1RJCA

Crystal structure of the camelid single domain antibody cab-lys2 in complex with hen egg white lysozyme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
123
Chain Sequence
VQLQASGGGSVQAGQSLRLSCATSATSSSNCMGWFRQAPGKEREGVAVIDTGRGNTAYADSVQGRLTISLDNNTLYLQMNSLKPEDTAMYYCAADTSTWYRGYCGTNPNYFSYWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords camelid heavy chain antibody
publication title Strong in vivo maturation compensates for structurally restricted H3 loops in antibody repertoires.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Immune system/hydrolase
total genus 29
structure length 123
sequence length 126
ec nomenclature
pdb deposition date 2003-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rjcA00
1OQOA 1PY4A 4H1LH 5BZWB 4PGEA 2P44B 1N8ZB 3SE3A 3T2NL 1WCBA 1YEKH 3H7BA 4PGEB 2ZWLT 2CK0L 1CTNA 5E1HB 3MUHL 3H7BB 5I66A 2OI9C 3HCVA 2CKNA 3IJHB 4M5YH 4I3RL 3SDDA 1TZGL 1XGYL 4KXZI 3QI9A 3R8BB 3EOAA 1AJ7L 3A6BH 3SDDB 5FUOL 3D5OF 1EV2E 3HPJA 3HR5B 5C09D 4LKXA 5C6TH 4PJIF 5JXAH 1HHKB 1MCCA 3PGDA 3BPNC 1SM3L 1T21B 4LKXB 2V7NA 1HWHB 1F58H 1ZGLP 4CVZA 5D70L 3UTPE 3BKJL 5J1SC 5HY9B 4I18B 4JFPB 1CICC 2R1WA 2MQ3A 4NP4H 2HWZH 3FB5B 3V7AG 4J8RA 3CDGB 4Z7QE 2X9WA 1EFQA 2R1WB 4ZTOH 5F7LB 2BNRB 4J8RB 4HQQH 1EAPA 2AJUH 4P4KC 5TF1L 1M7IA 3PL6B 3B9KA 4BQCA 4Y8DC 3O6ML 5BS0D 3B9KB 2IPUG 4ODSH 1U8JA 4JFQA 4PG9A 2PXYC 2WBWB 3QEUA 5D1QB 4X6BA 5IBLC 3OKMB 5DR5L 5CGYD 5JOFB 2CR6A 3W0WA 2Y1VA 1H0DB 2YA2A 2D9QB 4QGYA 5JA8B 1FLRL 2LABA 2GI7A 3QNXB 4R96A 2YZ1A 1Q72H 4HS6B 3S97C 1CIDA 1MCBA 5AD0A 3EO9H 4P9HH 2K1MA 5ITBL 2EDRA 2VE6B 1FGVH 1XGQA 1T5WA 5DEZA 3I6GB 4YBQC 4Q0XH 1MCEA 3VXOA 3ZKND 1BZ7B 5HI4C 1KBGL 4Z7NF 2X4NB 4KU1A 1O5DT 2BXYA 1H5BC 4YAQB 4ALAL 1DQJA 3MLVH 3CFBB 1AFVH 2FGZA 2XOTA 4IRJD 4OZHF 5E8PA 4P2OC 2P7TB 3AFLA 5C08A 1GYAA 4YHMH 3RVTD 5I1KH 2J8UE 3PGFL 3DVNA 3TBWB 4WEBL 1N7ML 3VWKC 3DMMA 3OR6A 5IUSA 1QQDB 1F8TH 1AGCA 1CVRA 5J3HC 3KLHD 3LD8B 3MGOA 5IK3A 4RGMC 3P3YA 4XAWH 4G9FE 3MGOB 3VFSB 3NGBB 5T3XL 3P11H 5IK3B 1FIGL 4G6KL 5HI5C 4NWUH 1YY8A 1LDPL 4R4BA 4XCNA 1UEMA 5CCKH 3F65A 5HGAA 4P3DA 4R4BB 4N0UA 3SDXA 2XZCL 2DICA 4G6JL 4KKNA 3GSXB 2VL5A 1QSEB 4P3DB 4HKJA 4N0UB 4DEPC 5D1ZD 5H94B 1T2XA 2QHRL 1G7PA 4LHUB 4ZAKD 4HKJB 15C8H 3A67H 2R69L 2DLHA 1HHGA 3L7EB 3QFJB 3T65B 1YZZA 2Z4QA 5HVFB 4OB5H 1N6VA 5D7LE 4S1SL 3CZFA 1XIWA 2Z4QB 4OIIH 4GQPH 1RIUH 3U0PA 4NPYA 2A6IB 2E9JA 1XIWB 4M6OL 4MHHG 2VXVH 3G5VA 3NA9L 2QADC 3PWVA 4Z7UA 3G5VB 3H0TA 2B39A 1UM4L 3QZWB 5DQDL 5D7JA 3DYPA 2XN9E 1CGWA 1MH5A 4AT6B 2BHZA 3VXMA 1ZVSB 2J3SA 4NBZB 5J1TC 3TBSA 1ZT1A 3ULUE 1QOKA 3VXMB 5CD5C 2AJVL 4L9DA 1C5CL 2BERA 3KPNA 2P5EE 4D0CA 3LSOA 1GPOL 3M8OL 3VWJC 3WO3B 1DVFB 1FN4A 5I75C 3FB6B 1GGBH 1JWMA 5D7IE 3LSOB 3G04A 4RAUB 2ATKA 1BM3L 1JWMB 3G04B 5FEBA 2BRRL 2ATKB 2F58H 2AEWA 4PGJA 2EDKA 2FB4L 3FRUA 2VLJE 5HD8C 4WO4A 2F5BL 4DGYH 4QHLA 4N8VG 4WO4B 1DBAH 5B4MD 4Y4FD 2AEIT 4EUPB 5FHAL 1T1ZA 2CXKA 4L4VD 5HGGS 1T1ZB 4V1DB 4ENED 4UU9B 4JO4L 4M1CC 3F7YA 5EZLA 4UTAH 4WTZA 2PYEE 4F3FA 3BIKA 3FFCD 5GISH 4P9ML 2A77L 1NCCH 1HZHL 2AEQL 4LFHD 2GK0B 1I3GH 3KPRA 4KK5D 4YFDB 3UTSA 1JPGA 5EOQL 3QUXC 1P84J 3KPRB 2JCCA 5FGRA 4IIQA 4X5XB 4CN6A 3DIFA 4ZDHA 1S7WA 1CGSH 2JCCB 4ELMF 4IIQB 4M62H 4ZDHB 1MCOL 1MIEL 5E0QA 2DQEL 3U7YH 3SDDD 1LO2H 5E8EA 4GKSB 3QI9D 1NBYB 3OG6B 2E7LA 1HHJA 3QPQC 4ZO6A 1EGJH 3QCUL 1HI6A 4HK0A 3T3ME 5LWYL 3O2DA 4I4WB 1FHGA 1HI6B 2CDFB 4HK0B 5IG7B 4ZUSA 5LGKA 1IGIL 5EC1A 3IFNL 2FRGP 4GMSL 2XRAL 3QFDB 3V95A 1CR9L 3L3DA 3GIVB 3QAZC 1LEGA 1TVHB 3VFPB 4QHMB 1FFQA 3SO3C 5GJTL 1JUFA 2UVFA 1LEGB 1ZLVK 3PL6D 3HZKB 2WWKO 1JUFB 3D69A 1A6UH 1SEQH 2V5TA 3B9KD 4WW2A 3UJJH 2NY1B 5EIVA 1AGBA 3ALPA 4WW2B 2FHFA 4WW1B 1WT5C 1EVTC 4NFBA 3HB3C 2Q8AL 4G7VL 2BY2A 1I1RA 2APXA 3FHAA 4MNGE 3MV8E 2X4PB 1FYTE 2VDQL 5TDPA 4HW6A 2GJ6E 4IM8A 5F88A 4O51B 2ARJA 3EJYD 3K4ZA 3V0WH 1DE4B 5A2LH 5K9OA 2EICA 4KDVA 3C8KB 5DC0A 1OAYL 1FFRA 1I7TA 1CZ8L 2Z31B 4PPTA 3HPLA 4ZODA 3T0DA 4N90E 4YDIL 5ISZE 3V5HB 1GZPB 4D3CL 4OI9A 2HVJA 4ORGB 3NA4A 3F5WB 5JOPD 3HPLB 4WVRA 1D9KB 2CRZA 3OAYH 4TNVF 2VXTL 4IOIB 4IDLA 3V4VH 4KHTL 1P2CA 4NQDA 1AH1A 1ROWA 1XGTB 5C08D 5CSBA 1EH9A 5DVOA 1P2CB 4OCRH 5TE6H 4NQDB 3QIBB 3TJHC 5CGTA 1KEMH 3BAEH 5JHDB 5KTEL 4TULL 2QSCL 3L5IA 1IMHC 4PJFB 3GNML 4HZLB 3MRGA 1P9MC 3HE6A 4MCYB 4OBSA 4RFOH 3T2PA 1A6PA 5D9SB 3HE6B 3BZEA 1R5VA 2Y7QA 3TJEH 1BFOB 5FM5M 3PUCA 5F7UA 2ZCKH 2GAZA 3KPLB 5DJCA 4L3CB 1RU9L 4HDIA 4HIEA 3VXSE 4D9LH 2GAZB 4XCEA 4XMKL 3GDBA 3I75B 3VRJA 1YY9C 4DGVL 4N8CL 2NY4C 2ZKHL 3VG9C 4L1DA 3VRJB 3WIHA 5EBLA 1DQMH 2OP4L 1AGEA 1RZ7H 2VXSL 5LBSL 1N2RA 2VDNL 5EBLB 4JZJC 2YXFA 3LKRB 4UT6L 5AUMA 1N2RB 5T1DL 1WIUA 3WHE0 3ZHLA 1RJYA 1F90L 1RSFA 5C7XH 2F53E 4UI2A 1XIWD 2BVEA 3HLAA 4H26A 3TBVB 2YXMA 2D4DA 1KFAH 5I8KL 1RAMA 2OM5A 4H26B 7FABH 3OZ9L 1NAML 3LIZL 3RTQA 2CQVA 1C7TA 3FONB 4JPIA 1YEFL 1MCPL 4AEFA 35C8L 2VDPH 1A6AA 5D7JD 3SGEI 5KS9E 4N68A 3PQYE 4YC2B 5F7YC 4KKLD 3VXMD 4HFWB 1FLTX 2APVA 2BVPA 2P45B 4UQ2A 1YNLH 3QDAA 4GSDL 1MFDL 1F4XH 2DI7A 4UQ2B 1HWGB 25C8L 4X83A 4CDGC 3FRPA 1KJVA 3N50A 1S5IL 