1RJCA

Crystal structure of the camelid single domain antibody cab-lys2 in complex with hen egg white lysozyme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
123
Chain Sequence
VQLQASGGGSVQAGQSLRLSCATSATSSSNCMGWFRQAPGKEREGVAVIDTGRGNTAYADSVQGRLTISLDNNTLYLQMNSLKPEDTAMYYCAADTSTWYRGYCGTNPNYFSYWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords camelid heavy chain antibody
publication title Strong in vivo maturation compensates for structurally restricted H3 loops in antibody repertoires.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Immune system/hydrolase
total genus 29
structure length 123
sequence length 126
ec nomenclature
pdb deposition date 2003-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rjcA00
5EU5B 1JL8A 4K2UL 2BNQD 3D0LA 2HFEB 1W72A 1JTOA 3KG5A 3R4DA 4OAWA 3VFGH 3VD5A 5C7XH 5KTEH 3T2PA 1F8TH 3RAJH 3M17A 1A47A 4WRLA 3ARGB 3RTQD 4H26B 4JN2A 1IAIH 3GSNB 4QXTA 1EUUA 1BEYH 1J5OH 3CAFA 3R06A 4NYLA 4YLQT 5BZWB 3PHSA 3MFFB 1TETL 4FP8H 4APQA 2JE8A 3VFPB 3GRWL 3K81A 5DQDH 3FRUA 3VG0H 1VGKB 3L3JB 2HA1A 4AIOA 2YPVH 3ZE1F 4U1GC 4BQ6A 5KSUB 2O61A 3IXAA 3O2WL 4MJ6A 3V8CA 1MNUL 2F8XC 2YC1B 3BP7B 4LSTL 3TN0C 3W5NA 4Q6IC 4BSJA 4L29B 3GI8H 2NY4C 3P77B 1A1OA 1IGIL 3OKEB 4POZC 5CGYC 3UTTE 1QYGL 4PJ9A 3VGFA 4QT5B 2DIAA 4KKBC 4R90L 1X5KA 4U1GB 4Y4KD 4PGDB 4JFEB 1KEGL 1MCPL 4HAFA 3WIHA 2FGWH 2PYFA 4WWKA 4R6UA 5FECA 4JKPH 2QSQA 2ORBL 4MNHA 1UA6H 3BGFB 1CDCA 2NLJB 3B3IB 3A6BL 3DX8A 1A14H 2XWBB 4NCC2 4V1DB 5INCB 2F53B 4M6ML 5EIIB 1Q94A 3UTTA 4LNVA 2FR4A 4MJ4A 5CEZH 3KPTA 4OZIE 3V0WH 2QBWA 2BNRE 1OM3L 5FGBA 5DJAB 4KHTL 5F9WB 1F6LL 1WEJL 4KI5D 5GJTH 3TVMC 4LSPL 4BQBA 1G0XA 1EGJL 1PKOA 4HJ0C 3P73A 1S7RB 4Y2OA 3L3KA 3UTPD 1MHCB 4HGMA 3C9NA 2IMMA 4XMLH 1Y18A 4AY0A 2DKSA 3I2CH 4YZFF 3PP3H 1F5WA 3PGCA 5BW7A 1K3ZA 4LLYB 3FMGH 4OZIA 2BNRA 4JO3L 2FO4A 3DUSA 2VRAA 3JTSB 1CG9A 1VA9A 2HT2C 3CFJB 5IG7A 3EHBC 1ROWA 3HE7A 1EUTA 2V2WA 5HYJD 4AMKH 2C7UB 4X5XB 1XR9B 1NCCH 3AMLA 3MV7B 4IMLA 3K4DA 4JCMA 4QRRB 4ZAKB 1J1PH 3C6LD 3FFCD 4ZODA 2APXA 2DI7A 3JWDL 3KLHD 1BFVL 1IM3A 2YN3A 5EU7E 2K3TA 2UV3A 4Z7WE 1FNHA 1X5ZA 1I8IB 1FV1A 3O9WC 2Z92A 1TPXB 4RDQG 1WISA 5GS1C 5MEOA 3QPXH 2ADGB 3EGSA 1NGWB 2AJ3A 3EDJA 3V5DB 1ADQL 4CMMB 1JP5A 1P84K 4O2FB 5K33A 1HQ4B 1EEQA 1G6RH 1RVFH 1FG9C 4ONFL 1NH6A 5L2JB 1T0MA 4TUJB 1C12B 2XQBL 3ULVD 4Z7WA 3AS3A 4RFOH 4Q9CA 4DUXA 2IWGA 4UT7L 4YHLL 1DCLA 5DJDB 4AEFA 1QSFE 2WBWB 4YUEH 1LO3L 2XXMB 4K07A 2BOCA 1GOGA 1U8PB 5HVFB 3RZCA 4NO5A 5I76A 5I1HH 4L9LC 3MV8A 4R7DB 1GIGL 3C2SA 2NXZD 2HKHH 1QR1A 3GMLB 4LDOB 4WJ5B 3SDXB 1P7QD 4J8RA 2W60B 1XGQB 3KPOA 4L8SB 1WF5A 1QSFA 3P30H 4POUB 3IAQA 2A9NL 2NCMA 4L9LB 4JGJA 1FLTX 3VFWA 1KT2A 1T1YA 4H20L 3BQUC 4X4XB 2YD9A 5JIKA 4LGSB 3VCLB 2A6IB 2PW2A 1ZEAL 1BJ8A 2W65A 5DK0B 2VABA 3JV6A 1NAKL 2HJLB 2HMIC 5E0QA 3BPOC 4KMQA 1FNSL 3FTGA 4EN3C 4FZEL 3GGWA 4U6YB 4Y1AB 3RY6C 3RDTA 3PHOA 1KPRA 2Z4QA 2RHEA 5DUML 5ERWB 1INDL 1XR8B 1LO0H 4HK3J 2VDRL 1J8HE 4XNYH 4BUHA 5K9KB 4XRCB 4OLEA 3T08A 1N0XL 3CDGA 3SDXF 5I17B 3FQNB 2HFFB 1FNGA 3SHSA 1F13A 4Z76A 2B7DT 2OL3H 5JXEA 4PV8A 1JGDB 3TBWA 4R0LC 3UC0L 3BZDA 3WN5B 3KR3H 1U91B 1OAYH 4MQXD 4U0RC 1T3FB 2XQYG 3QXDA 3QQ4A 2BOBB 2G75A 5F7FA 3RX7A 4X8XA 3QEQA 5DURD 3DX7B 5DJCA 1MJJB 3JV5A 4XNQA 2JK5A 1RK1A 3PL6D 2YBRB 4IRJD 1CF8H 1K3IA 3ARFC 4G43B 3K74B 1NCBH 5IEHB 5C0AD 1CXFA 3IDGB 3SOBL 4OGAD 1H3UA 2R8SH 4KY1L 4I0PD 2BSSB 5C0EB 4KTDL 4KUZH 2Y7QA 4LU5L 3GNML 4RGNB 3ZL4H 5IW6A 4U05A 3K2MC 4O5LL 5DD0H 4K3DH 1U3JA 3QEHA 1V5JA 4HXBL 1S7TB 1UJ3B 1X3DA 3BP6A 4DW2H 4PLNC 4HUUA 5KSAD 3Q2CA 1CICC 5AD0B 1RK0B 3B9VA 5GGVL 3MLVH 3ARFB 5ESVA 3LQZA 4LSUH 4K94H 5DVLA 4HZAA 3HE6D 5FOBA 3VFUB 2ZKHL 2Q87A 4UIMA 3ZSSA 4P57B 3S88H 3CSBA 4ODSH 3PQYB 1NC4A 3BWAA 2DLFH 5TE6H 5IQ9A 3TO4C 2Y4SA 5DJ0B 2VDNL 3ARWA 4WTXA 5DVKA 3X14B 4EBQL 3D9AL 5MENA 5ICXA 5E2VL 4NZRH 2X7LB 3RGVB 2IPTL 2NX5D 4IRSC 3LKOB 4XNUH 3QRGH 5CKAA 3NIDE 1FJ1B 2VDQH 3CVHH 2Q7YA 4Z5RB 2O5YL 1RZ7L 2IANE 2Y06H 1QG3A 3TWCH 1TQBC 1AE6H 5FYJU 4P2QB 3GHBH 2ITCB 1SVCP 4WW2B 1ZE3C 4PS4H 3ARYA 5L9DH 1KB5H 1DQJA 1ERNA 4RDQF 5IJVA 2NY6D 5GS2H 1C5DA 4IRSB 3CLFL 2DQUH 2H26A 3U46A 5HHOB 1CDBA 1PJ9A 1YYML 1SJXA 1N3NA 2EIZB 4NWTL 1I1FA 4BELD 3ROLB 1H8OA 5L0QB 2EE2A 2IANA 1YNKL 2B1AH 3AU1A 3G6JB 4CW1B 1MRCL 3PWVA 2FWOB 4JFXB 1C16A 3OJMB 2EDQA 4FMFA 4HUXA 1JZ8A 5H94B 1JV5A 1XGYH 4JDTL 5IIEA 1D5BB 3QDJD 5LAXB 4NCDA 4QRQB 5EOCL 5EG6C 5KVEH 3MRIA 3SDAD 5D1XC 1PBYA 4XNZC 3WFCL 3H8NA 2G9HB 2BCKB 3O81A 4JB9H 4K3EL 2GCYB 5JQ6H 5EFIA 3E8UL 2V9RA 3EDDA 1MJ7L 1QO3A 3GSUB 1E4WL 1ZHLA 5FO8B 2NY0C 5DVOA 1FH5H 4WW2F 2JJTC 1WIOA 1MIEL 2ZUYA 3W39B 3CXHJ 2HT4C 3NCEB 2K1MA 2WSKA 3JVGC 4IHOA 1BFTA 2XZAL 1UYWH 3H3PL 3REVB 4WO4C 1N5YL 1S9VA 4WV1C 2HT3C 5TF1H 5ADPH 1RZ8A 4PJEE 4UU9A 2J5LB 1A7PL 4HDIA 2CR6A 4WI2A 2F74A 3TA3A 4D0BB 1K2DB 2NY0B 2WP3T 5TQ2H 5IVXB 4OLYH 1A4JB 1VFMA 1D5IL 3G6JF 4HJJL 3CZFB 3P2TA 1XFPA 5DFTA 3ECBA 1HYSC 4MMZC 5CSZA 1X5HA 1F11B 4XPBH 3KYAA 2QQKL 3MGTA 2DI9A 4WV1B 4WU5B 4QNPE 3W11C 4WDIB 2QSCH 4QGTA 3CSPA 4KTEL 3ES6B 3QJHB 4PJEA 2F5BL 1RUML 1QRNE 1TVHA 