4UT7H

Crystal structure of the scfv fragment of the broadly neutralizing human antibody ede2 a11
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
146
structure length
146
Chain Sequence
VQLVESGGGLVRPGGSLRLSCAASGFSYSNHWMHWVRQAPGKGLVWVSRINSDGSTRNYADFVKGRFTISRDNAENTLYLEMNSLTADDTAVYYCVRDGVRFYYDSTGYYPDSFFKYGMDVWGQGTTVTVSSGTGGSGGGGSGGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ut7H00
2J5LB 1FYTB 2CIIB 4NN7B 1OAKH 5EA0L 3J8F7 1S5IH 3WFHB 4MA1B 3DUSB 4KKCC 5T5FL 5JQ6H 1CL7H 5EU6A 3WCYA 1TPXB 3BPCB 3ES6B 3QDGE 3D0LB 4G8IB 4HV8A 1ZTXL 4KRMB 5EC2B 1YY8A 4L4TD 2UUDH 4ZXBB 1CVRA 4U0RB 5EBWB 5DHVA 2R56L 5IESH 3JV5A 4KMQA 5I17B 4M7ZB 5KANI 4MNGA 2YC1B 4ZODA 5HGAA 5FAAA 1N0XH 1JZ6A 3O4OC 5ID1B 5HYJB 4J4PD 2YXFA 4OGAC 1RIVH 1S7RA 2VNCA 1FZJB 5IVOA 3U46A 3FKUS 2VLRA 1WK0A 2DBJA 1CLZH 4PREB 4Y2DB 1U8JB 3FQTA 5DK0A 5B21A 3E3QE 1QVOB 2KUTA 1PDKA 2DDQH 2VDML 3IS0X 5GGQH 5DFVC 1RU9L 3MODL 4N0UA 4JRXE 1KPRB 1F4HA 4S2SA 4BZYA 5H35A 3NCJL 4M1DH 4WI8A 3TP4A 1WBXA 1E27A 3ILPA 1KNOA 5EUOF 1N4XL 1WGOA 5HPOA 5HGDB 2CLRB 4WY7L 1UEMA 5SWSD 3NTCH 5HYFA 1IC1A 2RGSA 5C09A 4PG9A 4OZ4A 4K71C 4XNYL 5KAQG 2EEBA 1YDPA 2P8MA 2HT3D 4K2UL 3VH8B 1NANH 5D5MA 5F7NC 3H9SD 3HNSL 5BOZG 1K4CA 3T1FB 1JF1A 3UJJH 1S8DB 5E2TH 3Q1SL 4P23A 2A0LC 3I50H 4ZFFB 1BVLB 4OLYL 5DQDL 5I19L 1YY9C 3MV9D 3C8KA 1H3GA 2GTZB 3RTQD 2X4OB 4ZMAT 5GRZA 1QEWB 5K59F 3F8UB 3O8XC 5FGBA 1FV1B 4EIGB 2CKBH 3W81A 1KV3A 2WM0A 4JFDD 3VMPA 1ZA6B 3NH7H 5ADPL 4P9MH 4M6MH 1MH5B 5EZIH 1FZKA 3HR5B 2ICCA 4AMKH 1J0JA 4H26B 4M6AA 4FABH 4XAWL 3AM8C 3KYOA 2G2RB 3V6FA 4CAGA 4Q9QH 4MJIB 4NBXB 1AGFA 4L4VA 2AEPL 4NQEA 2N7AA 4EBQL 4MVBD 4LEOA 5IMKA 5DWUL 1ZLUK 2AJ3A 4Z0XA 1C12A 4R8WH 5I16B 2RB8A 2HJKB 1XR8B 2A6IB 2W9EH 2EKSB 4GXVH 3NCFB 3SGEI 5L7XL 1DQJB 1I1AB 4XGZB 1KB5B 3QXDA 3LEYH 3UCRA 5AZ2L 5E99L 2PTTA 5FO7B 5F8QC 1ZGLM 2FSEB 3GIVA 5BV7L 3E2HC 3PL6B 4G6AC 1JV5B 5IF0B 3RBSA 4F7EA 1NBYA 4FZEH 1J1OH 4LCYA 5EC1A 1CXLA 4GG8B 3HE6B 3RNQB 3MYJA 2GJ6D 1H5BC 1EMTH 4HPYL 1RFDH 3G6AA 3BIBX 2VXTL 2EO9A 2ADIB 1NGZB 1EO7A 1O7VA 2ZSWA 2IJ0C 4GUPB 1FSKB 5JMRA 2AW2A 2K3TA 1MLBB 1KYOK 2ICWB 3GSNH 4ODUB 5DGRA 4ELKA 4XPAL 2GW5A 3DXAA 3VFPA 5L9DH 5C0EB 5FUZL 1Z9LA 2E27H 1AD9A 2AJXL 3L3DB 5T1KD 1BVKA 2K1MA 1QRNE 1V8HA 3A0OA 3G5XA 3OMZA 3ZZ1A 4DK6A 4HKJA 5TE4L 1EAPB 3BKJH 3KPPB 4JJHA 4K3JL 1JZ4A 3OWEA 2R4SL 2EZ0C 2R2HA 3VD3A 2BOCA 2R69H 2F5AH 3CXHK 4QT5A 1QLFB 1MNUL 1P4IL 5IIEB 2HWZH 5EH1A 5DQJA 5HGBB 1HYSC 1P4LA 5FHBL 5I1JH 4LLMA 4BSJA 5C0AA 3JBG7 1T7VA 2F74B 1WT5C 2IGFH 2J8UF 3F5WB 1IBGH 2DQUL 4X98A 5LQBH 2GI7A 1T89C 3GMQB 5E7FA 1ZKAA 2NZ9D 4UINL 2ZNWA 1MQKL 4JM2A 3ARQA 1CYGA 4PP1C 3OX8A 3KLHD 1EZVY 4XC3H 3FT3B 4YHYC 2H9GB 3GO1L 2KKQA 2PCPA 2CRZA 1NDMA 3QCUH 3VRJA 4YE4L 5C6TH 1BX2B 5C0ND 3HI5H 4JFED 3U7WL 5EIQA 2HN7B 5EORH 3WNMA 2C1PB 3NZHH 1SM3L 3QQ9D 3D25A 4PJCE 5AZEL 1OP5H 1F58L 3B9VA 1U8MA 3MLRH 1MRDH 6CGTA 2EE9A 3FT2A 4LGSB 5DEZA 2G5RA 1F4XL 1WAAF 2R9HD 5DUMH 4K71B 5KZCB 2XQBL 4O58H 4JLRB 1FAKT 2HFFA 4TPRL 3DVGA 4P2RB 5H37H 2KDGA 1K5NB 1L7IH 1OAXH 4OLWH 3MBXH 3M8OL 1D5IL 3NAAL 5GRVK 3SE8L 4KKBD 5FKPB 4TQEH 3VI3E 4HFUL 2I25N 5EO1B 3U6RB 1AKJD 3B2UC 1ZLSL 2OX5A 5EWIL 4BH7B 4JZJC 4QHLA 2FX8H 4Q0XH 5F70A 4APQC 1G6RL 2X1PA 2HJLB 2DYPA 3CIQA 4GMSH 3A67H 4K07A 3FMGL 2IPKA 4JPIA 4L29A 2X10A 3O3EB 5GSRA 4NC1C 4Y1AD 4PJBA 3EDEA 4CW1B 3IAQA 4OCMC 3U4EA 5C0BA 5IT2H 4WNQB 3DVIA 4NNPL 3VXPB 1SYSB 2L0DA 5GISL 4LVEA 4KFZC 3QB7C 2Y1VA 4YHPA 3BHBB 3I02A 2YA0A 1XIWA 5JIPA 1OSPH 1SEQH 2W9LA 4DGVL 1A02N 2V7HA 4U1JA 4FFZL 2O93L 2BC4A 2NW2A 4PJFB 3OAYK 3G5VA 2ZOKB 3IFLL 2OZ4A 5HHMB 3U7AA 3VDBA 5FDYA 2WBJC 1HILA 4IOSD 1AGEB 4OQTA 1G84A 1Z5LB 4EDWH 3VW3H 1YMMA 5DJAA 5EUOB 1U8IA 5C0DA 4Z5RA 4C4KT 4KPHL 4M03A 4LHJB 2GCYB 1FBIH 4FRWA 2R4RH 2VUYA 2A6DA 1ZHKA 5L2KE 4LGRB 4NQVB 1SQ2N 3VFRB 3SJVA 1H5BB 5GRVL 1VGEH 5JOEA 1U8HA 2AEQH 3LIZL 3UAJC 3ET9F 4M1CC 4N1EA 3V0AC 4KZDH 5JPNA 5BV7C 3U7YL 5DJZA 3MRGB 1IKFL 1BFSA 2EYRA 4FXGA 1MFNA 5BVJB 3GI8L 4UNTA 1OVZA 4Z7OF 4KY1L 4JG1L 2O5YH 3SDAC 5IQ9A 5LXGL 4LU5L 15C8L 4QEGA 5IK3A 5CSGA 2OLDA 3QIUA 4HHAB 4ELME 1P1ZA 1CQYA 3C2AL 1WCBB 5A16A 2ZCLL 4MD4B 5L0QC 4NQSB 1OAZL 4N5ED 1U93A 3ZYOA 4F7TB 1HQ4B 1I8MB 3C60C 1ZT4A 3KPSD 1CFSA 2PXYC 4ZTOL 5KG9A 2DQTL 2OXGA 3EDKA 7FABH 1NGQL 4RNRB 1LO3H 1IAMA 4LVOC 4IMLA 3ZTNH 4MJ6B 1HQRA 1R3JA 1E4KA 2JCCA 1WFNA 4FZ8L 1U8LB 4WO4D 1EZVX 4Z18A 1JF5A 4HUKB 4M9PA 3TJEH 4U1SA 3L3KB 4FQHA 5HVHB 3QUMH 1IGMH 1UWEH 3WNNA 3NCYP 1X5IA 4TYUA 1U58B 2BVOB 4M00A 5ITFA 1ZT7B 1OOAA 1KTDB 3HI6H 4HIJB 4YHYB 1D5BB 3RUGA 1TJHH 3S35L 4MA7L 4HH8A 5CEZD 4NN6B 3QEUA 3DSFL 4M62H 5JDJA 3KWWB 3UYPA 1I9RH 5GRYA 1CQKA 4IDLA 5FK9B 2I60L 4S0TD 4XRCB 3AU1A 1I3RB 1UB5B 3N9GH 3OKEA 5DEGB 1H3UA 1MHCA 4J3WA 3D39E 1ED3B 1UEYA 3UPAA 4PJHA 3C87A 5CZKA 2DICA 4HC1A 4ODTL 4P4KD 4NP4L 1MOEA 2BSTA 1VFMA 3T3ME 1IAKB 3G04A 3LAFA 4PTTB 5E8OA 5K9JL 1DQTA 3L3JA 2IG2H 5BQ7B 4N0RA 3AXLB 5ID0B 2UWEE 5C08E 3IU3B 4LSUL 3WN5B 1ND0A 4HMEA 4XC1L 3KPMA 4G8GE 2OS7A 2IANE 1FNFA 4KDTA 4RGMC 1IQWL 2X70A 4JB9H 1FL6B 3C08H 5IGXL 