4WIQA 3SGDI 2GUOA 1VCAA 4N8VB 4X8JB 3VGDA 4UT7H 4NRXB 5GRZA 3IJYA 1HINL 2VLKE 4RAVB 1J1PL 5JORB 2BK8A 3O9WC 4WO4D 4G80A 5FYJH 3DV4A 4NGHH 5E2UH 3KLAA 3EDDA 5A16A 3TBTB 3RGHA 4HUWA 3H42H 4RGNB 3KLAB 3P9LA 3ARFB 4KY1H 4WNQA 4E42B 3JUYA 1KCRL 4GRLA 1S7QB 5EA0L 3Q5TA 3KYOA 1AO7B 1SJEA 4PJ9A 1A3QA 1EUTA 4GRLB 2NXYB 5C8JB 5EDXA 2FD6H 4WI2A 4EJ1C 3DECA 1ZGLA 5ECJE 2FEEL 4YK4B 5FUZH 1JGUL 1ZGLB 3KPRD 1PLGL 2AK4E 5CEZE 3UTSD 1MHEA 3Q5YA 5DVKA 1R3KA 1NGWA 4K3GA 1RHFA 2QQKH 1G9NH 5TPWL 4YX2H 1R3KB 1KIUA 4UOJA 5JOEA 4WY7H 5FB8B 2ZCLH 5IBTL 1E6JH 3O3BA 5D1XB 4EOWL 3DUSB 1AKJA 2ENSA 2E9BA 4LMQI 3RDTB 5I0DA 5DMKA 3O45A 5TQ2L 4LNVA 4ZSOA 4JJHA 3TC9A 5DMKB 2CIIA 4P3WA 4JO1L 4ZSOB 5HVWA 3ARVA 5BMFH 2OR9H 3TYGL 3SKJH 1G7QA 1CFSA 1ED3A 3WV0A 2Y6SD 5I15H 2VTFA 3J8F7 1M7DB 1T83A 2BDNL 2MFNA 5BV7C 1S7VB 5C86A 5IJVB 2CPCA 2CJUH 3I84A 1IGTA 4MA8H 4RSVA 1XGUA 4WUUA 1S7RA 5SWZA 1B6DA 2R0ZH 2F15A 5C2BL 3DTXB 1IGTB 1XGUB 4WUUB 2YD4A 1S7RB 1RZIA 2XZAH 1FAIH 1BAFH 2X4RA 5EU6E 4X7FC 2FEDD 4P5TA 1OW0C 3IFOA 3CMOL 2GJZA 1RZIB 5D6CA 1UFUA 4Y5XA 1Y18A 2X4RB 4HWBA 4LLAA 4P5TB 3OKLA 4RBPH 1QVOB 2GJZB 4LVOB 5HYQA 3U1SL 4RMQA 4M3JA 4KRNA 3LQAC 1M05B 2FBJH 3EDKA 5HYQB 2W0FB 2H9GA 1UB6A 4JM4L 2FEEI 2C7UA 5IMOA 5IGXL 2C7UB 4WCYL 1ZLUH 4GUPA 5GS0H 4O2FA 3AC0A 2YRZA 3MRCB 5D2NB 3GKWH 4O2FB 4QHUA 2N56A 5HYJE 2IALB 4MNHA 2DRUA 5DQJB 4FQ1L 4I2XE 1OTSD 4L8SB 5FM8A 1IARB 4MJ6A 3VFRB 2GSGA 2D03H 2Q87A 3KR3H 4G6AD 4GW4A 4I77H 5ADPH 1YJDH 4HS8L 4NQDD 1VENA 3HMXL 3RVVC 4GW4B 4KAQL 4XP5H 5JHDD 1ZLWH 3WL9A 5HPMA 5ILTH 4HT1H 3NPZB 3BMVA 5E2JA 1MHHB 5HPMB 3KDMA 1NLBH 4FQHB 3MA7B 4ZMAT 2EXWD 2H6PA 3HE6D 2ZUSA 3B9EA 3CSYA 4MA1B 1GC1C 1FG2A 3KYKH 3LPFA 4NQVB 1K8IB 3CSYB 1NGXA 2LAAA 1FG2B 3QEHB 2R2CA 5DJ8B 5GZNC 3MFFB 1X3DA 3N85H 1MELA 5JZ7D 2J8UF 3V0VA 1NGXB 5JHLH 3G6AA 4GO6B 3CVHL 2R2BB 3V0VB 4C4KT 2JB6B 2CIKA 4PRNB 3G6AB 3HRZA 4EDWL 3IDIB 4CNIA 1AD0A 2CIKB 4YXLL 3QH3B 2APFA 1JGEA 3NABL 4CNIB 4OJFH 2BFVL 3UYOD 4K3JH 5FOJA 1JGEB 4JFDE 3KXFA 2HLFD 4QHKJ 1SQ2N 3MCLH 2NYYD 1JI1A 2D7TL 3RRQA 2EZ0C 5LGJB 4M43L 3L3JA 4CRPA 1FGNL 4JDVB 4M6NL 5L7XL 1Q8MA 4G8IA 3D3VE 5DGQA 2B4CH 3JWDL 4I1NB 4XPHL 4WFGE 2L7UA 2BP3A 3J7HA 3R4DA 5F7DB 4H25A 5DYOB 5DJ6A 2RCSH 4KK8D 4Q9QH 5FECA 4H25B 2XWJA 5K9QG 1HN1A 1HILB 2ILLA 1E4XL 3HG1B 4N0YL 2VITB 3QXWA 4WFEE 2BHUA 5DDHA 3BYYA 1QUNA 1ULVA 1RJLB 4UV7H 3BEWA 3QDGE 1BQLL 5DDHB 3CLEH 1EAJA 5I1GL 5K9KB 3ZT5A 2AK1H 1MNUL 4HJ0C 1B0WA 2VISB 1BZQK 3ABZA 4QRUB 1WZMA 2P5WE 1HNGA 1J1XH 4JFOA 5D5ME 3WHXA 4LLMB 1NCWH 1UJ3A 3HI1B 2EDTA 3M07A 4OI7A 2XKSA 1D6EA 2NY7L 5D8JL 1D6EB 2WP3T 1OSZA 4GRLD 5EZJA 3MBXL 2H41A 1EERB 1IAIH 2DQTL 2HYMA 2YHGA 4U1KA 4PJ9D 4Z7VB 1MJ8L 4N1HB 2Q6WB 1OSZB 3OXSB 1A2YB 4L9LA 1NCBH 4TNWF 4U1KB 4PJHF 4U31A 5D2LA 3V4PL 4LSPL 1VKXB 4L9LB 4LHQB 3F6LA 3JTSA 5D2LB 1S9YB 1U58B 5H35B 3MXVH 3D2UB 1IEAA 4JQVA 1RZJH 4F58H 1G7JB 1II4E 3QQ4A 4M93B 1QZ1A 1IEAB 3JSSA 1D5MB 2A6KA 3GSQA 3CIQA 4JPVL 1IJ9A 3QQ4B 1NC2B 1S7XA 5EC2A 3MODL 4ZFZA 1CLOH 4EI5C 5DD5L 4R7DB 5J56B 1J0IA 1S7XB 4YJZL 3T0WA 3GMNB 1ES0A 3ZE0E 4ZO9A 1U95A 5DMIH 1Q1JH 3DROB 3TO2A 5FYKD 3ILQD 4KPHL 5INDB 1AKJD 3TO2B 4L3AA 3BDXA 4JPWL 4UIKL 5AZ2H 3RL2A 5KSVA 1MFEL 3JWOC 3FHQA 4OD1H 1P6AB 1E4XI 3IU3A 3GSNH 3QCVH 1SHMA 1U41A 1L4IA 4ONGL 3ULVH 3FO0H 4TVPH 3OGOE 4WUUD 2X1OA 4OV5A 1MHCB 5DRWA 5SWZD 4FOMA 2F9BT 1QPPA 3V5DA 3X3FH 1A0QH 4BYHA 2OZ4L 4MAYC 5HI3C 3E3QE 5DHVH 5DT1L 1F6FB 4P5TD 2DQJL 2EECA 5GGRA 5GJSL 1A7NH 4YXHH 4BFIA 4XP6H 3VFOA 5GGRB 3H9SE 2WBJA 1CGTA 1Q0XH 3ZL4L 4KTEL 1ZKAA 4UBDD 2VWEC 2WBJB 3D6GA 4FHBD 1ZSDA 5LKNA 1MLCA 5F44A 3LKPA 1ZSDB 1U8OB 3O3DA 5B3JE 3AAZB 1W2KT 5FYJE 3TFKC 1DBJL 2FH8A 1KN4H 1I9IL 3LKPB 4MXWH 1G7IA 4EXPX 1U6AH 5IR1A 1G7HB 3BE1H 3O2WL 4NOFA 4KRPB 4LPTA 1QFWL 1DJSA 4G43B 5E5MB 1G9MH 1IGFH 5FDWA 4ZFGH 1U8LA 1QRNB 1XGRB 3SE9L 4GJTB 1FVDA 5FDWB 5F9JA 3FKUS 2BSSB 3QUZC 1OSPL 5A3ID 1N6UA 4MQXD 5T5NF 1SYVA 2X9XA 3PWLB 3WDJA 3UMTA 1HIML 1BGXL 3PHSA 1SYVB 3BSZH 5ETUA 3VJ6B 3OX8B 4TOYL 1GOGA 4NDMB 3ZYIA 1NGQL 1MCFA 2KL6A 2VXQL 2ITDB 4POYA 1R3LB 4WWKC 4Y4HC 1KIQA 4LBEA 3P77A 3KS0J 3TCLA 1LK3L 4LBEB 3P77B 3BT2L 2QQNH 3ES6A 2UUDH 5DD0H 1FC2D 3WIFA 2WAHA 3ES6B 4PS4L 4O58L 4XPFL 4IRZL 1QLFA 1RFDL 2J8HA 5DVNA 1A47A 1RUPH 4CKVX 5L8KB 4APQA 2J8UA 3LPGA 3BWAB 1IILE 2DIJA 1MAML 2Y5EA 5F7HA 4JHZA 1T7ZA 4LOUD 2IPTH 1IT9H 5I8OH 3W81A 2VAJA 5GGQH 3O3UN 5EN2A 5DHVB 3VU2A 2R8SL 5JLZA 3FT3A 5I6XB 3EJZD 2R4RH 5HBBA 4G6ML 2VZUA 4G9FA 3CFCH 3DXAE 1J5OH 1T7XA 1FNHA 2AJZB 3GI8L 4G9FB 1QFWI 1XF3A 3QXDB 5L8JB 3F7QA 3AM8A 3UDWC 1U8QA 2HJFA 4R90H 5CWSA 1DQDH 1PG7X 1XF3B 3UZEA 2DQFA 4HIIA 4QNPE 3ARDB 4IRSC 5CWSB 1ADQH 1I9RH 1X7QB 3K1KC 2X42A 5CJBA 2BCKA 5FA3B 2FATH 3AB0B 1N64L 4BELD 1TJHL 5D7LA 3TIDA 4QXGH 3VMOA 3K4AA 1XR8A 2PTVA 3TIDB 1SVCP 4UZGA 1VGEH 1AXTL 1MCRA 1TCMA 1M71B 4IJ3C 2DMCA 3U9PH 3K3QA 1U8PA 4XNQB 3QDHA 1LVEA 3MBEC 4PRHB 1QBBA 4F9LA 4JKMA 5J89A 1A1NB 1AHWA 4PBXA 2HRPH 4TSBL 4OF5A 5HHVH 3KJ6L 3VGAC 2QSTA 3QHFL 2XN9A 2P8MA 3LS4H 3O6FC 3VGHA 1JGLL 1C8PA 1YYLL 5I1CL 2J5LC 2XN9B 2G9HB 2P8MB 6CGTA 2AKRA 2B1AL 5E70A 3CLFL 1DN0B 