3QWRD

Crystal structure of il-23 in complex with an adnectin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
91
structure length
91
Chain Sequence
DVPRDLEVVAATPTSLLISWEHDYPYRRYYRITYGETGGNSPVQEFTVPKDVDTATISGLKPGVDYTITVYAVTSSYKYDMQYSPISINYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/cytokine
molecule keywords Interleukin-12 subunit beta
publication title Structures of adnectin/protein complexes reveal an expanded binding footprint.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2011-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qwrD00
1KTLB 2DQHL 4S1RH 3UTTB 4P9ML 1NANI 2XN9E 5TFSL 5FM4A 1T2QH 2YZ1A 1BREA 2DQIH 4FTVB 4MCYA 1R5IB 3W11C 2CLVB 4LCWD 1UT9A 4D9RE 4HUXB 4XVUC 4Z7QE 1MREH 1RD6A 2HG5A 3MOBH 4AM0A 4ODBD 4OV5A 1A9BA 3LKPA 5I1DA 2IG2L 2OTUB 3FOMB 1WVZA 2W59A 1VGKB 5IVZA 3V5KB 1G7JB 1XCTA 1BD2A 4JFDA 3GSWB 3EGSB 4G8FA 1NBYA 2HVKB 5GRXG 4P46D 1D6EA 4NN6C 3KDMA 3F58L 4PJHF 3EDDA 4RWYL 4Y4HB 5L8KB 4J1UB 1KJ2L 4GRLD 2WWMC 3GI9H 1XIWA 3MNZA 5DRXB 2Z31C 4NSKB 5D9SB 3AREC 5C3TA 5F1IA 2HKHH 1M7DA 3EYFB 3WS6A 1F3JB 5CLTA 4DKFH 3E8UH 1KIPA 5I16A 5SWQB 1AIFB 2E9BA 5D7IF 3GMLA 1FN4A 3UTSE 5DRNA 1DBMH 4PRHA 1N0XH 3RZCB 3H42H 4M6AA 5IFJA 1ORQA 1UM6L 2CIKB 4FXLA 1RK1A 3UAJC 1I7TB 3G04A 4RGMB 1KJ3H 5ALBH 4PJCF 5I1KH 5MEND 3LS5L 3TEUA 1CK0H 3DOSA 5SV4A 5I76A 3DXAB 4ZOEA 2Q87A 5FGRA 4CVWA 2VR5A 3F7VB 4EVNA 2G2RA 3L3OA 1QR1A 5LCVL 2Q7YB 2XOTA 4RMSA 4EUPA 4MXWL 4LF3B 4JFED 3B4NA 4WEBH 1WAAA 1YMME 2YEZA 4UAOC 2VLLB 1B4JL 2WUCH 4JDTH 4KKBC 4Q9BA 2I5YH 2W91A 4RFEB 3LN4B 5DEFB 4JPWL 5IM7A 4DWHA 3OQ3B 4GXVL 2NY7H 4PRBA 1AGCB 4D9LL 3CIQA 4LVHB 4X5XA 4O51A 5D2NC 1XF5B 3BXNB 5FUCC 5A43C 1WGOA 3NACH 4XBEH 1IZKA 2FO4B 4XCFH 1NCNA 3VXQA 4ZFOL 1YPZE 1NSNL 1QYGH 1VFBA 2YPLD 2HYMA 4PJXE 4X6DF 3MRKA 1JP5A 3K7UA 3FO2A 3DX9A 4K55A 5ITFB 5JORA 4TNVF 1E4WH 2ZSVB 4JFFE 2DJUA 4FXGA 1KJVA 5B21A 1U6AH 1F4AA 4P5TA 3ILPA 3TT1H 3MLUL 3JXAA 3D0LA 4AL8L 4ZUUB 3OPZH 3NIGE 4JQXC 4W81A 2Y36L 5ETUB 4KTDL 1LEIA 2R29L 3FQRB 1S5IH 5IOPB 4JFOB 2IADA 2LTQC 2JJTA 1ZLVK 1FG9C 3TA3A 3R8QA 4GKNA 6FABH 1TDQA 3WFBH 1UM4L 2GJJA 5I1IL 1E4JA 4NWUH 5D70L 4R4BA 2R2EA 4W4OC 1FBIL 4QOKD 3O6KL 4XPTL 2D7OA 3LKRB 4L8DB 4WO4C 3BUYB 1AKJB 2BNRE 4YGVB 4OLZL 3VFGL 1AHWC 5FYKL 1J88A 2VZ3A 4S0TD 5CWSB 1OAZH 4LLQA 2MQ0A 3MV01 2NY5H 2Y23A 3ARFB 4MNQB 5FECB 3E0GA 4ODXB 3EFFB 3B2VL 5HI4C 1GGCL 2O61B 3C60A 3S4SA 1KCSL 2IMMA 4LASL 3BHBB 1W72H 3PQYD 3GBNH 3GSRA 3BKYL 5E7BA 2ARJA 4HUUA 2DQJL 3I2CH 1KTDB 4KJQC 4UBDC 2NNAB 5D1QB 2BOCB 4OD2B 3WJLC 1QEWA 5KBNC 4ZNEE 3BRFA 4GW4A 3GSVB 4LSTL 1WEJH 43C9B 3BZ4B 4UTBL 3BDBA 3QJFB 1MCJA 5DFTA 2E9IA 3CXDL 3SDYL 5B39B 4PJEB 2MFNA 4HJJH 4P4KA 1ZVSB 1WC7B 4KRPC 4F7CA 1S9YA 2B1AL 3TFKC 3ORJA 3KPNA 3P30H 1LE5A 3KNBB 4O2CA 2W60A 1KJMA 5MEOA 4G43B 4Y5YA 5EBMB 4HEPG 1KULA 1AR2A 4TUOB 4ODTH 3SDAA 5C7XL 3SEPA 4HSQA 4WWKC 5BVJB 3VRJA 4OQTH 1FIEA 4MJ5A 3BDYL 2WP3T 2NY0C 1BVKA 3RWFB 4WI8A 7FABL 5EA0L 5FGSA 3V6OC 1CD8A 3TO4A 1MEXH 3O41B 3BP5B 4YHPB 4ENEC 1NCAL 4ZPVA 1B0GA 1G6RA 5DHXB 2VAAB 1P4LA 1MCWW 3SDDB 2R9HD 5FUZH 4MHHI 3IS0X 1XGUA 5T5NF 2OMBA 4LAJH 4X4XA 1PW3A 1JZ7A 2FYYB 3Q5YA 4NUGL 3TM6A 1F4YL 3C9NB 4DOHB 4HC1L 5D6CB 1QFWL 3D3VE 3PWUA 3ROOA 3O3DA 3O4LE 3LV3B 1U3HB 3DV6B 4HGWB 3T4AB 3L3DB 3C6LB 1AGEB 4LSPL 5T3ZE 4OZGE 1M05A 3PHOA 3P2TA 4EDWL 1FAIL 3BUTA 4FQQA 1PY4A 3QI9B 1HKLH 3P77B 3RU8L 3MRIA 2FEEI 3DO3A 5GGVL 4LLYB 1WK0A 1KV3A 2HT4C 2H2PC 4S2SB 5SWSA 3L7FB 1MVFA 4C56A 1HXYA 4HF5H 1IAKB 3QXTA 1TTGA 2D2OA 3C8KB 3AS0A 5CHNA 3KPLB 2WLZA 3MRDA 2GFBB 4GKSB 3WV0A 3GKWH 1P4BL 4LBEA 3MXWL 2ORBL 5D1XB 3RWGB 1KFAH 5AYQA 4KJPD 3U9PL 4ZSOE 3VG9B 3MUJA 5EZLB 2X89A 1JZ5A 3CK0L 5KVFL 2HT3C 3D48R 3IRPX 2F8VA 1MJ8H 3MRRB 1WIPA 4TRPH 4PG9B 5DS8A 2VITB 5C08E 1H5BA 3DX6B 3VWJC 5F6IC 3EIFA 1CLZH 3QNXA 1FL6B 4N0UB 4JG1H 3HNVH 4AMKH 4J8RB 4F80A 3CSPA 4U2YA 2DWDB 5GZND 4YK4C 3U4EB 1QHOA 3N06B 1ZTXL 4EOWL 4S10A 2WUBL 4JFQA 3GHBH 2D0GA 2VKXA 1HHHA 3QFDB 3F6LA 1HI6B 4J4PC 4YXLL 4PJAA 1CFTB 2OYPA 1F6AB 1A1NA 2YS4A 5AG9A 3WFHA 4L4TB 1E28B 1FVCB 1EJOL 4XNYH 3L7EB 4JY6B 5CEYA 2EIZB 3QQ9D 4MSWB 3CX5J 1CVRA 2DQDH 2NY2C 2B4CL 3QXUA 4KI5D 5CZVL 1KB9K 4NRZB 3EHBD 1A14L 1ZHBA 3TBYB 1K6QH 3WSQH 1CD1A 4P4RB 1EEYB 1TCMA 3WE6B 3KR3L 4TVPD 4PLKD 1GAFH 1PEZA 3L3HB 3T1WA 3VWKA 3MV9E 5DVLA 1EEZB 4UUJA 5IJKA 3HAEG 2XXCB 2EDOA 3MV7A 3IGAA 3V95A 4FG6D 5EUOB 1MCWM 5AUMA 5TQ0H 4MQXC 4YBQD 1A7QL 1SBBA 3HUJA 2ZWLT 2J6EH 2UZIH 1OM3H 4WFED 1J87A 2ICCA 3BZFA 3UJTH 4XCYA 5C09D 5IMLB 1BAFH 5DGRA 1IM9D 1CLYL 3QCUL 3X14B 5T3XD 4TNVK 2LU7A 5INDB 5DJ2A 4IM8A 1FH5L 2J8OA 2VXVL 1KYOJ 4XXDB 3SQBA 5EU6D 1HHJA 5KSAA 5FCUH 4RMWA 1GC1C 5C0EB 1N5YL 3CLFH 3K8KA 1PD6A 4L3CA 4Y2DB 5CINH 3ZLQC 5DRWB 3BW9B 3BYTA 4IS6B 4NQDD 3RVXC 1IGCH 3UBXG 5DT1L 4L9LC 1ZLWK 5BZDA 3MRLA 4WW2F 4Y1AB 3BAEH 5HVWA 1IAIL 2BDNH 3PP3K 3CGTA 4BKLB 1HINH 2ESVE 4H0IA 5D96B 3AU1A 1T0MB 1FRGL 1KLUA 4KV5E 4FP8H 3MBXH 4KMTH 1IKNA 3QFJE 3ZO0A 3H6JA 5I2IA 2B5IB 5IB3B 2VLRE 1B6UA 4OF6A 5GGTA 3HCVB 4FQCL 3VRIB 5BRZE 1NPUA 4GRWE 4OGXH 1MHEB 4HCRL 4M8QA 1EFXA 