2LE9A 3D85B 2V5YA 2Z0BA 2PTTA 4JY4A 5DRZA 1DUZA 3MCLH 4X7TB 1KCKA 2EDYA 4XI5D 4G9FB 2XKSA 2CLZA 2ZG3A 4MA3A 1FZOB 4HQQH 2QSTA 2VITA 5IF0B 3MUGB 4GKSB 5JO5A 5J06A 3MXWL 3DHMA 5HI3C 3WUWB 3Q3GB 4YR6B 3GO1L 3OKNB 1KPVA 4TSAL 3WJJC 1BGXH 4UOJA 2BDNH 1J10A 1FN4A 4Y2DA 5FKPB 1QRNA 2HTKC 1ZA3A 3NFPB 4X9FA 5IVXF 3MMEB 4OZ4B 2BFVL 1FORH 2NNAA 4JFZH 2IH1B 2Z31C 3BPLB 1J8KA 3U0TA 5EUOE 2BSRB 3VI3F 3TH2T 1I7TB 3BRFA 2JIXB 4F7TB 4F7MA 4OI8A 4G7YH 4PJ5B 7FABL 1UKQA 3H9ZA 3PP4H 2HLAB 3IFLL 3I6LD 3MO1B 3N1QC 2F15A 4QHLA 2YPLB 1G9NC 4TSBH 3QAZC 3T0ED 3G04B 4OCLC 3LD8B 1U42A 4ZDHB 2PO6B 3F7VB 3K1KC 5CILL 3QH3B 4OQTA 5HHMD 2XI9A 1OAKL 5EUOA 5I75B 1WJ3A 4U1SA 4LSRH 3BYTA 4YDJA 3KPLB 4UB0H 5KS9E 1QRKA 2IPKA 1OTUC 4YEEA 2GJ6E 5GGVY 3C5ZD 4XXCC 3VDAA 3QXAB 3I3EA 4FFYH 5E9DD 3AREC 4PY7B 3W0WB 3VWJC 1E6OL 2HVJA 4C56B 4NQTA 1D5XB 3PXHA 5DMGD 1OGAB 5TH2B 4GS7C 5TQ0L 2ED7A 4U6TA 1BBDH 4S2SB 5KS9A 3X13B 1FP5A 1X5LA 3WLWC 2KL6A 1NCAL 1W0VA 4NC0B 2GJ6A 4NBZB 1CFVH 1XF4A 4HBCH 5I1DA 4WY7H 3PJSB 4Q58C 3ESVF 5EN2B 5GIRB 1VKXA 5GS0H 3IFNH 3ZMRA 2FB4H 1MHEA 2DQHH 4XX1G 1AI1H 1ZHBB 4LLQB 3NBNA 2DWEA 4ZYKB 1KJMA 1U8QB 4L4VD 1AY1L 4EDXA 4H5SB 4Y5YB 3VFTB 4DEPC 4MX7A 4XVTH 4NWUH 3PDOA 5GGTL 3STLA 3F6IA 3CC5A 4OZHB 2QQNH 4YQXH 4JJHA 1EO8H 4JAMB 4GG6B 4JKKA 3MBEC 4OQ1A 5FYKE 1ZLWK 1V7NH 2VIRA 2ZUSA 3O6FB 1SY6L 4JRXE 5L2KD 1DBJH 4U1HA 5ACZA 3IRZA 3QWOA 5T3ZH 3QEUA 4MDIA 2APTA 3T4YB 2HYMA 1PX3A 1BQHG 1OGTB 3C87A 4QHNA 1ZT7A 1IKNC 2FJGB 4LLVB 5TGBA 3RWEA 2P42B 2HLFC 15C8L 1S7XB 1JWMA 3C60D 1G7JA 2ZSVA 4DOHB 5D7JC 4QHUB 3BP4B 3DXAB 3IFOA 4P3CL 3QUKA 2D7MA 4Z7QE 1AH1A 1G7IB 3BD4A 3BX7C 2G5BB 1IC5L 5I1GL 2A74B 5J8OA 4FQIH 1KJ2L 3K0WA 3RY4A 3MLTB 4WFHD 1SMAA 3V2AR 1D6EA 3DYOA 2GUOA 2H1PL 1MFEH 4OZHF 2Q8AH 2R4SL 3FQXA 1MREH 1UWGL 4GG6F 4R2GD 4OCYL 1M71B 4MCZB 4FQ2L 1UB5B 3B2VL 1SM3L 2FHFA 5DYOA 2P1YA 4BYHA 2JCCF 2XKNB 1E6JL 3EFFA 1JFQH 5JUEH 1UCBH 4LL9A 2AEQL 4ZPTB 4YWGH 3W82A 4O9HH 3DUHA 4QRSA 3ARDB 5HI5D 2E6JA 3F58L 5KANI 3ARBB 3LS4L 4Z6AT 4KMTH 4HUWA 1N4XL 1BOGB 5JDSA 1XGPB 3IKCB 1YDPA 2MPAL 5D96B 3LHPH 1B4JL 2B5IC 5T5NG 1DQQB 2HRLA 1FO0B 3SKOA 4LCWD 4KV5F 3ARXA 1QKZL 2KZWA 1UACH 4NDMB 4EVNB 4PJXE 4ZS7H 1ZVSA 4UDTA 1KIUA 4RNRB 3RTQC 4LQFL 2KQMA 3GMQB 4F7PB 2DI8A 4YXHH 3O4LE 2V5SA 5EZOL 3RKDC 1A7BA 2ZPKH 4GRMB 4M43H 4OIIH 4YDVB 4PRPD 4U1NA 3QISA 5C6WH 5C0CD 3OR6B 4C55A 3WDIA 5HHPA 3H7LA 4WU7B 2YRPA 1OSZA 3TV3L 4X6DB 1DN0B 5C0JB 5B4MD 3BEVB 1EAJA 4F7CA 4PJXA 4Q2ZB 4Y19E 4DAGL 5BVJA 3IAPA 5ID1A 5HHNA 1ETZA 3O6LH 5DMYA 3A0OA 5D1ZA 2GFBB 2PNDA 1I9RH 5BMFL 3MJ9H 4RZCA 2WQ8A 1BQSA 3IYLW 1EJ6A 3BRDA 2FCBA 1IARB 5DD6A 1U8HB 2XYCA 3HZKB 4QF1A 1T20A 3L3IA 1IM9D 5EB9A 1EHAA 2VXUH 4Y19A 3TJHD 3ZSTA 3HMWL 1QBML 1AQDB 2UVFA 4R4BA 3ZO0A 1UXSB 3M45A 1YPZE 3T2NL 5BS0B 3NN8B 3B9DA 4WEUD 4PYHA 1BQHB 3NIGE 4LKCB 1NCDL 3OKKB 3VH8B 1A6WL 1ORQB 3VMOA 3DBXB 1WVZA 4I18B 3B9EA 4KROD 4NFDA 5I73C 4NKMA 4JDVA 1HCFX 4JZOB 1U3HA 2R2HA 4X6DF 3JUYA 4GKZB 2VQTA 3TT3L 4KI5C 2VN7A 1WBXA 5DA4A 1AJ7H 1YPZA 5HDQL 3BPCB 4OLXL 1F4HA 3O2DH 4OB5L 1RJZB 4MXVE 5INDA 1CT8A 2OP4H 2DDQL 3NFSL 2RFXA 4MA1B 4X4ZA 2EO1A 3C5JB 2WLYA 3MA9L 5I18H 5FM8A 1FVCA 2NW2B 3QEGH 1IMHC 2IG2L 3FB8A 3NGBB 2DYPA 1T21B 1CE1L 3KJ6H 3HNVH 1P5VA 2Y25A 4QTIH 3BXNB 4HKBA 1PKQB 3W9EA 3MRFB 6FABH 4U33A 4NN5C 4CJ0A 4QTHB 4OFYA 3SGDI 3JV4B 4D3CH 4MSWA 3TGXA 3MRQB 1T1XA 3DROA 1J11A 2E7HA 3C6LC 4JM2D 1TENA 1NGQH 1Y6MR 4Z95H 3KPPA 4F7EB 2FJFB 3QIUB 5SX5K 5F9AC 1Q9LB 2HG5B 5C07D 5D6CB 3CLEH 1YN6B 2XRAL 4P2OD 3BDBA 1G9NL 3T1FB 3UTSE 2CLRB 5ECJE 2A77H 2P43B 4RMVA 4D9RE 3IDMB 2VMFA 5A2LH 3TNNB 4KH2A 4A6YA 4JHWL 3UO1L 4QYOB 4PJBA 3V0VA 3ULVC 2DIBA 1G1CA 2E27H 5IGXL 5K59E 1S7QA 5ILTH 4U0QB 3HN3A 3CSGA 4NQED 4LHQB 1IZJA 3WXVL 4LLAA 1IL1A 3QG7L 5CJ5A 3N0PB 1MOEA 5I2IA 1MCOL 4XNXL 3IDYC 4GKNA 5T1KA 1G6RB 3BVNA 3UTSA 2X4PB 4JKLA 2FD6L 4KVCL 1BVKB 4APQD 1BREA 1GZQA 2MQCA 4L3EB 3SE9L 1CXLA 4HT1L 4E0RB 2NXZC 3HKFA 4MDJB 2R9HD 5I1AB 1BPVA 3WS6A 5IV2B 4XNMB 2NW3A 2I9LA 5FA4A 1I9IH 4M61A 2IAMD 3IJYB 4E41E 4X7EC 5T5NF 4PRBA 5LBSH 5D8JH 2EDWA 1C8PA 3MC0A 3EYUH 3F7QA 4N0UE 3RPIA 2DBJA 4RISL 1YEEH 4X9GA 3U4BH 1NMAL 4M48L 3QUMH 3MJ7A 3QIWA 3FQWB 1HQRA 4M1CD 5F3HA 5IHLB 2VN4A 1MAKA 3EOYG 1FCGA 3HR6A 2FEEI 4G6FD 4ESKA 4N9GA 1MCWM 3GJFA 4O2EA 4LPWA 5I8EA 3KAAA 4PTTB 4W70A 5FV2A 1LEKB 3P0VH 5AYUH 1FC2D 3MUY1 5D6DC 3UTTD 4N0UA 5J4MA 4P5KA 1SYVB 2Q76A 1WICA 3RWIA 4F15C 4LVOC 5SWZA 1U9KA 1N64L 4N8VB 1LO4H 4ZFOB 1S7SA 1T04A 4TVPH 5CP3H 1BBJA 3QHZH 1BECA 4JO4H 3MLRL 3OG6B 4KXZI 4MQXC 5E6IA 4PRIA 3QI9D 4ALAH 4XTRD 2OI9C 1AR1D 1AGCA 5CHNB 1CK0H 3LEXB 3MACH 1KTKE 4LLUB 1QLRA 4BSVA 3DYPA 5SV3A 3QR2A 2OL3B 1GPOH 3S37H 4IRJC 1HHHB 3PWJA 4R3SB 3ZKSD 4OCWH 1MWAL 5CEXA 4I0PC 5K9JH 3HE7D 3VWKA 1EAPB 4XP1L 1IC4H 4NZTL 1W8OA 1SBSL 1KIPB 4QOKE 1KLUB 4MQ7A 5EDXA 3VRLF 2YK1H 2CIKA 5C86A 2ADIA 5EIQA 3EOTH 3V6FB 5CZVL 5KSAC 1TQCB 4U1MB 1X4XA 2R2BA 1IZKA 1KFAL 5DMIH 4Z0XA 3G5YB 1J0YA 1EGJA 3HE6C 3VW3L 1I1AB 1J05B 3VFRA 3B5TA 4RGOL 2XG4A 3PGDB 4Y4FA 3OZ9H 5FUZH 4D0CA 5ICZA 1DQLL 3SDCD 3LEYH 4XHQA 1XF3B 3IGAB 1R5WB 2WWMD 2X2YA 