD7A 3G6JF 3HPJB 5TF1L 1MY5A 1G7HB 4LLYA 4WUUE 1S7WA 1IAKA 1INEH 3CX2A 2R1XB 4HCRL 4C59B 1IGCH 3HKFA 3FHAA 3KPSB 2BVTA 1RVFH 1ZKAA 4RMUA 3TGXA 3FFCE 5IB1A 4FXGA 3QAZC 1IGML 4L4VA 3SO3C 4WVRA 4OV5A 2IH1B 3L3KB 3NTCH 4Y19A 5DUBB 3TO4D 1WT5A 1A21A 3UPRB 2M26A 3R0NA 1QR1B 4C4KO 4JANA 2LU3A 1BX2A 5FB8A 1M7DB 2VXUL 5ADPH 2YPLB 3SKOB 3KYOA 4Z7WE 3IRPX 1W72H 4R2GB 5BW7A 5E7BA 1ED3A 3HA0A 4HJGA 1A4JA 3VFTB 3KXFD 5CLTA 1W72B 2A38A 3QZWB 3CLEH 1GPOL 1RURH 3WUWA 2GK0A 4TSBL 1ORQA 4LAQL 4NFCA 1T89C 1N6VA 1CLYL 4Y0GA 3T0EE 5K9QI 5TDNB 1FFRA 4WFHE 1JPGB 5I71B 3I85A 1JFQL 4X4MA 3BH8A 3O3DB 3CMOL 1H0DA 2E8YA 3O45B 5HGDB 2L7JA 4ZUWA 5JOFA 2X1PA 3QEUB 3WL9B 4DOHB 5FHBH 4QNPE 3JUZA 2FIKB 3H3BC 1OCWH 4QTIL 1D9KA 1T04A 1KTRL 4LSTH 1KLGB 2FO4B 4PJCE 4OCXL 3PHOB 1JWMB 1QQDB 1MY7A 3WIIH 4Y2OA 5D7LD 2E7BA 3GMMB 1V5JA 5DTFB 3MNZB 3MV11 4LCYB 4UZGA 4PS4H 4EOWH 1MF2H 4MD4A 3SDDB 5IBLD 4GFTB 1UWGH 3LKSA 1T83C 4I9WD 15C8H 3IDUA 2VZVA 3SGKC 3MFGB 4XGZA 3RUGB 5HSFA 1KTDA 4U6HB 5J1TC 1S7VA 1T89A 3MRIA 1RJZB 3OKYA 1QO3A 2VTFA 3K8MA 1U8IB 1REIA 5BRZB 5JOEA 5D1QD 1S3KH 1NC2D 5DD6B 5T1MA 5E2JA 4ZSOB 3QDMA 2BY2A 2WBJD 4JN1H 1WAAE 2DLIA 3EJZD 2OZ4L 3D25A 2ZCLL 5I15H 4BFBD 3LV3A 1KG0B 3M8OH 1T2XA 3SEPA 1HSAA 4LCUA 1JNHA 5I1EL 1G0DA 4MX7B 4PRNA 1VESA 2ITDA 3KNBB 1SY6A 5K9KB 3FN0H 3MRCA 2P5EA 4QRRB 1WCBA 4PD4J 2Y72A 3I3EA 3U6RB 5DMIH 1F11A 1DQLH 2X4PA 4JFDD 4HIHB 3WHXA 1NAML 3CDYA 1YJDC 4OCRH 4LSDA 1FZMA 3G08B 1RZIB 1T83A 4P4KC 1F6FB 3SGKA 4D0CB 4P9MH 1UA6H 4J4PD 1YDPB 1CU4L 2CPCA 2MOVA 1RIHH 3Q6FA 1ZHKA 5FKPB 3WUZA 3OB0K 3QO1B 4JFEB 2EXWD 2HG5A 3LRGA 3MO1A 1EFXD 4KTYA 4K8RL 2ENSA 4L4VE 1C5DB 1LDPH 5I17B 1UEYA 4LDLB 1UKTA 1Z9SA 1Q9KB 4KRLB 4Y19E 3VDBA 2K3TA 3MLRL 3U7AA 5TE4L 5KZCB 1YEGL 4MAUH 5FUOL 4EDXB 2R0ZH 1QSFB 4NWTH 3D2UA 4XAKD 1FAIH 3FRUA 1E27A 1HYRC 1U8NB 3I9GL 2HRPH 4KHXL 3WNMA 1A6TA 4UNTA 2WUCH 1RIVL 1T2JA 3KPMA 4QYOA 3MRNB 3H9YA 4PRDA 1FFNA 2I27N 3TZVC 4N0FB 2HJLB 3U0PB 2YN3A 2LU4A 3RWFB 3S96A 3BHBA 5T5NF 1IAMA 1OTUD 3W82A 2CGRH 3RAJH 2DQDH 5CLWA 4F37F 1TPXB 4O02L 4G8IA 4P4KA 2BNRA 4X4ME 2D7OA 4JDZB 1UKSA 3CX5J 4RFNC 5I1JL 2QQKL 2VNCA 1UM6L 5D1ZC 4RFOL 4WHTA 5C3LD 1EO8L 2Z0BA 2WWMC 4HHAB 5DQDH 5SV3A 4ALAL 2X4NA 4ORZC 3IJSA 1IC5L 2XNAB 5KVGH 5J12C 1CD8A 1J7VR 5IJKA 2BCKB 3TO2B 4QCIB 3MC0A 2D7NA 1TCRA 1IFHL 4AG4L 3P9MB 5DJCB 3RWCA 1YN7B 3W0WA 4OQTA 5I1LA 3OKOB 5IW1A 2QQLL 1HIMH 3T04D 3RZCB 3MLXL 1G7MB 2XG5A 3GBNL 43CAB 3A6BL 4JDVB 4KDVA 2A9MH 2BVUA 3BIKA 5GGRA 2R1YB 3TZVA 4CKVX 3KDMA 4JPIA 4OD1H 3TWCH 2R29L 5HHQA 3U79A 3GO1H 2CR6A 3FT2A 1XMWA 3DO3A 4OI8A 3RWGA 4GH7B 1AD0A 2GKIA 2ENYA 4U1IB 4TPRH 4Y4HB 2M2DA 1UM5L 3L5XH 4NT6B 5HVHC 5D1ZA 3GNML 3LDBB 2ZUQC 1YEDA 4Z76A 4R3SB 1JGVH 1YQ2A 4LCCC 4ZAKC 3NACH 1JI2A 5LBSH 4NQDD 4EN3B 1CFTA 3OXRA 5I1KH 3RL1A 2FHCA 5JW4N 4UTBH 4YPGA 5EOCL 1EHLL 2YZ1A 3I6LD 4WJ5B 5ICYA 2P5EE 2O5ZL 3ZT7A 2HP4A 4R96A 1ZLSL 5GGSA 2ZP0T 3REWB 1NGYA 3MRQA 4L29A 5GJTH 1TTGA 4YX2H 1PW3A 4PBXA 2VOTA 4WO4D 4KRPB 5F72S 1NCWH 1I7RA 4OB5L 5HYJB 4QOKD 4EBQL 4F2MA 1R3JB 2X4UA 2VAJA 4PP2B 5CEXB 2WIMA 2HTKC 2Z92A 2WIIB 1CT8B 1UQSB 3CDGA 2AXGA 4YBLC 3GMQA 2GK2A 4BQCA 4U1LA 4LCCA 1EAJA 4ZAKA 5J89A 4NZUH 4ODXA 2QADC 3VFWA 4HWEH 3QUYC 1ND0B 3NMEA 3X11A 1DBKH 1E4XH 2OL3L 5DD5H 1FGVH 3PIQB 1D9KD 1NJ9A 2BHUA 2C4FU 1MWAH 3OKEB 2BY3A 2XWJA 3MBED 1BWWA 1K4DA 4N90E 4ZUSB 4TSAL 5ICZA 5E4EB 5BZWA 1MWAB 5M95B 5MHSD 1R3HA 1JRHI 3OR7B 2J6EH 3G5VB 5TH2B 3A0OA 3O9WC 3SE9L 4BFIA 3QWRA 4I48A 3SKMA 4LRIC 3QQ3B 2GTWA 1JIBA 5FF6B 3DXAB 1Z3GH 4HJ0D 3H0TB 3U30C 2VZ1A 2V5TA 3U9UA 4P2OD 3GI8H 4LFHD 2EDQA 1F6AA 4X9IA 4XNMB 3S5LA 5LWYH 3BN9D 2CR3A 4LU5L 5C3TA 3HN3A 1AGEB 4NJ9L 1X5GA 1L7IL 2BOCB 1A7BA 4X6DF 5IMOB 2OJZL 3IDGA 5CWSA 2NY0C 4XVUC 1NBVH 3GK8L 3U2SA 2VITB 2PO6B 5AZ2H 3UYRH 3ARRA 4TULH 3QUYA 1F4WL 5DD3H 1CLYH 1KEMH 1IARB 4LLDB 2YD9A 4NZRL 3LQAL 1NGPL 1EUTA 3OKMB 1WQVT 4WUKH 1DL7H 5A2KH 1IGTA 2AK4D 3CGTA 3AS2A 4PJBF 5FYLL 3CMOH 4QRUA 3GI9L 3UPAA 4C83B 2IANB 4QRTB 4R4ND 1RUKH 1PKQE 1DN2A 1S8DB 5DURB 5C0CD 5KANI 1FN4A 3O9WA 4GKZB 3C5ZD 1KXQE 5F7EH 1G7LB 4KPHL 5BZDB 1WZMA 1JWSA 4HKZA 3ARGD 3B9VA 4LDEB 5CINH 3STBA 4HUWB 4YWGL 5CUSL 4JFQA 2VWEE 4E0RA 4P9HH 4LLQA 5L2KA 2ADJA 4L3AA 5IWLC 1GOGA 2MPAH 3ULVD 2HA1A 1V7NH 2OSLB 4PY7A 1FFQA 5IVXF 4KROC 1RZJH 2V2XB 3CFCL 5K59E 1OAUH 2HVKB 4NN5C 2A6IA 2PYEB 3X12B 3FO2B 4I8DA 5GS3A 4CVXA 4DFIA 2C1OA 4NDMB 1D7FA 1JF1B 3EYQC 4KK5D 3BP7A 3T65A 1FFPB 3CSYA 4RMWA 3TBTA 4LVNC 3F12A 3PWUB 5C7XL 3P4MA 5EO0A 2VE6B 1RUAL 4MDJB 1JRHL 4NZTL 4K7FB 2GYSA 3MV7B 1BF2A 4ZPVA 4NQEB 5GS1A 4M6NL 3NZHH 4HZLB 1BHGA 1H15B 3B2UD 1VFAA 1LE9B 1G7PA 1Q0XL 2Q76A 1WWAX 1KELH 2ZG1A 5F9JA 3DSFH 2AEPL 3DX7B 3FO1B 3MLWL 4W6WB 3WFDH 4LKCB 1JJUA 5I0ZA 3K74B 1MVUB 2NR6C 1BREA 3PABA 3PWJB 1CK0H 4MA1B 5DR5L 5I8OH 1U3ZA 4NQSB 3L95A 1OGAE 5SWSD 4OZIA 2RFXA 