1EEUA 3LY6A 3T0EE 3VXUE 1T2XA 3E2HC 2L7JA 4GBXA 4Q74A 2EDKA 5JA9A 3TYGH 1RU9H 4RAUB 1X6NA 5C0CD 4CVUA 3IU4H 3LB6D 2CMRL 1EV2E 5HHVH 4DVRH 3GM8A 5JXAH 4NZUL 4DEPB 3EOYG 3SDXA 3S34L 4Z76B 4FQ1H 3SE3A 4G9DA 1C5BL 2GSIA 3U6RA 1PSKH 4TVPH 1EGJA 4QRRB 1U8HA 2XXMB 5FXCH 3V6ZA 2AJYH 1L7TH 3P11H 4FZ8L 2GHWB 4XGZA 5GJTL 4TTDD 1KOAA 3OF6A 4NQXA 2PW1A 4TUKH 4U6VH 4WV1B 1A6AA 3U2SA 2EDNA 2HFEA 1GGBL 1LP9B 3O6FD 3R4DA 4JGUA 1MI5D 3RWHB 4AEIH 5F9WB 3MODH 3QQ3B 1NUFA 3G9AB 2GJZB 5DQDH 2ICES 3HI6L 3MREA 4AEFA 5KSBA 2YWYA 2FH8A 2CRZA 4GLRI 4HWEL 5T3XH 1QFOA 4QYOB 3FHQA 4KTYA 2DIBA 4OZFG 4TPRH 5BXFA 4OCWH 3HPJB 2ICEA 3KXFE 5K9QI 1CZ8H 3QPXH 5KANI 5IIEB 1MJ7H 1HZHL 5T1LD 3KPRD 5DK0B 1KT2A 2EDEA 5BO1H 5FYJU 1U8QB 5JNYA 1RZFL 4OFKA 3HG1B 2BNUA 5JR1H 4Y5VB 2DBLL 1JK8A 4LCYB 1HSBA 5ERWA 1CXEA 1WV7T 2BY0A 2GSGA 4JFPA 4Y16B 1AR1D 3MXVL 4LHUG 1SBSL 4KJWC 3AAZB 4ZO9A 1AO7E 1WZKA 3RX7A 2OJEA 2XNAA 4ESKA 4OZIF 1S7QA 5DJZA 2D31B 4EDXB 2IAMD 5C6TL 2IWGA 2IPKB 3PGFH 3IDJA 4UIKH 4NO5A 3W9EB 1XZ0A 1B2WL 2E6QA 4RRPG 5E9DE 5IHZA 4P2OB 4L3AA 3VFMB 3KLHD 3E6FA 3QB7C 1YNTB 4Z7OF 5JOEA 5FB8B 5GRWA 5I1AA 4NQCB 1IC4H 4CRPA 4OFYA 3TPUB 4MMZC 1JZ4A 1A1MB 4GW5A 1M7IA 2MPAL 4IRSD 4EI5B 4PTUA 4V1DB 4KROC 5J13C 3CFJB 3VXTA 4NZDA 4HBCH 1F11B 1YJDC 3WHXA 4E41D 5EO0A 1OGAE 4JHWH 3IDGB 2GUOA 5IHLB 2NY4C 5CEZL 3TIEB 3ZKQD 3D5OF 2VWEC 1NGPH 5F1OB 4PRNB 2ID5A 1MCSA 2QTEA 1D5IH 1UXSA 5T5NG 5FKPA 1YEHH 2DL9A 2FATH 3RTQA 4JZJC 2DYPD 2AEIT 3OKDB 1C16A 4NZRH 1DQJB 4J6RL 3DVGA 1IAOA 2NY1B 4GO6B 5E03A 5A40E 3KYNB 4HS3A 4NT6A 3O81A 2B8OT 1AJ7L 3U0WL 3IJYA 2YMXH 2BVQB 1BM3H 1NGZB 3D39E 2A6JB 1CF8L 4XPBH 1MY5A 1KACB 5D1ZD 5BVPL 1T03H 1LD9B 4JO2H 1MFNA 2YA0A 1R3IH 2F54E 2Z8WC 4FOMA 2V5SA 4D0DA 2F15A 1RJZB 3MX0A 1NJ9A 3QIUB 3JTSB 2R0KL 1N64L 3TBWB 4UU9B 5GGRY 2W9DH 5BV7H 2JCCF 4I18A 1DJSA 3BO8A 3NCEB 1GZQB 1VPOH 1F97A 1W0YT 5FYKE 4OCNC 3LKNA 3SDCB 2Q8BL 4POZD 4HIHB 1WBYA 2J5LC 4JR9H 4P3CL 2B7DT 5SX4I 2X4NA 3L5XL 2I9TB 1ZT1B 5CD3B 5KVEH 1HXMA 5IBTL 5IB2A 1T5WB 3NA4A 4XTRC 3GBLA 3IXAB 5DSCA 1U0QA 5EBGA 1U8NA 4HIEB 3UMTA 4DUXA 1QBMH 1ZT4A 4AENB 1P2CA 3CVHA 3VGFA 5IGXH 3U7AA 4HW6A 4JO4H 2Y07L 4XWOC 5CJXC 5JXEC 3L5IA 3BKML 4J3UA 5EWIH 2E7HA 4M6NH 5KG9A 3CDFA 3U83A 1Z2KA 2HH0H 4XBGB 1CFNA 5CGTA 1UM5L 2PXYC 4YAQB 3TVMD 2X5PA 1J86A 3MFGB 5EULV 4HIIA 3IFPA 2APWA 1GSMA 4HUKB 4ERSL 2VLME 3W0WA 3KLSA 2X4PA 2ITCB 5E1AA 2VMFA 5CJQL 5A16A 2ZSWA 1HYRC 2C1PA 2PTVA 3GRWL 4LU5L 5FYJD 4G3YH 5FO8A 4XNUL 3IYLW 3ULUF 1W0VA 4NC1E 1U95A 1EO7A 3FO1A 4L8SA 1TZIB 1ZGLB 4KY1H 2VERN 5DUMH 1WIOA 5GS2D 5SWZD 2YXFA 4OV5B 4GAGL 5J6GB 2R56H 1I9EA 4PJ9D 1KIRA 3PP4L 3KYKL 5EOCJ 1WICA 5TE4L 3X11A 3S3JA 2BHUA 3BGAA 3CX2A 3L5WB 1BD2B 1XCTB 2LVCA 1AD0B 2DKSA 3ZMRA 4DGYL 4N0RA 3NIFF 1KJ2A 4NM4H 4G8FB 5MP6H 4JKPL 3O4OB 5AZ2L 1D6EB 1I85C 3KDMB 1CDHA 2ZCLL 5B4MD 4O58L 1V7NL 1JE6A 3IVKA 5FKAA 3HE7A 5J0BA 2P24A 4ZUVA 1LO0L 3BZDA 1XIWB 4OB5L 2ZOLB 1K4CA 5EZOL 2DQCH 3P4MA 2EYRA 2GTZB 5HDBE 5KS9E 3BGMA 1PJ9A 3PL6D 4ZTOL 4FQPA 4XAWL 3K8MA 1M7DB 4F57L 3ZE0E 2F9BT 2ATKA 4HX1A 4QXUH 4X9IA 5MEQB 3W5NA 5DHVB 4HUNB 4OBRA 2X44D 2DLEA 5DD1L 4L4JA 4KJYB 2F19H 2R23B 5GJSH 1KIPB 5C0RH 5DHYA 4L4VD 1YA5A 3KVQA 2HJFB 4PJFF 4PRIE 1RVFH 4WGVB 3GMLB 4YDVA 2C3WA 4JO1H 3SJVB 4EXPX 2P4AB 1DZBA 1X7QA 4PJIA 2YD4A 3WMSA 4PRHB 4JFHD 3QWQB 4FRWA 2JELL 5IFJB 1ORQB 4U2ZA 4O9HL 4KPHH 1RK1B 2G5RA 3MJ9L 4JPVL 3QDME 1N7ML 5HJ3A 3WIHL 4U31A 5DLMH 2ZG3A 3MRHA 4F33A 4Y4KB 4XP1H 3VI3F 1CS6A 4F9LA 4NIKB 4HS6A 4X9GA 4OIAA 2XQYG 1GHFH 1AC0A 2G2RB 4H20L 3H7BA 2XI9A 4EUPB 4RGMC 2B39A 3R8BB 4HWBA 1LHZA 5EU3A 1OWRM 5AWNH 3PF2A 3QA3B 1I7RA 3N1GC 4LEOA 5EIQA 2GQHA 3T3PE 1CGXA 1F8TH 4PRBB 2AJ3B 1DFBH 4X5XB 1N6UA 3PDGA 5FYJH 3H9HB 4NUJB 4WHYH 4AQOA 2KPNA 1IEAA 2X1OA 4ZPTB 3T8XA 3VXSE 4CAGA 2XWBA 1I9IH 1OD7A 5F7LB 3R1GL 1HKFA 4ACPA 3JUZA 2IFFH 4LGRB 5GS2H 5JORB 2AABH 4XH2B 1JGVL 25C8L 1ITCA 2AJXL 4FXGB 1MH5A 3H3KA 4HXBL 1Q72L 3BQUA 5DUPH 5EU4A 4P2QE 3FB7A 2QSTA 1UWGL 1RZ8B 4IRJA 3ILPB 4PREA 3VFPB 3V7AG 1BF8A 1DN0B 3D0LB 4GG8B 5CP3A 2D03L 4JGMA 1CU4H 1M71A 4YDLB 2HMIC 3B9KB 3UZQA 5DMIH 2WINA 2AXJA 3QJHA 5C07E 1NLDL 3BD3A 1N4XH 1FO0A 2AERT 4G9FE 3TA3B 4M62H 3I6GA 4OLVL 3CFIC 4WFFE 2AAVA 3VMOA 1I8LA 4EBQL 4R4BB 2R2EB 3FFDA 4M5YL 4JQVC 4Z7UF 3V0WH 1H8OA 1FYTA 3MLSH 3O45A 5L7XL 3VFOB 1CDBA 1XGPA 1BIIB 3V8OA 1IEBA 2PR4L 4NRYB 4OT1L 3QDGA 1CGUA 1WISA 1BQHG 3FOLA 3O2WH 2ED7A 2X7LA 3WO4B 4XHJC 3QIBB 4Y4FA 4BK4A 3CMOH 3S3PA 3C60B 3S4SB 1CE1L 2AK4A 3KJ6H 3BT2H 1FC1A 3IDYB 5CP7A 3GSRB 1GIGL 3ZTJH 1MFEL 4NFCA 2A9NH 3MNWB 2CO6B 2VXSH 4GQ9L 4TUJA 4HXAL 1QEWB 1ZE3C 4OZHF 4CMHB 3UTSD 1V7MH 3O11B 1R3HB 4L3EE 2UY7A 1QBLL 1H15B 4I0PB 4BFEA 2VZ1A 4M1CD 3NTCL 4Y0GA 2EC9U 4H0HB 3BKJH 2EE6A 32C2A 1KSRA 1CE6B 4HZLA 3FQWA 4P4KB 1DBKH 1QLFA 3AS2A 2NTFA 5IVXA 3QXWA 4UV4H 2FJGA 4F2MB 4KUZH 3KPNB 3P3YA 4OLWL 5E2WL 3SBWA 4O2CB 4Y8AA 2W60B 4QT5B 1KJMB 4NP4L 4HUVB 5MEOB 3OR6A 2VSCA 1EBAA 3SDAB 4FFWD 1BOGA 2G75A 2CJUL 3ZDYF 2DL2A 1JPSH 3TT3H 1NL0H 5CSZB 3OG6B 3VGGA 2FLRT 3RPIB 3VRJB 1OHQA 3C5ZD 5E94B 2Q20A 1REIA 1YMMD 3P4OB 4JFXB 