5BO1H 2EYRA 4M3JA 3RL2B 3G08B 5KJRL 3MV9E 1K8IA 1NUDA 3L5IA 3IKKA 1P2CA 4PJDE 2EIBA 1TCRA 4NKQB 3L3GA 5TFSH 4FXKB 2BHYA 3WEXA 3F5WB 2Y23A 3RZCD 2VR5A 3N85L 3MV8D 4PB9H 5D7SH 4S1QH 3B83A 3LKSB 4ZG1A 1Q1JL 5C6TL 3BRGC 1F4WH 4N1HB 8FABA 3P9LA 5EZIH 2VNCA 3O6KL 4KTYA 4QKXB 1MJ8H 2NY6C 3TPKA 3MV9A 3IDNA 4LCYA 4QGYA 3RJQB 3ELAT 1FFOA 1PYWB 3IS0X 1QSFD 2AQ3A 2DL9A 4C4KT 2EECA 3QUYA 1A3RH 1ADQA 2ILLA 5JMRA 2HFGL 3HMXH 5I16A 4YHOH 2AK4B 5E94B 2P5EA 5ETUB 4OGZA 1CXHA 3KPSE 3EW3B 3QWQB 1G6VK 4F57L 1S8DB 3SDAC 4NRXA 1C08A 3MRRB 5F97E 4X6CB 4P9HH 5IB4A 2HRPL 4HPYH 2CUMA 4TULL 4BSWB 2AJVH 3O8XA 4M9OA 5EO0A 3KYOA 4FTVD 1H5BB 2P7TA 4U7SA 4WGWB 3CXDH 2EYSB 4OCMC 5JIIA 4ZUTA 4UUJA 1BHGA 1QFWL 4HX1B 4KRPB 5D1QA 3MQIA 3UJIL 1CWVA 4ZNEE 3KPSA 5HYSG 1FL3B 4P2RE 2V5RA 5D2NC 4HK0B 3HUJA 1JGEB 2YD6A 4HMDA 3C8DA 3MNVB 5JXED 2DQJH 1IQDA 2BZDA 4GQ9H 3D2UB 2AGJL 3VDBA 2HKFL 1BOYA 2OTUB 4C59B 4XMPL 4KAQH 5EUKB 5I8OH 2R56H 2X05A 5KSBB 3L5WA 1F4AA 3QEQD 4ZNEA 3I2CL 1AKJB 4X99A 2VDLL 1AGEB 4KZDH 4P2RA 5KVMC 1NGZA 4X6CF 4X7FC 1WIPA 4EXPX 5DJZA 3DUUA 3TP4A 1MI5B 3E6HA 4JGMA 4LCUA 2R0LH 3TEUA 1EEZA 1ZLSH 1U8KA 3KHOA 1U8NB 4LP5A 4LCIH 4XI5C 1F3JB 2F5AH 5CMAA 2BY3A 5F88A 1T5XA 3V4PH 2JF1A 5BV7B 1VFAB 5CCKL 2PYEE 5IFJB 1YEIH 1Z5LA 5MP6H 2AV1A 3MRKB 3SGEI 3GMPA 4YIQA 2APVA 2VWEE 1WTGT 3D0VA 4NP4L 3FO2A 3KYKH 3U79A 3UEZA 4XWGL 3OPZH 4JANA 4XP9L 4TOYL 4C54A 1NC4D 1UG9A 5E00A 4YH6A 4X80L 5KSBF 1WBZA 3BAEL 3WFEL 5MEND 4Y16B 5EORH 4JVUA 1NGPH 1RVFL 3MA7A 1KEML 3WDJA 1NDMA 1OT1A 4J3TA 2J8UE 4LIQH 5HI4D 3OXRB 1D5MA 1NEZB 5ISZE 5I74B 3ULVL 3OAUH 1JGVL 3QO1B 3HPLA 3T0EC 3B8SA 5EO1A 4ZXBC 3E2HC 4JEGB 3U83A 4C83B 4IDJH 2RCSL 1ZHKB 2OCFD 3RX5A 4HHAB 3QCVL 4PJ8B 2ZSWA 1D9KA 4PP2B 1YMHB 3ZKQD 5I0ZA 4JHAH 1JGLL 5GRYA 4G5ZL 1RURH 2J8UA 3U1SH 3L5XL 4IMKA 3BDYL 1S5HB 3VXUE 5DJXA 3C5ZC 4Y5XC 4ZXBB 3LPFA 3P0YH 2IAND 5EU5A 3H7BB 4XP5H 1YYLH 1HOCB 3J7HA 5CBEB 1OCWL 4B53A 1T0NB 3LKPB 2NY1D 2DM4A 2Y36H 4ORGA 1SBBA 2EDBA 5DSCB 3ARGA 4H26A 3DRQB 4JO2L 5DMGC 4HFWB 5T3XH 3HNTL 4K9EC 3CH8A 5I1KH 4PR5B 4RAVB 1JNNH 4UIKL 4YZFE 2O93L 1XH3A 1TXKA 3NPSB 4N8CL 2R0WH 5BZWA 2VLJD 4LSVL 2V5TA 3MFFA 2E7BA 3VXUA 3VFPA 3NAAH 4NJ9L 5HYSB 1EZVY 1VGKA 2OBGA 3FB5B 4X5LA 5KSUA 4GAJL 2ZOKB 4XPHH 5DC0A 3MRHB 5B38G 2YC1A 1AO7D 3BP7A 3GM8A 1YN7B 1BZQK 5L8LB 1YEFL 2VZTA 4L29A 1N8ZB 5J7CC 3P77A 3OKEA 2IQAB 5FGCB 3HAEG 2F19L 4YE4H 2YMXH 4JFEA 5HXMA 4Q9RH 3F7PC 1UWEH 2Z9TA 1PLGH 1QBAA 1NBYB 3MLYH 5JTWA 4OSUL 2MHAA 2NLJA 4Q6IA 3B3IA 2VDOH 3WBDA 3S35L 3IU3A 5K9QG 3PWNB 4GO6B 5INCA 5EIIA 4EXKA 1OAXH 4KWUA 4UTBL 1EFXB 5HGGS 3ISWA 1EFQA 4NFBA 4F58L 2XWJB 5GRVK 2YUVA 5DJAA 5GGUB 2FIKB 3C60C 1FFQA 4PRHB 4HEME 2J2ZA 1DQDL 2Y07H 1S7RA 5D71H 1YEHH 3NH7L 5LWYL 4HUVA 3IU4H 3U7YH 4HXAH 4BJLA 4R4FH 4QRRE 4Y2DD 3X3FL 4LLYA 5IMMA 1HWGB 4HC1L 4HLJA 5EOQH 4QRUA 3TVMA 1LDPL 4R2GC 1KNOB 4I2XB 1CLZH 3OTTA 4PTUB 2EICA 2YUXA 3CFJA 4MAYD 4RQQB 1BZ9B 2D0FA 4GXVH 2C7UA 3U9UB 3WYRA 2W0LA 4FQHB 1KELH 4QRRA 4H8WH 4ZAKA 2J6EL 3DO7A 3VFVB 5EBMB 2PXYB 2XTJB 1TZGL 5TPWH 1KBGH 1NQBA 3FONB 1F3RB 4O4YL 5FB8B 1Q9KB 5GRWA 1I8IA 4MQTB 5F7NC 2VC2L 5IBUG 4W68A 3MGOB 3VXME 1FE8L 4MA8L 3SE8L 1M6OA 1NGWA 4O2CB 3V5DA 2OZ4A 4X0KA 5C6PB 5EZJB 1FGVL 5SWSB 4O2FA 5I8CA 1HQ4A 3EOAA 1ITBB 4UAOC 5L2JA 4TUJA 1C12A 3MJ8B 3MODH 3BKML 3GFUA 2YKLL 3BW9B 3VD4A 5I1JH 3S36X 3NMEA 5DJDA 1QFPA 4WUKH 3VXMA 4UNVA 1QACA 3ILQD 4JRYE 2CH8A 4PJAB 1A6TB 4FABH 1FZMB 2R4RH 5IMOB 3ZDYE 1GL4B 3R8QA 3GSWB 2GJ6D 4X9HA 4UAOB 5B4MC 4NQCE 2UZIL 3T0WA 3NFNB 3U9PH 4OJFL 4R7DA 35C8H 3UPCA 2BVQB 2AK1L 4HSQA 1IAOA 5B38B 3OKDB 1DQML 1P84J 3MUJA 4LRNL 4OCNC 5LGHH 2W60A 1XIWB 3RX8A 2MQ0A 1OLLA 1XGQA 2BRQA 4L8SA 5FYJH 3ZTNL 1X7QB 2I9TB 5C0BE 1RJYB 4WI5A 3O3UN 3SCMB 1A2YA 1FSKC 1FQ9C 3HAEB 4L9LA 4LSSH 3DGCR 4J3OC 4U1IA 5KVFH 3K4AA 4X4XA 3U82B 1JYWA 1CN4A 3VCLA 3P4MA 4OLUH 2CDFB 2X4SB 1GH7A 4BH8B 4MZ3A 3TJHC 1DR9A 1NANH 5FCUH 2HJLA 4G8FB 4QXWA 5HVWA 5HY9A 5IB1B 3MRLB 3EDFA 4U6YA 4LLDB 4Y1AA 3MTRA 1MPAL 1MSPA 5IUSA 4TUKH 3BQUA 4MJID 4KROC 1IFHL 4PJAF 1BQLL 2P5WD 4YXLL 5ERWA 1A3QA 1XR8A 3HFML 1QHOA 5KOVC 1LP9B 1WT5C 3VXSE 1PQZA 1IQWL 2ICWJ 5BV7L 5DJ2B 2XT1B 5K9KA 4XRCA 5I17A 3FQNA 3C6SB 2JJVA 4XVSL 5C2BL 3MNZA 4X7SL 4M7LT 4JPWL 1U8MA 5C08B 1U91A 1MAJA 1UENA 1T3FA 4JZJC 4HIEB 5CIPH 5F1SA 3QQ9D 3VXSA 2BOBA 4GRWE 1FRGH 5GGTA 4F2MA 1OF2B 3DX7A 1BGXL 1U2HA 1MJJA 4QCIB 5CSGA 2YBRA 1NMBH 4G8IB 2ZP0T 2EXYD 1CL7I 4G43A 2D7OA 5IEHA 4JM4H 5DGQA 3IDGA 5SX5H 4S0SD 4YDIH 2O5XH 3WIIH 3NCYP 1SY6A 2BSSA 2ENSA 5C0EA 4ZOAA 4JZJB 1QSVA 4JM2C 4FQLL 4HD9A 5CJOH 3UTZB 3PQYE 1MVUB 1S7TA 1UJ3A 1LP9F 4E5XA 5ID0B 5MI0C 5JW4N 5FIEA 3LH2L 5AD0A 5IBUB 1RK0A 3GBNH 2BJML 4HF5H 3MREB 2XG5A 2D3VA 3ARFA 5D7LE 2EH8H 4PGBB 2R29L 4G7VL 4P2OC 3DYMA 4IM8A 3VFUA 5IR1B 3MZGB 4FQPA 5EU6E 1WFUA 1BIIB 4P2QE 1KJ2A 3OF6D 1CYGA 3PQYA 4QRPB 3LZFH 3ZKXB 2WBKA 1CICA 3KXFE 5JR1H 4DK6A 2CRMA 2EKSB 3S36L 1K8DB 1RI8A 3FB6B 2X7LA 3ZYJA 4PP1D 3LKOA 3X3GH 2Z8SA 2VLLB 3GSXB 1WLHA 4K71B 2VXVL 3UCRA 2GTWB 3IT8D 5DJYB 3RWFB 3TBVB 3MRNB 5IB5A 4APQC 4XH2B 5EU6A 5F7KC 5DZOA 5F70A 4P2QA 2ITCA 2OLDA 