3GM8A 4XHJC 5IWLA 2YC1B 2D7TL 5DWUL 3TV3H 4GW1B 4MJID 1U91B 3LQMA 2X09A 3V4VL 1RUPH 3M1BA 1NAMH 3WJJC 1MEXH 3G5XA 5DD1L 1YQVL 3WN5C 1EMTH 2ICEB 3QFJD 1NAMB 4FQ2H 3ROOA 4WY7H 5F7KC 3LKOA 1BVKA 4MJ6A 5ALCH 1HKLL 1GAFL 4IHOB 1RJYB 4YXHH 1T1XA 1V7MH 1EDQA 2EYTB 2HVJB 3NCBB 4KJYB 2QQQA 3BP5A 5C07E 3SDCC 5EFIB 2CO6B 1M6OA 3G5ZB 1X3DA 4ONFL 4EUPH 4WV1C 1I3GL 4R7NB 5E8EA 4OZHA 3ZTNH 1NBYB 3GMLB 2AJVL 1KC5H 1EHAA 3MUHL 2VAAB 5IHUL 1CFVL 5TE4H 4EUPB 5FUOH 4AL8L 1KTLA 1BVLB 5KS9A 5H35A 4UILL 1QSZA 3QWOA 4FFWD 2A83A 5DQJA 3OB0H 1BGXH 5SWZA 2E9WA 3VD5A 1DDHA 2IJ0C 1J11A 3WFZA 1NC4B 4OF5A 3DXAE 1YMHA 2R56H 2DBJA 3IT8D 4RWHA 3GSWB 4YBQD 3O11B 1EPFA 1VFUA 3PQYE 2BDNH 3Q0HA 4TVPD 4Y4KD 5EU6B 1T2QL 3TBYB 3WJJA 1T0PB 4ZOEA 4LPVA 2FH8A 3WN5A 1SJVA 3BMWA 2E9IA 4ZTOH 2NPLX 2ZUVA 1JN6A 3QDGA 3I50H 5EULV 1Y6KR 1C7SA 5CGYC 3PDOA 1BPVA 3X3GH 3CZFB 3NABL 1ETZB 2GY5A 4TOYL 5D7IA 3NZ8B 1EO8H 3SDCA 2YD4A 1KN4H 3OAUL 5GXBB 1IC5H 4WV1A 3MRJA 2YUWA 5TFSL 1WWBX 5KSUB 2Z31B 2XKNB 1FRGL 2DQFB 3HNSL 3DGGA 2IANE 4EDWL 4D9LL 1MLBA 2GITB 5E94B 3A6CH 4O2FB 4F33B 1AIFB 3FT3B 4HIXL 4ZS7L 4K94H 4PRHB 5IR1B 4ZFOL 4AK1A 5I30L 3HZMB 3MLSH 5JO5A 3REVB 5HGBB 4ELMA 3MLXH 3GBNH 1YECH 2P7TB 1MFAL 3AXLB 2AABL 5GSVA 1D5ZB 1NANI 3WEXA 4LKXB 3RHWK 4LPYA 5EOCJ 3QIUB 4I2XA 4HS3A 2AGJH 2WLZA 4NCDA 2AVGA 2NY5H 3ZYJA 1YMMD 4RNRA 4FZEL 2JJVA 4I0PB 2AS5M 3IKKA 2H2SC 1S9WB 4TRPL 4QY8A 2D2OA 1WBZB 3F8UB 3N1FC 4WU7A 3T08A 1YEKH 1G9NC 1UB5B 4FXLA 5JPMB 2QL1A 5GRJL 2HT4D 4R90H 4C56D 4JO3L 3U0WL 4JO2H 3K2UL 3B8SA 3VH8B 2BJML 2LVCA 4WNQB 4D8PB 3SKJL 3QXDB 4RMVA 4M7LT 4IRZH 5KVDL 2R0LH 3DV6A 3IFLH 2GSGB 2XPGB 5DUMH 4B53A 4Y5VB 3IDNA 2ZJSL 4CDHA 3IGAA 4GBXD 1P7QD 4J23A 4LSPH 1CFSB 2APTA 1A5FH 4NWUL 2CKNA 3OJMB 4CVZA 2XZCL 1CR9L 5EPMB 3TM6A 4OB5H 1J88A 4ODTH 3VXUE 5EZLA 1K2DA 3UTSD 2ATPB 1NQBA 1VPOL 1DBML 1MCFA 4HGKC 4EZMA 1UM4L 4PJGF 3WFEH 5CJQL 1IEHA 2NY3C 3O6FD 3HRZB 5AAMA 1RUQL 3QCTL 4OZHE 3W39A 5I74B 3GIVB 4DZ8B 4LCIL 1GZPB 2Y06L 1F3JA 3OAYK 1A7NH 1URLA 4FN0A 1MI5A 2YD6A 3GB7B 1BVZA 4TSCL 4TUKH 4ZOBA 3MREA 2KH2B 4U7KA 4NHUB 3WXWL 2B4CH 3NPSB 5SWZE 4YO0A 1JF6A 4QHNA 3ZYOA 4YHKL 4XCNB 5D5MA 2YEZB 3G6AB 4XBPB 4CDGC 2FO1A 1SJEA 2C1PA 4I13B 2OK0H 4R4FH 4UINL 4NKDA 3ORJA 3UJJL 3IETB 4JJ5A 4TSAH 1X9QA 3MUGA 3DETC 1F58L 4OF7A 1GVIA 3TO4B 3MZGB 1W8NA 3AS0A 1TJGH 3T8XB 3MLPA 3GSRB 4LLUB 1BLNB 2WP3T 3HRPA 4LSRH 3QDGE 1TVDA 3ULUC 4JZOB 3GMPA 1KGCD 3QULA 5EB9A 4BZ2L 1FDLH 4ETQA 1BZ9B 3FOLB 1PGRB 4OAWB 2QHRH 4QXTB 3BZFB 4LCWA 5DK2B 3BEVA 3KXFB 4ZDHB 3MJ7B 2ZSWB 5EU6E 2WBKA 4JJHA 4XCCL 3RVVD 1RIUH 4GAJL 5A2LH 2Y5TA 4IEFB 1KB5H 4P5KB 1WWWX 4PJ7B 4XMLH 1RHFA 1T7XA 3NN8A 1H8OA 1KCRL 1SY6L 1I1RA 2FGWH 2GHWB 5CD3A 1A1OB 1KB5B 1KCLA 5DRWA 4X5WB 3QXTA 5CEYA 2DRUA 1V3LA 4OLWL 4X8JB 3R0MA 3HE6C 3VGHA 1F4WH 4OFVA 3OXSA 5IBLC 1I9RL 1NGPH 4M93B 4HKBB 4Y5XC 3DV4A 3HS0A 3QCUH 4PJAA 4ELME 1IKFL 4HUUB 2DI8A 5A2FA 1N64L 5FOBA 5FO9B 4QT5B 5T1KD 1HE7A 2H9GB 3MA9L 4I2XE 3WIFB 4K23H 2ICWJ 5FYJE 1CIUA 4N9GA 3TN0D 3IDXL 2P24A 2WBJC 1FVCA 3MX0A 2FBJH 5HI4C 1D5IL 4PRHE 5D7LB 2K7QA 1M71A 1CBVL 3DPBA 4GQ9L 3S5LG 2XTJC 3CDCA 4NHCL 3L1OH 2VISB 3LPGA 1IC7L 3SOBL 4XWOC 3EUUA 3D9AH 5GS2D 2WWKT 4L5FH 1NGXB 3TA3C 2GIYA 5GGVY 1KNOA 1KF9B 1UZ6F 1DFBL 1OT2A 4G6KH 2HAZA 3ZKMD 4WFGE 1AGFA 1G7IA 2VDKL 4DFHA 3NIFF 3EGSA 1M7IA 3KJ4C 5D1QB 1NC2B 2DMBA 5L9DH 4MQSB 2KUTA 4HFWB 3S8WA 3CD4A 3DMMC 2ICWB 3CFDB 1MJUL 3HE6A 3GSVB 1WJ3A 5L6YH 5MEPA 3TBSA 3DVFA 1FNGA 2DBLL 3CXHK 5EOTA 4KXZH 1KIPA 3MOBL 3F58H 3STLB 3GSXB 2UWEF 3O4LD 5TE6H 5BVPH 5EO9A 3SE8L 3VGFA 2MMXA 1J05A 1QEWB 3LZFL 2EXWC 1YYML 3U4BL 4TUOB 2J8UA 3QXUA 1Q0XH 3RNQA 1QBML 3O41A 2LFGA 4FXKA 4W4NA 1A0QL 1HHGA 4WHDA 4FP8L 3RKPA 4JPWH 1BF8A 4XNXL 4J8RA 5T3ZE 4PRAB 2QLVB 5JW4Q 1S9YB 3H9SA 1C16B 4X0KB 1HI6B 1FNLA 1PLGH 2HLAA 1MI5E 4Y2DC 4YHYC 2DLGA 4KHTH 3TA3A 4M4RA 5L0QC 1ZS8A 3MJ8A 4HGWB 2DOCA 4JZNA 4G42A 4O51B 4F7MB 4HUXB 1G7QB 3CUPA 3BZ4B 3K0WA 2AJXL 2HFTA 4OQTL 5JZ7D 4P3WA 4Z78B 3DMMA 1WZ1L 1M05B 1MCQA 5DGRA 4MWFB 1AKJA 5IGXH 1GAFH 4G80B 1A6AB 4JFOA 3MRBB 4NNYA 1U8LA 2XQBH 5D9SA 3QNXA 4GSDL 3MGAA 5C2BL 3K4ZA 3WMSA 5DJ0A 3BOVA 5LG1A 1CICD 4W6YB 5IHUH 4UT6H 3TF7C 1CFVH 2VXSL 5SX4I 4M5YH 5BJTA 1HH6A 1F2QA 1AI1H 5EUOB 5EBMB 4UILH 3QJFB 1NPUA 4HW6A 2CUIA 5HD8C 2XACC 4Z7VF 2W38A 2FLRT 1MCBA 4LSVL 4G9FA 1C7TA 1YA5A 2XWTA 3QI9D 2G60L 4DGIH 3P30L 4Y2DA 1KT2B 4RGND 1PZ5A 3EYOB 5I66A 3KXFE 4P23D 5D2LB 4HIIB 1U58B 3RGHA 2DYPA 3D3VA 3F7PC 4NRZB 3SQOH 5L7XL 1FIEA 5IQ9A 4RAHA 1ZOXA 3K3QA 2H26A 4D0DB 3AMLA 1WFOA 4NO3B 3BW9A 5HI5D 4K9EH 3JWNC 5ICXB 2Q8AH 2VXTH 4GAYA 4RAUB 4JFXA 4WU5A 5IKCA 3AS1A 4YLQT 3D0LB 3HNTL 5KOVC 3LPFA 3SDXB 3OAUH 1AH1A 1GL4B 4L8DB 4YK4C 3LKQB 3ULUE 3X14B 2E3VA 4PLOB 1X4ZA 1WFUA 2I26N 3HZVA 5INDB 1EIBA 3UTTA 5J13B 4OKVA 4I4WA 3N06B 3MRRB 1CG9B 3MRHB 2GSIA 5FK9A 