4DKEH 4XC1H 2HFFB 4BSJA 1U8KB 3HFMH 1FNSH 5BZWA 1G6RB 4QNPF 4OCYL 1P4LB 2JJSA 3LN5B 3ARBD 5JW3L 1CDCA 3VGEA 4WWID 1XGUB 1NBZA 2FD6H 3H9SA 2O5XH 2GTWA 5HI5D 5I8EA 4YEFA 1NLBL 1GYAA 3O6MH 4K71B 1S3KL 5BCAA 4HKBA 4Z9KB 1RZKC 1WBZB 2UWEE 1X5IA 4JFFD 3LQAH 2VR9A 3MA7A 1T7XA 3SDDC 3N50A 5IEKA 1U3ZA 3RA7L 2X4SB 3G5ZB 2YHGA 3MRIB 4YFEA 3I50L 5F97E 4D0CA 3FO0L 1H3TA 1IRAY 2YSSB 3HMXH 1LDPL 4FFYL 3O2DH 3EJZD 1UKQA 1RULL 1KTKE 2FLBT 3N85H 4C56B 4YHKL 4MGXA 5L2KA 4BZ2H 4HQQH 4N5UA 4BFIA 1QO3A 4EN3A 3QI9C 3CFDA 3CSBA 1JHLL 3BMWA 3QNZA 3VDBA 5CHNB 1INEH 5IFAL 2BNRD 4OGYH 1D5ZB 3MRDB 1FL3B 1BQLL 1HH6A 2RQ8A 4LBEB 3IDIB 4I9WE 2KUTA 4P57A 4HMEA 4P9HC 3FB5A 1JZ8A 1XF4B 3DIFA 1KNOA 4FXKA 3CC5A 3O8XD 3T2NH 4MA7H 2EXWD 4HKZB 2ENYA 1D5XB 5DS8B 5E6IA 5D6DC 5HYSG 2OL3L 1DUZA 2I24N 3ZSTA 2PW2A 4POYA 5D1XC 2YC1A 3SO3B 3EAKA 3OKLA 4LDOB 4PJDA 5CJBA 3QZWG 3VG9C 4DGIH 4Z0BH 4JFQB 4DFIA 2M2DA 2XRAH 1CFBA 1A7RL 5F3HB 2F53D 5HVHC 3THML 3UTPE 5LGKA 2VC2H 1HHHB 2VJXA 3P9MA 3PWJA 1XGYH 1GZPA 3MBEC 2GYSA 1WWBX 5HHOA 1ORSA 1CL7I 4H8WC 4N1EA 4PJAB 4P2RA 1JIBA 1VESA 3T0VA 1A1NB 4HPOL 1UWEH 4PJHE 3NH7H 1OTTD 4GW1B 3PHQA 5CEYB 5HVFB 4ZD3L 1P7HL 2QEJA 3O6LH 4LEXH 3PWVA 1A7NL 6CGTA 1S7TA 2WMPA 1JF6A 5E8EB 5FFLA 5KAQF 4PJ5A 1RZJH 1U8PA 1MFAH 3ZDXF 1A6ZA 1TENA 1CD1B 4U1LA 3EDFA 3I75A 3MRGA 5CEZE 1FL5A 5DGQA 2GK0A 5KOMC 4XMLH 2DQFB 5F7EL 1LO3L 1YEKH 4UUJB 2LQRA 1BFOA 2F8XC 5D7IE 1QR4A 3IGAB 1FCCA 5AUMB 3KGRA 4U7MA 4OM0H 4LNVA 5D2LF 4GMSL 1X6LA 4GRLB 3HUJB 4U1HA 4QGYA 3D3VD 5IKCA 5AEAA 2IFGA 2AQ2A 4XCYB 3O4LD 2UVEA 5MHSE 1FFOA 1RJLA 4PJCE 2V17L 4FQXD 1CT8A 4KVNL 4FA8A 4C83B 5T3ZD 4YFLF 5DJ2B 3VI4F 5E24E 5C0AE 1DBAL 3PWPE 1HHJB 4ETQA 5KSAB 4JPIB 2QHRL 3VFNA 1SYSA 1VB9A 2H32A 2Z31A 3TZVD 5IQ7L 4JN1L 1W72B 3AREA 2RBLA 1TPXB 4LIQE 4MVBC 1TITA 3GZKA 1C1EL 4EEEA 5DUBB 4APQD 3VXRE 4X80L 4K9EC 3P9LB 4OSUH 5MENB 3IDNA 3RY6C 2HKFL 4NQSA 1H3UA 2GT9A 4TSAH 3WNOA 5BZDB 3NBNA 4HDIA 1HN1A 3ESVF 4Y2DC 1ZT7A 3RIFF 4NOBA 2UZYB 2J8UF 2VQ1B 1CYGA 5KSUA 4XI5C 1NCBL 4X6DE 1KLUB 3QH3A 5GXBB 3EW3B 5GRUH 4JFEB 5CD5C 1FE8L 2Z8VC 1P1ZB 4LARH 5D71L 4Z7VB 4HLZH 3F5WA 2A6DA 3FMGH 1SEBA 1AD9A 3FFCD 3ARQA 3QYCA 1E6JH 5C08D 3JWOH 1NAKH 5FHBL 1ETZA 4XVTL 5D96C 1ACYH 1KPVB 1EFXB 4M7JH 5E8PB 4GG6B 4KAQL 2HN7B 4PV8B 1JMZA 3T0BA 3BPNB 1F3DJ 5GZOC 3QUMA 5GHWH 2J4WH 2XN9A 4ODSH 2XKSA 1TZGL 2O5ZL 3OR7A 3Q6GL 4HAGA 1AGFA 4NZTL 2NW2A 4L1DA 5T33H 1JPGB 1P5UA 3TV3L 4U0RB 3UJIH 5IFHL 3PE9A 3MRCA 4G9DB 2QR0B 5HYFA 2PYEE 5FGBC 1SY6A 2GSIB 3U6RB 4U33A 5DI8B 1H8NA 1U8HB 3ARDD 3V6ZB 3LKOA 3IDMB 3WKNA 3MUGA 1RMFL 1FPTL 5FCSH 5E99L 2Q76B 2PW1B 4DEPC 2EZ0C 3QEQA 1AY1L 3GMNA 4MS8C 3U2SB 1UYWH 4WUUA 2HT2D 1SM3L 1E27A 1MLCA 1NAMH 4L8BB 3VCLA 4WIQA 4TSBL 5DZNA 3MV9D 3MRBA 3MREB 3HC0B 2BVUA 2YN3A 3CU7A 3KHOA 1EO8L 4NGHL 3X3GH 4CNIB 4PGJA 4D3CL 5T3ZH 5ISZE 4G42B 4IDJH 2ICEB 2DIJA 4XNZB 4M4PA 4WV1C 1J1PL 4C58B 1QSEE 3U0TA 1CLOL 3VFVA 1VHPA 2M8XA 2R4SL 3AFLA 4M7LT 3LDBB 4I2XB 5F9WC 1KT2B 3KS0J 3AROA 1WWWX 4W4OA 3ARGD 2B1HL 4XNMB 2BNUB 3UJJH 4B7LA 1AFVH 4WO4A 5DJCA 3L3KA 1JK8B 3LS4L 4K8RC 1G7HA 5EZJB 3ULUL 1HSBB 5ERWB 2GSGB 4JFPB 1MHPL 1H3WM 3OJ2C 4RZCA 4ONFH 2JJWA 4G8GE 4Q6IB 4XMPL 4ONGH 1DVFA 4X7EC 2XNAB 1S7QB 4WTWA 1WWAX 4MAYA 5J12B 1JZ6A 1J5OL 3IDJB 2QQQA 3RGVD 5HHNA 3D69A 1MRCL 1R3LB 1XZ0B 2V2WA 3LPFA 3QULA 5IHZB 5BS0A 4ELKA 4Y16C 3QR2A 3UX9B 1C12A 2R2CA 2UVFA 3WFCH 2X42A 2DM2A 2P5EE 1OAUH 2IANE 5DRZA 3PWNB 2ESVD 4GW5B 1GJIA 1EUUA 4RA3A 5EZIH 1BEYL 2R2BA 1Y0LA 2CKBA 4PTUB 5EO1A 2FECI 4P2OC 1HCVA 4WUKH 3UYOD 3QFJD 2Q6WB 3AMLA 5F21B 2VDPH 2VLRD 3GMRA 5EO0B 1GXEA 4LSQH 1BMGA 1MCOH 4UINH 5BRZD 2W0KA 3MC0A 1X44A 3QHZL 4XPAL 1SJXA 1UXSB 2AK1L 5F7UA 3T0ED 3VXUD 3V4PH 3ULVC 3RTQB 1IGIL 3OX8B 1NGYB 2NY3D 4BFBD 4HULB 1IGFL 1LNUA 1C16B 1YPZA 3FQNA 3LEVL 4WTZG 5E1HB 5CZKA 1T5XA 1MVUB 1D6VH 1OAKL 5K9JL 1IAOB 3UROR 3OXRA 5F9DC 2O5YH 1BJ1H 2AV7B 2NZ9C 5LGJA 3NCJH 1JGEB 3IJYB 1TETH 4UTAH 2J1KA 4WHTA 4M61A 5I18H 1DQQA 3VH8G 1K3ZA 5I8CA 2ZNXA 1FJ1A 4LKCA 4LSUH 2NY1C 4D0DB 5B8CB 5IB1A 4MQSB 2LU3A 2XZQL 4MXQD 3TN0D 2YA1A 3U30B 2OK0L 3MZGB 4WI7A 3ZT7A 4ZFGL 3HNTH 3OJVC 3P4NA 4KKAD 1A4KA 3GI8L 5HHPB 3BO8B 3BISA 4NJAH 4Q9RH 4RX4A 4OLXL 2NY6D 2BVPB 3QIUC 4DGVH 1RUMH 1VACB 5JDSA 4BQ9A 1JGDB 1WAAF 3KXFD 5T5FH 5DSCB 1FNLA 1MWAH 3H3PH 1NC2D 1U8NB 2BNQA 2BMKB 1P2CB 2VQUA 3CVHB 4MJ4A 2I60L 4GFTB 5HGAA 4Q7DA 4ETYA 5ITBH 1F42A 5LKNA 3RDTD 5KG9B 2X4QA 1CFNB 1JYWA 3P9WB 5EIIA 1MCKA 3CLEH 1U8OA 5C0JA 4ZS6C 2X05A 4JGJA 1AO7D 2W0LA 1E0OB 3KWWB 5IW1B 1F3RB 2HTKD 3IU3A 2EECA 5A16B 3IDUA 5FO8B 2APXA 3KPQB 4M48L 4Q0XL 1LEGA 4P9HL 1W0VB 5ID0A 4NO0D 5F71A 3L3IA 1U95B 4TSCL 5I0DA 3FO1B 4L8SB 5J89A 5LQBL 3BEVA 3HZKA 1AI1L 2VDQH 4FMFA 3GSNA 2MNUA 3PV6A 4FNLL 4GRWH 3MJ6A 1CQYA 4XXCA 3MYZA 4LAQL 3MLZH 1KIRB 4LLUA 5F8QC 3RVUC 3JVGC 2B0SL 1FDLL 4PP1C 5KAQG 2DQHH 3X13A 4P9MH 3RIFK 4J4PA 2E6JA 1HEZB 2CDGA 4P59H 4GMTH 1UWXK 3KYOA 2R1XA 3KPOB 1KB5L 1RIHL 4N8CL 4MXVF 5FKAB 4UB0L 4CU7A 3HE7B 2ZP0T 1TJGL 1J0IA 3BPCA 3VFRA 4ZUVB 2DI9A 5F7HA 2V9QA 3FTGA 4BK5A 3CDGA 3F12A 3LRSA 1K4CB 3RVWD 