1RJCA

Crystal structure of the camelid single domain antibody cab-lys2 in complex with hen egg white lysozyme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
123
Chain Sequence
VQLQASGGGSVQAGQSLRLSCATSATSSSNCMGWFRQAPGKEREGVAVIDTGRGNTAYADSVQGRLTISLDNNTLYLQMNSLKPEDTAMYYCAADTSTWYRGYCGTNPNYFSYWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords camelid heavy chain antibody
publication title Strong in vivo maturation compensates for structurally restricted H3 loops in antibody repertoires.
pubmed doi rcsb
source organism Camelus dromedarius
total genus 29
structure length 123
sequence length 126
ec nomenclature
pdb deposition date 2003-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rjcA00
3OR7B 4YFLI 4YHKL 4Q97A 1KLFA 2APBA 2VZOA 5KW9H 3S34H 4TSAH 3ARQA 4RA3A 1SY6H 1N0LA 2N7BA 1WFNA 3PGCB 4WU5B 3V7AG 4MCZA 1Y18A 1P6AB 4QY8B 2VZ1A 4XBEL 4PJEE 4PLNC 3EKCA 4XTRD 4P5KA 3WIHA 4YXHH 1OAZL 3KPOB 1OD7A 1K2DB 2IPKA 5TF1L 3KYAA 3S5LG 2WWMC 3TVMA 4ZUUA 3VDAA 1ADQH 4JZNB 5IVXF 3FHQA 1CFTA 5F7WC 5T1LB 3CIQA 3VXSB 1R3IH 3T2QA 3TEUA 2XI9A 3GHEL 2DM4A 1OTSD 2GFBA 1FGVL 1IC7H 4NKOB 3HAEG 3LQZB 4M6ML 1HKLL 1RIVL 1EBPA 4QRRE 4OZIB 1Y6MR 3GUTA 1VEPA 1DBBH 4NC1C 1IC4H 1AR2A 2OX5A 4HSQA 1CS6A 1AR1D 4MAYA 3TVMD 1HXMA 3EO9L 4KQ3L 4PRPA 5F9OH 1G9ML 5D7KD 1UB5A 1Q1JL 3OZ9H 2FR4B 4FHBD 1I7TA 3LVEA 2ATPA 2A2QT 3MR9B 4ODXB 4UINH 4L4VB 1IGJB 1U6AL 3NFSH 5CEYA 1FL6A 4MA7H 1RFDL 2OM5A 2E9BA 3OKMA 5HDQL 1K5NB 3PP4H 2BCKB 2FSEA 2HFGL 5K33A 4HXAL 3ULVC 3NAAH 4U6XB 4NP4H 4WWKC 2YUXA 2VAAB 3IGAA 2GJ6A 4MAYD 1XMWA 1GHFH 3BEVA 3Q1SH 3LQAL 1TZGH 1IGTB 1N6QL 5EWIH 3IDNA 4YEEA 1UWXH 4G7YL 4QCIB 4M8VA 4QWWD 3IDIA 4CMHC 4ZPTB 4OZHE 5ITFA 3TNMB 1TJGH 3GGWA 3VFGL 3KPQA 2IG2L 1NAMA 3AU1A 1JUFA 4RAVA 3L3DB 1R5WB 3RWEB 3QQNA 1UJ3A 5FHAL 5IT2L 2X4NA 2HLAA 5LBSH 1A1NA 2VSDA 4O2FB 1BLNB 1U93B 4ODSH 1S7WA 2ZUQB 2A77H 32C2B 1KJMA 4N5ED 1PD6A 2WWKO 4OAWA 2VDPH 4NPYB 3VMPA 3FQTA 3U4AA 4DKFL 3IKCA 3GMOB 1OP5H 3ARBA 4D9LL 4MNGA 2WMPA 5FK9A 2W9DL 4LSPH 3UPCA 3SKJH 4HAFA 5EO9A 1FNFA 3B9EA 1CL7H 1SJVA 3FO0L 1WSST 4LMQE 4LLVA 3IU3B 1YEIH 4GAGL 2AEQL 4PJFB 2VNCA 5I76A 5HGAA 1UA6L 2H6PB 1URLA 2V7NA 2VIRB 5ACLA 4D0DB 1KTDB 3WJLA 4CDHA 3OHXB 2EKJA 3W39A 2HH0H 1UB6B 3VH8B 2BSED 5HSFA 4NO2B 3VFOB 1UWEL 4KRLB 3KPRE 1MY7A 3TPUA 3DBXB 3I84A 3ARBD 5CKAA 4JG0L 4QTHB 4WDIA 4NFCA 1GIGH 5IB2B 3UJJH 5I15H 5AEAA 3TBWB 3B2VH 3HPJA 2DWDA 5C2BH 4OV5A 2F9BT 1P7KB 3BSZH 4QHMA 1H5BB 3MV9A 2EE3A 4I0PC 1GC1C 4MQXD 1G0DA 4ZOAA 3Q5TA 3ZDXF 3D25B 1XF4A 3MUHL 2CRMA 1IQWH 3VRLF 3SDDD 2OK0L 1S5HA 1BVLB 5CFHA 4EDWH 2DKUA 2V9QA 1A14H 4QRTA 1VFAA 3K2MC 3MRIB 5F7FA 4IRJC 1K8DB 1QP1A 2C3VA 1T1WB 2ADGA 4Y4KB 3GRWA 2ED7A 3NPZB 4ENED 4MJ6B 1OSZB 3ARPA 3MV8A 2IALA 1XR8B 4OCYH 1GZQB 3O8XD 3MV9D 3UTQB 4KK9D 2D31B 3S36L 3E6HA 3RAJL 2VLJE 3PHSA 2AJ3A 3GBMH 5D2NC 5FECA 3RGVC 1IEHA 2LU4A 4OQTA 5JMOC 5J13C 3GBLA 4HIIA 1BOGA 5EZLA 5DDHA 1BVZA 4MCYA 4ZTOH 5I1AB 2OMBA 3VXOA 5I17A 4OBRA 3WFEH 1F4XH 4MS8D 3H8NA 1WWAX 3ARVA 3VD9A 1LP9B 1PG7X 4S0SD 3RPKA 2NR6C 3C60D 2QADD 5D1XA 4KTYA 3MTRA 2GSGB 1T04B 5GGVH 4HUUB 3MV8D 2XTJD 3MRHA 2DM7A 4OFVA 1FJ1A 1JHLL 4OLXL 1AI1L 1B90A 2X4UA 1MCEA 1NCUA 3O3AA 3QRGL 2WUBH 3EJZD 5FYJU 4F57L 2K1MA 2XKUA 3AB0C 3RHWF 3U7WL 1HWGB 1PY4A 3WS6C 2YPLB 3VFNA 3WUWA 2DRUA 4HIEB 2A6KA 5DQJA 2DDQL 4OCXL 5BS0E 3MROA 3REWB 5D1XD 2GQHA 3Q6FA 2BMKB 4DVBB 1XGYH 3RX7A 1CFNB 1FNSH 2VDQL 4ZFZA 3VXQB 4JPVL 3MV7B 4H25B 1V7NL 1SJXA 4NQEB 2BNQE 4ELMF 3TIEB 3PHOB 5CMAA 4DZBB 3VFUA 4KK5D 4QXUH 3VW3L 4XC3H 1G1YA 2IQ9L 3VGBA 1R5VA 2CIKA 2EC8A 3MRKA 4PJ7E 4XVTH 1D5XA 3T2NL 1VFBA 4W70A 1G84A 5JW4R 5MI0B 1IAOB 1JPGB 3OF6A 1L7IL 1H15A 4XNYL 4XVJH 5I1IH 4YHZL 3RWFB 1JRHI 2Y5TB 2O5ZL 4LHUB 1DUZA 3FT3A 5ESQA 3WNMA 4X5XB 4PRHB 1BX2A 3N1QC 4ERSH 5C6TL 4JHBA 3SY0A 1QFWI 1F4YH 4NIKB 3GMNB 1MWAA 4EUPH 1BGXL 4O02H 3BP5A 5BXFA 3T0EE 4G3YH 5J1SC 5CHNA 2X4QB 3MXVH 4H1LB 2DN7A 4M5YL 4GMSL 4QGYA 5I66A 4CN6A 1ITCA 3O6ML 5D8JL 4NKQB 3FO9B 1S7QA 2C4XA 3V6OC 2D7MA 4CRPA 3ZKMC 1CXLA 1MCWW 4YPGB 3NCJL 4K94C 3RVTD 1RZKH 5T3XH 1RZJL 2R0LH 4FQLH 4LLMA 4XMLH 3NOIA 1TENA 3VG9B 3VGAB 4MXVE 2CKBB 1ZV5A 4UNTA 3LSOA 1DP0A 3GK8L 4JO2L 1EXUA 2QBWA 3QQ9C 1A9BB 3IS1X 3ZT5A 1G9EA 1N59B 2NZ9D 1QEWB 3RVUC 4LSUH 1Z6JT 3C6LA 3MJ8B 3CLFL 3T8XA 3WFDH 4HG4K 5HHVH 5JDJA 1NDGA 4FABH 2JCCA 4IOIB 1JCKA 4I2XA 5DHVA 2VLKD 4XH2A 4YK4B 3F58H 3DV6B 3BQUA 1LE9A 5CD3A 2JJTC 5DC9B 1EAPB 2CLVA 3UYOD 1UQSA 3GM0A 5IVZA 4M6OH 1T4KA 1DEEA 4YC2B 4NN5C 4NZJA 3WNNA 5TDNB 5A2JH 1JTPA 2ZJSH 4X4XB 5C08D 4LNVA 3UTTE 4NQCE 1U8HB 3W5MA 3QXWA 4D9RD 4X6CF 1R24B 3C6LD 3L3GA 3B9DA 2EC9U 5DHYB 4PJXE 3OKDA 2XG5A 4W4NA 2ZKHH 3IDGA 1FO0H 3EYFA 4AM0B 2AKRB 5ITBH 4EOWH 5LWYH 2FSEB 4RMVA 5I16A 2R9HC 3BQUD 3QO0A 3JWOL 5SWZD 3RVVC 3HAEA 5IEHA 3P4NB 3N06B 5JLZA 2IPUG 3LAFA 4XPAH 2FECI 3QCVL 3VFRB 5JTWA 1TVBA 1KXTB 4DVRH 2DWEB 5GZOD 2XIDA 4HGWA 1EGJL 4S1DD 1QQDA 3D2UD 5E9DA 1HEZB 3KJ6L 1VEMA 2JELH 5D72L 4NQXB 3HKFA 4YXKL 3GJFA 4D0BA 5HI4C 2CLZA 1A3QA 5L2KE 3X13B 3FT4A 3LKSB 3SQOH 5E4EC 5IHZA 3HMWL 1ACYH 5SX4I 3GBNH 3ULVF 4OLZL 