3QWRD

Crystal structure of il-23 in complex with an adnectin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
91
structure length
91
Chain Sequence
DVPRDLEVVAATPTSLLISWEHDYPYRRYYRITYGETGGNSPVQEFTVPKDVDTATISGLKPGVDYTITVYAVTSSYKYDMQYSPISINYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-12 subunit beta
publication title Structures of adnectin/protein complexes reveal an expanded binding footprint.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/cytokine
total genus 13
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2011-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qwrD00
1JV5B 1I9RH 1JWMA 1VFBB 2QHRL 1YPZA 4YHML 3WHE1 3VXQB 3QIWB 2XRAH 5DA4A 4XC3H 3KXFB 1YYLL 3AMLA 4IDLA 4OGXH 4IM8A 5GGRY 5B22A 1CE6B 2R0LL 4QXWA 2E3VA 4RBPH 2YA1A 4QTHA 2Y06L 4ELME 3GMOB 4L9LB 2AS5M 4OUUB 1T83A 2NX5D 3WFCH 4ZOAA 2D31B 1EHAA 1F6FB 3TZVA 5HDOA 1TNMA 5HJ3A 4W6YB 4R0LC 1A8JH 4P46D 2XN9B 4LSVH 3V5DB 4MMXC 1NL0L 3QNXB 5JW3H 3H0TB 2NY5C 1G7JB 5HDQL 1KCRL 3W0WD 2DWEB 1FL5B 4G42B 5HYJD 2QTEA 2PETA 4P59H 3ZKND 1KENH 3EUUA 4JFDD 3V0VA 1K8DA 1PJ9A 4LLDB 3DVGB 5JW5B 2FD6H 3C5SB 4PGBB 1CGWA 2ZSWA 4EI5C 1NKRA 5ICZB 3VXNA 5FKPB 4MD0B 5FA3B 5FF6B 4PD4K 4UQ3A 4XVSL 3IDUA 2BNRA 2JTDA 2C26A 2H1PH 4XP4H 4QCIA 1DE4A 4ONOA 5C0AB 4YDKH 2NY3C 1I4FA 1HH9A 2YWYA 5IV2B 4HKXB 4UV7L 2DMKA 3FOLB 3E8UH 4WU5B 5B39A 4M7LT 4RX4A 4OTXH 5HYSG 3AMKA 3MUZ1 3NA9L 2ITDA 2VDOH 3IXTA 3C2SA 3BAEH 5JOPE 1IGFH 5IB1B 1OAYH 3ZYJA 1N6QH 4Y1AA 1C08B 1F6AB 5MEOB 1A4JA 3GIZH 4HWEL 4WWKC 4XNMA 3FRUA 4LVOC 2YPVH 1XF5A 3PWVB 4ODUA 3RZCD 3REWA 4PR5B 2WLZA 3H9SD 2CKNA 4I18B 5IMOA 1M1SA 4CMMA 2AK4B 4X4MA 5AAWA 1NDGB 1UACL 3CCHB 1OAZL 2EH7H 5D1ZB 4MJ5A 2ID5A 3K7UA 3V5HB 4KDWA 1I3GL 2JJWA 3KS0H 2X09A 3L3KB 2EDWA 4GW4A 1D5IH 4U31A 2NY0B 3D2UD 2VXTL 1IAIM 4Y2DA 3FB5A 5CFHA 1KBGL 5BS0E 3UPRB 3SO3B 4RA0C 3VFNA 3CFKB 4JM2D 4B7LA 2QSCL 3CGTA 4PYHA 1S7WA 5FYJD 1MLCB 3V52H 1Z9OA 3MLXH 4Z7WB 3O6LH 1I1CA 5I71B 4W81A 3QHFL 4KROB 4K7FB 4ZPTB 1U8IB 5JUEL 4OCWH 5DD6A 5C0DA 1FZOA 5DK2B 1PDKA 5IROA 1ROWA 3AS2A 3S36L 4ZTOH 1HHHA 1Z6JT 2O5YH 2W1NA 5AG9A 1XF2B 1EZVX 3AAZB 3O8XA 5B3JF 1MJJB 5E8OA 3RJDA 2VITB 5C0JA 3ULVF 3BEWB 4EI5D 4L4VA 3OKLB 3MLSL 4UTBL 5KS9A 2R29H 3IB4A 4OLEA 4G6ML 3U4EA 2J8UE 1LMKA 5EU6D 1T4KB 3KAAA 1FAIL 3KPPA 3IDYB 3NPZB 2HJLB 2NY3D 3SHSA 4LGSB 4MXWL 4IRJB 5F9JB 5I1IL 2VXSL 1PLGH 4PLNC 1EJOL 3EYOB 1DVFB 1J9CT 5GIRB 5J1AA 2P42B 1T1XA 1EMTH 1F02I 4JY6B 4HZLA 3DO7A 1PD6A 1ZGLP 2CR3A 1QSEE 1U58A 4F2MA 3OKNA 5KVFL 2I25N 4PTTA 4PV9B 4K94L 1PKQB 2WINB 1FORH 2UV3A 3ZKQD 2B1HL 2H8PB 4KJYB 3TNNA 5EIVA 4G9FD 4OGZA 3NCFB 1JIBA 4HFUH 4ETQA 2X9YA 3OHXA 5FV2A 3O9WA 3TBWA 1NMAL 5KOVC 2DL2A 3MRDB 4ZTPL 1K6QL 3PDOA 3E6HA 1A7QL 2F58H 4FQXB 5EC1B 3S4SB 1ES0A 1H3UA 1FN4B 2UYLB 3F7QA 4AL8H 1KIQA 4NQEB 5GRYA 3GGWB 1SBSL 2QSQA 4I1NB 3QG6A 3PE9A 4NIKB 5KSUA 1RK1B 2GEEA 4JVUA 3VFTA 4L3AA 3DRTA 4PP2A 1U8QB 3PDGA 4NQVA 1B88A 3W9DB 1MRFH 3VU2A 1CL7H 2VISB 4QXTB 1S7WB 4HWNA 5BZDB 4PJIF 2NY2D 3CVHA 2I60L 1GC1H 5CJ8A 4ZUUA 1OWWA 5IK3B 4NRXB 2YD6A 3RDTA 1F97A 1CFBA 1RZ7H 3GSNH 4NN5B 2P5EE 2R2CA 3VGDA 5ELIA 2Q8AH 3QPXL 4E41E 3CMGA 4IRSA 5ALBH 3NCEB 5F6HI 2BVOB 1GOFA 1NFDE 4X6FB 4GG6A 3L7FA 2GSIB 5E8NB 1IAII 1WK0A 2X05A 4O51A 3TLRA 2FHBA 4MNGB 4AQ1B 3ARVA 1BF8A 3WHXB 3ROLA 2O93L 2HAZA 2VN7A 3MXWH 5CJBA 3K2UL 4P57A 6FABH 4OZFH 4WO4A 3MV7D 4K3DL 4OF8A 1BFOB 1S5IL 2I07A 4GXVL 4K7PY 4BZ2L 2CRIA 1A2YB 1NFIB 3F8UB 3NTCL 1FYTB 3MFFB 1UB5A 4G8EA 1YECH 2FH6A 2EEAA 5M94B 2FX9L 2OK0H 2JCCE 4M7JH 2P8PA 2HG5B 1RZ8B 4E9LA 4YQXH 1JN6B 1MWAH 2PCPA 2YC1B 4EVNB 2AVGA 3I75B 1HWHB 5C2UB 4M03A 3TVMB 4F2MB 1ZLWK 4M5YL 1OQXA 5JDSB 1MREH 2W59A 3C8KB 4YDJB 2Q86A 1LE9A 3S5LG 3HNTL 1MQKH 2AGJL 4JZJB 1MH5A 2BOBB 2DTSA 5C08B 4AIZB 4HGWA 4MAYC 2DM2A 2QADB 1G7PB 3GRWA 3AXLA 2CKBA 3VGAC 5TE6L 3Q5TA 5GGSA 5A2KH 5HYEA 5JPMB 4Y89A 1KIQB 2VLJD 1AP2A 1TXKA 2IAMC 4U6HA 3RY5A 4QRRD 5DEGB 4Z0XA 4HX1A 1NGQL 1N5AB 4FXGB 1TVHA 1CG9A 4ZS6C 4ZFZA 2W07A 4GKSB 2HT3C 4NWUL 4WI2A 3NA4A 1IQDB 15C8H 4EDWH 4HCRA 1B0RA 1M7IB 3K81A 2HKHH 4N68A 4U1LA 1YEHL 3T3PF 4HS8L 3F7YA 4KHTH 2F53A 1QNZL 3WUWB 4ONHA 1AE6L 4L4TA 5IFJA 1W0YT 3OKDA 2ICWI 4EJ1C 3MLUL 4WHDA 3W5NA 4OLVH 3QQ4B 3ZSTA 2V9TA 2WNGA 2ATPA 2ZJSL 4L8SC 3HAEB 1EA9C 2XIDA 2Y72A 4FQIL 3ZTNL 1K5NB 2XWTB 3SCMD 1NCDL 1RJZA 5CD3B 4GAYB 2VKXA 4Q9RH 3K2MC 5EU4B 4YXKL 2DWDA 1MPAL 2XKUA 4FFVC 5DJCA 3AUVA 4PV8B 3RVUC 4YBLB 4W4NA 2DTML 5K33A 4EQ2A 5TQ0L 4WW1A 5CHNA 3U6RA 3WXVH 3EOTL 3RWJB 3TT3L 5DJXA 1LDPH 2YKLL 2BCKA 1T20A 1DCLA 1R3JB 1E27A 4CRPA 1S7VB 1JGUH 3EIFA 1ZT7A 1CS6A 1QA9B 1U93B 4XTRC 3L5IA 4HIIA 4J12A 3QUML 1D5MA 3QUXA 1AY1H 2GTZA 2JB6A 3NCYS 4ZSOB 1LEIA 2VMFA 1N0XL 3N1GC 3O6KH 4BJLA 3ARTA 4EN3D 2L7JA 2ZPKH 5JXAL 3IDMB 1B2WH 2HN7A 5EO0B 2VDLH 3OPZH 3TBSB 3ZDZE 4N0FB 4DGVL 9CGTA 4GRWH 1U3ZA 4YPGB 4X98A 5F88A 1RUQH 2DMCA 3BX7C 3OKEB 1KJ2A 4WFGD 2OQJA 4FNLL 3CUPB 1CGTA 5MEPA 1J1OL 2YA0A 4ODVH 1A1NB 1P6AB 4YHOL 1JRHH 3LKOB 1XGYL 4MAYD 3GIVB 4PS4H 1R5VB 4LLWA 3MV8A 4QYOA 4XCFH 4ZUVA 1UKTA 5SWZD 1BX2B 1YPZF 1MCIA 1JWUB 