4UT7H

Crystal structure of the scfv fragment of the broadly neutralizing human antibody ede2 a11
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
146
structure length
146
Chain Sequence
b'VQLVESGGGLVRPGGSLRLSCAASGFSYSNHWMHWVRQAPGKGLVWVSRINSDGSTRNYADFVKGRFTISRDNAENTLYLEMNSLTADDTAVYYCVRDGVRFYYDSTGYYPDSFFKYGMDVWGQGTTVTVSSGTGGSGGGGSGGGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 30
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ut7H00
3MV01 2K1MA 3M8OH 3QUMA 4HAGA 4GLRI 4ZXBB 1GC1C 4OZIF 5IJVA 1C7TA 4M8VA 1F13A 1L7TH 4WCYL 1HOCB 5EA0L 4Q9CA 4YWGH 3STLA 4BKLA 2VLJB 3OX8A 1YN7B 2EYTB 3CLEH 5D71L 1T7ZA 1CQKA 2Y07H 5E8NB 2BK8A 1SY6A 2DQJH 3NCYP 5EC1A 3GMQA 2PXYC 1U42A 5HPOA 3EOYG 4HGWA 3TCLA 4JM2B 3TO2B 1KXTB 2W07A 1W0YT 5DDHA 4ZAKB 4N0YH 3MA9H 4URTB 3BKCL 2X4PB 4LK4A 4CKVX 1P4IL 3REWA 2PW2A 2OS7A 1L9MA 3F7RA 4ZTPL 5SX4I 5TFSH 2A6JB 4EKXA 3T3PE 2IADA 1A64A 4GXVH 4JQVC 4JANB 1KIPB 1BJ1J 4JAMB 3UBXG 3VXNA 1Q94A 3UTPD 4UINH 3CXHJ 5IW1B 3I02B 3X11B 4LHUB 3TBYA 1MF2L 4KAQL 4JPKL 3RKDC 4E0RB 4HF5L 5JPMA 1FL3A 5F7UA 2D4FA 3OB0H 5DJ0A 3NCCB 5JMRA 3P77A 4U31A 2VC2H 1X4ZA 4BELD 1IC5H 1U8NA 4ZS7H 4LIQH 1B4JL 1F8TL 2A6KA 5CJOH 4JFEB 1A1OA 5HYJD 2FJFA 4G43B 4JM2F 1WAAF 4UV7L 3PWPD 3ETBF 1GJIA 2V6HA 2VQ1A 3QR2A 1K2DA 3EYSL 4HIEB 1BLNB 5J13B 2XZQH 2YUZA 1L0XA 5MERA 4KK8C 4XGZA 2HTKC 5LGJA 1T80A 3QNXA 5DRZA 5C0GA 2JJTC 3HTLX 4D0CB 1JGVH 3WIIH 4TRPL 5ICZA 1AGCB 2GCYB 3IJHA 4JFOA 3F6IA 4PYGA 3IJSB 3BWAA 5CD3B 5L7XH 4NDMB 2OMBA 1T6WA 3FT2B 1TJGH 2V5TA 4TQEL 3MREB 2FZ3A 1RZKC 1DZBA 2VKWA 4H1LB 5CSGA 3EYQD 5FHBL 5EO0B 5E94A 1E4XH 2WUCH 1AXSB 5J6GA 1PZ5A 2EDYA 5IM7B 1OAKH 3PNWB 3U7YL 3CDFA 1UFUA 3PGFL 4Z7WF 4R8WL 3VXSA 4EN3D 1PSKH 1VADB 4RA3A 5F1NA 1A02N 3KPPB 1AGBA 5I1IH 4NM8H 3S35L 5CFHA 3IFPB 1TJIH 4R7DA 2R56H 4BH8B 3CDGA 2B4CC 4XI5D 2NY2C 4W4NA 3VFGL 5JHDE 5A40E 3TBWB 3NCJH 4XMKH 3RHWK 3KXFB 