4HUNB 4WW2A 1I4FB 5EWIH 2O5ZL 4AEHL 2AXHA 3KXFA 2R9HC 4K9EL 4G42B 12E8H 3VG9B 4FQ1L 5HDOA 2WLZA 4IRSA 4K8RD 3U6RB 1HILA 2IAMC 2Q1EA 1CXEA 1R3IL 4JO1L 5D1ZD 2ZUQC 3QXVA 3ROLA 2ICWB 4AM0B 5EOTB 1ED3A 2AJYL 4M6OL 4OT1H 4CW1A 3ZYZA 4WW1B 5F9OL 2GW5A 3TJEH 1FFPA 1RZGB 5C92A 3PWPE 4FQJL 4RMSA 3SKNB 1QFUL 1D5BA 4QRQA 1MF2H 1JPGB 4Y19D 5AAWA 4YHNB 5IHUL 1ZVHA 5CJQH 1EPFA 3AC0A 2BCKA 2CKBH 3QUZB 2VISB 1TTFA 5DD1H 2GCYA 2MSPA 4Z78B 3G9AB 1VGEH 3RY5A 3UROR 5FUCC 1JZ7A 5J1SC 1U8LB 1U3HD 3T3ME 2NY2B 3T0DA 5FGBC 4GBXD 1SJVA 1DTUA 3PWPA 5ANMB 3THMH 3VXRB 4YGAB 4ODHH 3VXPA 5D1XA 5F7DB 1FHGA 4YHZL 1J0ZA 4ODBD 2ARJA 4UOW0 1INQA 4ZFZB 3REVA 1N7MH 4PUBH 4PB0L 4G6KH 4NPYB 3IETB 5DWUH 2Y9RT 3BYYA 1HI6B 3DIFB 5F8QC 5HGDB 5LGJA 5C09D 4ZFFB 1JIBA 3QI9C 4EOWH 2X41A 4XMKL 4XTRC 5SV4A 1AR1C 1K2DA 3A6CL 4OCXH 4H1LH 2JJTA 2ATKB 2BMKB 3CZFA 1YY8A 1OTTD 3JVGA 1F11A 1OAQL 5A2KH 2A9ML 4WO4A 1RULH 3TIDB 1A7NH 1UZ8B 2Z8WC 4WV1A 3LRSA 4WU5A 5DUPL 1DBAH 1EERB 3DV6B 1MQKH 3HE7C 4QHMB 3NCJL 3ES6A 1DFBH 3QJHA 2F58L 1KJVB 4OFYD 3SPVA 3D85A 4JKMA 4X7TA 3P11H 1QR4A 4OD1H 5FDWA 1FZOA 1F42A 4YBQD 2GYSA 3I84A 5IF0A 3MUGA 4OFDA 4RMUA 4GKSA 4IRZH 1U8JB 3VI4E 3TF7C 1MAMH 2PKDA 4G6ML 1X4ZA 3WUWA 3Q3GA 2DKUA 4YR6A 3OKNA 3MOBH 4NCC1 5FKPA 3K8MA 1HN1A 4LFHG 5GRJH 2FJHB 1FCCA 3TYGL 3SDCC 1Q9OB 2I5YL 3MMEA 3S3SA 1UM4H 5A3ID 2WWMC 4R8WL 5FK9B 5JHLL 1REIA 1NUNB 4NQSB 4Y4HC 2IH1A 5CINH 2VL5B 4OLWH 4Q74A 2BSRA 4CVXA 4FRWA 4N0RA 4FA8A 2JIXA 4F7TA 1KTLB 1NBVH 3WJJA 5CEYB 1H9VA 5T1KD 3MO1A 3UTSD 1A6ZB 3RZCC 3ARTA 4D9RD 2YPLA 4NHCL 1XGRB 4MGXA 2X6MA 3ZTJH 4RWYH 1BFOB 3MXVH 2AI0H 3G04A 4M43L 1A1MB 4LHUG 5EO9B 2YSSB 4ZDHA 4Y4HB 3VE0B 2Z31A 3DSFL 4H0IA 2PO6A 4HS6B 3F7VA 4JN1L 4OFIA 2FDBP 1TJHL 4PREB 4P4KB 4PGCA 4M1GH 4CU7A 3STBA 5F6IB 3L3OA 1A3LL 1S7WB 3AAZB 1T6WA 1MJUL 5D2LB 3QUXB 4K3JH 3QXAA 1JWSA 1OD7A 4PY7A 3EFDL 4CGTA 1WC7B 3QIWD 5JOFB 5E2WH 4C56A 2P8LA 5DGRA 3LEVL 1UM5H 5TH2A 1QSEB 2VKWA 4S2SA 4O02H 1Z3GL 4NZJA 3X13A 1CFSB 4M5YH 3D48R 2VLKE 3N50A 5BOPA 2DLGA 3E1F1 4XXCA 3QA3B 4LMQI 2JB6B 3PJSA 5EN2A 5GIRA 4OZHE 1CDGA 5BZDB 4JFDB 3ULUF 3L3HB 3DHJA 3AREA 4QXGH 1ZHBA 5SWZD 4ZYKA 1U8QA 4Z7OF 2XKUA 4H5SA 4UQ2B 3LB6D 4YC2B 3SO3B 3VDCA 5HGHB 3NCCB 5JXEC 4Y5YA 2A1WL 3VFTA 2R0KL 4XPTH 5E4EC 1HWHB 2C4FT 5E6ID 4X4YA 7CGTA 4PRID 5GRUH 1JHTB 1K85A 2EDKA 2GIYA 4OZHA 5HPMA 5F72S 2R0ZL 4JAMA 4DOHE 5CZKA 5J1AB 3S3JA 2VZOA 1C1EH 4Z7VB 43CAA 5JZ7D 3JWOH 3O6FA 2X4OB 4L1DA 1FL6B 1EEYB 2JB5L 3T4YA 1T2XA 4KK8D 4KV5E 1IILE 2HH0L 1OGTA 3CDFA 1YMMB 3EYVB 4LLVA 3S37X 4OM0H 5IBLD 5B22A 1T03H 3ROOB 3BZ4B 1S7XA 5DD3L 3OGCB 5JORB 2FHCA 3CMOL 5DS8B 5DT1L 2AV7B 3MFGB 1DZBA 5DLML 2G5BA 4XPAH 5L88H 2A74A 2DQCL 3RA7H 1KN2L 4ZUUB 4Y4FD 2YS4A 3MLTA 4LGRB 4LLMB 3VMPA 2D03H 4LLWA 1S9YB 1JN6A 5AWNH 3HZMA 1MFBL 4MNQE 3L9RB 3ZT6A 3P3YA 4Z7VF 4HWEL 4AIZB 3GI9H 1UB5A 3Q48A 1IAIM 5HI4C 1KGCD 5KZCB 3C2AL 1IAII 4JFOB 4LHUB 1FIGH 1RZIB 1W72L 2P48B 2FX7H 2Y6SD 1RUKH 1XGUB 2VDKL 4ZPTA 1E4JA 2YN5A 3EBAA 3DVNB 3ARDA 4DN3L 2DIJA 3KNBB 4MNQA 4YFEA 4W6WB 4M4RA 1U92B 3WKNA 5IEKA 1BOGA 1XGPA 3V6BR 3IKCA 2VH5H 1WBYB 2JJSA 2YD4A 4XVJH 1RUPL 4LEXL 1T7VA 1GGBL 3QUYD 3SDDB 1VFBB 4XX1E 4NDMA 2NY1C 4EVNA 5J13C 2P5ED 3NCMA 1DBKL 4JFYB 2X4NA 4MAUL 4RNRA 1PG7H 1V7ML 3U7WH 1ZAGA 1IGYA 2MNUA 1UEYA 4YDVA 1QFWM 1CLOL 1EXUB 4J1UB 2OK0L 3CNKA 4AZ8A 5F7EL 1QVOB 3OR6A 4EI5B 1QFWI 5ADOH 3LN5B 1DN0A 3BEVA 2C4FU 1AQKH 3MJGX 5I15L 5JW5A 3RTQA 4FXLA 1KCRH 3KPSD 3P4LA 3FO0H 3MRDB 3BEWB 1OARH 3FT2B 4I1NB 5HGBA 4AG4L 5C0IA 2AERT 4HFUH 4M3KB 5HDLA 3UAJD 4ELMB 3TM6A 4KK6D 3SKMA 2GFBA 3TNMB 2NXYD 3RVVD 3QDGB 4NGHL 3CZJA 1XF2A 3F6LA 4HH9B 2VOTA 2CR3A 2M2DA 3KDMB 1U8HA 3HA0A 4KMLB 2RAMA 2XZCH 5CUSL 1I75A 4WI4A 1T2QL 3WXWH 4ZD3H 2YR3A 2BRRL 3SQOH 1G7LA 4D9LL 4DKFH 1UXSA 3MV11 1EIBA 5BS0A 1YEDB 3NN8A 3KLAA 4ZQKB 1BQHA 4LKCA 1F4YH 3OKKA 4WGVB 1MEXL 3VH8A 5E2JA 1QNZL 2M8XA 3WFHB 4I18A 5FOJA 1BM3H 1EHXA 4LF3B 1DUYB 2H6PA 3OAZK 4JZOA 4Q0XL 3DGGA 4GKZA 4JQIH 1A6PA 3QPQD 2I26N 3NABL 4DQOH 2OJZH 3H9SB 3GJEB 3UTPE 1ONQB 1XF5B 2YXMA 3QCTL 2DBLL 1PKQE 3VD7A 4CN4A 1RJZA 4ELMF 3WIHH 3LS5L 3C5JA 3SY0B 1DBMH 2VERN 4JPVL 2NW2A 2XN9D 3HC4H 4WCYH 1T21A 3W2DL 2P24B 4NUGL 2IFFH 3QNYB 2JELL 4MAYC 3V4UL 3BXNA 1JPFB 3TBTA 1P4IH 1PKQA 3DX9B 3MRFA 1MQ8A 3N1GC 4RGMB 2P8PB 4QTHA 3FFCE 3L95B 2J7LA 1YEGH 3IF1B 3ULUL 4PJ7B 1UWXK 5FO9B 3UYRL 2QHLA 3LQMA 2UWEB 2AQ2A 1QLEL 4F7EA 3QIUA 4CU8A 5D70H 2A0LD 2VR4A 4WUUD 1Q9LA 3OB0H 1J1OH 2HG5A 1CGVA 1YN6A 4JG0L 1AFVH 1A7QH 1HZHL 4WEBL 5F7WC 2CLRA 1CR9H 4F9PA 3C8KB 3IDMA 5IOPB 3CFEB 4L3EE 3ULVE 2QKIB 4QYOA 2LU7A 4PJIB 2ZNXA 5ALBH 4JFHD 4ZTOH 1E4XL 4GFTB 4DGYH 3ARGD 4RA0C 1RQ5A 2DMKA 2YPKB 4OGXH 4MVBC 3O3BA 1AXIB 4HIIB 5J9PB 2X4PA 1ZKAA 3ZZ1A 3WIFB 4L3EA 3HG1B 5KW9L 1TZHA 4PJ7F 3ZDZF 4E0RA 5C0RH 4TUOB 2UWEF 4FZ8H 5AUMB 1RIUH 5AZEH 4MDJA 4NUJB 2WMPA 5I1AA 1FLRH 5D7IB 5IV2A 4N5ED 1MCWW 2E9BA 3PIQB 5A2FA 2BVPB 2FHBA 4J3WA 4DN4L 3N9GH 2PR4L 2LV4A 1WGOA 5I71B 4PLJD 2LABA 1F58H 4JFED 2AJSH 4M93C 5L6YL 4PJIF 4UT9L 3BE1H 5MEQB 1CGSL 3FQWA 5F7LB 3S5LG 1I85A 1CZ8L 2VSCA 3MR9B 3I50L 4V1DD 3LY6A 4PTTA 