4HQQH 2AXFB 4EIGB 2IAMD 2Z8RA 1FRGH 4PJ9C 5DQJA 1A21A 3DWTA 3OGCA 3KYNA 1QFPA 4ZMAT 4LHUA 3SGKC 4ZS6D 4EXPX 4XWOC 4ZD3H 1OF2B 2HT3D 2FJGA 1A5FH 4X83A 4PJXB 5FHBH 5DK0B 1XIWB 3NZ8B 3IVKB 3PJSA 4JRWA 4GRWF 1MCPH 3O2DA 4GJTB 1MLBA 4HIEB 1U8HA 5EOCL 3VXOA 4HV8A 5IFJB 1MIEH 3HRPA 4JQIH 5EORH 4Z7WF 1YNLH 1ADQH 2AJVH 4Z9KB 1UEYA 1UB6B 2HFEA 5DJ2B 4YXHH 4WENB 2XQBH 3LPGA 3PHQB 3UP1A 4RGNB 4LASH 1MJ8H 1U3HC 3MLYH 5L9DL 3O3AB 2DDQL 5IJKC 1R3LA 4K9EL 3BKMH 3MV9A 3UZQA 5IVOA 4FFVD 4C4KO 3ZE1F 3BP4A 3LQAL 1HILA 4XVUC 2W0KA 1G6RB 4JKPL 2F74A 4QRUB 5ACLA 1GIGH 5JXEC 3OKKB 4MDJA 1BOGB 4P5MB 5AYQA 3ULUE 3MODL 2OR9H 3TCLA 5D72L 2WSKA 4BFIB 4HDIB 5DUML 1RZJH 5T1MA 4KMTL 3ULUL 2VAAA 3MR9A 3ZL4L 4ONGH 3OL2A 2G2RA 4XTRD 1GZQB 5TF0A 4Q6IC 1OGAD 3T1FB 5E2UL 3T4AA 1VENA 2R69L 3FHAA 3WIHH 1HI6A 1QR1B 4FZ8L 4XNQA 3RU8H 2RCSH 1F3JB 4M61A 4YO0A 5HHQA 2NX5A 4JPWH 4NKIH 1S8DB 4LVHB 4XWGH 1PZ5A 4QHUA 3VXRA 2PUQT 4AYFA 4O2CB 4RSVA 2X1WL 3HZVA 1CI5A 4CADB 4F57L 1CIDA 2XI9A 1DQDL 1UZ8B 2P47B 4O02H 3N06B 2R2EB 4JB9L 3EO1A 4X7SH 1FPTL 1QLRA 3BEVB 5LG1A 2FX8H 5JHLH 3JV0A 2ATKB 1MCWW 3TA3C 1R0AL 4OLWH 5DRXB 4QYOB 4OZGA 5DWUL 4JFDA 3CFCH 1NCAH 1RUPH 4K3JH 5EO1B 1E28A 3OTTA 4HJGB 5EFIA 3WIFA 4PJ9D 3SDYH 4M1GL 3R0MA 5C0CE 1NCBL 5I66B 3WXWL 3G6JE 3OB8A 1KCKA 1TVBA 3GBNH 4XWOD 1CBVH 1OD9A 4DW2L 4LLVA 5HHNA 4U1KA 5B39G 4LCUB 2NMSA 3I6LE 3P0VL 4Z77A 3VWJC 1D9KC 4YUEL 1S7RA 1NUGA 3OX8B 4ORZC 5GZND 5F3BA 4U7SA 5F8QC 1EX0A 3QQ9C 4OCRL 2XT1B 4KJWC 3TBTA 4FABL 5DURD 4DKFH 3BPOB 5DT1H 4YAQA 1I7UB 4MHHI 3IFLL 3DECA 3LRGA 4Y7MA 1D5BB 4ZXBC 5E08L 5A43C 1U3HD 1DUYB 3GJEB 4XBEL 3M8OH 3RA7H 5E4EC 1M6OA 4BZ1H 4LDOB 2VZ1A 5GS1C 1RPQA 4XCNB 3RZCA 4XVUD 3H9SA 3S4SG 2MCPL 5JXED 4D0CA 4ZUTA 5IFHH 2EDDA 4WFHE 4L3EE 5CJOH 4G5ZH 3X14B 4WTZA 1JYWA 3OV6A 1EHLH 5T1MB 5I75C 4MJIA 1Y18A 2ADGA 5C2BH 3O3DA 1T0PB 3AVEA 3P4MA 1LEKA 1UADC 2FECL 4HG4K 5HD8C 3CSYB 4IJ3B 5ESQB 1LILA 1CCZA 2DQCL 1J1PL 3DIFA 5C0IA 1HI6B 1U91B 3SDDC 4R4FL 4JM2A 2BX5A 5AZEL 1PQZA 5FK9B 3CX2A 3UTQA 4TQEL 5IIEA 4G6JL 1CZ8H 1JTPA 3AM8C 5TFSL 2NXZC 3CVHH 1S9VB 3OR6A 4P46B 2YD3A 3CH1A 1OW0A 4TVSa 4PJBA 3T3MF 4LAQL 4GKNB 1T0MA 3W0WB 5HYJB 2OJEA 1KIPA 2AV1A 1QSFB 5MERA 4AG4H 3TA3D 3V95A 4LFHG 3VE0B 3JV4A 1LP9E 1P7QD 1B4JL 3HAEH 5CKAA 1FZMB 3CJJA 5JTWA 4DKAA 4EI5A 1P4IL 3LB6C 1YMMB 4GQ9L 1OAQL 2D0GA 5DC0A 4AENA 3MUGA 1WVZA 3FQXB 3HNVL 3U7YL 1JPTH 1T0NA 4JDZB 1V7ML 3PV6B 5F7EH 3VH8B 3TN0C 3MOQA 5CMAA 3NCYP 2WIIB 2ICCA 3IAGC 5FYLD 1T21B 5D96C 3VWJD 1YDPB 4K8RH 5ITBL 4QTIH 4P99A 1DSFL 4JO4L 3VJ6B 2F9BT 3QQ9D 3TBTB 1KB5A 3LN4B 3QDJB 4KJWD 4CVXB 3FQWB 1RZKL 3QQNA 4Y5YB 5F72S 1RUMH 2ZUYA 4WV1B 5DRZB 2ZNXA 4ISVB 5CSBA 2CPCA 4X99A 3ZKSD 3U1SH 4CN6A 1CN4A 2ZUVA 4P2QD 5GGTH 1ZXQA 4LCIL 5A2FA 4G9FA 4GG6F 2BHUA 5MEQA 3FMGL 3H9SB 1OLLA 4X5XB 1U92A 3INUL 4TUOB 3GHBL 4YIQA 4X6CE 1XGUB 5E2TL 8FABA 3CX5J 2VXQH 2DI8A 3FOMA 1PX4A 4WEBH 3GRWH 2DQFA 4JAMB 2P5WE 2CKBH 5DVOA 4P23A 4RMQA 3C2AL 5EB9A 3IDGA 1PYWB 5GSRA 5E5RB 2QQQA 3D2UB 5HD8D 2ZCHL 3ZDXE 4OIIH 3SKOB 3MA7B 5F7WC 2ITCA 2XA3A 3DIFB 1KLUA 3TO4A 1V7NH 1Z3GH 3SDDD 1M05B 3FN0H 4X7DC 4EQ3A 1OARL 3VGGA 3KR3H 5T5NF 3FT3A 4X4XB 3VXMD 4PLJC 1F4YH 4GMSH 2NXZD 1TFHA 5EOQL 4R0LB 1I1YA 4WI3A 4XC3L 2YRLA 4DVBA 3V9FA 3JSSA 1CXHA 3BP6A 5D71H 3QP3A 2V6HA 1K4DA 4M6ML 1QG3A 4V1DB 1J0YA 4XGZA 1VFUA 2VOTA 4X7EC 5SX4H 2C7UB 4XP1L 3V6OA 3NCMA 4XP5L 1KV3A 4PY8I 2VL5A 3F65A 5IHZA 4QRPE 1ZT4B 3T0VA 3GDBA 3KLAA 2CIIA 3NFPB 4OQTA 2PYED 4F9PC 1FFNA 1HQ4B 1AKJA 5EU6B 1EBPA 2QQNL 1ORSA 1F4XL 3IJHB 3SDXA 4YHZH 3RWCA 1EVTC 1G6RH 3HN3A 4NO0B 1IKFL 3ILQC 2A6DB 2ARJB 2NY3B 5FB8B 5BO1L 1P2CA 1HEZB 4HUUA 3L3HA 4PJXF 1BIHA 3HG1D 3WHE0 3Q6FA 1QRND 4KTEL 5BVJB 5LQBL 3NACL 5B8CA 1MI5A 2FCBA 3OAUL 4UNVA 1KC5H 3DSNA 5I1AA 5HY9A 3D39D 4QWWD 2VXVL 3V4VL 2ZP0T 3RWDB 1KUMA 3HHRB 5DMGD 3GB7A 3ILPA 4WWKB 4XBPA 3UJTL 3VXUD 4N0YL 4BA8A 4LVOB 4HPYL 3QXAB 3ARPA 1FO0A 5EH1A 4C56A 4OI9A 1DTUA 1KTRL 2IQ9H 2VDMH 3B3IA 1NANH 4Y5VC 1SQ2N 1E4WH 1HXMB 1TQBC 4Q6YA 2DF3A 2ADFL 1GAFL 1H3TA 4EKXA 4L8DA 3P3YA 3RGHA 4POUB 3JWOH 4WU7A 2HJKA 4OZIE 1R5WA 3HFML 4Y4KC 4W6WB 1EFQA 2IADA 1V8HA 2J12B 1V05A 2AEQL 3LHPH 3MJ9A 1R3IH 1QFWM 4UTAH 1CT8A 2PR4H 1CQKA 1HWGB 1JFQH 1DQJA 3G5YB 4JRXA 4QNPF 5E8DL 3U4BH 5C0BB 1NBYA 4OD1H 3IF1B 3ULVE 3DHMA 4PLJD 1HNGA 2ZUXA 2GJ6E 1NEZA 1ETZA 4N90D 1AO7D 3ALPA 3ULVL 3O2DH 2RQ8A 5ENWB 4Y16D 3IDIB 3C9NB 2PYFB 3VFSB 2J3SA 4DN4H 5T3XD 1MY5A 3LKSB 4PGEB 4X6DE 5TF1L 4DOHB 3IFNH 1ZA6A 2Z0BA 4U6TA 1PFCA 5I1KH 3SCMA 3HPLA 5L2KE 3L5XH 5F70A 4NJ9H 1X3DA 1ONQA 4G8FB 4JZNB 4FQCH 3C6SA 2PO6C 1BFVH 5FO8A 2D0FA 4F3FB 3MUJA 1FGNL 2X4NB 3MV7B 2DLIA 2OZ4A 2DKUA 2Z31C 3UBXB 1GGIH 4PJEE 1CFNA 4D9LL 4I0CC 1TPXC 3BUTA 4I3GA 3PIQA 4NT6B 3VXSE 3L3DB 2VLKB 2FBOJ 1BIIB 1MQ8A 4MA1C 4PP1C 3GZKA 2GTWB 1UG9A 1FGVL 2V2WA 1X5HA 1BGXH 2AXHA 2HP4A 4FN0A 1VA9A 3MCLL 4NKMA 3OB0H 3RUGB 2MHAA 4EN3A 3WFBL 1QLEL 2EDXA 4HGKC 5C6WH 1JNHA 3CLEL 3WNPA 2EO9A 1A1OA 2CLRA 4QHMB 4MAUL 2VDPL 1KIUA 2FATH 3C60D 2WM0A 4XH2B 4KXZH 2V2TA 4LSSH 1T1WA 2B4CH 3V4PH 3CC5A 4PJ5B 2VXUH 5HI4C 1MHCA 2MKWA 5I18H 