5HDBF 4YBHA 1QP1A 2YC1B 3LS5L 1JFQH 1HXYB 5ALCL 3NABL 2CK2A 3LS4L 1GGCL 1MFAL 2P47B 1OAYL 3DARA 2PYEE 5MEOA 3BVNA 3C9NB 3IAQA 1TVBB 2CKNA 4GKSA 5HPMA 3JZ7A 3OXSB 5ENWA 4NQEA 3OGCB 4PJXE 1SYVA 5D4QA 1IC7L 4LNRB 5C70A 1NC2B 4JJ5A 4Y2DA 1F02I 3DV4B 1WZ1H 4LVEA 3TZVD 3RDTA 4CU6A 3MUHL 4XP6L 2CR3A 1CD0A 4ODSH 2QR0B 3WSQH 3OR7B 4HX1B 1QBML 5D7IA 4MD0A 4X6DB 5IEHB 3GUTA 4YK4B 5JPNA 4XNZB 1ZGLP 1NKOA 4IRSB 4PRPE 1A7NH 3RA7H 5F97E 4WU5A 3U4BH 1A9BA 3ZKMC 2IWGA 1AQDB 3FB8B 3GIZH 1MQ8A 3BAEL 2VDKL 4X9HA 4OIAA 3TYGL 3TN0B 3I9GL 2EE3A 4M3KB 4Y4FA 1T1ZA 4EIZC 5C8JA 2R0KH 2DRUA 2RFXA 5JW4Q 1SJXA 7CGTA 1ORQA 3F58L 3L5WA 1FYTB 3U46A 3V0VB 3CSYA 4OD1H 1U8PB 4RAUB 5IB4A 3LQZB 5B8CB 3OTTA 3STZA 4X6DF 4RZCA 4G5ZL 2JCCE 3IB4A 1UVQA 5K9OB 5KSBE 4LHQB 3U30C 1TMCB 3C60B 2ADFH 3CFDA 1YEDB 3RUGB 1KTDB 4P2RA 4YDIL 1Q72L 3RWGA 2CRZA 4ELME 1I4FB 2ADGB 1Y18B 1JHTA 3MLVL 3BE1H 5DQ9B 3WJJA 1C12B 4KZEH 4XP5H 2PR4L 5DWUH 4FTVA 5EU6E 5BV7C 4H25B 2XNAB 4PY7A 3KNBB 5I1GH 3IETA 2O5ZH 4UT9L 3K8MA 2IQ9H 3MACL 5D8JL 4JFDB 1HNGA 1D5MB 2IPTL 2XTJE 4L8BB 1X4YA 3VGBA 4DKAA 4OTXL 4EI5B 1JYNA 3EO9L 4DQOH 4NO2A 1EEZA 2XA8H 4K8RL 2DTMH 5MEPA 5H2BA 2IEPA 3MOBH 4G9DA 4XVUD 4U1LB 1KTLB 1DQDL 3MRJA 2A83A 1JNHA 3RUGF 5F7YC 3V5KA 2WK2A 1ES0B 4XCYA 4PJ8B 4JFYB 4GSDL 5E2TH 3IKCB 4QHLA 1QPPA 3ARFB 5GS3A 3BMWA 4F9LC 3RRQA 4ELKB 4AT6B 1ZHNB 2EEDA 4LSPL 1URLA 5D1ZB 3IU3B 1A7PL 3FQXA 3L3GA 1LEGA 4Z95H 1TETH 4PGEA 3GEWB 5IHZA 5ERWA 4WI6A 1CGWA 3W0WE 4MJIA 4ZNCD 3AY4A 4QRRA 2AVGA 4HCRA 4WJ5A 2NTFB 5DUBA 4DN3L 3GJEA 3BP6A 1ZEAL 3WFHB 1JYVA 1B88A 4S1DD 4OV5B 2UWEB 1EHXA 3QQ4B 2XN9D 3CX5J 3BKJL 3BHBB 2BVEA 1PFCA 3RDTC 3BO8A 5DMYA 4HWBL 4X99A 2C3XA 2AK4B 2J8HA 5BQ7A 3OAYH 5ITBH 1P4LB 1KN4L 4LRNL 5ADOH 3C5SA 5BRZE 4XPAL 1U95B 4XMPL 1QTYT 2F19L 4R4ND 4NCC2 4NQSB 4L1DA 1ITBB 3O6LL 3WFZA 1HE7A 4OLYL 3S37L 1DANT 1MRCL 3WIHH 2VE6B 4LEXL 3SKOA 4U7KA 4LQFH 5EN2B 