4B41A 1IGCL 4Z0BL 3F7RA 4GSDL 1EVUA 2F53D 2EEAA 4ODVH 3BUTA 5E1AB 4PGEB 4M7KL 4LPYA 1UZ6E 1SYVA 4HCRL 4CAGA 3OKMB 2OJEB 1UH4A 5JNYB 1D5ZA 4HKJB 5LJYH 4N8VA 3OKYA 1XMWA 4LVNC 1AC0A 4ZFOA 3IRPX 3BKJH 3NA9H 5D7IF 2VDMH 5B3JF 1IGFH 2GEEA 4ZUSB 1J18A 1OVZA 2FSEA 2N7BA 1ITCA 2I60H 4HMCA 2AJXL 4ODTL 1MFCL 1FFRA 3S8WA 1NJ9B 5CHNA 1N2RB 3RI5K 2MTPA 4XP6L 3U48A 3LEXA 1A6UL 2DJ4A 1GOFA 4LLUA 3OG4B 4KHXL 2NY3C 1FBIL 5C0AE 4ZUVB 4K7PH 4YNYB 1PG7W 2EXYC 4R3SA 2H9GB 5T1DH 1U8OA 5E8PB 3G6AB 1N5AB 5CIPB 1QFHA 3HTLX 1EAPA 4WFFE 2YUZA 1ACYL 4M8QB 1KIPA 1KLUA 1VPOH 3MV7D 4H1LG 4QRRD 3QO0B 4ZAKD 3QDMB 2FL5B 2VXQL 4TRPH 5IT2H 4KDTA 4AL8H 2WUCH 2NY3B 1OY3B 1T1WA 3PGFH 3OBAA 4IRJA 4U1MA 3RIFF 3MLPA 2J88L 4YO0B 3PP3K 2B0SH 1I1RA 2HT2D 5C0AA 1A9BB 1K5NB 3EHBD 3G5YA 4BFEA 5IVZB 4Y8DC 1X5YA 1R0AL 4UILL 1A1NB 1J05A 1CE6B 1YNTA 5DD5H 3PGDA 5E08L 5I9QC 3SJVB 4DKEH 1H3PH 1JYVA 1F90H 4KGJA 1HYRC 5KSAA 1XF3A 3IGAA 1CBVH 1NFIB 3RL2A 2NX5E 1U8IB 1A7OL 3A67L 4OI9A 4FS0A 2BC4B 3HE6A 2D7QA 4ONHB 1L7TH 1LK2B 5IJKA 4HIXH 2DD8H 2VZVA 1G9MC 3LOWA 4CMHC 1ZS8A 3CFKA 4HKXA 2VUOA 4POYA 4XCCH 3T4AB 2AK4E 2J6EA 3LKSA 1LO2L 1B2WH 5E8DH 4G3YH 3TT1L 5F7UA 2UY7A 2ZJSH 2ICEB 4K8RC 1GVIA 2XV6B 1F45A 5D1ZC 4AQOA 4OBRA 2CRIA 2BY2A 1QLFB 1F4XH 3QHFL 4JY5H 4TQEH 3O3AB 2MCPL 2EYTB 2IGFL 1BAFL 5IFHH 3ZTJG 3OX8A 2YRLA 4D9QE 4QRTB 2V2XB 1AD9A 4H88H 2BX5A 4FQCL 3QDJE 4LPUA 2AK4A 3NCYS 5E94A 4I77H 4OLVL 5ETUA 3S5LB 3WO4B 3W9DB 4TSCH 4HS8L 4DVRL 4J4PD 4X6CA 2W91A 3BKCH 4BSWA 2WM0A 3EO9H 4Y1AD 1H5BA 1RUQL 4F37K 3WUZA 4HG4K 1TJGL 2EYSA 1FPTH 3LIZL 2R23B 1IC7H 1U3HC 1XCTB 1KXVC 4HX1A 5DK3A 5ACZB 3QDJA 4GBXC 4AENB 2OTWB 1FL3A 2CKBB 5EC2B 5D2NE 2QADB 4UMGA 1CGYA 1O7VA 1G1YA 1JGEA 1HINL 1NCWH 2DOCA 5C0DB 3WD5L 1AXTL 1Q9WB 3T0VA 2NY7H 1BVZA 1OAUH 3QHTC 1DLFL 3D2UA 4MD5A 1RJCA 3QQ3B 4CUCA 3GMMA 2OTUA 2VAAB 1JUFB 2N7AA 1OTTC 2C3XA 5EUKA 3EO0B 5T5FL 3BI9X 3BSZH 3UPRA 3HNSH 4UQ3B 1AKJA 3GIZL 4ZTPH 4JQVC 4ETYA 2PCPB 3TPUB 1K6QL 2ATPB 5B21A 5HDBE 4R7NB 1HNFA 3NIFF 3BUYB 4H1LB 1MI5A 4JCLA 5GISL 4X8JB 1FAIH 3GBML 3V6ZB 4RGND 3DSNA 1PZUB 1U8NA 3RZWA 3FT3B 3OSKA 3FOLA 4YX2L 1H8SA 3DMMB 5C70A 2WIIB 3MZTA 5IMKA 3WNOA 4CVWA 2V17L 1VFAA 3QSKB 1MRDL 2OTPA 2APBA 3ARFD 3SGKA 5IFJA 5DJ8B 1HSBB 1KJ3H 1U58B 2X42A 1YUHA 4CVZA 3MRKA 2AJUL 1RFDL 1GGIH 1YJDC 5D9SB 3KWWB 4HS3B 4FQXC 5J89A 1JRHH 4B7LA 4HH8A 1UM6L 5F1IB 5A3IC 3PQYD 3MRMB 3WV0A 3SQBA 2F8OA 4NJAH 3RWCB 4Y16A 4LRIC 1CD1A 4UTAH 2BERA 3RGVD 1QFOA 3I6LE 4JJ5A 1TTUA 2Y5EA 1MFAL 4PRDB 4FQXB 3OXRA 1NEZA 3T0EE 1UEMA 3QO1A 3WKML 1FAKT 2EXWD 4Z8FL 4P2QD 3GKWL 3WE6B 2OR9H 4P23B 5HHME 3IDUA 4MCYB 1ZHKA 2DMBA 2VXSH 4R26H 2OQJB 3T65B 5J1TC 4PJ8A 1MFDL 3CVIH 1YMHA 1ZA6B 4IRSD 5HHOD 3L1OH 4P9MH 4RFEB 4YHYB 5E8NA 3T0EA 1NMCC 4HV8B 1R5IB 2DN7A 5E99H 3P9MB 4ZXBA 1Z2KA 1JHKL 1XAUA 4AJ0A 5IESL 4ONOA 1HOCA 3BHBB 2B39A 4ORZC 1RSFA 1X5FA 1T0NA 1FNFA 1HIML 4XBGA 3QCUH 3BO8B 3QIWC 5DSCA 2DRUA 4XCYA 3VJ6B 1HDMB 4WWID 4IIQB 1Y0LB 4PR5A 3TIEB 2A83B 3BGAA 2BHZA 4RAVA 3SKJH 4ELKA 5SWQB 3LRHA 5IBTH 4HIJB 1QQDB 4OQTH 4CKVX 4W6YB 4M7ZC 3WFDL 5DO2D 4L4VE 4WHDA 1JPSH 1JNLH 2VE6B 5FDYA 1QA9B 4I13B 2ZOKA 4OGYL 3HI6H 3BWUC 3O4OB 3LB6C 4XWOD 5IM7B 3H0TB 1N8ZA 2FBJL 5E6IC 1KPUB 5ITBL 2IQAA 4LSQL 1D3CA 2NY0D 4YFLF 2W1NA 3O45B 4ZFGH 4L4VA 5GSVA 4PRHE 2WV3A 2VLMD 1ACZA 5L2KE 1NBYA 5EH1A 5JZ7C 3EJZD 1NFDB 5GGSY 4YFDB 3RL1B 3DETD 3KPMA 4LDEB 3PWNA 4KK8C 3OJDB 1TJIH 3MBXL 5IBLC 3D85D 1EFXA 2WUBL 4RIRB 2CO6B 1P6AB 2XWJA 5GGUA 2FIKA 3MLUH 3MCKB 2Z93B 4G9FD 4EI6B 4PRHA 5E95B 4I2XE 4NQUA 3PXJA 4I3RH 5L2KA 4NO0A 1WZ1H 4LVEA 2CJUL 3KYMB 4G6JL 4TTDC 1UKTA 2D9QB 1YQVL 4Y4FC 4DTGH 3Q5YA 4JR9H 1HSAA 3GHEH 4I0KA 4UV4L 5LGKA 5FYLL 2J4WL 4D94A 1TVDA 3RQ3A 4YXKL 3O3EA 1KNOA 4I2XA 4OFPA 4PTUA 2C4XA 1JGUL 1I3UA 4RQQA 1BZ9A 5T33H 2NPLX 4Y7MA 2JIXD 1DBBL 4IJ3B 1RIVH 4PJ5D 2ADFL 5DXWA 3MUHL 1NSNL 5FYKH 2Q8BH 1LK3L 4EIGB 4NKIL 3BZFB 2Y6SC 3D39B 2YPLD 5KAQG 2RGSA 3KPRB 2PXYA 3ZE0F 1E27A 4HUKB 5FB8A 2PO6D 3WNNA 4NN6B 1WIUA 4N9OB 5ESQB 1TVBB 5EBWB 1R5VB 4K3HA 3NACL 1C5BL 1G9ML 4RSVA 3MGOA 1Q0YH 5FF6B 4PJAE 2Q20A 4LCWE 4P59L 2Z35A 1H3VA 3QUYC 3MLWL 1JPTL 4PLKC 4DGIL 1S9XB 4XP4L 4YHML 3M1BB 3LPGA 5I8KH 5J6GB 1KC5L 4ZO8A 1JYXA 3K8LA 2AJZB 4L5FH 2H2PD 3WLBA 1G7QA 5K9QI 2XA8L 4JREC 5E5RB 5LKNA 4GAGL 1YEKL 1K4DB 3BW9A 1T2JA 3GDBA 1ND0B 1PSKH 4OV6F 5J57B 3W0WD 3LN4B 3DECA 3RVWD 4C56D 1OGAD 4B0MM 4PJAA 1A6TA 1FZMA 1E4KC 2AW2A 1GAFL 3GSWA 3UTOA 4KQ4L 2AP2A 4N0FB 1JI1A 4S1SH 3AM8C 3GMNB 4NKOB 5LCVH 1AR2A 2E9IA 3JSSA 5B38A 1RZJH 2FATH 2PF6A 4XVUD 1X4YA 3UAJC 1J7VR 4BFBD 1XIWA 3QULB 4KK6C 2VDPL 4UV7H 2VQUA 2NXYC 2I9TA 3RVVC 5EA0H 2J3SA 1RJYA 2CDEB 1MCBA 1ZTXL 4DGVL 2LTQC 3HAEA 3X12A 2A6KB 3U0WH 2EDDA 5MERA 1ZSDB 3WFZA 4I4WB 3B9KB 5DRXB 5LXGL 2CDFA 2E6PA 2FX8H 4BH8A 3MOAH 1JVKA 5IB1A 3MRLA 4LLDA 3O6FD 5HD8D 2LTQB 1CIUA 4J7RA 2VL4A 5F7YC 3I75B 5MEPA 4GLRH 4K8RH 3QRFM 1LP9A 1DLHB 3QPQC 2W9EH 5C9KA 1JTPA 3FOMB 4DVBB 1KN4L 1EMTH 4EDWL 5AZ2L 3IXAB 3DXAD 3PWUB 1OPGL 3MLXL 5TDPA 3C6SA 3BJ91 5FKAA 2KKQA 1EH9A 1DANT 4QY8A 1Q0XH 3Q6GL 4TPRL 5E2TH 1RU9L 1JMXA 3VGDA 4HIEA 1A1OB 