4GAFB 3FFCE 3CU1A 4QGTA 1A6UL 3LZFL 4JPVL 3BWAB 1R5IA 2A9ML 5E00A 5B38B 5LBSL 4Y4KD 3D0VB 4HEME 3QUKA 2VLJB 5SWZA 3O3UN 4JANA 4LHUG 2PXYC 3PDDA 4LEXH 4QRRB 5CJXC 3DMMC 5D7JC 4XNXL 5AD0B 1G0DA 1VB9A 1A14L 4HXAL 5EULV 2BNQE 3MRIA 3OF6A 5DD1H 4JFOA 3ZHKA 1UA6L 1BM3H 4W4OA 3BZDA 3ZDYE 3G04B 4BYHA 4OUOA 1CVSC 5FDYA 4LDEB 4QT5A 5K9KA 4N5UA 3PF2A 1GGCL 4YHPB 4TPRH 2X4TA 3KPSB 2BY2A 3O0RH 5HHOE 3LN9A 4TNWF 1IL1B 1AHWA 1Q9KA 3F5WB 4J8RB 4FQHA 5K9OA 1H5BA 1HHGB 3P9WB 1MSPA 1U8MA 4PJ8D 4E5XB 3U83A 4K94C 1QTYT 2E9WA 1N59B 2JB5H 3ISWA 3OKOA 5JO5B 5DMKA 1T22B 5JOPD 2A9NL 5F9DC 2RAMA 5DEZA 1RIHH 3TYFA 5CWSB 4JPIA 5F1NB 3O41A 1I1FA 2RJMA 1QFWI 3EYVB 5IB4A 1T03L 3CXHJ 1EFXB 2VUYA 5INDB 1AGDA 4RISH 4G9DA 2PO6D 2XWBB 2B0SL 4OAWA 4JE4B 3MNWB 3CD4A 4C83B 5DEFA 1SJHB 4DUXA 2Z31D 1NAMB 2A83A 4OD3L 3PNWB 3PQYD 1BVZA 1NBZA 3NFSH 1WC7A 1ZANH 4XAKE 5IF0A 2APXA 2WUCH 4MJ6A 3BH8B 4XNYH 1UC6A 4JG1L 3ZKMC 2WAHA 5BS0D 2IANE 3MGTB 2NQCA 4M00A 5DHYA 5IWLC 4ODXB 1BD2D 3MGOA 4A2LA 1DQLL 3IU3B 4YHLL 5GGVY 5EWIL 1FNGB 1WIUA 4DFHA 5DI8B 3KNBA 4YHKL 5FYJH 2EKSB 5IW3A 2XFXA 3O4LA 1RVFL 1A6AA 2B8OT 2ESVE 5J11C 1ZTXL 4MNQB 2G5RA 2GT9A 3P73B 2BNUA 5H94A 1MWAL 1IAIL 2EDRA 4RQQB 5HI4D 4OBRA 2GHWB 1INQA 2CUHA 2EDBA 4MAYB 1PEZA 2NY5H 3ESVF 3T3PE 5I76B 2BC4A 4GOSA 5KJRH 3VGAB 1BHGA 5IMKB 3HMWL 2YUXA 1M7XA 5D7SH 3EOAB 3WO4C 2PXYD 2AV7B 2IAMB 3RNKA 4EUPB 4F58H 5DTFA 4EBQH 4PJ9A 1JGDA 3DMMD 4MS8C 5B3NA 2JKXA 5IMMA 5D7JD 1LEGA 5T3ZD 2E27H 1EGJH 3HI6L 1FC1A 2J88H 4S1SH 2I9TB 4J3TA 1J5OL 3OZ9L 2DOCA 5E5MA 3T65B 1N8ZA 1T2QH 4PRHD 5ESVB 4O58H 5CGYC 4JM2F 5T1DH 5EUOB 2R0ZH 3DTXB 4GAJH 5F3HA 4NQTA 3MRRA 3UTTA 1KELH 3R1GL 5KZCD 4YR6B 4MLSA 2HYMA 1FZKB 4MGXA 4FQHB 3SOBH 5K9OB 3MJ8B 5KVGH 2X1XR 2EICA 3LDBC 4PJBF 5TGBA 3SDCB 3DROB 3H2WA 4L8SB 1QSED 2P49B 2H45A 1CXIA 1MRCH 1S7XB 2YPKA 4DZBB 3MO1A 4J2XA 2NW2A 3MLPA 2WIMA 3C8DA 5CBEB 5IJKA 3CFDA 1BBDH 5HHPB 4OCNC 4UIMB 4LMQE 2FO4A 4IMKC 3GMMA 3A6CH 1KEGL 4WTZG 4G43B 4AK1A 5JXEA 5TH2A 4ORGB 4N0UA 3D48R 3B8YA 3VFMA 2AJUH 1YEFL 5KBNC 2OX5A 2R56L 1S9XB 1BBJB 4FQ1H 4ODHL 4K3EL 4F7CA 2HJFA 1O5DT 1OOAA 4BFGA 3NIGF 3UCRA 1KN2L 4WJ5A 3B5TA 2X42A 2DLGA 5GJTH 4TSCH 5D7KE 1OGAB 2VSCA 1QYGL 1FVCA 1NUNB 2D03H 5M95B 4G3YH 2XA8H 1YPZE 4KQ3H 2VE6A 2YUWA 3WIIL 2FR4B 2WWKO 2DQUH 35C8H 4FZEH 4JFFB 5HGAB 1RHHB 3LKPA 4JG0L 1LO4L 2QHLA 3QH3B 4ZAKC 4PJFB 3I50H 4CDGC 4IIQC 3S35L 3EDKA 5E1AB 2XACC 4GRWE 3CPLA 5GJSL 3S88L 2APBA 4XAWH 2IALA 3LEXA 3TH4T 2CH8A 3WBDA 5DTFB 4NHCL 1RUQL 2WBJA 4MS8D 2IBZY 1RI8A 4XMLL 1FSKC 3STZA 2B39A 3GSRB 1OAKL 3S98A 3PWLB 4UUJA 4I48A 4HMDA 2UWEA 4W68A 4U7MA 3LKRB 3H9HB 1G6VK 1ZVSA 4NGHL 5CGYD 4G7YL 3CFJB 3VWJA 3SQOH 4XCFL 4X7CC 1NGYB 3DO3A 3SE9L 5I8OL 5JW4N 4Z7VB 4YGAB 4Q0XH 2BNRE 2BHYA 5DURB 4NZTH 3GI9H 3PG2A 2LABA 4P3CL 5ILTH 3RGVD 1I1AC 5E6IC 1HSAB 3DJ9A 5EC2A 3I6KA 4R9HA 1JNNL 1QSVA 4KVNL 2W0LA 2E5EA 3KWWA 1U3HB 1W2KT 5GGSY 1RU9L 1IAKB 5IB2A 4P2QA 1Q1JL 3SQBA 4MD5B 1CL7I 3MBEA 4HIXH 3QEQA 1KXVC 4IOSD 3BXNB 4Z0BL 2HVJB 4JZOA 5CBAA 1OGTA 3CDFA 4ALAH 5JZ7C 4LIQE 3X11B 5I16A 1RIVH 3S7GA 4LIQL 4Y1AE 2Z91B 1MCSA 5F7DB 1OL0A 2VSDA 3FO1A 4LGRB 4HIHA 1GGBL 4R4NC 2CLZA 2LVCA 4RNRB 5E9DA 2CSPA 2FIKA 4X4ME 4Q6IB 3K74B 4JN2A 1FVCB 2K9UA 4Y19B 1XF3B 3TIEA 2CD0A 1M7DA 3U7AA 1YMHA 4FOMA 5JOFB 3QFJD 3STBA 4QXUH 3WKMH 3RUGF 1HHIB 3O2WH 4MCZA 4X9IA 3QB7C 4S0TD 2G5BB 4JFPB 2FEDC 4HK0B 3O4OC 3X3GL 1QRKA 1F58H 2OSLB 3AREA 4ZS7L 4ZFGH 4PRAA 4CVZA 4Q74A 1X4XA 2Q3AA 3TA3B 1GHFH 4MSWB 1P7QB 1MCWM 1HQRB 4X4YB 4K9EC 3MRCA 3T8XB 4PJHA 1CDGA 1FG2B 1JNLH 3LQAC 3NCJH 4LSUH 5CGMA 1IGTA 1PX3A 4S1DC 5IMLA 1C1EH 3U0TA 4I3SH 4M8QB 2D7OA 4W6XB 1S9WB 3H3PL 5E8EB 1UM5L 4MQTB 2DQIL 4OCXH 2OL3B 5DD5H 4GRMB 4M43H 5L8JB 3SGJC 3TBVB 2G60H 3S96A 3ULUC 2OTPA 2OZ4H 3EYUH 4HMCA 5GGVL 4MJ2A 1NAMH 3ECBA 3C6LA 1D9KB 1UVQA 5I1HL 3HG1A 4L4VE 1JHLH 3PWUA 3K80A 4NHUB 4NFCA 5KS9E 1N6VA 2DQTL 3VGEA 1I8IA 1J87A 4XPTL 4PD4J 3H8NA 1KTDA 3JXAA 1NGWB 2KDGA 4LSQH 1I1AD 5E6ID 5EU3A 2H26B 1NAKH 4LLMB 4TSAH 4ZXBB 2HLAA 4L3CB 3BO8B 4WUUA 3RJQB 2BFVH 4O9HL 3TPUB 5I30H 4HKJA 4P2QB 5E4EB 2DAVA 5T1LD 3E6FB 2FB4L 3VXUA 4E42B 4JHAH 4PLKC 4AEFA 5GS1B 3DUHA 1EEYB 4I0PC 3LD8B 3PWNA 5GRJH 5JZ7D 3WMSA 5LGKA 1XGPA 2BMKB 3VFRB 3OAYH 2EDTA 2QQLH 2C1OA 1MHHA 4QXGL 5I75B 4OT1H 1L6ZA 1FP5A 5AYUH 1CLYH 5HGHA 4FRWA 1RZGB 1AGFB 1Y0LB 1VGKB 4HBCL 4HKZA 4R4ND 5ISZD 5E5UB 4EUPH 4NC1C 3MMEB 4WNQA 4MCYB 5CJQL 2R1WB 1A4KB 5I1LA 3SDDB 1AFVH 5I8EA 1NEZG 4P4KC 3ESUF 3T0BA 3NAAL 1OP5H 2O61A 3DUUB 3VXMB 3QG7L 1B0GA 1ZSDB 2NXZB 3GJFB 1Q9WB 4G8GB 1AO7A 1JF6A 1WFTA 3O11A 5TDOA 2FEDD 4JGMA 4MDIA 2E6QA 4Y16A 3U9UB 4U4BA 1BQLH 2BOCA 1YN6B 1CFTB 4NJAH 3G6DH 1QBLL 1P1ZB 3H7BA 4WHYG 3TWCL 4YHYB 4K71C 3LQMA 4S2SA 4M48H 4M6OH 2XTLA 2Z35A 3TIDA 2AJ3A 4GMTL 4OLYH 1SYVA 4YXLH 3WJLC 3PXHA 5I1JL 1R3HB 5L8KB 4AJ0A 4LEOB 1KPUB 2BRQA 3CVHL 3SDAB 1YEIH 4N5EC 3GSWB 2PYEB 3DX6A 5LCVL 4S1DD 3RL1A 4LHJB 1FH5L 4FP8L 3WS3B 3HE6A 3P11L 3BIKA 4UNUA 3TPKA 3TN0B 1Z5LB 4RGMB 3ULUD 2X1QA 4D9QE 1X7QB 4JEGB 5D1XD 4GG6E 2W0PA 4XT1C 5D96B 3I6GB 2X4PA 3LOWA 4OFDA 1F11B 3QI9C 