1EEYB 2J3SA 4IRJD 1G7LA 4RISL 2VXSH 4ODTH 2XG5A 4HPYL 3VCLB 4GXUN 2H2SD 1M7IB 1JNNL 4DGIL 5EC2A 5DD6B 2UWEF 3S3SA 3QDJD 5EBLA 2AXGB 4KI5D 1ZT1B 5DO2D 4AIOA 4DKDC 4KUCD 1FPTH 1QHOA 4K94L 1T3FA 2Y06H 4N0CD 1AGEA 3JXAA 5T3ZE 1I1AA 2Z91A 5DT1L 4UTAH 4YXKH 5DHYB 3HB3D 2YPLD 1T5XA 2R4RH 2EDRA 2B5IB 3BDYL 2DIAA 3RU8L 4WTXA 1NGZB 3T2NL 4WENB 4Y88A 1BEYL 1ZLSL 1MSPA 1X5ZA 3V7AG 2IFFH 1A3QA 1P84J 1RHFA 4KMTH 2WUBH 4KKBD 2WBJC 4YDVA 4JM2A 5D7LE 3O8XB 2VZ1A 5GGQL 1I7RB 3VD5A 4H26A 2X4PA 3NCEB 3V5HB 1OP5H 4YXHL 2E7MA 3ZHLA 3RX8A 4I18B 1EJOL 3ZE1E 3OF6D 4JE4B 3ULUC 5J8OA 2GJZB 3IDYC 3B9AA 1KIPA 3P0VL 3T0EC 4JAMA 3SDDD 3BP4B 1BOGA 3KYKH 3X11A 1A3LL 4XB8A 4ERSL 1LK3L 2VMFA 3BFOA 2ICWJ 2NXZD 1DBBH 3R4DA 3MJGX 4OAWB 5IHBA 2E9BA 2Y1VA 2PYFB 1M7XA 2HJKA 1FNFA 2NY4B 3ISWA 5CINL 1GIGL 5GS2D 3EYUH 4JFEA 3BGFC 4PUBL 1FZOB 1VPOL 2IH1B 1DEEA 1RZFL 3UYRL 1FNSH 1FAIL 4LOUC 4RNRA 3AAZA 1BP3B 1F4AA 2BJML 3ILPA 3TIEB 3VXUE 1BFOB 4Q97A 1ZVSB 1EJ6A 5ISZE 2VXTL 2AGJH 4MCZB 3BKML 1S7WB 4JDTH 3PP3K 4NKIH 4WFGE 2ZG2A 4MNHB 1K6QH 4TTDC 1LVEA 3EFDH 5EPMA 2X4SB 4D0CA 1AGCA 3WFBL 2GCYA 4HKZB 2G60L 2RQ8A 3RTQA 2YHGA 1N6QL 3IJSA 4NGHL 5KSVB 3LRHA 1OGAE 2EDQA 1KT2A 5T1LD 2ADIB 4AM0B 3MREA 1Q1JL 5I1LA 1MI5B 1MAJA 4H1LA 1O0VA 4QXTB 4UB0H 5EO0A 3GDBA 2Q7YB 4XNUL 1INQA 3O41A 2F53B 1G84A 4UOW0 4TUKH 1XGPB 3HFML 2QQNL 4LSRH 4P2QE 4BQBA 5L8LB 5IHUH 4NZRL 3ULSA 4YDKH 3FN0L 5ELIA 1Z9SA 3O2VH 4JFFB 5F6HJ 3KPPA 1UYWL 4MCYB 5KVDH 2JLLA 1G0DA 2DBLH 4NKOA 2VIRB 1QR4A 5E5UB 3SJVD 4H88H 1D7FA 3IFPA 4JDVA 4XPFH 1OL0A 2D7TL 1G7JB 5JQ6L 4ZXBC 3TBWA 1UEYA 3DUSB 2P1YA 3QHFL 3R06B 1QBAA 4R96B 3QCTL 1JN6A 4F33A 5FGRA 5A43C 1R3JB 1UWXH 4OKVB 2YC1A 5EWIL 4GKZA 3B43A 3MV7D 3TCXA 3DMMB 2DYPD 3MFFB 5FGSA 1G9MC 5BS0B 3Q6GL 1MEXL 3WDIA 5I0DA 4AZ8A 1HQRB 2Y23A 3ROOB 2Q8BL 2R1XA 3C9NA 4RRPG 5AYQA 1TVBA 2A77H 4RGNB 4ZAKC 2RBLA 3OXSA 1P6FA 1U36A 2VDML 4X4ME 5J9PB 