4AL8L 4JN1L 3V5HB 1HINH 4KK6D 4OFKA 1A2YB 5ILTH 3MRCA 1KB9K 4GS7B 1IAIH 3IKCB 1U0QA 3PXJA 4Y4FA 2UYLA 5E9DD 1HN1A 4OBSA 1LVEA 1WWWX 3ARBB 4MNGB 1OCWL 2B4CH 5FK9B 3MA7A 1A6UH 3CFKB 4GRWB 4M7JL 1NEZB 3CVHH 3GIVA 4M93B 4NQDD 3BE1L 3RL2A 3BIKA 1NUNB 5HGAB 5C3TA 1NGQL 1T5XB 3HB3D 2NY3B 3V7MA 3CFEA 3SDDB 4KJYA 4C56E 1BQLH 3CNKA 3SDAB 1PGRB 4G6AD 1W0WA 4X8JB 4XP5H 4Y4FD 1IFHL 3CPLB 4LAQL 4HFWA 1LQSR 5ETUB 4MB3A 2YN5A 1KJ2A 1WCBA 3VG0H 4FFZL 5HD8C 1CU4L 4WDIB 5SWSA 3WXVH 5ESVB 4V1DA 1J0ZA 4RAUA 3FFCB 1I8KA 4MQSB 4RMSA 2J88H 1X3DA 5DJAA 4XB8A 4JJ5B 3HC4L 2YUWA 1MSPA 2AEPH 4BK5A 3MZGB 2B1HL 4WI8A 5DK3A 2I9LA 5T5NF 3O8XB 2HAZA 1K4CA 2YD8A 1QPPA 3HZYB 1BECA 3MLUH 2FL5B 3WIIL 1T1ZB 4M1GH 2Z4QA 3ZDYE 4HF5H 4RISL 1MRCL 2QHRL 3FCTB 4TUOA 4F8QA 3RKDD 4TSBL 3WNKA 1FFOB 1YMHB 5IR1A 4J7RA 1B0WA 4ODVL 4LCIL 4NC0B 3I6GB 3WFCH 5SWSD 4M4RA 4V1DD 1XGPB 5DVOA 3C60B 2F8VA 2IH1A 5HHQB 4H88H 3D1MC 4E41A 5T3XE 5D7JB 1JGVH 1YEFH 3P11H 2B5IB 2ZSWB 3DROB 5A2IH 3I3DA 4GLRH 5GGUA 3HZMA 2EYTA 1C12B 1BOGB 1Q9KB 3QG7H 2VXSL 4MMXC 1CDUA 4J1UB 4QTIH 2DQGH 1F8TL 3VGHA 3RQ3A 4L5FH 4XC1H 3ZSSA 3OKNB 1JGDA 1MVUA 1BBDH 3ME0A 4BQ8A 1YECL 2UWEF 3GIZL 1I8LC 4OF5A 4NC2B 4HXBH 4NRXA 5DYOA 1RJZB 1PKQB 4GXUN 5DK0B 4LP5A 4LFHG 5F44A 3P4MB 2D7TH 4FFWD 4HJJH 3S37L 3QNZB 3GSQB 3O3AB 1E27A 3ZE0F 3BZEA 2WP3T 4B50A 4Y5XB 1EHAA 1KLUB 4JFFE 5FKPA 4NKIH 1X5IA 2EKSB 3HI1B 1M4KA 3P9MA 5KSBE 4CVUA 1FIGH 1L7TH 4U1SA 5C0DA 4J3TA 4PJ8A 5JIIA 4R4ND 5EFIB 1I1CA 2IGFL 3FB8A 5CIPB 3SCMB 2OR7A 1BFTA 3O0RL 1KIQA 3C08H 3DPBA 4MD5A 1X4ZA 5EU6E 3QHZL 5F88B 1I4FA 3QXUA 1T20B 4DKEL 1JF1B 3B6SA 1J87A 5DJ2A 4YDLB 3T3PE 5HYSG 2UV3A 2FH8A 1G7JB 4YXLL 1H3WM 2HN7B 3AMKA 1JGLL 4JO4L 3LIZL 4HDIA 4O51A 4PJ8D 1T3FA 5ABDE 1VFBB 4TSCH 4U1NA 3MJ9L 2D9QB 1U3HA 3X3GH 2NW2A 3L95B 2NY4C 4U6YA 4RWYH 1CBVL 3CXDH 5ELIA 2OJZH 1B6UA 1ZANL 2J8HA 3WE6A 4NM4L 2CGRL 5TE4H 4DOHE 4Z7OE 1U9KA 4PRIE 3QQ4A 3G5ZA 4PFEA 2L7JA 3STBA 3P0VH 1MCNA 4YGVA 5D7IA 1KELH 5MEPA 3NIFE 3BP5B 1FG2B 4X4ME 4S11A 2L7UA 5DEGA 3LHPL 4J3OC 5FUOL 4MQ7B 3I6LD 1NCBL 2QJDA 3QXDB 2FJGA 4ZTPL 5KG9B 2VLKB 1C1EL 35C8L 4PS4H 4HT1H 4W6XB 2V9RA 2M1KA 4U1GB 5T5FL 3BUTA 3KR3L 1KB5A 3L3HB 4X6DA 4U6VL 1CFQA 4RGNB 1BF2A 1N26A 4LSRH 3CSBA 3CUPB 5C08B 4HGMA 1Q9WA 2IH3B 2R23A 1D6EA 2Z0BA 3LS5H 4P3WA 1YY9C 3FO2B 3C6LB 1AP2A 2X09A 5TE7L 1NDGB 4G8GB 3RRQA 1AIFA 2ZOKB 1XF2B 5BV7H 5IJKA 3KXFA 4UOJA 4FP8L 3T4AB 3K80A 4PREB 4BSVB 1U91A 2X9YA 5SWZB 2UVEA 1EO8H 3PWPA 4QHUA 1RZFH 5KN5B 1MCOL 2HRPL 1AJ7H 1SVCP 5F1IA 4Z5RA 3C9NA 1BIHA 3O3EB 1FZJA 4N9OB 4XXDA 3S36X 5FOBA 4XNQA 2HKHH 1IKNC 3CH1A 4PJBE 3EHBC 2K9UA 3WKNA 5E1AB 3MLVH 2OR9H 2A73B 4RSVA 15C8H 3MRMB 3D2UB 4PRDA 1YDPB 3DX7A 2SEBA 3S5LB 3BGMA 4BSJA 1MCBA 4HWZB 4P3DB 4YHIB 3EJYD 4IMLA 4WV1A 4ZQKA 3QEHA 2K3TA 1XT5A 5I18L 3KPTA 4P57B 3IETA 4HWEL 1QPXA 1ORSA 5IVXA 1IAMA 3HAEB 1LO0H 2G2RB 4QT5A 5IEKA 4Z7WF 4K7PL 4NFDA 2X7LA 3QA3A 3IFOA 1DLHB 5L6YL 5EC1A 3CFJA 3DVGB 3T0XA 3EOYG 4Z6AT 3QG6A 2YUZA 4IHOB 4PJGB 1JZ3A 4C4KT 4LPYA 4NO0A 5E9DB 1NMCC 3BRGC 3PV6B 3HLAB 5ALBL 1RZKC 5JHDB 2VC2H 4IS6B 5KZCD 2RJMA 4NT6B 2JTDA 1X5XA 5FO9B 3QUYA 2XZCH 4AIZB 4NQDB 4NOFA 3WLBB 3B5HA 5IW1B 3W5NA 3IYLW 3VXTB 4B7IA 2VUYA 4N8CH 1J12A 4XCYA 4XPHL 5J11C 3VD3A 2EZ0C 3D48R 4KHTH 4YFLF 4OZFA 4Y16C 3VDCA 4HJGB 5IMKB 4QRSB 4NO0D 5JW5A 3MNZB 4LP4A 5DA0B 5GGRY 1DQDH 3RI5F 1CLOH 2EECA 1JWUB 3ILQC 3SKUD 3S3JA 4HUKB 1DFBH 4NBYB 3R8QA 3QUYD 5HVHB 3ULUL 1WZMA 4XP1H 1KPUA 1QBLL 1W2KT 4Z7QF 3PWJA 3RL2B 6CGTA 4G6ML 4UTAL 4O5LL 3UTZB 1A1OA 2YPKB 3TNNA 1MAJA 5CEXA 3IS0X 4PY7A 1IGFH 4MXWH 4S1QH 1RUQH 1IQDB 3P2TA 4CVWA 2AV1B 2D7OA 4NQUA 4N0CC 4YE4L 4KJQC 3BPOC 1VFUA 4QOKE 3E2HC 3M8OL 3DSFL 4Z8FH 4ISVB 3FQUA 5IOPB 4KK8C 1C5CH 2PR4H 3E6FA 4XAWH 2BVOA 3MODL 3PHQA 4NJAH 1S7RA 1YPZE 4G9DB 5D2LB 3KPNB 1BMGA 2FLRT 5DURD 5INDB 1NAKH 3ZYZA 4LHQB 3GSNA 5JUEL 4XCEB 3TBSA 1B0GB 1MPAL 5DJDA 1MRDH 4I3RH 2ZPKL 4KKBD 3IF1A 2MCPL 5T5NG 3ZTJH 1A7OL 2P5EA 2A6IB 2XRAH 4AEHH 5I8CA 5GSRA 1BVKB 4ACPA 3Q6GL 2ENYA 4E0RA 3QP3A 2IANA 3MLSL 2LFGA 4CL7A 2HFFB 3EZJB 3TFKD 3I3BA 3O3BA 2AJSH 1KOAA 2HJLB 3GO1L 5ANME 2B0SL 4Z7VB 1HSAA 3SPVA 3OX8B 2IMMA 5L2JA 1OB1A 1RHHA 1RUML 2P24A 3SJVE 1ZT1A 3GNMH 1LEIB 4PY8J 4WFEE 3GM8A 4O4YH 4R0LC 4X7DC 1JJUA 2X9XA 1G7IB 5D1ZC 1NFDB 2YC1B 5IBTL 2QKIA 4GRLA 1HHJB 3TT1H 2HVKB 4WNQA 4A6YH 1MELA 2B4CC 2P5WE 2DQTH 1RK1B 1CGSH 1ODAA 2IAND 4JY5L 3CH8A 1JGDB 5GJTH 2Z8SA 3F12B 4I48B 2C4FU 1UM6H 2EIZA 3GMLA 1CXIA 3QEQA 3RGHA 5I1GH 5IHUL 5I1JH 1DN0A 3KGRA 2NNAA 4K8RH 3U4EA 3HNVL 1OP3K 4PPTA 3C87A 3RIAK 1TXKA 4F7PB 4R26H 5F8QC 4OKVB 1I1FB 4PTTB 2PCPB 1P7QA 1K8IB 2AJVH 3G6JE 4GRLD 5IHLB 2YA2A 1T66D 2BSRB 2CDFB 3SDXB 1IKFL 1RIUL 4X4ZA 1JRHL 2X1QA 1B2WL 1Q0YH 3CMGA 1JI1A 4MX7A 5KVEH 1QSEE 1IT9H 1CTNA 1IGML 3QEQD 4HCRA 1WAAE 3ZE1E 5I1KL 1QFWL 4L3AA 4F37F 4HWBH 2PXYA 1JV5A 2WBJB 3RWJB 5IB1A 1N64L 2OCFD 2FWOA 4JFEA 3W0WA 5F96H 5MEOB 3OJVC 3QIUD 4CU7A 1CFVH 3VXUA 5TGBB 1G7HB 4JZOB 1P7QD 3KS0H 3MOBL 3P0YH 4P2QA 3NZHL 1R5IA 3P30H 5DJ2B 4F3FA 3ZYJA 4ZYKA 1KGCE 4XP9H 5I30L 2E7BA 3JZ7A 3ESUF 1RURH 4NNPL 3NACL 4UV7L 