1QRNB 1MFAL 3UJIL 4TVPE 5EUOF 4K23L 3FQTA 4KRPC 3ZE0F 1PG7H 1L9MA 5BRZD 3VFGL 4TVPL 1T6VN 5I19H 1JUFA 4OKVB 4LARL 4WW2A 1H0DA 3D39B 2IPKB 4H1LA 4XC1L 5LVEA 1II4E 5ADOH 1JK8B 5FUOH 1IFHL 3C60A 5D1QB 1CF8L 1HHKB 4DAGH 4M4RA 3SJVB 1EUUA 4PLKD 3H42L 1N3NB 4O5LH 1CLCA 4LRNH 1S3KH 1FJ1B 5FM8A 1A1MA 2MQ0A 4O2FB 4N8CH 1BZQK 3WV0A 4LVNC 5EOCJ 4LBEB 1S9KC 4DKEL 3FO2B 4Y4KA 5F8RC 1I3UA 1FVEB 4CNIB 1HXYA 1CLZL 1AIFB 5IHBA 1S7TA 3IDXL 5C0CD 1W0VB 2HA1A 4U1SB 4WNQB 1MJ7L 1E4KA 3O6ML 4QHLB 3EZ8A 5JA9A 1AD0A 3HMXH 3RZWA 4P4KD 2NY4C 4A6YB 5BZWA 3I3DA 1NMBL 4UDUA 1QFUH 1NPUA 3WLBB 3L5JA 3I6LD 5L6YL 5FGRA 2XG5A 1XR8A 3IGAB 1RZKC 4GW1A 4UILH 3C5JA 3B43A 4UIKL 4ZOCA 4PIRF 3RWIB 1BEYL 1BFTA 3F12B 1DLFH 3Q1SH 4PJ8A 4U33A 1SM3H 4BH8A 1U95A 2KZWA 1R24A 3AC0A 5FXCH 5KTEL 5JORB 4HCRL 3C5ZA 3S34L 1F4WH 4GMSL 4M5ZL 1MUJB 2F53E 5C09B 3IETA 4L8CB 4L4TE 2WP3O 5LAXA 1AGEA 3QUZC 3NOIA 4R7NA 3B5HA 1DN2A 1IKNA 3SE3A 3KPNB 2A73B 3T0AA 1IEBB 4L3ED 3PQYA 4F9LC 3N1PC 1C5CH 2R9HC 5DRWA 1A9BB 2GW5A 1K8IA 5C0GA 4LPYA 4HKBA 1K3ZA 3PUCA 1J0ZA 4XP6L 3ET9F 4POZD 3QI9D 4IMLA 4RIRA 1MCKA 2VDKL 5IJVB 3PP3H 1I75A 2OJZL 1FL3A 4GW5B 2VQ1A 4Z7VF 4JRYA 1EXUA 4MX7B 5F1IA 3BT2L 4ELMB 2H32B 1BJ1H 2VLRA 1E6JH 1BD2A 3RWEA 2OLDA 4X0KA 3MLZH 4JFHE 4YHNB 1FV1A 4P2OD 4R90H 3L1OL 4XCEB 4GUPA 1KJVB 1TZIB 2C1PB 1MAKA 2GUOB 4R2GC 2FX7H 4QNPE 4NZRH 4Y5VB 2R4RL 3QXDA 3A6BL 1TQBB 1KPVB 1XCTB 1YQVL 1BWWA 3DURB 1JF1B 3QO1A 3T4YB 4Y4KB 2DQEH 1EAPB 4D8PB 2PXYA 4LCYB 4J3OC 3ARDB 5E2VH 1FLRH 1YZZA 4KKBC 3EO0A 1A7RL 1KJ2L 3OG6B 4P5TC 2J8UA 5FA4A 1AC0A 3BZFB 1ZLVH 5D6DC 3MRBB 4I3RH 4KJPC 2NY4D 1YC8A 3MUY1 2OL3H 3MV8E 4PRHA 7FABH 3DI3B 3W5MA 3JWOL 3T77A 3ZE2E 4Y88A 4O00A 1JYXA 1B9ZA 5GRUH 5BV7L 5F7MC 1VFOA 4N1CA 3NH7H 1O7VA 5HDLA 4OM0L 4FFYH 5DMJB 1G84A 3FB7A 4K7PX 1JFQL 4BH8B 2ED8A 3GUTA 3U2SB 1QSEA 2HWZH 3U4BL 2ADIB 1LK2A 3WL9B 4MWFA 2ADJA 3QA3B 1FFQA 2ICEA 5IKCB 5IGXL 1YUHA 3QWRD 3O3EA 5FUZH 1B6UA 3GBMH 4C58B 1S9YB 2PO6B 4OBSA 3MRKA 4RCAA 4OB5H 4NQDA 1IM9D 2DM7A 2X6MA 3QUZD 1T1YB 3WN5C 3R8QA 2Z31B 1UM4L 2AXJA 3V6FB 5DYOB 4Z7QF 1TPXB 4PRPA 1S7UA 3T0XA 4RZCA 2P5WD 2R9HD 3W2DL 4ELKB 5F9WB 1CTNA 3I84A 2UWEF 4LSPH 4QRSA 1AXSB 4LLYA 5J56B 1I8KA 4MA1B 3RPIA 1UXSB 3MV9E 5FUCC 3C08H 4BH7B 4KZEL 5DR5L 4ZOEA 1FZJB 3R8BB 2CGRL 4X9FA 2VQ1B 3GI8L 1Q72H 1BFVL 2QSVA 5BS0B 4HULB 4Y4HA 2EYTA 1MFEL 5C70A 2X1OA 3PGCA 5EBWA 5CJ5A 1PBYA 5M7QA 1RMFH 3BZ4B 3L3OA 5HGBA 3ULVC 1G7QB 4BQCA 2C4XA 1CQYA 2D0HA 2JJTA 1L7IH 2C4FU 2BVYA 4XVTL 5I8CB 4R2GD 4YK4C 1BJ8A 2DYPB 5J6GB 1F2QA 3QXDB 3U48A 2IQAB 2R2BB 5TE4H 3QUYC 2XWJA 3MYJB 5E1HB 3BDXA 2CXKA 2GFBA 3X13B 4WHTA 3ARFC 2NX5E 3I02B 4OFPA 3MOBH 3VXRE 3NMEA 1H8NA 3LS5L 4OCLC 4JLRA 5FV1L 5IESL 4QRPD 5KN5A 3DMMB 1CXLA 1W0WB 1LE5A 5D7JB 2ZOKB 2ED7A 4EDXB 4OSUL 3TNMB 4TUJB 4P5TD 5FA4B 2DLFL 4UQ2B 1E6OL 4HWBA 4KJPD 2D7QA 2OM5A 1XT5A 2F8XC 1U8LB 4JFQA 4OZGE 2EXWC 4JFDE 4U1JB 4J7RA 5I2IA 1UJ3A 1RUAL 4GKZA 2H3NA 3JWNC 4PREA 2FZ3B 1DJSA 2HKFH 3F6LA 3QDGA 5KZCB 1WZ1L 4JFZL 4N9OB 4L8BA 4DUVA 5C8JA 5E2WH 2MJWA 1RZIA 4UV4H 2K3TA 3RGVA 2BVPB 1VKXA 4OIAA 5T5FH 3E2HC 4X6EA 2IF7A 1K4CA 1BVLA 5HPOA 3TJHC 5HYQA 5KVDL 3IXAB 5TQ2L 4PG2C 4BSVB 1CLOL 2F5AL 4KUZL 3S37L 1TLKA 5MHSD 1WAAA 4IMKA 1NH6A 1TZHB 4OGAC 1H3XA 2DQGL 4NWTL 2XTJE 1CGUA 3GSVA 1NCWH 1KOAA 1S7UB 2BK8A 5SX4I 1PGRB 5DD3H 3MLRL 3N85H 4KJQC 3RPIB 1CICD 5DDHA 2R4SH 2I9LB 5EZIH 3SGEH 4FQLH 1HH6A 5A40E 2R8SL 1DQMH 1UKQA 3MLVH 4NYLA 5HPMA 3QULA 4KC3B 3QFJA 1D5ZB 4MJIE 2Z4QB 5ANMA 3O45A 4DQOH 1LVEA 3UC0H 1MHEA 5B4MD 4P4RB 3IJYA 5J11B 4LU5H 4LDLB 4N8VA 4DJMA 4HPOL 2P5EB 4BUHA 5JMOC 4JFXA 1R3KA 1RZFH 3QFDA 4E41B 1QFWL 3QQ3A 3QUYD 1KSRA 4R97C 4IIQA 1EEZB 4ZPVB 3ARFD 2CRZA 2GKIA 5T3XH 1P4BH 4U0QB 1NFDB 3WO4B 2W0FB 3MXVH 1X5KA 1H15A 2EYRB 1ODAA 5GGRB 4O4YH 4PJBE 4ODSL 5BW7C 3HZYA 4JJ5B 1ZGLB 4X80L 4CUCA 5F21B 3CMOL 3FQNB 2QHRH 4YHMH 3PXJA 4UDTA 2CO7B 1TITA 2V5RA 2JIXB 1BPVA 2BP3A 1YYLH 4H88L 3VXSD 4JVPA 2JCCB 3QUMA 2R0WH 2YZ8A 1Q9LB 1N0LA 2X4RA 2R0LH 3PGDB 4LOUD 5JLZA 2F19L 5H8DA 3LDBB 3QEHA 3IDJB 2Y06H 3EOYG 1I1AA 2BVTA 4QO1A 1QQDA 2YD1A 4S1QL 3CLFL 5BJTA 4H1LH 4Z7NF 4P9HL 5JIPA 3BD4A 1A6TB 4NNPL 5TDPA 2I24N 5T1LA 2FNBA 4Z18A 1JPGA 3WO3B 4Z7OF 5T33L 5JA8B 1NL0H 1JGLL 1WJ3A 3WDIA 3VXPA 2CIKB 5HVGB 1NCCL 5HDQH 1KCRH 3L3GB 1ND0A 5LWYL 1KB5L 4OGAD 1I1RA 5GS0L 5KVGL 1AR2A 5ICXB 4R7DA 2X89D 2QR0A 1CGYA 3MQIA 3FAWA 1A3LL 2ZOLB 3FFCD 3QIBA 5I17B 5IQ9B 2X4OB 1Z0MA 4AT6B 4JFYB 2B1AL 4KJQD 4NNXB 3BD5A 4YFLF 5ISZA 4LSDA 1LNUA 1XAUA 4XVSH 4RMUA 4H5SB 5F6IB 2HRPL 1XR9A 5KSAC 2BNQD 2EH8L 2E7LA 2H41A 3GSQA 3U4AA 2DLEA 4RRPA 3O45B 2ZSVA 2N56A 4UV7H 1VERA 3BSZL 1FFRA 3EOBB 1DBAL 1MVUA 1VEPA 5KG9A 3QSKB 3NA9H 3RL2A 5HHOD 4ZAKB 1ZT1A 3KLSA 3B6SA 3SBWA 4LKXB 4XNUH 3WEXA 1M4KA 1VACA 5D7LD 2DQJL 4U1IB 2XZAL 1KIRA 1HDMA 4HWEH 2D2OA 2QKIA 2GAZB 3K8KA 3MLWL 5DHVA 3H9ZA 1U9KA 3T0EA 3KPRB 1MAML 4KAQL 3BPCA 1FSKB 4HHAA 2G9HA 3L6FA 1UACH 3ARGC 1OAZH 4X6BA 4ZDHA 5L2JA 2FWOB 5CSZB 3VD3A 4N0RA 3SGJA 3V6OE 1I3GH 3FTGA 4DCQB 2VH5L 5D1XA 5J9PB 3G6AB 4XAKD 2XKSA 1I85C 4YDVB 3OJDB 1NC2D 2VXTH 3N1FC 