5C9JB 4OSUL 4JN2B 5MI0B 4LNRA 1DDHB 4NRXB 3HI6H 1NC2A 4NQCD 3DV4A 5IVOA 5TPWH 4DK3A 4PJCB 2OJZH 3EJYC 5L2KA 2BVYA 3BXNB 4KJWC 2QR0A 3OR7A 5FYKU 4OGYL 1EEQA 2GJ6A 2GFBB 1IZJA 4X6DA 3MR9A 3RIFF 4FFZL 1YEGL 4JO1L 5IEHA 1G6RH 2DBJA 2MMXA 3IDIB 5EORL 2YUWA 1CT8B 3X12B 3EDDA 1DVFB 5ETUB 3LHPL 2UYLB 1VSCA 4MJ2A 3T0XA 3MYJB 3VXOB 4RWYL 4TSCH 4OV6F 4JFHD 1RMFL 3GHEH 4LKCA 1MCNA 3DX8B 5D1QD 4HH8A 4XNQB 4F15C 1I3GH 5CEXA 1YEJL 1MJ7H 1F90L 4KV5E 2VDNH 1UGNA 1P7KB 4ZYKB 3LMJL 3OKOB 3H9ZA 2R2BB 5J13C 2VAJA 3V0VA 4KFZC 4FQLL 4PJCF 3BD4A 5B8CA 1NJ9B 5CHNA 5D7SL 4R3SA 4Q58C 4HJ0D 4P9HH 4JZNA 1UWEL 3WKML 1D6VL 4HLZG 4EOWL 3A6OA 3C60A 4WI4A 1D9KB 3RUGA 5JNYA 3O6FB 4IMLB 3RX5A 1I4FA 2ADGA 1Y18A 4A2MA 5IF0B 1UZ6E 5DQ9A 1F6LL 3NA9L 4I0CC 5KVGH 4FQ2H 3U48A 4QWWC 5JA8B 3QB7C 2XNAA 4DOHB 1J8HD 4MLSA 2DM4A 2ORBH 3ARGA 4MHHG 3LQAH 2OTUA 4L8BA 3S4SB 2X6MA 5DI8B 1JNLH 3MBED 3RWFB 1JL8A 4I3SL 3ZE2E 1EH9A 2OLDA 3QUMH 1EGJH 1NBZA 3GSNH 4XB7A 1BM3H 2L4OA 3QEUB 5CBAB 1TFHA 4U1HB 4MJ4A 4P5TA 4PJ8A 3ARFA 4DWHA 3H9SE 3UTSA 5C0ND 2BXZA 4AT6A 4KKNA 1A1NB 3T0BA 2WMPA 2FLRT 3F8UB 2YD7A 4XAWH 4OZ4A 4N1HB 5DD5L 4DN4L 1AJ7L 1JWUB 2A6DA 3IFLL 3RGHA 2H9GA 1CD1B 3D69B 2GK0B 2JELL 4Z18A 1JTPA 4EVNB 1LP9B 4PB0H 3I84A 1TCRA 5CEZE 3C2AH 5DRNB 3TO4D 3U9PL 5SWQB 1BF8A 1FG9C 4HS6B 4G8GA 5C0CD 1T1YB 3U82B 1AR1D 5C08B 3VDAA 1KCUL 4JZJA 3U9UB 4XNXH 5JR1H 4S1SH 4CW1B 2EC9T 4X4XB 2OQJA 1OOAA 3WFHA 3N85L 2VDRH 3C09B 4X8JB 1JRHL 1KENL 3HG1D 1LE5A 3THML 2WLZA 5I8CB 3QEQD 1KB5H 4GBXB 4PGDA 4KK9C 2QEJA 5LWYL 1OTTC 3J8F7 4ZDHA 1KSRA 3LPWA 5HYFA 2Z8RA 3A0OA 1C5BH 3O81A 2HFEB 1OSPH 4MAYD 4YK4C 5SWZD 4XNZC 4IRSC 4ODUB 4NQSA 1V8HA 3MUZ1 4LCCB 3IGAB 1LP9F 4NHUB 4CMHB 5EOCL 4JFPB 4XNYL 3EJJX 5ILTL 3VW3L 2A1WH 3UX9B 3CH1B 4J3SA 4MXWH 5EN2A 1TQBC 5T3XL 5B4MD 3TN0C 1EEYA 5HYIA 3EAKA 5L6YL 2D3VA 2NY5L 4CN4A 5JXEC 1T2QH 1UXWB 1U8QB 1IGFH 1QSZA 3HZVA 4XT1C 3W9DB 