2Z8SA 4PJEB 4H20L 4K71C 4PTUA 1H3PH 5I30H 1OLLA 1ZXQA 2RHEA 5SWQA 2JF1A 2DQEH 3OG6B 2ILLA 3BO8B 3BISA 3HNVH 3RVUC 5C0EB 3FQXA 3IU3B 1KJVB 1MRCH 3QEGL 1QSED 5CSZB 4EVNB 2MFNA 2YRPA 3QXAB 1NFDB 4G5ZL 4HXBH 5KSAD 4IOIA 1SEBB 4I9WE 1FO0A 2X9WA 1JPST 5GRVK 4ODHH 4LLYB 1MAKA 1S7WB 2L7UA 4MD5B 3C5SB 4NQDB 2BXZA 3EJYD 3ZKSD 3ZKXB 1T3FB 1HXMA 4MA7L 4YQXL 3TEUA 5E6ZA 4HK0B 3IDJB 4F37K 1S7RA 4GMSH 5ID1A 4N5EC 3IJHB 2ICCA 3GBML 3L6FA 1YEIL 4K3JL 4UQ2A 2XXMB 5IB3A 1WIPA 4Y1AD 4WI3A 4NOBA 1TNNA 1IILE 4JFZL 3L3GA 4U7MA 1S7TB 2HFEA 2XTJE 3SKJH 5EU3A 5KVDH 1IT9H 4NO5A 4LVOB 2J8OA 1BZQK 4J1UB 1H5BB 4ZUVB 1J1XH 2NXYC 2DQGH 4WO4B 2MKLC 3BVNA 5DRNA 1B6UA 2D03L 5DJYB 4PV9B 3BP4A 4QOKB 1AQKL 3SO5A 4NWUH 5CKGA 3CVIL 3R8QA 1B0RA 1CTOA 1W8OA 2XZCH 1JNNH 1ORQB 1XF4B 3GSOA 4JFDE 1FNEB 1DE4B 3PWLA 2YPVL 4F15B 1P84K 2EIEA 5ABDE 4X80H 2W59A 1FORL 3IVKA 5B8CC 4QHKI 1MREH 1A3QA 4LSSL 3MRKB 4M8VA 1CWVA 2F5AH 2BSRA 2XWBB 5HDQH 2HKFH 4NJAH 1K8IB 4P2OC 3C60D 2FL5B 2Y06H 2F19L 2HWZL 2VDNL 4O2EA 2AJ3A 4PYHA 1D9KB 1S7QA 1PG7X 4TSCH 4Y7MA 3MBEB 2D0GA 3GEWB 2MCPL 3ZLQC 3CPLB 2PF6A 4ZD3H 3QQ9C 4Z0XB 5DJ2A 5JIHA 4MQXD 4XAKE 2FB4H 1A7RL 2EEBA 4FFZH 4MNGB 4G6AD 2VDPL 4KY1H 1AQDB 1WIUA 1ACZA 1PG7H 3VGBA 4WDIA 2D3VA 2JB6A 3M17B 3OAYH 4R9HA 1NANH 2DI9A 3D3VE 1IL1A 1FPTL 4FQIL 4G7VL 4YDVB 5J8OA 1A1MB 2AKRB 4XGZB 3SCMC 4U6YB 4M7KH 4GOSA 1FQ9C 5GGTA 1C1EL 1E6OL 4NNPL 5HDBE 4G8FA 1QO3B 2P8LB 5H94B 1CFQB 5EWIL 2YXFA 5DD0L 3C5ZC 3U7YH 1EAPB 1FCGA 1QACA 3QDMB 2NMSA 5HHVH 5B8CA 1I9IL 3NOIA 5F89A 5E08L 4OI9A 3MMEA 3S35L 4PJDA 3V0AC 3UC0L 5J11B 2IFFL 3SE3C 3O81A 5DA0B 2XA3A 4KC3B 4V2BA 5F88A 1Q72L 2GAZB 3JZ7A 3ULVC 1JNHB 3O8XD 1VHPA 4WW2C 1P4IL 2Z91A 5CGMA 3UP1A 1TITA 1OLZA 3MRCB 1WCBB 3GZKA 1VENA 2MCG1 5CHNB 4KK5C 5IIEB 3E3QC 4NN7C 1RMFL 5C0CB 3PXJA 5DMKB 1N64H 3L9RB 4XTRC 5HHPA 1MAMH 3ARGB 4XNQB 1XF1A 1S5IH 1AXTH 3TYFA 1IGIL 1JL8A 4CMMA 2WV3A 4LNRA 4PJEE 1MFNA 1N8ZB 2YPKB 3SCMA 3Q6FB 1TDQA 3GMOB 4U1GB 3CK0H 2FIRT 2ERJB 1CGUA 1S78D 3K1KC 4M8QB 3BDYL 3ECBA 3PWPA 3LB6D 1NFDE 3VFMA 4WEBL 1XR8B 4FQQB 3CU7A 3T0VA 4Z7UB 4XPAL 4RDQG 3NFSL 1Q9LB 2YK1L 3SE3A 3VWJC 4KV5E 1VFMA 1E27B 4NQDE 3IKCB 3G6JB 1WIOA 2BVEA 2A77L 2OXGA 4NUJA 4YEEA 5JR1H 5DVNA 4WW2A 4M9PA 5GJSL 4E41D 4F7TB 3CXHJ 1T1ZB 2NLJA 1BIIB 5J7CC 1JZ8A 3I6LE 1KLFA 4IMKC 4ZFFB 3DRQB 1KCVL 4X7EC 3VJ6B 3O2WH 4IRSD 3QUXD 4NO0A 3SE8H 3S96B 4G8GA 3BHBB 3U46A 1UH4A 3MRDA 4FQLH 2V2WA 3BRDA 4M62L 5JQ6L 4PJXA 4QHUA 1AE6L 1OY3B 3NH7H 1BJ1H 2BNRB 4HF5L 1A0QH 2HRLA 3BP6B 1OWWA 5SWSB 4IRJD 3EOBA 1KIQB 5A1AA 4MJIB 5F93C 3HE7D 4QOKE 4GJTB 4WHTB 1NCCH 4L3CB 4X6FB 2P8MA 1AP2A 5A43C 3O3BA 1MCLA 1Y6NR 2BNQD 3MLYH 4PB9H 5D71L 5JA8B 1TNMA 4UMGA 5EZJB 5CBAB 5AYUH 5I8KL 4EIZC 4L8SC 3F7RA 3OKNA 3VWJA 1AFVH 4KVCL 4M1GL 4AEEA 4Y16D 4DCQA 1YNKL 4CN1A 4KTEL 4X7DC 3W0WB 2DTML 5GIRA 5ISZD 4QEGA 4U6XB 3W9DA 2V9QA 4IMKA 1MFEL 3TBWA 1N4XH 4BSWA 5FGBC 3GSUA 3HAEA 3T4YA 5FYJL 3QRGL 4KQ3L 3RDTD 3QUKA 2PNDA 1R3KA 3KDMB 4JPIB 2XOTA 5C0AA 2FJHB 5HHQB 4IBLT 3TVMC 4LARH 2F8XC 2N56A 3C9NB 1X5XA 2E27H 1E6JH 2G75A 3CC5A 5FM8A 2AV1B 1CQYA 4UUJB 3VFRA 1ZGLB 1HINH 1B0GA 3TT3H 5FKAB 3VWKA 3BWAA 3C6SA 3MBXH 3BKCL 4HJJL 1QKZH 3ZT5A 2Q87A 4Y4KB 4U1SA 4JEGB 1SEQH 2J8HA 3HCVA 4YDIL 1J12A 2R8SH 3MRGB 2XKUA 1HDMA 4YPGB 1EH9A 3B9AA 4L8SA 1Z5LA 1SJXA 5E24E 5CJXC 1ZA3A 2AW2A 2P42B 1FJ1A 4IDJH 3KPQA 1MH5A 4O5LL 3QNZA 4L29B 3KYMA 2WWKO 3B5HA 3PNWA 4GG8B 1OTSD 3DIFB 1Z0NA 3MV8D 4JRXD 2AK4E 5C09A 4ZXBC 4U7SA 5FGBA 3EFDH 3Q1SH 4GXVH 3O3AA 1I7RB 2DLEA 4MMZC 3OGOE 1EUUA 4XC3L 3HPLB 2LV4A 3TVMA 5HYEA 4P2RD 5DYOB 5EU7C 4YUEL 1G6RH 3FO0L 3MODL 4KKAD 4UQ3B 3K4DA 1DQJA 1U3HC 5ACZB 5T3ZL 5DFWH 1UWXK 1G6RB 1G9NL 3PWPE 5K9JL 2AXJA 2AXGB 4W68A 5FYKD 3TNNA 2EKJA 1T7YA 4MQ7A 1G1YA 5DVLA 2APWA 2XY1A 3ARTA 3RGVD 1YMMB 4ODXB 1EHXA 1R5VA 2DJSA 3ULVE 2PCPA 1IMHC 3VFWB 1TTUA 3CXDL 5J1AA 2Y4SA 4XP4L 3X11B 3FTGB 1JUFA 1NGZA 2AJUH 2B5IB 1WBYB 2EDLA 1P4BL 3EOAB 3VXRA 4DUXA 1FHGA 3MLTB 1F90L 4ZUUA 5CJXA 2DM7A 3E3QE 4JHWL 4Z7UE 5D7SL 2F53A 4L8CB 4G8GE 1MHEB 2XRAL 3V6ZA 2EIZA 1CLCA 3MCKB 4C56B 1KJMA 4LQFL 3G6JE 4NKMA 1H3GA 1RFDH 4PJXE 5DQ9A 4ZXBA 2BOBB 4I48B 3P40A 4RBPK 2AJSL 5J4MA 3C08H 2GTWB 5T1LD 2KL6A 5E95B 4JGJA 4GQPH 4GBXB 4GKNA 4NIKB 4X5XB 2B7DT 1P7QB 1N6QL 1AD9A 1F6AB 4ZO9A 1U3HA 4YAQB 3FQTA 1YN6A 4F58L 4ZTPH 1G0XA 4JHAL 4NYLB 4KJPC 4Y4FC 1E0OB 4LP5A 3QHZH 1CCZA 3O3EB 1C5BL 5CWSB 3UTSB 5KVFH 3AB0B 1SHMA 3U2SB 3QO0B 3RWIB 1LK2B 4MJIE 3L3JB 4NM4H 3G9AB 1P84J 5C9KA 5EORL 3O6FB 2K9UA 1GC1H 1NCAL 2W9EH 3HTLX 4HV8B 5EG6C 5E6YA 2H3NB 4RA0C 3QFJE 2GUOB 3O6MH 4APQC 2LQRA 1S9VA 3BE1H 3BPCA 4U1HA 1BD2D 2CUHA 4ENEC 1VFOA 5C0AE 3UJIL 4KKNA 2B0SH 5F7DB 2Z35B 4XI5C 5E6ID 5ILTL 3ULUL 1FZOA 2HH0L 3ALXA 3RVTD 5IVNA 3T2QA 2BC4A 2X4RB 1RY7B 5L88L 4HKZB 1CS6A 3NCEB 1OAYH 4OT1L 1D5BA 4DQOL 1ZHBA 1MCPL 4P2QA 3MRLA 