2QQLH 4PJ9B 4EEEA 5CZXD 1SEQH 2B4CH 1J0KA 4ETQB 1OF2A 1C5CL 1F2QA 1NLDH 3MLZH 4QCIA 3SKUD 3BZEB 4AK1A 1YJDL 4WWKB 5J11B 1P9MA 2ICES 2Y1VA 4G8IA 2LAAA 5DRWB 2NMSA 1YNLL 4X98A 4P3DA 4M1DH 3U30B 1N6QL 1SJEB 2I25N 25C8H 5IFAH 3DX8B 1EA9C 1RZKH 3CGTA 4JZJA 2PW1B 3CK0H 2MFNA 3UTZA 4DFHA 1LNUB 4QRPE 1MVUA 4XXDB 5ID0A 4U6VH 2FR4B 1D7FA 1CDIA 4XHJD 4KVNH 4NZUH 5C07E 2A0LC 3ARDD 2W0KA 3ARBD 4OLZL 3ORJA 4N8PA 1FG2B 2IBGA 3MREA 4O51B 3DJ9A 1PEZA 4WHTB 3WJLC 2GSIB 5I66A 1VERA 2YZ8A 1ZWIB 1RIHL 1Z6JT 3C9NB 3FN0H 4PJHE 1A02N 3ZE2E 1BIIA 1Y18B 5JDJA 3GKZA 3FAWA 4QRPA 2JKXA 3PGCB 4NQEE 2BHUA 4OZIB 3EOBB 2EKSA 2BNRB 1K8DA 3ARGC 1MHPL 3QFDB 3FB6A 1GOHA 2FO4B 3DUSB 3NZHL 1YA5A 2FZ3B 1Z9MA 4M62H 3GSXA 2VLLA 4OCSH 3MX0A 2W9DL 2GTWA 5DJYA 3RWFA 3TBVA 3WO3B 3MRNA 3PWLB 4I3SH 5LVEA 5KAQF 5JPNA 4PJHA 1PG7X 3TFKD 1B88A 3K4ZA 1CFTB 2X4RB 4NQEA 2EEBA 4DUWA 1FL5B 4G42A 1IM3B 3BKYL 4DK3A 4N5EC 5D72H 3RKDD 4A6YH 3U6RA 3FT4B 1FV1B 3JZ7A 1D6VL 1FNEA 3WHXA 3ARPA 4KZEH 1ZGLB 3OHXB 3UJJL 2ICWA 5FGSA 4AM0A 5EOTA 4PLJC 4IOFC 2HWZL 4WW1A 2ZCLL 1INEH 3SKNA 3UJTL 5AG8A 5IB3B 1MELA 3LKQA 5JOEA 3O6MH 4OZIF 4K23L 4X7CC 4ERSH 2IAMA 5B8CB 3BGFC 4BFIB 4OZGE 1RUAH 4P3WA 3FFDA 2D31B 5BS0D 3QUZA 2VISA 2X4UA 3RU8L 2PETA 5BXFB 5DVMA 1NCNA 3CUPB 3DOSA 5FUCE 4Z78A 2HP4A 3INUL 2YWYA 2BOCB 2CXGA 1DANU 4RFNB 1U8LA 4NO5B 5DFWH 5JW3H 2C1OA 1RHHB 5TDOA 4PPTA 5JLZB 1MIML 5ANMA 4KPHL 2X09A 3F65A 5F9WC 2ED9A 4I3GA 1MH5A 5F7DA 4M9PA 4O58L 5HBBA 4OZGA 4XZUA 3RNQB 2OMBA 3IETA 4LGPB 4NPYA 3TH3T 1W2KT 2FEEL 1I9JH 1HI6A 3DIFA 3SN6N 5HGDA 4ZFFA 4K2UH 5FHAL 5HVHC 4W4OC 3H9YA 4MMXC 3KHQA 2WINB 3VFWB 2ATKA 3REWA 2BMKA 2ZUWA 3N06B 1S9KC 3G9VA 2V5MA 2W65B 3IJHB 3FQRB 3VGBA 1TETH 4ONGL 3DV6A 4QHMA 3V4VL 3GRWH 5HVHB 4NQXB 3QI9A 4LBEB 4GXUN 3RDTB 2EE6A 1CLYL 4ZAKC 1CU4L 4F8QA 3O2WH 2VZSA 1MNUH 3MCG1 2EDEA 2IF7A 3QIUD 2NY5C 1JHLL 4LSTH 1T83C 1TPXC 1IGIH 4OD2B 1QYGH 1BF2A 2DQDL 3ZDXF 4R90H 1JK8A 4QEGA 2ZCHL 4Z76B 1KEGH 1MCPH 2FJHA 2A38A 4PV8B 3TBWB 4NM4L 4PD4K 4XC3L 3ULUE 1UVQA 2ORBH 3QXDB 1E4XI 5FK9A 3A6BH 2QTEA 4NQSA 4Z7OE 1J8HB 2VL5A 4H25B 5C0GB 4U6HA 4OD3L 2EH7L 5DJCB 2AABL 4HWBL 5D4QA 4DCQA 4M6MH 2JK5B 1RK1B 3K2UL 1KTLA 1MCHA 5CEYA 1Q72L 4RA3A 3MV8E 1OM3H 1A6ZA 3SDCA 3VGGA 5D2LE 2Y7QB 4KHTH 1BFOA 1WEJH 1A1MA 4L3ED 4LSPH 1EGJH 4BZ2L 2FX9L 5EO9A 2YSSA 4Y4HA 3QEHB 5KVGL 4HS6A 4HUUB 3VD3A 2X70B 1T5WA 1BJ1J 4LASL 1F3DH 4L8SC 4P4KA 4PREA 2D7PA 4Z7UE 3TYFA 5HHXL 4GW5A 2VO5A 4DKAA 4BQ9A 3BPNB 1S7WA 1WFNA 4BM7A 5FOBB 2GAZB 3AAZA 5CD5C 4JO3H 4UIMB 5EBGA 5D2LA 4JFPA 2QHRL 4OM1L 3QUXA 4JFDE 1GGCL 1X44A 4J4PC 4UT6L 5JOFA 1NL0L 4FTVE 4IOIB 3IS1X 1UQSB 5A16B 1QSEA 4Z7UA 3HMXA 4QWWD 1CFSA 3JWDH 4WIQA 1BFVH 4XGZB 3AS1A 2BNUA 4YDKL 2WP3O 2R2CA 2D7NA 3QA3A 5GRVL 3G6DL 1A6VL 2B2XL 3PG2A 4M02A 4J3UA 4JFDA 4MD0A 4Q9BA 5BZDA 5CS7A 4JG1L 1LE5B 3L3HA 2HFTA 4JPKL 3LQAC 4FQQA 1ADQH 1WZLA 4FTVA 4UQ2A 1GCFA 2H26B 5HGHA 5I1IL 4ONFH 1N3NB 2XQBH 3WN5C 2CMRL 4Y8AA 3T77B 1JHTA 5DZNA 4UT7H 3QEQE 5E5MA 3RWJB 4YHLH 2G5RA 1KXTB 3QDHA 3WFBL 5J1AA 3DX6B 3RHWK 1LO3H 3TO2B 1P7KB 4Z7VA 3EAKA 5BJTA 4MA7L 2X4OA 5I19L 1FL6A 1GIGH 1IEAA 5KSVB 4JVWA 4RGNC 3ZT5A 3AXLB 3C09B 2QSVA 1IAKB 4B5EA 5IMLB 3EYVA 1ZV5A 3FCTB 2VB5A 3QBTB 8CGTA 4K7PX 1UJ3C 3ROOA 3BZ4A 5DRNB 3OGCA 1T89A 4P5TB 5LQBL 2G60L 4HCRA 5JORA 2VZ3A 3D18B 3V79C 5DS8A 2A9NH 1DE4A 3FO1B 3HHRB 2AV7A 3WHE0 2RBLA 3KPQB 4H20H 4E9LA 1CGXA 1I1AD 3WS3B 1S9VB 1YZZA 1ZEAH 4WFFD 4ZUUA 1TZIB 5E2UL 2MJWA 3V7AE 1VEOA 3NIDF 1QZ1A 4LLMA 1FGNH 1NAKH 3TA3B 1FNSH 1S9YA 5MENE 3H42L 2G2RA 4FZEH 4UBDD 2CK0L 3BH8A 3L9RA 3G5VB 5GJSL 1CI5A 3VRJB 1CQYA 3ECBB 5CSZB 1HHGB 3RGVC 1UH3A 3G5ZB 5DUMH 3ZT7A 4AIZA 5GHWL 3MGTB 1INDH 5F1NA 2IALA 1A5FL 2VDRH 1X5AA 2EXWC 4PJEB 4JFOA 4LHUA 3RWDA 1JYNA 1RZIA 5L7XL 3QXTA 1TVHB 3OR7B 4WW2C 1N0XH 2GITB 2DWDB 5KVDL 1FVEA 3DVNA 3GSNL 1F97A 3KNBA 1WAAE 1B90A 2R1YA 1U92A 2X4QA 1S3KL 3FHAA 1DJSA 3UC0H 1CLCA 3G5XA 1WBYA 1IBGL 3WSQL 4GJTB 3TZVB 4TNVF 1SHMA 3NPZB 5L0QC 3QWRD 1EHLL 2OMNA 3SDDA 4GMSL 1GHFL 1J0JA 1LGVA 3GEWB 1QRNB 4OTXL 1OQOA 2ADJB 2AK4D 4PBXA 4JFYA 5D93B 3SOBH 1WAAA 1VEPA 4KY1H 4KTDH 4XAWL 4LU5H 1IGML 3HC0B 3GNMH 2VLJE 3U0TB 4O5LH 4XAKE 3DNKA 1FZJB 1EXUA 3QDGE 4J1UA 1GC1L 2IQ9L 4V2BA 4HXBH 4IS6B 5J3HD 4GAYB 4DZ8A 4WI9A 4D9QD 3LN5A 4PJEF 4WI8A 5GGVH 4B50A 4QHLB 5A2JH 5DO2C 2DQGL 4KRPD 3QNZB 1UC6A 1BFSA 1W0WB 1AO7E 2D7TL 3MRDA 3BEWA 2ZKHH 5D5ME 4XWOC 4MHHG 2CUIA 4PYGA 2VLJA 4OCRL 3WL9B 2KH2B 4J6RL 3TNMA 4CVUA 3QDGA 4YDJB 2J5LC 2ITDA 4QNPF 2IPUK 4HH9A 3IDXL 2VDNH 3KDMA 4EBQH 3D2UD 1TIUA 3D9AH 1L7IL 1XEDA 2XY1A 3BMWA 5F21B 1FDLL 5E2VH 4GW4A 1IT9L 2IPTH 5GGSA 3I6KB 4QXUL 1KACB 1AKJD 1AO7A 2YA1A 3CCHA 2R69L 3EJZC 4UINL 3LKRB 5D5MA 2O5YH 1RZ7H 1YEDA 3WHE1 3MV01 4ZQKA 3VA6A 3DETC 1WITA 1MI5D 1IKFL 4JFQA 1A4KA 5KS9B 2R1WB 4BK5A 1NBQA 4LF3A 1DUYA 4M7JL 5DMJB 2GJ6B 4NC1C 1XF4B 1S9WA 3GM0A 3CLFH 3HZVB 4S1RL 1YYMH 4NKDB 4TVSa 3GJEA 1ONQA 4NWTH 1XF5A 5F96L 2DQIL 4XCFL 4LOUD 4AYFA 4BQCA 2DWEB 4LARL 1YNKH 3CDYA 1MRCH 1VFOA 5EUOF 3D3VB 4YHKL 2CGRL 3ZDZE 1KENL 2NY5L 4JDTH 3SY0A 4MX7B 5I6XB 1OOAA 1PVHA 2C5DC 5EOCH 4HLZG 