4HT1L 3BGMB 2NZIA 3BDXA 3L5HA 2DQEH 4LFHG 2DTSA 3O4OC 1RHFA 2XT1B 3P0YH 4I48A 4RGNB 5E08L 4HX1B 2ZUTA 1WBXB 3VU2A 1CFQA 3GNML 5DD6B 4NKOA 1IM9B 1CGWA 2VH5L 1JCKA 3RNKA 1B9ZA 3D39D 4BQBA 4DK6A 4OZGA 5I30L 2A0LD 3F58H 3RKPA 2H8PA 2ZNWA 4RWYH 3DETC 5CIPH 5JUEL 3S35L 2VQTA 5F89B 2MQ3A 5TDOA 3WEXA 3NFNA 2F54D 2A1WL 2COQA 2Q86A 3SPVA 1S9WB 5JPNA 3VGBA 4W6WB 1KCVL 4KK5C 4R8WL 5HJ3B 2VDNL 3OKOB 1XGRA 5FV1L 3MRHB 1BP3B 4NQDB 4F33B 3CFCL 3WKMH 1JGUL 5FYKD 3HRPA 3PDDA 4DZBB 4Y19A 1JNHA 1CGTA 1N59A 2FB4H 5ESVB 4Z95L 4PJBE 4Y4KC 3VFTB 3LVEA 1I7RB 1UM6H 4LEOB 1FGNL 3TGXA 1NKOA 3KPSA 4L9LA 1RFDL 3G6JA 3HE6D 1HE7A 3LS5H 5C08A 1QKZL 2E6PA 5EO9A 3V7AE 1XH3A 3DUHA 4JANA 4LPWA 1JPTH 2OZ4A 4K9EL 1OAYH 4JJHA 2XWBB 4RBPH 1MQKL 5LCVH 2YD6A 1G9NL 2VLMD 4MXWH 3BH9A 4PP2A 1CGVA 1I8IA 5CCKL 1B4JH 1NFDB 4OV6F 3BQUB 3QDJE 2D0HA 4PRPE 5C0CB 4RMVA 3FB7B 4YPGA 2NXZD 4JPWH 1XR9A 3OXSA 4PREB 2IPUG 4OFIA 1JZ3A 2R0WL 1C5CH 3D85D 5DC4B 5AD0B 1S7VA 4D9LH 1M71B 3MO1A 4XBPA 3MLVH 1JHKL 3QJHB 4PJ7E 1JWUA 2FJFA 3GMPA 1KELL 5H37G 1NSNH 1FO0B 4ODVH 1UXWA 4U1IA 3IKCA 4JY5H 1X5HA 2ADGB 2V7NA 3INUL 1ZEAL 5IBUB 3FFDB 1QFUL 2V2TA 1J1XL 2EH7L 5T1KA 3O45B 2C3VB 2X1WL 3O6FB 3B9KC 1QLRA 3ARRA 1MI5B 1JV5A 3A0OA 1IEBB 1PKOA 3QDGB 4XAKE 5GGSY 3FOLB 3UTTE 4WW2C 3FN9A 4Y5XA 2FHCA 2Y36H 2DM3A 1CL7H 2R29H 4OZIE 4XPFL 3OTTA 5KSVA 2V2XA 1WSST 5DO2C 5T1LB 4LVOC 5D72L 1YUHA 3L1OL 1UM4H 1MNUH 1P9MC 5D70H 2FR4B 4PJXF 4ONHA 3HKFA 1FBIH 4TUJB 4EJ1C 3O6KH 4XPTH 4Z7OE 5KVGL 1UH3A 2YD1A 3QIBC 5K9KA 4OLZH 1MWAA 3C60C 3VFGH 5FYKH 3ECBA 4LSRL 1Q0XL 1RIVL 4MA8L 4HK0A 2CK0H 4X8JA 32C2B 2DLFL 2Z35A 3FQWB 3QDMD 1UJ3B 3B2VH 2NTSP 4HZLB 5J3HC 3RKDD 3RGVA 4I3SL 1KCSH 4CMHC 4LASH 5IVXB 2FJGB 1LILA 3JWDC 2NYYC 3KPTA 4W70A 4R96B 3B6SA 4I0PC 2DQJH 4PR5A 4H1LA 4DZ8A 4D0BB 1BOGB 1N6VA 4JHAL 4MNHA 1FNFA 4AT6A 3RP1A 4HK3N 4LSTH 4TYUA 5FDYA 2P5WE 1BECA 1AQKL 5DZLA 4GSDL 3S96A 1V05A 4IOIA 2VN7A 4OF5A 4JM2F 3FT2A 4CVZA 2VLRA 2GAZA 3WNPA 2GI7A 1EXUB 2B1AH 5BRZA 1WCQA 3H9SB 1URLA 1MJJA 3MLTA 1FYHB 3VXSD 3T77A 3BH8A 2CDEB 2DYPB 3KYAA 4N8PA 4YH6A 2F5BL 5E2UL 5FHAL 4HKBB 2C3HA 3BDYH 4R0LC 5EU7E 2FX8L 3JV0A 7FABH 2JCCE 3EKCA 5EA0H 3ETBF 4O2FA 4YXKH 1AXTH 5IEKB 4P2QD 3M07A 2H6PA 3UPAA 3GIVA 1ZLSH 3BEWB 3TJEH 5C3LD 1I9JL 3P4LA 5D1ZB 5JHLH 3QXAA 1HILA 4K71C 4D0CB 3UTZB 3QIWD 4JZJA 3GHEH 5C07D 2Z9TA 4OD1L 4NUGH 1XT5A 1IFHH 3NPZB 1F4YH 1Z3GL 1AH1A 1XMWA 4G9FD 3BPLB 3WLBB 4LKXB 4HC1H 1QFWH 4WFFD 3MUY1 3LPGA 3VGAB 3DMMD 5I66A 3X12B 4BFIB 3ULVL 2YUWA 3CFDB 1HHGA 2WBJD 3QNZB 3STLA 1T0NB 3QT2A 1WQVT 5F44A 4MQ7B 3C2AL 3L95B 4EDWH 3CVIL 5GS0L 1AGDB 2CIIB 4ZOBA 3RU8H 2VL5A 4NNXB 2RFXA 3CC5B 4O5LH 1KLGA 2VLJA 3V4VL 1RIUL 4OI7A 5E6IB 4MA1C 3DROA 3ULUE 4PB9H 5LBSL 1DUZB 5IWLC 2YC1B 2EDQA 4PG2C 4X6FB 3SCMA 1CICC 1MHHA 1NFIB 3C09B 4L3ED 4F9PA 3GO1H 3NZ8A 1W8NA 3MXWH 4NQEA 1ZKAA 2YD5A 5KVDL 4GS7B 3U9PH 3PWJB 1GZPB 2K1MA 3FRPG 3QHFL 4ZUSA 5HHOB 3CK0H 3D9AL 1ORSB 1VDGA 3VGDA 3QPQD 3SO3C 5CJXA 3DURA 5JXEA 5KVFH 1U41A 3SDXF 4P2RB 4UI2A 5DXWA 5E9DA 3DHMA 2PXYA 3PHQB 3ZTJG 4OQ1A 5GRJL 3G5YA 3PWVB 1ZTXH 4EOWH 1CDUA 2DWEA 2WUBH 4MD4A 4MNQE 5C0BE 3OKEA 1NBVL 4M00A 1KENH 4PJ9B 1U8PB 1QOKA 2ICWB 1RZ7L 4QHKI 1A6ZB 4U1LB 4EKXA 1BPVA 3I75B 4OF0A 3V5HA 3UTQA 3ZHLA 1DEDA 1G9ML 2YPLE 1KTLA 2K3TA 2X40A 4YXLH 4BELD 4PJFE 5KSBF 1DLFH 1OGAA 1UA6H 2OP4H 4AY0A 5F9OL 2AEWA 3RUGB 1EJOH 5FF6B 3OAZK 4FTVA 1QSVA 2FSEA 2FH6A 1H3PH 2DLIA 2Q3AA 4A6YH 3S4SG 5IKCB 3STBA 1NFKA 1IQDB 3PL6B 3DGGA 4P46C 1UCTA 1DQML 2A38A 4NN6B 4IJ3B 3KR3H 5I0ZA 4GRLC 1VGKA 3V5KA 1G7JA 3JZ7A 4ETQB 3D39A 3TWCH 2FGWL 3VFNB 2H32B 4PGZA 5C6PB 2Z31B 4UDTA 3EGSA 5HPOA 4M6OL 4X9BA 1A7QH 2HVKA 4QOKE 3AVEA 5I19H 3TIDB 3LEXB 4WU5B 4B53A 2W0PA 4H88L 5KSAC 4N5ED 2NY5C 2X4RB 1CVSC 2VRAA 4K7PL 4NQSB 1CLYH 2GT9B 4YBHA 4HDIB 4NSKA 2I25N 2CKNA 2X1QA 1FH5H 1TPXC 3EYFA 3NPSB 3MRJB 4I9WD 1V5JA 1F3JA 1PFCA 5F88A 2APFA 3KAAA 2AP2A 3ZKMD 1N5YH 4XVJL 3LQMA 4QWWD 5SWQA 1ZLVH 2UV3A 1GGTA 4UILL 2NR6C 5D7JA 1EJ6A 4LK4A 4CL7A 1SEBB 5I9QB 2XZAL 4YHML 5L6YH 2A77L 2UY6A 4KHTL 1YNKL 5DT1H 4XPHL 4UOW1 2CIKA 3HA0A 2MHAB 3FQXA 3ZSSA 4QXGL 4UAOB 1A6PA 5JQHC 2VXUH 3RWJB 1OARL 1LK3L 3QUMB 5CFHA 2XN9B 3DXAA 3UTPD 4BZ1L 3LIZL 1FRGH 3LAFA 3LZFL 4OJFL 5DFVC 2R4RL 3F7VA 3OR7B 3P0GB 4Z7WF 3QUXD 1T04B 4LSVL 5L0QB 2Q7YA 4KKNA 3MRCB 1LWRA 5IMMB 1KN4H 2VLLA 4HCRH 4FMKA 2EDBA 4KJQD 1ZHLA 4UBDD 1H3VA 3WYRA 1ZANL 3LN4A 5DEFA 1JGLL 3HLAA 1CDYA 3MUGB 5MI0B 3O3EB 1S7WA 5DA0B 4UV7L 2EDXA 4LCUB 5I1CL 5CEZD 1E27B 3CZJA 1T7YA 2QQKL 4J3WA 2CMRH 3MRBB 2ZJSL 1I7ZB 3GBMH 2XICA 4OZHE 3NCCB 3S34H 2VLKE 4WU7A 5ITFA 3W2DH 5LGHH 2ZSVA 1C5BH 3SQOL 4RMRA 4LPYA 1JFQH 4ZQKB 3H7LA 3B5TA 3VFVB 4X6CA 4PB0L 5GJTH 3HC3L 2C4FU 4ZUUA 5MHSD 1X4ZA 4PJGF 3BN9D 5ETUA 1G7IB 3L3KB 1GGBH 2F58H 5HTSA 4XNZC 5IOPA 5IQ9A 5ENWA 5C0AD 5K59F 3SY0B 4PRIA 3D18A 3RAJL 4S1SL 1FIGL 3WD5H 5JZ7D 3LDBC 3HI6H 2LU4A 4UOJA 3ZDYE 1ULVA 5AAMA 4RMQA 1DVFB 2J88L 5JMOC 4CU6A 1A3RL 2PO6D 1WZLA 4MAYB 5HYJE 1INDL 4IOFD 2HJKB 5D7LD 4L8DA 3BUYA 4KH2A 5HHNB 1SJEA 4KVCL 3QULB 1BX2A 3B5GA 4XHQA 3R06B 3VXRD 4TOYL 1GPOL 