1OGAE 2OL3A 2LVCA 2P5EA 2AKRB 3RWCA 1F13A 4N0CD 2OL3B 4HWEL 1KPRA 2UWEB 5D7IA 3RWCB 4MNQE 5D7IB 1KYOJ 1C5DB 4K7PY 5HYSA 4UOW0 1A7PL 5EOCH 4PJHA 2VLJA 5HYSB 3MSPA 1YEGH 3K8LA 5ENWA 3DX9B 1U8NA 5IB4A 2YN3A 4GXUM 1RULH 2VLJB 2MNUA 5ENWB 5IB4B 4WI4A 3P4MB 9CGTA 1ZANL 2R4SL 1C08A 2AABH 3D48R 5T3ZD 4GKNA 1OP3K 2PYEA 3RZCC 1Q9LA 4XMPH 1FZMA 2H32A 4U05A 2FX8L 3I9GL 2PYEB 3MNZA 5BVJB 1FDLL 1FZMB 2H32B 3C5JB 5EUOB 4JFEB 3ZKQD 4EQ2A 1XGPA 5MEOA 1LO4L 4OZFA 2BC4B 5J1AA 3CXHK 4G6FD 3KLDA 5MEOB 3IDJA 2HKFH 5HDBF 2EDDA 1JWUA 1QA9A 1A6ZA 5I73B 5LGHL 1V05A 1LE5A 4LLWB 1PW3A 1A6ZB 4EXKA 5DJDB 4Q97A 1K4DA 2HWZL 4CVXA 1BD2B 3SGJA 3VRIA 3OR7A 1YEJH 1YNTA 1K4DB 1ERNA 1HHIB 4NHCH 1NKOA 1I7ZA 1IGYA 5JO5A 1YNTB 2CGRL 2WBJD 1BHGA 1HHHA 5FKAA 2QKIA 4QYOB 2BVOB 2DKMA 5D7KE 1U3HA 1ZVYA 5FKAB 2JELH 2QKIB 3UTPD 3FB7A 5IW1B 5CGMA 4I8DA 3M1BA 4JY4A 3VW3L 3ZKSD 4P3CH 2IBBA 3QRGH 2CMRL 4OCWH 4MDJA 4HKZA 1R5IA 3O8XC 4MDJB 3TIEB 1A6TA 4HKZB 1NCDH 3GI9H 3U46A 4OUUA 5IMMB 1R5IB 3E2HB 3VG0H 3MRBB 2FX7H 4MXQC 4ODUA 4OUUB 1JTPA 3FOLA 2W0PA 4YGVB 4Z7WF 4ODUB 2XFXB 4Q0XL 3U0WL 1X6LA 1FVCB 1DDHB 3DHJA 3BDYH 4OCYH 4MNGA 4ZUWB 3RA7H 5ABDE 3MV8A 1CLZH 1FYTA 1YDPA 2I24N 2X10A 5DJAA 3QSKB 2V2XA 5ESAB 3KPQA 2GJ6A 1MREL 5DJAB 3RFZC 1DLFL 3QO1B 5EZOL 2EDHA 3HFMH 2GJ6B 2XIDA 3PHOA 1DN2A 2IH1B 5TFSL 5JQHC 4OZGB 1LILA 4G7YH 4XTRD 4XX1E 1QNZL 1HCVA 1HOCB 5DWUL 3MRHA 3V6ZA 2EIEA 2ENYA 1U93A 1LEKA 3OMZA 5ISZA 1U93B 1LEKB 5C71A 2JLLA 2DJUA 4IMKA 4R97C 5I19H 4DN3H 1A9BB 3G08A 3P11L 4KMQA 1RK1B 4R4FH 2DBLL 3NACH 3OB0H 4OTXL 1AY1H 4URTB 4FFZH 5BQ7B 3RIAK 1B88A 1QR4A 1F6LL 4IDJH 4HIHA 4KQ4H 4RWYL 5GRJH 1JHLH 5ACMA 4IOSD 1PVHA 4H1LA 5ID0A 5JW4R 5LQBH 4RGOH 4G9FD 4M1GL 5LAXA 1A6WH 1I1YA 1KC5L 4A6YH 4N5UA 4FG6C 3RWDA 2A73B 4G3YL 1NUFA 4X4YA 1CGUA 5F9OL 3BQUC 3C60B 3RWEA 3VXSA 3C5ZA 4X4YB 1L7TH 3MLYL 2APTA 1EO8H 3RWEB 4HXAH 3VXSB 3HUJE 3JTTA 4K9EH 1MWAH 3ZO0A 4PJGF 5CBAB 1HSAB 1T7WA 3IS1X 3L3HA 1KULA 4XRCB 5C0ND 1PGRB 5DEFB 2H1PL 5D7LD 2F53A 2ORBH 4NC1C 1HH6A 2O5ZH 3NIFE 2V5RA 3QP3A 5C0AB 1Q9WA 2HG5B 5A2FA 1GGBL 3D39E 3LS5H 3UTTE 2Q7YB 2BNUA 2VXUL 5GS2H 1BECA 2GCYA 1O7VA 3C9NB 5KS9A 5DVMA 1CXEA 2XN9D 1WWBX 3Q1SH 1AQDA 1PSKL 4HUVA 1F6AA 5HHPB 5KS9B 3PQYB 2W9EH 3ULUD 5H2BA 1HH9B 5CBEA 3AROA 1OARH 4HUVB 4PLKD 2P46B 3IDGA 2P5ED 3WYRA 3U82B 2FWOB 4MDIA 5CBEB 3PXHA 1MOEA 4JAMB 3TO4C 4UIMA 4K94L 5GGVY 3IDGB 4MDIB 3TH4T 4JCMA 5D6DC 5F1KC 2W0LA 4UIMB 3IXAB 1B0RB 5FF6B 4ETQB 4YZFE 2FNBA 4OFDA 1TQCC 2VLKA 1RIHL 5FO8B 4PJAF 2D7NA 3O6LH 4G8GB 2VLJD 5HPOA 1K2DA 1A7OL 2KQNA 4WU7B 4XNYH 2D31B 4WV1C 4PJDB 3HR6A 1JZ2A 3O6KH 2Y5TB 1K2DB 3BMWA 3NIGF 3S34H 3IGAA 3X11A 3QEGH 1V3LA 2IADB 3EOTL 3IGAB 3CFJA 5T1MA 4Z78A 3X11B 2R15A 3MFGB 1OGTA 2PYED 5JIIA 1A14L 3FAWA 3X3GL 4FQXA 3MJ8A 1B9ZA 3RX5A 4NZDA 5DRXB 3BESR 3MLZL 3ZE0F 4CL7A 3GBLA 4TNWK 5TE7H 4FQXB 3MJ8B 4OGZA 3H3PH 1AGFA 5KSUA 4QLRA 3TYFA 5GSRA 2AK4A 3RHWK 3UO1H 2OR7A 4GMTH 5GSRB 2AK4B 3MREB 5B21A 1J8KA 3U2SA 4NQEE 4TUKH 5MEQB 3EOBA 1XCQB 4KJQC 1IC5H 3EOBB 4U2ZA 2EDFA 2X4UB 3LZFL 3WIHL 4JFYA 1MWAB 3CFEB 4GH7B 5IT2L 2NY2C 3ZYZA 3IT8D 4LSDA 2R1YA 4K8RD 4Y19B 3F12A 1YN7A 2G60L 5L2KE 3PABB 4PTTA 3WNPA 1YN7B 3RP1A 4NCC2 1U3HD 3SDCA 4YQXL 3OL2A 1T0PB 4YHIB 3QIWB 3SDYL 1UM5L 4WUKL 4Y4KA 4JFXB 2C1PA 1YQVL 4ZXBC 3B2UC 3CUPA 3SDAB 4NNXA 4HPOL 1UWXK 2WV3A 4NNXB 5IROA 3TWCL 1WZLA 3TZVA 2P43B 4XVUC 5H37G 1KTDA 3MUJA 4PJEE 3TZVB 5BJTB 43C9A 5FHBL 1J1OL 1MAJA 1B4JL 3QUMA 5HYFA 5GS1C 4XPAL 1FIEA 1ZAGA 2E5EA 43C9B 5EU6A 4AEEA 3JWDC 3QUMB 3W11C 5JQ6L 4NFCA 2H2SD 3DSFH 3P0VL 3GJFK 2HAZA 4MQ7A 3MV8D 4UTBH 1FYTD 3F7RA 4LVHC 5CSGA 1X5KA 2E7CA 2PTTA 1H9VA 2A1WL 1YNKH 2GJ6D 4K7FB 4NO0A 2PTTB 1A7QL 1IGML 3BW9B 2BSRA 5C0FB 1YECH 4LRNL 4LGSB 1UWEH 5HJ3B 2EYTA 5TE4L 4DVRH 3K8MA 2ADIA 2YEZB 1EHXA 2FHCA 4AL8H 5HYJA 4MHHI 4UNTA 4NUJA 4N90D 4NN6C 4LSRH 5ISZD 4O5LL 4I2XA 4PRAA 5DD1L 3W82A 1NC4A 4NUJB 3BP4A 1O0VA 3AVEA 3L5XH 4JGUA 5EO9A 2ZCKL 5E8NB 1NC4B 2VUYA 1YYMH 4J3UA 5EO9B 3IFPB 3QBTB 3BX7C 2A74B 5KG9A 2I07A 1EO7A 1FZKB 4Y16A 5IMKA 3EGSB 5KJRH 4DKFL 4NIKB 3TVMA 2FGWH 3WFZA 2AXFB 3FTGA 4XPBL 3C6LA 1KCSL 4R7NB 5I18L 1ITCA 4IHOA 4HK3N 4U6XA 2ED7A 3AREA 3WO4C 4PJ7E 4LCUB 1K5NB 3L3OA 4FA8A 4UILH 3AREB 3L3OB 4UDUA 4OCSL 3OKNB 5BXFB 5GSVB 1A4KA 4X4XB 1N3NB 1INEL 1REIA 1K6QH 3LV3A 4L4TB 3NH7H 2UV3A 4TUJA 3VXSD 3C5ZD 1XF5B 1CK0L 3QQ9D 3LV3B 1UQSA 4TUJB 3HZMA 4FN0A 2HT4D 4PUBH 1UQSB 3HZMB 3Q6GH 3RWHA 4ZPVA 4TSCH 2Z35A 4HXBL 4X6CE 5DK3A 1L6XA 2I9LA 5EBWA 4ZPVB 4JFDA 3RWHB 4LPVA 2ICWA 1XT5A 4M7ZB 3S35X 2Z35B 4DUVA 3TT1L 1KLUB 2F53D 3LEYL 3A0OA 2PO6A 4QNPF 2YN5A 5I1JH 1T2QH 3D3VA 4L4JA 3X13B 5H37H 5B8CA 4PRDB 2NR6D 2QTEA 1TJGL 1G9EA 2DQGL 4NZUL 4P46A 2ZCHH 4NM4H 4R26H 5E5RB 2Y4SA 5ICYB 3IKKA 3PQYD 4TQEH 1NDMB 4NGHL 4LLVA 4ODXA 3BZDA 3ARSA 1JFQH 1MUJA 2WQ8A 2N7AA 3VI3E 3UPAA 1FZJA 4F33B 4OAWA 3H3KA 3MLUH 2NY5L 2UYLA 5D1ZC 5I8CA 4J6RH 4OAWB 5KVGH 5GS3A 3CXDL 3QDGA 4LU5H 2E8YA 2DMBA 4HKXA 2X70A 2DQDH 4G8GD 4NT6B 1RURH 5C0IA 3QDGB 4Q6IA 1DEEA 2VLKD 5FUZL 4K7PX 3N1GC 3STLA 2P5WA 3AY4A 1DEEB 4NZRH 4KH2A 4F2MA 2XA8L 2HFGH 5D5MA 3NMEA 