2WBJB 1MCLA 3R1GL 3WFCH 3GK8L 3CC5B 5KBNC 2P24A 2AKRB 5KG9B 1AIFB 3BPLC 4K3EH 4Y16D 4AT6A 2OZ4L 1JPFA 3E8UH 2ERJB 5I30L 2VIRB 1MJ7H 3Q1SL 1E4WH 4XC1L 5JW4Q 2P8PA 5F9JA 4PRNB 1K4CB 4U1HB 1MIEH 3BGMB 2FO1A 4GMTL 5FO9A 3KYNB 5KS9F 2LFGA 5TE4L 3LD8C 2UWEA 2XZAH 1KCUL 2NTSP 3H3PH 1NC2B 4FFZL 3QG6A 2PO6C 1N5YH 4MAYA 5GGQL 2AXJA 5HGAB 5I75C 4PJ8D 1A7PH 2DQEL 2GK2A 5TE7L 4EJ1C 3FAXA 2XNAB 3IFOB 4WNQA 2OR7A 1D5IH 1LVEA 4HJJH 3C8KA 4JRXB 5I1LA 3BT2L 1R3KA 4ZXBD 2QKIA 2H2PC 2QQKH 4CDHA 4PRAB 1JF6A 5E8EB 2AVGA 2CQVA 4KTEH 3OKOA 5D7IE 4LSDA 5A2IH 3RVWC 2F5BH 1RUMH 3L3DB 2YPKA 4FN0A 1NLBL 1NANI 5JA9A 4HIIA 5J9PA 2H8PA 1AGBB 1NKOA 3FQTB 3WIFA 3HG1A 3MROA 3QFJB 2L0DA 2IADA 5DFVD 3MXWH 4NT6A 2AXGB 3V52L 5AUMA 3GO1H 4XVUC 4TSAH 4QRSB 2AQ1A 5D7IA 1KB9K 5FUOL 5FM5O 4HUWB 3RVTD 2YOCA 4JLRB 4GKOA 5JDSB 4Y5YC 1DL7L 4KQ3L 1FNAA 3IXTB 5EBLB 4BKLA 1HNGA 2O26U 5I0DA 4A2MA 1CTNA 2BFVH 5GS0D 4S10A 5H2BA 4KU1A 3VXTB 3BIKA 3LQAL 2BVOB 5FO7B 2ZCKL 3LDBB 5MEQA 7FABH 4ZOBA 5DHVH 5CJBA 3IFLH 3EZ8A 3MR9A 2UYLA 3O6FC 4NNXB 5HD8C 1NAMB 4MJIE 2P5WE 1X5XA 3QDAA 4MJ5B 1LMKA 4XCEB 5E1AA 1B0RA 1YY9D 4MNGE 1P53A 1EFXD 5CILH 1OAKH 3VFMB 1C7SA 2OJEA 5JNYA 1UH2A 2EC8A 4HKZB 2B1HL 4HKJA 2VXTL 3V9FA 4PRHD 1Z0NA 4F7CB 4PJXB 2QEJA 4F33A 4J12A 4NO0D 2DTML 2JCCB 1ETZB 1FFNB 4WFGE 4MJIA 5IK3A 3O4LB 4ZUSA 2P5WA 2VLRB 4M6NL 2W92A 4MNGA 1L4IA 4FNLL 5CZXC 1E6OH 5JQHC 1HHKB 2XA3A 1T20B 5TQ0H 3B8YA 2NR6D 4ZUVA 4YNYA 4J3VA 1L6ZA 2CIIB 1NCAH 2H9GA 1A22B 3ARSA 4YBLB 3VGAB 5E8PA 3G6AA 1N5AA 1EJOL 1HXMB 5CIPA 3RJDA 1II4E 1OP9A 1YECL 4M8QA 1B6DA 2EDOA 3RBSA 3S7GA 3QO0A 1JBJA 1OW0C 2ED8A 1I7RB 1P4BL 2FL5A 5DR5L 4HULB 2PXYD 4XHJC 2XTJD 3ALXA 5DTFA 1AY1H 3ARDC 5FYLE 3ARBC 2V6HA 1IJ9A 1GXEA 4YO0A 5EU3B 1A9BA 1K5NA 1HKLL 3FB7B 3WMSA 4PJXF 5FHBL 1CL7L 1A1NA 1PX4A 1JNHB 1A7RL 1CE6A 2JJSC 3MRCB 4YHPA 5D96C 5GGTH 4F3FB 3HC3L 4X6BB 2XWTB 4LDLB 1CT8B 1IEBB 5SWSD 2AEPL 2V7HB 3HB3D 3M8OL 1NFIA 3QZWA 1U8IA 1I3RA 3FB8B 2DYPB 4ONHA 4NNPL 4NN7B 3VFNA 4GRWH 4AEEA 4HKBB 4LVHB 4OUOA 3ZKNC 15C8H 3OF6A 4JQXA 3TFKC 1AHWB 1WUNT 4CL7A 3DROB 3T4AA 1GGTA 4P3CH 4OFVA 3KLSA 3KPPB 1IC5H 3MLSL 2ICEA 5I1GH 1Z9SA 5DDHB 1KJ2H 3KJ4B 1XIWD 1WK0A 4NHUA 5F1OB 5BVPL 1I3GL 3SCMD 2EYTA 2GJZB 2UZXB 3JUZA 1I1CA 2H1PH 4QRTA 2V7NB 2R4SH 3NIGF 5CGMA 1UWGH 1RZFL 2CLVB 4A6YB 4OCYH 5F3BB 4NSKB 2LU3A 4FQ2H 3S5LA 3V0VB 2C3VA 5C8JA 3B2VH 1SM3H 4M5ZL 3SDYL 4L8BB 1S7QB 1I7ZB 4KKCD 4AQ1B 3ABZA 5TDNB 1E6JH 5I1CL 3JTTB 4S0TD 5I2IB 5JA8B 3Q5OA 2AEQH 1UKSA 2R23A 3B4NA 4I18C 1T7YA 4XPFL 3F58H 3LS4H 1XCTA 4P4RB 1N4XH 5FV1L 3HCVB 4BZ1L 1BLNB 4AENA 1ZANL 2OTWA 3QB7C 4NRYB 2CKBA 5EC2A 3S98A 5IWLC 2H32A 2MPAH 5IQ7L 1B4JH 3HPJA 1OAZL 2WW8A 1IE5A 1S7VB 1MY7A 5C09E 3BH9B 1M4KA 1FVDA 3IDIB 4LAQL 1A64A 1H15B 5B39G 2ESVB 3CFCL 3CFIC 2I9LB 1QKZH 4EUPA 4MA1C 1U2CA 5C08D 3KPNB 1U6AL 4WI6A 4GBXA 1T7ZA 5DHYB 1TMCB 4LQFH 1JUFA 3RIFK 1TTGA 4HW6A 3EO0A 5EZOH 3NGBC 4HG4J 2I27N 4PG9B 3EYFA 3TPUA 3L5JA 2Q3ZA 3U36A 1T4KB 3HS0B 2ATPA 5C09A 3TV3H 4R7NA 3BUYA 4H1LA 1WFOA 1OSPL 1CS6A 1ZLVH 3V6ZA 4E41B 4N9GB 3NTCL 2P49B 5I8EB 3LMJL 1FZKB 4JRWA 1EO5A 4RMQA 1CDJA 4DAGH 1BVLB 3QIUC 4N0UB 5ALCL 4MXWL 4JQVA 2WIIA 5ELIA 3BN9D 5JXAL 5BMFH 3LV3B 5DJ8A 1HSBA 1R3JA 4G6AD 5K59F 3R0MA 4YFLI 1MHHB 3GSRA 4ISVA 1BBJB 5D9SA 3K1DA 3CIQA 1CFNB 4F9PC 3KWWA 4HS3A 2GKIA 4R9HA 1O7SA 5ITFB 4PJBE 4G80B 3HMWH 1QBMH 3MRMA 3TBSB 1HH6A 1J1XL 4QRPD 3RI5F 3T2NH 2FLBT 1IRAY 5HYEA 5IROA 4ENED 3RWCA 4OZFA 5C3LD 3HI5L 1NCDH 1QLRB 1QBLL 1A6WH 1RMFL 3DRTA 1U95B 4FQXA 4C4KO 3TCLB 3ZYOA 3VWKB 3TT3H 4AEIL 3WE6A 3MRPA 4GRLB 5JPMB 5HDQH 4WHCA 3X11A 4MCYA 1K9TA 4OLXH 4LRIA 3VXNB 4OB5H 2OQJA 3T65A 2IMNA 2DDQH 3NFSH 4R97B 2R2BB 3BOVA 3MA9H 2GTZA 4NM8L 1S78C 4PBWD 4HV8A 2IG2H 3VFRB 2DJSA 2NZ9C 1IAMA 1CE1H 4U2YA 4RCAA 4QOKB 3VXOB 4U1KA 1N59B 4ZO6A 2XFXA 1S5IL 3BO8A 3BIBX 3FO9B 3VJ6A 1HDMA 1NAML 1CFQA 1I85C 4IIQA 4PGJA 1Y0LA 1DSFL 4Y5VB 3TIEA 2A83A 1CD0A 4QWWC 5DHXB 3QUZD 4HPOL 4HIJA 3F12B 4M00A 3L3GB 3B2UD 4Q9QL 3T0BA 3H3KA 4G8GB 2FIRT 5SWZE 2NY2D 5KOMC 3VXRD 2XRAH 1QA9A 1G9NH 1MFNA 5B39B 4KJYB 1Q38A 1R3LB 4XBEL 5EZLB 3GIVB 2Y72A 1NFDE 2AXFA 3MV9B 2Q6WB 5IM7A 3FQUB 3H0TA 3TH4T 4JHWH 1HHJB 3UO1H 4PRIE 1KLGA 1CTOA 4PJDB 1KPUA 1JCKA 2XZQL 5IGXH 1CXKA 3I9GL 3DVFA 3ZE0E 4JDZB 4M7LL 3WXVH 3EYSL 4U1LA 3O45A 3QG7H 4TVPD 4KFZC 3ZHKA 1MCOH 1OL0A 4XNXH 5J12B 5IHZB 2FD6H 4NRXB 4KVCH 1NFDA 1CDUA 4HUMB 5IB4B 3SE9H 3RL1A 4HT1H 1OP5H 3O8XB 5I1EL 2OR8A 3O0RL 4F37F 3OJDA 1WV7T 2X89D 5F93C 2OX5A 4KDTC 4M1DL 3EO1B 1TQCC 3MCKA 2Z93A 5HHVL 4EI6A 5D1QB 3O3DB 1NBZA 4P49A 4L3AA 4XPGL 1I1AC 3KYMA 3LCYA 3P4NB 4RISH 3C08L 3V6OC 1KCSL 1B0GB 1NMAH 4M48H 4ACPA 4PJDF 3D39E 4GOSA 5FCSH 3RUGB 1ZHNB 3DVIA 4YGVB 3O2VL 3S34L 2N4IA 1MRFL 4UBDC 1YEJL 2X9WA 1DVFB 1MLBB 1XCQA 1KGCE 4P2RB 3NVQA 5IJKC 1FO0L 3FN9A 1AD0A 5CWSA 5DQ9A 3CJJA 1MVFA 3E6HB 1KULA 1N26A 3BZFA 3TBYB 3D39A 3KPRA 1N64H 2YEZB 1ZVYA 1NGYB 3ULUD 4YDLB 1A0QL 4Y4HD 4N0YL 3CX5K 2IH3A 1Z9OA 3MLRH 5ESQA 1TVBA 3Q6FB 1R5VA 2NZIA 4JZNB 4WFED 4GQPH 5C7XL 4P4KD 3VFGL 5KTEL 5FF6A 1F8TL 3RAJL 4L4JA 3VRIB 3D69B 3LKNA 1IAIL 4YIQB 1BEYL 