4DN3L 1KBGH 1ZS8A 1FNAA 3RRQA 3QJFB 3V79C 4H1LG 3SDXE 5BRZA 4OQTL 1I1AB 5E6IB 3ES6A 2NCMA 2IAND 2QSCH 3GSOA 3MROB 3Q0HA 1TJHL 2BVQA 2YD2A 3VRIA 4OQ1A 3QHFH 3SQOL 5I0DA 3ARBB 2ESVD 3I9GL 3OXSA 2P24A 5JUEH 5H37H 4P5KA 1MI5E 3S36H 2V2XA 4NQSB 5JHDA 5FYKE 4QF1A 1AQDA 4CGTA 3TZVC 25C8L 1TJGL 5FYKL 3KPQB 4YHIB 3LRSA 5AUMB 2EE3A 4C56E 3MLSH 4UTBH 1TCRA 5D7IA 1FO0L 1J88A 3SKMA 1FAIH 4MA8L 3TO2B 4FTVA 4MXWH 3D3VA 5I1IH 4JHBA 2VXSH 2OS7A 5C6TL 5E7BA 3MRJA 1FYHB 1EJOH 1NUDA 2LAGB 3O4OB 1YNTA 3MJ9L 1YEDB 4FA8A 3VD4A 1BAFL 1VADB 4JRXE 2XZQL 3VRJA 3QNYB 2JJVA 5KVFH 3PWJB 3UTSA 1FL6B 4K94H 4HH9B 4GRLA 3L3JA 2B1HH 2XG4A 3PP3K 1FFPB 2BRRL 5K93A 2EDYA 1PKOA 1ED3B 1NMAH 5C9JA 5GISL 1KTLA 1F6LL 4HJ0C 4ZTPH 3BW9A 3ARGD 1A7QH 3WFDL 1IEAB 3DUSB 1MIML 3FTGB 2J8UF 4G6AC 5F6HJ 5SX5H 4ZOBA 4LQFL 5LGHL 1X5FA 1OWRM 4NQCB 4EI6A 1SBSH 2ZUSA 1I3VA 5KAQF 4LSUL 4OCMC 3UXFA 3V5KA 1T3FA 5EO9A 2O5XL 4KDTA 3IFOA 5D7KD 4E0RA 5D2NA 5GSVB 1BOYA 1FLTX 1A7BA 1UQSA 2LU4A 3MRFB 3QIUC 1FNSL 1JMXA 4XI5C 2EEDA 4ZFFA 5C0EB 1QD0A 4I2XA 5H37G 1LO0L 2I60H 4ZG1A 2OZ4L 5F1OB 4P2OA 3CK0L 1X6LA 5MENA 4Q2ZB 1ZLVK 5EBGA 5CEXA 3DVFA 4I0PB 4Y2DC 4IEFB 1MCHA 2LFGA 3QPXH 4XRCA 1XZ0A 1ZVYA 5ETUA 5CD5C 2KQMA 1WF5A 2BSSA 4QOKA 1XGQB 3IKCB 4YEFA 3TZVD 5BVPL 5J4MA 1IAMA 2VIRB 3MREB 3UTZB 3T0DA 3MV01 2ZCLL 2E7CA 5C0CB 3SPVA 4DEPC 4PUBL 5IROC 3G6JB 2NNAA 3DX7A 1AD9B 3K2UH 4U1MB 3UYOD 5KAQG 1C16B 3BPLC 4XCCL 4OGYL 5GRJL 4K3DH 1S5IH 3LKQB 4P4KB 1Q94A 2YUVA 4GXVH 4BZ2H 4DWHA 3NTCH 3O8XC 4Y4FA 5SWZE 4Q9QL 1G0YR 2FX9H 2P1YA 1U0QA 1SY6L 3AU1A 1BQHA 2R1YB 3WNLA 1U8JA 3P2TA 2HFTA 4EXKA 1HHJA 2IJ0C 1YNTB 3T04D 1Q0XL 4G8IA 4HUXA 2BNRD 1DDHA 4K71B 2Z93B 4M5YH 5DC9B 1DEEA 5A16A 4PJAA 1A6ZB 1TIUA 4LNRA 4IOFC 4M62L 5H35B 4XMPL 4TRPL 3CDGA 3HNTH 1NFDF 2AGJH 4BELD 1QR4A 5IR1B 3SE8L 3IJSA 1S5HB 3G5XA 3FO9A 3C09C 4P2RA 1F4HA 5TE6H 1ORQA 1MCFA 4G6AD 4L3EB 3MRMB 4Y1AD 4F9LA 2YSSB 2P5WA 1LK3L 1T04B 5HYFA 2AK4E 3QI9B 3L9RA 1K2DB 4KRPB 1KJ3H 1NGQH 1O0VA 2R2HA 4BK5A 4NWUH 3QIUD 4MJ4A 4QHKJ 4XI5D 5C07D 1IC5L 1YEHH 3RY4A 2P8LA 4HS8H 5JIIA 2VZOA 4JHWL 4HAFA 4U05A 4L1DA 1QNZH 3HI1A 1AE6H 1WBZA 3UBXI 1SYSA 5TDNB 5CD5D 1CDBA 1WAAF 3B2VL 2ZJSH 2W9LA 4FQIH 3CDYA 3ZTNH 2BDNL 5CIPB 1NCDH 1LP9B 3CVIL 3D0LB 3O4LE 4C55A 5JW4M 4YXKH 3CFEB 1MPAH 3RDTC 2APWA 5L88L 1KG0A 3W9EA 2DTMH 4M1CD 1QPXA 5TQ0H 4X7TA 3HUJA 1GOGA 4IRSC 5JNYB 3EOTH 3FQRB 4RA3A 1J7VR 3P4NB 3TT3H 2YKLH 4YDIL 5DJ6B 4H25A 4KGJA 4DKDC 2ERJC 3DX8B 4L4VD 3QUMH 1HSBA 2B20A 3OXRB 4NQXA 2BY0A 1T5WA 1OSZB 3RPKA 1C7SA 5E6ZA 1N0XH 4JQXA 3U9PL 5JXAH 3MRGB 4WO4C 5SWSA 1H3PL 2IBBA 3GSXA 4DGVH 1UH3A 3O3BA 4H20L 1MJUH 3O6FB 4YX2L 5IM7A 4IOFD 3GSUB 4UOW1 3MRNB 3JUYA 1JI1A 5ESAA 3UTTE 4PRNB 1J1OH 2A6JA 1OY3B 2EYSA 1IM9B 3QUZB 2X40A 4X6CB 4YHOH 3UO1L 1XGYH 5K9QI 1ORQB 2P8MA 5LKNA 2MQCA 5FCUL 2IPTL 2NLJA 1CFSA 4WDIB 2P5WB 4R8WL 2JK5A 4UOJA 3F7RA 5IVZA 2CDEA 1CICA 1ZHBA 3IFPA 5CP3A 4EIZC 1U8KA 2ARJQ 1QPPA 5DC4B 4Z95L 1MY7A 1CFQA 1A7OL 1RQ5A 5HI3C 4N0UE 3UTPE 3KPMB 4WCYL 1KPRA 4OZ4A 5DQ9A 4NRZA 4N8VG 5EOCH 4Z76A 3V4UL 4ZO7A 5H2BB 4R2GB 4OZHE 3FCTB 3FQUA 4M9PA 3L3IB 3VGHA 4NPYA 3QUYA 3T2NL 3BP5A 3NVQA 2Q3ZA 4WEMB 1T6WA 1VFAB 2HFFA 32C2A 3MLZL 2DDQH 2FDBP 3CIQA 4K9EH 4QRPB 3HR6A 4Z78A 3RDTD 3VFVB 5ECJE 5DHVH 5IW6B 3LQAH 4L9DA 4JKPH 4O2EA 3J8F7 3QWOB 4P5TB 1AXIB 1LO5B 2FJHB 4XB8A 3MRHB 3BHBB 1NUFA 3QHTC 3MODH 4TUKL 1MCEA 3LV3A 1MCLA 3KYMA 5D72H 5IW1A 1MELA 3P9LB 2UZYB 5EBMA 5DUMH 1C5DA 1I3RA 4KMTH 4NN6C 3RTQA 4D9QD 3ULUH 3ZL4H 3HLAA 5ALCL 1UWGL 1NGXB 1HOCA 4J3SA 3BH9B 3TBYB 2JF1A 1DBKH 3D1MC 4F7MB 1WQVT 1P9MA 1I8MA 3QRGL 5HHME 1KXTB 5E2UH 2R69H 1J05B 5E94B 4FZ8H 1BECA 1JHTA 1I7RA 3PP4L 4J3XA 2C3VA 2UWEE 3O3BB 1HYSC 1IJ9A 3HE7A 5FYLE 1N2RB 7FABL 3JVGA 3PHOB 3HI5L 5FYLL 2MPAL 4F57H 1DQDH 5T1KD 4F7PB 4JB9H 1LO2L 2CXGA 5DRNB 1FPTH 3WN5B 1UENA 4XCYA 1R0AH 2X89A 5D70L 5J12B 5DWUH 5HGDB 1I7TA 1ZHKB 1A6PA 4OZIB 4D0BA 4J1UB 3ULUF 2CDEB 5IVXA 3QEQE 4U2YA 4M1GH 3GMNB 4R4BA 1NCBH 2J6EL 4NNYB 4NN7C 5AWNL 3TT1L 3WXWH 4ERSL 5KVMC 3VD9A 1WZLA 4RRPG 3TJEL 2Y25A 5I1DB 2LTQC 4JKMA 1FCCA 5TJWK 4DW2H 3VD7A 1S7SA 4Y5XA 2DKSA 3S97C 1FFOB 3JWOC 4R96A 3P0VH 2WWMC 5BV7C 4ZUWB 4YUEH 3MZGB 2GJ6B 4I0KA 1ZLWH 1KCLA 3DVNB 1OAXL 4YK4B 2CLVB 4OCRH 5E9DE 3C08L 4GBXA 4FABH 3EYQC 2J8HA 3RWFB 4GS7C 3QCUL 3PL6B 1U3JA 2VDRL 3BN9C 3IFLH 3ARFB 5D7LA 5E08H 1Q8MA 3D25B 2ICES 2WW8A 4X6DB 1IGJA 3DX9B 4HWZB 3MRPA 3G5ZA 3S9DB 5FGCE 4XBEH 2V7HA 3TGXA 2ZUWA 3BGMA 5L2KB 1NQBA 4LHQB 3HZKB 3JTTB 2VR9A 1D6VL 1MFCL 2F53D 4JDVB 5GS2D 4NUGL 5TPWL 5BW7A 2CK0H 4KK6C 4L4TD 2MCPH 1YY8A 2Y07L 5IBTL 2PW2B 5FO7A 3LEVL 5D7IF 4JGJA 3RIFF 3UYRL 4N8PA 3G6JF 4PJEB 4HS6A 4P9ML 3KYOA 4XXDA 4G7VL 4PJHE 3MNZB 3VXSB 2OTWB 5IG7B 4MQSB 3FL7A 4W70A 4WY7H 2DQCH 1JPSL 1J1PH 1M71B 3U46B 2D9QB 43CAA 4NSKA 4P3DA 3MJ7A 3ARXA 3CZFA 5AZEH 3E2HB 2A1WH 4TQEH 2Q76A 4G6JH 4ONFL 1HYSD 1IAOB 5TFSH 4JFHD 3K4AA 1ZA3A 2Y7QA 3HG1E 4UNTA 3DVIA 3REVB 1AQKL 4PGCA 5FAAA 5FDWB 3MZTA 4LAQH 4APQC 3EFDL 4JN1L 2BY3A 1VHPA 3SY0A 4ODWA 2Y6SC 5BQ7B 3TESA 2AJXL 3L5WA 4JREC 1WBYB 3FFCB 3VXTA 4WUUE 5CP7A 1TNNA 