5DMGC 1HQRA 5L2KB 3RZWA 5E00A 5I1CH 4DEPB 1ODAA 4GG6F 3PP4L 3VFOA 2CKBL 5JDSB 4RISL 1UXSB 5ESQB 4K2UH 3MA7A 4Y4FA 1NFIA 5F1IA 3HC4L 1HSBA 3MR9A 3UPCA 4NSKB 4CVXB 1FPTH 5JORA 4P4RA 2QSCL 3TBTB 2CK0H 1J8HA 3F7YB 1JZ4A 4S0SD 4G6ML 4XBEH 4NNPH 4NQCD 3VXPB 4WI5A 3ULSB 4TVPE 2CXKA 5I1GH 3P4MB 3OKLA 4GKSA 2IPKB 4APQA 3BZEB 5F3HA 5GS1B 2HN7A 4EI5C 5HVWA 1VA9A 3KR3H 4YZFF 1CGWA 5SV4A 4MCYB 3SJVA 2Q76B 4Q0XL 4GMTL 4KAQL 2H32H 4H0HB 1MFCH 4PRBA 4X4YA 3BJLA 3RTQD 2H32B 2YXMA 4QHKJ 2IADA 4PRPD 2VDRL 3PABB 1FLRL 3FMGL 4OZIB 3QHFH 1RZKC 1U92B 2P8PB 4UV4H 3S4SG 1RZGB 5F7WC 3TN0B 1HKFA 2F54D 4WI6A 5IJVA 3HG1A 5HVFB 4F57L 5DEFB 3VXRE 5GS2H 2WUBL 2CIIB 1XGPA 5IB4A 4JVPA 3ROOB 3VMNA 3VCLA 4U6VH 4LVNB 4S2SA 2R4SL 2RGSA 3TJEL 1YMME 1I8LC 2OCFD 3O0RL 5DJDB 4BQ9A 3UTQB 3BP5B 4I77H 1GGIL 3BXNB 1DQML 2I5YH 5EUKB 4ZYKB 4GUPB 4KKCC 1XF2B 3FOMA 4EI5A 1Q0YL 4L1HA 1CDYA 3AU1B 4WEBH 4GLRI 4JRWA 1U3JA 4XNYH 2NZ9D 3V5KA 2AJYL 2AV7B 5EU7E 2VO5A 5KS9B 3LPWA 3DLQR 3DURA 5IEHA 2VDOH 2CJUH 3B2VL 2CUMA 3J7HA 3BKJL 5IG7A 3O4LB 1BEYL 4L4TA 2APVA 2RCSH 1DDHB 1I1YA 1J86A 3QUZC 5JZ7C 4F8TA 4LBEB 1QFOA 4PGCB 1Q9WA 2MQCA 2FX7H 4LRNH 1KULA 2QKIB 3LH2H 1J0IA 5DHYA 1RUML 3FO9A 4AMKH 7FABL 3C6LD 4M62H 5FO7B 5JQ6H 4M61A 2AI0L 3EYUH 4JRYA 4KVNL 5C70A 5JW3L 3W11C 3ZDZF 3VXSD 4HXAL 5EBGA 3G9VA 4JO4L 4BELD 2NY4B 4HH9A 3EYSL 4OD3H 4GW5A 5A40E 5D7IB 5GISL 4HPOL 3FONA 4XVJL 1I8LA 2A6KA 2PTUA 3QNYB 4X6DB 3HLAA 4HUKB 4A6YH 3MRJB 1LK3H 5EIIB 3ZKND 2KPNA 3OR6A 1U2HA 4P2QE 1YNLL 5CD5C 2O61A 1GHFH 1PD6A 2XN9D 1KJ3L 4A6YB 1TQBC 3DGGB 3ARDC 3D48R 3QI9C 1A4KA 5T1DH 5IQ7L 3IJYB 2DWEB 5FCUL 3GBLA 4PJBB 1YY9D 2N4IA 4FQPA 4P23C 5F7LB 1CICB 2VR4A 4U31A 3L3IA 3QUZA 2VLLA 4LVHC 4YGVA 4OF0A 3VXOA 3MRPA 3UBXA 1Z9MA 1NBZA 1J8HE 3VGDA 1FO0L 2J4WL 3FQWA 4HS3B 3MLUL 4WI8A 1T0NB 3Q3GA 4D0BB 4HPYL 2DF3A 1A7PL 1SBBA 1XF3B 1P6AB 3CFJA 1TZIB 1ZSDB 1KENL 2R2HA 4JR9L 5D1XC 5IVXB 1PYWA 4RGNB 5EZIH 5KN5A 3D87B 3SJVE 2DL2A 1A3RH 3ARED 5AG8A 4XP6L 2R2BA 4YDIH 5F1SA 2K7PA 1RZ7H 1XGYH 4YR6A 25C8H 3VFVB 1FVEB 1S5HA 4U33A 3DV6B 3T1WA 3ARDA 1DQDL 2G5BA 5E99H 3HAEG 5I18H 3IDNB 3IGAB 1KJ2A 3TPUA 3HG1E 1HZHL 2F58L 5K9OB 1XCTA 1P4LB 1WICA 3MYJB 2FJFB 2IBZX 5TDPB 4HS8H 2CDEB 2RQ8A 2EZ0C 3RVWC 4BQ8A 4Q97A 3GRWA 3FHQA 3MRFB 4OCSH 1K2DB 2CLVA 1XGTB 1XCQA 4O58L 4UI2A 1NGWA 3VFSB 2C7UB 2C4FT 1TLKA 4LVEA 3MODH 3P11L 4DVBA 4ZPTA 3QA3B 4N0UB 1KPRB 4LSQL 4PJFF 2AJZB 5BOZG 2Q20A 4V1DA 2AQ2A 5GGUB 2IQ9L 4XXDA 5D1XA 5I75B 3THML 5B39B 1IGFL 1QSEB 1INQB 4YHOL 3RX8A 4ETYA 1A6ZB 1X5KA 2DB8A 3HR6A 3LOWA 1R5WB 5KSAB 3A6OA 4ODBD 2NY1D 2X5PA 3D85A 5DMJB 3KYKL 1X7QB 1ACYH 5JA9A 1QPPA 4XP4H 1FFOB 3VG9C 4YO0B 4F7EB 3CFBA 1CVRA 3EAKA 5MERB 1FGNH 2ZCKH 3LKPA 5D5MB 4JKPL 2W0KA 4Z0BL 1UWXH 1EVUA 5E9DA 5KVEH 4ODVL 5TDOA 2IG2L 1U8HA 5D7SH 4HLJA 4P46D 5DT1H 1VGKB 3FAXA 1AY1L 2I60L 1G1CA 4Y1AB 3WFBH 4AEHL 5GGTL 5ETUA 1XIWC 4Y88A 1ZLWK 1KYOK 2YBRA 5LAXA 5DRXB 2AJSH 2ZOKA 3D0VA 35C8H 3RY4A 4W81A 1KN2L 3LD8C 1JGLH 4P5TA 1ZWIA 3GMPB 2PXYD 4PGDB 4ETQB 4Z7NF 5CAYB 4LCWB 3BEVB 1C5CL 2H2PD 3BT2H 1SM3L 4GRLA 4CGTA 2ARJQ 1KIRA 2Y5TB 1JHLH 5HHOA 2JIXD 4OSUL 4P2CG 3VFNA 2JJUA 4RBPH 4PR5B 5KSBF 1ZVYA 1BFVL 5J6HA 1LP9F 4BQBA 2O5XH 4X6DE 5HI3C 1FC1A 4N0YL 3S34H 3C60B 2GJZB 2JJWA 5FGSA 1XGQA 2E7MA 2O5YL 1CDCA 4X6CF 2VDMH 5TGBB 3ILPA 1RK1A 4XPGL 1JTPA 4EI6A 3MACL 4MS8D 1B90A 3B5TA 1XIWA 2L0DA 1FVCB 3BKYH 5CKAA 1DLHA 5L88H 2ZOLA 3N9GH 1ZE3C 4PBVC 3CMGA 4KGLA 1FE8L 4OZGF 3JV4A 3H7LA 3VXNA 2X05A 3EBAA 5GRUL 3C8KB 3H8NA 4PP1D 5IT2L 2Q6WB 5D96C 4RISH 1LEKA 5FIEA 1KNOB 3ULVL 1QFWH 5IFAL 3W2DH 4TYUA 5I76B 2ADGB 1AGFB 4LLMA 3L7FA 1CDGA 5DHVA 1M7IB 1NMAH 1F4XL 1TVBA 2FZ3A 5EU5B 5IVXE 1NSNH 2J7LA 3GMRA 5ID0B 1T03H 4PREB 3IU4L 3CLFL 3HE6B 1OTTC 4NO2A 3KPLA 1UH3A 4LAJH 5JLZB 1DUYA 2DQJH 4EJ1C 3FQNB 4YIQA 3IDYB 2VRAA 4G8EA 1J05B 4YXLL 4R0LC 3WXVH 3O8XB 1NL0H 2UZYB 1T20A 3GGWA 3F62A 4Q9BA 1WC7B 1I8IB 3BQUD 2M1KA 4DGYH 1IAIH 4EQ3A 4BSVA 1HHGB 3BDXA 5I1IL 3ARUA 4R7DA 1YEEH 4KI5F 3PHQA 3ILQC 2V7HA 1NKRA 4PGZA 3DX8A 5CP3H 2VL5B 4ISVB 3TNMB 1TJIH 4L9LC 1RULH 1I7UA 1AGBA 1RHHA 1ZV5A 1VEPA 3MUZ1 5DK0A 2E6PA 2I07A 1MRDL 1N0XL 1BAFL 2VXVL 2PTTB 2H6PA 3ZDYF 1I7TA 3QQ4A 3KLHD 3UJTL 4XP1H 2JK5B 4S1DD 1A9BA 4PJGB 1OAXL 4FA8A 2XZAL 1QSEE 3NCJH 2R4SH 2BZDA 4F7PA 3HI6H 4AH2A 4JFOB 1F45A 1U8LB 2DWDA 5F96L 4JVUA 3WFCH 4Q6IC 3QNXB 3STZA 1CD9B 3QEQD 1RK0B 4IRJC 3UZEA 4QRQA 1EBPA 5LGJA 1QOKA 1NKOA 4AENA 4GRMA 4R0LA 3P77B 3IDIA 4DVRH 2HYMA 4BSJA 1U8MB 2EYRA 3SGDH 1QBLL 1S7SB 4E41B 3ARQA 1E28B 1K8DA 5B38A 4Z95L 4MD0A 3DUSB 2P1YA 4UDTA 4Y1AE 2VLRD 4LLVA 4X9FA 4Q2ZB 4IRSB 3QUXB 5HHOE 4PJ8C 4OM1L 1N2RB 3BIBX 4L9LA 2X40A 3VMOA 2FATH 4H1LA 1SVZA 2VQUA 2QJDA 4NKIL 4NRXB 2ZUSA 5C9JB 3VFPB 3HE7B 1CF8H 4UV7L 3WNPA 2VLJA 3U0TA 1SBSL 4OZ4A 2H26B 3MLZL 2CDFB 1B6DA 1TZGH 1UJTA 3GHBL 4KRNA 5F6IC 