1S9XA 1J5OL 2ARWA 3M1BA 4WTWA 2P5EE 5J6GA 2M26A 3FO2B 4YPGB 2DJUA 3RUGF 2AJZA 5FA3B 3QUXD 3IDJB 4FP8L 3V5KA 1MWAH 3CVHB 4JANB 5DQDL 1M7XA 3T3PF 1NCUA 3FZUD 1ND0A 4XP1H 3VG0L 3LN4A 1WBZB 4NZTH 1SBSH 5FM5M 2YPVL 4FMKA 4K7FB 4HWBA 2PYEB 1H5BC 1QSED 3S96A 1KB5B 5CZVH 5J3HC 5DEFA 3MYJB 3RKPA 4OBSA 4KRPC 4N0FA 3GI8L 1KFAH 3BDXA 4NKOA 4JFDD 3N1FC 1X5GA 4P5MA 3VW3H 3ALPA 2BVYA 3CPLB 5GGRB 4Z77A 4RGOH 5A40E 3HUJE 1LEIB 3QULA 1J12A 5CJ8A 1D9KB 2FGWL 4HIHB 1E4KA 4JKPL 5EPMB 2CDEA 1DQLH 4JY6B 2DTSA 4LQ1A 1UA6L 4CBPA 2A6KA 1CQKA 1HH9B 2J8UB 1ZSDA 1WSST 1A14L 5ISZB 4I4WA 3AM8A 5KJRH 5DRXA 4U7MA 1IC1A 4NIKB 3MRBA 4I9WE 1T7WA 3K46A 4HJGB 5CEZL 3UX9B 3V0WL 4ORGB 1S7UB 1NKRA 2P44B 3LSOB 3N85H 5GJTL 1Q1JH 5C6TH 3I75A 2F54B 1XH3B 4W6XB 4U1JA 3O6KH 1YMMD 3VXUB 1M7DB 4RWHA 1DLHA 4XMLL 2AS5M 4URTB 3FOMA 2X9YA 4DVBA 4NQDB 1N6VA 5FEBA 5BV7C 1X5IA 3FMGL 4LOUC 5FFLA 3PWUA 4X6EB 1RAMA 3SGKC 2WWKO 4KUCF 1NGXB 3BJLA 2HN7B 3K8KA 4LFHD 4AH2B 2HFGH 3PHQB 2V2TB 4N5UA 3B6SA 3RWGA 2B20A 4F80A 3QQNA 2J8UF 4ZUWA 4F57H 2XN9E 2BXZA 3CFDB 4AMKL 1JWUA 2GK0A 4WI3A 1NCCL 2HRPH 4ETQA 3EDKA 2MQ3A 4TULH 1J1PL 2JJUA 5ACMA 4BH7A 2XPGB 3CH1B 4Y16C 1GZPA 3MOQA 3BZEA 5DRWA 4JFFB 3VMNA 2RIKA 3S4SG 2WK2A 1RHFA 1SJEA 1I8LA 2MHAB 2P47B 4Q6IB 3TN0B 1QFWH 3IU3B 5I74C 3DURA 2NY4B 2PW1A 4U31A 3AS2A 3UJIH 5KZCD 4LHUD 3ZE1E 3QPXL 2XN9A 1X6LA 1LNUA 2X40A 4XXDA 3UBXG 4WUUE 1ZGLM 4L8DA 3M07A 1FG2A 1G6RL 4PJ8C 3D5OF 3T8XB 4O51A 1OD9A 4WHTA 2AGJH 4RFOL 2HKFH 2GSIA 1T6VN 4HUVB 4XMPH 3BIAX 1KTDB 1ZWIA 2MOVA 3CFBA 2W9LA 5AG9A 1BX2B 1LD9A 3SDDD 2VDLH 2UUDH 2ICCA 4JFHE 4YUEL 1T1ZB 5DQJB 1PZ5B 2YD2A 1PDKA 4WUUA 4LPCA 5IMMB 5I1HL 3EOBA 2W38A 5CP7B 1CVSC 5E4IA 4QRUB 3TVMB 3QFDA 3WJLA 2HKHL 3CU7A 4MWFA 1UT9A 2FZ3A 2ZG2A 2PN5A 3NPSC 2EDTA 3PWLA 4K55A 3O11B 2BK8A 4EI5D 4U7KA 1F6AB 1JJUA 5AAMA 2X10A 3P30L 3DO7B 2HFEA 5CCKH 5DFVC 4GT7A 1CFTA 2X4RA 4TN9A 2EEDA 1AXSB 5T3XD 3RFZC 3ARRA 1FL5A 2LVEA 2XIDA 3GSNA 3FT4A 4ZS6D 1NPUA 3RVTC 1B4RA 4NP4H 4Z7NF 2CPCA 4XWGH 4XAKD 4LKXB 3OHXA 1GGYA 3QDGD 1ZGLA 5GS0C 2OSLB 4RAUB 1M6OB 4XP9H 4TOYH 1J0HA 2PTVA 4X80H 4X0KB 3L3JA 4JFEE 1MCEA 2FRGP 3WFEH 3BAEH 4ZFOL 3PUCA 4OF0A 5I8CB 5IB3A 1KEMH 3EOAB 1PW3A 2X1WL 1JPST 1FYTB 4OIAA 3UYPA 1LO0L 5B8CA 3O9WB 4BFIA 4V1DE 3ULVH 1JGVH 4GW1B 4KKLD 3ZDXE 5GS1B 1KTRL 3OGOE 2D31A 4XNYL 2F53E 1DEEB 3ULSB 5BXFA 4QT5A 3VXMB 2DLEA 3CUPA 3HR5B 1YY9C 2RCSH 4PGDA 4NFCA 2OL3L 5DHVB 3QCVH 1RHHA 5JLZA 1G7MB 3KR3L 1OAYL 3GB7B 1JGLH 4G5ZH 3L5XH 3H9SD 3BDYH 1IAOB 2XWBA 1OP3H 4V1DA 3RNQA 1XZ0B 1KUMA 5E1HB 1UXWB 1BD2B 2DM7A 2F53A 2YA0A 2V9TA 1W8NA 1CF8L 1OCWH 4JRYB 1A2YB 1NCBL 2ZUVA 2DL2A 4OF5A 3MRJB 1BWMA 2WINA 2R8SL 4U1IB 3HLAB 4JO2H 4KUZL 4NQCB 3HNTH 3ZL4L 3P4MB 3RVXD 5DD0L 4K3DL 2NR6C 1P4LB 4UIKH 5F6HJ 4N8CH 1W0YT 3S4SB 1SEBB 4L8CB 3IJHA 4LSVH 3FQRA 5GZND 1MHCA 5SX4H 3D6GA 1FGNL 4DW2L 3OJVC 5HY9B 1T80A 2E8YA 3MV7E 4NQXA 4LBEA 2A6DB 4NJ9H 4W4OA 3SGJA 3MLVL 5C0BB 1WZMA 4LSUL 1CDYA 4K94L 4ODUB 3UBXB 4ZPVB 3BQUB 4GAJH 2FGZA 1VB9A 2PXYC 2MMXA 2XTJC 4RAHA 2CUHA 3EYOB 3S88L 3JTSA 2MWCA 1PQZB 4P2YA 2Q3AA 4ODSL 1YEFH 2WWKT 3BPOB 5CBAB 4EN3B 2DLFL 4X6FB 5TE6L 1LO5B 4OD2A 4X5XA 2B8OT 1XR9A 4L3CB 4CNIB 3MV7A 2F19H 4NZDA 3PV6B 4NZRL 3UYOD 2W59A 3MNZB 5D7KD 4XNUL 3RIAF 3QRGL 2D9CA 1U8MB 3HRZB 3HB3C 5IVOA 2VDQL 3CVHL 3ZDYF 4KK9D 4OSUH 2L7UA 2Y06L 3TWCL 3VXSB 3S35H 1AE6L 1J8HA 1T83A 3GHBL 4F2MB 4H25A 5C0GA 3BMVA 4GUPB 2EIDA 3F7YB 4PS4L 5L9DL 2ADGA 5H35B 1KB5L 4U6XB 4I5BB 3STZB 4UTBH 4CMMA 4F58H 2DQUL 4R0LB 2GT9B 3OB0K 1ZLUH 5JOPE 4U0RB 2N56A 2Q7NA 2VAJA 4M6AA 3H2WA 3HG1D 1DQDH 2OXHA 3SDXE 3IFPB 3NH7H 5LWYH 4GRWB 4E5XB 2B1AL 3U0PB 1ES0B 4PD4J 4DFIA 2X70A 1UFUA 1XIWC 3X3FH 1XGYL 4MVBD 1CCZA 1U8PA 3SCMC 1JZ5A 1G0DA 5KVEL 1B0WA 2FYYB 5C9JB 2GQHA 4HC1H 2GAZA 4LEOB 3WUWG 3P40A 5EC1B 4JB9L 4P46C 1LDPH 2ARJQ 3AY4A 4N0CD 5DJ6B 3GMLA 4YBHA 3EUUA 4QHKJ 1KJ2B 4WJ5A 5JQ6L 3SDXA 5FYJD 5BRZB 1CICB 4NO2B 4KKCC 4Y1AE 2J8HA 1AGDB 3OB8A 1FH5L 4IOIA 1UQSA 5A16A 2J6EH 5D7LB 3SO5A 4XGZA 1UYWL 1TZGH 3B5GA 4P46B 2A6IA 4O4YH 5TF1L 5ADPL 5IB5B 5EU6B 1LE5A 5DK0A 1WWAX 4J4PA 2VC2H 1FE8H 3TO4B 4MA8H 5TQ2L 3SE8H 4OLYL 4GRWF 3KXFB 2EO9A 4MB4A 1FGVH 4MD4B 4XPBL 1HILB 1UB6B 3U7AA 2YD7A 3T09A 1NUFA 3T77A 2QSCL 3BKMH 1TQBB 2YKLH 1ED3B 3ET9F 3RWJA 4KRLB 1JRHI 1FFPB 3DX6A 3KGRA 3MCLL 2HFFA 1SJHB 3TO2A 1P7KA 1P9MC 2QJDA 1XGTB 4DZBB 3L5HA 1JGDA 2MCG1 4HQQL 2UZIH 4RGNE 4WFGD 3WN5A 4OJFH 5KSVA 2R1XB 4XB7A 1V05A 2AK1H 3AXLA 3ETBF 4HWUA 3TLRA 1IAKA 5IMLA 3FCTA 1DQMH 3QDMD 4LRNH 4CU6A 2BDNL 5DRNA 5FYKU 3ZTNH 3I6GB 4P5TA 2NY3D 3BN9C 3ARQA 3NZ8B 3D18A 3PWPB 4N1CA 3FO1A 3VXPB 5D1XB 1DDHB 4G6AC 3KPQA 4XNZB 1FORL 2ARJB 4O00A 1INQB 4JFZL 5FXCH 2E7LC 3WS3A 4NBXB 1TZIA 5LGJB 5E6YA 3SJVD 3RNKB 4G7YL 3PP4L 2QQQA 3ZKXC 4ZO7A 4ENEC 1MPAH 3G5VA 4CADB 5FYLD 1YY8B 4TSBL 1F6FB 3VRJA 4CN1A 1G9EA 1HHGA 3G5ZA 1LE9B 5J56B 2YRZA 4YXLH 1IFHH 4WO4B 1BQLH 5BQ7B 3HFMH 1SQ2N 3LRSB 4K71C 4P57A 4RRPG 3I85A 4LSRL 1IQWH 3IVKB 1Y6NR 5BV7H 4UB0L 3CSYB 3OR7A 3SPVB 2GITA 3S3PA 2DWDA 3X14A 5DJ0A 3VG9C 1QUNA 5HHOE 3RGVA 4XVSH 5FDWB 5C2BH 4X7SH 4JPWH 2APFA 1FJ1A 2C3GA 4