4NP4L 4PG9A 1B4JH 1N6UA 2AJYL 2VABB 1IM3A 3LN5B 2DI9A 2OI9B 2YA2A 4NFBA 3VXUE 1P4IH 3T08A 3NBNA 5F89B 4GQ9H 5D2LA 5IOPA 1OAQH 5EZJB 5D8JL 4CW1A 4IOIB 3E3QE 4PRDB 1S7QA 1FAKT 3HNVH 4OF5A 3U7YH 4HUVB 3S5LB 1FIGL 1V7MH 2BNQB 3OGOE 4HFWA 5DZLA 3BYYA 3WE6A 2HRLA 2ORBL 2Y5TA 2VDQL 1IBGH 5GGUB 4G6FB 1A9EB 2YBRA 1KCSL 4PJGA 3MV8D 2WWMD 4JR9L 5ITBH 1T5XA 4NKOB 4KV5E 2GJZA 3WFHB 3LEYH 4LCCC 4FMKA 1DSFH 2WQRA 4JO4H 4MA7L 5HHOB 3CFBA 5F7YC 1G7LB 5EIQA 4OD2B 1RZKH 3EYQD 2BVUA 5MP6H 2FJFB 4R97B 2FHCA 3K0WA 3KYKL 2DD8L 1BZ7A 2X7LB 4ODTL 2GSGB 3BN9D 1RJLA 4D0DA 2BXZA 3MLTB 1QLFB 3DV4B 4LCIH 1AO7E 1X5LA 4RFNC 3UC0L 8CGTA 2CDFA 5EPMB 1J1XL 3FMGH 1LP9F 4HK3N 1OT2A 3INUH 5ID0A 4KK6D 1IZJA 3GHBH 2XV6B 2ENYA 3BZEA 5DJ8B 5E2TH 1RK0B 1W72A 4UBDC 2XTJC 5KSBE 3G5VA 1A6WL 4PGDA 1PY9A 4AIOA 2Q6WA 3THML 4PY8J 1NC2B 4KK9D 4LSRL 1WT5A 2ZCHH 3NCBB 3U0WL 5L7XL 3MV9D 3K4DA 1IGML 3RZCC 2AK1L 4WVRA 3RFZC 2ARWA 2OP4L 1G9ML 5D6CB 1Z9MA 3GBLA 2XZCL 2IANB 2ICWA 1OARH 1OB1A 5DS8A 4P2CG 2J1KA 4X8XA 4LKCB 2NTFB 3P0YL 2BVEA 2G75B 5FIEA 1JCKA 5EOQH 1GPOL 2K7PA 1HNFA 4MQ7A 1T1ZA 5ACMA 1MWAB 2ESVB 4H26A 5DVMA 4DGYL 3DXAD 1CXEA 4M6MH 2R0WL 4APQD 1UWXK 4LGPB 3SY0B 4BUGA 2Y6SD 4ZUSA 4KRNA 2X9XA 5ADPL 4XP1H 4RMSA 4FHBD 3M1BA 4JM2C 2A6KB 2W60B 4FXKB 1AGBB 3BVNA 1P84J 4LCWA 4MMZC 4X6CF 4XP5H 3LKNB 3E0GA 3GMQA 5SWQA 3JV6A 1FNEA 5DJZA 4XBGB 2K1MA 3VXRD 1EV2E 1OW0C 3IDNB 5BOPA 1WFNA 5GRXG 2QQNH 1F4XH 3L95A 5KSAB 5CGTA 3ZDXF 1IKFH 4LLUB 1HKFA 4PJDA 5FO9A 1UCTA 3IRZA 1BQHG 4BKLA 5BO1H 4U1NA 1P7KA 3DBXA 2P7TA 4U0RC 3EKCA 5E4IA 1A3RL 3SKNB 3EFFB 3FAXA 1G7HA 4KTEH 3NZHL 1I7ZA 1ZLSL 3GMPA 3HCVA 3NIFF 5LQBH 2EZ0C 1XCQA 3BWUC 3NACH 4TTGA 2N7AA 4P0DA 4ZQKB 1LQSR 3OAUH 1L0YA 1TETL 5ACZB 1KT2B 2EDKA 4GG8A 5EU5B 4P9HC 2VXVH 3V4VH 5LGJA 1NGZA 3BQUD 4MA3A 5KVEL 3ZYIA 1HINL 4OFYA 2DIAA 3UJTH 1PEWA 4N0YH 4HPYH 1Z2KA 5ID1B 4RMVA 4X5WA 5GS0C 1ACYL 3EGSB 3ARGB 2ADFH 5E8PA 1GAFH 4UBDD 4XNUL 2ENSA 2XTJD 1DUZA 3HPJA 2Q7YB 1WCBB 3HFMH 1C12A 1RURL 4F7TB 1NCUA 2VLLA 2AEQH 4R3SA 3G08B 5LJYH 1CYGA 5AEAA 3UPAA 1FQ9C 5EZLB 3F7VA 3VG0L 2DICA 1NDMB 2HVKB 2X4QA 4KZDL 2FO1A 1JWMB 5E8DH 3QIUA 1X6NA 3QO0A 3IU4L 1YPZB 2VLME 5C07A 3B4NA 3PQYE 3QDMA 4P23C 2FSEA 4MJID 3BOVA 4B41A 3ULVH 4H26B 1G9EA 5HHVH 4PJ7A 3QRFM 4XPGL 1N5YH 1FDLL 1WBXA 4JRYE 3TO4C 4Q9BA 4CAGA 4QTHB 1J10A 1WZMA 2VLRE 1BD2E 4LL9A 3MBXL 4GRWB 5TF1H 3TZVB 3DNKA 2NY2C 5HJ3B 2Q8BL 2E7MA 4M8VA 4AM0A 1FNLA 4RWYL 2RBLA 4IHOA 4LPXA 1Q0YL 4FMFA 1UFUA 1BWMA 4OZIF 4AEIL 2YUZA 1CD0A 5J6HA 3NFNA 1P53A 4G6KL 3BFOA 1MHPL 4ESKA 1FGNH 2HLFC 5FO9B 1KYOK 4D9LH 4OJFL 5DJDA 3V6OC 5FECA 1VGEL 1KB9K 3V0VB 4GKOA 1K8DB 2OTUA 2X4UA 5HXMA 2ZSWB 3B5GA 2NR6C 1DLHA 1FGVH 3VXNB 1INEL 1CXKA 5A2JH 5T3ZE 1BLNA 4UQ3B 2EZ0D 2BNRB 3RI5F 4U1HA 4ETYA 3MCLH 3LS4L 1HCVA 5T3ZL 4QCIB 3WFBH 1DE4B 1G7IA 5TE7L 1FHGA 4NOFA 1QLEH 1AJ7L 3CLEH 3SGEI 4PRHE 2CJUL 1VDGA 1VFMA 4MAUH 1I4FB 2VDPH 1HH9B 5EUKA 1WWBX 5HBBA 2VAJA 5IBLC 4X6DF 5B39B 1U8PA 4HSQA 2NY1C 2EIZA 2E6PA 1TTGA 2ITDB 3Q6GH 5GS0D 2CDGA 3IXTB 5B8CC 3P9MA 1NFKA 4JDTL 3U36A 3WNNA 4HGMA 1A6UH 3LZFH 5BMFL 4JPVH 2A9MH 5LBSH 4HIJA 4Y1AB 1ACZA 1QBAA 4KK5C 1A4JB 3NCCB 4XNMB 3FRUB 4PJEF 2PTVA 3D5OF 1XF5B 5IEHA 4ODUB 5FKAA 4AEHL 4XNXH 1L4IA 3REWB 4CMMB 4NQDE 1A14H 5IMOB 2C5DC 2OMBA 3GMLA 4HXAH 2OBGA 4KQ4L 1J8HE 3VWKA 5IUSA 1UA6H 4MJ5B 1OTSC 2W65A 4PRPE 1GGCH 3M17A 4P23D 4DGIL 4JM4H 1LGVA 4FQ2L 4GW4B 1EBAA 3S37X 5ERWA 3IS0X 4BQ6A 2P44B 4PRIA 4Y2DB 3FB5B 3QEUA 4YLQT 5EIIA 4RMTA 4ZNCD 3HRZA 3GFUA 4R26L 3TO4D 3VFNB 2FEEI 1HZHL 2A9NH 3UDWA 1WSST 1RJCA 1T03H 4L5FL 5J6HB 4MB5A 5IVXF 4DEPB 5DD6B 5F93C 1FZOB 2B0SH 5C0DB 2VKWA 1JP5A 3QBTB 3BPLB 1HHHB 1DBML 1K9TA 2HLFD 1WWCA 2DLTA 4OD3H 2Z92A 4JHZA 1A7PH 4LPUA 5F7UA 3O8XB 3T0WA 4XHQA 4I8DA 1IC1A 2OTUB 4M6NL 3SCMC 5KOMC 5E8OB 3J7HA 5C0JB 3ZDYF 2LU7A 4L4VB 5F71A 2NR6D 4M1DL 1U3YA 5DFVC 1C5BL 5KS9B 4JG1H 3U4EB 3V7MA 1CGSL 2XYCA 4HUWA 1AKJD 4UU9A 1QVOA 3KPPB 1CTOA 1TQCB 3FRPA 1DQLH 2OYPA 3KDMA 2OCFD 4YHLH 5EWIH 4HWBL 2BSTA 5FOBA 3SN6N 4M6AA 4YHKH 5CZVL 1RVFH 3W81A 5IBLD 1ZTXH 3QDGE 3ROOA 2XPGA 3RIFK 3U7WL 2NY1D 5T1KA 3SKJL 1TZGL 1IAIH 4FQQA 5DJ0A 5J1AB 4NFDA 4L4JA 1T1XB 3DO7B 4HZLB 4TYUA 1MI5D 3FO0H 4LRIA 4WWID 3C09B 3P30L 1U58B 3FB8A 3OKNB 4EN3C 3HMWH 4PTTB 5FYKD 4I4WA 4KK5D 1CE1L 2VDNL 3TNNB 5C7XL 2P45B 2YPLA 4ETQB 3OHXB 1WAAE 4C56D 3N0PB 3O9WB 3TBWB 3HI6H 1U6AL 4X5LA 1WFOA 3QNZA 5E2JA 3KLHC 1KJMA 3PDOB 3E6HB 3FB6A 1P4LA 2IWGA 1J5OH 4Q7DA 3OZ9H 1KCUH 1OTSD 5BCAA 2ED9A 3BKJL 1ES0B 5DSCA 3KPLA 1MFBL 3ME0A 4HLZG 3QG6B 1FNHA 3R1GH 5KSUB 3QEUB 3STLA 3VFTB 3DRTB 4PP2B 4KKAC 1KJ3L 3F58L 4NQVB 4F33A 5C0RL 1JJUA 1C8PA 4JRXD 1AGCA 3N50A 1N4XL 3QFJE 4W4OC 2COQA 4XVJL 4YPJA 5ANME 2VZUA 3CVHB 3R06A 1UXWA 4ZUUB 5C6PB 3DV6A 3RDTB 4RAVA 1ZGLM 2QLVB 3IS1X 2E8YA 3D69A 1KEGH 1AHWC 3LIZL 4QHNA 1JGVL 4IRSB 5D2LF 5DGRA 5CEYA 1H5BC 5FOJA 5CKGA 1YEFH 2R56H 1SJXA 4ODHH 3GK8L 4K3EH 1F5WA 2YEZA 1BVKA 3L7FB 4GG6B 4JJHA 2ERJB 2IMNA 1G7MA 4O51B 1KN2H 4OCYL 3SKUD 1V3LA 1RSFA 1X4YA 3BE1L 5DFVD 3RAJL 4HD9A 5D1ZC 3QZWA 3ROLB 1QYGH 2AEWA 4P57B 4WO4B 3QXWA 