1V3MA 2W60B 4PP1D 5GRWA 2P5WB 4OLZL 1CFBA 5D5MB 3GBMH 3HNTL 3MROB 1U8KA 2XICA 1SEBB 3O4OB 2FJGB 3UPCA 3CSPA 4P2QB 3GSOA 1KENH 5F1IA 3ZDYF 3ESUF 1F2XK 2VL4A 5KSBE 4WDIB 5BV7H 4HHAB 2DQHL 3INUL 4MSWA 4FQXD 1JVKA 2JTDA 2VLRE 3S7GA 2BVQA 3GRWH 1ZTXH 4U49A 3W2DL 4MSWB 4TPRH 3IDUA 3OPZH 3O4LE 1OHQA 5EU3A 2AK4D 5CEZD 1F11B 4JHAH 2Y07L 4C83A 4CADA 3FO9A 1C7SA 1FJ1A 3MO1A 2WQRA 4HBCL 1NLDH 1GCFA 3FO9B 5IHZB 4XCCL 5MERB 5DUMH 1FJ1B 4JQXC 1X5JA 3MO1B 3ARPA 3FN3A 4YDJB 1I8IB 1WLHA 4ODWA 5E6IA 3LQAH 3CFKA 2VDRL 3SE4A 4LSTL 4RMRA 3BHBA 4ODWB 5E6IB 4Y19D 3V9FA 3MRKB 4U1JA 4Y4FC 4C57C 3RUGF 3HC4H 4U1JB 1OM3H 3QNYA 3NFSH 2IAMA 3OKEA 1S8DB 2ESVE 3L3GB 4LQFH 5JW4M 2XZAL 3B5TA 4LLDB 4WFFE 3SDCD 3QNYB 2IAMB 3IAPA 1MCNA 2DI8A 5DD6A 4JO2H 5AAMA 4GW1A 4HSQA 1G6VK 1G6RH 1OT2A 1JZ3A 1RD6A 4PGBB 3TZVD 1JPFB 5IFHH 3ZTJG 1U8HA 5CP7B 4AMKH 3DNKA 1T20B 1NGPL 4JZOA 2DLTA 4YE4H 2YA1A 3VXUE 1QSFB 3I6LE 2VZ1A 5F3BA 3ZHDA 5EU6D 3HNSH 4KXZH 5GHWL 1RVFH 3AS2A 1L9MA 5F89B 1WBXA 1FL6A 3H9SA 4AH2A 4NKIL 4Q9BA 1I8LC 2D03L 1MRDH 1YEEH 2NW2A 5DC4B 4AH2B 3KR3L 3RL1B 1HYSC 3QJFB 4M6MH 1P4BL 3MRPA 4M61A 3RGVB 2FO4A 4M8VA 4AIXA 4YIQB 1KJ2A 3S98A 1J8HB 3ARBB 1CWVA 4I18C 5T33H 1MEXL 2IGFH 2X4SA 3UROR 1KJMA 2X4SB 4Z5RB 1HQRB 1KJMB 5HYJD 2NMSA 2O5XH 2G75A 3PL6C 1CFVH 1NC4D 4KGJA 1JHTB 2ARWA 4QXUH 2G75B 4PV8B 3B9KC 2OK0H 4PRBA 3ZDXF 3IYLW 3G5XB 4ZQKB 5DRNB 5JHLL 4Y5VA 4PRBB 4Y16D 5D1QC 4RWHA 1KB5B 3TVMD 1T4KA 5C0JB 1DL7H 3MNVA 4D9QE 4S1RH 5GGTH 2P8LA 1T4KB 3C6LD 1MY7A 5C9KA 3BOVA 1AR1C 1TPXB 4OJFL 5JPNA 2JK5B 3MACH 1TVBA 3MCG1 1QEWB 4QTIL 4NC2B 3S96A 5F7EH 5EZIH 1UB5A 3ARED 3R1GL 2GEEA 5L6YL 5CZKA 1TVBB 4XNMA 3S96B 3MRLB 3HZVA 3T2NH 5A2IH 3KYNB 4RCAA 4MQSB 4XNMB 5SX4H 3AUVA 4N0FA 3KAAA 1NEZA 4PD4J 4JFZL 3AS1A 5AG9A 3ULVF 2AV7B 4J3OC 4I3RH 4N0FB 5T3ZL 1TZGH 3OJDB 1XGYH 2IPKA 1AJ7H 4F7TA 2UZIH 5EO0A 5F9AC 2BNQB 4KV5F 1D5BB 5EPMA 4JFDD 4X6DE 2QQLL 3CZJA 5D70H 1YMHB 1RJZA 4P4RA 2O61B 4XPTL 2NY6B 2PO6D 3BKJH 4OQTL 2E7BA 5CD3A 2FJFB 1RJZB 1PG7W 3DX7A 3LN4A 3UZVB 2OJEA 5HDLA 3ZTJH 2NW3B 4G42A 4CVWA 1FZOB 1GZQB 3NGBC 4WFGD 4M9OA 4P5KB 4P46D 1BQUA 3MV9E 3PWNA 4LSSL 3DXAA 1A7BA 2MCPL 2ED9A 5TF1H 1A5FL 2BOCA 3NIFF 3BZ4B 5IQ9A 1CT8A 3Q48A 2BOCB 4CJ1A 3KPOA 5I1LA 2FX9L 4NQXA 5IQ9B 1CT8B 4WFED 1QBLH 1IAIL 3KPOB 5I1LB 2VDKL 1FLRH 4NBYB 3GKZA 4OT1L 3QDGD 2M8XA 4HEME 3LQMA 2PW1A 4JGJA 2H8PA 1FV1B 5ITBH 5KSAA 4MD4A 1XIWC 4QXTB 2YWYA 3MV7E 3HS0A 5C6WH 3S5LG 1KIRA 2ATPA 2C4FU 2P5WD 5KSAB 4MD4B 3HS0B 4EI6B 1UWGL 3MYJA 5IW6A 1MRCL 4QHNA 1WC7B 3L5WA 3ME0A 2ZPKL 3UCRA 3GSWA 4ALAH 3Q3GB 4YZFF 2GT9A 5DJZB 3HMWL 1Q1JL 1FYHB 4P9HC 2MMXA 1OF2B 1DVFC 4RDQF 1OGAA 3PGFH 3RVWC 3X14B 3UTZA 3MRJB 3WN5A 3HAEA 4WEBH 4HUNB 4JZNA 3OAUL 4ONFL 2MQ0A 3KGRA 4FFVD 3HAEB 2OTPA 3MUY1 4JZNB 4MNQA 1CD9B 3E6FB 1NBVL 4W68A 4OCLC 4ZOAA 5CMAB 3I2CL 2VJXA 4KHXL 1RQ5A 5E6ID 1K9TA 1KELL 1FIGH 3KHQA 5E94A 4G6KH 3ULSB 4U7SA 4WO4C 4ZS7L 1LDPH 3BRDA 4XP1L 2F5AL 4ZUTA 3RNKB 2VIRB 4NKMB 5EBMA 1TZIB 1PKQE 4JG0L 4X9BA 4KRMB 4O4YL 1S7UA 2XZCH 4G6JH 1BEYL 2IAMD 1X5HA 1H8NA 1XCTA 1S7UB 1KLGA 2QHRH 1YEDB 3C8HA 1OWRM 3MRFA 1KLGB 2R69H 1IAII 2AEPL 3QIUB 3CNKA 3QWRA 4ONHA 2FSEB 4K23L 4AYFA 3THML 1MRFL 3H9HB 3UTOA 2D0GA 3S88L 1FL3B 1MFNA 1UXWB 3NA9H 2XA3A 1YC7A 3V7MA 2HJKA 3JVGC 4PJBE 2X4QA 1F3JB 3LN5B 4F9PC 1UM4H 1SJHA 2O5YL 5C9JA 5DQDH 2XPGB 5T1KA 3MR9B 4OQ1A 3FQXB 12E8L 2R29L 5T1KB 5IKCB 5F6IB 3WSQL 5C0BE 1RI8A 3H9SD 3M45A 2AJVH 4RZCA 4F8QA 4JVWA 1C5CH 2HTLD 3ARTA 1GPOH 3M8OH 4PJEF 4LP4A 2OX5A 3KPSB 4QRTA 4RZCB 3U36A 1HXMA 4KKBC 3TV3H 4EVNB 4HGMA 4PG2C 1BM3H 1IC7H 2Y25A 2BRRH 2EDJA 3EZJB 4K71B 2Y6SC 3RVXD 2FB4H 2VZTA 1C1EL 2F5BH 3BO8A 1JWSB 1I3RA 1XZ0B 1OL0A 5DD3L 3WJLA 2PF6A 3BO8B 5FHAH 3ULUL 2NY1C 1Q94B 1QP1A 3FFDA 2NXZB 2OL3L 5B3NA 2E6PA 3RKPA 4JO4H 1OTUD 4ODBD 4RIRA 5F71A 4W4OC 4J3XA 3GHBL 4QCIA 3MLRL 4HF5L 3KWWB 4RIRB 5HGHA 5K9QI 4QCIB 4P9MH 2A77H 2AEQH 1HZHH 5GRYA 4LCYB 1Z5LA 5GGSY 4GRWH 4JLRA 4XBEL 4FP8L 5EOQH 4G9DA 2VZOA 3CH1A 3QEQE 3WEXA 4JLRB 5I16B 2V5MA 1Q9OB 2XTJB 4G9DB 4J4PC 2FZ3A 2DTMH 3BIAX 4K94C 5SWQA 1MCOH 4LIQH 5DEGB 3WS3A 2HH0L 5FUCE 4CJ0A 2AJYL 1Q9KB 2Z31C 2DQEH 3REVA 1QTYT 2JF1A 5DZLA 1D9KC 3EHBC 4JY5L 4YDVB 3L1OL 3EOYG 3L9RB 3BUTA 3BN3B 4R3SB 3QCUH 1J5OL 4EN3B 4PJ7F 1ZEAL 1BF2A 4U1MA 1BOGB 4F37F 2ZOLA 5LWYH 3NPSB 2ED8A 4UMGA 3MC0A 1IEBB 3QIBC 2PETA 4U1MB 2VQ1A 4YLQT 3I6KA 1U0QA 2P47B 1IGIH 3RPIA 3IETA 3BH9A 3U4EB 3IFNH 3MRQB 4GMSH 2JIXA 1MFBL 2XRAH 2XY1A 3W9EA 1CR9H 4BH8B 4TVSa 1JI2A 2JIXB 1T04B 3HE6C 3DLQR 2BMKA 5GJTH 2V7HB 1T1WA 3LKQB 1NSNH 1RHHB 5C0CE 4K8RL 4X6CF 1GL4B 2EE3A 4N9GA 5JXEA 1R24A 1VGEL 4GKZA 3GJEA 4GKZB 1P7HL 1M4KA 4IMLA 1ZA3B 3GJEB 4G7VH 3HUJA 1H8SA 1NL0L 4GAYB 3S5LB 4H88L 2Z8WC 5K9JL 4X0KA 4L3EE 2VDQH 2HFFA 4TUOB 1YEIL 4ZOEA 5GS0D 1JNNH 5BVPL 1VDGA 2VN4A 2HFFB 1TFHA 5KSAD 2DQUL 1MFAL 3OKDA 1FBIH 3VI3F 5HDQL 4KUZL 3T4YA 3D39A 3EYSL 1MJJA 1OAYH 3UTTA 5AYUL 2MPAL 2W9LA 1CZ8H 1MJJB 3SGEH 3OKKA 3UTTB 4RQQA 1RUAL 1URLA 3FN0L 3WLBA 4ODTL 4YC2C 3QUKB 2HP4A 2WSKA 1TENA 5DF0A 4U6HA 3WLBB 1YEGL 2CK2A 2VDOH 2B2XL 2VXTH 2VAAA 4Y1AE 1HYRC 4KHTH 