3G5YA 5MI0B 2FBJL 3GMMA 3I84A 2E3VA 5D9SA 5C07A 2AK4B 5ERWB 1YEEL 4TNVK 2BSSA 4WGWB 1DBJH 3CGTA 3VD9A 2OTWA 3QA3B 4BUHA 1UJTA 3BVNB 4Y16A 4BH8B 3V52L 3HPLB 3WO4B 4JRYB 1BLNB 3R0NA 3TFKD 2J8UB 2YN3A 2NTFA 4ZOCA 2HFTA 4P23C 2VIRB 1NMBH 4XCCL 2Z4QB 3VXME 1FAIL 3VE0B 3QRGL 4O5LH 2Z8SA 1Q94B 2LU4A 3D18A 4OCWL 5C2BL 5C92A 3DURA 5E4IA 1GGCH 3LEVL 1QKZL 1WEJL 3BW9B 5FGBC 3QIWB 1A7QL 1D9KA 3QR2A 4PY8J 1NFKA 2HMIC 3V5KA 1U3ZA 3TH3T 2G60L 4RAUB 3OQ3B 1J18A 3O81A 5HHOA 3VWJD 1FO0A 3PV6A 1YPZF 3VXUD 5FO8B 1HHHA 4OQTL 4OD2B 4WFEE 3KYKL 3WHE1 3NFNA 1GPOL 4RRPG 4GKSB 4UNUA 3HLAA 4HPOH 3VFVA 2ZJSH 4CMHC 2DQDL 3FOMB 1HSBA 4Q97A 1KLUA 4N8CL 4AH2B 5KVDL 3H3PH 2P24A 5EZOL 2XG5A 1DQQB 4LP5A 1T0NA 4Z0BH 5MERB 1E0OB 1JNNL 4OIBA 1OP3K 1X5HA 3UMTA 4YAQB 3MOBL 4FA8A 3RZWA 5I18H 5EUKB 5T5FH 3PWLB 3T08A 4WW2A 3SDAB 2IBGA 3K8LA 1FE8L 3T1WA 4ETYA 3PWPE 5EPMB 4JHWL 4BM7A 2YBRA 2F19L 1MI5A 5EIVA 2R56H 1LEGA 3O3AB 1LDPH 3CVHB 4P2OB 5EO0B 1HE7A 1ZMYA 5JR1L 3ULVE 3C60B 5IEKB 1INDL 4BK4A 4UV7L 4XMPH 3S88H 4XTRC 2PXYB 4NQXB 3V6BR 2NY3D 1XFPA 3UZQA 3S9DB 4LVOB 1XF5B 5MEOA 4ZOAA 5JZ7C 3G6JF 2QHRH 4YXKL 4ZS6D 4XP4L 2R2BA 4MQXD 2VDMH 5EU6B 1RU9H 3MODH 4U2ZA 4PJ7F 3E1F1 4MDIB 3F7VA 1CLCA 1IZKA 5FGCB 2ITDB 3RY6A 1MFCH 1AXTH 3ULUE 1U9KA 3NCJH 5KSUB 2FIKA 2BVUA 4Y7MA 4LMQI 2J4WL 1GSMA 4OZIA 1N4XH 4OFPA 2IH1A 3F58H 4TNWF 4AQ1B 2DQIL 1OT2A 4ZUVB 4QHUA 1DFBL 1K2DB 4X6FA 1F3JA 3DVFA 3MRQB 2VZ3A 4K2UH 3ZDZE 2PNDA 1F2XK 3QEHB 3HNSH 4JM2C 5IBTL 1JGDA 1U8QA 2XN9B 3FQTB 3FQNA 5DK0B 5DMKA 1CD8A 1IKNA 1DTUA 4NT6B 3V95A 2W65B 1TETL 5I19H 1RK1B 1M6OA 5HGHA 2QL1A 4KMLB 1SBBA 4H0IA 5H35B 3MLVH 4PJXA 3O11B 4RGMB 5HDBF 2ED9A 4U2YA 5D4QA 1J0HA 1WBXB 3EYSL 1E27B 3WEXA 5ADPH 2VN4A 4Z8FL 5B8CA 5E5RB 3K8MA 4HLJA 1CFTA 1DBBL 1KF9B 3IDJA 3MUGB 5ESQB 4JHBA 4OV5A 4OZ4B 3U83A 3MNWB 4XAWH 4EVNA 2X9YA 4PYGA 2P8MB 5C0CE 3OKKA 5EOCJ 4BK5A 2P5EA 2YPLA 1A7BA 5D5MB 4OFDA 1K4CB 5DD0H 5C0IB 4P5MA 4R4BA 1JF1B 5D7LE 2AEPH 3HZKA 4EBQH 3ULSA 5IVXE 1GVIA 1QSFA 5CD5C 4ZUTA 2PKDA 1MCSA 1C1EL 1IEBB 3FQWB 3BN3B 1D7FA 2DQGH 3OV6A 1WICA 2I24N 5JMOC 5HSFA 5FYJD 2VZ1A 3JZ7A 3KPTA 5H94A 5J13B 4LIQH 5JW5B 1GOHA 5L7XH 3LH2L 4JDVA 3KXFD 1CFVL 1MRFL 5IEHA 1FZKB 2V2WA 5AZ2H 4NIKB 5F7DB 5ABDE 4BFBD 3SCMD 5BV7H 5KSBF 1QRKA 4UBDC 3VFWA 3N1GC 4LCWD 2P7TB 1QA9A 1EBAA 3KYOB 5EU4A 2XA8L 3V6FB 2X4NA 3VMOA 3PDDA 4HS3A 4HPYH 4OLXH 4YIQB 1AO7E 3TWCL 1AGFB 4CMHB 2VXTH 1HSAB 1WLHA 2C5DC 4U4BA 1Z2KA 3OJ2C 4KTDL 4JFOA 4LEOB 3SEPA 5IB3A 2AJ3B 1SJEB 2EYSA 1C12B 5T3XL 4MNQA 3Q5OA 4FFWC 3O9WB 3F6LA 1UKQA 2I9LA 3EYFB 5CWSB 1MHEA 4NUJA 3L3GA 5M7QA 4XPAH 2LQRA 5IR1A 5FUZH 2QQKH 5LJYH 1A6VL 3O6ML 3HE7D 4XCFL 3GSQB 3TO2B 4QRUA 4PRBA 2AJXH 2PTTB 4FTVD 4OB5L 3GIVB 3FN0L 3ARFB 3CJJA 2CLZB 2H32A 4OZGF 4QHMB 4QRRE 1UGNA 1G9MC 5TE4H 4LCYB 4JFFD 1X5KA 3CFDA 3QI9B 4K3JH 2WUBL 3MYJB 2R4SH 3EYVB 2GAZB 4KVCL 3G6AB 5DHVH 4YNYA 3CDFA 1MNUH 1HHKA 1P4IH 3OB0K 3ZYZA 5CD3A 3VFUA 2VDKL 5FHBH 5T1MA 2B4CH 2WIMA 4HAGA 1BVZA 2DQUH 4CADB 2ZP0T 4XNUL 5FYKU 3MQIA 4I77L 3QDJD 4ELKB 3NFSL 4UINH 3DXAB 1MQKH 4S1DC 1YNKL 5INDB 3EOAA 3QIUC 3UYRL 3PWJA 3D2UB 3OJVC 3GO1H 4RBPK 4KRPC 1MCWM 3C5SA 5DQ9A 3GI9L 1YPZB 4HKJB 4YE4H 5CILL 8FABA 1JZ8A 9CGTA 3RVVD 3U7WH 3QG7L 4PRIE 2H3NB 2Z31A 1SM3H 5AZEH 3BMVA 3UPCA 1JMXA 2D9CA 1FNAA 4QT5B 1NMAH 3EHBC 5DQJB 4G6FB 1E4KC 1F4XH 4E41E 4XI5C 1QSEA 2XQBH 5K9QG 5IVNA 4H8WL 3V4UL 4TPRH 4KQ4H 3HG1A 4LCUA 3HZMB 5DYOA 3M8OH 1H3XA 4LSTL 1JI2A 2EDRA 4QRSA 1YEHL 1D5IH 3NAAH 4JM2B 3SE8H 5HGGS 1KJ2L 1T66C 1FFQA 1QFWH 2VLKB 3MLXL 3HNTL 2MOVA 1ZLSH 5EWIH 1T1ZB 5FECA 1HINL 2PCPB 5DUBA 3DYMA 4WCYL 3GKZA 1G6RH 1T1WB 2P5WA 1BWMA 5D1XA 3VRJB 4GXUN 1A0QL 3FFCD 4R4NC 5IBLC 3OF6A 5D7JA 4IOFC 4YBLB 3MV01 3D25B 1WWCA 4RIRB 2WLYA 5D6CA 3RHWF 1JGLL 5MHSE 3DYPA 1F3RB 3K4DA 4BFEA 4CMMB 4XWOC 5GISH 1JP5A 5E2UL 5E8PA 1VPOL 3DWTA 1MF2L 1MWAA 3VFMA 3T65B 3PJSA 4KHTL 4XPHL 3LZFL 2GFBA 1D6VH 3L7EA 5D2LB 4ZNEE 1F6AA 4HWZA 4DGVH 1H9VA 3CU1A 4R97C 4WI9A 4KDTC 1GOGA 4QHLB 5B3NA 4JR9L 3KDMA 1A7NL 2DAVA 1U3HB 3QPXL 4MXVF 5I66A 5D2NA 4D0CB 1WSST 5HI5D 4XNQA 3K80A 1BF8A 3DX7B 3N0PB 4JPIB 2DQCL 2FR4A 3AAZA 2ARJQ 4CN1A 1CG9B 5GSRB 4X7CC 4N0FA 1RHFA 5HYSB 1A21A 3MRCA 4PJBB 1AGBA 5KSAB 4Y16C 5IW1A 3GM8A 1OQOA 1U8KB 4OM0L 3U4EB 5D7IA 3PDOA 2A6KA 1IVLA 2VLJB 1J5OL 1RUML 1F8TH 4XHQA 3X14A 1EHLL 3HCVB 4U6HA 2Z8WC 3QSKB 3I02B 1DZBA 3AMLA 1IC5H 1B2WL 3LIZH 3K4AA 4OCSL 1CD0A 1FC2D 2FZ3A 2V7HB 1HI6A 4KI5F 5JTWA 2BC4B 1D9KC 3U82B 2NW2B 3KJ4C 4XVTL 3U7YH 3G5VB 3VFTB 1IKFH 1GGUA 3GI8H 1XF3A 3QUYB 5E9DB 3FO2B 1HILB 1P2CB 5LXGH 1KCVL 4LU5H 5H37G 15C8H 3C8HA 3HUJF 4LPCA 1L6ZA 1FYTE 3GKWH 4XBGA 4A6YH 1X6NA 5HHPB 3QDHA 1FZMA 2GK0A 3C2AH 3O2DA 2X7LA 2GYSA 2ZCLH 3MACL 3LQZB 1OAZH 1HH9A 1ZK9A 2GEEA 4OZHF 1ZHKB 5F6IB 3H7LA 1LE9A 1II4E 3MV8A 4JPWH 5C71A 4GBXA 2ZUQC 3SJVB 3TN0D 5J3HD 1SVCP 3GSVB 1TLKA 1XH3A 4ZTOH 1YEIL 1N3NA 2X05A 3Q0HA 1NGQH 1U8HB 1ZV5A 2P47B 3ZDXE 1R3KA 4R26L 4RMSA 4GXUM 1KJVA 5DZNA 1S7VA 5HYJE 4WDIA 4JFQA 3OKYA 2NY5C 2EYRB 4FXGB 3GEWB 3SY0B 5IV2B 3BT2L 4UU9A 1A9BA 3MXVL 4WW2C 