5CWSA 2OM5A 4QNPE 2Y6SC 1C12B 2WQ8A 4Q6IC 2DBLH 5FECA 1YNLL 3EFFA 4Z7NF 4EZMA 5J12C 3BHBA 3MXVH 2R2BB 2CKBB 1L6XA 3C5ZB 5EO1B 1MAJA 3F7QA 4NJ9L 2PTTA 4ZXBD 2NNAA 1YMMB 3FO9B 2ATPA 4OD2A 4ODHL 4KRPB 5FYLE 3GMRB 4OAWB 2WZPD 1RUKL 3ZE2F 1T2JA 1QLEL 3GSVA 5L2JA 1IBGL 43C9A 3EOAA 1B2WH 3BZ4A 5KW9L 4F3FB 3QJFA 4U6TA 2X6MA 4NN7B 5DURB 4KKCD 2YK1L 3OAUL 5FUOH 3NCMA 1KBGL 5B39A 3ARBB 4PJEA 2ZUQB 1IGYB 1TVBA 4XP5L 4ELMF 3HAEH 1YPZB 3FQNB 3E3QC 1CDGA 1U58A 2YA2A 4IMLB 4G6JL 3CH8A 1R3KA 3KNBA 4QRPA 4DN4L 3AXLA 2I9LB 5EBMA 4JFFB 2A73A 1A6WL 3NAAH 4HLZG 4OF3A 2R9HC 5C8JA 2DMCA 3ET9F 1BJ8A 5F72S 4M61B 3GK8L 4PJIF 3VWJD 2D9CA 2PYED 5CEZH 5FA4B 3WUWG 1DQQB 4N0YL 5I8CB 1VENA 2C3GA 4A6YA 1FJ1B 3M1BB 5A1AA 2R0LL 3U4AA 3GMOA 5EPMB 1T2QL 1I1RA 2DQIL 4U05A 2VAAA 1G7PB 4NN5B 1FZOA 4FQIL 4J6RH 5FM5M 4K3JH 4YX2H 1LGVA 1CIUA 3H2WA 3MOBL 4G7VL 2JF1A 3U36A 5B8CC 1G6RL 1UEYA 2BNRB 4MA3A 1CF8H 4NOFA 3OAYK 4PLNC 4LHUD 3U30C 3LV3A 5BVPH 2UZXB 1CTOA 5ISZD 3K8LA 1JL8A 3T4AA 3L3DA 4O4YH 5ICYA 1QSED 2SEBB 2QQNL 4GXUM 4HKXB 3O8XB 5EU6E 3RBGA 2R0KH 1N64H 1U8JB 1KPRA 2RHEA 3QI9A 4H26A 1WTLA 4X5LA 4CKVX 4LIQH 1F90L 1N5AB 1TMCB 5GRZA 4LLYA 2BOBB 3GI9L 5EIIB 1YY9D 1WWCA 4KJPC 2KDGA 5C0JB 1IJ9A 2Q8BH 3L7FA 1PBYA 4P3CH 1U36A 4G8GD 3I84A 3L5XH 1IAKA 5E8NB 3IFOB 3S36L 3FN3A 1DSFH 2BSSA 3IU3B 2FL5A 2GW5A 3ZDXE 3KPLA 1LEGB 1NGQL 4GKSA 5D6DA 3K4AA 3E8UL 5ID0B 5GZNC 3BJLA 3UPRA 3L3IB 1U3YA 2VUYA 5D1XA 3RWGA 1ZGLP 4FFZH 5DJ6B 3BEVB 3HZKB 4X99A 1FV1A 3BKMH 1L0QA 1DBML 3GSNB 1QVOA 5EZLA 3PV6B 2P5ED 2VSDA 5D2LE 1UM5H 2IAND 2JKXA 3D0VA 3MRRA 1DQTA 1FNHA 3EDJA 1EVTC 3DX6A 5HGGS 3X17A 1FL6A 4F7EA 4ERSH 1KCUL 4N0UA 1KJ3L 3OKNA 4J8RA 1AXSB 2CDGB 5I1KL 4L8SC 2DWDA 3S8WA 3MBEA 4K3GA 2CUHA 3MV8E 1R24B 5CJQH 5L9DL 3GRWH 4QLRA 1CI5A 3QQ9C 4KDTC 1E4XI 3VI4E 1ZLWH 3VFRB 4R90H 1J8HA 2C4FT 4KI5C 2E9JA 1OT2A 3CDGB 3F12B 3LRSB 3PP3H 4QXWA 2RIKA 3EHBC 4HH8A 3TCLA 1AC6A 3NVQA 1CFTA 1NGWB 3KYKH 5IMKB 3D3VB 4OZFH 4PLKC 5TE4H 1FVCA 4TTGA 1N0LA 3L7EA 4QGTA 3O4LB 4MSWA 4DGYH 2UWEA 4FG6C 2ZUXA 1FNGB 4HJGB 4OZGB 5AZ2H 3DJ9A 1T6WA 1YEGL 4XCFL 1EH9A 1V7NH 4AZ8A 3U79A 5TDOB 2LE9A 1QYGL 2ERJB 5C0ND 3TBYA 5EN2A 2RCSH 4RGNC 1ZVHA 1LO0H 2J8UE 4P4RA 1EEYA 2Q86B 3LKQB 3WE6A 4CJ1A 2P45B 5EZOH 3TZVB 2H2SD 1QSFE 3BGFB 5FO9B 3VE0B 4ZTOH 1XGRB 4YO0A 3S35X 1U6AL 4XAWH 1E6OL 2PN5A 4F57H 5EUOA 3TT1L 3WDJA 4WHCA 3OPZL 3WN5C 4XPGL 4Y19B 2VUOA 5HGDB 1JNHB 2NX5A 2KQMA 3QO0A 5DWUL 5TE7L 2EO1A 1MFCH 4GKOA 5CJOL 3BP6B 5IT2L 4F7PA 4OLEA 4O9HH 4ZSOB 4C4KT 4NWUL 3MJ9H 4JPVH 4XCEB 1N7MH 3WIHH 3G6JB 3RY6A 5C08B 1JNNL 1RHHA 5EO9B 5KS9F 1RZGA 3NZHL 4J7RA 2C26A 3V0VB 1JRHL 4L5FL 4WEUD 4JANB 3M8OL 5C2UB 35C8H 4G80A 1EO5A 4IS6A 4OFVA 3BRGC 4H20H 1F00I 3ALWA 4OLYL 3LN9A 1FLTX 1I8IB 4XCCH 1NMBH 3GBNL 5DJ8A 4WEMB 5DVMA 3IETA 4YPGB 5ESQA 4BKLA 3C5JB 1XR9B 1ZOXA 3OXSB 5E5UB 3MLXL 4KK9D 4GJTB 1S7VB 1MUJA 4PJHA 4RFOH 1WEJL 4XBPB 3HAEA 3E2HB 3LOWA 5H8DA 1NC4D 4HK3J 3EDEA 2FJFB 3ARDB 1DN2A 1UXWB 4U1IB 3STZA 3LB6C 2V7NB 1MHEA 4HS8L 1TIUA 3MLYL 3WXWL 1U8IB 1A7PH 2GJ6E 2EO9A 2V2TB 1DTUA 25C8H 4ISVA 2AJXH 4LPXA 4HXBH 1Q72H 1QLRB 3TBSB 5FGBA 1UWGH 1JV5B 1T83C 3EYOA 3MV9B 3P40A 4NPYB 4RAUA 4TTDC 4B0MM 2D4FA 4Y5XB 3GSQA 2DOCA 3IRZA 4P23D 4XT1C 1QRNA 4OGAD 4URTB 3S37X 2BFVL 1NLDH 4PYHA 5KSVB 3O6FC 4Z76A 1EX0A 4M6MH 1MEXL 5C0DA 3BIAX 3OSKA 4OLVH 2EE2A 4PGDA 5CUSL 4EBQH 4I4WB 4ZUTA 1W2KT 4QRRA 4PJCA 1OY3B 2R1YB 2VNCA 4M5YH 4PJDF 5L7XH 5BV7C 3BKCH 5F9AC 1MWAB 1J05A 3G6AA 3L5JA 3PWPA 3ECBB 1EGJL 2PR4H 4YHZL 4HK0B 5JIIA 4JFDE 3RWHA 1MLBB 1CDIA 2Z35B 5T1DL 1RI8A 2GJZA 4BH7A 3RGVB 4U7KA 1XGQB 1CE1H 3BIKB 5IBLD 2ZKHL 3ABZA 3P0VH 4RBPK 1YEDB 1AR1C 3B6SB 1MFEH 3IXTB 5IIEA 4PR5B 1CTNA 1O7SA 4DZ8B 4GQ9H 4UQ3B 5DK0A 4AT6B 2IAMC 1UJ3C 1QBLH 5DDHB 3HG1A 3S9DB 4YE4H 1MOEA 1ED3B 1FLRH 4LCYA 3S96B 4R7DA 3KLHC 3QFJB 1FCGA 1BFTA 3J8F7 4Y16A 5CILH 4ZO8A 4CUCA 2VLRB 4NC2B 3W9DB 5BRZB 3V79C 4GRWB 4AH2B 4EDXA 2IPKA 2BP3A 4KFZC 1MJJB 1ZA6A 4IRSC 3MLTB 4QTIH 4X9HA 3T0EB 4U1SA 3VXUB 1U9KA 2CJUH 2ENSA 3T77B 3F62A 2VAJA 1OAXL 3VFMA 4KROB 5J13B 4TRPL 3QDHA 3AY4C 5J6HA 3GJFK 2JJSC 5SWZE 3DNKA 1YNTA 3VA6A 1CLZL 1FFPB 4O2FB 3QDJD 4NQCA 4PRPD 4AMKL 3HNVL 3SGJC 2H6PB 1A64A 5DJXB 3TPUA 5KZCD 5CMAA 3MUZ1 2D7MA 4HFUL 5JIKA 3MCKB 5D5MF 4OCYH 4DN3L 3ZKXC 4K94H 5JW3H 5I75B 4JZJB 1WAAE 3MLRL 2FO1A 1KEMH 3IDGA 4YUEL 2BSTA 5I66B 5JW5A 5D1ZC 5ESAB 4MJIE 2DD8H 3STLB 4YBLB 2Y06L 4NCDA 2FEDD 2BHYA 3Q1SL 2DQDL 1ERNA 1FGVL 3WHE1 5A3ID 3BPLC 3QP3A 4X4MA 1ZS8B 4XAKD 3KYNA 3UTTD 2CRIA 3I50H 3VGAC 1JTTA 4LHUA 5ISZA 2RFXB 2NCMA 3KXFB 1NGZA 1NC2B 2A6JA 4ZAKD 1LDPH 4FFYH 3DROB 3DO7B 1GAFL 4UDUB 1ZWIB 3U46B 2PNDA 4POZC 4YWGL 4YHKH 4K23L 4PD4K 4RRPA 3NGBC 1S7UB 4LMQE 1JHLH 2Y25A 4LHQB 2J5LB 1AQDA 3HB3D 5TQ0L 3JTSA 4S1DD 3BI9X 3SCMB 4FZEH 5IFAH 4PJ8D 4XNQA 1MHHB 5JW4M 1OM3L 1EVUA 4P5MA 1CCZA 2VOTA 1JF1B 2R39A 1N8ZB 4OKDA 1BAFL 4OIBA 1FC2D 4NNPL 1GGIL 3WFEL 3KPPB 1T0PB 1N3NB 2IPTL 3DURB 1KYOK 1ACZA 1QFPA 3DX7A 2BRQA 4MXVE 3TVMC 5E9DB 1ZT1A 5GGRB 3S88L 3I02A 1MFBL 2RGSA 4Y4HD 4KMQA 4M7KL 4GXUN 3IXAA 1ADQA 4MJ2A 1EIBA 