1FBIL 5IB5A 1FFNA 5CEZD 5M94B 4BSWA 1MFAH 1WWBX 2EDJA 2I07B 1LO4L 1I7UB 2PXYD 3FFDB 5DS8A 3CDFA 4IDJL 4JFED 3LS4L 2IMNA 1WBYA 1RJYA 3PQYA 4UIKH 4L8BB 1N3NA 3VXUD 4YGVB 1LDPL 4P2QD 2Z92A 5E95B 5E8EB 3NIGF 2EC9T 4YNYA 3TV3H 1BJ1H 1S9VA 3V0VA 2FIKA 4R4BA 5CILL 2H9GA 3DNKA 4K23L 1DBAL 1G9NL 3PIQB 3IJSB 4L8DA 4CNIA 3ZMRA 5FYKH 4OLVH 2FATH 3SKMB 4NHUB 3WN5B 3UJTL 1TVHA 4TVSa 2EO9A 5I8KH 3KYOB 1YY8A 3H9YA 5B39B 1EERB 4LMQI 5EIQA 1EH9A 1M7DB 5A2KH 3TO4C 1J18A 1YZZA 3EW3B 4ELMA 3PQYD 1U8OB 1W72L 1NGPH 1EEZB 3JV4B 5C8JA 5HJ3B 4JREC 2H2SD 1JPFB 1X5GA 4FQ1L 2GI7A 3W9DB 3CMOH 1LE5B 4I9WE 4WFGE 4RBPH 5D7SH 3Q2CA 1D6EB 1NLDH 4Z7NF 4LIQL 5DJZB 1XGQA 2NY2C 4HS6A 1YEKL 3GSVA 5EC2B 3RFZC 4I0CC 3MGTA 4NBXB 2DLGA 4H8WL 3FT2A 4WUUA 2Y7QB 5J6HB 3VE0A 1MEXH 4XT1C 2MQCA 4X6BA 5TFSH 2QHLA 4YBLB 3VMNA 4PJIB 1I1RA 4ZS7L 4ZFGL 1U91B 5FHBL 4I18C 1SJHB 5F3BB 3H9HA 3TCLA 3STLA 4ODHH 5A16B 4G7VL 5I74B 2IQAB 2ITCB 3EFDH 4WY7L 3TYGL 2ED9A 1IZJA 5FUZH 3CH1B 2R0ZH 2EO1A 4MJIA 1UZ6E 1I1AD 3VXME 1A6VL 1I9RL 4Q6IB 3HMXH 3MC0A 2GYSA 4JPIB 4WUUD 3ARFA 2R15A 3MV11 4YGAB 4IMLB 1QFUL 2APVA 3BKYL 1MCPL 1HXYA 4JO3L 5KZCB 1A3LH 2APTA 4ZD3L 3QPXH 3MGOB 2ZG2A 2GTWA 4LOUD 3IT8D 4OCRL 5F70A 4OZ4B 2OMNA 2V2TB 5F9WB 4HPOL 4JVWA 4JVUA 4NHCL 1S3KH 1NSNL 3CFJB 1MJJA 4HUMB 3EDJA 3VWKA 4G6JH 2DQHL 4MJID 4YDJB 4MJ2A 4I5BA 4ALAH 3LV3A 3RTQA 2EEAA 2R2EA 4FXKB 5HHOA 3HG1B 3D18A 3NABH 2PTTB 2OJEA 3ARFD 4QHNA 3S6CA 4LVNB 3QWOA 4GRMB 4EN3A 5BO1L 3DETD 4PJ9D 2DKMA 4MB5A 4U6HB 4GW5B 1PX4A 4NRZA 3O2VH 5GS0L 4ZO7A 4KPHH 4X6CA 4R8WH 4PJHE 5EBLB 4KU1A 4N8VB 3RTQD 1QNZH 3P73A 5DO2D 3JWDC 4HFUH 5BV7C 1DVFB 5HHOD 5K9JH 1I8IA 4XI5C 2ID5A 4F7CA 1NFIB 4HKZA 1UCTA 3C6SA 1JHTB 4JR9H 3PG2A 4JFZH 2CLRA 4EN3D 3ZHDA 3MCLL 4PV9B 1VESA 1YNKH 1FP5A 2WWMD 5HYJE 4HKXB 4R96B 2V17L 2BC4A 2Y4SA 3L5WB 4UDTA 1CDGA 5IFAH 3VWJB 4PUBL 3NCMA 3O4OB 4JN2A 5T3ZH 3RUGE 1REIA 5IFHL 3DUSB 1ZAGA 4Q0XH 4P4KC 2F54B 1S5IL 2ARJA 1LO5A 1UM5H 3OJ2C 4U7KA 1WBZB 4JDTL 4Q74A 2JB6A 3PHQB 1J5OH 3LQMA 4TVPE 5DI8B 3MUGA 1ZGLP 3BPLC 4KC3B 1J05B 2PF6A 3H0TA 5ID0B 1P69B 1V3MA 4ZO9A 3A67L 5GRXG 2DAVA 4RFEA 4RFOH 1RMFL 2OZ4L 5DD6A 4CU6A 4F7EB 4WU7A 1KCSL 5EIIA 5C0AA 4JFDA 3QIWA 3EO1A 4J12A 1WC7A 2VXUL 2R0KH 1T5WA 2COQA 2DD8L 1CK0L 2GK2A 4JM2B 2VZTA 3O6FC 4HIHB 1IMHC 5E70A 2EDKA 3VXRA 3BXNA 4M5ZL 4PJFE 2EDXA 3H9SB 4N90E 5JORB 4FOMA 2VR5A 3ULVD 1MFBL 4WWKD 3CVIH 2Z35B 1FGNL 3ET9F 4CADA 2EIBA 4NO5B 3IDYB 1D9KA 2Q1EA 3PWLB 2Y36L 3DRTB 5C0AD 1X9QA 3WNLA 1UKTA 1IAKA 2FCBA 3DVNA 4JFDD 4LPTA 5FM5O 2CMRL 2BZDA 3GI8L 4XGZA 1AQDB 4EEEA 1NGXA 2EIDA 1JPTH 1A0QH 1WITA 4BQ9A 5L9DL 5K9OA 1AQKH 5EG6C 3VXRD 3I6KA 4RNRB 4KFZC 1S9XB 4J23A 4FQPA 4X80H 5GGTL 2JIXA 2DTMH 1K4DA 1VKXB 4LRNL 1D9KD 3QIUB 1OQXA 3MRGA 4JHWL 4GG6B 4K7PX 3RWIA 4QHLB 1AXSA 4HH9A 4JFOB 2G5BA 4CMMB 3WIFA 1GZPA 1OWWA 4I77L 3VCLB 4GW1A 5CINL 2H1PL 1TITA 4JKKA 4NN6B 1IILE 2BNUA 5EU5B 3OPZL 3WL9A 4AEFA 3ZTNH 3IFLL 3VI4F 4AG4H 1X5KA 2ZG3A 2JIXD 5IB1B 4M48L 5FDWA 4I0PA 3NIDE 1U8LB 3PP3K 4P2RD 1WIUA 4BYHA 4FTVE 1T2QL 3S98A 4W68A 2EDOA 1HK6A 5I1CL 4OJFH 3GMRB 3VXUB 4OT1L 4P4RB 4L3CB 3QDGB 1NAMH 3CZJA 4JB9H 2UUDH 4YDKL 2FHCA 1A6AB 2YMXH 5GGRB 3TGXA 2UWEA 5D70L 3PDOB 4LEOB 4N68A 2R2BB 4XZUB 5K9KA 3DRQA 4BZ1H 4TTDC 2W0LA 3NGBC 1ND0B 1C5BH 4APQC 5C9JA 2QEJA 1IBGL 1LWRA 5IBUG 4J3WA 1FZKB 5CGTA 2CR3A 2F19L 3EYOA 3V6BR 4I0PD 2Q3AA 5TDPA 3EIFA 3SO3B 4PG9A 5D2NA 1QKZL 3AROA 1MCRA 1UG9A 5E5MB 4U1IA 4DTGH 4F9PC 4QXTA 2Z8WC 1RZIA 1KJ3L 3U9PL 2FIKB 2FHBA 4U0RC 5FYKU 5A3IC 2NY0D 1HI6B 2FD6L 1P84K 4G42B 4IRZH 4TRPL 3HUJF 4K8RC 1S8DB 3K81A 1UM4L 5I6XB 5JA8B 1CQYA 3MV7E 5D7LB 3G08A 3BD5A 5HYSB 2F5AH 1AKJA 3O9WA 3VFPA 1I3VA 4JDZB 3UPRA 3GJFK 3QEGL 3WFHB 4G8FA 3RGVD 5C8JB 2NY5L 4PV8B 2H32B 1F90H 2DYPD 3SGKA 5HHMD 2I27N 3TA3B 3SGEI 3HR5B 1JNNL 4HQQL 1CICC 1I1AB 3GSRB 4EDXB 1S78D 4YQXL 2EDEA 4UILH 4URTB 4MNHA 3L6FA 4ZUSA 2NR6D 4MAUH 4EVNB 5IMLA 1QG3A 2R1YA 1J7VR 4DN3H 2VMFA 2ZWLT 1AKJD 2QQLH 4MNQD 1CDBA 4XBGB 3BFOA 4NSKB 1MNUL 1T1XA 2ZCHL 3GMMA 3K3QA 5F7YC 3T0WA 1KXQE 1EAJA 3DUHA 1W0YT 1VHPA 5DLML 4JPWH 4OIIL 4KUZH 5DZOA 4FQJH 1MIML 3OJMB 3RNKB 4JPKL 1CFSB 3FB7A 4NNYA 1BZ7B 1WUNT 5IMMB 4U1KA 3E0GA 2W0FB 1DQMH 5IB4A 2E9WA 2EYSA 3I50H 3WSQL 1CLYH 2LABA 2X4OA 5AZ2L 3RWDB 1WIOA 4ODTL 1EMTH 4BQCA 1E4XI 3I3EA 5D6DC 5D7KE 1E4XH 1FDLL 5FYLH 5F7EL 1NJ9A 3DMMC 1L4IA 4PJ9B 3TBTB 4L4TA 4Z7UB 2O61B 1PJ9A 3MZTA 4PJ5A 4XCCH 5ALCL 3VJ6A 3VFSA 1YEJH 3FONB 1CVRA 5E99H 3RBGA 3SDYH 1HHGA 1NCCH 4AQ1B 5TE6L 1R0AL 4WCYL 1U95B 1R3HB 1NANH 4S1RH 3RL1B 1MFCL 1SYVB 3OAUL 5J1AA 3RJQB 3WUZA 1HYRC 4A2MA 5LQBH 1LK3L 4X0KB 4E5XB 3K8KA 4J3XA 3QJHB 3BZFB 1H3PL 4L4TD 1KCVH 4PJ5D 1G7QA 1KCLA 3CCHB 2ATKA 2D9CA 1F4AA 4PGDB 1P2CB 4EUPG 2CSPA 4OFYA 4N0FB 3L3OB 3RZCC 1G0XA 1YQVL 1HIMH 4Z7WA 5JDSB 5I1DA 1Z9SA 4J3VA 2JJTA 3D3VB 1FHGA 2Y25A 5IB3A 1HOCA 1OW0C 5E2UH 3F65A 1MHCA 5FYJD 1WT5C 3D0LA 5EUKA 2FJHA 3HE6C 4EI5A 3EYQD 2C4FT 3QQ9D 4Z76A 2V7HA 4LHJB 1UYWH 3RVUD 2NLJA 2CD0A 4HX1B 3DX9A 4X5LA 1VADA 4OFYD 3D85B 5TQ2H 2YOCA 3R1GH 3H9ZA 5D5MF 1YEDA 1A6ZA 2CDGB 4GT7A 5CGYC 2ZCKL 2FGWH 3HRZA 4WWKB 