1MCFA 4YFEA 2QV2A 4LDLB 1BOYA 4PY8I 3MROA 3LS4L 3QIUB 4ZXBD 3QWOA 1R5VA 3LOWA 2Z92B 1IM9A 5KSBB 1EJOL 2VUOA 5B38G 3H8NA 5TE6H 1Z9MA 2MMXA 1KPVA 2OQJB 5ALCL 2VDQL 1ZT4B 4GKZA 5DZOA 3E0GA 4MXWL 4QXTA 4D9RE 4M4RA 3RKDC 3RVWC 3D69B 2DQJL 4IMLB 3JTSA 4OI8A 1HQRB 4PJEF 1VERA 3M17A 4L4TA 2Z93A 1EH9A 4WFHD 3OKLB 5GJSH 1H8OA 3E6FA 5BZWA 2BZDA 5K9JH 1NUDA 2BVPA 3X11B 3CFIC 4X4XA 5E95B 3PQYD 3PUCA 4F7PB 1OAQH 3AC0A 4LSUH 5ITFB 4NJAL 3RY6C 2MPAH 1WZMA 4XC1H 4QNPF 4J4PA 2MWCA 1IQWH 3BE1L 3T2PA 3VA2C 5IGXH 1KCSL 4KAQL 4HG4J 4HJ0D 3TT3L 3QDGA 1BIIA 1I85A 1YEEH 4NM8H 3BPNB 2W0KA 4DW2L 1K85A 1A8JH 3WIHL 5F7KC 1S7SB 1FIGL 2BSTB 4HFWB 1JPFA 4XPBH 3T4YB 4RZCA 1FHGA 5DEFA 3GSOB 3HI1B 4S1QL 5E8OB 1IKNC 5TH2A 4ZS7L 4XCCH 1GIGL 3L3JB 4X6DF 1FAIH 2VL5B 3D3VB 1W2KT 4ODVL 5C2BH 1JIBA 4MJIE 3RVTC 1NUFA 1OSZA 2DLTA 1A1NA 1ND0B 3KPMB 3LEVH 4F57L 3BP4A 2EDBA 2ERJC 2X70B 2E7MA 1XAUA 2UV3A 4GFTB 4OTXL 3G5YB 3V79C 3GMMB 2FJFA 4EDXA 1UVQA 2G60H 2AP2A 4JRXA 1C5DA 5C07B 1KJ3L 2D31A 5B8CC 5HI4D 4NNXA 4N9GA 1CXHA 4V1DD 1ZHBA 4ZFGH 3CC5B 1KB9K 2B5IB 2CD0A 3MV9A 5AAWA 4Y16B 2IADB 2FEDD 3RTQA 4UTAL 2NYYC 4CJ0A 1GH7A 5CGYD 4HIHB 3WBDA 5IB4A 4DZ8A 1GPOH 1N5YH 2NY7L 4JFDA 2NTFB 2B8OT 2DQDH 3P11L 4MLIA 2VKWA 3T77B 3NACL 5EZOH 1S7XA 2VYRE 5BW7A 4UMGA 2R2CA 4ORZC 4MS8D 4MD5A 1JNNH 4WTXA 5I0DA 4HJGA 1AP2A 3FTGB 1BPVA 4PGBA 3REWB 4CVZB 4ZO8A 3IVKA 1K8IA 4IDJL 4YFDB 3HC4L 2I26N 1YECL 1BQHG 1MCDA 1FE8H 1FO0B 2BY3A 1AXSA 3PV6B 2HP4A 5F1OB 1ADQL 4G7YL 3UJIL 2F19H 2YPVL 3QRFM 5JHDD 3HE6D 1SBSL 2W0LA 2GHWB 3DJ9A 1AQDA 5JR1H 3NFNB 2EXYC 3LVEA 5E00B 4UV7H 1T7YA 3O2DL 4R9HA 3WSQL 3QHFL 2F58L 1OTTD 4YDVB 1MVUA 2P24B 2AKRB 3SKNB 1UXWA 3FHAA 1NDGA 1JVKA 3MLSL 4RX4D 5MEND 5JDSA 4G43B 1CVSC 1U3JA 4P4RA 4XP4H 2AEWA 5IB5A 3E6HB 2EDQA 4DQOH 3QJFB 3RWEA 1LILA 4NN5C 1AR2A 2PYEB 5MP6L 1G7MA 3S96A 3GMOB 5JORB 4S0SD 4I9WE 3OXRB 3ESUF 3VG9C 1MI5B 4I0PA 1XCTA 4JANB 1PD6A 1GZQB 2XKNA 5I71B 3GK8L 2J4WH 5ADOH 2HT2D 5DK2A 1W72B 5B39G 3CLFL 5TDNA 5JXED 5FOBA 2DQIH 4M3JA 4YZFF 2FNBA 2B1AL 3CFCL 4POZD 4G7VL 4L3ED 3UTQA 1JGEB 3ARED 5T1KA 1DFBH 3CFJB 3KJ6L 4LLQA 3QUZA 1OP3H 4JPVL 1XGUB 5GHWH 1B4RA 1T7XA 5IBTH 3P4MA 4FXKA 2R2BB 5I1AA 4P2RE 3MUJA 1WF5A 1TETH 3F7VB 3CSBA 3HUJB 2RHEA 1G0XA 4DAGL 3DOSA 4DTGL 1S7UA 1OY3B 3HTLX 5DMJB 4M7LL 2Z31C 4GAGL 3GSWA 5DJYB 2HFGL 5DMGC 3BGMB 5BMFL 3L7FA 3L5HA 4Z8FH 4OZIB 1NPUA 4O2EA 1QRNA 3TO4A 3JV4A 5DJ8A 5HHXL 4GMTL 4XBPA 2X4QB 5JW4R 4X6FB 4X9BA 1WFUA 3BIKA 4G9DB 4KH2A 4P2RD 5A2LH 1OTUD 4JFEA 5ITBL 4PBWD 4PRPB 3FQNB 4O2FA 2XKUA 4N5UA 1MHPH 5KBNC 1WVZA 5BO1L 2D4FA 4LCCA 4PJGF 1BJ8A 4NRXA 5JPMA 4PFEA 5D1XC 2AS5M 2APFA 2NPLX 3QXUA 3WKMH 1NFIA 1E4WL 4X6CF 4PJFE 5ACMA 5D7JC 3RWDB 3LH2H 1NGWA 4KGLA 1OGAD 1CFVH 1MRFH 3BEVA 5FM5O 2DF3A 2Y7QA 5HHME 4MWFB 3VXOB 5I8EB 1KCRL 5DD6B 4UIMA 4X9IA 4RWHA 1DSFL 2OL3A 1TQCC 5EUOE 5AD0A 2NLJA 3P9MA 4PJEB 2XA8H 4LVHC 3TCXA 3BKYL 1KIUA 3OKKB 4PJCA 1A2YB 3TVMD 1JWUB 3TWCH 1ZHLA 1CWVA 4U6TA 1IMHC 3RNKB 4R6UA 1FYHB 2ESVB 4ZUTB 1BBJB 4KK8C 1U8OA 3R1GH 3U79A 3C09B 4BYHA 1A6TA 2FBOJ 5EBLA 5D2NC 3VXQA 3O2VL 5FUCC 4Q6YA 5H94B 3X13B 1PKOA 2NX5D 3WDIA 1A6VH 5K59E 3MFFA 1E28A 3O6MH 4XCFH 1BQHB 2OI9C 4Y5VA 3LKPA 4H1LH 2XRAL 4OB5H 4GLRI 4Q2ZA 3I6KB 5JUEH 3RWGA 4KROC 5JXAH 4L8SA 2G75B 2WUBH 2X4NB 5DA0B 4HS3B 1U2HA 4GH7B 4JQVA 4X0KB 4WWID 3BPLC 5F3BA 4KVCH 3WNKA 1OB1B 1KT2A 4X6DB 1JWMB 5I1CH 1G9NL 2AXJA 2Z8VC 3ARPA 2DJSA 1OL0A 4AYFA 1SHMA 4LF3B 1WIPA 1ZXQA 3HZYB 1MHEB 4I77H 2FJHA 4NUJB 3NFSH 4TVPE 1YNKH 4FFYL 1KPUA 4J6RL 4PJDF 1B88A 1RUKL 3UYRH 4RA3A 1KXTB 4QRUB 4OBRA 5FM8A 4Q74A 4YFLF 1IGIH 3WFBL 4W81A 1RJLB 4AZ8A 3GI9H 4Y4HB 4O51A 3GJFK 3QFJB 5CILH 3FONA 3BN9D 4XZUA 3QG7H 2OR9L 5IB1A 4GBXC 4MDJB 2ARJB 3HS0A 1OAUL 1T5XA 5B39B 4ODSL 1SVZA 1HHKB 1WZLA 2CK0L 1FL5A 5EULV 4QRPB 2Y23A 3TBYA 5IHLB 3MO1B 3JV6B 5D71L 3BZFB 4XX1E 4H8WH 1MCLA 3V4UH 1S9XA 2C4XA 1HH6B 4IJ3C 5ISZB 2V5YA 1HZHL 2DIJA 2YMXL 4YHZH 4B5EA 3ECBB 4YHNB 4C54A 4NQDD 1XGPA 1ZS8A 1RZJH 3KPSA 4XXDA 1C16A 1KJ2H 4Z95L 4K23L 4KRLB 3MLXH 3HNTH 1WZKA 4J3OC 3T09A 2APXA 1M05A 2EH7L 4HEPG 1KCUH 3EO9L 4FQQA 2QADB 4WCYH 3WXVL 1I4FA 8FABB 1A0QH 3T0ED 2LTQC 3OR6B 3G5ZB 4G3YL 1S9VA 2Z31B 3V4VL 3IJYA 1FP5A 1MEXL 4ELMA 3O4LB 4ETQB 4I3RH 4JHAH 3OB0H 1J8KA 2AK4E 2NXZC 3L5WA 5DTFA 2A9ML 1R6VA 1PG7X 1R3LA 4G6JH 5DT1L 4D9QE 5DYOB 4KHTH 4XPHH 3W11C 1QFUL 3LZFH 4JRYE 2J8UE 3PGCA 2LE9A 4XMLL 2NR6C 5GXBB 1ORSA 2Q76A 5DR5L 5GJTL 1X6LA 4U6XB 2YD7A 4J4PC 4RBPH 3TF7C 2JKXA 1YYMH 2AXGB 3DVNA 3KPOB 3MUZ1 4PBVC 4HIEA 4JR9H 3ARWA 1A7NH 5FYJH 3G08B 5D1XB 5CIPA 1I85C 4HXAL 1QNZL 5D7JB 3MCLL 4M6OL 1AQKL 1FVEB 2DQCH 2VITB 4Q9RH 4DVRL 1S7WA 3SE3A 1WWWX 4HS6B 2R23A 4OM0H 1T0MB 2QEJA 3VXSD 1V3MA 3ZE0E 1RUMH 1W8OA 3KPLB 5E8PB 5GS0D 1MWAB 5FKAA 1RZIA 1QFOA 3PJSB 3D39A 1QYGL 2FX7H 2OL3L 2ICWJ 4XP6L 4OCSH 3QP3A 4GRWH 1F11A 1KN2L 2X44D 4N9OB 4X8JA 4AIXA 4PJ5D 1KOAA 3RL1B 4XVTH 3E3QC 3CUPA 2HT3C 4J7RA 4WTZG 5J6GA 3TNMB 4QRQB 5D2NB 1N64L 2VQ1A 1KCVH 2NTSP 2EC9T 4YDKL 5C08A 1GAFL 2EDWA 3U9PH 5TQ2L 1NCAL 2IANA 1CIDA 3MRCB 3MACH 4X6BA 