1R5IB 2PW2A 4JFXB 4XVJH 4Q6IA 1NH6A 2A1WH 3MJ9H 3KJ6H 3KLAB 1MFBL 1U8OB 3BYYA 4Y16B 2JLLA 4DK3A 3UTTB 2X44D 2X70A 5TE7H 4IOFC 5F7NC 5IQ7H 1KXTB 4M5ZH 1IEBA 3MROA 4GW4B 2FX8L 3HUJF 3RL2A 4XHQA 1LO4L 4DUVA 3RDTB 4XT1C 3B9KD 4POZD 5H2BB 4PJ8A 5SWQB 4WWKD 1J0KA 2HLFD 2X4SB 5HGAA 2I9LA 3VE0B 2R4RH 2XFXB 1FO0H 2ORBH 2DKMA 1WEJH 3MLUH 2IF7A 2P44B 2APBA 5ESAB 2VDQL 4R8WL 5I2IA 1FO0B 4PY8J 2VIRB 2NY6C 4UAOC 2IEPA 4JY5H 2EDBA 2Q3ZA 1A6VL 1IC4L 5GGQH 1AO7A 1N5AB 5T5FH 4KKAC 1T1WA 4PV8A 5LXGH 5MENA 5IMKA 5FUZL 3BGAA 3AGVA 1AHWC 4MAYD 5DJZA 4UQ2B 5IB3B 4ONHA 4XPTH 1NAKL 3P0YL 2YR3A 3VDCA 4Z5RA 1I75A 4UBDC 2C3XA 2FEDC 1ZANL 1ORSB 1YUHA 3QIWD 4LIQL 1NCTA 3PL6A 5HY9A 4QXUL 1DBJL 1PVHA 1QTYT 3MV8B 4YDJA 2ESVA 3B9DA 3EW3B 1FG2A 4RRPG 1EJ6A 2FSEA 5DJ6B 2UWEB 3WDJA 4Z8FL 3KPRD 5IFJA 2CO7B 3QEHB 4JPKL 5F9WB 4F80A 5D6DA 4X4XA 5E1AB 3BP4B 3L5WB 2F15A 1VKXB 1EZVY 5MEOB 4PRID 3GSOB 5E2TL 3GKWL 5FYKH 4CNIB 4KZDL 4NC1E 5KW9H 1MJ8H 4XCFH 1MQKH 1FNSL 3JV6A 5IW6B 3QCVH 4X7SH 3IFNH 3QQNA 1LO0L 2RR3A 3ZDXF 4MZ2A 3RGVB 4HUMB 4HIJA 1G6VK 5JXAH 3CAFA 3IF1A 3AROA 4HX1B 1ZLUK 4C55A 3PUCA 2AJ3B 2ZG3A 4IMLA 3QUMA 3ZL4L 4LHUA 1T1YB 2VN4A 1FNHA 3QR2A 1U95A 2BVYA 4GO6B 1DSFL 1OAZH 1IGJB 4M6OH 4FQXC 4PPTA 1MHCA 4JVWA 3EDJA 1CE1H 2VSCA 4RQQA 4Z0BH 4M7JL 3ROLA 1DN0A 5IF0B 4ODVH 2YD5A 2IG2H 1V3KA 4E41E 3GDBA 5JHDD 3SGEI 1AY1H 4WDIB 5T1LB 5A16A 2B1AL 1D6EA 1R6VA 3NPZB 1IL1B 2BNUB 4QTHA 3S4SB 1I4FA 2YSSB 6FABH 4G7YH 3I02A 4P3CL 3UCRA 2VKXA 5CIPH 2YD1A 1IQDA 1BWMA 3ZKQD 4Z7VB 5CIPB 4D3CL 4MVBD 5TPWL 4ZNEA 4NQVA 1P6FA 1L7TL 4G6JL 2G9HB 4FQJL 1Y0LA 4GAGL 1S9XA 1JPTL 1KBGH 1XEDA 2UZIL 1BM3H 1CL7I 3I2CH 1ZLWH 1X5ZA 2G5RA 2BNQE 1EEYB 2FECI 3ZSSA 2B1HH 1QA9A 2IAMD 4U1MB 3TFKC 1JHTA 5J3HD 5ESVA 3RZCD 1BD2B 4FQXA 3UYOD 4Q6YA 1A7QH 5BV7C 3HB3C 4QHLB 1C12A 4FNLH 1E4WH 1K4CA 2EECA 4XAWL 3LRSB 5E6IB 3UBXI 2DIAA 3WLBA 2RBLA 3LHPL 2EYSA 5C0RH 3RFZC 5ISZE 1PAMA 3O6KH 5I1AB 5I6XC 4RX4D 4C54A 4DKFL 1T5XB 2FEEI 2X7LB 3ESUF 4GXUN 4WFFD 4LNRB 3FKUS 4DKEL 4MNQA 2X10A 5T3XD 3MRMA 2FD6L 4PJ7F 2VLKA 1D6VH 2J5LB 5MENE 1A14H 2EXYC 1K6QL 5CP7A 3VD7A 5E8OB 4JM2A 1QSVA 1N6UA 5C0DB 5BS0D 1INDL 3ES6A 3JBG7 4X9BA 3A67L 5IK3B 3MZTA 4LOUC 1TETH 2MNUA 2VQ1B 4NQCB 4X9GA 1JGEB 3P0GB 3S37L 5DS8A 2DQIH 1UXWA 5FUCC 1UYWL 4CMHC 2OTWA 4FMKA 1LE5A 4POYA 1RZKL 2V7NA 1PKOA 5DVOA 1NLDH 4JQIH 4OTXL 3DVGB 5GS0C 1MRFL 1KLUA 2YOCA 1HOCA 4KRPD 1I9EA 1KPVB 3NFNB 3B8YA 3MV9A 4KMQA 8FABB 3WSQH 5ERWA 4GKOA 2CRMA 3LSOA 2V2WB 2QQNL 4OLZH 5F9AC 4OGXH 3RTQB 3F7VB 4KQ4L 3QJHB 2E7LC 4JRXE 5ANMB 3DBXA 3V6OE 1I8MA 2NYYC 4PRPB 1P7KB 3EOBB 2LVEA 4QRSB 4DAGH 4P2RE 5JUEL 2F54B 4U1KA 4Z7OE 1F8TH 5DJAA 3BAEH 4FFYL 1OARH 3TCLB 5KG9A 2HT2C 3LEYH 4Y5YC 2PR4L 1A3LH 3O3UN 4KJWC 5FYKE 3MGTB 4OIIL 5D2NC 3LKNB 1HHHA 1LGVA 4HDIB 4L1DA 1I1AD 2CDGA 3TIEB 2FECL 4ESKA 3N85H 3OKNB 4HWZA 4JN2A 4O9HL 4ZS6D 4XVSH 3BGMA 2VR5A 4WFED 4U05A 1UCBL 2Y7QB 5D72L 2D7MA 1NDMB 3FQRA 3HI1A 5DC4B 3DO7A 3BX7C 2C3VA 4MXQC 4OLXL 5AUMA 3SPVB 5IBTL 3ETBF 1ES0A 4PLKC 3P73A 4XZUB 3FB7B 3CVHA 2QR0B 4ZQKB 2E7CA 4WCYL 5HHME 5I8EB 1CN4A 2FEEL 2CLZB 1HHKB 1QFUL 4LPTA 1Q9OA 3BPOB 1OF2A 5IHZB 1EXUA 4BKLA 1AC0A 4PJ9D 2E7LA 2YS4A 1KEGL 4ZNEE 4X7TB 4Z95H 5KJRH 1S7XA 1IRAY 4F7CA 3VWKB 3VRIA 4WENB 3WBDA 3BWAB 5C08D 4H88H 3C6SB 3UYPA 1DBBL 4L8BB 2ITCA 5DF0A 3L7EA 4U1NA 1VEMA 1S7UB 1DBAH 5IB5B 1A2YA 4P57B 1RZ8A 3P4NA 3C6LB 4U1SB 4Y5YA 3ALPA 1F00I 1JNLH 2JKXA 1JCKA 5D2NA 4JKWA 1U8KB 4XPHH 1UFUA 1W0VB 3G6DL 1J1PH 1C08B 2A9NL 4GAFB 3VXSB 1KJ2L 4MNHA 3LIZL 4LEOA 1MLCA 3N1QC 3VW3L 3OG4B 4FZ8L 3CFEB 2OJEA 1NLBL 3CCHB 3WS3B 3QNZB 3KYMB 2ATKA 3EYFA 5HJ3A 4QNPF 1B2WL 1SYVB 4ODSL 3GRWL 1LO2H 5CEZE 4U0RC 4PJIA 2XN9B 3O3AB 5IVZA 5B38G 2EE9A 4MNQE 3QT2A 1YNTA 5LJYH 1CZ8H 1MUJB 3O4OB 1MIMH 5D7JC 4FTVD 2VLKE 4YHML 3R06A 5C71A 2AEQH 3FCTB 1NMBH 3OWEA 4KI5D 2OMBA 2APFA 3INUL 4H1LG 1UJ3B 4NC0B 4P3DA 3GSNH 1U3YA 2MHAB 3RI5F 1R3LA 3DUUB 1IGYB 2LAAA 4D9RD 1IBGL 3GSNB 5FGCE 2PCPB 4YNYB 4A2MA 1G9MC 3V0VB 2V6HA 4M48L 3S97C 2IMMA 4JHBA 1BBDH 3RU8L 1WCQA 3HC3H 2JE8A 4ZUUB 2FWOB 4H25A 1AR1D 2ED8A 4OLEA 5DLMH 2JCCA 5E5MB 3MV9E 3AREB 1MHHA 4RIRA 4MA3A 1WBXA 3R1GL 1IC4H 4NQCE 1DEEA 1PY9A 3MUY1 2AEWA 1RV6X 3TT1H 4HD9A 4PJ5A 3E6FB 1ZK9A 5EC2B 4KU1A 2ZUYA 3LKRB 5MEQB 2IPTL 3U1SH 3BPLB 4PD4K 3FL7A 4ZFZA 2HT3D 5D7JA 2UUDK 2BSTB 2AXHA 2NXZC 4GKNB 4KUZH 4LIQH 1AR2A 1OB1B 2GJ6A 3MQIA 5HYSA 1AD9B 2RB8A 2JELH 4IM8A 3BKML 3UO1L 3PV6B 4LPXA 4NN6B 1T21B 4PJHA 2ZSVA 4CU7A 2VZUA 1ITCA 3VXMD 1F6LL 3H3PL 4JPKH 3MNWB 3KPTA 4GS7B 5C2UB 4X6BA 4DTGH 5IV2A 2DI7A 1HH9A 2AXFA 1F4AA 2EDTA 3E8UL 1ZLVK 1U6AL 1LWRA 1DVFC 4KK8D 2F54E 3JWOH 5B3JF 3WIHA 3M07A 5IB2B 4KK9D 4UU9A 4M6MH 3QHTC 2NY7H 3NGBB 3FQUA 3PGCA 3TJHD 4DW2L 1S9VB 3QDJA 4J3TA 3QIBC 1FZKA 1TZHB 3LQZA 4U1HB 4K8RD 1OW0A 1DZBA 1HXYA 4MB5A 4E5XA 2NX5D 2PXYC 3GHEL 2NY1B 