5I1HL 4MJ4A 2DS4A 1MWAH 2XXCB 1MLCB 3KDMB 1LK2B 2V2WA 4X99B 4YFEA 5I2IA 4O2EA 5EZOH 3EOTH 5ADPH 1ZGLA 3WDIA 4DZ8A 3FQNA 3G6AA 4L29B 4EI5D 1SY6A 4HIXH 4KQ4H 1E6OH 3AC0A 2ZCLH 4YBQD 4GW4A 4MNGE 3QCUL 1HH9A 1T5WB 5JR1L 3F62A 4OGAC 3KLAB 1MHEA 5E2VL 5EBMA 1SEQH 2CDEA 1B9ZA 4GRWE 1RUKL 4EKXA 2YHGA 4NOBA 5ERWA 3ETBF 4LCCB 1N2RB 2R9HD 3MJ9A 1ADQA 3BH8B 3IAPA 3DX8A 3LY6A 2XOTA 4PGJA 2IBBA 1JZ4A 4ONHA 4KZDH 2VWEE 1SBSL 1NMAL 3O6KL 3QBTB 5H94A 4ODUB 4GSDL 1CGWA 4OUUA 4QRPD 3T2PA 4OI9A 4LDOB 1BWMA 3BKCL 3FFCE 5DHVH 5IGXH 3AY4A 3MX0A 2ZOLB 1ZA6A 5K9OB 3QO1B 3FB6B 5HI4D 1DE4A 3MV9E 1MHHB 4CVZA 3U6RB 5LAXB 1BREA 4LNRB 4ODWB 4XPTH 3C5JB 5DMKB 4LLWA 3SBWC 5KANI 1BD2D 4P2RB 1CT8A 4PGEB 2FDBP 1QACA 1U8KA 3KPPA 5AAMA 4DEPC 5B3NA 3MBXH 1RULH 3PF2A 4WTXA 1J8KA 1M05A 1WZ1H 5H35B 3N0PB 5EZJA 5EOCL 7FABL 1AXSB 4HH9B 1XH3B 5DD3H 2CXGA 4UQ2A 3I9GL 2ZP0T 2C7UA 3GSWB 4XMPL 3MV8E 2XTJE 1F00I 2X2YA 5EOQH 2VLRB 4K9EL 5GGVY 4PRBA 3JTSB 3QUXA 5MEQA 3HC3H 2BDNL 1EFXB 1FV1A 1X5AA 2D4FA 1HDMB 4I0PB 1AXTL 1Z0NA 3D0VB 4GAJL 2AI0L 4G8IA 4MA1C 4UT7H 1F58H 4PTUB 5A2FA 1N0XH 3QNYB 4ZOEA 4CGTA 1D7FA 4HLZH 4M9PA 1GOFA 1MJUL 3TVMC 2WM0A 4IRJB 4OCSL 1AD9B 5L7XH 3ARDB 5EUOB 5E2TH 1MJ7L 3QUXD 4MHHI 5JW3H 3TZVA 5F8RC 2XQBH 4LL9A 5SX5K 4JRYA 1FAIL 3FOMB 4KVCH 3RGVB 2GSIA 5J13B 2DYPB 3BEWA 4K3DH 4Y5VC 2DLHA 1OP9A 1T22B 2HYMA 4XAKD 3DV4A 1VDGA 1WQVT 4GKNA 4UAOC 2OTWA 4JJHA 5B4MC 4PJEB 4MAYC 1RZ8B 5I75C 2KDGA 4UOW1 2G60L 3P4LA 4H26A 4Q2ZA 1YEEH 5HGHB 3ZYIA 4YAQA 4QWWC 1CLCA 5HBBA 3DO3A 4JRYD 2ICWI 2DIJA 2R69L 4MNQB 1HQRB 5IQ9B 4OGYH 5ICZB 3U0TA 4UT6L 3N9GH 5GSVB 4YLQT 1YMMA 2D0GA 4CUCA 4WJ5A 4GQ9L 5ISZA 1BBJA 5DJCA 3QWRA 4QRRB 3IXTB 3PGDA 2Y5EA 3RVXC 3EYUH 4G6FD 2P8PB 4D3CH 2FX8H 4Q9RH 3OB0K 3T65B 3WDJA 5D4QA 2FHFA 1ZLSH 2VL4A 1G6RL 5KVDH 2E3VA 3NFPA 5E2WL 4TPRL 3ARWA 4N5EC 1QR1A 1NGZB 2Z31B 2OSLB 2OP4H 2IPUK 3U79A 1EHLH 4CN4A 2A9NL 3L3JB 1YMMD 2NPLX 1NL0L 3TJEL 4S2SB 3U0PA 3QWRD 1MFDL 2BVEA 5JXEC 1TNMA 2VL5B 5DMIL 2XQYK 1UJ3C 1BEYH 2CRYA 4NNYB 1QLRA 4F7MB 4KJPC 1RZGB 4UZGA 1L6ZA 2VLKE 3BI9X 3WNPA 4XPBH 2DJUA 2HKFL 5EPMA 4R7NB 3MRDB 4MSWA 1MQ8A 5D9SA 5T1MA 5KTEH 3VA2C 2VR9A 2HG5B 4XP6H 5C08E 2P4AB 4OZHB 3I75A 4MD0B 5ECJE 2VTFA 5C7XL 3P9LA 1ZHNA 2A9ML 4HWUA 4Z77A 1ZEAH 4D9RE 4LEXH 5C0RH 5HGBB 1ZVYA 1JPSH 2JCCE 3TYFA 1KPRA 4M43H 5EA0L 1HHGB 2PO6A 4PGCA 4U1HA 2MQ3A 2MSPA 2Q8AL 3WJLC 2Q7NA 5SWZE 5D6CA 3ARGB 4KHXH 4IMKC 2NY4D 2VWEC 3O4LD 1SM3L 2X70A 1JWMB 3V7AE 4FRWA 5DFVD 2R4SH 2LVCA 4OD1L 3LKOA 4AIOA 5DJXB 5DUPH 4U3CA 2D0FA 4F15C 4MD4A 4NDMB 2VXTH 3TN0A 3TWCL 1FNEB 3GSOB 1F4HA 5L8JB 1T0MB 3U0WL 1E28A 2VQ1A 4M7LL 1FORL 5DR5L 2F5BH 5T33H 4FQCH 1AY1H 5BRZD 4YJZL 3ROLA 1RJLA 4JG1H 1CCZA 2AXGB 2DQDH 5D71H 1MAKA 2QQKL 3QXAA 5BZWB 1JE6A 1JGUH 3TLRA 4Y5YB 2BFVH 1KJVA 2DQJL 5DRZA 1PEZA 2BP3A 4JFPA 4XPFH 3LPGA 3V52L 4L8SA 4PJGE 3KPRB 5GIRB 3WHXB 3TN0D 3ALWA 4WENB 2QADC 1IKNA 3IDXH 5INCB 4EQ2A 5E9DE 4AT6A 1PG7H 1TZHB 1ZLWK 3CK0L 4LSPL 2IBZY 5AG8A 2X4PA 2OL3L 3MO1B 3OR6A 3IJHA 1YEIL 1KEML 5EN2A 3LOWA 3EJZC 4NQDE 5AUMB 1UT9A 3BMVA 1IZKA 4PP1D 5DJ8B 1SYSA 3MNVA 4XX1G 3CZFA 3X12B 4P23B 2VJXA 5FO7B 2O5XL 3TJHC 5B38G 1ZGLB 4LRIA 3ELAT 1PQZA 1R3LA 3CDGA 4LLQB 3WNOA 4QRPB 1INEL 3U4BH 1I85A 2XPGA 1HHHB 2J5LC 3BSZL 3DX6A 3DI2B 4PJAF 2O93L 3BDYL 4PLJC 2GUOB 3MGAA 4JANA 3O81A 1ZVSB 3BH9B 5CWSB 1HH6A 3F5WA 4XNXL 4BH7A 3FMGH 5E8DH 5ADOH 4X6EA 5FA4A 5E4EB 3WKML 2OTUB 3EDKA 4ZXBB 3DX8B 1FZMA 3K8LA 1BD2B 4KUCF 4B41A 4M61A 1AD0A 3U9UB 1WTGT 5TQ0H 3THMH 1PX3A 4HZAA 3MLTA 2ICEA 3QUML 4U3HA 3LZFL 2RCSL 4KAQH 4UBDC 4V1DE 4P0DA 1F2XK 2IFGA 2R4RH 1INQA 5D2LE 4JQIH 4WFFD 3MXWL 1ZGLM 3NCYP 1X5JA 3WD5H 4OF3A 4YUEL 2Y6SC 4Y7MA 1AGCA 4CVZB 1P4BL 2W07A 1JNLH 1QZ1A 2EDQA 2G75A 1C7SA 3BP4A 4LLWB 2R0WH 1LNUA 4LLUB 5C6PB 1M05B 3MLRL 1W72A 4Y16D 2VLMD 4OB5L 1Q38A 1A8JH 5BS0B 1FLRH 3MCKB 1OAXL 4UOW0 3OL2A 5TJWK 3DTXA 4Z7VE 4ZUWB 2PYEA 5C2UB 2A6JB 3D9AH 1A7RH 1FN4A 3B3IB 4UQ3A 1RVFH 3ILQD 4KKNA 2EYRB 5C1MB 1KT2A 1J1OH 3TPKA 1OAUL 4DK6A 1KN4L 2QL1A 1AGBB 1QO3B 4MJ5B 3NZ8A 2BNQB 3RIFK 5BQ7A 5A40E 1A6TB 3HZVA 2VABB 1FH5L 4XNZB 3VFTB 1F6FB 5CJOL 4Y2DC 1FLTX 3H42H 3UTSB 4OLUH 4N0CD 3EO0B 3LKNB 4KJQD 3QZWG 4OD3H 4PJ7B 3FO1A 3B5GA 4JFYA 4X9FA 3NCBB 2PYED 4D0CA 5HHNB 4D8PB 1V3JA 4KK8D 4Z0XA 1FNLA 2IJ0C 3DHMA 3V0WH 3HN3A 4FMKA 4ZPVB 4P9HL 3PL6A 2MPAL 4WTZG 4HUVA 6FABH 2VISB 3RY6A 3NMEA 5MHSD 1HYSC 4KV5F 4ELKB 4XWOC 1CXFA 5DK2B 4OZFH 1E4KA 4XC3L 5BVJA 4YHYC 3MNWA 4XMKH 1MY5A 4R0LA 3SDXE 2HFEA 4K3JH 2A0LC 4MA3A 5ICXB 4LCYA 4OSUL 1J1XL 1U8JB 3MUZ1 3BQUC 4P3CH 2Q86A 3BOVA 4FXGB 3ZTJG 5E4IA 1HHKB 1FFRA 4RDQF 3GMQA 4YIQA 1IE5A 3HFMH 5J89A 3BD3A 4LLDA 4EBQH 4LCUA 4PRAB 4ZSOA 1YJDH 4X7TA 4FQ2H 3P4OB 3GSXA 1TPXC 4G43B 1G7LB 4PRNA 2BNRA 3TBYA 5IBUB 4BQ6A 2H8PA 1BBJB 1F3DH 4ZDHB 5I1LB 1X4XA 3QUKA 2BVYA 2XZQL 5AD0B 2VDKH 2Y06H 4HUNB 4J8RB 3T09A 1N5AB 5C09A 3C5SA 3QFJA 1LO2L 3EOAA 3RWGB 5T3XL 5F6IB 3VFMB 4C59B 3QNXB 1RUPH 1YN6B 5HYQB 3DO7A 4XPGH 2X1XR 5FO8B 3GSNH 5TPWL 5AZEL 4TOYL 4OV6F 5F9AC 2CK0L 3HS0A 3NTCL 2ADIA 5ACZB 5KS9F 2I60H 5D7IE 2Y72A 2DQCL 2BNRD 3LB6C 3L5XL 