3PF2A 3SOBL 5IW1B 3RTQC 1FVCB 2X1OA 4QHNA 5D7IB 3PDOB 2A6KB 4F15B 2BNRB 1LEKA 4P3CL 3OL2A 3X14B 3C6LA 3MGTA 2I5YH 1YEIH 5JA8B 3ARGB 2H32H 3MLUL 5DC9B 4LEXL 2ZG3A 1XF1A 4R26H 4KJQD 4I4WB 4R2GD 3W39B 1OGTA 2NXYC 5BW7C 3MNVA 5CHNA 2FZ3B 4XHJD 3DLQR 3AS2A 3IDMA 1KGCD 3IDXL 4ZDHB 3VXUA 3F7PC 2NY2D 4PJGB 1CE6B 5I1LA 1XF3B 5I6XB 3MXVH 4JCMA 5ICZB 3VXRB 1O5DT 2OJEA 1RZGA 5C0RL 2D7NA 1MCBA 3RKPA 4MVBC 3LS4H 4XBGB 3HNVH 2GK0B 4TVSa 3FO1A 5EU6E 2Y72A 3BZ4B 4TTDD 1ZVSA 3IDNB 1NC4A 5FGCE 3GMRB 4P2OD 3BXNA 4DKDC 2XZCL 3BO8B 5ALCH 4JO1L 1CLOH 4A2LA 3C6SA 4LPXA 4KJWD 2Q8BL 4MXWH 1TFHA 2EIZA 1CGWA 1T20A 2SEBB 5EOCL 3BISA 3OPZL 3P30L 3ZLQC 1DBMH 1R3KB 1OD7A 2DQJH 5E2JA 1LEIA 2GITB 3S36X 5ANMB 2Y06H 3NIGE 5D8JL 3NOIA 1TITA 2ICEB 4OFYD 5IHBA 3NZ8A 2Z35B 2VLME 2XTJE 1A9BB 3QQNA 2IQAA 4J8RA 4LP4A 1RZKL 4NJAH 3L3OA 2XN9E 3T2NL 5I73C 1SJVA 1L0QA 3QWOB 3FN3A 2NY6D 4I0PC 1V3KA 1IM9B 1CR9L 1OLLA 1A6ZB 2B39A 2YKLL 4PLJC 3WDHA 2ARWA 2BVQA 2LTQB 4MCZB 3TT3H 3EO0A 1BFVL 3PWPA 1UXSB 3UPRB 1JN6A 2VDOL 3IRPX 4LLUA 3F7RA 5TDPA 3PIQA 3WFEH 3RZCD 4DW2H 3JTSB 2BRRL 3WIHH 1KULA 1FIGH 3QUZC 4L4TB 2JJWA 1MFEL 3P0VH 2XTJD 3SKJL 1F4YL 4E0RA 43C9B 1ETZB 2ZOLB 4S1QH 5BZWB 4I13B 2XN9D 4UDUA 5SX5K 4IRSA 1GIGH 4TUKL 3DUUA 5D5ME 4N68A 4ODVH 2IAMA 1FJ1A 4PJDB 4WWKD 3KYNB 5KW9H 2VAAA 4MQTB 4F57H 4M4PA 3M07A 4X99B 5F7UA 1XF2A 1PZ5B 4OTXH 4XPFL 5EG6C 3FCTA 2NZ9C 1IEAB 1KJ3H 4W4NA 3V0VB 4RGND 3TO4C 3TBWA 4N0YL 4ZUUA 1XZ0B 4OCYL 3EKCA 2R1YB 3KVQA 4JDTL 2YWZA 5ETUA 5F7WC 1JPFB 2HTLD 2NY7H 5DEFB 5T1LD 2FLBT 2QBWA 3P11H 5LCVL 3PDGA 3NACH 5IMOB 1GXEA 1OSZB 1B90A 4LCCC 4X6EA 5SWSB 5CFHA 4OGYL 2WANA 2NMSA 5F7FA 2P1YA 3H7BA 4N1CA 4EDXB 4JO2L 3H9SB 4P48A 5D1ZA 1DUZB 2I9TA 2D31B 1ZE3C 3MRRA 5ALBL 2GSGA 5DC0A 1UH4A 4P3WA 1ADQH 3MV9B 3GJEB 4G7YH 3UJIH 2YPVH 1KLGB 3VWKD 5IFAL 3RTQB 1SBSH 3MMEA 5GZOD 2GTWB 5IB4B 4DZ8B 4N8VA 4C56D 5E8EB 3QHZL 4JFDB 3L6FA 1WCQA 3O2DH 4TNVF 2IBBA 3WSQH 3KXFA 3QHFH 2F58H 2F54E 3UROR 1LMKA 1XR9B 4F3FB 1P7KB 3STZA 4L9LA 4U6YA 1T3FB 1S7XB 2YD8A 3ARZA 3X12A 5C0CA 4P57A 4MD5B 4ZSOB 2N1KA 3TBVA 3KPRB 5C0FA 5D7LA 1RULL 3IVKB 4PIRF 5IVXA 4PLOB 4YK4B 3P3YA 4XVJL 4MD0B 5E8NA 4JQXA 4OM1L 4Y5VC 3ZHLA 5MP6H 2GJJA 1IGJB 3DXAE 1AXSB 3MNZB 1KCLA 4JG0L 3VXTB 2Z91B 3ARFD 4M5ZH 3TPUA 3P4LA 1YQ2A 4L8SC 1CICD 1TJIL 1MCJA 3FB6B 3GK8H 2F54D 4JQVC 1MJJA 1YPZE 5SV3A 4U1LA 2VLLA 4OCRL 3CLFH 1F90L 2GSIA 3ARBD 1RIHH 3CFCH 2B1AH 3HE7A 4UT9L 5JIIA 3NCBB 2C3XA 1IGCL 1RJYA 4ONHB 5HDQH 1CFQA 1NDGB 4JPVH 3QNZA 4U1IB 1AO7A 4HDIA 4JFXB 5BS0D 1JHLL 1MCWW 4NO2A 1DQDH 1EXUA 1ZVYA 2GJ6B 4HS8L 1KTLA 1UT9A 4NKIL 3D2UD 4LKCA 1LO4L 4KKLC 5C0JB 4PTUB 4PY7B 2VLKE 1XCTB 4PJAF 2YPKB 4GAGH 3HPJA 2BCKA 2XKNB 4K7PY 3I6LE 3CVIL 5BMFH 5DK2B 3H42H 4GW5A 4O2CB 1BFOA 1HHJA 2RCSL 5DD5L 2A6JA 5FYKD 4GQ9H 3LKNB 5FOBB 3PWVB 4X7SL 4QRRA 1FZOB 5DI8B 4JM4L 5T1KB 4A6YB 4UQ2A 2EDLA 4FMKA 4X5WA 2FD6L 3K2MC 3TYGL 4WUUD 5CCKH 2LAAA 4PRDB 1IQDB 5I1DB 5ITBH 1KG0B 3P4MB 5LGHL 1NSNL 5I1AB 5IKCA 1AFVH 3L3IB 3QT2A 3ULVL 1VFUA 3WL9B 1MIML 1JZ7A 4UUJA 1S7UB 5D2LE 5SWZD 3FB7A 1G6VK 2V17H 4O02L 1MY5A 4FQJL 4B41A 1ZWIA 3A6BL 1TZHA 5FDWA 2HTKD 5HD8D 4XCNA 3L7FB 4ZO6A 4PD4J 2RFXA 1R5IB 2F53D 4RAVA 3FQRA 4UTBL 3S97C 3IGAB 1DSFH 3VJ6A 2YSSA 2R0KL 2VERN 5DRNA 3T3PF 4FQ1L 3DRQB 4PJBE 3BQUA 4JFEB 3ULUL 2XPGB 4PRAB 3FFCA 2VLJE 4QTHB 2ILLA 4F37K 1IT9L 2AABL 2FX9L 3GMLA 4E41A 1MIEL 4M8QB 5HHVL 4LCCB 3FRPG 3RWJB 2V5TA 5HVFB 3WV0A 4HMDA 1NAKH 1TZIA 2JB6A 1U3HD 3L5JA 5DD1L 1AR1D 3MRNA 5T33L 4FQXD 2HRLA 3VGHA 1NGWB 3QO1B 3HB3D 3CFEA 4NZTL 5CSZA 2E6QA 3BEVB 2Y7QB 4YO0B 1URLA 5E9DE 2W38A 4NKOA 5HDBE 4MJ4A 4IHOA 3SE3C 3ARVA 4UIMB 1AKJB 1NGXA 4LLDB 5AD0B 3PHOA 5BZDB 3P9MB 2BOBA 1VADB 2N7BA 2XG4A 4HK3N 4NOBA 3O3DB 3CSYB 2P49B 2O26U 3VFSB 3K8KA 1MPAH 1N7ML 4PS4L 2X4SB 3SJVE 3Q2CA 2ZG2A 4HKZA 4E42B 2VZVA 1G9NH 1JTPA 3WJJA 4Y1AB 1OD9A 2H2SD 4CBPA 5JW4M 2HAZA 1PG7L 2CDEA 3M45A 3U30C 1CCZA 4JY4B 3I6GA 3VXQB 3VGAB 5E9DD 1T04B 2MHAA 5F89B 1XCQA 1JK8A 3O2WL 3DX8A 4ZNEA 3BKCL 4DZBB 3S34H 4OUUA 1RUKH 4JFPA 4X7EC 3QCTL 3HMWL 3RDTD 3LV3B 4Y5VB 4OD1L 5CJQL 5J1TC 1A3QA 5KOMC 4Q2ZB 3WFBH 4XPTL 2VR4A 2JB5L 3CZFA 3Q3GA 3RWGB 1NGYB 1CFNA 4M43H 4L8SB 3RJDA 2OR9H 5CEYB 2VABB 3C6LC 1OAUH 5I8OL 5KSBE 2AXFA 4L3AA 3HAEA 1NEZA 4D8PB 2VDNL 2AI0L 4LVNC 3O0RL 1KT2B 4FNLL 2VDLL 3DGGB 1TQBC 3LMJH 2CK0H 5F9OL 1HKLH 4JDZA 1DANU 5CZXD 4H25A 3MC0A 2D0GA 1K4DA 5ELIA 5D71H 1FGNL 3PGFL 2BHYA 3C5ZD 5FHAL 3LS5L 4LLVB 1E6JL 1HZHH 1WBZA 2YMXH 2FJHB 5D96C 1U95B 2IALB 1KSRA 3SKUD 4OI7A 1KPUB 3CCHA 4Z95H 4D94A 1ZT1A 2DD8L 4NWUL 4ZYKA 1ES0B 3Q5YA 1CFBA 4K7PX 1M71B 4WW1A 1BZ7A 1XGYL 4R0LA 2MQ3A 4WI5A 3VD5A 1CT8A 3EO9H 3WXVH 2A73A 4XZUB 3MJ7A 4G3YH 4P46D 1FYTA 2CIIA 5ICXB 1MEXH 1H3WM 5FUOL 1NCTA 1H3TA 5DVOA 1A1OB 3BPCA 4G8IA 1RMFL 5JLZB 4WEUD 3OBAA 4NO0D 1FL5B 3RAJH 4ZXBA 1NAML 5DFTA 3TBYB 2IFGA 5EBWA 4QWWC 4H1LG 1QPXA 1L0YA 3UC0H 5DT1H 3S4SG 2ED8A 1QFUH 3NPSC 1KEML 5B4MD 1T22B 3KPSB 4XXDB 1JBJA 2YC1A 1JRHL 5DR5H 5GJTH 5ID1A 5HYJA 4PJXF 1TNMA 2X89D 1QLEL 1X5XA 3D3VE 1NEUA 4FQQB 3EYUH 