4GRWB 1WFTA 2D7OA 4DW2H 1I1FA 2BOBB 3RWFA 5C07B 4KZDH 2ITCA 1OGAD 3T8XA 3T04D 4HWZB 4PLJD 4PY8J 1I1FB 3C6SA 1CFQB 3P4NA 5FO9A 3RWFB 3SGDH 2ITCB 4LCIH 4TULH 3T8XB 2QSCH 1T66C 3P4NB 4BFGA 3WFCL 3GNMH 5CEXA 4MNQD 2R9HD 3H3BC 2DL2A 4EDXB 5KOMC 5ADOL 3ZE1F 1ZLWK 3FB8A 4RGNC 5FYKU 3ARFC 1RU9H 1H8OA 3WUZA 1JYNA 3RBGA 1AD9B 4XMKH 4MQTB 3FT2B 4POZD 4N8CH 1I1AA 4MA7L 5E8DH 4Z0BL 3LB6C 2ZKHH 4GRLC 4PJ5B 4KJWD 2NXYC 2OP4H 1I1AB 2VXSH 5LBSH 2VDNH 4Y7MA 4YK4C 3QWQB 5KVMC 3QWRD 5T1DH 4UT6H 4P23A 4YPJA 5T1LB 1LQSR 3BP6A 1F90H 4XH2A 1CCZA 5CJ8A 3IXTA 3VFGL 4Z6AT 2IBZY 1AGDA 1RV6X 5C0DB 3QUYA 2CDGB 5I8KH 5FK9A 3OZ9H 5E6YA 3LIZH 5A2KH 5A40E 4NQEA 4MS8C 3QWOA 4R2GB 5CJXA 4U3HA 1YEFH 1MCPH 4P3CL 4NQEB 2N4IA 4TN9A 4MMXC 2VSDA 35C8H 3OV6A 3QNZB 1JHKL 5T1KD 4JM2B 5D1XC 1WTLA 4C59B 1ADQA 5F70A 3RDTC 3TBYA 4CDHA 5TGBA 1Q38A 4GSDH 1MFDH 1TVDA 3TBYB 4U0RB 5L2KA 25C8H 43CAA 1KNOB 1U92A 5D7KD 2QHLA 3GFUA 3B8YA 3MJ7A 4YO0B 4MD5A 1BPVA 5FM5O 4R0LA 4X6EB 4MD5B 1QLRB 1PYWA 2EIZB 3V5KA 2XXCB 3HRPA 4QOKB 1L0QA 3U9UA 5HHNA 2NXZD 4PJEA 3HFML 2YUXA 3V5KB 4OKVB 3DV6A 3TA3A 3BN9C 5HHNB 5HHXL 4OGXL 2XKNB 1N59B 4G7YL 3TA3B 5EA0H 3ELAT 4N0RA 1RUQL 4P5TC 2CSPA 3B2VL 1J0JA 4LVOC 4Y2DB 5DMGC 2E3VA 4LLYA 2Q20A 3DYMA 4V2CB 3RI5F 3ZMRA 1JGUH 3BISA 3DURA 1PLGH 4YHNA 4R4FL 4ZOCA 5SX5H 3PDGA 2E8ZA 2GITB 2OI9B 1AY1L 3A6CL 4FFZL 4HAFA 2B1HL 4DKAA 2F19L 4A2MA 3H9ZA 5D2NC 5BOPA 5T3XE 5TPWH 4KQ4L 2NY5C 3DRQB 2F74A 2VWEE 4PV9A 3P9MA 2A9ML 2FL5B 2X89A 1F3DH 3BPNB 2C1OB 4RGOL 5IBTH 4L8SC 1MLBA 4NC0B 4EN3D 4PJIE 4EOWH 1DUYA 5TQ2H 4YUEL 1A6WL 2ZG1A 2EXYC 1BJ1J 1WCQA 2QSVA 2BXZA 3TYGH 1FNAA 4I48B 4P4KA 4RA3A 4AIOA 4NZJA 2JIXD 1PD6A 1R5WA 2J4WL 2ZOKA 1YMME 4BSVA 2BDNH 2YUVA 3NN8B 4MA1C 4R4ND 3F62A 1OVZA 1HDMA 3BGAA 4PJ7A 3ZKMD 2PXYA 3ARRA 3KG5A 4BUGA 3FQTB 1HDMB 2PXYB 1FNEA 4X6DF 2YPLB 5JXED 3MCKA 1UC6A 4M1DH 1FNEB 4U1HB 1PQZA 2LVEA 3CMOH 1DZBA 5CHNB 5HHMB 5CP3H 4FQPA 4UV4L 5I2IB 3U1SH 1R3JA 1S5HB 7CGTA 3RWJA 2EIBA 4ETYA 4JM4H 1FFOB 5FCUL 3GMQA 3RWJB 4X6CA 5IGXH 4MYWB 1F45A 2C3GA 2DWDB 4WCYH 1WZ1L 1H5BA 4IS6B 3CPLA 4OZIB 4NUGL 3ARZA 3L3KA 4LOUC 1H5BB 3QUML 4P2OA 3D39D 2XXMB 3BEVA 3BI9X 4LLUB 1RZ8B 3UTTD 4Z7NE 4P2OB 4AJ0A 5JW3H 2JJWA 2FR4A 4FQ1H 4OZHE 3S37L 2KKQA 3R0MA 1RPQA 2VLME 3STBA 3VWKA 2EC9U 2ADFL 3OF6D 1NUDA 1GJIA 3C87A 3HMXH 2OYPA 1EXUB 3I50L 1FCCA 2EDLA 5E1AB 5BRZB 3QEGL 1WWCA 4ZYKA 1ZHKB 3DGGA 1LP9B 3RU8L 1V8HA 3DGGB 5AWNL 3VDCA 4C55A 3SBWC 5HYIA 3MJ6A 5IVXF 1J05A 3QCTL 4ZPTA 1QFPA 1ETZA 4X7CC 2NX5B 4WHYG 1SMOA 1J05B 4C56E 3SY0A 4PLNC 4M8QA 4UINL 1M6OA 1YJDC 1LO3L 4QT5A 4YEFA 1VESA 1NFIA 2ZP0T 1T3FA 3EO0A 4GMTL 2LAGB 4K55A 4U1IB 3CVHH 1M6OB 3U0TA 3P73B 1NFIB 5DJ2A 4FQ2L 2RJMA 2Z93A 2WM0A 4EDWH 1I1AD 3IDNB 5CFHA 4YXLH 3GMLB 4NCC1 4ZFFA 2Z93B 1H15A 2BFVH 5KSBA 4L9LC 1QO3A 3DO7A 5J6HB 1ACYL 1B3JA 1KPUA 3MLWL 2QR0B 5E4EB 3NZHH 4E41B 2VLRA 5KSBB 3FOMA 4P23D 5I8EA 4NO2A 3DO7B 1JRHL 1UKSA 2QADB 3VFWA 2D7MA 2D7TH 4KK9D 5EFIA 4M43H 5I8EB 4NO2B 4MJIE 3O4LA 4LKCB 1FGNH 2UUDK 3QDJB 4M93C 4N0CC 4WI7A 4XI5C 3QUYD 1DUZB 4QF1A 5L7XH 2XQYK 3O4LB 4PJCB 4R2GD 4GRMA 3JWDH 5DZOA 2JJSC 4NQED 4XPHH 1CI5A 4JO3L 4RFNB 5IJKC 3VWJA 5FA4A 3VD4A 1RIVL 4AK1A 3VWJB 1CDCA 1NGZA 3CH8A 1EJOL 1VFBA 1D5XB 4JCLA 5F1NA 2IH3A 1Y0LA 5DFVC 1NGZB 3SHSA 2NCMA 1E4XH 5L2KD 4QHKI 4ELKA 4P59H 4I5BB 3RVUC 4N0YH 2ESVA 4F7PA 3D25A 1H3UA 4PJBF 4O9HL 1IAMA 5IEHA 4Z8FL 3NFNA 3KHOA 3T3PE 1BQLH 4DTGL 5I1GH 3DSFL 3NFNB 1MNUH 2H2PD 1N5AA 5ESQA 1S78C 2DLIA 2HFEA 4KMLB 4MLIA 5GZOD 3P4OA 1N5AB 2A6DA 2A6JA 1YNKL 1FFNB 2HFEB 1MQ8A 1ACZA 5DQ9A 5IIEB 2WIMA 1LO5A 5DJYA 4M7JL 3T2QA 5IF0A 2A6JB 1T7YA 2ADJB 5FGCE 3TA3D 1LO5B 4C58B 5FKPA 2SEBA 1A8JH 3EDJA 5D8JH 3VXUA 1F4YL 4Y2DD 3MBXH 3KJ4B 2PCPA 2DQTH 5HGDB 2P1YA 2I27N 3EO1B 4PGCA 3NCFB 2F54B 5J13C 4KZEL 3AU1A 1S9WA 3V4PH 4LSPH 3GSRB 4PGCB 3MUGA 2BRQA 2WUBL 1OD9A 4J3WA 4RNRA 4HFUL 4CGTA 1JRHI 3TLRA 4PJXB 3FQRA 4RNRB 4ELME 4O2CA 4FXGA 4F7EA 2FLBT 4WHYH 3M17A 3SKNB 5EIIA 4JPVH 1T6WA 4F7EB 2YS4A 2RB8A 3MODH 2NY0B 2X5PA 4LNRA 1P6FA 2X89D 1UG9A 5CLWA 4POUB 4LNRB 4KRPC 5E00B 5KW9L 3VH8A 3BXNA 2WWMC 2WIIA 4KPHH 2EE9A 3BXNB 3MNWA 1KSRA 5ITFA 4JPWH 4UIKH 5TQ0L 5HTSA 1U2HA 1MFEH 1TXKA 2V9TA 1RZJC 3B3IA 3EFDL 4LVNB 3DBXB 5ITFB 1EMTL 4LEOA 4XMLL 5DVLA 3FAXA 1RK0A 1FVEB 4P4KD 3I85A 2XZQL 3CMGA 5EH1A 1RK0B 5ID1B 2HMIC 1BVKB 5EORH 5GIRA 3KPPA 4ONGH 3IJSB 1WT5A 4HC1L 5IM7A 2OTUA 1H3TA 1ORSB 1WIOA 2G2RA 1MJUL 2PXYD 3VA6A 5IBLD 1TETL 1TZHA 5IM7B 4GW5A 3JV0A 5KVFL 2ZUUA 5DUPH 2ZJSL 1TZHB 2OZ4H 3V8CA 4BH7A 5I1JL 3PV6A 5DT1H 5FIEA 1AC0A 3GB7A 2YUZA 2DQJH 5GJSH 4DFHA 2KZ1B 2CLZA 5D7SL 3QO0A 3ZL4H 3FQUA 1I9EA 4KTEH 1C12A 3MA9H 2W07A 4TQEL 3FQUB 4X6DA 4LLQB 5HI4D 1C12B 3K0WA 1CXFA 1JFQL 2YRLA 3OHXB 1PG7L 1JZ6A 3LVEA 5BS0B 2R2HB 1P7KA 2EYSA 3BH8A 3NZ8B 1ZMYA 4P5MA 1DBJH 1XFPA 1I9IH 3VGBA 1P7KB 4KDWA 4P2OD 3SE8L 4NO3A 4YHLL 5I6XC 4P5MB 1DSFL 1PEWA 5C2UB 3W39A 2O93L 1FAKT 1HSBA 4LU5L 4NO5A 2E9IA 5J9PA 4Q7DA 3O2WH 1E4KC 1QFWH 3MV9A 4NO5B 3TNMA 4LSVH 5J9PB 4DCQA 4X5WB 3BPOB 4YNYA 5DRZA 5DSCA 3ALWA 1BBJB 5J3HD 1P9MA 2HFGL 4DCQB 3SE9H 3ARDC 4YNYB 5DRZB 