4NQCB 3FTGB 3UBXG 2A1WL 5CJXA 1CGTA 5F7UA 3BKJH 2X6MA 1JK8B 5CUSL 5CBEB 4EJ1C 4PB9H 2BX5A 2W9EH 3LMJH 4PJXB 1NCDL 3HUJA 4F58H 3QUMB 5C09D 3QFJD 1F4WH 1TFHA 2YD3A 4LQFH 4IJ3C 2F53B 4H5SB 4R7DB 3HB3C 3AUVA 3D5OF 2DM3A 2QSCL 1QTYT 5J3HC 3O4LB 2QR0B 4B5EA 1BZ9A 1ZS8A 5GHWH 4DK3A 4X6DE 3MOAL 1OPGH 2DQUH 2J8UF 4RQQA 5JOFA 1ETZA 1KYOJ 3HHRB 4JKPL 1E4WL 1MQKL 4GAFB 3V6FA 1UH3A 2A6DB 4LLYA 4O2CB 4YHKH 1ZHNB 3BN9C 5C0CA 5F89A 4NN7C 2OZ4A 4LU5L 1IM9B 5E56A 1FO0L 4Y88A 4YHML 4OFDA 2OI9C 1OTTC 3OXRA 5L2KB 2Z93B 3DGGA 3N85L 5DZNA 5BRZB 2EDYA 2X4SA 3C8HA 4PJIE 3P9WB 1ZLUH 1EBAA 4XBEH 4K3GA 3OAZH 5D6CB 1TZIA 1BAFL 3O45B 4N1HB 4HIJA 1PZ5A 1OAZH 5DRXB 3KPLA 5TF1H 4GAYA 2AJYL 3TO4A 4X83A 5T1DL 2CRIA 1XCTB 4JDVA 2BXZA 1HE7A 5GZNC 3GHEH 5FB8B 5C0CD 4JZJC 5F9DC 3EYSL 3D69B 4M6MH 4HCRH 1HKLH 1RIVH 5D1QC 3OQ3B 4XP4L 3SE8L 1ZT7A 4OCMC 4I3SL 1CZ8L 2F58L 2HVJA 4KDTA 1RJLB 2MHAB 5IVXE 1YC7A 3V4VL 2UZIL 1ZHKA 4ZUVB 1INDL 1DZBA 3UTOA 1UZ8A 3U36A 1WF5A 4D9QD 3SGJC 3TO4D 5CP3A 4OCWL 4HHAA 3EO9H 4KQ3H 1G9MH 3MRJB 3IFNL 3EOBA 3E3QE 1O7SA 1Q1JH 2XY1A 5GGTA 5BJTA 4JO1L 1ZKAA 3MMEB 5IFJA 5C0BB 2ADFL 3HG1E 4P48A 2XKNB 1R6VA 4EIZC 2NY2D 4JE4B 4L1DA 3F7YB 3BN3B 4JFQB 3PJSB 5DJ0A 1RJCA 1CG9B 1RFDH 2YD5A 5CJ8A 5HDQH 1KG0A 1H0DA 1XIWA 2HFGH 3WS3B 1AGEB 4HXAH 2YN3A 1OY3B 4RMRA 1IC5L 4MGXA 3JTTA 3MYJB 3UEZA 4C83A 3LQAH 3IJYA 2J1KA 1FL3A 1MAML 4EUPB 1N6QH 1J0JA 4X7EC 2DQIL 5SV3A 3LRSA 2HP4A 4G7YH 3UPAA 5ENWA 3OXSB 1KC5L 1NC2A 4MDIB 2GITB 3VFGH 2XPGB 4GKSA 2IG2H 4GBXC 1Z9LA 1EEYA 1OAKL 3I02A 2WLZA 4X5WA 2ZUTA 3QISA 2AABL 3DGCR 3U46B 5I19L 1LILA 3QULB 4WW2B 4Z9KB 3LH2L 1XIWD 2XXMB 4DQOL 5FHAH 5IT2H 4WW1B 5I8OL 1DQTA 5DQ9B 3GJEB 4PJ8C 3T4YB 4KZEL 2DOCA 4R97B 1VACA 2XN9A 3MRQA 4FZ8L 5DD0H 3QCTL 4BFIB 3B9KB 3KPMA 3MRNA 5GISL 2BK8A 1ZHBB 1ED3A 1MVFA 4MVBC 4DKFH 4Y16B 4TUKL 1NC2D 1GSMA 3ECBA 3IDJB 5KVGL 1INQB 3JV6B 1MCIA 4D9LH 5D5MA 4P5TA 2NY7L 4M62L 2W9DH 1JGVL 5CSZA 1CE6B 5B38A 3ROOB 5DSCB 3X3FL 1XF5A 3FO0H 4OLYL 3HE7C 3V8CA 1T7XA 1Y0LA 4GAGH 2AEQH 4PLKD 1YNTB 1UA6H 2FX9L 3SOBL 4YWGL 5KSBB 1XZ0A 3WXWH 2XN9D 5EO0A 1KLGB 4HV8B 1U3HC 2ESVA 3KYMB 3VXPA 2H26A 3U2SA 9CGTA 4GG8A 1UWEH 2I9TA 3E2HB 1KIRB 4JG0H 4KI5C 1FO0B 4XI5D 3BZDA 3C2AL 1WFTA 4KWUA 5IF0B 2AK4A 3QDJA 4RZCB 4POYA 3ILPA 5C0FB 5CJQL 3LKPB 3BISA 1L9NA 2X4RA 2VITA 2V6HA 1L7TL 2LTQC 5KVFL 4KMLB 2VZ3A 2ESVD 4BKLA 2OK0H 2B20A 2EDTA 1M7XA 5J9PA 3D39A 4Z95L 4HUWA 4RGOL 4P4KD 5J12C 2HRLA 1YEHH 3QEQE 4DN4L 1H8NA 5GRYA 3ZDXE 3QDJD 3VRLE 1F11A 1NBYA 4DOHB 2Y9RT 4R2GC 4UU9A 1F3JB 3S35L 5FFLA 1TJIL 1NPUA 3S36H 3DUUB 3RAJH 1XGTA 4ORGA 4IRSA 1FVDB 1A5FL 1PZUB 2ED8A 1EHXA 5IJKC 5D1ZB 3WCYA 4TSCL 3D39D 3EYVA 3I2CL 4CVXA 4DUVA 3GKWL 1TQCB 4U1LA 5KSAB 3OJDB 3RDTA 5CEZE 3IXAB 4I13B 4M8QA 3W9EB 3O6FD 3DIFA 3QJFB 5HYFA 3CVHB 4HK0B 4MWFA 3QZWA 4FQIL 1JHLH 3OKKB 4NUJA 1FZOA 4OLXH 1DN2A 3VXUE 4BUHA 1FCCA 2FYYB 4P2QE 3QRGH 1U8IB 4IRSD 4F57H 1XGRB 3BO8A 1X6NA 1A9EA 2GJZA 2H8PB 3BGFC 5HYIA 4WV1C 3IAGC 5IW6B 2VXVL 3VRIA 1T21B 1FNGB 2DDQH 4OCXH 5CBAB 1NUFA 3RDTD 5E8PB 4PS4L 2YK1L 5GRJL 1IAIM 2NX5A 3CC5B 5KSUB 1S7SA 1QVOB 4FFVC 1CE1L 1UADC 3VFVA 4UMGA 3ZDZE 2G5RA 3PQYE 4PG2A 2VDQH 3VMOA 4JPVH 4PJBB 5HY9B 3MLZL 5DJ6B 2IFFL 3BPCB 2EIEA 5DUML 3M1BB 3STZB 4ZFOL 4JHZA 3VW3H 1S7VA 2IQ9H 3GHBL 1KIUA 1Z5LA 1GGCL 4JAMB 4XRCA 3T2NH 5C0EA 2ADJB 1L7IH 2NX5D 3MREA 1BFOA 5EOTB 1G7PB 1RZFL 1WBXB 4HUXA 1N4XL 3QDHA 4XNYH 4LASL 3QFDB 4OFIA 2W65A 4YHZH 2HKHL 2O5ZH 3LRGA 1KNOA 1ETZB 2NY1C 5C6TH 1FSKC 4A6YA 1BGXH 5I1EL 3ALXA 5AYUL 3QIBB 3U30C 4NKDA 4FG6C 4M5YH 4GMSH 4NNXA 4WUUE 1CD1A 2GAZB 3LDBB 3O6MH 5D8JH 4TTDD 5GRZA 2BY1A 2X4TA 3UBXA 3RI5K 3UDWA 4BA8A 4F2MA 4UUJB 4EZMA 3KWWA 1YJDC 3NCJH 4X9BA 4K71C 1KB9J 1RZJH 5FGRA 5I8EA 2AV7B 1M6OB 2AGJL 1S7TB 1JI2A 2HJFA 4M4PA 1A7PL 1OF2A 4LKXA 1X7QA 4MJIE 1MI5B 2BOBA 2BVQB 4HEME 3GK8H 4JREB 2E5EA 4JO2H 2FIRT 3MRRB 2XWJA 3NN8B 1UEYA 5A3ID 4Y19D 1QLFA 4X4YA 1FG9C 4EI6B 3O3DB 3AVEA 2IAMC 3CLFH 5DD5L 5EU4A 2VE6B 4HWBA 1BIIB 3SKOA 2N7AA 2HT2C 4XNMB 4YDIL 4X98A 5C0GA 3SHSA 4PLOB 5E00A 4I18B 43CAA 5L8KB 1KIPB 4K7FB 4P5MA 3CSYB 4Z7UE 2HTKD 4QOKB 4ZS6D 5LCVL 4HLJA 4P46A 5F1NA 3MRLA 1EVTC 3HZKB 5HHOE 4AMKL 4K3EL 3DVIA 1C16A 2P8MB 2E6JA 4P2OA 5E1HB 1ONQA 3FB5B 4IDLA 2Q7YA 2HA1A 5GRVK 2A74B 3UJIL 1YPZF 5B3JE 4NRYB 1KCUL 3JWOH 1AO7B 1MUJA 4N8PA 2ZNWA 5GS1A 4PR5B 3V5DB 1BFVL 3DYPA 5JOFB 1B4RA 4BZ2L 5LGJA 1HHIB 3LEXA 3QCVH 4X6CE 4YR6B 3MCG1 1UXWA 1SJEB 5JPMB 4KH2A 3RNQB 4NO3A 5EO1B 2MTPA 1FQ9C 1EGJH 3E8UL 3M17B 1EPFA 1UWXK 4NCC1 4JY6B 1TCRA 1UCBL 3BWAA 3KJ6H 5DUBB 4DAGL 5D72H 4NC1E 1U8QA 1H8OA 5J6GA 4YXKH 4IIQA 3SJVB 3QYCA 3D3VE 1EHNA 1GOGA 3GDBA 5CZKA 1HWHB 3HMWH 1M71A 1RQ5A 1ZHLA 2VDNL 4W81A 2P8LA 5EORL 3V6ZA 2G9HB 1Z2KA 4OLZH 4AL8H 4JN1H 4OD2A 4G80B 3X11A 2BRQA 2C1PA 4HK3J 5IJVB 3M07A 4HS3A 1A3RL 3ESVF 5FYKD 2ICCA 4LSSL 2PXYC 2ZUYA 5GJSL 5I73B 3VA6A 3FN0L 1TCMA 8FABA 1DQJA 5BV7B 4CAGA 1GOHA 1OCWH 1WISA 3KPSA 4WI2A 3TIDA 1DQLL 3GNML 3ULVE 4O58L 4GUPA 2QV2A 4M7JH 1IM3A 1G9MC 3BE1H 3X14B 3OKLB 5CLWA 4F37K 5ACMA 2V2XA 1SBBA 1I3GL 2E27L 1MFEL 1NGQH 1OW0A 3PWNB 3T1FB 1YN7A 