1FZJA 1CU4L 2H8PB 4TULL 5ILTL 4WO4B 1OAYL 4HXAH 2B20A 4PREA 5GGTA 4K3HA 1U8JA 3IJYB 3TEUA 2KQMA 3JVGA 4M6OH 4UAOC 1CK0H 1AQKH 1QVOA 3BIAX 3MCKB 1JPGA 2M8XA 1YZZA 4DVRH 4CKVX 1KPRA 5C07E 1A3LL 1I7RB 5CINL 3VFOB 1O0VA 3MRDA 4YXLL 3C5JA 3HKFA 1CZ8L 3ULVC 4YHOL 3QUXD 2FGWH 3EDJA 2MKLC 3MGOB 5I74B 1R3LB 2NQCA 4OGZA 5IROA 4IRSC 3ZSSA 1HNFA 5F9WB 2QR0B 1QYGH 3BP6A 5BXFA 2ZUWA 5GGSA 3BH8B 3PGCB 2IAMC 4XP6H 5HGDA 2CLRA 1MAML 2R0ZH 1MRCL 4FG6D 3S36L 2Q76B 1KN2H 5GPRA 2Q8AL 2NY4D 3A6CL 2DBLL 4OLVL 3SO3B 4P4KB 1U91A 4HIEB 2QQLH 4K94L 3VH8A 4Y5YB 1N64H 2V9TA 2IC2A 2QSVA 3RPIB 4YDKH 1GAFH 3BKMH 3NABH 1MLCB 1S8DA 5CSBA 1UYWL 1DBKL 3MV7D 1NCAH 4S1RH 2D0HA 4GRWF 1PQZB 4V2CB 35C8L 3SOBH 5I1KL 2R23B 1CN4A 4MQ7B 4R7DB 3MZGB 1QEWA 2K7PA 4H20H 1B6UA 4ZD3L 1FV1A 4P3CH 4RWYL 4EI5D 3RGVB 1ZA6A 5FKAB 1X5LA 3SDDD 1J8HD 1G7JB 1DUYB 2WW8A 4LEXH 1J87A 4BKLB 1OCWH 2V5MA 4V1DA 1G7QA 3HR5A 1PLGH 3UZVB 5KTEL 4X8JB 3IDXH 2JK5A 3BAEH 2F5BL 1J0KA 1I8LA 2XT1B 3GMPB 4PP2B 3UTSD 1T2JA 4OCNC 3U30B 3SQOL 5I0ZA 4JQIL 4I3SH 4X9HA 4P59L 5D1ZC 4MJIA 1GZPA 5C0RH 4HUUB 3FO9B 2I27N 4GW1B 3EYQC 2FWOB 2PYEE 5I2IA 2W1NA 3QXVA 5I16A 3TM6A 1KC5L 1XR8A 4Z7VA 2A6IA 2XZCH 2XZQL 1LEKB 1Z3GL 4HUMB 4JO1H 2EKSA 2Q8BH 1MI5E 3FRUA 3MGTB 1FVDB 1CDGA 5EOCH 3OPZH 3P30H 4IOIB 4QF1A 1I1AA 4L9LC 3VWJB 4LVNB 3RVXD 2DQHL 3MZTA 1TQBB 4EUPA 2FSEA 2Q3ZA 3OHXB 3PL6A 5JIHA 3VXUB 5D8JH 1DBAL 5IF0A 1E4JA 1NMCC 4MAUH 3BWAB 5D1QD 4X4YB 4NNYB 3HE6A 1JHTB 2HRPH 3UTTD 5D96B 4XH2B 4JQXC 1RZGB 5DVLA 4HUXB 1RZKH 3T2NH 2ADIA 1NGZA 3F7QA 3VD7A 3QIBD 4NRYB 4GUPA 1F13A 4LHQB 1CR9H 5EN2A 3HUJE 3RWHA 4FQ2L 2YKLH 1MLBA 2YOCA 3BXNB 5MENA 2ICWA 4P2QD 3C6SB 4ODUA 1A64A 5CJXA 5C0EA 5I8KL 3HE7C 2VDOH 2E7BA 1RURL 4N90E 3B43A 5KVGL 4OZIE 2BRRH 2YUWA 4WV1A 2WBWB 5HPMA 5IFHL 1MFEH 3SKJH 4KI5D 1F4YH 5IMLB 4PGDB 1RI8A 3K1KC 2GIYA 5D93C 1EAPA 1CBVH 3KPPA 2XZAL 4UT6H 1OW0A 4D3CL 3ARYA 5GZND 4TUKH 2AJZB 3NPSB 1LQSR 5GS1B 4KV5E 2IQAB 4J8RB 2YK1L 4PRPE 5IIEA 1PFCA 4XP5L 2NY3B 1JYWA 1AH1A 4NZRL 1J0YA 3GBML 2BERA 1Q38A 1RUPL 1D6EA 2F74A 1A4JB 3F5WA 3B9KB 4XPFH 3WXWL 4P9HC 2DMCA 2BVQB 4HQQH 1BREA 4X4MA 1P84J 1C5CL 3EO0B 1AXIB 1F00I 2JE8A 1JN6B 4UAOB 4IS6A 2PTVA 3V7AE 3K3QA 1PKQB 2WIIB 4OGAD 5CIPH 2H9GA 4UOW1 5GGTL 4OCYH 5JW4Q 4NUGL 4JDTH 4W6YB 2OK0L 3ORJA 1VEOA 2XFXA 4M02A 3RVVC 3U0WL 1GL4B 1T0PB 4J23A 5TF1L 4PJEE 3GBNL 4IIQB 5LCVH 2DJ4A 4KC3B 4Z7WF 4TN9A 2VAAB 1F3DH 4OGYH 1CTOA 1RZFH 1JFQL 2BY1A 1DL7L 4FMFA 2AQ3A 2ESVE 3BEWB 2DLIA 4P2RA 3TNNB 4QNPE 4M5YL 3FCTB 1K5NA 4YWGL 1UQSB 1VENA 4LDOB 1TVHB 5FKPA 5EO1A 3U6RA 5E4EC 1HIML 1EUTA 5IFAH 2PW2B 2FYYB 3LKRB 1UM4L 4MXQC 5ETUB 3BQUC 4G8EA 5LBSL 2EDNA 2AJVL 4K8RL 3QHZH 4FOMA 4XPGH 4K94C 2HJFA 3FFDB 4MX7B 2DS4A 3GRWA 4LSRL 2BSED 1IFHH 1FORL 1L4IA 1DDHB 3ZMRA 3O3EA 2VKXA 1DEEB 3BP5B 4KTEH 4CW1A 3O8XD 4PB0H 1RUAL 4X6DE 1BGXL 1VCAA 2EIBA 1Q9KA 4WNQA 1A4KB 3H7BB 5TE7L 2WUCH 4UT7L 3VXPA 1SYSA 4JREC 5F1NA 3B9EA 4QXUL 3KPQB 5KVEL 3IKCB 4XVJH 1U8PB 3BHBA 4GLRH 2I9TB 4FQLH 4OM1H 1YYLL 1SMOA 1V3LA 2YUVA 3MREA 2BJML 2ENYA 4HXBL 3B5GA 1TJIH 4PJFA 5DJ6B 3MMEB 2ZOKA 4MLSA 5HI5C 3QFJE 4OCRH 3L6FB 3ZE1E 1F90H 3QZWG 1RV6X 4HLZH 3MUY1 2NX5A 1Z5LA 1YNLH 3QDMD 1I1FA 2VXVL 3KXFB 5EUOA 1W0WB 4U6YB 4UT9H 3WJJC 1O7SA 1IGCH 3X12B 3SCMB 2GCYA 1FGVH 3EJYC 4Z7QF 3STBA 4A2MA 1QO3B 4LCWB 4LCIL 4QRPE 4D9LL 3FQUA 1KB5L 4P0DA 5ISZE 5FYLD 5E8NB 1BECA 1T2XA 4JJ5B 4JFHD 4NKIH 3MLTB 3TYFA 4QTIL 1UJ3A 1LO4H 3LKOB 4AQOA 3MLWL 4GRWB 5C2UB 4TUOA 4AL8L 3MRGA 4AY0A 2V9QA 1GJIA 1MJJB 3CVIH 1L6XA 5BVJA 1HWGB 2RCSH 5DD5H 4LHUG 2ZKHL 1I9IL 2YHGA 3P0GB 4X7SH 4HHAA 4JM4H 3O4LE 3GFUA 1E4XI 2DLHA 5GRJL 4FTVB 4JN1L 5KSVB 1WCBA 1CFQB 2FD6H 2KZWA 4MD4A 5KS9F 4NQSA 3UEZA 1DE4A 1ONQB 3TYGH 5ISZD 4JFFB 4NO2B 1CXKA 3EFFA 2YWYA 3I2CL 2Y5EA 5D72L 1HQ4A 5DDHB 5D93B 4X7FC 5J3HC 1NSNH 4ZNCD 5CLWA 1FG9C 1QHPA 3IB4A 3IYLW 4ZOBA 1K9TA 4JPKH 4LMQE 4O9HL 4R0LC 4RNRA 3ULVH 3BZEB 1PGRB 4LKCB 2VXQL 4X7TB 4O02H 4Q6IA 2JLLA 1BQLL 3I3EA 4FQJH 5CP7A 5FA4B 3A6BH 2J5LC 2BCKB 4G6KL 4MA1C 2EZ0D 1AGCB 3IS1X 4WUKL 5F96H 3QDJB 4GW5B 1IILE 1TPXC 5F8RC 4NQTA 1KXQE 1MCIA 2AJSL 1U58A 1HYSD 4UTBH 1L9NA 4L8DA 4ZXBC 3P9LB 2CSPA 1KTDA 2DM4A 5BRZB 2Y6SC 5BVPL 3G6DL 5DMYA 1D5BA 2R0KH 1FNSL 5CP3A 4QGYA 1FFOB 4FQ1H 4MB5A 4YZFE 3L1OH 3KWWA 1IZJA 4M7ZC 5T3ZE 3ULUH 2EECA 5CBAA 5FK9A 1JYNA 3MCG1 4PP1D 1IT9H 4XRCA 4ENEC 1I3RA 1PYWB 1UB5A 5DEGA 1MIEH 5HHVH 1ED3A 3FJTA 2OMNA 4UUJB 2H2PC 4WFGE 3FB7B 1H3PH 5ESAB 2DOCA 4ONFL 1TZHB 4PTTA 3OJDA 3O6FD 5T33H 1DQML 3JVGC 4JKWA 2O5ZL 4NZTH 7CGTA 1AI1L 3ILQD 2RFXB 4PYHA 4K7PL 4U7SA 5D2NE 3ROLB 5BQ7A 3AXLA 4RAVB 5ID0A 1TIUA 3WN5A 3IU3A 5J57B 3OR7A 3VJ6B 1B0RB 2H41A 1EGJA 4OLUH 5DRNB 5GRUL 5IROC 3SDYL 1RUQL 1A1MA 2YZ8A 2R29H 5E70A 4HJ0C 1QBLL 5D7IE 3FFCB 2FHFA 5ERWA 2BNRE 2LFGA 1N7MH 4PS4H 3HA0A 4XNZB 3B2UD 4APQD 1VHPA 3V8OA 4QKXB 1R0AH 4OGXL 1ZEAL 3WNPA 4S1SH 4BH8A 1TZIB 2BX5A 2JB6B 3VXSA 1WFOA 3GRWL 4JRYA 3GNML 1BLNA 1DLHB 5DRWA 2J8UA 3U36A 2ZPKH 3MRNB 5J8OA 1CS6A 4PJGE 1H15B 4HCRA 3VFNB 5CSZB 1S9WB 5DURD 3PG2A 4K8RC 3QCTH 3HMWH 5L8LB 