4FQQB 5BOPA 2Q6WB 3QUXD 4O2EB 3QIUD 5IB5B 2X09A 5B8CC 4KVNL 3FMGL 4HWBA 3RVXC 3UJJL 1I8KA 3D3VB 4I9WE 3IAGC 4J1UB 1R0AH 1IRAY 2DQUH 2P8MB 4HG4J 2NR6C 4FNLL 4WFFD 1UACH 5DHYA 2W0KA 2IG2H 4N1CA 3C60C 3X3GH 4Z78B 1KPVB 3HE6B 4XP1L 2APBA 2MWCA 4P46B 3EZJB 3RVWC 1MJUL 3O2WH 4WI9A 3T09A 1A4KB 2YA2A 1NUNB 5E9DB 3VU2A 4ODHL 5AUMB 4DTGL 1KPUB 4GFTB 3O0RH 2R23B 2NLJA 5IROA 3UDWC 4ONHB 2DLFL 1QLRB 3ZKXB 1KV3A 1LO4L 4XAKD 1I7RA 4ZFZB 3U36B 1HDMA 3UTTB 1U3HD 3V5HA 4G7YL 2GSGB 4EI5C 5JW5B 4I18A 2ZUUA 2FSEB 3PL6B 1CI5A 5EIVA 4GJTB 3R8QA 2HTLD 2VLRA 1MIEL 4I0PA 4Y19E 5JXAL 3DX6B 4CBPA 2VL5B 3NMEA 4K9EL 4PJ8C 5DJAB 3B5HA 5CGYD 5KBNC 4OAWA 2C7UA 2PYFA 5D1ZC 1HHHB 4M1CC 5E6IC 3P0YL 2QSCH 1WC7B 3ZL4H 1JF1B 1FZOA 1INDL 5F1KC 4OQ1A 5GS0L 1FFPB 2YD8A 1X5FA 5E08H 3KPSE 4V1DD 4GAJL 2CO6B 3U6RA 3TIEA 4P23B 3MBXH 3I6LD 1ZVSA 4KTYA 5JTWA 4P2CG 3QRFM 1J88A 2Q86B 3W39B 1E4KA 4NRYB 1EHAA 3QP3A 5DMGD 1H3GA 5BJTB 3QO1A 4TOYL 3NAAL 4M7JL 2OK0H 4HKZA 2WBKA 2C3VB 3OJ2C 5KTEH 4K3EH 4X9GA 3I3DA 3DBXB 3V6FB 4IMKA 3A6BH 1KXVC 4AM0A 2H26A 1MI5A 3HR5B 4J4PA 1IGCL 4QXTA 2B39A 1JGEA 3KLDA 4X7FC 2EKSB 1FLRL 2Q7YA 1BD2E 4R0LC 5HVHB 4JM4L 4Z7OF 2F53A 5BZWB 1XGPA 1S7TA 1NQBA 2JIXD 4PRIE 2YOCA 3CD4A 1NAML 3X14B 5HHOB 1NSNH 4H0HB 2Y6SC 4MCYA 2V2XB 3T08A 3VFSB 3GGWA 3T3MF 5JHLL 1AKJD 3G04B 4N5UA 3B5GA 2XWTA 4Y4HA 2MCG1 3CLFL 1GPOH 1AO7B 2IF7A 4TPRH 5CILL 4FQPA 1G7JA 4ORGA 4PP1D 4ZD3H 4V2CB 4C57C 4ALAH 3KLHD 2NY0B 2ARJQ 3DUSA 4JN1H 3FRPA 1IAIL 3R06A 4R96A 5CJ8A 4OCYH 2B5IC 4POYA 2DMCA 2QBWA 4QRPB 1I7UB 5IW6A 3U1SH 1AIFA 2HT2C 3O6ML 5EBWB 2WQ8A 3CK0L 3OKDB 4HIXL 3OKMA 5ESVB 4ENEC 2EYRA 1FZMB 1FYHB 4D9QE 3RL2B 2NXYD 3O8XC 4GRLA 4M7LH 5MEND 3CVHL 4Y5XB 1TLKA 1NAMB 2Y36L 4NN5C 3ARYA 3QNYA 5JUEH 5E2VH 5J9PA 3HZYB 4OCSH 1OAQL 2X05A 4K94C 2ZUWA 5SX5H 1DUYB 5LJYH 2RCSL 5KSAB 5B39G 5DURD 3VI3F 3B2UC 2ADJB 1KGCE 3LEYL 2NX5D 1WQVT 4PJCA 1FRGL 1CLZL 