3G6JB 1I9JL 5CSBA 2ESVB 3HE6A 1GL4B 3ZL4L 5C71A 2H26B 3HMXA 4PJAA 2HJKB 1QSEB 1IFHH 4GG8B 4LAQH 4P4KB 1P4LA 3FQRA 4I4WB 4FFZH 3VXRE 3BHBB 1CU4H 5DTFA 1PYWB 1S7UB 2YSSB 3KPSD 1DQQA 2RFXB 3ZE1F 4MLIA 4R4FL 2B1HH 1G6RA 2VLJA 3LQAC 1KFAH 2QQNL 2DM2A 3IFPA 1KCRL 3PWUB 1GCFA 4RISH 1AGDB 4OZGF 1MRCH 2QHRH 5TDOA 1A4JA 3HE6D 4DW2H 4TSBH 4ZFFB 1DDHA 5J9PB 3D39B 1IT9L 5IM7A 4ODVH 2WANA 4LCIH 4FFYL 1MJ8L 3L1OL 4Y1AA 1YUHB 2ITDB 3T77B 1ZSDA 3EFFB 4XCNA 2HT3C 1CGVA 3O6FB 3BP6B 2ZNXA 4KI5F 4P2RE 2YD1A 2VLJD 4KUCD 3L7FA 3BZ4A 5MERB 2ZUWA 3EGSA 4NCC2 1U8NA 4PBXA 1JN6B 5DRWB 1ORQA 5F9JA 4XP9L 3NA4A 1GRWA 3QH3B 5MI0C 3ARSA 5IP4A 2MQ0A 1NGWA 4TVPL 5HHXH 3S96A 1F8TH 3KS0J 1MFAL 3BW9B 2PNDA 1NMBL 2VLRE 1JTOA 4LOUC 4NQVA 4OGAD 4Y1AD 2NW3B 5IV2A 3H3KA 2XFXA 1QFPA 1ES0A 1NH6A 1YECH 3GIZH 2MJWA 1DUYB 5IMOB 3SGDI 2QQQA 1JZ8A 4YX2L 3ZKXB 4DCQA 4LSQL 3ES6B 5F7DA 4X9GA 2JK5A 2W60A 3S37H 1ZA3B 3FRUA 4LVEA 5HDBE 4WI7A 2UWEE 1UFUA 3EBAA 1SHMA 4N0RA 1BJ1J 4G9FD 3QPQC 4WGWB 5FF6B 1FVEA 3DI3B 5KJRL 3F7RA 3VFWA 4U1JA 5FA3A 4QYOB 2AS5M 2IGFH 3VGAC 1QOKA 3NH7L 4MA8L 1CXKA 3VWKC 3O0RH 5D2NE 3RTQC 3U7AA 4R90L 4U7SA 5DEZA 2F8XC 5DO2C 5D93B 1JF6A 2PTUA 3IDMA 3QHZH 5D7SL 5T3ZD 5HHME 3OG4B 3VXMB 4OM0L 3U1SH 2V5YA 4DKEH 3T0EA 3MRBA 4FQHB 4TN9A 4GOSA 2BHZA 2PN5A 1KN2L 3TBVB 4YXLH 4EN3C 1UZ6F 4JO4H 1JGLH 3LIZH 2VLLA 5E5RB 1UVQA 4ZOBA 3NFNA 5HPOA 1N8ZB 3MJ9H 4APQB 3NGBB 4QRUB 1LD9A 5C0NC 2OL3A 3C5ZB 1CBVH 4MNQE 4P59L 1AH1A 1DTUA 3EFDL 1NGYB 5FUZL 3QDMA 3S3PA 1FVCB 3GB7A 4NM4H 4C54A 2CGRH 1AGFB 4KKLC 2ZSVB 4Y5VA 1PLGL 4R3SA 1WLHA 4OZIF 4Y19B 5DZLA 5FUOH 1M7IA 3A0OA 1NCBH 3EUUA 1J0HA 4JCLA 3OKOA 4NZTL 4ZTPH 3SE3C 3V5KA 5KS9A 3FQXB 1C1EH 35C8H 4ZOCA 4HLZG 3MRPB 4K2UL 3QDMD 1OF2B 3W11C 5T5FH 1CF8L 4PJHB 4Q9QL 3KR3H 4U6VH 4FS0A 1MLBB 4AENA 1D5BA 3UTTA 2WBWB 3WLWD 1VGEL 4PP2A 4Y4HB 4X6FB 2N4IA 3NCYS 3L3IA 4X4YB 1FYTA 4XBPB 1CICB 4OUOA 1K3ZA 3HNSL 4KXZI 1P9MC 5B4MD 5JIPA 3REVB 5TE7H 4FQXB 4PRPD 4PJDB 2DQFA 2UVFA 2EDRA 2YBRB 4FP8H 5HYJB 1RIHL 5E94B 3MACL 2J8UA 4UDUA 3QIWC 2VDRL 4UI2A 1C7TA 5SV4A 5EBWA 3GI9L 2D03H 3S4SB 2DLFL 1MCOH 2HRPH 3MRFA 3RUGB 4PJ5E 2IBGA 3S35X 3LKQA 1KYOK 2MMXA 3R8BB 2BVUA 1GPOL 5DT1L 3FOLA 5JOPD 1I9EA 3DARA 3G04A 2OQJA 4KKAC 5IQ7L 3RVXD 5JXEA 4L9LA 4AH2B 1KTLA 1FYTD 2BY3A 4UV4L 2VDML 3V6OE 2E7LC 2GJ6D 4ZO8A 1T0NB 1EDQA 2Q7YB 3QB7C 4FZEL 1D9KC 3QSKB 4HZLA 2FBJL 2PYFB 2NY3C 1OGTB 1II4E 5I18H 1I3UA 3IDUA 4M6NL 4HWEH 3C8DA 5C0JB 1H3XA 3BDXA 5FYJE 3SDAC 2UZYB 4K7PH 3T3MF 5HVFB 3DMMB 4YO0B 5L6YH 4O9HL 2Q76A 1R3JB 5JXED 1WGOA 2Z8RA 4JY4B 3LKRA 1EJ6A 3F7PC 4KJPD 4F7TB 5MENA 5ALBH 3AS0A 1RZJC 1EJOL 1V3KA 2CUMA 2FNBA 3D6GA 1NCAL 4IMKA 2GT9B 2IADA 4PJFF 5JOEA 2JE8A 2C3WA 4LCWA 3VGFA 2MNUA 1Q94A 5JPNA 4WVRA 5I9QC 2BVPB 1C5DB 1FE8H 1FFPA 3L9RA 3O41B 4XPHH 4C56A 1E6JL 3PABB 1QHPA 3WIHL 4QGTA 5I71B 1IGYB 1B0RB 1KEGL 4XB7A 1C08A 2CKBL 2BERA 5CP7B 5JO5B 3RBSA 5D7JC 5MEND 4JQVA 3PWVA 1UJTA 3RZCB 3MLWL 1S9YB 4DGYL 3ULUH 4LCWD 1FNAA 1QBLH 4UTAH 1UXSA 2NY0C 3GSUA 4G6MH 2FX7L 3S9DB 4O5LH 3LN5A 2BHYA 1HZHL 1T1YB 4ETQB 4QRQA 1I8MB 1WZKA 4QRPE 3PDDA 1WK0A 1CD0A 1YYML 3VRJB 3CU7A 3M8OH 1QR4A 1CGXA 3DSFH 4HMDA 2XZZA 2YD9A 1O7VA 5GGSA 1NEUA 5EU3A 4Z7QE 3UZQA 3BRFA 3MODH 3CFDA 5H2BA 3JWOC 5DRNA 2XNAA 3C09C 3IVKA 1EX0A 1VENA 1VGKA 5A2LH 5GS2D 4FTVB 3HC0A 4Y5XC 1BQHG 1BD2E 3AFLA 3P77A 2BOCB 3L7EA 1NBQA 3DHJA 5IG7A 1S78C 3NIDF 5EU7C 3RPIB 5JUEH 3BP7A 1MPAH 2ZPKH 2MCPH 4JHAH 1A7OH 4NYLA 1DDHB 1ZWIA 1Z0MA 3C8KB 2YR3A 2Z91A 3MBEA 3Q6GH 1LP9F 5CD5C 4PY8I 3SCMC 3O9WC 2ORBL 3MLSH 1N6VA 3QQ3A 4M00A 3GO1H 2B0SH 1LEKA 4N9GA 5E6IB 3SGKC 3T0BA 4YHPB 5L88L 5FYLD 4ZUTB 1RUMH 2Q8BL 1U8MA 1NAML 4JB9L 1KCKA 5F1SA 4JFFA 2PW1B 2YMXL 3FRPA 3QEUB 3TJHD 3BIAX 5IBTH 1IC1A 3TO2B 3ZE2F 4MDJB 3MBED 1KACB 5F1KC 4R6UA 4RGMB 3AXLB 4G9FB 4JY5H 4KDVA 5IV2B 3PE9A 2LE9A 4PLJD 5C07A 4NJ9L 4WIQA 1I7RB 5IHUH 3FQWA 1DLFL 4AQOA 1BJ8A 5EU6A 3HNVH 4PJCB 3JV0A 1BM3L 1WJ3A 3UTSE 2IEPA 2XWTB 3WJJA 2R1WA 3F7VB 4WHTB 3MJ7B 4DEPB 4H0HB 25C8L 3BVNB 4XAKE 1TMCB 1D5IL 5E24E 4S1SL 4UBDD 1IKFH 4F33A 3UTPE 1RIUH 1JRHH 2RGSA 1B2WH 3G5XA 3L3KB 5C07D 3WEXA 5TF0A 2NXZC 3O2WL 5I1KH 5FA3B 2Y6SD 4JRYE 1QFWH 1KPVA 1H8SA 4Z0BL 5EU6D 4X7CC 4PRIA 1N64H 2EICA 1XF3A 5E8OA 5E8NA 3PNWA 1SEBA 3OF6D 4Y2DA 4HPYL 4MCZB 1Y18B 3MOBH 3NZHH 4WWID 1LDSA 3ALPA 3JBG7 4ETYA 2JF1A 4P5KB 1NCTA 4DN3L 2IPKB 1J8HA 4ZNEA 1S7XA 4NNPH 3TVMB 3NACH 4UV7H 4ZUUB 1FBIH 4CJ1A 1CFTB 5I0DA 3BX7C 1LO4H 3EYQC 2GFBB 4PRID 4IDJH 1FL5A 3B83A 2JJUA 3LS4H 4L3EA 4ESKA 2BSSA 3GRWL 4WO4A 4Y2DD 1LDPH 3GUTB 3VXNA 2FZ3A 5CILH 1DBAH 4CW1A 1G9NH 1CIDA 5JA9A 1U3JA 5GGQL 2MOVA 5DMJB 1J8HD 3AS3A 4OQTL 1IGCL 4MAYB 1EMTL 3UJTH 1XR9A 1AFVL 1HXMB 5I75B 1QRNA 4PRPB 1UB5B 12E8L 2YWZA 4EI5C 4DGVH 1QBBA 4BH8A 1HYSD 1I7TB 4YBQC 1GYAA 2ATPB 4L3ED 4DUWA 4XWOD 1W72H 1NUGA 5CEYB 2FO4A 4LARL 4WO4D 1Q9OA 1FL6B 4G6KL 4FQ1H 4HKBA 2DB8A 3OKMB 2NY6D 2A0LD 2XWBA 4OZFG 2F53E 2I5YH 2R29L 1BOYA 3L3IB 4LIQH 4P2YA 1XAUA 5DWUL 4LF3A 5LGKA 1YEKH 3IGAB 1RU9L 2GJ6B 4M7ZC 4RX4A 3O4LE 4H8WH 3BEVB 1QRND 4YHNA 1AE6L 4YZFF 1JGEA 4HS8L 3IDNB 4ZS7H 5FHBH 