3VE0A 4NKOB 1Q94A 4IHOB 4YBHA 4X6CE 3VXRE 2VOTA 4XPTH 2JELL 1X5ZA 4HWEL 1NGXB 2JB5H 4PJ5A 1BD2D 3QIWA 1P7QD 1AJ7L 5I8OH 1Y0LB 1QTYT 1EHXA 4UOJA 3H6JA 3H0TA 4RAUA 4ZTPH 2VDNH 4FNLH 4HWUA 2ATKB 2VDLH 3B6SB 4KXZI 5F9OH 2HVKA 4LASH 1QSVA 1SY6A 1NCUA 4LIQE 1I8LC 1P9MC 3EZ8A 1JNLL 4DN3L 2FEDC 4KK5D 1IAIL 5CGYC 3BYYA 4OD2A 2C3HA 1WAAA 5ANME 2WBJD 2MHAB 2BNQD 4WEBH 4LDEB 3BP7B 4NWUH 5D6DA 4OUUB 4AH2A 2WLZA 4MYWB 4ODWB 5EIIA 5A3IC 2JJUA 3S37X 1RQ5A 3Q3GB 3EZJB 4YDJA 5MERA 4HZLA 3S35X 5I1IL 1TCMA 1F4AA 1I7UA 4M6NL 5DO2C 4YAQA 2AXFB 4OAWB 5EUKA 3HAEB 4AEHL 1I1AC 3PWLA 1EAJA 1RMFH 1TTGA 4M1CD 1UZ6E 2H1PL 3PL6C 1NAMH 2PW1A 1K4DB 3HE6C 4UILH 3H3KA 4P2OA 1G7LB 4NKMB 5EO0A 4HWNA 2DTML 4PJIF 3TN0B 3C60A 3CCHB 1B4JL 1JRHH 4ZYKB 4YPGA 4ALAH 1RZ7L 1BZ7B 4R0LB 1QLEH 4AEIL 1BOGB 4ODXA 4PJDE 2V2TB 2A73B 2B1HL 4TULH 5ILTH 2XI9A 3MJ7B 2UVEA 1EHNA 3QDAA 3JWDH 3OB8A 5CJXC 3QXTA 3QH3A 4MDIA 4TVPL 4WV1C 5CINH 4YXLH 3V7MA 2ITDA 1CZ8H 1EO8L 5LKNA 5HDLA 1MJUH 5E2VL 5FO9A 4JY5L 4F2MA 5KSUA 1OW0C 5HYQB 2HT2C 3R4DA 3CXDL 5A2JH 3IRZA 2CDGA 1MAMH 1MRCH 3S36H 3GSXB 4IRJB 3W5NA 2Q8AH 3I9GL 1CGVA 2AV1A 3A6CH 4BQ8A 4ZUVA 2DM7A 1T5WA 2DBLH 5J11B 3CX5J 4HKBB 1K2DA 1J86A 3MRQA 5SWSE 5J12B 4C4KO 3QEHA 2CJUL 1Y6NR 3W5MA 1MY7A 2J6EA 3WD5H 2EC9U 2XN9A 3PQYB 1DBKH 5DFWH 1JPGB 2PYFA 4NT6A 5IB2B 4EOWL 2W65A 3H9SE 1CL7I 1HYRC 4F58H 4WWKA 4XXCA 1RK1A 4PJCF 3MRDB 3C5JB 1BMGA 2VLRD 4MA8L 1VDGA 4ZD3H 2VSCA 3O11A 4RWYH 3MV9E 4M7KH 3SBWA 4NOFA 3VGFA 3ZKMC 4DEPC 2G5BB 3S6CA 3BP6B 5BXFB 1FDLL 5GGSB 5F71A 4JFDE 1NBZB 4R3SB 1NBVL 3MUGA 5ESQA 5KTEH 1ORQB 2DKMA 2VRAA 3LPWA 2F5BH 3MNWA 3MRPA 3VI3F 1MHHB 1U91B 2WWMC 4JGUA 3W2DL 4JQIH 2XWTB 4FN0A 3WFCH 4P59H 1VKXA 1V7NL 4ZSOE 4EKXA 2YD4A 3KPRE 1BWWA 5C0IA 2LU7A 1TCRA 4NHUB 1DLFL 2UY7A 3DSNA 3MRJB 5C09D 1LK3L 1V7ML 1T21A 1FG2A 4B50A 5I30L 1IEBA 3FQWA 5D7KD 4GG6F 2XZQH 3BDBA 5B3JE 5A2IH 4YXHL 5JW5A 3GB7A 4YDIH 4F7CB 5DRXA 3MRHB 4HEME 3WJLA 2X5PA 1I1CA 1Y18B 4V1DB 2V5RA 1G7QB 5F9JB 5F7DA 3PWNB 3GHEH 4NKDB 2CK2A 2JK5B 1C7TA 2P7TA 3KPRD 3VWKA 1NL0H 2AQ1A 1KIQB 2HMID 2IH3B 3JWNC 4RRPA 4R7NA 4C56A 1NANI 4YIQA 1GZPB 4HSQA 1SY6L 3KHQA 1HSAA 2VE6A 4RFOL 2GJ6E 1SJEA 5I2IB 1EEZB 4FQ2H 5IVZA 3VGDA 3O9WA 5KVFL 4Z7VB 3EYFA 5CWSA 2DI9A 3FRUB 4NQED 1MUJA 6FABL 2Y36L 5I8KH 4QF1B 3GSQA 3IJHB 2AAVA 5KVGH 3TO2A 4EUPB 2IMNA 5IFHH 3U1SL 1GC1L 3ARFA 4AENB 2CLZA 4QHMA 5E24E 1CICA 2UZIL 5JHDB 4R4FH 1RJCA 2XZAH 2FCBA 3IDGB 3QI9A 2F54A 3DYOA 2VXUL 4LARL 12E8L 5T1DL 3EYVA 2GAZA 4O4YL 5E6IB 2XYCA 4UV4L 1HCFX 5CMAB 1UJ3C 4XP5H 1I8KB 3CVHL 3KYMB 4NZRH 2VXSL 3CD4A 3GBMH 4DFIA 1RUPH 5EN2B 3RWHB 3IDYB 2YRZA 4CADA 1S3KL 5MENB 5BS0A 4MJ5B 2KZ1B 2GQHA 4M61A 5DSCA 5INDA 1X4XA 4C55A 2GJZA 4FFVC 1MELA 3QULA 3D2UA 4WV1B 1TNNA 5GGTH 5HPMB 2QQNH 5K9QI 4L5FH 4ZUWB 1HXMB 1YPZA 3NCEB 2ZWLT 1KIRB 3BN9C 3U0WH 1H3VA 3QQ4A 5TF1H 2H3NA 2XZZA 2A9NH 3GBNH 3LPGA 4NSKA 1UH2A 1A14L 4LNRB 4JFEE 2QSTA 3B8SA 1DN0B 4PJ8D 3OXSB 1I1YB 2CRYA 4Q6IC 1JFQH 4L3EB 1DL7H 3AREB 5I76B 4H88L 1D6EB 4LSPL 2W9DL 3LQAC 4B7LA 4WUUA 3HZMA 5HVHC 2W0FB 1DCLA 3RI5K 4Z77B 4LQFL 4XBEL 2VISB 5KJRL 4IS6B 4NZUL 5C0AD 2VLKA 3TCLB 3VU2A 4LFHD 1T1ZA 2MCPL 1HIMH 3MLZH 5A1AA 5LG1A 2CMRH 2A2QT 4NN6C 1F2QA 1U8NA 1UM4H 5F72S 5J9PA 3QHTC 4DGIL 1T1WA 2AJVH 2XFXB 1FCGA 4K8RH 1KENL 4JZOA 3X17A 2YXMA 1YN7B 4DEPB 4LSRH 5LVEA 4CU7A 3T3MF 4EN3D 1KTRL 5IHUL 1FORH 4PJIB 4RIRA 4UQ3B 5A2KH 3WHE0 4ODHL 3HRPA 3IFPB 1RUAH 2J88L 4CMMA 4GRMB 2UWEF 1Y6KR 4HW6A 3RA7L 5TE7H 4CDGC 4Y1AE 1FFPB 5FGSA 3S3SA 3G6JA 3SDCD 1X5JA 3T65A 2A83A 1PW3A 1G7PB 1YYLH 3WN5C 5D2LA 1MAJA 4TSCH 1K3ZA 4PJ7A 2BJMH 4MHHG 4PJ9D 5MI0C 4G8EB 1U3HA 1WTGT 3GJFB 4D0CA 2HJFB 5J7CC 2VXVH 1KJMB 1OGAB 3DX7A 2WK2A 5CD5D 1CG9A 5I15L 1J1PH 5HYSA 1YJDL 4OQ1A 4UNVA 1LDSA 1K6QL 5KSAA 1FNEB 1QQDB 1U8KA 4HBCL 4HUNB 1Z9SA 3WO4C 5IG7B 4LCIH 1Q9KB 4BSWB 2VLJA 5EU7E 4D9LH 2DYPD 4HD9A 5F1NB 1KB5H 1UFUA 5F9DC 3TVMB 3V4PH 2PO6D 3WLWC 3HCVA 2IQ9L 5M95B 4H0GA 3CLEL 2VO5A 1P69B 5DJCB 1BQSA 1AE6L 2FB4H 4QTIH 5C0BD 3MREB 2ADJB 3MLWH 3QIWC 3VFTA 1L7TH 2JF1A 1QLRA 1UCBL 3QUYA 5E9DA 3FO2A 1BZQK 1XIWD 1P2CA 1RSFA 2NX5B 5CUSH 1I9IH 1I1FB 2D2OA 3QAZC 1FC1A 3QO0B 1I7TB 2VR9A 5GRJH 5HHPA 4JN1H 2B7DT 2A38A 4KZEL 5E8DL 3LQZA 2PN5A 2DB8A 4K3EL 1IAOB 3RRQA 1UA6L 3JXAA 3LN5B 3FQUB 2DKUA 1YMMD 3GSVA 5D6DC 1N6QL 5AG8A 2EDYA 5MEPB 4P2CG 1PVHA 4R2GC 5C70A 3TYFB 4IRZL 2VXQH 3KPSE 1UJ3B 4WENB 4XHJC 1JNJA 5AYUL 2COQA 1BQLH 3IXAA 2NY2C 4NO5B 4TUOB 3C5ZA 3GSRB 1GC1C 1I9JL 4GG6B 2AERT 4WUKH 3SY0A 4LKXA 5IV2A 2WWKT 4Y19D 2XNAA 3LSOA 3AVEA 1UB6B 2AJSH 4PR5B 4LSSL 1C8PA 3IFOB 4KK9D 1ZLVK 3ULVF 2HVJA 4TTDC 1NGPL 3G6DH 2XQYG 3NIFF 2Z92A 5KSBA 1DE4B 4P2OC 5GIRA 4BFIB 3EFFB 2ICES 4NM4L 2OQJA 4KJWC 4S11A 3VFGL 4LRNL 5CEZE 3BJLA 3NCMA 3UXFA 3OKMA 4HF5H 3U4BL 3B5HA 1T1YB 4XCEA 1CGXA 3KGRA 4L3CB 5TQ0L 3D69A 3RX8A 1KYOJ 2BMKA 4HLZG 4KRPD 4LNVA 1JJUA 5AAMA 2Q6WB 3SKOB 1J1XH 1KACB 4Q6IB 5DK3A 2ZUUA 5CP7B 3OKLA 2NW3B 1VFBB 3RVUD 4UB0L 3X11A 3ULUF 2VB5A 1AI1H 4NQDB 4K7PH 4F7PA 4MSWA 2R1WA 3Q6FA 4L8DB 3D9AH 3S37L 2NY6C 5GSVB 4DVBB 