3F6LA 3T0EC 3V52H 1NUDA 3KWWA 2OR9L 3KHQA 5DEZA 2BC4B 5MI0B 3RPIA 4O4YL 1OSPH 5I8CB 3OHXB 5L2JA 3QH3A 5MP6H 4H8WH 1ZHBB 3WHE0 3P9LB 4P46B 4JY4A 4ZO8A 5E00B 4Y8DC 1SMOA 3RVXD 4WRLA 4S1QL 2UYLA 5BO1L 4IJ3B 4QF1A 4MSWB 2R23B 5EOQH 3X3FL 3ARXA 3EO0B 5DUPL 1AGCA 5F1IB 1ZLUH 3CX5K 1HSBB 1UB6A 1SJHA 3LS4L 3PGDB 1AJ7H 1RJCA 3LN4A 2Y1VA 3S6CA 2NY2C 3KVQA 1HYSC 3F5WB 1G9EA 4BZ1L 1TVHA 1DVFA 1JTTA 4Z7WA 5EO1B 2R2EB 4HKJB 1HEZB 4YE4H 3K8LA 1Q94B 4JHZA 2YWZA 4U49A 4RGOL 4BK5A 1J5OL 1P1ZA 4B5EA 1JGDA 3QIBA 5F21B 3VG0L 1W0WA 4MCZB 1F3DJ 4YHPA 1DLFH 5DJXB 3HZKA 3T3PF 3T0EA 3OF6A 3BIAX 4MXWL 5F7HA 1NMCC 5ADOH 2X1OA 3ARBD 2VZSA 3SY0A 4TQEH 4JFFA 4LLWA 5HHNB 1EGJH 1FL6B 1GGUA 4I18C 4K3DH 2ADIA 4JDTH 2L4OA 4ZOAA 3BH9B 4Y8AA 2XKSA 3O6LL 5E03A 1TQCC 2X89D 3HMXH 3SGJC 4JKLA 4OZFG 3O2DA 4PJCA 1ZA6B 3SDYH 2EO1A 3SKNA 1AGDA 3JTTA 1GGBL 4LF3A 2W0PA 4HK3J 3CFKA 5IOPA 5C0FA 3K2MC 4KMTL 2VN7A 2GJJA 4JAMA 4LK4A 3KLSA 5E2UH 1U93B 1Z6JT 4PJ5E 2A0LD 4UDUB 4P59H 1BBJB 4LQ1A 4ERSL 5K9QG 3S3SA 1RU9L 3RY6C 4PTTB 1FP5A 4OGAD 3BUTA 2PETA 3HI5H 3P0VL 3EO1B 4YDLC 4DN4L 3GJEB 5E8PA 3DURB 3H7BB 2WBWB 5TQ2H 1WAAA 4RGMB 2C4XA 4PJHE 3WLWD 2VERN 4NKOB 1DTUA 2HJFB 2OYPA 5ITFA 4JFHD 4I18A 4BH8A 5I73B 4YHIA 5J06A 2I9TA 5EC1B 5JXEC 3T1FB 4OF3A 5AZEH 1YPZA 4U3XA 3BQUB 2EDEA 3NFPB 4OCYH 4OGYL 1UZ8A 4N8CL 1PSKL 3SGJA 3FB8B 5DHYB 2R0WH 4XRCA 5FECB 5IM7B 5E8DL 2RJMA 5CCKH 3OZ9L 5T33L 1KCUL 4XH2B 2IH3B 4YDKL 4M61B 3BD3A 4JRYB 1C8PA 1PQZA 3WFHB 5CZXD 2YA1A 5GSRA 2JTDA 5FHAH 2A6KB 4XPFH 3ARFD 3D39D 1EK3A 4R2GC 4JPVH 2UVEA 2QHLA 4MQTB 4S10A 2BERA 4OLUL 1IC1A 1CD1B 4FQ1L 1V3JA 4OCWL 3RY6A 1GIGL 2KQMA 5JIKA 2HKHH 4O2CB 2YMXH 2WANA 2ARJA 2NW2B 2VH5L 3GJFA 4OD2A 4FFVD 4UT9L 1N5YH 1AXIB 4H26A 2YD3A 2CMRH 3MGOA 2P5WA 3QEQB 4HULB 4YC2B 4JG0L 2E9BA 4OLXH 3HPJA 1JGUH 2WMPA 5SX5K 4OLVH 1T66C 5D7KD 4YGVB 5JXEA 1F4YH 4ONOA 1UVQB 2DM3A 2W9DL 3U7WH 1A47A 1NBZB 3VFGH 2EICA 3KPSA 1CLZL 3HFMH 3FQWB 5DO2C 2VLRB 4BM7A 5C0ND 3Q3GB 4OFYD 2F8VA 4BYHA 2IH1A 3L3KA 4TUJB 5DUBA 1ZGLP 4S0TD 3UPRA 5CILL 1QR1A 1T5WB 1MFDH 5CJOL 4GG6B 3IFOA 4WIQA 1DBBH 4HT1L 2IGFH 5KSVB 1M7DA 3SDAC 3O2VH 2ZCHH 4OJFH 5J9PA 2Y07L 2YPLA 4GRWE 5D93B 1L9MA 2EC8A 3SKOA 4MB4A 3U4AA 3EIFA 4GT7A 3SDDC 1QBAA 4FS0A 4WHYG 3VFTA 4DZBB 1EEQA 1W72A 3QZWA 1G7JA 4JFFE 2CH8A 2Y6SD 1LEGB 2A9NH 2HLFC 5EZOL 5IESL 1KJ2H 4QRPD 3WE6B 4CUCA 1BQLL 4FZ8H 1ULVA 2YKLL 3OGCA 4WTXA 1KJ2B 5FYLD 3EZJB 3M45A 5TDNA 3TPUB 4R26L 3MCLL 4CVUA 2SEBB 3O3DA 3NA9L 1MCEA 1FYTD 3E2HC 3RBGA 3O45A 4KI1A 4BA8A 3IAGC 1QYGL 4JZJB 5F9OL 2DDQL 3EOTL 3IYLW 2FIKA 3JWDH 1XGUB 1NGWB 1FYHB 1EHNA 4DVBB 1IM3B 1P69B 3PF2A 3B9KB 4XPBL 4WWKB 4Q9QL 2FO4A 4ZODA 1CLOL 4V1DB 2R9HC 1JWMA 5K59F 1QQDA 3QUML 1FVDB 1QRND 2F74B 5C0BD 4CRPA 3NAAL 4N0CD 3SDAA 4ORGB 3DX9B 4XP5L 4UIKH 3MNZA 2F5BL 1FIGL 4LEXL 4L3ED 4QWWD 4M03A 1NCBH 3SDDA 1I85C 2VABB 1SVCP 1QLEH 4WUUD 3RUGA 2DQUL 4U6HA 1YPZE 3ARVA 5E9DB 5GZOD 3H9HB 1A1NB 3IFPB 4LGPB 5BRZA 4MAYB 5IMMA 4S1RL 4YXKH 1FH5L 1T22B 4XBGA 5DD6A 3S3PA 3EFFB 2HFGL 3FFCD 4ZSOA 2VXQL 3HR5B 1IAOB 1X6LA 1BECA 5ETUB 3QPQC 4XC1H 4JE4B 5H8DA 4HK3N 5LAXB 3QIWB 5EN2B 1KG0A 1CGSH 4BUGA 4P5TB 1D5XA 4OCMC 3E6HB 3KPRB 4HFUH 5HBBA 4XNUH 4QXGH 3FZUD 4MX7A 1K5NB 4GRLB 3KNBA 1ADQH 1KIRB 3UAJC 2BRRL 1TXKA 5K9KA 2GTZB 4PRIB 4PGBB 4QRRA 1I7ZB 2IC2A 1TJHL 4UT7H 1BJ8A 4I3RL 1GZQA 1MCOH 3E8UH 3RWHB 1OAKL 2P5WE 4F3FB 4JREB 2UUDH 3OKDB 1WWCA 1I85A 3G08A 1RZIA 1MCCA 2H41A 1TPXC 2OR8A 4J6RH 4F8QA 3VG9B 1KB9J 4D0CA 4S1SL 1YDPA 2Z4QB 5I19H 5FKPA 1OAQL 3Q5TA 4KTDL 3QO1A 5CEZL 4JFEA 3GMNB 3KPSE 1A6WH 1RK1B 4M7LL 1VACB 4Q7DA 5E5RB 1HCVA 1JPFA 3QEQE 1VGEH 1Q9KA 1A6PA 1ZLVH 5HYSG 1F42A 3K46A 5IFHL 5DRZA 1MHPL 1QSFA 2DD8L 4JB9L 3TYGL 5JHDB 2YPLE 1U8NA 1GRWA 1AXSB 1N7ML 1LEKB 1QNZH 5AG9A 2YUVA 5DUPH 4X99B 3RZCC 4OLYL 4N8VA 3MRNA 1LD9B 2X4QB 2Q3AA 2Y36H 2VWEC 2CIKA 3L7FB 5ENWB 4N0FA 43C9A 3U0PA 4HS6B 3RWFA 4HLZG 4AEIL 3GMRB 3IXAB 3V6FB 1OPGH 3RJDA 5BV7L 2P46B 4NO2B 8CGTA 2DQTH 5E2WH 1L6ZA 4Y4HC 1EZVX 3FB6A 4MJ2A 1DANT 4G8EB 3LDBC 3VG0H 2BP3A 4DOHE 4M43H 3S88H 2IAMB 2LE9A 1RAMA 2GFBB 4EN3C 2J12B 2BCKA 3WUWG 5GZNC 4S11A 3JV5A 4ONGL 3TO2A 2B2XH 4KK6C 4QCIA 3DX8B 1PKQA 5GQBA 4XWGL 4KRMB 3P9MA 5T3XH 1MJJB 1YEJL 1YN7A 3OKOA 4TTDD 2VC2H 4LASH 4YHLL 1EJOL 3I6KB 2H6PB 1FBIL 1ZHLB 4KRPC 2R1YA 3RUGE 1X5IA 1K3ZA 1XGRB 1J9CT 5GS0L 1JHKH 5BRZE 4PJFB 3CVHL 2XZQH 3MUJA 4AH2B 5JHLL 2DWDB 4ZSOE 4DN3L 2XI9A 5BS0B 4L4VD 3STZB 4U1IA 4Y4HA 4KKLD 3VXTA 3GIZH 4Y19D 1YYLH 4NT6A 2FX9L 4QRQB 1T80A 1GJIA 1MSPA 1XAUA 3I75B 3PWNB 2IQAB 2LAGB 4G6FD 1UWEL 4JY6B 5I1DB 3LEXB 4OZIF 3P3YA 1K8DB 1T6WA 5AWNL 4EN3A 5C0GB 3CIQA 4XP9L 3S3JA 5IHLB 4UDTB 5EIQA 1XF5B 2FJGA 1CDBA 5KANG 3P4LA 4XMKL 5F3BA 2RIKA 4WJ5A 4Z18A 4H1LH 4B0MM 4QRRE 1A7OH 4JFPB 3REWA 3DROB 1JI1A 5E4EC 4H1LB 4NGHH 2WK2A 1P2CB 5INCB 2X9XA 2Y23A 5EBWB 