4KJWC 1EA9C 3IDIB 2WINA 2GK0A 5CJ5A 5ITFB 2X5PA 4YDVA 4G7VH 3BUYA 5KOMC 1Q72L 4Z7NE 2XQYG 3GGWB 3KPQB 1NAMB 1EUTA 1QSFA 4NCDA 1I1YA 3AU1B 1JNJA 3TYGH 4NBZB 5F3HA 1JUFB 4RAVB 3T0VA 3WO4B 4W6YB 4NUGL 5BRZE 1UJ3B 1U8PA 1UGNA 3H7BA 1A6VH 1I9RH 1D5MA 2VN4A 2X4NB 2HLAB 2GCYA 1A1NB 4RX4D 1L0XA 1S7WB 5SX4H 4J2XA 3AAZA 2P7TA 1QFUH 1QUNA 2YXFA 1KJMB 3BKYH 1MCPH 4JO3H 1NCWL 2WIIA 4OAWB 3FQTB 4OCRH 1OGAA 4KI1A 5DJYA 4E42A 3AY4C 3RJDA 4HPOH 1JYVA 4NHCH 1QSFD 3LB6D 2I25N 1NSNH 2O5YL 4HKJA 2Q76B 3R06A 2DQHH 5EO9B 3BPNC 3QT2A 4LLVB 5HI5C 1X5LA 2B1AL 4JKMA 5I76B 4NGHL 2V7NB 4GRWF 4KY1L 1A1MA 5DEFA 5MP6L 5J3HD 3W39B 2V5RA 3HCVA 1U92A 1OGAD 5BO1H 1IGIL 1DBJL 3TPUB 5JXAL 2NTFA 4JGJA 5C0BE 4F15B 3NCFB 2AXFA 4NFBA 5GS0H 5J7CC 3BN9D 2F74A 2R2CA 4JZJA 3QUXC 4ZAKA 3HPJB 2DWDB 4OV5B 4QHMB 2R39A 4WRLA 5D1QA 1OTTD 5HGDA 3MV9B 1FFQA 3OAYH 1HSBA 4LKCA 3U7YL 2ZUSA 4F8TA 1FPTL 1XF4B 3BRDA 1I3RA 4LPCA 1S5HB 5BZDA 2M2DA 1UWGL 3MCLH 1P1ZA 3ZKQD 4N0YL 3SGJA 1A4KA 1RPQA 4M1DL 2V17H 4QRTB 1VFAB 2FJFA 5KAQF 5IIEA 4KKCD 2Y07L 5HPMA 5GZND 3ZT6A 1LEGA 1KBGL 3LEVL 2C3VB 4PUBH 2ADGB 4ZAKD 2BSTA 2QADB 5IFHH 2EXYD 3TZVC 4HJ0C 4QXWA 3MV8B 2IALB 2XTJB 4WFFE 5GS3A 5D1QD 3WV0A 3NVQA 5B8CA 1S5IH 5ANMA 3E6HB 4JDTH 2OBGA 2AJ3B 2E8ZA 5FECB 1GGIL 4HIIB 1JZ7A 5EZLB 5DDHB 5A43C 3AREA 4MCYB 3A67H 1RK0A 3DXAA 1YYLL 3IU4L 3VXOB 5I17B 2H32H 1RMFH 2OZ4H 2XYCA 4W6WB 3AM8A 2D0HA 1KCSH 1V7ML 2VLME 5FUCC 3U83A 3ZO0A 5D1XB 1OT1A 2P5WA 2VXUH 4WI9A 3MRHB 2EDLA 4E41D 2DD8H 1CK0H 2X89A 2CIIA 1FJ1B 2WBJC 1XGUA 2J5LB 4GBXA 2X4UB 4H0GA 4ZFOA 5TH2A 4M5ZH 2GTZA 4X7SL 1V8HA 4WI4A 3ARED 3VFNB 1ZT4A 2NXYD 4TULL 1MFBH 3DXAD 3WUWB 1FGNH 4HEPG 3RWHA 2A6KB 5DQJB 1IL1A 1P84J 4LVOB 2A83A 2PW2A 5C70A 2Y36H 1SMOA 3MROB 3Q6FB 2YS4A 4NQSA 3UP1A 2P5WD 2CMRH 2PYEE 3GI8H 1BQHA 1MF2L 4TYUA 2VAJA 2VOTA 2X89D 3ULSA 4ZFZB 4LIQE 2JKXA 4M3JA 1S9WA 2YZ8A 5HYEA 4GBXD 1IEAA 5L9DH 1HQ4A 3ULUC 1EUUA 5MHSE 3LD8B 2R2HA 1Q9LA 5CP3H 3GMPA 5KBNC 1JWSA 3W2DL 5K59E 5CMAB 3VFUB 1A6WL 4IEFB 5GGTH 3HE7A 5L0QB 4LRNH 4OZGA 5F93C 1R5VB 2CIKB 5IK3A 1I7ZA 4AEEA 2XA8L 3MRKB 1D5XB 4EIGB 4JHWH 4Z78A 43C9A 4D2NA 4JFXA 1H15B 4DUXA 4MVBD 3DSNA 4I77H 2H1PH 5CS7A 2DQEL 5DFVC 4KRNA 5JQ6L 1DUZB 3FT3B 5ESQB 3OPZH 1G7MA 1BX2B 2P47B 5AWNL 3SY0B 1U41A 1CN4A 3IFLH 3QUZA 2YEZA 1MWAB 3HE7D 3L5IA 1HILA 4M48H 5BXFB 1KJ2L 4POUB 1A7QL 4RA0C 1T89C 5CHNB 1T2QH 3NCEB 5I66B 2PO6C 5I1CH 4LHUG 1MH5A 4OT1H 1S7QB 1U3HD 3KVQA 4EXKA 2YRLA 4YDKH 5DMGD 1WIPA 4TQEL 3KAAA 3VI4E 4NQTA 5D70H 4LLMB 5KSVA 4KI5D 1IBGH 1Z3GL 3BESR 5I74C 4ZSOE 3TN0C 3LSOB 3OGCA 1EXUB 2F19H 1WWCA 4HMCA 1FL5B 2H3NA 2CJUL 5IKCA 5FKAA 4G8EA 4DGIL 1QKZH 4M6AA 4YHYB 1YA5A 4QF1A 3T08A 3T8XB 5CZVL 3CFBA 3HPLA 4KTDL 2JCCB 2WWKT 3JWDH 1KJ3H 3U9PH 4TUJA 4I2XB 5C09E 3QFJE 5DHVB 4XH2B 2FD6H 1RHFA 4CW1B 2B2XL 3BQUB 1LE9B 3BAEL 5CD3B 1U58A 4PP1C 2A38A 2CLVB 1UQSB 4TRPH 5IVZB 3SDCA 5T1KA 1T4KB 1DEEB 4L8SC 4XP6L 5CCKL 1UM4H 2BXYA 4R2GD 3OR7A 2AJXL 1D6VL 1JF5A 4UB0L 3B5TA 3QEGH 5HDOA 3S88L 4JLRA 1TPXB 3F6LA 3L3GB 2NY5H 3PGCA 3OKDB 4WU5A 3HUJE 3KXFD 3H2WA 4OTXL 3IDGB 3BD4A 3EYFB 1JNNH 3IRPX 4HQQH 5I16B 3QO0B 4DKAA 4YQXH 5K9QG 2F15A 5IEHB 3PWPD 4RBPK 4CU8A 4F9LC 5JLZB 3KPOA 1OAYL 3SDCD 1K2DA 1PBYA 5T1KD 1TVBB 4JZNA 4LRIC 3LEYL 5T1LA 3VXSA 2E6QA 1JBJA 4HGWB 3EDFA 1QQDB 4NKOA 1MNUH 2ZCHH 1I85C 5CSGA 5IESL 3LQZA 5C0CE 5C92A 4LSDA 5DLMH 4OIIH 4OZIA 2VYRE 1FAKT 4PJGF 3GJFB 4D0BB 2CLZB 1MIMH 2C3GA 3FT4B 1MCHA 4JPKH 1MRFL 5IHZB 3H7BB 1NQBA 2UY7A 2E8YA 1J1PL 8CGTA 3WSQH 1JZ5A 4D9QE 4FFVD 4Q58C 3VXSD 1DEDA 3KYKL 5AZ2H 4ODTH 3MRCB 3O4OC 2FR4A 1FDLH 1MI5E 1JZ6A 2VDLL 5F7EH 3UZEA 4Y4FB 2UYLB 3MR9A 4ODXA 3HI6L 3RZWA 5FCUL 3IB4A 4L4VA 1QYGL 1IGJA 4ONFL 3KHOA 1G9NC 4Q9CA 4XVSL 3MA7B 5IWLC 5EBGA 5ALCH 1KUMA 1K5NA 1HNGA 2BCKA 3QHFL 2EE6A 3GIVB 2FLBT 4ODBD 2OI9B 3BIKB 4U6XA 5TE6H 2VAAA 3HRPA 1R0AH 4WCYH 1VPOL 3KHQA 1RV6X 1IGTA 3CFEB 1MFCH 4KJYB 2DI9A 3HI5L 2E7HA 3OAUH 1W0WB 4QCIA 5GPRA 1NEZG 4HFWB 1LK3H 4ZPTA 3TNMA 1KJ2B 1WCBB 1H3PH 2DBLL 4L4VD 2NY1D 5SWSB 2DLEA 4V1DB 4RAUB 3R0MA 1I8KB 5DJAB 5JW4M 1HCVA 3L3DA 1P5VA 1R5WA 3RWEA 4H8WC 3TH3T 4FG6D 2I9LB 2IAMA 2VH5L 1K4CB 1KB5L 3JUYA 2N56A 1HSBB 5D2LF 4AK1A 4O2FA 1AO7E 1BLNA 1U93A 2J4WL 2Z4QB 3G6DL 3DURA 1YQVH 4TUOB 32C2A 3CLEL 3K2UL 3TT3L 1ZXQA 5IR1B 4NPYA 1IJ9A 3T0AA 3GMOA 5FM8A 1AHWC 2AW2A 2DL2A 1OD9A 2DL9A 3PL6C 3QWQB 4M7KH 2IH1B 2YKLL 1M1SA 4QNPF 3RY6C 5KAQG 4E41B 2IAMD 3EJJX 5DVNA 2RQ8A 3IU3A 4Z7VF 1V5JA 1E4KC 4GXVL 4PJFA 2LAGB 2XY2A 2H6PA 2M8XA 2VIRA 3TP4A 5GGUB 3HZMB 2EYTB 2HT2D 2P5ED 1KTDA 1I9IL 3OHXA 2ZCKH 4PD4K 5I1HH 1UB6A 2XN9E 3VH8A 4NO2A 3VFOA 3HNTL 1NFDF 1Q0XL 3DBXA 4OF6A 1MVUB 4QTHA 2AXHA 5IB2A 1XF1A 3TBWA 4NRXB 5DYOB 7CGTA 4XX1E 5JR1H 3FZUC 5E2VH 1H5BA 1RUKH 5C0IA 4J6RL 1E27B 1MCFA 1DANU 3BZEB 4J4PA 1F6AA 3D25A 5FKPB 4KRMB 4IOSD 3P9MB 3V4UL 5GS0C 4U1SB 5C0DB 2ESVE 1SBSH 1NMAH 3O6KH 4PJ8B 4GFTB 3MRIA 5JW4Q 1K8DA 1BQSA 4GSDH 4HC1L 3FB8B 1T1WA 3SDXF 4UNUA 3ZLQC 3BKCH 1OSZA 4MJ6A 3QDJE 1XR8A 1KIQB 1Q8MA 1GZQA 3UTQA 4MD5B 3IAQA 4RIRA 2D31A 5CJXC 4AEIL 4J4PD 1I4FB 3B6SB 1N7ML 3HE7B 3MA9L 1UH2A 4O51B 