4DVBA 1YQ2A 2D4FA 2FYYB 1GIGL 1KJ2L 5HI5D 3BJ91 3AB0C 1DQQB 3MV11 1HIMH 1BGXH 1I8KA 4PGZA 1A02N 3KXFE 4TOYH 1NGQH 2C3HA 1ZTXL 1UH2A 1G9MC 2VXQH 2R1XA 2WW8A 3DWTA 1NUNB 1U8MA 3MV7A 4X7TA 1WBYA 1OPGL 3PF2A 2ZSWA 4FZEL 5IB2B 2R1XB 4JZJA 3MV7B 1LK3H 1KB5L 3GMRB 4JZJB 1NLDL 5E7BA 1LGVA 4NC1E 1S7SB 4YDLC 3RKDC 4PS4H 5ANME 4O58H 4H8WL 4XPFH 2AJ3A 4IRZH 2D2OA 1B0GA 2EKSB 1RFDH 3O3EB 5KN5A 2QADD 2VLRD 3FQNA 3MQIA 1EK3A 4NWTL 1LE9A 3HC4L 2AJXL 1CD1B 1MAMH 2AQ2A 3G9VA 3UPRA 3LHPL 3O4LD 4YHPA 1BLNA 4LQFL 3VFUA 2WNGA 2JJTC 3AMKA 4FXLA 4P99A 3UJIL 3UPRB 4XVTH 1BLNB 2IBZX 2R8SH 5CD5D 4ZNCD 4O2EB 2Q76A 4ZAKB 1CL7L 3K8KA 2YD6A 3VWJD 4G6MH 1ZLVH 1T22A 1KEGH 3GI8H 1GHFH 2CDEA 4Q58C 5DC9B 5CIPB 1PKQA 1VEMA 3QQNA 5L2JA 3G6JB 3O9WA 2W59A 4ZUUA 5HD8D 4UB0L 1MQKL 3BD5A 4ZUUB 5SWSE 1EZVY 4HX1B 3GMOA 4XXDB 2BSTA 2DKUA 1N64H 4L8DA 2VH5L 2PR4L 2VDML 1TJHH 2YPKB 4H20L 4M1CD 5FV2A 4U0QB 3TN0C 4M6ML 1WFOA 1JPTL 1AXTH 4U1NB 1LD9A 4BM7A 4NQCE 4ZFOA 1LD9B 1VERA 4PJBA 4JHBA 3VXUD 4CN4A 4NRZB 5ICZB 3I6LD 5DS8B 4PY7A 4B53A 1YN6B 1E6OH 3KJ6H 5L88H 5C0EA 2FO1A 1KLFA 4PY7B 1JGLH 1NFDB 4OIAA 1YYLH 5I1CH 5KAQF 1OP5H 5C0BA 3DETC 3RIFF 2B1AH 3CLFH 1QR1B 3MMEA 4BJLA 2BY3A 2X05A 4WHDA 5FGSA 4HWEH 3QQ3B 2HTKC 1E28B 3DVFA 3QPQD 4KGLA 3FMGL 2XQBL 1JF1A 4PD4K 5GGTL 1A7PH 3FFCB 1JF1B 3VMPA 4WTWA 5D4QA 3A6OA 4J7RA 4MA3A 3OWEA 3E2HC 1AQKH 4MA3B 3WFHA 3UBXA 5CJ5A 4WTZG 1T0NA 1WCBB 1ZANH 2R4SH 3FN9A 2NTSP 4PRIE 3ZZ1A 3BVNA 4X9GA 5I66B 1IC4L 3HCVB 4D9QD 1A4JA 2FX8H 3I9GH 2UZIL 3IDYB 3IF1A 4TYUA 1FDLH 1QD0A 3QI9B 5AG8A 3EOAB 1OW0A 1LO4H 2CKBA 1OCWL 3IF1B 3HPJB 3RI5K 3BYTA 4N9OB 4J23A 3HB3D 1Z3GL 1RZKL 2YD9A 2CKBB 1WVZA 3CU1A 3PGDB 3QEQA 3DVGA 1RUKL 4RRPA 2V7NB 5LGHH 4CVZB 3QEQB 2UZXB 1OAQL 3K2MC 2DL9A 5DFTA 2DM3A 1JK8A 3WNNA 4XZUA 1NMAL 4JE4B 4HUMB 1JK8B 3CXHJ 5F7FA 3VXRE 4DN4L 2CGRH 4PB9L 3GGWA 4CU7A 1EAPB 1WEJL 3VE0A 4LCWE 1M7IB 2VQUA 3VE0B 1G6RA 2V9QA 4GXVL 3S8WA 4ORZC 3VDBA 3QHZH 3PP3H 4CU8A 3VW3H 3NCJL 1U8JB 2CH8A 4JFQB 2RGSA 1QBLL 4PG9B 3QEUB 2CMRH 4X6BB 4RMWA 3W0WB 3ZSTA 2E7HA 4YBLB 4I9WE 3JV6A 5IVZA 4R96B 1FNGA 3TJHD 5C0CA 4S1DD 5DTFA 3RX7A 3MV9D 5AD0B 1F4HA 5IVZB 1CFTA 3ARUA 3C60C 3DRTA 2HT3D 5SX4I 3BKML 1XGQB 2PUQT 3U0WH 1WAAE 3PV7A 1T5WB 3HC0A 4HLJA 2GFBA 3Q6FA 4QRPE 4U2YA 2R2EA 4M00A 3VXOB 2GFBB 2KZWA 4L3EA 3G6DL 4LARL 2AGJL 1DQJB 4MWFA 1BQSA 5M95B 1MREH 4EUPH 1YY9D 1DLFH 5CILL 2NY4D 5EZOH 5E8PB 3TM6A 4MWFB 4LF3A 5EO1A 5FFLA 4KVNL 3MV7D 5C08B 5IWLC 5TFSH 3ZHKA 1QBML 1UT9A 1QNZH 5DWUH 3DVNB 4GRWF 2NR6C 3DMMB 3OR6B 1UZ6F 1AGCB 1W72A 2R56L 3UYPA 2I9TA 1S9VA 2YWZA 5IEKA 1W72B 4KQ3L 1S9VB 5IEKB 2DBLH 1HEZA 4Y1AA 4FFWC 4LQ1A 4OTXH 4Q2ZA 1YY8B 4S11A 4OLUL 4XCNB 1KB9J 1MCWM 4RWYH 5HGAB 4X99A 2BZDA 3SDXB 2X1PA 2VL5B 2W65A 3BP5A 3SKOA 3FJTA 3TESA 3LKNA 1G7PB 3BP5B 1HHGB 4M1GH 1KC5H 3ILPA 2RAMA 3CZFB 5F72S 4G3YH 4PP1C 5F9OH 3U0PB 4NPYB 1PJ9A 1G84A 2WBKA 1BWMA 3MLYH 3O9WD 1BMGA 1CFNA 4HIXL 3R0NA 4JQIL 3PWVB 4Z7UB 3RY6A 3B9AA 3H0TB 5CZXC 3D87B 3BPLB 3PGCA 5D7JB 4FQXC 3FL7A 2MQCA 1MH5B 2MKLC 2ZUYA 5FYLE 2H1PH 4JR9L 1CN4A 1ZT1B 3TBSB 2HN7A 4AEHL 5D96B 3KPNB 1WTGT 4D0CB 3DX6A 4KK6C 4N1CA 1ZHBA 5E2TL 3TV3L 1FN4B 1IC7L 4K9EC 2RBLA 5E9DE 4M7LL 2VXUH 4RX4A 4O00A 3T3PF 3CFIC 1IAOA 1OY3B 2HJLA 4PJHE 4KUCD 3AXLA 3PDDA 3FRUB 3HZYA 1F5WA 1PSKH 2HJLB 3FRPG 2YBRA 1IFHH 1S9XA 3AXLB 5TDNA 3HZYB 4EI5A 2YBRB 4QHLB 1S9XB 1MIML 1L0YA 1MI5E 4K94H 3QIWC 1AIFA 5JMOC 3GIZL 2HA1A 3WBDA 1SBSL 3SDAC 3F7YB 5EZLB 4F3FB 3BIKB 1I4FA 1VADA 4GG6F 1K8DA 3WIIL 1RIHH 5F9WB 5A1AA 3JXAA 3SKMA 1I4FB 4AEIL 1A7OH 1K8DB 3BDBA 1RMFH 3TZVC 3SKMB 4KI5C 4MX7A 4LSQL 1RY7B 3UTSB 2YMXH 1JPGB 1DBKL 1A22B 4BK4A 3EOTH 2DTML 3DIFB 4JPKL 1IKFL 4LIQL 1S7WB 2XV6B 1IQWH 3T0BA 3ETBF 3WLWD 1A14H 3X3GH 2VC2H 4B7LA 5E8EB 3MLZH 4MAYA 1X5AA 2A0LD 5KVEL 1HHJB 2ERJB 1K3ZA 3S36X 3QEQD 1XR9A 3O3AA 5B39A 32C2A 3VXPA 5DK2A 4ZUSB 3O3AB 2OLDA 5EC1B 1JYXA 5D71L 4Z9KB 1DP0A 3LZFH 3WIHH 5IT2H 3L3DB 3T1FA 1NSNL 4FZ8L 1PDKA 4PJIA 2G60H 3T1FB 4HUXA 2BNRE 3D69B 1NCUA 2D9CA 1NCAL 4YQXH 3VFNA 5F8RC 5DO2C 4JDTL 3SDYH 1AGBB 4YH6A 2CLRA 1YPZF 1UM5H 4I3SL 4WUKH 4J3TA 1MJ7L 1YQVH 3W0WD 3L95A 1YMMA 4HPOH 1OAUL 3QUZA 3TWCH 3OJVC 1JNNL 5TDPB 3QUZB 5C0CD 3S35L 1GAFL 4CW1A 5F88B 1LMKA 5FHBH 1J1OH 4HJJL 4YFEA 1B4JH 2ARJB 1JNJA 1FBIL 4XPAH 3U4AA 4M3KB 3UP1A 5K9OB 4XBGA 4OFKA 1BIIA 1OAXL 1J88A 5JQ6H 5CKGA 3P0VH 1I7TB 2J6EA 4Y4HA 1A9EA 2E9WA 4L3ED 2HVJB 5DI8A 4M7ZC 2VDOL 5GGUA 5JDSA 2A1WH 2DDQL 1OT1A 4DW2L 4KZDL 2YSSA 3S3PA 2IANE 2A9NL 1A7QH 3MRMA 5FGBC 1IGMH 5C70A 1BFTA 2JB5H 2YSSB 1JYVA 3K74B 4LCIL 2OSLA 4JB9L 1LK2A 3DMMD 4LRNH 1O7SA 5TE4H 2EE6A 1FC1A 1IM9A 4H5SA 2OSLB 1TQBB 1G1CA 3MRGB 1L7IL 4O5LH 4H5SB 5DD1H 4OZHA 3BZEB 1R5VB 2Y7QB 4K7PL 4OZHB 1CG9A 4NFDA 5J6GA 5DJXA 1ZS8A 2P42B 3IAGC 5ESVA 5GGSA 1ZHNA 1EFXA 2CRMA 3H7LA 4DKFH 5DJCB 3IKCA 4HDIB 4HIEB 5GRUL 1EFXB 1OB1A 5E8DL 2E27L 4XCEB 4Q9RH 4XPBH 1E4JA 1KCSH 3UDWA 1WISA 5I18H 3WXVH 1I7RA 4ODVL 4HPYL 4MJ4A 1QSEE 4JKPL 1AGEB 4IRSA 1R3IL 1KTLA 4OD2A 4OCXL 5FYKH 4C56A 4LGPB 3NVQA 1EX0A 1D6VL 5AUMB 1QPXA 4OCSH 1RJYB 3LDBB 3QFJE 4FQLL 4XWGL 1KF9B 1UM6L 