1A6WH 3SDYH 2FEEI 2NNAA 4WI7A 3CXHJ 3T0EB 5E2WL 4Q9CA 5CBAB 5FB8A 3ZDZF 2P8LB 1UACH 4WJ5B 3IAPA 4Z7NE 2R0LL 3OAUH 5C86A 4RGOH 4QYOB 5I1GH 1S7SA 1ZEAH 3CFKB 2XTJC 5GQBA 2OK0H 4HFWA 4U1HA 3HN3A 1OAKL 3T4YA 3GSOA 3HI1A 3OJDB 5JQ6L 3OSKA 5IFJA 1JNHA 2VL5A 3D3VA 4WWKC 4XXCC 1CD1B 2IMMA 1C7SA 2JELH 4HWEH 2EDHA 3OR7B 4POYA 3BPOB 5IESL 2HLAA 1TZGL 3SBWC 1A1MB 3MR9A 3V5DA 3RGVD 2CKNA 5J06A 2XV6B 3HMXA 1UH3A 4YX2L 5J6HB 3T3PE 3MV7A 1BM3L 3CC5A 3KLAA 1UZ8B 2X9WA 4HK3J 3I3DA 1JNLH 4DN3H 2EKJA 1IAIH 5JOPD 2IADA 3VXSB 1CLZL 5DRWB 4HIHA 3MOAL 3U36B 3VXUE 4OBSA 5FYLH 1EVTC 2X09A 4G6ML 1QD0A 1J8HA 4F37F 2EDJA 3T77A 1NFDF 2L7UA 4PJ5B 4M1DL 1YJDC 3FTGA 3UTSA 3REWA 4CVZA 3PE9A 4M6NH 4JKPL 5J13C 4JE4B 3H0TB 2VTFA 4AEHH 4DKFH 3WJLC 4GAYA 3QAZB 2HVKB 3VI4E 5F1SA 1D9KD 2OZ4L 5IBUG 1Q72H 3VWKC 2A1WH 3S7GA 4XNXL 4JZNA 5GZOC 1X5AA 3ABZA 5HHOD 2DTMH 4KJPC 3R06B 5E00A 2AGJL 5E2TL 5DHYB 1B4JH 5CBEB 3W9EB 3AROA 3OZ9L 4YDVA 5EIIB 2QKIA 1UM6H 2AKRA 1G9ML 3ARSA 4R2GB 3EW3B 4ZO7A 3SKNA 4AEIH 3GMNA 3O9WC 4YDJB 25C8L 2B1HH 1QZ1A 4HZLB 3TBTB 5T3XD 2NY2B 4U31A 4X9GA 4G43A 2HA1A 1I7UB 5EA0H 2D0FA 3NH7L 3MRKA 4DUVA 3E6HA 3UTTA 3QJFA 1JPSL 4KDVA 4U3CA 4OZFH 1N2RA 1LP9F 4TVPH 1IAIM 2PYEA 1ZTXH 5CGTA 3ARFC 4FABL 3GMOA 2XACC 4CNIB 2PW1B 5E2VH 5JORA 3U9UA 5EOTA 1CICC 3U2SA 3OXRA 1PKQE 2FRGP 2CDFA 3QI9C 4JANA 1GZQA 1MQ8A 2IPTL 3CXDH 1J12A 1W72A 4YHLL 4DCQA 3BESR 2DWDA 32C2A 3D5OF 4P5KA 1IE5A 3SDXF 4YPGB 1D5XB 5CP3H 3I9GH 3CMOL 3H9HA 1JGEA 4WHDA 3CFJA 4ODXB 3B9KD 4U49A 2HLFC 2R0WL 2CJUH 1XGUA 1KELL 4GW4B 4GXVL 3KS0J 4MA3A 2Q20A 3RKDD 3RWIA 4CL7A 4EOWH 3RVWD 4RQQB 5C8JA 2HH0L 3QH3B 1RHHB 3HUJA 3IKKA 4KK6C 3RX5A 2FLRT 1PX4A 2F8OA 3BUYA 4FZEL 2NY6B 5FO9B 1B0GB 4MA8H 4F2MB 3ALPA 1NCCL 3STLA 4AM0B 5DJYA 1QP1A 4OZHA 1YEGL 2XWJB 4B53A 3BGMA 3BSZL 1FDLH 5GGUB 2CDGB 1PX3A 4UDTB 5CKAA 4WY7H 3UYOD 3RZCB 2AV1B 3UO1L 1T5WB 5HI3D 4XNYH 3BUTA 1GGTA 2X4QA 1YMHB 2XTJB 3W2DH 4CDHA 3JV0A 4G9DA 4W70A 1V7NH 3K4ZA 4PRPA 4N0CD 5L9DL 1ITCA 1DLFH 2PYFB 3Q1SH 2DIAA 2X6MA 4HC1L 1LK3H 1V7MH 4OLYH 5DQDH 2QQQA 4WWKB 1CE1L 5IP4A 3VD4A 4RFEB 2Q86B 5I30H 3TBSB 4NBYB 3S8WA 1MFDL 3KHOA 5L2JA 3AS1A 2HTKC 2VR5A 4YXHH 5HD8C 1KIPB 3BDYL 4YBLC 3RWDA 3UTOA 1AHWB 1FN4B 2F5AL 4MWFA 4XMKL 3RVTD 4ZFOB 5FYJE 3QUMA 4RGNB 3VXOA 5I8EA 5I1JL 2D03L 5DD6A 2VMFA 1N59B 3KXFE 5T5NF 2L7JA 3MRPB 2BNUB 4PJEA 4YQXL 1A2YA 3HMXL 1VKXB 2ZCHL 1JWUA 2Q87A 5T1LB 1JMZA 4LCWE 1TCRB 3RNKA 4RFOH 1KCKA 3LDBC 4XC3L 1JPTL 3C9NA 2ESVA 3ARDD 5DWUH 1BBJA 1T21B 2CLVA 4G8FB 1FG2B 3AFLA 4ISVB 4K7FB 4PLKD 4ZG1A 4NPYA 2P5ED 2YPLD 3QCUL 5C9JB 3WFDL 5KVFH 5C6TL 1U3HC 4GRWE 2I07B 6FABH 2Y36H 3GB7B 4OF3A 1EFXD 1R3HB 3X13A 5DRXB 5IOPA 1BQHA 3EUUA 3L3HA 5E99H 3F65A 5KSAC 1U36A 4Y8DC 1GC1H 3I6KA 4B7IA 1ACZA 5DUML 4LLWB 5F21B 3VWKB 1GYAA 2UZIH 4O58L 5BCAA 4FTVE 2CH8A 2G75A 1L7IL 1OAXL 1CDCA 2VXUH 4R7NB 3AB0B 4C56B 1FO0L 3FAWA 4X0KA 12E8H 4AT6A 2CUIA 4JFFE 4O4YH 4WU7A 4JFZL 1OB1A 5FFLA 2VE6B 4X6DA 1JWMA 1HOCB 3ZL4L 5KN5A 3CVHH 2VXSH 1MJ8L 4Q0XL 2H2SC 3H9ZA 1M7IB 4Z7UF 5IVZB 4LF3A 2ED7A 5EU3B 3HZYA 3QUYC 2EXYD 2Z8RA 5TGBA 3F6IA 1MUJB 3A67L 2WV3A 1QPPA 4L9DA 1NCWL 3QDJE 4MNQD 4BZ1L 5EB9A 5C0GB 1RJLA 4KUZL 4Y4HA 2NY5L 3ZDXF 3N1QC 5F6IC 1CICB 3QFJA 1F42A 5T5NG 4KKAC 4Y5XB 5BRZE 1H0DB 4MDJA 2ARJA 2F54B 2O61B 5B39A 1BF2A 1A14H 2J1KA 3ARBB 1OSPL 5BJTA 2OCFD 1UKTA 2FHBA 3IXTA 3QQ3B 1FNHA 4NYLA 5E0QA 1NUNB 3I75B 4QRPA 2G9HB 1NFDB 4H88H 3MO1A 3JV6A 3C5ZC 4LSPH 3BZFA 1KUMA 1T6WA 5DLML 1W72L 1HKFA 1HH6A 5ISZA 3P4OA 5BS0B 1VGKB 3ECBA 4YHNA 1NEZG 2FO1A 4LQFH 4XBEH 4EDWL 4M61B 5DSCB 2GJZB 1ZOXA 3D87B 3TJHD 5F9AC 4NZUH 4YGVB 3MYZA 3QULB 1FBIL 2MCPH 3EFDL 3RIFK 1RIUL 5BRZD 2C7UB 4BQBA 1ZHNA 4DGIH 1AGDA 2CRIA 4P3DB 3GGWB 4HH9B 3OR6A 3QQ4B 3G5ZA 1VGEL 4JKLA 4NSKB 3O4LA 5IHUH 4ETQA 1KLFA 3IT8D 4K3DL 1F58H 3FFCE 4ODHH 4HK0B 3SGDH 1QR1B 1DANT 3FN9A 1M7XA 3FZUD 2J88H 4NKQB 4YFLI 3RA7H 1R3IL 5DMGD 3SN6N 4WUUB 3AMKA 2O5YL 5SX4H 2N56A 4HFUH 4D0BB 4U6XA 1QSED 1LP9B 1ITBB 4RAHA 3HG1D 5SWZB 1U8NB 2AXGA 3KPOA 1JTOA 5J9PB 3G08A 5DS8A 3B3IA 3V5HB 4G9FD 4JZOB 3O6FA 3FMGH 2VITA 1FVEA 3BPNC 1LO5B 2F53B 4LRIA 5I15H 2XIDA 1UG9A 3SDXB 1RJZB 1K6QH 2P5WD 4HS6A 3UBXG 4HBCH 1T0MA 3WIFB 4HMCA 1SEBB 4NNPH 2X9XA 3WIIL 2E8YA 3KPLA 3R8BB 3G6JB 1IGYA 1UWEL 2A83B 2VJXA 5I8CB 1G7IA 1AE6H 1OF2B 1HHGB 3GUTB 3LDBB 3HI6L 4PJ7B 3VA6A 4FFZH 1QFWI 3RL1A 3DRTB 2D3VA 4M62L 1Y6MR 3LCYA 3IFLH 1I9RL 5EZJB 3TNMA 1UCBH 2Z0BA 4CU8A 4QRQA 4POUB 4FQXB 5DVKA 1INQB 2B5IC 3QNXB 2KBGA 4JO3L 3OKOB 4KPHH 5CS7A 4NGHL 5F7EL 1FVCA 4OCXL 1CDJA 1NC2D 1P7QA 3ZE2F 1UA6H 2BNRA 3IDIB 3N06B 4MCYB 1N6QH 2CGRL 4OFVA 4OKVA 3ARGA 3TV3L 3P77B 4IRZH 2WMPA 4I4WA 3R8QA 5FOJA 3W39A 4JN2B 5AYUH 4WIQA 4ERSL 1JWSA 1PG7W 4ZDHA 3FB8B 4JB9L 3W0WD 4WGVB 2ZSVB 1BQUA 4PJGA 1CE6A 1I9JH 1QLRB 3ROOA 2NY0D 2YZ1A 2BNQA 1ZGLB 4KY1H 3DX9A 2ITCB 4JG1H 3WUWG 4X6CA 4LHUD 3VXRA 5ICZA 2CXGA 2D7TL 3LRGA 1DBJL 3RDTB 1ZLWK 1NGPH 4BUGA 2CUMA 3BZ4A 1WC7B 3IDNA 3GMRA 1YQVL 1T80A 4NM4H 3BO8A 3CMGA 3VFGH 4NQCD 2CKBB 1PEZA 2DQTH 2SEBA 4O5LL 5TQ0H 1OT1A 2DI7A 3RVXC 