2X4SA 3QIWD 2I07B 2M26A 3ZLQC 4G8EB 1UB5B 1OM3L 3WIIH 1XH3A 4U6VL 2P8PB 2QEJA 4YBQC 4JG0H 2PCPB 3M07A 3ULSA 1LO4H 3KJ4C 2X70A 1UT9A 3Q3GA 1F42A 3S35H 4KY1H 5INCA 5GJSH 3S88H 3QXUA 4OLUL 3RWGA 5GQBA 3VFPA 2Q86B 1MJUL 4U3CA 1XF4A 2XN9D 1LE9B 4NHCH 2XZZA 1CGXA 1MH5B 4X9GA 3BP7A 4XMLH 2N1KA 5KSVA 1OAKH 3KLHD 4HZAA 5E99L 2Q7NA 4HGWB 2V7NA 3AXLB 2CKBB 4PRBA 5GGSB 3MRLA 3L7EA 4NGHH 2Y23A 4G7YH 2JJSA 3EYFA 2IMMA 5ITFA 1HKLL 3OKMA 1AP2B 3SE9H 1S78C 5I8OH 3LSOA 4RFEA 5ISZE 1DBJL 4U6HB 2KH2B 4Z0XB 1U8OA 4HX1B 3PGFH 5MI0C 4P3CH 4KKAD 1TVHB 1CG9B 1O7SA 4ZFZB 5C0AD 3OF6D 1AGCB 3LCYA 1JNNH 1EAJA 1UH2A 4KVNH 1B0RB 4CN1A 3OJVC 4U1LB 5IB3A 1RU9H 1Q1JH 4B50A 3F7YB 2ZWLT 4NKDA 5GZNC 2F53B 2FBJL 2AXGA 4Z0BH 4ONHB 4L4TB 2IBGA 3ZO0A 2J7LA 4UOW0 3OKDB 2GK0A 3TEUA 2ATPB 4LIQH 3DPBA 2XNAA 4NN6B 3RQ3A 1KNOA 4PJDF 3U0PA 1RJZB 1GGBH 3GM8A 1Y6NR 3OR7A 3HZMA 2DWDB 3T0EE 2AK4D 5DJCB 5F7HA 3ZT6A 4UT7L 3CSGA 5D1ZD 4WW1B 5CHNB 1UEMA 3U6RB 3X12A 2VUOA 4Z7UA 3WFEL 2IH3A 1GGYA 1JE6A 4AH2A 5DJXB 4KTYA 2BCKB 1T20B 2P48B 1E27B 2AKRA 4U6YA 4KMLB 1ZT7B 3BESR 3HS0A 3ULSB 4HIIB 4IDJL 4YBQD 1AXTL 1DBKL 3DXAA 3ARZA 1D5MB 4HC1L 3X3GH 4QRQA 4APQA 4ZS7H 3W39A 3QUXB 5BRZE 2GTZB 2JB6B 4AQOA 1LEIB 3DRQA 3KLDA 4ZYKA 4JKLA 1ZLUK 2HN7B 2BSRA 2VN4A 4GLRI 1NBVL 3H7LA 3KHOA 4MNQE 4F7EA 4UI2A 4EZMA 4X98B 5F88B 3O4LD 2WBKA 1ZHNA 3MOAL 1KJ2B 1KCVL 2OQJB 3HTLX 2YOCA 5MEPB 5C3LD 3H3PH 4QLRA 1UM5H 4UT6L 2DQIH 2LTQB 1OAUL 3K8LA 5JHDE 1YN7A 4NUJA 3GMRA 2PW1A 3MRLB 3OBAA 5GGVH 4LLWB 3MV8B 4ZUVB 5BV7B 4TTDC 2X9WA 5I1HH 5BXFA 4LCCA 1S78D 1QEWA 4FXLA 2DQTH 5DQJB 4KTDL 1B0WA 2WBJC 2ILLA 3OGCB 4NC1E 5D7IE 1ZWIA 5DUPL 3KYNB 4XPTH 4ZFOA 4PTUA 3P77A 4GS7B 4LHUB 2KUTA 4UT9H 1Q9OA 1IILE 1P69B 2FJGB 1D5XA 4FTVE 4NDMA 3AFLA 3D3VE 4O9HH 4Q9CA 3BQUA 2A74A 3DGGA 5DQDL 2R23A 3PJSB 1J12A 2FB4H 1MLBB 1U8HB 1DVFD 1QSZA 4RGOL 3QWQB 3UTTD 3VXOB 4HV8B 5HYSA 1JBJA 5JIKA 3QHZL 5F9OL 2HFEB 4PJCA 4HS3A 3UTOA 4YFDB 3UTSE 4L29A 4QXGH 4Y8AA 1SVCP 3RI5K 5EG6C 4WTWA 4MD4A 1R3LB 4HBCH 3MBEC 3MV9B 3K8MA 2YZ1A 1JGEA 3BP4B 3V6ZA 1HILB 5CJQH 2CK0L 2F74B 4XPBL 2DIBA 5CUSL 4FQXD 4MDJB 3B9EA 2IH3B 5CS7A 5KS9F 4URTB 3UTPD 2ZG1A 3NAAH 4UZGA 3TCLB 1SJEA 5I6XC 4QKXB 2RFXA 4KDVA 3PWPA 3QG7H 3ARWA 1DN0A 2VAAB 3MR9B 2G2RB 3RY6A 1D6EA 2KBGA 4GSDL 3N9GL 4YGVA 4WY7L 1B6DA 1H3VA 3T4AB 4LP4A 5D2NE 1OCWL 1QBLH 3LMJL 3TWCH 4XNQB 4JREB 4LF3A 4M3KB 4M61B 4YO0B 5HHQB 4I2XE 2NX5B 4GMTH 4MLIA 3MNVA 4BSWA 1IGCL 2A1WL 4KWUA 4F7EB 1PZ5B 4QHUB 3RIAF 5I1JH 4HF5L 3VXRB 5MENE 3HZVB 1IC7L 5LCVH 2E9BA 1RJYA 1A3QA 1FH5H 4FP8H 4LK4A 3BJ91 3AREC 3EO1B 3P11H 4UAOC 1QLRB 4J6RL 1JWSA 4JO1L 1IC4L 4QOKE 4IS6A 1U41A 4OZGB 4JFDB 4RAUA 4TTDD 1E28B 2QQKL 5EFIB 4LNVA 5IT2H 3WIFB 1MFAH 3UJIH 5IEKA 4K23H 4B7IA 2WBJD 3BKCL 4NO3A 1PG7X 4JO2L 1T7XA 4KRLB 5HHMD 4XXCA 1Q9OB 1FVDA 1ZHLA 4TVPH 1TVBB 3VFGH 3VRLF 4LLVB 4LARH 5HHNB 4U1KB 4XC1H 4PBVC 1IBGL 1ZOXA 1IFHH 3C6LC 4Z77B 1CF8H 4G80A 4RFNB 2D4DA 1S7RB 5F3BB 3VFUA 2YXMA 3LQZA 3H42H 3LEYL 1SEBA 2AJSL 5CEZE 5DUBA 3ZT5A 4YAQB 4KUCD 2A6IA 5MP6L 3HC0A 1YEGL 4MB4A 5CEZL 5EDXA 2YK1H 2XTJB 4PJAE 5K9JL 1V5JA 4AIXA 5CCKL 2DIJA 3TV3L 4M7ZC 4DKEH 4QWWC 2VQTA 4LLQA 4KKNA 3B83A 4MD4B 1CLZH 1XGTA 4H8WL 2GITA 5DMGC 1OP3K 1M6OB 2FLBT 3QCVL 1L0XA 3MBED 2FH8A 3IDXH 4KRMB 3QEQD 5IBUG 5C08D 3RZCB 3RNQA 1MJ7H 1BJ1J 3E3QC 2CK2A 3O6MH 4UINH 1NJ9A 4D0CB 4HUMB 4ZUTB 4MHHG 4P2RE 1U8NA 5EOTA 2XKNA 5FGSA 3B9KA 3EO9H 1NMBH 4JY4A 4IBLT 5AZ2L 4MJIB 1CD1A 1Y18B 1QO3A 2ADGB 2L4OA 1E4XI 3O3DB 2R1XA 5L6YH 3P4MB 1LEKB 1WWWX 3UJJH 3VDAA 3ZT7A 3VW3L 3BDYL 5J06A 2GY5A 4UIKH 4XPFL 5E9DD 3QYCA 5C0IB 1BEYH 4P49A 3H9YA 4JM2B 4X8JA 4MXQC 1PQZB 3UTQB 5KTEH 5IIEB 2CMRL 4HCRH 3HB3C 5EA0L 3S34H 2DKMA 4M5ZH 3OR6B 3NIFE 3MJGX 4PLOB 3CH1B 3CXDL 4YE4L 3DYPA 1VEMA 4PJBB 5I15L 1V3KA 4Y16C 4QEGA 3FT2A 5GS2H 2PTTA 3ARED 43C9A 5DJAA 1T0MB 5F7FA 2OJEB 1KIPB 2AJZA 2AV1B 1X5YA 3MRQA 5MERB 1ULVA 3FONA 3JV4B 5C0NC 2NW3A 3MC0A 4XP6H 1KFAL 5EN2A 4EI5B 1N7ML 2VDKH 4HJJL 2C3WA 2OJZH 3FRPG 1G9MC 4P48A 5FYJU 4AENB 2H9GA 3MUGB 3HUJE 4J4PA 4NO5A 1T0NB 3HE6C 3BT2H 5J3HC 2MSPA 1MCOL 5CMAB 1EVUA 2WUBL 3FT4A 4ACPA 1EPFA 2CR6A 3L1OH 2HMID 4XZUA 3C6LD 4NO2A 1JPFA 3LQZB 4L1HA 4WFFE 2N7BA 1OSPL 4PJIA 1KB5B 1FC2D 3ZKXC 2R4RH 4TULL 1H9VA 3A6BH 4RDQG 3NN8A 1I9JL 3BUYA 1YQVH 5SWSE 4S0SD 4LVHC 4WW2C 4X99B 4WUUD 1F8TL 3KPOA 3C60C 5C0FA 4G9FB 3D18A 1ZVHA 5MEQB 1EERB 1A7RH 5MHSE 1KJ2H 1U92B 4I5BA 4PY7A 4YIQB 3QR2A 2JLLA 1CR9H 4NC2B 2Z8WC 5F1SA 8FABB 2R39A 2Y36L 5EOTB 3FOMB 5JIHA 4YNYA 3D85A 2DQFB 3WNKA 5CILL 4P23B 5CLTA 1XGRA 3IDGB 5GSRB 4MZ2A 5BV7H 3K1DA 5FUCE 4JFEA 4LPWA 4GH7B 2CUIA 2I26N 4NCDA 1BQSA 2ITCB 2F54A 4DZ8A 2FECI 1KLUB 4Z5RA 4OM0H 3TO4B 4XNZC 1E4KC 5JPNA 4MXQD 4G8GE 3EJJX 3FFDA 3FT3B 4QRTA 3GSNA 2EC8A 2NY2B 3HB3D 3NGBC 5IGXH 1SBBA 2AP2A 1RY7B 1I1YB 3BPNC 3M45A 4DVBB 4NRYA 2AI0L 2NY7L 3BP6B 4F37F 4D2NA 3FN9A 5I74C 1I9IL 1K4DB 3UEZA 4K55A 1IGIL 5HHVL 4QY8A 3MFGB 4XGZB 4U6XA 1N5YL 4RGND 1UM4H 3RWHA 4PJ8C 3BMVA 1UKSA 5C0ND 1DQQA 3VFOA 3W2DH 3C5ZC 3PABA 2VL5B 3QZWG 5IHZB 4KZEH 3SE4A 2GIYA 5DR5H 5IB5A 3KLAB 4OZFA 