4OGYH 4LGRB 4P2YA 3KPRE 1JF5A 3V0WH 4HBCL 2DICA 1HN1A 3BEWA 5HYJA 1OGAA 1MIEH 1CGTA 2VLJB 4PRIE 3U0TB 3DRTB 4B41A 4OZ4B 4OZHF 5LGHH 4JFEE 3BSZL 3WD5H 4CADB 5J1SC 2FBOJ 4PP2A 4WEMB 5HYQA 2VLMD 5CEXA 5KS9F 3OPZH 2EDHA 2UY6A 3WO3B 1I1AB 2WIIA 1CT8A 1UQSA 5TF1H 3OMZA 5EBLB 1F13A 5KSBB 5JW4M 4FQ1H 4HCRH 1HHJB 4HUNB 4RWYL 1QSFE 3B6SA 3L3DB 1QHPA 1LP9B 2PO6C 1OSZB 1IKNC 2WSKA 2GCYB 5C07A 1ND0A 1HHIB 1IEBB 1IGMH 4UTAL 3PIQA 1J18A 1JV5B 12E8L 4X6CB 1VADA 3OKEA 3V5DB 1LO5A 1V05A 2LTQB 1MWAA 4XX1E 4PJ9B 3PV7A 2VXUH 3OR7A 5TH2A 5JHDE 1P7HL 4K3EL 3V95A 5D7IF 4R4BA 4ZG1A 3QDMD 3LMJL 4OZGB 5C08B 2O93L 2J6EA 2EEDA 3QQ3A 3DXAA 1W0YT 1GPOH 3H0TA 1FNAA 4TSBH 5D70L 4LAQH 1JZ3A 4WI4A 2BSSB 1T1WB 2OQJB 3PQYA 4PLJC 5SX5H 2EIBA 3F7QA 3TH2T 2GY7B 4XNMA 1KOAA 2R0KL 4P9HC 3T4AB 5DJZB 5C1MB 5IROC 4ZMAT 4IIQB 3RP1A 5KBNC 1JFQH 1AGEA 2BOCA 5HTSA 5IMOA 2P5ED 1YUHB 1RZJC 2H1PL 4ELMF 2VITA 2PO6A 32C2A 3PL6B 1IKNA 5HY9B 4UB0L 4XMPL 5BXFB 1JBJA 1FG2B 4QTIH 4LLDA 3K7UA 4LRIA 3OKMA 3GSQB 5D8JL 2W07A 2N1KA 5GGRY 4R26H 5CSBA 1G9ML 3KS0J 4OCXH 3WIHL 4FTVB 3NA9H 1ZEAL 4G3YL 2IANA 4QRTA 3QPXL 4EQ2A 4NUGL 3WKML 4JKKA 1S8DA 3BPNB 4GKZA 5IMLA 1G7LA 3ET9F 3MLVL 1ZTXL 3OJDA 5C0JA 4MA1C 3IF1B 2ICES 3NIDF 2BFVL 3EHBC 3D2UD 1OHQA 5JOPE 2EH7L 4ODWA 4IMLB 2OSLA 4Q9RL 5LGKA 5IROA 4LEXH 2HVKA 1KACB 3FN9A 5E2VL 2PYEA 3X12A 2HTLC 5GGSY 4N1CA 1BQSA 2OZ4H 2ZCLH 3MXVL 3VXQB 4NDMA 3VRLE 1JF1A 3LY6A 1FFPA 4UOW0 5B4MC 4E42B 2OI9B 3PWUA 1DN0B 5I1EH 5FA4B 2VE6A 4S1RH 2VJXA 1IM9A 3P4OB 1M7XA 5BMFL 4OZFH 4P4KD 2BNRD 4K7FA 4G9DB 3D69B 5HYJE 3V4PL 4HZLA 4OZFB 1H15A 3N1MC 1LE9A 1IJ9A 4ODUB 1MNUL 1IQDB 5KTEL 2D31B 2F9BT 5CMAB 3VXMB 4NQVB 3FO1A 1RQ5A 2QBWA 1PG7W 4AIZB 4LKCA 1SQ2N 1MVUA 1CU4H 4NQSA 3VXUA 2NNAA 4XVTL 2YC1A 1JPSL 5F7MC 4Z7NE 5D5MF 1IAIM 1U91A 1FZJB 3EO9L 4K8RH 3W0WD 3RI5K 5CZVL 2KQNA 3MLRH 1BFTA 2ICEA 5F7FA 1YEGH 3WNLA 2NX5B 1RJLA 2Q8BL 4WFEE 3O2DL 3TZVD 1K4CB 4JG1L 4ELKB 4KTDH 4N1EA 4FG6C 3VI3F 2MKWA 2EYSB 2EYTA 3I9GH 4KHXH 4OM0L 4M7LH 2ED9A 2HVJA 4KJYA 5CBEB 5EFIA 2DJ4A 5E8NB 1RIVH 3PGFL 5F1KC 4R7NA 3BESR 2YZ8A 4X6CE 1NBYA 3GMLA 2EH8L 1JVKA 1RZFL 2Z31C 2VAAA 3MRMB 4BFEA 5D1ZD 4EUPA 1P5VA 1BZ7B 5HDLA 3HUJB 2KBGA 5JMOC 5CP7B 2FR4B 4JM2B 4O02H 1HQ4B 4RDQF 1N7MH 2W60B 5C08E 4OZGE 5I1JH 5BVJB 4HMEA 2QQKH 4OV6F 4HKXB 1UM6H 1NC4A 4K94C 5LCVL 4PJAF 1LO3L 3DGCR 1JWUA 4AQ1B 4RFOH 1T0MB 1J1OL 2AQ1A 3GSWA 5DS8B 1BFOA 1UXWB 3KPNB 3QIUC 4ALAH 4K7PL 4YBHA 5EU6A 3TBYA 2E5EA 1KXVC 4I0PC 4U1JB 1HOCB 4XCEB 3U36A 2NY5C 4U2ZA 2VKWA 5E7FA 3HC0B 1I9JL 2A6JB 1IFHH 1MPAL 3ULUF 4RAVB 3CZFA 1ZMYA 5CZKA 1FL5A 4ZOCA 4AG4H 5ERWB 1ETZA 5ITBL 2X4OA 3ARBB 3NZ8A 1U8QB 2ZG2A 4KKBD 4OBSA 5DJ8B 2QQLH 4X5LA 3B3IB 3ZSTA 2P49B 3MOAL 3A6BH 5L8LB 3IRZA 2XICA 1DUZB 2Z31A 5KSUA 3TH4T 2A73A 2XKNA 2DQFA 2R29H 3CSGA 4N8VG 5DJAB 4ZAKD 5EA0L 2GITA 5E94A 4O2FA 4Y5VC 1AIFA 3FT3A 5JMRA 3G5YB 4KI5E 4PRHA 1OD7A 3HZMA 4NPYA 5J57B 2PYEE 3REVA 1HHHB 5HGBA 1UM5H 4WHYH 2CDGB 2VL4A 2P7TA 1ONQB 3GNMH 3AXLA 5E56A 1D5ZA 5M7QA 1U8PB 1Z9LA 5C8JB 2EE3A 3QIUA 3V6BR 2YRLA 3EZ8A 2J8UF 4I0PA 5EOCH 1S9WA 3KPOA 3P73B 3QWRD 4RSVA 1INEL 1Y18B 3MV7E 3S36L 3ZHDA 1OL0A 2EIDA 1IGCL 2O5ZH 4NQEE 2W0FB 5K33A 1ZLSH 1RVFL 4N0RA 4DUWA 1UB5A 3QFDB 4BKLB 5FM4A 5JPMA 5E0QA 2R1WB 1DR9A 2HTKD 4WI9A 1A9EB 2DQCL 2V5MA 4JGUA 3VH8A 3CJJA 4WNQA 4D8PA 1KFAL 3NPSC 3QXDA 4PG9B 3W81A 3L7EB 2B4CC 1A2YB 4A2LA 4EBQH 1RZ8B 1W72L 1GH7A 2QADD 4Y5VA 4X9HA 3ZE2E 3DVIA 1T7ZA 3QUYD 2A6DB 3TO4C 3JTSB 5TQ0L 4EIGB 4OCNC 4I5BB 1CFSA 3CLEL 1RURL 4NQXB 1R0AL 2WQ8A 4HBCH 5EPMA 1JZ7A 1MLCB 1XFPA 1XH3A 1QVOA 4KDWA 2ATPA 2YRZA 3ARFB 2J88L 3D39B 3RNKB 3BSZH 5J0BA 2EKSB 1QLRA 5IUSA 3C5JA 3O9WD 2OL3H 4N1HB 3HRZA 2GI7A 3ZYIA 4PJIB 2W92A 4X8XA 3GIVA 4DZ8A 4RZCA 2BK8A 2OL3B 1G84A 5J6GB 5FHBL 1OGTB 2DAVA 5L2KD 1OCWL 4RWYH 1YC8A 3WO4B 4D2NA 3SE9H 2HFFB 4NHUA 1IZJA 4OQ1A 3WIIL 1ZT1B 3N1GC 4M93C 1YZZA 4P3DB 3ELAT 4XCNA 3G6AA 4XBPA 4XVUD 4AIXA 2A74A 4N68A 3IETA 4EOWL 3VDAA 1MF2L 4Q74A 3TO4A 1UWGL 4LU5H 15C8L 3KG5A 3T8XA 3GSRA 1T4KB 3FB5B 4LLUA 4NJ9H 1BLNA 1L7IH 4H25B 2OJZH 1FV1A 1TCMA 2JCCB 3GK8H 3T2NL 1LHZA 5F70A 4W70A 4JZOA 1S3KL 5D70H 1BFSA 1BZ9A 3FOLA 1QHOA 4OAWA 4QXTA 4DGVL 3BZFA 5DK2A 3KXFA 4JN1L 4NZRH 3LQAH 4ZDHA 4I0CC 4Z77B 2ZSWA 5AYQA 4EEEA 5I15L 4QRPB 5FYLH 1FL3A 4ZFZB 5AD0B 4P5KA 2P48B 4QGYA 2IMNA 4NM8L 4RA3A 5ALBL 3GI9H 1F4HA 4N0CC 4LHJB 5D1QC 1A1OA 1KB5A 4D9QD 4X5WA 1MQ8A 4X8JA 5DDHA 4KROD 4KPHH 1FYTB 1X4YA 3EJZC 1N59B 4HKBA 2X4TB 4YWGH 3JSSA 4HUUA 5CUSH 3RWEB 5DMIL 3EYQD 3WIHH 1DQLL 1LNUA 5FO9A 4QT5A 4YFLI 2H9GA 4HLZH 1ZHNB 3WIFA 4OCRL 2V5SA 1F2XK 3ALWA 3CFCH 4P9ML 1UA6L 5D7LA 1QRNB 4XCYA 1MCJA 5C0BB 1U8JB 2CKBA 3CH1B 1RIHL 4L3EB 3WS6C 5C7XH 4H5SB 4KV5F 1LDPL 3BZDA 5FDWB 1CVSC 1NGXA 4Y5XA 4Q9RH 1RUAH 2PW1B 3ZDXE 2QTEA 2XA8L 2VDLL 4J4PC 4WUUB 1JRHH 4NZTH 1YJDL 4MAUL 