1WGOA 2NY1B 3QRGL 4PJEE 1IGJA 1WITA 3M45A 1SEQL 3NZ8B 2DQCL 2V17L 3WHXB 3KLAB 1MVFA 2VABB 1WFUA 1CT8A 5L0QB 1YEIH 5FYLE 1MAKA 4WO4B 1OP3H 1DVFA 5ETUA 2UYLA 4KPHH 2NY4C 3MV9E 2E9WA 1P4BH 1NCBH 4FQXB 4HCRH 1A7OH 5H94B 1INEH 3DX8A 2ZUTA 2EXYD 4BJLA 4YJZL 3CVHB 1NC4D 1JPTH 3CPLB 5M94B 2XY2A 1KCRH 1Z3GL 3N1GC 5HGHA 2A73B 2R1WA 2MSPA 4LRIC 3TBTA 3IFOB 4NC2B 4HUUA 4X6EB 1NJ9A 3N1MC 3QQ9C 5F9OL 2EDKA 1KEGH 4G6KL 1VA9A 4Z7QF 4PJGB 5E1HB 5DZOA 4X9IA 2CKBL 4YBLB 3JUZA 3RNQA 1NBQA 1D9KA 3EYFB 4HS8H 3O6FA 4NOBA 3P11L 4TVPH 4IHOB 1HYSC 5LVEA 2E7CA 1MOEA 1A7RH 4O58L 3WNMA 1A14H 4DW2H 3UJIH 4Y1AD 1CGTA 4NUJB 2FATL 5C0JB 4QOKE 3UEZA 2G2RB 2HVJA 5HDQL 3OKEB 4U1JB 2CK0L 3GFUA 2Y25A 2VUYA 2J7LA 1QPXA 1B90A 3VFTB 1BJ8A 2YR3A 4ZFFB 3S4SA 5DI8A 1QFWL 5FYKD 3RWFA 4HUWB 5IVXE 4EI6B 4HFUH 1MJJA 3LRSB 2BC4B 3PWVA 3BH9A 4M1DL 3ARBD 3PGDA 4OGAD 4UBDC 4PJ5E 1IBGH 2DN7A 4X6BB 4F58H 2CD0A 4FXGA 4PJGF 3TIDB 2GSIB 3D85D 4LPVA 4UT6H 5CBAA 4YDJA 4LNVA 1KN2L 1YEKH 2JJUA 2R2EA 2J4WH 1DQML 3RAJH 1ZLVH 1RK0B 5KSBB 4XMLL 1JWUA 3DMMC 4OJFH 1C5DA 1Y6NR 3D69A 5IHLB 3P4LA 4NKMA 3TNNB 1V3KA 3KGRA 3RWHB 1T1YA 2W92A 1KJ2L 1DBJL 4LAJH 5C08A 1DLFL 1T89A 4NQDA 2R69L 4CW1A 3DYMA 1LO3L 35C8H 3O11B 5GGSY 3CFJB 4RGNC 3GKWL 5AD0A 4EBQL 1MLBB 1DTUA 4N0UB 1OAUH 4YHLL 2AV1B 4Y4KB 3MOAL 4JRYD 5MI0C 2FEEL 2V5MA 4LVOB 3JWNC 4L9LB 2VXQL 3D25A 3GK8H 5FGBA 5D7JC 4B7LA 3TYFB 1F11B 5KSBF 4FXKA 1KCLA 2BNQD 4LPXA 3F6LA 4MAUL 2HFEA 1QRNA 2JJWA 2PXYD 1OHQA 2C5DC 2AAVA 4ODUA 3IGAA 1RUAL 4EQ2A 3P4MB 3EIFA 1Q8MA 4NHUA 4G6FD 4HGKC 4M61B 3CH1A 1MPAL 3GSWB 3NFNB 25C8H 1CQYA 1J5OL 1KJ2B 4WVRA 5I1EH 5E7FA 3D18B 1MRDL 4G6AC 4NKDB 3HUJE 1C1EH 4G8FB 1U8QA 4PJHA 4QHMB 5DJXA 4KZDH 4D94A 5SWSD 3AM8C 3QIBA 5FHAL 4JKPL 4FQQA 3TH4T 4JPWL 4ODXA 4HV8B 1AXTL 1I7ZB 1YMME 3PHOB 1G0XA 2Q6WA 1BJ1H 1IGYA 5IB5A 3RKDD 2ATPB 3MLZL 3DUUB 2FR4B 5J89A 1W8OA 3BP5B 1E28A 3FB6B 1B6UA 1N64L 