2CIIB 2CGRH 3ZE2F 1JV5A 3GI8H 4M7KL 1FFNB 1HIML 2D7TL 1AKJB 1VFBA 1ORSB 3SDXB 3RWCB 3HE6D 1MFEH 1IKNC 3SE3C 5J3HD 1MCRA 3BRFA 3VXQA 1YEJL 3QIWA 2QSTA 1RUKL 1A02N 4NZUL 1P2CB 3KXFA 4NO2B 2RHEA 4HUUB 3L3HB 4XVTH 3Q6FB 1CE6A 2NY1B 4Y0GA 2DJ4A 3GMOA 4L9LA 4DK3A 5B8CB 1MI5B 4OUUA 4RMWA 2D31A 3CZJA 1QOKA 5I1AB 5HY9B 5IHUL 1CFVL 3X3FL 3LS5H 3GB7B 3ILPB 4XBPB 2XN9A 3V5DA 1DL7L 5IESH 3QNXA 1MF2L 1FO0B 4C56B 3H0TA 4NM8L 1G7JA 2ZKHL 4OSUH 3B3IB 5F9AC 2DWEA 1FL5A 4G42A 2DLFH 2YD5A 3Q6GL 1E6OH 4U3XA 4L8DB 2EDHA 2V5SA 4LLDA 4WU7B 3DVGA 2HJKB 1R5WB 5JW5A 1SY6A 3C5SA 2IADB 4PGBA 1RUAH 5IVXE 5FKPA 4MD0A 5FA3A 5FF6A 2LE9A 5A3IC 2WV3A 1WZ1H 4WI8A 4JFZH 4I77L 1JF5A 2FGWL 1CT8B 1FIEA 3VMOA 5C0AA 1ZV5A 1DQJB 4JRXB 3P4OA 1NBYB 4A6YL 1R6VA 3FFDB 5IV2A 4HKXA 3FOLA 4WU5A 5KVDH 5TQ2H 2AW2A 1NEZB 1ETZB 4JM4L 1CLOH 1X4ZA 2F5AH 4CVUA 1JMZA 4KUZH 3S37H 4Y5YC 4WV1C 4DVRL 5DMIL 5IB1A 2DQGH 3FJTA 4NWTH 3RWHB 2Y1VA 1CDHA 4V2CB 5D7LE 4BFBD 1C08A 3EW3B 4LPVA 1F6AA 5MEOA 3BDBA 3I2CH 1ZA6B 1U36A 4A2MA 3SCMB 3MLRH 3HPLB 3C5ZD 1ONQB 4PR5A 4I18A 4OZGF 2AK4A 3C6SB 4XB7A 5I1CL 1JZ7A 4NC0B 1UCBL 5FO8B 1NDGA 3CCHA 5D1ZA 2R8SH 1CDJA 2FL5A 3V5HA 1CFNB 3L3KA 2VLMD 1A7PL 2JELL 3PIQB 2FEEL 4HT1L 3F7PC 1A7NL 2V2WB 3UPRA 4HPOH 4F80A 1QFWH 3CFKA 4IRZL 4MQXC 1KN4L 4NKMB 4Y4HC 4JRYD 4EN3B 1MLCA 2BJML 2MHAB 4LSTL 2VLRD 1JNHB 4PJCF 4Z7WA 1A1OB 2CLRB 3Q48A 4ZPTA 4K7FA 1EH9A 1U8IA 1EO8L 2JJTC 5DK2A 4ODSH 2V2TB 1T1WB 3CC5B 3VI4E 4X80H 1UYWL 4OV5A 3ARSA 1MHCB 1EHNA 1QSFD 3CMOH 4UB0L 5E7FA 1XF2A 3AAZA 3FO0L 4WUKL 1MJJA 1R5IB 2VITA 4OLXL 5E00B 3BEWA 3QUKB 3GHEL 4H88H 1YMMD 4JANB 5SWZB 3OKLA 4I9WE 5A3ID 1YJDL 5D2LE 4FQJL 1T4KA 2F19H 3RIAK 2VL4A 3MRIB 1ITBB 2HJLA 3P4OB 4JFOB 4S1QH 5F9JA 2F15A 4IRJA 1NGPL 1KCUL 2W38A 3CLFH 4QT5B 5K9KB 4PJGE 4P9HH 3VA2C 4NNPH 5F44A 1B90A 1UJ3C 2APVA 2X4TB 3EYOA 3U30C 3QDJD 1ADQA 1RFDL 1DVFA 5GIRA 5T33H 3WS6A 1JGLH 4JY6A 4ENEC 1NCCH 1GL4B 1ZEAL 1AHWB 1Q9KB 5LWYH 1KB5H 1H5BB 1U2CA 1U8MB 5GS0H 4PV9A 4JPKL 3RGVC 3IRPX 1PKQA 2WINA 3OKOB 1A3LH 5DMKB 2H8PA 4KJYA 3CU7A 3DGCR 5GRWA 2HH0L 2B1AH 3TYFB 4JPIB 5IB4B 3O41B 1I1FB 3RX8A 2IEPA 1AGDB 3MRDA 5F7KC 4G9DB 2EXYC 2YR3A 4NQDD 4KMQA 2FL5B 2HRPH 2EDEA 4OAWB 2DB8A 4FQXA 5EC1A 3S4SA 1J8HD 2EH8H 5DEFB 1NSNL 1JTTA 1XF1A 1FN4A 2A83B 2UYLA 2Z8VC 1W72L 4PRPD 1NBZB 3BSZH 4NQEA 3GGWA 1WC7B 1DBAH 5B21A 5IF0B 4GAGL 2E9JA 1RK1A 1J0HA 4MJ6B 2BZDA 3WIHA 3B2UC 1U8QA 2GY7B 2F5BL 3KJ4B 3MYZA 5CINL 4OZHA 5HDBF 3W9DA 5I1GH 1FE8L 4MQXD 2VISA 4QXTA 5BZDA 4Y4HD 2SEBA 2DQJH 3ALWA 3GNML 5DHYB 2XZAH 3MGOB 5IK3A 5DLML 4NRXA 3KNBB 2XFXB 3MLWH 3O4LB 1A6AB 3RVVC 1SEQL 4V1DD 2WZPD 2GT9B 1MAMH 4KAQH 2BNUB 5H94B 3BRDA 4OV5B 3BN3B 1INQB 2BVOA 4KY1L 2BC4B 5I1EL 1UGNA 4X6FA 2VH5H 3EHBC 4LCWE 2GSIA 5E8NA 2DM4A 2PTUA 4MNGA 2J5LC 3RNKB 2EDJA 4PJ9B 4DN3H 1JGDB 2B2XL 1X5AA 2DQHL 2X10A 3WHXA 5IMMB 1BJMA 1ITCA 1LEGB 3ZYZA 5MI0B 4NO0D 4OQTH 1BFOA 4PJDE 4RMRA 1A2YA 1NFIA 1FYTA 3MFFA 4DFIA 4J3VA 5EZOL 2YXFA 4JY5L 5E5MB 1N8ZB 3GEWB 1PSKL 1TJHH 1JZ6A 2HG5A 1RZ8A 1JN6A 3HNSL 2VTFA 5F3HB 2YC1A 3SGDH 3I9GH 3MRRB 4EVNA 3UTTB 3BMWA 3QDGD 3I75A 5HVWA 4EOWL 3RX7A 4ENED 3TVMA 3ETBF 3S36X 4DTGL 3PGFL 5TGBB 4NOBA 5JDSA 5JDJA 3C8KA 4YDJA 4WWKD 25C8H 2YPKB 4N1EA 1TJGH 3MO1B 5FYKH 2NW2B 2J6EA 3CFDB 1MFDL 4JZJA 4NZDA 2BOBA 3V0AC 2ZCKL 2FO4B 1AI1L 5C08A 2EXYD 3D9AL 4TNVK 1FO0H 3GMMB 4AIZA 1RULL 4KU1A 1G7PA 5E0QA 1YEKL 4MA8H 5TH2B 4D94A 3CDCA 3EAKA 4N0UB 3VFMB 5JPMA 3SDXF 4D3CL 3QIBC 4F7CB 2HJFB 5C6TH 3AS1A 5DEGA 4X9HA 3B2UD 4WJ5B 4OZHB 1N26A 1N5AA 4FXGA 4AY0A 4B5EA 1WTLA 1MCBA 3MJ9H 5E70A 3G9VA 4GKSA 1BAFH 1IQDA 5C0BD 2V17L 3G9AB 2SEBB 2XZQH 1M7IA 1TENA 1UWEL 3MACL 3VGBA 3WDJA 2E7LC 5C07E 5I8KL 2VE6B 2B5IC 3QDME 2BRRH 3WUWA 3IKKA 3RVVD 2O5ZL 3LKPB 4PJ7E 5GISH 3QQ4A 1TJIL 5D9SA 3WFDH 3SBWC 3HAEA 1MIMH 7CGTA 1G9NL 1SJVA 1K5NA 3S3SA 3CPLB 2XWTA 3EHBD 4RWHA 4JQVA 4LQFH 4MB3A 5CD3A 1GZPA 4GAYA 5LGHH 1IE5A 5EU4A 4BQBA 2IALB 5SV3A 3LEXB 4WHYH 4PV8A 1QUNA 2WBJB 3T0EC 3WSQL 4NM4H 2O5XH 5HHMB 3STZB 1DFBL 1RD6A 3RWJA 1FNSH 4NBZB 4KI1A 4XMKL 3QCTL 4UUJB 4AMKL 1R3JA 4I48B 4F37K 1S7VA 1LO0H 2UWEB 1ZVSB 2VLKD 1QA9A 1U93A 5D1XC 3O2VL 3CK0H 3VWJB 1E0OB 4KHXL 4ZSOA 1YYML 2M2DA 2MMXA 3CNKA 3IDMA 5EO0A 4UT9L 5EC2B 3TBSA 4N0FA 5GGTA 1L9NA 3I6KB 1P84K 4YPGA 3JWDH 5BVPH 5JQ6L 3KWWB 3OKEA 5IB2B 3CUPA 4PJ5D 3MBEB 3QEQB 2ZCLH 2YD9A 1A1NA 1UJTA 4JZOB 1NEUA 3MJ6A 5CBAB 2MCG1 1OGTB 2EECA 4PUBH 3LKOA 5I16B 3GIVA 4XCCH 4OGYH 3KJ6L 1B3JA 2F8VA 3DSFL 1R5VA 5F97E 5I6XB 2NZIA 1Z0NA 1BX2A 1JWUA 2C3GA 3QIBD 3LH2L 4LMQI 2AXFA 4Q9QH 1A47A 1SY6H 3FO1B 4HIHB 2UY7A 2CLZB 1FG9C 1Q0XH 5E9DB 2FIKB 1OF2A 3KVQA 1YNKL 4JN2B 3OAZK 4PJXA 3TIEB 3VI3E 1M7DB 1MOEA 5DK0A 1YMHB 4GFTB 1CDCA 1XIWA 3NZ8A 1DQTA 3IVKA 5JR1L 1J8KA 4HIEA 3KPSD 4M62H 4XMPH 5FGCB 4TRPH 4MCZB 4C59B 2NY6C 4YBHA 2AEPL 4PRIE 3VRLE 3SDCC 1EJ6A 1UB6A 4Q97A 3SE8H 3AREB 3MUHL 5D9SB 5DD0L 5DJ2A 5K59E 4UAOB 4PRAB 5FM5M 4K2UL 3PHQA 3BGFC 4CVZB 1GZPB 4QGYA 1FBIL 4OZFG 5KSBA 3O3AA 4GRLC 1LK3H 4KVCL 1EFXD 3QJHA 3MRCB 4N9GA 3KPRE 4PJHB 4KI5E 3BIAX 1IGTB 1DANU 1G6RA 4QRUA 3T0ED 1KEML 5IMLB