1L6XA 5E2VH 5SWZD 2R0ZL 4M6NH 4NWTL 1FAIL 4XHJD 4JY4B 5D1QA 1NC2A 3WUWB 2HRPL 3FFCB 2Z8RA 2WBJA 1X44A 2WUCL 3GSVA 1CDHA 2AEPH 1ZT4A 3MLWH 4BH7B 2OXHA 4JFHE 4KJQD 4W4OC 3STLA 2AERT 5DI8A 3LN4B 3R4DA 4YHZL 5DR5H 1T7WA 3QDGD 1QEWA 2D7TH 3V4PH 5DWUH 3BD4A 4Z7WB 2CGRL 4TUOA 4ZNCD 1J0JA 2NY4D 2EDYA 3RAJL 2DQDL 4CW1A 5F71A 3V4VH 5F97E 4X7CC 3V9FA 3SDCD 1D5MB 5DD1H 1JZ6A 4J3OC 1YQVH 2IBZY 1QR4A 1I3UA 4JFDA 3T0AA 1C16A 3T2PA 1HI6A 1HKLH 1OTUC 3HZKB 1VCAA 3V4UL 5KVGL 3D39E 3K80A 1BOGB 3AAZB 2FDBP 2VR9A 3EO9H 4J4PA 4HGWA 4O51A 4F7MA 4ONFH 5H37G 1I3GH 4LLWB 3BZ4A 2GT9A 2AJVH 1E4XI 1QLFA 1EFXA 2Q86B 4AL8H 4AM0B 1M05A 5CJBA 4MWFA 5E4IA 2PN5A 1IEAA 3V5HB 1A6AA 1HIML 3MFFB 3MRBA 5FYJD 4OM0H 3IB4A 4PJCB 4ZFGL 4W4OA 2A9ML 4K9EC 5D7KE 2PKDA 2X1WL 4OD1L 1N3NB 4X98B 3KAAA 4JFYB 3TWCL 3FFDB 3W5NA 5CGYD 3GO1L 1CE6B 4PJDF 5IOPB 5C0FB 3IXTA 2O26U 2HJKB 5J13C 4JAMB 3ZO0A 4HUVB 3C09B 5EUOA 3MCG1 5EBMA 4TPRL 1T2QH 1CDIA 3QJFA 3QXVA 5KOMC 1JK8B 3L5XL 1XZ0B 1NDGA 3FRPA 2C3GA 4PJ7E 2NW3B 1JGVL 4NOFA 3NACL 5LBSL 4W6XB 3NABH 5F1NB 5F6HI 1NMCB 5I1KL 5IEKA 4TOYH 1J1OH 1CFBA 4UTBL 3AUVA 4G43B 3LS5L 2V5RA 3PWVB 5D2LA 3V7AE 4HIIA 1U58A 5TFSH 4NRZA 3MV01 4YHIB 5LQBL 2I9TB 1FRGH 4PBWD 4D0DA 3HNSH 5GJTL 4NO3A 3ZKXC 4D9LH 4EDWH 5FYLE 3FT4B 2YN5A 5ICXA 5CS7A 2GW5A 4XRCB 3RWDA 4RAUA 4HIXH 4ZS7H 4EUPG 2OTPA 3D0LA 1NCWL 3B4NA 4J3SA 3SDXA 5D7LE 2R15A 1FYTE 2H2SD 4HEME 4L8DA 3OKKB 5HPMB 3X14A 4ZFOB 1MFAH 2AABH 5EU4B 5T3ZD 4LVOC 1H5BC 1I1FB 2YA0A 1MI5D 3C2SA 3MRRA 3ULVF 4FZEH 1CG9A 3MRHA 5D4QA 4WO4C 3I3BA 4PJEA 4WW2F 1IAKB 3PDGA 4TRPH 5HYIA 2OBGA 1QRNE 5FAAA 3S36X 3VA6A 4NZUL 3BO8A 2DL9A 1EA9C 4HWEL 4LL9A 5C0EA 3IU3A 1KJVA 5IB1B 4FXGB 5CSZA 4EVNA 4L4VB 1DBKL 4F15C 3UZVB 1E4XL 4OV5B 3QXAA 1FGVL 1NFDA 4Y19B 5GRJH 2NQCA 1MWAL 4CU8A 4JO3H 1SEBA 3U0WH 4PJXF 3K2UH 1EVTC 4M1CD 4JANB 2BJMH 3SHSA 1BX2B 3ZE0F 4G6FB 3S36H 5FB8B 4U4BA 4MD5A 2W65A 3C5SA 3PG2A 3ME0A 2VZTA 1GOHA 4NQDA 4UIMA 2J6EL 4K55A 4EXKA 3KYOB 1T3FA 2G2RA 5ACMA 4HK0A 3IDJA 4EXPX 2ZJSH 3IJHA 3QDHA 1ED3B 4HJGB 4LCWD 1A4JB 1D9KC 4NBZB 2NY3D 1Z3GL 3MBEC 2DN7A 2DQCH 4P49A 2GK0B 1CR9H 5I16A 1KFAH 1S7TA 3IFOB 3GI8L 3WDHA 1CFNA 4J1UA 2XQYG 1H5BA 4ZUVA 5J9PB 1VPOH 1DBMH 5LWYL 4MB3A 1UC6A 1UM4H 4WO4A 3BH8B 1H0DB 5CJQH 5DJYA 4PV9A 5TQ0H 1G7JB 4HJ0C 1NBVL 4ZUWB 1RUQH 3QCTH 4QOKA 5JOFB 1R0AH 4LCIH 5AZ2L 3UYRL 1XF4A 1FNEA 4AYFA 4TULL 1DE4A 1VDGA 1F97A 3QAZB 5DD3L 1KEML 2UV3A 3SO3B 3BN9C 1PX3A 1XT5A 3DETD 3OGCB 2J88H 1T04B 4WUKL 1DL7L 3WXWH 2OLDA 1GCFA 3MRKA 1QRKA 2XWBA 3HZYA 4YHKH 3N50A 1RUKL 3ULUD 5J11C 1K8IA 4UINH 2FL5A 3UJJH 3VH8G 5F7EL 1F58H 3K4AA 2IWGA 4MD4B 5EUOE 5CINL 5E5UB 3LKSB 1EFQA 3MBEA 3CPLA 1KTDB 1S7VB 4P9HL 4R4NC 5DMYA 4Z0XA 5GHWL 3MRIB 3PE9A 3SDAB 4MNGA 2MPAL 3BUYA 1V7NL 5T1MB 4BZ2H 1Q8MA 3LN5A 1RZJL 1OAUL 1AQDA 3HE6D 1HILA 3ARGC 1I1CA 5D2LE 4I3SL 3M17A 6CGTA 3D25B 4XCCH 4ZUTA 4YDVA 4GAJH 1A1MA 2AKRA 1PY4A 3LV3B 4P2OA 4JCLA 4U6YA 1CGYA 1HSAB 1KCRH 1SY6H 4LCUB 5F8RC 3T2NH 4U1GC 2P8LA 5H94A 1CFQA 5IMMB 2ERJC 4PRNB 3DTXA 4XBGB 4OLWH 2ITDB 1EAPA 4DGVH 2P43B 2C9AA 1I9RH 5HI4D 2P5EB 3E2HB 3SDXE 4WTWA 3NZHL 1IKFH 1CTNA 1F11B 4HC1A 4NM8H 2X4PB 2XTJD 5ALBH 1D5XB 1KELL 3H9SD 3L3OA 3WHXB 3DSFL 4XWOD 3MA9H 2GAZA 1FZMB 1W2KT 3WFDL 2AK4A 5CGTA 3TA3D 3IDXH 1D5IH 2OP4L 1CK0L 5I8OL 3V8CA 1CBVH 1ZHKB 3B2UC 4GQ9H 5CHNA 3BGFC 5IIEA 1X5JA 3DI2B 7CGTA 2HG5B 5DSCA 3TV3L 3MO1B 2WLYA 4NHCH 4H0GA 5C0CA 1GZQB 3C5ZA 5DMKA 3UZQA 3L9RA 1KSRA 1IC7H 3SOBH 4CVWA 3DMMD 1RUPL 1AKJD 5A3ID 4MMXC 4XNQA 3ARGA 1MEXL 4DWHA 1EMTL 4FQ2L 1DFBH 1N8ZA 2YPKA 4WY7L 5ALCL 3D2UB 5AEAA 3GMOA 2VDKH 3FRUB 4D94A 5B3JE 3HMWL 4YXHL 3UTOA 1V7ML 2KKQA 4HG4J 2DLTA 3VD9A 1A6TB 1MJUH 3ARPA 1L0YA 1JPFB 3KPMB 4M8QA 4QYOB 3DX6A 2DBLH 5IJKC 3ZTNL 1EEZA 4PRDB 3MOBH 1KC5L 1XR8A 4FQQA 2XA8H 2VDLH 1FFNB 5FA3A 4JKMA 4Z7UA 1YJDH 5DRZB 1Q9LA 1HNGA 3LZFH 3V7AG 4G9FD 1YYMH 2R69L 3U4BH 1NEZA 3G6JA 3IKCA 3EOYG 3VGAC 4Y2DD 1QBMH 5FGRA 1DCLA 4G8IB 4P4KB 4F7TA 1BGXL 1T1ZA 1BIIA 5I1HL 2H8PA 4FP8H 4N8VB 4ZFFA 3DRQA 2DYPD 3D3VD 2R56L 3VJ6A 4XNXH 2CIKB 4YHZH 43C9B 4FFWC 4QLRA 4NZJA 2X4NB 2BDNL 4F9PC 3IJSB 1TMCB 2WP3O 4JQXC 4LPCA 4ZTOL 3BP6A 5SWSA 3I50L 3FB6B 1KIQA 1Q1JL 2AJXH 1TCRB 2XQYK 3DHJA 4OQTH 3X3GL 4MJIA 3QP3A 4YBQC 4L3CA 4X6FA 3RWCB 4PGEA 3UTPD 1WZ1H 3UTTD 2VLME 5IW1B 5I1LB 1MCSA 4Y4KC 1KN4L 3KPPA 4V2CB 3V4UH 2X6MA 1P5UA 3B5GA 3QFJA 3T3ME 5EZJA 5HD8D 3BIKB 5GGRB 5CBAA 4GSDH 3TZVB 5C2BH 5MHSE 3T3PE 1PKQB 4MNGE 3FT2B 2VXSH 3A6CL 4YJZL 3RWGB 2X1XR 3OTTA 4K94L 1EX0A 1AD0B 3MLSL 3FAWA 4RFNB 4U6XA 1TTFA 4ZFGH 1YECL 5D1ZB 1UADC 3DOSA 1PEZA 1YEDB 4Z76B 1T6VN 4LSVH 5HHXL 2FJHA 4LSUL 2AGJL 4F9PA 1T7VA 2G60H 2NY5L 1CFTB 3OXRB 4FQHA 3C9NA 3P30H 3RL1B 5J12B 4AQOA 4KKBC 3QDME 4JQXA 1IZKA 4NNXA 2AV1A 2YD8A 3T0BA 5FO8A 4UUJA 1U36A 1UACL 5ICYB 1ZGLA 3TC9A 3VXTB 4R96B 5FKAA 5GGSB 5L7XH