2BSRB 1X3DA 1GGCL 2GITA 5A40E 3PP3K 3ZO0A 2GUOB 5ANMA 1BJMA 3IXAB 3MV8D 3PABB 4FZ8H 4GBXD 3B9DA 3C5ZB 2ICEA 3BRDA 5FEBA 4UB0H 2Z35A 4I0CC 4LKXB 1NQBA 4I18B 3QEQD 2XNAB 1BZ9B 3U0PB 3LSOB 2YA1A 5DJDA 4WFHE 2VWEE 3PQYE 4K9EL 4X5LA 4EJ1C 2HVJB 3DTXA 3S35H 4KMTL 4MA7H 2MTPA 1FPTL 3E8UL 5BOPA 5GIRB 4RMTA 3DSFH 1A6ZA 5I71C 4XNMB 1XEDA 1FL3A 2ZJSL 2ZUSA 4MCZA 5E2WH 1HDMB 4P46B 5IJVB 1L0XA 2I60H 3OKMB 3UPRA 1UXSA 1EPFA 2Q1EA 4XCEB 4IRJD 3A6OA 3BZDA 2BMKB 2EDFA 4U1KA 4J3UA 1YUHA 4NO0B 4P49A 3NGBB 3MSPA 4ODTH 4NP4H 4KI5C 1QACA 2VC2L 43C9A 1ETZA 2ZOLA 1WFTA 4OF5A 4U3HA 4Z7UB 1PZUB 4PRHD 2WNGA 5I18L 3DBXA 5GZNC 1I3GL 4CVUA 4C83A 4MSWB 1ZLVH 2R1WB 2NXZD 3Q6FB 4PJDA 3KYNA 1R24B 4OF7A 1EUUA 2D7MA 4PGEA 1EEYB 1LDPL 4X99A 5HHNB 1TZGH 1PZ5A 2NNAB 4OZGB 2FBJH 1WZ1L 3W11D 4GQPH 3CPLB 4XMPL 5FB8B 3S88L 1IEAA 2NR6D 3GSNB 5HVGB 4YX2H 3PXJA 2NZIA 3V0VA 3ZYJA 1BM3H 1DVFD 3PGDA 3UBXB 1NLBL 1XZ0A 2MCG1 4V1DE 3LY6A 3V52H 4D2NA 4QOKB 4Z78A 2R1YA 3QDGD 2QHRL 3QUXB 3MOAH 4U1HB 5GGRB 1EX0A 2J12B 3Q48A 4G6MH 1AY1L 5IFJB 1JNHB 3K1DA 5CKGA 3QRGH 2GY7B 4PJFF 5T3ZL 3ZKND 1K8DB 4OCWH 5IMOA 3EGSA 4NRZA 5SWSA 1MFCL 2NY4B 1AXTL 1QKZH 3W9DA 5EZLB 1WEJH 4QCIA 4PV9B 1MWAL 2X41A 1A7QH 4J3XA 4BQCA 2C9AA 3QFDA 2HLAB 4WTZA 3MR9B 3V5DB 4JKPH 4YH6A 2EYTB 3H9SA 4R90L 4EXPX 4Z7VE 2Q7YA 3F58L 1DUZA 2Y4SA 5EU5B 5E08L 3MV7B 3ARUA 2P8PA 4F80A 3KLAB 2OZ4H 3LD8B 5CJBA 1Z0MA 3GJEA 1KLGA 4XNXH 4AEEA 4OQTH 4Y88A 1XGQA 3N1MC 4QXWA 4JRXD 2OMBA 2GTWA 1CDYA 2DRUA 3KYKH 1S9KC 2W0PA 4LPTA 4YBQD 4EI5B 5E8EA 1G6RA 1MCPL 3DI3B 2AGJH 4PLNC 5JHDE 2Y9RT 3WE6B 3SDDB 3OZ9H 4N8CH 5KVDH 1J8HB 3U4AA 1XR9A 4F3FA 1P7KA 5JOFB 1GRWA 3UTZB 1G9MH 1T3FA 3C09C 1X5GA 3MLVL 4JHZA 5E6YA 2V9RA 3OAZK 4ZSOA 25C8H 3KPRA 3SGEH 3UTSB 1OARL 4LSQL 1IC7L 4BQ9A 1OWRM 3MOBH 2APBA 3B4NA 3RIAK 3WUWB 1JPSH 4G5ZL 4MD0A 5MENE 1OWWA 4X8XA 4GS7C 4GAYB 1YEJL 2CIKB 2NXYD 3VRLF 1IGJA 3MJ6A 4HUWA 4JHWH 3MNZA 3VXTA 2Z91A 5JW3L 2L4OA 4HGWA 4JZNB 3FB6A 2X4UA 4Y8AA 2IPTH 5DD0L 4OV6F 1INDH 2EDXA 4YHLH 5E6ID 4CUCA 2IWGA 2QKIB 3CMOH 3FOLB 1D5ZB 1BP3B 1I7ZA 3OG4B 4ONHA 3GMNB 2DQGL 5DMIL 2R0WH 4U1IA 4JFXA 2BY2A 1KELH 4L3EE 5D1QB 4LIQL 4YXKH 1J05B 3MRKB 2GJ6A 3UTTB 4B0MM 3MA7A 3IU4L 4X4ME 1N2RB 2HH0H 1Q9OB 4TUJB 4LBEA 1A7RL 5TDOA 3DPBA 4I5BB 4Y4HC 5C0JA 3QIBB 3U9UB 4PTUA 4PY7A 5EOTB 3U2SB 1LD9A 2EICA 4JKKA 5E94B 5B38B 4NWTL 1NCCH 2CDFB 3ARXA 2YS4A 2YN5A 2YPKA 2X1QA 4F33B 1YEGH 4OLXL 4P2QB 3BSZH 5A2FA 4O2CA 2VH5L 1VACB 1OM3L 2DWDB 32C2B 4P5KB 4DCQB 3LKNA 3PWVA 4LL9A 1FZOA 3EOYG 5DI8A 2DTSA 3H9HB 1WIOA 4I0PD 3UO1H 2HKFL 4PJIE 4A6YA 3EAKA 1NLDL 4K9EC 4PLJD 2RR3A 2X4TB 5I1EL 4LLYB 1OTSC 1QBAA 1TENA 3OGOE 2D9QB 4PRDA 1IQDA 4ZUSB 1BAFL 5I1DA 1KG0A 4MA3B 2YEZA 2QQKL 3MRLB 3DETD 3RWIB 4HC1H 1S78C 3L3IA 4W6WB 5C8JB 4MAYD 3SHSA 3WO3B 3QUZD 3HFML 1CE1H 4PJ8A 3WL9A 2QADC 3BUYB 3EOTL 2YUZA 1MFDH 1YEFL 4LPUA 3STLB 2OJZL 4OZHB 3BDYH 1JUFA 3EYSH 1BBDL 1KTKE 5F88B 4XMKH 4QGTA 4KWUA 1R5IA 3O4OB 4AK1A 1WQVT 1DBBH 2D03H 3IGAA 4OZFG 1OGAE 2B4CL 1F45A 8CGTA 4YQXH 5C6PB 3QBTB 3HMXH 4UIKL 3DRQA 2ZCHH 2E5EA 3DV6A 5IM7B 4JCLA 4M7JL 2XPGA 4PRAA 1QRND 3S5LG 4QTHA 3TO4D 4EN3A 1JPTH 3AUVA 1DQLL 4M8QA 1ROWA 1V05A 5J89A 1C1EH 1F97A 3RWJA 4XVUC 3MTRA 1Q1JL 4ZOEA 5JIKA 1EV2E 3WFDH 1QBBA 2XWBA 5L2JB 1LGVA 4TOYL 3N1FC 3O6FC 4PB9L 3SDCA 3QO1A 3ZE0F 3ILQC 4ZAKD 1UM5L 4YO0A 5TJWK 1NMAL 4LRIC 4XX1G 3NA9L 1E6OL 3PWUB 2C4FU 1RVFL 3IJSB 3QUMB 4LSDA 3AGVA 5E1AA 3ZKSD 1SYVB 3OKDA 2NX5E 2ZUXA 1S9YB 1AKJA 5FCSH 4LLDA 1VEMA 5BZDA 2YD5A 4KQ4L 1VADA 4I2XB 4PJ9A 2MNUA 3O3DA 2AEIT 1FO0H 3CSYA 2OYPA 4JFZH 3VFSA 1OLZA 1QFWL 4KTDH 4DGYL 1JZ5A 2X4SA 3ZL4H 2X4RB 2VDPL 3C9NB 4E42A 1MJ8H 2CLVB 5EO9B 3GHBL 4Y1AA 5T3XH 4NPYB 3O8XB 2ZG1A 3O6KL 1LNUA 4JY4A 4XP1L 1JHKL 1T04A 5F89A 1KB9J 3MRIB 2PO6A 4DZBA 4JFYB 2VAJA 4GG6E 4BJLA 5IOPB 1FLTX 1S7QA 1NCWH 4JGMA 2GKIA 1DEDA 3L3HB 4GS7B 3LV3A 1CTNA 4BZ1H 5IHZA 3FN0H 1RZ8A 1ZSDA 3QPQC 4KUZH 2NY5H 1FNGB 1UC6A 4F15C 4WHYH 1NGYA 5CEYA 2VABA 1TJGL 1MCCA 2HFEA 3ARGC 3WLBB 1D6VL 2E7CA 4WU7B 4AT6B 4PV8A 2E6JA 4D8PA 1WBYB 3QDMB 4QRTB 3DGGA 5KN5B 2VDKH 4C58B 1EERB 2KL6A 2HYMA 4J1UB 4KK5C 5DLMH 1W72H 1EEUA 4LLVA 2QHLA 2UZYB 4XNUH 5TGBB 5I6XC 4W4OA 2X1XR 1U95A 2IALA 4G80B 4LQ1A 1ES0A 1W0VA 1M71A 3EFDH 4NQDE 1RIUH 4MZ3A 3E2HB 2BHZA 1MREL 3KNBB 5ESVA 3MRMB 3GBLA 1F8TL 2A74B 2FECI 3NIGF 4Z76A 2W07A 5ICXA 2APWA 4L8CB 1RK0B 4Y19A 5HY9A 2DJUA 1YEDA 1IC5L 3T0EE 3OGCB 4K3DH 1A1OA 3JWOL 5BJTB 2E9BA 5JLZA 3DV4B 3IXTB 4KKLD 4NYLB 1VFAB 1R3IH 3EJZD 3P4OB 5F1KC 4LSTH 4Y4FD 1YEHH 1T22A 3MJ9A 3UZEA 3GKWL 1T7WA 4A6YL 2C1OA 5L2KD 1HINH 3JTTA 1ZHNB 3U0TA 1AGDB 2H8PA 4JPWL 4NO3B 4WO4A 3V8CA 3DMMD 1GCFA 1YN6B 2A77L 3MCKA 1IARB 2V5SA 5F97E 3P2TA 2QSQA 1JGLH 4OIAA 1T4KB 2QLVB 4OZFB 1I7RA 3VFOA 3D85D 3TT1L 5D5MF 5H2BB 2PTUA 2XTLA 3WIIH 3MGOA 4OIIL 5E2UH 1VPOH 4KUCD 1MF2H 3LPFA 2NY1D 2QR0A 5AUMB 3VXSE 1IM3B 3S5LB 4QY8A 1IGTB 3BH8A 3P73A 2HT4D 1F5WA 3FRPA 2QSCL 4R96A 5SWQB 2YR3A 1YA5A 5TE6L 4P4KA 2B4CC 3QPXH 5DS8B 4Y5YA 3B3IB 4X9FA 4L1HA 4PJ5E 3O41B 3CH1B 2FL5B 4PJAA 3RI5F 3RPIA 3O6FB