2PYFA 3IU4L 3D9AH 3OAZH 4DKEL 3ZSSA 1INEH 3HLAB 2LU3A 1WK0A 2PYFB 3O4OC 1CK0H 4HJ0D 4TSAL 2V5SA 3T4AA 2ZUWA 3RTQB 4XP9L 3C5SA 4ZD3L 4JPIB 1VFMA 4HXBH 2WINA 1B90A 1N26A 1QYGL 3MBEA 1A6AB 4XPGL 2YD8A 2WINB 1EZVX 3TT1H 1BQHA 2BVPB 4ESKA 3LEYH 2KUTA 4XAKD 1N0XL 4MJIA 4GG8A 4F80A 1VPOH 3O6FA 1BQHB 5AEAA 5CSZA 2DIAA 3CU7A 1I1CA 1U3YA 4D0DA 5AZEL 4FTVA 3B6SA 4JN1L 5CSZB 1KJVB 2AQ1A 1CDYA 2GUOB 1TJGH 2DQGH 4NZUH 5BW7A 4HMCA 3CDYA 5E6IC 3IJYB 5EULV 3SE4C 4OZ4A 5INCA 3MZGB 3MRRA 1I9JL 4G80B 1ZK9A 2VR5A 3DV4B 3SPVA 5A16B 1BX2A 2IAMC 3QDME 1WWAX 4HUWB 4FQQA 3VGGA 1X5FA 1CD8A 1KGCE 2NY5H 3HI6L 3P9LB 4WNQB 2EH7L 3ROOA 3UZQA 4AY0A 1QLEL 3CXDH 3VXQA 1ZLSL 4W6YB 5EIQA 3KYOB 4V1DE 5FYJU 3AS3A 1SJEB 3V6BR 3K2UL 4PJ9B 3VD3A 1Z0NA 1C5BL 4NJ9L 1KCVL 1GGTA 4HCRL 1J0ZA 3RZCA 2XA8H 2EEBA 4J1UA 2YPVL 4QTHA 4OLZH 1MHEB 4J1UB 2DN7A 1QFUL 3HNTH 4QKXB 3EDEA 1NGWB 4LL9A 1FL5A 3BGFB 1NCNA 1E27A 3E3QC 5HVGB 2KBGA 3GSVA 5HYEA 4OCNC 5I17A 1DANU 2DQHH 3RNQA 3V0AC 3INUH 3L7FA 4YHYB 5I17B 3MOQA 3W2DH 4MGXA 5JA9A 3O3BB 2X1XR 2R0LL 4KFZC 4XVSL 4JRWA 3RIFK 3RGVC 1AKJB 5HDBE 1I85C 3O45B 2Y07H 4ELMA 1EBAA 3ARBC 2XY2A 3DO3A 1J18A 3EYOA 2CIIB 4HBCH 3WFBL 4ELMB 5T3XD 1IKNA 4XCCH 4HMDA 4LAJH 3EYOB 3V7AE 2EKJA 3RVXC 4ZUVA 2DBJA 4NNPL 1G7QB 2YD5A 1CFSB 1ED3B 2VDRH 2VUOA 4LSTH 4ZUVB 2EIDA 5IB3A 3TFKD 1DANT 4LVEA 1F4WH 1X4YA 5SWZB 3PJSA 4NKDA 3O8XA 4M1DL 3IVKA 2X40A 4JKLA 4CMMA 5E08L 4JVPA 3EYQC 2YD3A 4NKDB 4MCZA 4YWGL 3IFOB 5D6CB 1TPXC 1CE6A 4Y5XB 1Y18B 5KZCD 2DLFL 3EIFA 3OKLB 4JKKA 1YMMD 3W5NA 2DM2A 1D5ZA 1CE6B 1NAMA 4F7CA 3QUZD 1TJIL 1BFSA 1EA9C 5IVNA 2UVEA 3C08L 5CINL 4F7CB 1FH5L 2H9GB 1UB6B 3HI5H 4WU5A 1NGYA 4KTDH 1UA6H 4KTYA 4NYLA 5IMOB 3MLSL 1KXTB 4Z7WE 5F7WC 2VR4A 5MHSE 1NGPH 4NYLB 3CK0L 4QRSA 2ARJQ 4GUPB 1GXEA 5GHWH 4UDTA 2XWBA 5JW3L 5JW5A 4QHUB 4UDTB 4Y4HD 2X1WL 4S10A 3IDXL 5EU5A 4MNHB 4NKIH 3RWIA 4M9PA 4PYGA 3QG7L 4MJ6B 2GSGB 1P4BH 2NY6C 3OJ2C 2WZPD 3E0GA 1MEXH 1WAAF 4W70A 3WL9B 2FECL 5IB5A 4OM0H 1PBYA 5GRVL 1IM9D 5JHDE 3KDMB 5GGVL 1MPAL 4PJFE 2X1QA 2H6PB 2BY0A 2PW2A 1KTRL 3RZWA 2W1NA 1UXSA 3CX5K 4XNZB 2QBWA 5DLML 4WEUD 3VFTA 4U3XA 3QG6A 2BJML 2AVGA 1EFXD 2YR3A 4PJ8C 3VFTB 2Y9RT 3NCBB 3HRZB 4OSUH 3BQUA 1GRWA 1AD0B 1EEZA 1I7UA 2X44D 2GQHA 4QTIH 1HQ4A 2AV1A 3NZHL 3BQUB 4IRSD 3R1GH 1I7UB 5L6YH 1X5IA 2AV1B 4C56D 4BQBA 1W0VA 5KSAC 3KXFB 3ZTNL 4UUJA 3L3JB 1OP9A 4JFZH 3GSUA 5T3ZH 3RTQD 4UUJB 4G8IB 4PJGE 2AJSL 4KKAD 1EEUA 5ANMA 1XF2A 3H2WA 1JGDA 4LCCA 2ZUXA 5ANMB 5BZDA 4FQJL 4LCCB 5DK0A 2QQLH 1UYWL 5DJ6B 1EHAA 5FECB 2NY3B 2XWJB 2IMMA 5DK0B 1JZ4A 4P59L 1AE6H 4XPTH 4OQTH 4DKDC 3WFDL 3V79C 5I76A 1A6VL 2R9HC 2FECI 2AQ3A 5I71B 3BEWB 3S37X 4LPYA 3TO4A 4LSSH 4FXKA 1QKZL 2B20A 2MCPH 4YXKH 1ZT7A 5D6DA 1A5FH 5CP3A 1D3CA 1PY9A 2FJHA 4JFOB 3WHXB 4TTDC 1UJ3B 4POZC 2FX9H 5EWIH 2YD7A 3SCMA 2X9YA 4RGNE 5LCVL 3QIUC 2VDKH 1NDGA 4AG4H 4OT1H 5EZJB 5SWSA 3SCMB 1D5IL 4PJAE 4KC3B 1SY6L 1AO7E 5SWSB 4HGKC 5C1MB 5FCSH 2ICWJ 1CF8L 2X7LA 5C0RL 3NIGE 3JTSB 3U83A 3IFLL 3RWGA 2V2WA 4HG4K 2OQJA 4NQCA 1UWGH 3L6FA 1J10A 1VFAA 5I74B 5ICXA 2V2WB 1MRCH 2A6KB 2ZPKH 3GSQB 4P49A 1BF8A 3HMXA 5EC2B 2OJZL 4ZFZB 5F6IC 2KQMA 3HMWH 1ES0B 1U95B 1IEHA 4I0PC 4KROC 4CAGA 3WUWA 4L8BA 1GVIA 5HYSG 3OAUH 3D85A 1NUGA 4ONFH 5KSVB 3RL2B 1BVLA 1YA5A 4L8BB 1GGYA 4PBWD 3IU3B 1BVLB 1NBVH 3SGKA 1JN6A 1V7ML 3I2CH 4KHXH 5C92A 4OFYA 5IFAL 4OGAC 4OD3L 1KELH 5EORL 1QSVA 4ZS7H 1MAKA 2ZZUT 4XP1H 2F5AH 5FAAA 2EE2A 3FQWA 4JG0H 4D8PA 4ZXBA 4G6FB 4U6YA 4O4YH 4OFIA 3JZ7A 5DUPL 5L0QB 1IZJA 1JE6A 3FQWB 5F9DC 4OV5B 1BEYH 4OF8A 5DRWB 5CZVL 1B4RA 3IDMA 3V5DB 1YUHA 3JV4A 4PRIA 1MVFA 5KVDL 2H3NA 3R8QA 1CXKA 4OZFG 4MXQD 3DI2B 2AEPH 5EUKA 4PRIB 2H3NB 1WITA 4K23H 3THMH 4M5ZL 1MRFH 4BFIB 5BO1H 3VFOB 2X09A 1WV7T 5ACZA 3MA9L 4BA8A 3HC3L 3S88H 2XTJC 5ACZB 4FMFA 5MEPA 2BVUA 4MB5A 4AQ1B 2VO5A 5MEPB 1MLCB 3MRDA 1ZXQA 1DBBL 4JVUA 3GEWB 1FNSH 2O5YH 3O3DB 3DI3B 5AAWA 1G7IB 5D2NE 5IR1B 12E8H 2R29H 4EN3C 3WSQH 3QULA 3VXRA 2GY5A 5DUBA 3STZA 4LSVL 3T09A 2OTWA 3NPSC 5B38A 3ZDZE 3ARWA 1INQA 3MOAL 3MLXL 3STZB 2I25N 1CYGA 4LCWA 4BSWA 2YKLL 1U8LB 2YD2A 4QWWC 1IGJA 1ZT4A 4LCWB 1FVDB 4NQTA 5F9JB 1ZT4B 4S2SA 4XCFL 1C1EH 3V2AR 4S2SB 1CU4H 5DD3H 3ZKMC 5JNYA 5ETUB 4M7LT 3FZUC 3ULUH 1WUNT 3X12A 3MYZA 1FNLA 1IGCL 2OL3H 5JXEC 4KJYA 4AENA 4X7EC 2DJSA 1J0YA 4HIJA 4XT1C 1ZWIA 3BD4A 1KIQB 4YDKL 3GHBH 1WAAA 3MLRH 4HF5H 1ONQA 3TCLB 1ZWIB 2DMKA 4QRPA 3TT3L 1EUUA 5HDOA 4FG6D 1ONQB 2DQCH 4GS7B 4YR6A 1U8IA 3WIFB 3BQUD 5FO7A 2HT2C 1U8IB 4FP8H 2HKHL 4XBEH 3V6FA 5M94B 3KXFD 2LQRA 1QLFB 4TNVK 5T5NG 4WI6A 3TP4A 2C3VA 4JFHE 4APQB 1RZGA 2J8UB 1CDGA 2HH0H 2C3VB 2AJYH 4XVTL 2W9DL 1BJ8A 2AXGA 1RZGB 4P48A 5EN2B 5JLZB 2H32H 1CDHA 4EIZC 3FT3B 4JY5H 3L1OH 5CJOL 1U91A 1DFBL 3SDXF 5FM4A 1ZEAH 1KEGL 3Q5OA 1GHFL 1U91B 2CKBL 4R8WL 4HV8A 4OZFH 3ZT6A 2NY3D 4H1LG 5D93B 1U8QB 2HJFB 1EVUA 4U4BA 5F3HA 1KT2A 5I1IL 2DQFB 3Q0HA 1MFBH 4HIIB 1A3LL 1KT2B 3HG1E 1UWXH 2GSIA 3V6OC 2BCKB 1T1YA 3TPKA 3OSKA 3TO4D 4K8RH 5D1ZA 4HKBA 4Z7UF 2DKSA 3S4SA 4YHZL 5D7LB 4HKBB 2R0KL 2CRYA 3S4SB 2QSQA 1XR8B 3QXTA 2VN7A 5KBNC 1EJ6A 4X6FA 4XCYA 2D7PA 4MJ5A 1SVZA 5I1EL 