3TH3T 3T0XA 3MFFB 2VDKL 4GS7C 4Z0XB 4AENA 2HJLB 2L0DA 3PIQB 3K4DA 3TBTA 1WCBB 4MZ2A 3OKEB 3V0AC 2YWZA 2YUXA 1UKSA 2EDDA 3CNKA 4HEME 2P5WD 5C9KA 1IGCL 4ZOAA 3WLWD 2AW2A 2N7BA 3UZEA 3V5HB 3UTQB 3CVHL 3WS3B 1IL1A 1T80A 5I1EL 3BAEL 1ZA3B 1OGAB 2BDNL 4M4RA 4U1MB 3OB0K 3F7RA 4JG0L 1HINL 2ITCA 4PJ9C 4ZFOB 5TH2A 3BRDA 3RZCD 1DDHA 4ZD3H 2FSEB 4X98B 3JVGA 4NKIH 3MBXL 3RFZC 3W5MA 2DN7A 4OFPA 1A9EB 3DGGB 1TZIA 1ZGLA 1PG7L 4QHMB 5B4MC 5I8KH 1UENA 2R8SL 1HYSD 1J9CT 5J6GA 1OF2A 4OGXL 5ILTH 3VFWA 1FVDA 4YXHL 2E9WA 3BN3B 2A6KB 5B22A 3D39B 3PWLB 2HLAA 1CXLA 4WENB 3LH2L 1Q1JL 3L5WA 4Z5RA 4XP4L 1AD0A 3PL6C 4UDTB 1J0ZA 4GMSH 1BIHA 3ZL4L 1RU9L 4AEEA 1PG7W 4IJ3C 3IU4L 3WNLA 3SO5A 5HHVL 4HUWB 1KF9B 5LWYH 5DMJB 1YC7A 5JXAL 3NCYP 4JM4H 4UT9L 4FQ1L 2ZOLA 1T3FA 2GTZA 3GSUB 4KVNH 3ZT6A 5HI3D 5C86A 3DI2B 1MRFL 5GISL 1DBAH 5MEQA 1A7OH 5DHVA 5F88B 1DQLL 5E6ZA 5I6XB 4KJYA 1PZ5A 2R23A 5IQ7H 4X6BB 4TUKL 5JIPA 4JN1H 4JQIH 2HJFA 3SJVA 4RAVA 4YFLI 1ZLUH 5D7JB 3HZYA 2VL4A 1C1EH 4AEIL 3MODL 3ULUD 5DQDL 3NPSC 3HE6B 3SE9L 5IK3A 3ISWA 4MWFA 2HKFH 4TPRL 3FQXB 1I75A 4OCRL 4JO3H 3FB8A 2WQRA 3MPCA 4Y4KA 5I9QC 1NCBH 2A2QT 5SWSE 3T09A 3CH1B 2DLGA 1YEIL 1HDMA 1PY9A 1XCQB 5E5RB 3ARYA 5D71H 3CU1A 1TXKA 2YBRB 4BFGA 1M6OB 2NXZB 1AKJD 3QDAA 4R9HA 5FHBH 3CDCA 3H9YA 4XP6L 3QA3A 4DVBA 2CLZA 1S8DA 3U7WL 1ZHLB 4B7IA 1NKRA 2CLRA 3JV4A 3HLAB 5AYUL 3ARFD 4MNQD 4X5WB 5C0BD 1S7WB 4HWBL 4UIKL 5L0QC 2AJ3A 3H9HA 4NUJA 4J3VA 5C1MB 2P49B 1OTUD 1EHLL 4W68A 1TZGH 2O5ZH 4ZPTA 3Q6GH 4D9QE 5D1QD 4NZTH 5IMOB 4Q2ZB 3TV3H 4YIQB 3MQIA 1IC4L 3EYQD 5MI0C 1BLNB 3LQAC 4WU7B 3TPKA 2XTJE 3IAQA 4XH2A 2OR9L 3B2UD 4X6CB 1MCNA 1RZ8A 3LSOA 5HD8D 3VFPA 3EYUL 1RMFH 1DN0A 3T2PA 1OT1A 1BZ9B 4GG8A 1LMKA 3EO0B 1NEZG 5E99H 2MQCA 4PJAE 1AY1H 3B9KA 1R5VB 5IV2A 4K3EL 1NGPL 3T1FB 5IQ9B 5ENWB 3T04D 4TSBH 4JREB 4PRIB 3D18B 4M43L 2FATL 4WW2A 2ADJB 1XF3A 2UUDK 1EO8H 4NGHH 1RQ5A 4D3CH 2H1PL 2VO5A 2EXYD 1NUGA 1MCCA 3VFOA 1J1PH 3HHRB 1BIIA 1CLOH 1FO0L 1E4XH 1FZMA 1SJEB 3EFDL 1BX2B 3QDMB 5IVOA 3Q6FB 3WDHA 4NRYA 1C8PA 1P9MA 5TE6L 5GSVB 2B1HH 3MV7E 3Q3GB 1RUAL 1DVFC 3QIBA 1T03L 1EK3A 4MAYC 1R3IL 3ULUH 4HFWA 4M1CC 4M1GL 2W07A 3BOVA 5DJYB 3L3JB 1TJIL 2PETA 4XMPH 2PTTB 2V5MA 3MNWA 5HVGB 1I3GL 3BESR 2ATPB 3KLDA 1U3HD 4IRZL 3O11A 1R3HA 3C6LD 5L2JB 1CFVH 3EOAB 1H15A 1JTPA 1UH4A 4FFWC 4I0PA 2F53E 3HI1B 3QUZD 1QACA 2WAHA 2O93L 2OCFD 5HPMA 5ICZA 4OUOA 3C5ZC 5HBBA 2DKUA 2D9QB 5IF0A 5KVEL 1CE6A 1TVBB 2VDRH 3RBSA 4LHJB 4W6YB 3VXSB 1U58B 1QBML 4F2MA 1R3KB 4QRPB 5IGXL 4QT5A 4BM7A 3AXLB 4DUVA 2HTLD 4HUVA 1PKQA 1XFPA 4JO4L 4NN7C 5BQ7A 5EWIL 2A73B 3NN8B 3ARBC 1NCUA 3VW3L 5C8JB 3QDJA 2IQAA 2ZUQC 4PRPA 5CSZA 4P2QB 1RZJC 3RPIA 1NUDA 4WI3A 5E94A 5HI5C 3QUYA 3QHZH 4XPAH 3P4OA 4JFXA 4YDJB 1YN6B 4A6YB 2HFFA 4QCIB 4GRMA 1U8KA 5A2LH 1TCRA 2AK1H 4M93B 3GMOB 3DRQB 3OKMB 3QIWB 3M45A 3W81A 4KZDL 1IGIH 4PBXA 1SJHA 4R0LA 3LEVH 1LO2L 1FZOB 5FOBA 4H25B 3LN5A 4NM8H 3TESA 5IG7A 3BE1L 3DMMB 1EA9C 2VDMH 1SJVA 1IC7L 3U36B 1L4IA 2LABA 4M02A 4MA3B 5C9JA 2VLKD 1ND0A 3QSKB 3MOQA 1WBZA 4NN5C 3QG6A 1S7XA 3EJZC 4WI5A 1U91A 5E4IA 5GIRA 5ICYB 3RJQB 4RNRB 3GB7B 1H0DA 2X4SA 3G5ZA 5MP6L 4OZIA 2XZQH 3IJSA 1TTUA 2CDFA 1KPRB 3C5SB 1P7KB 2OK0H 4H26B 2CGRH 3SDXE 5SX5K 4ZFGH 2HFTA 2YSSA 2MJWA 3OJDB 3GI8H 4L4TD 2Z92B 3Q48A 2L7UA 1X5GA 4OCXL 2JTDA 4I3RH 3NA9L 2GCYA 1A22B 2MCG1 4OLXH 3O8XC 1NDGA 2EXWC 4JRYA 2E8YA 3C8DA 2BSSB 3MV11 5HYJD 1FORL 2DKMA 2D4DA 2FL5B 1EZVY 4F7MA 3Q0HA 1D5ZA 5D7SL 5DR5L 1FL3A 2ICWI 2BXYA 5GJSL 2AXHA 4OD3L 2I60H 5C0RL 3UPRB 3IDIA 5IWLA 1RVFL 4ORZC 4JO1L 4X99B 1FV1B 3HI5H 3S97C 1XF4A 4PG2A 5KSBE 1SMAA 1QVOB 1CICA 4U0QB 8CGTA 4U6HB 3D0VB 2FNBA 2BSRA 4HKZA 2WM0A 1D5XA 3JWOC 4KPHL 3FFCE 5HVHB 2IH3A 2DICA 4F7EB 4MLIA 3OKNB 3V8CA 1H9VA 2L4OA 3HPLA 5EOTA 3MBEB 5TF0A 1OTTC 5E2JA 3S3SA 5JW4N 5FYLD 1MPAL 5EBLA 4F7TA 1N6QL 2X09A 1GHFL 4XXCC 4TULH 1UZ8A 1ITBB 5F3HA 1J8HB 2W38A 2A6IB 5LQBH 1AI1H 1F58L 4R4ND 4ONOA 1H3XA 1JHTA 5FA3A 3TCLB 1Z9SA 2FBOJ 4FNLH 5EH1A 4JFYA 3CZFB 4LAQH 2A74B 4LCWA 4YLQT 4HKJA 5B38G 4TNWF 5CLWA 4GW1A 1XGTA 4LMQI 1F8TL 2UWEB 5DVNA 4BJLA 1DFBL 3I3EA 1F02I 1OSZA 2AXGB 1KB5H 3MA9H 1RIHH 4N8CH 4Y1AD 5E8EA 3U1SH 3EZ8A 5C70A 5I1GL 4UB0H 5EN2B 1BOYA 3U48A 1VEPA 4WCYL 2OJZH 3EDKA 2AABL 4HH9A 5DK2B 1N26A 2DQFA 1JI1A 3RY5A 5DJDB 1YQ2A 4HGKC 4P46A 2G60L 4YO0B 5DUPL 1ZK9A 5E08H 4PBVC 1I1FA 4JDZA 4KXZH 2ERJC 4GRLA 4NBYB 4RGOL 2VH5H 1QG3A 2NX5B 3TZVC 3QO0B 5I30H 3VMNA 3S35H 5JUEH 3BGFC 3QZWA 3SHSA 1TNMA 4F7PB 4APQC 4C83A 2A1WH 2FWOA 3H8NA 2BY3A 1YY8A 4OZ4B 4Z7WE 5FIEA 4JPIA 3KYMA 2VDNH 3MLSL 1I3RA 1RHHB 2EICA 4X7TB 3RWEB 1RZGB 4OTXH 1TVHA 1JGUH 1MCEA 1QFWM 1YEFL 4YHNB 5KN5B 1W72A 5E2TH 2AGJH 4G80B 3QG7L 3NCYS 1MF2L 1TLKA 5DUBA 3OKYA 5DC0A 2OTWA 3CMOL 3P9LA 5MENA 1MCBA 5DYOB 3QXVA 2VTFA 3VRLF 3KJ6L 1J7VR 4U1NA 4Z95H 5DJ8B 4U6XB 3IETB 1FGNH 5ESQB 4KZEL 5FGCE 4CN6A 2VQ1A 5C0GA 1RFDH 2XG5A 1V7ML 4S1QL 1MUJB 1UADC 4PJHB 4JFEA 5EU5B 3HAEB 5FYLH 1BWMA 1P1ZA 4GAJH 5DF0A 4Z7VA 4Y7MA 3STZB 2YD9A 1Q9KB 3BKJL 4ODUB 4KDWA 4LFHD 4LCCA 1G9NH 4G5ZL 1KPVA 1OCWL 2GEEA 3HMWL 3GSXB 5E8PA 3MV8D 4ISVB 