5MP6H 5I1HH 4KAQH 4FA8A 1HQ4B 4M9PA 1RFDL 4Z78A 1KPVA 2IAMB 3HNTH 2AJXL 3BESR 3O4LD 5DTFB 3HE6A 3QI9B 4RMSA 5T3ZL 1FIGL 4P46A 4L4TD 2I60L 4PJAE 5DQJB 1XF4B 1OP5K 2AJYL 3QCUL 2F8XC 5BRZB 2YXMA 1A4KA 4YXLL 3HI1A 5DZNA 2GJJA 5DC0A 3GNML 4XXCC 5FUCE 2D9CA 5AUMA 2BVQB 2EDLA 4KK8D 2R23A 2HTKD 3IJYB 3QUYA 5LCVH 4ONHA 4TNVK 1QLRA 4E41D 5B38G 2ESVD 4XVTH 4ZFZA 4Q6IC 4GG6E 4LHJB 3L5IA 4D8PB 3PL6A 4NCDA 4G6JH 3QULA 2X1QA 4NUGH 1PDKA 4MA8L 1QFPA 3ULVL 3QZWA 3HAEG 5C0BE 3X13A 4OI7A 1YJDL 2BFVH 5DJAA 1XH3B 3FKUS 4L4VE 4Y89A 3QXAA 2YRZA 3M1BA 5FHBH 4Y8AA 3H2WA 2UUDH 1FZKB 4B41A 3LKRA 1R3IH 1QSFE 1VFAB 2ZUYA 3PGFH 3NZHL 4LASL 1FFPA 5I17B 1VFUA 2NTSP 1UJ3B 3TT1L 1T89C 2V7NA 1LE9B 3GSQB 4P23A 2NY2D 4FQ1H 1PYWA 3QNZB 4NNXB 3S7GA 3C09C 1NMAH 1A8JH 2DQHL 5FO8A 4NRYA 3VFGH 5JW4N 1MCSA 2BNRB 2Z0BA 4Q7DA 4GBXC 5ACLA 4UQ3A 4P2OC 1E4XI 2A0LC 3NPZB 4KQ3H 4QTHA 4JFQB 4OQTL 3BPNB 5GZNC 1BVKA 3NABH 5CAYB 2XWBA 2AERT 3L3HB 1AFVH 4LCCC 4XVJH 1CDUA 3LKQB 5E24E 3MRMA 4KGLA 4CMHC 3T4YB 1FNHA 3PQYB 1U91B 1H3PL 1IEBB 2DQFB 2EKSA 4FG6C 2X41A 1JHKH 1VESA 2ENYA 4LSSL 4UAOB 3G5XB 4KY1L 1WJ3A 3B9VA 4GMTL 4PTUA 3ZKQD 2GTZA 4I5BB 2GUOB 3B2VH 4HIHB 5JO5A 3PIQA 2J6EL 2VB5A 4NSKB 4QYOA 1QA9B 4OB5L 3VXUB 4UDTB 1QO3A 5DK2B 3ULVF 3DJ9A 2QSVA 1EIBA 3QEGH 1AO7A 5CSBA 1XIWB 5CGMA 4MNGE 2R0WH 1GOHA 3FFCD 2ZUQB 1TXKA 5EU5A 2ZNWA 2CUHA 1DFBL 3TM6A 3FQWB 3HE6C 3KDMA 3X3FL 5GSVB 2Z93B 43C9B 1KIQB 4QHKJ 2RAMA 4F3FB 1A7QH 3BAEH 2VDKH 4QRPA 4LDEB 4Y0GA 1I7UA 5DJ6A 4G9FE 1Z2KA 3UTPE 2CUIA 3O3AB 5D72L 5E70A 4M6NH 1K8IB 3ZTJH 3L3JB 1QLEH 4F7EB 5I30H 4UIKH 4OZHE 2WWKT 2NY5C 2I07B 2BHUA 3F58H 1RZJL 4Z7UE 3ZKXC 4YNYB 2EDTA 4XPBL 1T1WB 2J8UE 3EHBC 4YAQB 1NAMA 5HYJE 1GH7A 4B53A 2CDFB 5ECJE 5J12B 3GSUB 1U8IA 1DUYA 1RJLB 1F4YH 3PL6C 4NO3B 2PW1A 5T1DL 5E0QA 2EO9A 4KDVA 4OFYA 3ALXA 1M05B 1Q72H 4OUUB 4GRMB 2LV4A 2OXHA 4GAYB 5DHVA 3O4OB 4YUEL 5AEAA 4F2MB 2LVCA 