1U8PB 1NL0H 4JDZA 1N6QL 4X6FB 2C5DC 3SCMD 3TEUA 3ECBA 2IG2L 2GIYA 4H88H 1E6OL 5K9JH 5L88L 5SWSD 5EG6C 1AHWB 1YEIH 5IHBA 4QXWA 1KXQE 1TMCB 5BVPH 1FE8L 4Z7VE 1ZHLA 3F6IA 3T77A 3U48A 1JP5A 2DQUH 3MJ9A 1ZHLB 1MFAH 3T77B 1HKLL 5HDQH 3UAJD 4RMUA 2P5EB 4KUZH 3EYSH 1KG0A 1KPRB 5AYUH 1GC1L 3ZDYE 2MPAH 5E9DA 1RUAH 3FN0H 4ODTH 4JM2C 4KMTH 2ADGA 1C16A 1FO0A 1WQVT 2B2XH 4PTUA 4PJHB 1V3KA 1AQKL 2CO6B 4JANA 1FO0B 4JQXA 1U8NB 2MHAA 2NZ9C 4PTUB 3WJJC 3GM8A 1NANH 4JANB 3EYUL 4J3SA 1MI5A 2MHAB 4NN5C 3D85D 2NY2D 3WFCH 1C08B 2JJUA 3NAAL 4L4VA 4GKNB 2JCCF 1Q9LB 2XWTA 1W72L 4OFYD 3DJ9A 1L0XA 5ADOH 3MNZB 1TCRA 3LOWA 3RUGE 2HVKA 1XGPB 3PP4L 4OZFB 4X80L 5J1AB 4ZXBD 3B2UD 3TA3C 3IDJB 1PEZA 4MA7H 4Z0BH 1JWUB 5BZWA 1QA9B 4Y2DC 1N8ZA 4PY8I 5MP6L 5K59E 4LDLB 4XVUD 4PRID 4U1GC 5IHUL 1LE5B 5DGRA 4YEEA 1I3VA 4DZBA 4CVXB 5J8OA 3VRIB 3OR7B 4K2UH 1W8OA 3IJHA 2P4AB 4DZBB 3DX8A 3VFGH 1I7ZB 4DJMA 3W11D 3N1QC 1IGYB 5JO5B 1HHHB 3DX8B 3HR5A 2DS4A 1LHZA 1U3HB 1HHKA 4LAQL 3N1PC 4LRIC 1I8LA 1T21A 1Q0YL 3QHZL 1BREA 3GJFA 3FB7B 1MHPL 3M1BB 4JY4B 3GJFB 4WW2F 1JHKH 4CBPA 5HY9A 1CLYL 4I18A 4JFPA 4X7SL 1U9KA 3VXRD 4OLXL 3FB5A 5DFWH 1A6TB 3CDGA 3U46B 2K7QA 3SQOL 2BNRA 3ZE2E 4LCWD 5E56A 4ERSL 3FOLB 3PL6A 2HRLA 5IBUB 2VSCA 1QRNE 5DXWA 2B0SL 1QFWM 4JRXE 4YHKL 4ZO8A 4M48L 5D1QA 4MNGB 3WXWH 3MV8B 4I9WD 3OKMA 5K93A 1FYTB 5JOFA 1YDPB 3QYCA 1H0DA 2LTQB 2LV4A 2V2XB 3KPQB 3QNXA 4OLYL 3ZDXE 1JBJA 4HS6A 5HHXH 4OGXH 3HNVL 3PHOB 4OLEA 1RUQH 3B2VH 2VE6A 1KB9K 3GM0A 3MRHB 3CX2A 3V6ZB 4QRPD 1JGVL 3WCYA 3I6GA 4B41A 1J87A 3JWOL 5ISZB 4BSJA 1CGYA 1BZ7A 4PJFF 2X4NA 4FMKA 4UNUA 3G08B 4YAQA 3A6CH 4GBXA 2B1HH 4PB0L 3CFBA 2F19H 2IANA 4APQD 1P5UA 3CC5A 2KPNA 4GBXB 3ULVE 2IANB 4TVPE 2P7TA 1CXHA 3CC5B 2A9MH 4HIHB 4WRLA 2DLGA 3T0EE 1Z0MA 3TBWA 4H1LB 5ID0B 4YHOL 4KV5E 1QQDA 3VMNA 4YUEH 1HNFA 5LAXB 5E4IA 1I1YB 5CEZH 3O2DL 3VFSA 1NFKA 3RWDB 3LRSA 4NJAH 3C5ZB 4LPUA 3LRSB 4P2YA 1CDBA 2J4WH 3JTTB 3GSXA 1DTUA 1QSEA 3E8UL 5H94A 4LHUA 3L3HB 5JIKA 5TF0A 1JNLL 3L7EA 3QFJA 3T65A 3VRLF 2F53B 1HH6B 1T03L 4OF7A 4DWHA 4KKCD 1Q9WB 3W5MA 4HH9A 2A6IA 3PWUA 4UV4H 4EKXA 3KYAA 4HH9B 4G5ZL 3PWUB 2BNUB 1IBGL 4PRHE 5E4EC 3MGAA 3PWPE 1QSZA 5FCUH 3U7AA 2VDLH 2GCYB 1N4XL 2EDWA 3QZWA 1IFHL 4UAOB 5FYLD 1AQDB 1VEPA 1F6AB 1WZ1H 4AT6A 5HVHC 1NQBA 1ZVSA 2OMNA 3PNWA 4NUGH 3QPXL 5H2BB 3WS6A 3QUMH 3PNWB 2YC1A 4RFNC 1DVFA 2YC1B 3FB6A 1XMWA 2UWEE 3C09C 5E9DD 4RAUA 2F8XC 3S37H 2J6EL 3D18A 3EKCA 3V4UL 5LXGL 3RAJL 2V9RA 2VLKB 2ADFH 3D18B 1RMFL 3P2TA 5FV1L 3VD9A 1T89C 3DUUA 6FABL 2YMXL 5ALBL 1MF2H 3I50H 3DUUB 1WSST 1MI5D 3QDMA 1J0KA 1RJCA 4XC3H 4EUPA 3CSGA 3Q2CA 3RU8H 2Z8VC 3QDMB 3CFJB 1IQWL 5T1MB 5AWNH 4Z78B 1G7MA 5FOBA 5SV3A 4V1DA 4UU9A 3QCTH 2DM7A 2VC2L 1OGTB 1G7MB 5FOBB 4DGIL 2BSED 1MSPA 4UINH 1LO3H 2GK0A 1DLHA 1X6NA 1AGFB 4JFEE 5EUOE 3TYFB 5KSUB 1WFUA 5L9DH 1DLHB 3D1MC 4FQ2H 3KJ4C 1H3PL 3U2SB 4X5XA 3I3EA 5JIHA 3NCCB 1ACYH 3K1DA 1PX3A 2Q8BL 3MLWH 4JFYB 3JVGA 1JRHH 4F9PA 2OXHA 1BD2E 1JYWA 4GKSA 2R1YB 2P24A 3T08A 1NBYA 5LJYH 3F12B 2P24B 4PTTB 3PIQA 3C2AL 3SDCB 2NY0C 3PIQB 4I4WA 4OIBA 4JO3H 2CDFA 5IG7A 1HYSD 2VZSA 1RIVH 4Y4KB 5F6HJ 2C1PB 4HWUA 4Y0GA 3CUPB 1R6VA 4PG2A 3QFDA 1ZOXA 1EJOH 3BKYH 3GIVA 1TVHA 3VFPA 4LVNC 4XVJL 4QHMA 1KTDB 4Z77A 2BNRD 3WMSA 1T0MA 3HZKA 4O9HH 4Z77B 2Q7NA 4Z8FH 1T0MB 5EU6B 4LSUL 4DTGH 4H0HB 3GUTA 4NQUA 4WW1A 1GGCL 4W4OA 3GUTB 5J57B 5JPMA 2EDEA 5D1QD 3ZKXB 4MQ7B 2B5IB 3BD3A 3ZDZF 2DJ4A 5JPMB 1AP2A 2X4PA 4O02L 4M7JH 4HBQA 2GK2A 4Z7WA 4F57L 1AP2B 4NO0B 2JB5L 1AR1D 1UCBL 3UC0H 4Z7WB 1F4YH 4O51A 2BSRB 1FPTL 4OZGE 1DE4A 4YBHA 3UX9B 5I1AA 4W6WB 2H45A 5F1SA 3OBAA 2EYTB 4KZEH 2ADIB 3C8KA 4J4PA 5I1AB 5HYJB 2WUBH 2NNAA 4HFUH 2Z31A 4I2XB 3MX0A 4PRAB 3V5HA 1GZPA 1QFOA 4KVCL 4JN2A 4ORGA 3BP4B 2NNAB 3F5WA 3UJTL 5E95B 1D9KA 4GBXD 4JN2B 3U79A 2IAND 2JKXA 4IOIA 5KG9B 2I07B 4Y16B 5IMKB 2DLEA 2F8VA 4Q9RL 1B2WL 1XGTA 3TVMB 1OP5K 5CGYC 4Z18A 3QIBA 3WXVL 3FTGB 3C6LB 5JHDA 5KW9H 3WKNA 4IHOB 4U6XB 4PJFA 1KOAA 3BPOC 4S1DC 4HZLA 5FYKL 3EZ8A 4MCYA 5TQ0H 5D9SA 3EFDH 3D9AL 4NZTL 2WLZA 2HT3C 4UDUB 3PG2A 1EMTH 1BFOA 4XMLH 1A4KB 1EGJA 3ZKNC 3KPLA 1XF4A 1KN2L 2IBGA 4L3CA 4N1EA 2XZQH 3DYOA 1XF4B 3I75A 4DZ8A 3P9WB 5T5FL 4IRJC 1OAKL 2J2ZA 1QSED 2VB5A 4HC1H 1H3VA 4DZ8B 1NEZG 1MJUH 4BZ1L 1GGUA 4LHUD 2PN5A 4OFVA 2Y06L 1TETH 3RVTC 2I9LB 5EBWB 4JFDB 2EC8A 2ICWB 1OTTD 5EOCJ 5KVFH 1VPOL 2ZJSH 3LKRA 3QFJD 2EYRA 4P2RE 4G8EA 1D7FA 2EYRB 2PO6B 4S0SD 4G8EB 5C0AE 3TBVA 3KLHC 3D3VB 4PJGA 2CXGA 3TGXA 3V8OA 4HWBL 1Y6NR 5B8CB 5D7SH 4PJGB 4PR5A 4P46B 3FONA 4PR5B 1JL8A 1EHLL 4GAJH 1QHPA 4WENB 3WD5L 1PG7H 4LLVB 4ODXB 5E2VL 4HFWA 1QG3A 2APBA 1MUJB 3B4NA 3KS0H 1FZJB 3SE8H 4YHLH 4ZAKC 1T7VA 1DSFH 2UYLB 4JKWA 4LEXL 1DVFD 5I8CB 1N0LA 3RVWD 4DUXA 3GMPA 4HKXB 4N8VA 4X8JA 2OS7A 2X70B 2C4XA 4Z7VF 5C0IB 4Q6IB 3GMPB 4NRXA 2A38A 3PP3K 4RAVA 3MXWH 4Q6YA 3STLB 5JORA 4F2MB 4G8GE 1FORL 1GIGH 1DCLA 1KJ2H 5D2LF 4PJDE 4FFYH 3QDMD 3X17A 3TBTA 4RISL 1CGXA 1KGCD 4JEGB 4K07A 5KANG 1U8KB 3ARFA 4E42A 3GSOB 5F1IB 3ZT7A 3I3BA 2E7MA 2XNAA 4V1DD 4PJAA 1S7QA 2QEJA 3ZE1E 1AO7A 4LP5A 3ARQA 1DEDA 1Z9SA 2XNAB 4PRPE 2D7QA 4PJAB 5C8JA 2BVQB 4