4OQTA 4PJGE 5CCKH 4GG6A 4KUZL 1F2QA 2HN7A 4PV8A 3EYOB 2YPLA 3ARDC 4PJBF 1EFQA 5K59E 3QO1A 2OS7A 1JPSL 5D7IB 4XRCA 3TT3L 3I9GL 3W0WE 1UB5B 3GSQB 5L8JB 2AI0L 1U8MB 1JHKH 1QRNB 1JPGA 1TTFA 3ULSA 4XC1L 2HT2C 2BC4B 5M7QA 1KELH 3BFOA 3GSOA 4RA0C 2H9GA 1FNSL 2QR0A 3VXME 4B50A 1OPGL 3QUML 5C0DB 2XA3A 5H35A 3EUUA 4PGDB 3AM8C 4P2OD 5DI8A 4ZUTB 4PJCB 2ADIA 3QISA 1J1XH 2EH7H 3UBXB 3IDMA 4Y5XC 3S37H 4MNGA 5C0AB 1J05B 4Z7NE 3G6AB 2E27H 5L8LB 2Q76A 1SY6L 3PWPB 4HIXL 4QTHA 4LLAA 3CXHJ 4YHOL 1EHXA 1GOGA 4EI5D 3DTXB 4L8BA 2LV4A 4QY8A 1QSFD 1UG9A 4QOKA 3I6KB 4XPFH 4YR6B 4HPYL 4BH7B 3HC0A 2NXYD 4N0FB 4CNIA 3ZE2E 3VXRB 1G7MB 4PJ7F 3VD5A 4G42A 1D9KD 5D72H 4QEGA 3L1OH 1OSPL 2R69L 5GS0D 3R0NA 5EOCL 4KMLB 1K8IA 2R0ZL 3RJDA 4I2XA 4XVSH 3RGVC 4ELME 3RL1A 3DSFL 3PQYA 4HBQA 4XNMA 4CADA 2JK5A 4X6DB 4LSRH 3QEHB 1RIVH 3GDBA 3EYVA 4MA8H 1S5HB 2BSED 4ZXBB 2ITDA 4R7DB 5EZJA 3FAXA 5CZXD 3O9WD 3U7YH 1INEL 4I3SH 3MACL 3WDIA 5KJRL 3DARA 4Q6IA 2IGFL 1IEHA 3UYRL 3AS1A 1SMOA 4PJIE 3QUZA 4F58H 1ZA6B 4GKZA 5F6HI 1R3LA 4U1SB 4OF7A 2VB5A 3PXJA 2MOVA 4JHAH 2ED8A 3QIUD 4HWNA 3T2NL 1EUTA 4JKKA 3V4UL 5J6HB 2X4OB 2ICWJ 3QWRD 1P4IH 1AQKH 4PFEA 1U3JA 5J1AA 5F8RC 3PWNA 1A2YA 1YEJL 1Q9OA 3SDCD 5CMAB 3T0EC 2AJUL 2XQBH 4Z7UA 1UACL 5INCA 4N9GB 1DBJL 1PX3A 2NY3C 2XRAL 2Q6WA 1VFUA 1CIDA 1ZAGA 5J56B 5B3JF 1XGYL 4ZS6D 2CKBL 1IQWL 2BSTB 1IAIM 5E2UH 5FHAH 3N9GL 2GJ6D 2FX8H 1YYMH 5JW5B 1OP3K 5I75C 3OX8A 1U92B 1NGYA 4LLDB 4LNRB 1MVUA 3BSZL 4LEXL 2RAMA 2V9RA 3UO1L 5ICXA 1CXFA 43CAA 2VLKA 1I9JH 2AS5M 4MXQC 4DW2L 4LHUB 2AV7A 5ISZB 1RZJL 4UNTA 1MFAL 1JGEA 5I1JL 5AAWA 4KKAC 2BVOA 5IB4A 1QSEB 4YBLC 2YXMA 1Z3GH 3RVUD 2AEPH 5DMKB 2J6EA 3F7YB 5HSFA 4XMLL 1UWXH 2NY6C 5DJ0B 5B8CA 3OG4B 3A6BL 1AQDB 3VJ6A 4XNQB 5C6WH 5IW6B 5TDNA 4EI6B 3C2AH 1R5WA 4YZFF 2ILLA 4P5MB 5GS0H 4GQPH 1FSKB 5HHPA 2BY2A 3BPOB 4G8GB 1BD2D 4JFDD 3UXFA 5D4QA 2HFGH 3RNQA 3QQNA 2XIDA 1FYTE 2BVPA 5BMFH 3SCMC 1IKFH 1JF5A 1IGTA 3DX7B 1VACA 1NCWH 2ZUWA 4F9PC 3I02B 1JGDA 2P8MB 1EMTH 5LBSH 4FFVD 3DSNA 3QDGE 1XIWD 4MJ6A 2BMKA 4FQJL 3V52L 5CJ8A 1EERB 4E42A 4M03A 2HTKC 1DEEB 2P5EB 3FT4B 4XB8A 3JV6B 3TBTB 2IANB 3O3BB 3P73B 1YYLH 4MD5A 3SKUD 5F7NC 3T3MF 2AK4E 1Q0YH 3MMEB 1IE5A 1MCFA 1UC6A 3SOBL 5KVDH 3T65A 1WF5A 4OSUL 3QEUA 3UTOA 1IL1B 5H37H 5C2BH 3QHFH 4MLSA 2CR3A 3D9AH 5IW1A 3KWWA 4HAFA 2X4TA 5TH2B 4PRHD 1KG0B 1DDHB 1I1AD 3KPQA 3VH8A 5GRJH 5JIHA 3DV4B 4PRDA 4N8VG 1NBVH 3B9AA 3FMGL 3GMQB 2DQTL 1MRDH 1RZ7H 3LKSB 1E6JL 1L6ZA 1OF2B 3TJHD 3VFWB 1FVDB 4LLWA 1EHAA 2GKIA 1L9MA 4KDTA 1ACYL 2XQYK 2MCPH 2OQJB 1G9MH 2HLAB 3FT3A 1M4KA 1F45A 2Y4SA 4Z5RB 1PG7X 3GSNL 1HEZA 3MYJB 5EDXA 1G7QA 5F9OH 3K1KC 3KPOA 5EC1B 4U7SA 5GHWL 2J4WL 3C6SB 4ZO7A 2ADFL 5LVEA 4QXTA 5ANMA 5JOPE 4J2XA 2A0LC 4AIZA 1DQMH 4HUMB 1T3FB 4MJID 3GEWB 3TNNA 4H1LG 1O0VA 5DD0L 5I1HH 3H9SE 1QNZL 4K2UL 4CDGC 1LEKB 1WBXA 1PYWA 2FGWH 2WWKO 3BWAB 1Z6JT 1P84J 2W92A 1JUFB 5C09A 1DR9A 1PZ5B 5DD6A 2EDWA 1IM9A 5EC2A 4LSSL 2DDQH 4KK6D 4RAVB 2VDLL 3PHSA 2Y7QA 3HZYB 2E7LC 3GFUA 1INQB 1KUMA 5F89A 1B88A 2DLTA 5EU6A 5TQ2L 4DAGH 4P5TD 2DQUL 4KHXH 4BZYA 4H88H 4PV9B 4J3TA 5IK3B 1X5FA 3WN5A 1S9WA 2HP4A 1J1OH 4MWFB 3WFZA 3EJYD 4PJEF 5I6XC 2HWZL 3S98A 5J57B 1PEWA 3I6LD 3OKOA 3FB8B 2QQLH 4NQDA 4JKMA 5D7JC 1FFNA 3TA3D 1TZHA 3HE6C 5L2KE 1HDMB 4DZBA 15C8L 2CH8A 3DUUB 4UILH 1IZJA 1VEOA 2X1PA 3UJJL 3SE4C 4IIQC 3MNVB 4YGAB 2XZAH 2A77H 5ESVA 4KHTH 3VFTA 4DVBB 2CLZB 3O2VH 1CR9L 1S8DB 4ONFL 4XPHH 2ZCKH 2CLRB 2OXHA 1GC1L 3JV4B 1NC4B 3LRHA 3L9RB 4G8IA 5MERA 4E0RB 4QXGH 3CSGA 2NXZC 2YUZA 3TH2T 2C1OA 1OARH 4NC1C 4BZ1H 3FCTB 3LZFH 2R4RH 5JQ6H 4YHLL 4LSVH 4PJDE 4PRAB 1OAUL 2X1XR 5F6HJ 1RK0A 5EZIL 4XB7A 1NFDA 4WNQA 2EC8A 2OZ4L 2XA8L 5C0CA 5ACMA 1ZANH 1T1XB 3LSOB 4P23B 3ZHKA 1T7ZA 1JGLH 2Z0BA 5GGVY 3G9VA 2FZ3B 5HHOE 1BZQK 3L3GB 3PV7A 4P4KD 5AD0A 3HS0A 5E8OA 3EO9L 4LSQL 3RVTD 2ZCHH 3MCLH 5IV2B 1MAMH 2ZPKH 1T83A 2DQGL 5FO7A 1JZ2A 4LDLB 2VDOH 3SDAD 5A2IH 2ADGA 2ZJSH 3V4PL 4WW2B 1ZLUK 1XF3B 1ZHNA 1MJUH 4PJ5E 3SQOH 2C7UB 5IESL 2J8UA 4HGMA 2C3VA 3O6FA 1FZMB 2O5YL 4LVOB 1MI5A 2ZG2A 3TO4D 1QPXA 3BP4B 4DTGL 1TETL 4UTAL 1YDPB 4JREC 5E7FA 1SVCP 2WIMA 4KWUA 3HC3H 3S5LG 2DJSA 4X0KA 4NHCL 3TC9A 3K2UL 4HFWB 5E95B 5T1LA 3KPRA 5E4EB 2QSVA 5C0IB 1YECH 3RKDC 3UZVB 5DVOA 1IM3B 3ILQD 4YHYB 4PLJD 2FR4A 5GGSB 2LFGA 4G6FD 2I07B 1A3RH 1LO4H 3QEGL 3HNTL 3NFPB 2B2XL 4NJAL 4X9FA 4Q9RL 4KVCH 1JNLL 3AB0C 4JZNB 3HNSL 4MAUL 1OWWA 4TOYH 5HPMB 5ICZB 1GPOH 1LDSA 5D5ME 3U4BH 5IF0B 2YR3A 4YQXH 2IAMA 2QADB 1UJ3A 3MOAH 1MWAL 1A3LL 4AQ1B 3QRGH 4WW1B 5SWSD 4R96A 4C56D 5ITBL 1PKQB 5BQ7B 4NJ9H 3K74B 4ZYKB 4D0BA 5JHDE 3QWRA 1S9KC 2UYLB 3QDJB 2IQAB 4PRPB 4HJ0C 4WHDA 3WIFA 1QLEH 5J1TC 5KZCB 1VADA 3QUYB 5ALCH 1PLGL 4MYWB 4IRSA 5HY9B 2YK1H 2EKSB 2LAAA 3OAUH 5GSRB 1WFTA 4GRMB 4OCLC 1KBGH 1TCRB 1R0AH 4UIMB 4KQ4H 1BQHB 3OMZA 4PJ7B 4HIJB 1PQZB 2X89D 1SJHB 4R0LB 4E41A 4EIZC 2XY1A 1CD0A 3SKOA 3AY4A 5FOBB 3T2OA 5EUOF 1EXUA 3B9DA 5IG7B 5TF1H 3RIAF 4O2EB 1EAJA 4PUBL 3SGJA 4DN4H 4KK8D 4KUCD 4ZFFA 3E1F1 1T22B 4D9QD 3MRMA 1A6WH 1A6VL 4M93C 5L88L 3QIWC 2CDEA 5E00B 5C9JB 2DYPA 1ND0B 1QPPA 3GK8H 