5BMFL 4HDIB 4TNVF 5I1AA 1T3FB 3WYRA 3D39E 3WHE1 1RZ7L 4U1NB 3T2OA 1LP9A 4L9DA 1U3HB 1CLZL 5EOCH 7FABH 2NW2B 5BCAA 3QAZB 3NA9L 4U6YB 3ZSTA 2GSGA 4OM1L 5E08L 1T04A 4HUUA 3I9GH 3W0WD 3WE6B 4XMPH 3QQ4B 3B9VA 4K07A 3G5ZB 1JFQL 4K9EH 2BDNH 5D7IB 3ULUF 5MEPB 2YPLA 3TA3C 1P53A 1AXTH 5DEGB 4GAJH 4LLAA 4HIEA 4WUKL 3ZZ1A 4HGKC 4V2CB 5J1TC 3CFCH 5B21A 4KMQA 2FJGB 1CI5A 1DR9A 3REWA 2BMKA 4LSTH 4DVBA 2GEEA 3GSNL 5J12B 2UUDK 1CFNA 1MJUH 4OCSH 3VXQA 5F1OB 4X6DB 1KB5B 1F2QA 3MV7A 4H25A 1MJ7H 1NLBL 4NWTL 1CFQB 3B43A 4JQXC 4NQEA 3TIEA 3PHOA 1Q9WB 2YPLD 4DZBA 1FAIH 2R23B 3OKYA 3SKNA 4XHJC 2E7CA 4KDTC 1AP2B 3W82A 1AIFB 1N5YL 1IAOA 1JPGA 3KXFB 1OSPL 4BELD 4OGXL 2NX5E 4QLRA 4UT9L 2JJWA 3PWPB 3RWFA 4QHUB 2Y5TA 5C3LD 2HT3D 2D7QA 4LHUA 5T1KB 5E7BA 5F1IB 4Z5RB 3MV7D 3C9NB 4X5XA 4XXDB 3H3BC 1FZJB 2G60H 4PJIF 4PRHA 1T7ZA 5FOBB 4XNQB 4NQED 2EXWC 3K74B 3MUY1 3GMNA 2R69H 4YH6A 1OARL 4PRDB 1E4JA 2XT1B 4UT6H 3DX7B 2X4QA 2SEBB 4H1LA 4JLRB 4RAHA 4WHYH 4GQ9H 3BGMB 4PIRF 4KMTH 1HCFX 4ZG1A 3BGFB 3FO9A 4WV1B 4ZQKB 1XIWC 3QEHB 3IETB 2WP3O 1ORSB 4YPGA 3VI3F 5IVXB 1A47A 4QT5B 5HI3C 3WFBL 5IEKB 1G6RH 4U31A 1SVZA 4LHUD 5FCSH 2X7LB 3QA3B 3IFOB 5CKGA 4PRHD 4TPRH 5E2WH 2CKBA 5EC1B 3FAXA 3A6BL 3QG6B 1EIBA 1A9BA 2A9NH 1N59A 5E6ZA 2KBGA 2DI7A 1QEWA 4NO0B 1NL0H 4HCRL 3TJEH 5CEZL 1U2HA 5F6HJ 3MJ8A 4I0KA 4Y19E 4QKXB 1MFDH 1D5ZA 2ERJB 2X1OA 4IOIA 1O0VA 5DMIH 1DBML 2X10A 3QUYB 4FMFA 1CWVA 1Z9MA 3DV6A 3QPQD 4PLKC 3O6LL 2JB5L 4MYWB 1X5HA 1EAPA 2LAAA 4XCYB 3UMTA 2HKFH 2W91A 3VWKD 4OZFB 5TDNA 4X4XA 2NTSP 4RCAA 1U8HA 5JW5B 4U2ZA 1OTUC 4P5TC 5JZ7C 1R24A 2NY1B 5C7XH 2A9MH 1FSKB 5DHYA 4LVHC 4PYGA 4AM0A 1UEMA 2AKRA 3QR2A 4PJDE 3SQBA 5DURB 4XXCC 3U30B 1KPUB 4RFNC 3PWJB 2B7DT 5EA0H 1X4YA 1A1OB 3TNNB 5CEXB 3P4NA 1C8PA 4PY7B 2Q8AH 1U3YA 2J6EL 5C0ND 3VFRA 3SE3A 1SM3H 1ZOXA 1QLEL 4IOFC 4K71B 1A02N 4RWHA 1WTLA 2DWEA 4OD1H 2NY5C 2N1KA 3BKML 3FQUB 4KKLD 3K4ZA 3E6FB 1HEZA 2KKQA 2BVOB 3TWCH 4NQXA 1S7RB 3O11A 3X13A 3U0WH 3LKSA 4M7LH 1FORH 4LCCC 5DR5H 3S7GA 1LO3L 2IAMB 1P9MA 1QD0A 1RD6A 3GSNB 1P4IL 1JHKL 3TBSB 5I0ZA 4XNUL 5DJDB 3QI9C 4M02A 3DURB 4U7MA 3IF1B 2QQKH 3CX2A 2P5EB 3V4PL 3V5HA 5DD0L 3OV6A 5I8CB 1A2YA 5GSRB 2DQJH 3SE9L 2BRRL 4X7FC 4NZUL 3W11D 5H37H 4E0RB 1U2CA 3B2UD 5DXWA 2IANB 3PXHA 5FYKE 3V52H 3H3PL 4LSVL 3O3BB 1HSAB 3SPVB 1T03L 4NZDA 3CK0H 4JM2F 5L2JB 3CFKA 1OB1B 1RHHB 2OL3H 1CL7I 2P24B 1NEZA 2E7LA 1ZT1B 1KEMH 4WFHD 4IRSC 1T5XA 3WXWL 5J4MA 3QIWD 1ZTXL 3WHE0 2QKIB 3SDDA 4GRLB 3V9FA 3SDAA 4LDEB 4WNQB 1KTKE 1OAQL 4OKDA 4X8JA 3RDTC 3CPLA 1ZLVK 3WO3B 5ETUA 2O5XH 2EIZB 3GMLB 5ESVA 3QEQB 4KKAD 1DN0B 3FFCA 5HDLA 2NNAB 3RU8H 1INEH 2VDOL 3KPSE 4WEBL 1K6QH 4JJ5A 2VR4A 3U4EB 3O8XA 2W92A 3BDYH 5AYQA 5C0IB 3HZYA 2DIBA 4C4KO 2FL5A 4XNXH 2VKXA 1T1ZA 2NY3D 1F6AB 3N1PC 4DWHA 1P7QB 4P2CG 3FCTA 3WKMH 4LPUA 1VCAA 3SDAD 1FFOA 2D3VA 1YMHA 2YRPA 4GG6F 2F8OA 3UO1H 1B6DA 2GKIA 3RWCA 4PJAE 4MX7B 1YEHL 3I6GA 1A64A 2XV6B 2EE2A 1XGPA 3QUMH 3ARDC 2GHWB 3FFCD 3C60A 2RCSH 3LZFH 3TC9A 4PG2C 5HHQA 2PXYB 5LGHL 1JV5B 2FWOB 4JFEB 3W0WB 3MXWH 4RIRB 4HBCL 5D7JA 2E6PA 4YUEH 2ZSWA 3DROA 1DCLA 2VXQL 1P4BH 4P2QB 4YHLL 1R5IB 1C12A 1Q9KA 4F3FB 4BK4A 4J1UA 1AC0A 2Z9TA 4ZYKB 3V95A 3OKNA 4AJ0A 3MLRH 5IB5B 1FFNB 4Y1AE 4BSWB 4OB5H 5CJBA 2CUIA 1OAXH 5DS8B 1BQUA 1RJZA 1WEJL 1PKQA 1NBVL 5DK0A 1WBYB 3L5JA 1RJYB 2IPTH 3PQYB 5D7JD 3P4MA 1N3NB 3QNZA 3GSQA 1OAUH 4XWGL 1KN4H 2Z92B 3V0VB 4YNYB 4Y5XA 1S9VB 1KLUA 4RRPG 5IVOA 1G0YR 2EKSA 2XZAH 3HI1A 1JL8A 4R4BB 3ZDZF 1CXHA 2H9GB 3QXVA 4L8DB 4Q9BA 3PGFL 4CNIB 4Y8AA 1FH5H 4JRWA 5CJOH 1EGJA 1TVHB 3UDWC 4G9FE 3ULVL 1YY8B 5EFIA 2DKSA 2GY7B 2Z31C 5CIPA 3SCMA 4ELMB 2C3XA 4Y8DC 2HTKC 4P9HH 1TETL 2MPAH 4ZS6C 1ERNA 2HWZH 2ZZUT 4PJCE 2R56L 5F88A 2FEEI 3F7QA 3SGEH 1T20A 5T3ZE 2YPVL 1JF1A 3SKNB 4P9ML 5B39G 3GZKA 1XGQB 4HS6B 1G7JA 2B8OT 2HN7A 3GSVB 3Q48A 3MGTB 3Q0HA 3FT2B 1GAFL 4WUUB 1QA9A 3VE0B 4X6BB 4OSUH 1J1XH 1B4JL 3B9AA 3L95A 5CD5D 4O00A 3RIFF 3O9WD 4KV5E 3SCMD 5GS2H 3H9HB 3TCLB 4NWUL 3STLB 1QBML 2CPCA 3S3SA 1A21A 4P46C 1MIEL 4LBEA 4UTBL 4MJIB 1UACL 1VSCA 2NQCA 1FG2A 4OF8A 1FNHA 4P2OC 5D96C 4FNLL 2VB5A 1FRGL 4MQ7A 3ARFB 2EEBA 5ICYA 2V5MA 3QXDA 1TJHL 1HXYB 2XZQH 1GJIA 5CAYB 3ARGC 3G5VA 5GS1C 5KG9A 5F7MC 2VLKA 4K9EC 2GTWB 1LO2H 3LPFA 5H8DA 1QFHA 3QDME 3L3HA 5TPWH 5AZEH 1MJJB 4TOYH 2R8SL 5LXGL 3VWKB 5LG1A 4MXQD 2CK0H 4QXGL 5EULV 3NTCH 4I5BB 3CUPA 3LV3B 5C08A 3RTQB 2IH3A 4Z7UF 2R2EB 2DQCH 3L5XH 5DQDL 5HTSA 5HHOB 2A1WH 3D18B 3FO2A 2OJEB 3T0DA 4QHNB 4IIQC 4G8GA 5CUSH 3UYPA 1D5ZB 2ZOKA 1XF2A 1GC1L 1NCDH 4PRPE 3DOSA 3QWOB 4EN3B 3T4AA 4PREA 4Y5YC 4BSVA 5SWZA 2HLFC 5KS9E 5KN5A 2ZUUA 2NXZD 1PEWA 2HTLD 2PETA 4NRZB 2QSCH 3O3EA 5B3JF 4X6CB 4RGND 2FB4L 3MOAH 5E1AA 3P73B 3Q3GA 5GRUL 5JOPE 2A73A 3MRMA 2J2ZA 3D2UA 1YDPA 4JKPH 1E4WH 1MQKH 2RIKA 3S5LA 1I8IB 1IRAY 3BDBA 1FYTE 3VGEA 4F7CB 4HKZB 4HWZA 4G8GD 4P3DA 4YHIA 2APXA 3C6SB 4LU5H 2GJ6E 1DL7L 2VRAA 2FO1A 2CLRB 4YHMH 2AEIT 4P57A 4N8VG 3UC0L 4QHKJ 3N85H 2G2RA 2J8UE 3AMLA 2EH8L 2BC4B 4UDTB 1PSKL 4P23C 3VU2A 1BAFH 1DLHA 4JN2B 3CU1A 3DVGA 4K7PY 2AJYH 5T1DH 4IHOA 4PJGA 1TDQA 2ARJB 4JM4L 1LO5B 1DSFL 4KTEL 5JHLL