2XTJD 2EDJA 3MLZL 3QG6B 1S7XB 4N0YH 2NW3A 1U91B 1WUNT 1KGCE 2M26A 5GIRB 2AVGA 5F1NA 2R1WB 3DMMC 3H9ZA 1H0DB 3V6BR 5TPWL 2BVEA 2R0LH 4P59L 3ROLB 3F65A 4Y89A 4OZIB 1T20A 3IJSB 4GMTL 2CDFB 2WBJC 2JB5L 3BEWA 4ZAKB 1JPFB 1F2XK 4YDIL 4KC3B 4JJ5B 1YJDL 4FQIH 5D1ZA 4X8XA 5D2NE 3UTZA 5FUCE 1SHMA 1BHGA 5A2JH 1BFVL 4WY7L 2GCYB 1KLFA 4G7VH 2JIXD 3WLBA 1KXVC 4LKXA 1G6RH 4LRIA 4PJ8B 1NDGB 2D7QA 3CDYA 2DQEL 3OAZH 3X12A 1FVEA 4YHIB 5A2FA 3P0YL 4JRYB 5CGYD 4ZNCD 3QEQE 4F7MB 2Z93A 1T0NA 4LDEB 4G6AD 3VXOB 2QQNH 4MA1B 4MQ7A 3HRZB 4WUUE 3VXPA 1DL7L 4QHNB 4RWHA 3L95A 1QSZA 1AGDA 4OUUB 1K5NB 4JM2D 3SGKC 3VWKD 2CIIA 3W39B 3ZYOA 3MV7D 4NNXA 2R2HA 1JJUA 1CICB 1F90H 1C5DA 2EDFA 5HHXL 2BSRB 2EYTA 3K2MC 4AYFA 4IHOA 2IH3B 2CSPA 4OGZA 3QPQC 3ZTNL 3HPLB 5EOTB 3S36H 2P5WB 2WV3A 3WKML 4X6FA 5GRVK 5LAXB 1RY7B 4D2NA 4JRXE 5EBLB 4F7TB 1NFIA 3TVMA 5ADOL 1IT9L 4QO1A 1NGQH 1RSFA 1A0QL 2M1KA 1UZ8B 1X5ZA 5DMGD 5KSAD 2H45A 2CR6A 2FB4L 1JHTB 4WGWB 5FA3B 4Z6AT 3ZHDA 1I1AA 2N7AA 3LQZA 4I0KA 4JFYB 4LCWB 2X9YA 1NMCB 4HKJB 1BJ1J 4BSWB 3EOTH 3KJ4B 1XGTB 1KCUH 4W6XB 3CMGA 3G5VB 5BS0E 4P3WA 3Q2CA 5SWZA 2JCCB 1OSZB 4L9DA 5L9DH 1D5BB 2NR6D 4JVPA 4PJ9A 1JPTL 1OAYL 2ICWA 5F3BB 1LP9F 1DQDL 3DI3B 1MAKA 2C5DC 5GRYA 3RY4A 5LG1A 4PIRF 4HH9B 1IC5L 4P46B 3JTTA 2CPCA 4LLVA 3U9UB 4PS4L 5HYEA 1I1FB 4JDZB 3PNWA 3RUGA 5FF6A 4NBZB 1C5CL 5DFVD 5HYSB 4M5ZH 1EFXD 4MJIA 3MLVL 4FQHA 1K4DA 3CCHA 1YEGH 1I8KA 1IQDA 3PL6A 1AGBB 1E4KC 2XZCH 3QZWB 4GBXD 4WFGE 4Y2OA 4ODVL 4NQVA 4JY5L 5IROC 5I74C 4X7SH 4ZTPL 1NGXA 2FWOB 3V6OE 4N5EC 3ZKND 1YY8B 1U2HA 3D25A 4L4VA 2Y5TA 3VFUA 3KYMB 1VCAA 3FRPA 3TO2B 1I3RB 1Z0MA 2VKWA 1E6OH 1S78D 4LOUD 3R0MA 1TVHB 2X2YA 5B39G 5D7LE 5IHUL 3TIDA 1DUYB 4XPGH 5HDQL 3LEXA 4WU5A 5HHME 1CQKA 3ZKMC 4QWWC 1CL7L 2OTWB 4RISH 5DWUH 3EYSL 5TE7H 5LXGL 2X4RA 3OF6D 2JB6A 5CJOH 4WTXA 4U1NB 5IT2H 4JEGB 2QSCL 2KQNA 4YDKL 1MNUL 1CGYA 2JLLA 3MRJA 3HZMA 5C0GB 2A9MH 3C08L 2P1YA 4JB9L 4XC3H 1F4XH 1JNNH 3ULVF 3RL2B 3NZHH 2NQCA 5FEBA 1JRHH 4L5FH 5HGHA 1MELA 4WI4A 1I3VA 1NQBA 3M8OH 5F9JB 1JVKA 3WXVL 3OZ9H 5FAAA 2CK0L 2BNQE 4LCCB 4OLYH 5C0BB 3QUXC 1QFWI 1ZHKB 3TYFB 4LRNL 2IQ9H 4N90E 3NABH 2J2ZA 3IFNH 3PDOB 2MHAA 3GGWB 4QRTB 5EOQL 4X4YB 1LQSR 4WJ5A 1ZVYA 3B83A 2YPLB 3MLXH 3QCTH 3RWJA 3B9VA 3QO1B 2EYSB 4PJFB 4XRCB 4Q9CA 4YPJA 2Y6SD 1BBDH 1WTGT 1T04A 2OI9B 3ULSB 4QRQB 3EO1A 3GSOB 2H9GB 3OGCA 3MGTB 1Z5LB 5H35B 3QXDA 2EIDA 1H3GA 5IMMA 3JWNC 1BWWA 1SVZA 5M95B 4HS8H 4HG4K 3CFBB 3MLYH 3WXWH 4U49A 3RWCB 3ES6B 4G6ML 3A6CH 2DTML 2ADIB 2RB8A 3O3AB 1F4WL 4NYLB 3O3EA 4MNGB 4RFNB 4A2MA 5GGTH 1RURH 5F7MC 2DI7A 3IDXL 1QZ1A 4OFYD 4QTHB 5D8JL 3DVIA 4LCUA 5GGUA 1HHKB 2AEQL 4JDVA 4QY8B 4XNXH 4QOKB 1BVLB 3D1MC 3BN9C 5EG6C 1I7ZA 3MJ8A 2BFVH 4YXKL 1AXTL 4OI8A 2ARWA 3HMXA 1G0DA 1ZLSL 4DKDC 3O2DA 5CUSH 3TNMB 5JZ7C 4ZQKA 3TJEL 4FS0A 5T1MA 3RIAK 3TBVA 1T21B 5JHLL 1WT5C 1K8IB 4JFZH 4KKLD 4Z78B 3LHPH 2PO6C 3GHEL 4IOFC 3RTQD 4PGCB 4P48A 4NHUB 4CN1A 1IFHL 3FQTA 3RL1B 3PQYB 2PTUA 2JK5B 4L29A 4CADB 1EGJH 3K3QA 1G7IA 3EYVB 1FP5A 4YHZH 3DLQR 5JW4R 3LEYL 2ITDB 2DLHA 5GS1C 3SY0A 5T1DH 3UTSA 2RJMA 1P5VA 4EQ3A 1MIEL 2DB8A 3QNYA 2N56A 2ZKHH 2E5EA 3ARVA 4G6KH 3QUZB 2HJKA 4GKZB 5F7WC 2E3VA 4XCNB 1NBQA 3OAYH 4ZXBC 4O5LL 3R06A 2IC2A 5IUSA 1CD9B 1KPUB 4NKMA 4Q9QH 2DM7A 5IJVA 1AE6H 4KI1A 4PB9L 2V7HA 2Z91A 1CBVL 4KKCC 5J1AB 4MDIA 4QRUB 1A2YB 1Q9OB 2MSPA 4Y19E 4Z7UB 2QV2A 2FX7H 5C0FB 5INCB 3LMJH 3C5ZA 4OI9A 4M1DL 3GO1L 2XWTB 1LO5A 1YMMA 3FL7A 3FO9A 3ZE1F 5M94B 4OAWA 3V7MA 5I1LB 5F70A 1PZUB 5E2VL 1AP2A 4UOW0 4F3FA 3KPSE 1OAXH 5GRVL 4D94A 3G6JE 1KB5B 2ZUYA 2XPGB 3ARBA 3GM0A 3ARUA 4NWTH 1IGYA 1Y6KR 5E8DH 2BY1A 4LLMB 4M7LH 4KRMB 4PJXA 2EE9A 2IF7A 3L6FB 4IMLA 5ICXB 4HFUH 4OZHB 4C4KO 43CAB 4WDIA 5DTFA 2VLKB 4DN3H 5C71A 5FK9B 3W0WD 1KENL 2I9LA 4JFFA 2EH8L 1A7BA 2BVOB 5IB4B 3MLRH 3IFLL 3VG0L 3G6DL 3LRGA 3VXMD 1RJYB 5HGBA 5H94A 5FA4A 1TQCB 4YUEH 2IBBA 3VD9A 3QAZC 1VGEH 3M1BA 1DLFL 5HYQA 1UA6L 2OP4L 1FAKT 3QQ4B 1T1YB 5EPMA 2Y06H 3VJ6B 2HLFD 5TDNB 1IAII 1EHNA 1NMAH 1G7PA 1R5WB 3Q1SH 2JIXA 1FGVH 1H3PL 4A6YL 3FKUS 5I15H 2EDTA 2WIIA 1JWSB 1CGSL 1ONQA 5HYJB 4O02H 1RZKL 3RNQB 2BNRA 1IGTB 3UCRA 1YY9C 4QHLB 2P44B 4RSVA 3HE7D 2VXQL 1JMXA 4JM2A 4YWGH 3TWCL 4K23H 4JPKH 1FSKC 2FECL 4P99A 2SEBA 4R26H 3BPOC 4MJ6B 4E42B 4HKXA 2EEBA 3O8XA 4PD4J 1S9XA 1U8JA 1I8MB 1IAMA 4MD5B 5I19L 4LQFH 2CXGA 1JN6B 2FBJL 4RGND 7CGTA 1N5AA 3NFSH 1T1ZA 1A02N 3T65B 2OR8A 4MQTB 2BOBA 3QEUB 3T08A 3UC0L 2XWJB 4NNPH 1GGIH 3QHTC 3WFEH 4ZNEA 3FZUD 4X4ZA 3CPLB 2IPTH 1OAQH 3JV5A 3GIZH 3NMEA 3KLAB 5DD3L 4JN2B 2X4TB 5E8NA 3IFOA 1VSCA 3S88H 1MFBH 2F53A 4MDJB 2P7TB 4M7KH 3WUWA 1IILE 2VDKH 3VH8B 4MZ3A 4PRDB 5FDWB 1I9RL 2BK8A 5BOZG 1Y18B 3MRPB 5DJ6A 4ODWB 1GRWA 4A2LA 3RVVD 1RPQA 5L6YL 4K3DH 4LLWB 1MHCB 2BRRH 3QWOA 3CVHH 1OTSD 4LPTA 4R4FL 2EDYA 3FT3B 2HRPL 5I1EH 4KTEL 2Q3ZA 4POUB 5TFSH 1AXSA 4AEHL 1G7QB 4NC0B 4JG0H 1OGTA 1T7WA 2AKRA 4ZS7L 4FQLL 1RUQL 2G9HA 1R24A 2VXUL 4I3GA 5EORL 5F96L 2K7PA 1IGML 4UT7L 5F7YC 2K9UA 4HMDA 1DE4A 4QXTB 5ANMB 3OKKA 1RZIA 1PG7H 1U8LB 4JCMA 4UZGA 4AIZB 4DQOL 4H8WL 2R8SH 1QA9B 1T4KB 3TNNB 4HWUA