1K85A 5FB8B 4KDTC 5AYUH 4APQB 2DQIL 5JHDA 4YHNB 4WO4A 3VD7A 1HH6B 1NGWB 2AJVH 1BGXL 2NW2A 5A3IC 4R26H 3VXSD 2E6JA 2AQ1A 2LAAA 4FQXA 4PRHB 1RUMH 1MREH 3MACH 1ZWIA 4HXBL 5D8JH 1XCQB 3NH7H 1RU9H 3ES6B 3LN9A 4J2XA 4Y16A 3CVHA 3CPLA 4X6CB 1LO0L 4P23C 2EIBA 1N59B 2A73A 4QF1B 1B0GA 2CLVB 2QLVB 2G75B 5GGUA 4CADA 3V7AE 4X6EA 4UI2A 2XWJB 2KL6A 1I3UA 1I8MA 2P4AB 3CFBB 4GSDH 4K3DL 1KIRB 4PJXA 4BFIB 3CVIL 4K9EC 3OWEA 5EFIA 1UCTA 4ZOEA 2C4FT 4U33A 3EYFA 1A7PH 2WAHA 3WL9A 2VRAA 3SKUD 2M26A 2J5LB 5C0RH 4IHOA 4BSWB 1SM3H 2DL2A 2F54D 3T04D 2PUQT 3MV8B 3VDBA 4JLRB 1JYWA 4PRPA 4UQ2B 3VWKA 2G2RA 5E99L 4YHML 3ET9F 4U1JA 1QKZL 5GS0C 1ZEAH 4M1GL 4X6CF 3RDTD 4RFNB 5HVHC 3PDGA 5D70L 3T2QA 4TTGA 4LP4A 4L8CB 3HZKB 2X44D 1RIUH 2BNUB 4HUWA 4N9OB 3LOWA 3DI3B 4HWBH 2BC4A 3FZUD 1A6ZA 2ZCHL 1CGXA 2I25N 2HT4C 3MRRB 1HN1A 1CGUA 4X6BA 2XOTA 2EIZB 3S98A 4W81A 1SJEB 4LRNH 5FO7A 2GSIA 5HYSA 1MFBH 3AMLA 5C1MB 4I48B 3AC0A 5IFAL 4XMPH 2CKBA 1AD0B 3GRWA 2NY0C 2ZPKL 1YECL 1EUTA 4OI9A 4C83B 5DQDL 4OLYH 4EUPG 3CAFA 5KSBA 1CZ8L 1EAPB 2AS5M 2EH7L 1QFUL 4OF3A 4X80H 4X98B 4X5WA 2B8OT 1LEKB 3OL2A 4DGIH 3WNKA 1A7BA 5GGRA 2W1NA 5T1KA 1J1XL 2F5BL 3GMRA 4LF3A 4NP4L 1S78C 5HY9B 5CEZL 1MHPL 1ORSA 5IT2H 4Y5XC 5F7NC 4JPVL 3B8YA 3SQOL 1U8KB 3HCVB 2AV1A 3H7BB 3IF1B 4Y4KA 4Z9KB 3MRDB 4P2RD 3QPXH 5KSAC 5J7CC 2NZIA 4P57A 2EE9A 2IALA 5ID0A 3C2SA 4M5YH 1KLFA 2NY1C 1OAXL 5D96B 3TT3H 4PLNC 2QQLL 1F11A 3RVUC 4FTVD 4DZ8B 2VLMD 5KW9H 2A9NH 2WBJD 5L0QC 1QSED 1Q0XH 3B5TA 4WTZA 4WO4C 3H9SB 3SKJL 4P48A 1DBAL 4HKXA 3ZYJA 1WT5A 5FECB 1RHHB 4HEME 5IOPB 3DI2B 4RGMC 3NFNA 3GSWA 3D39B 4K7FB 4XP9L 4TNWF 3WJLA 4RWHA 1MCQA 1KJ2A 2YD2A 5C07B 1FNGA 4YXHH 3ULUD 3ZKNC 1F3RB 2HKHL 4WI2A 3T0ED 4G8FA 4QHMA 5IQ7L 3L95A 4JO3L 1K3ZA 1MFEH 1WCBB 4UNUA 2NNAB 3NFSL 3OXRB 5ADPL 3PHOA 2VNCA 1FN4B 1REIA 2YA1A 2ATPA 3DUUA 2FR4A 3BP5A 3FB6A 3ZE2F 4NM4H 4JVWA 5CP7B 3V6ZA 3G9AB 3EGSB 5KS9E 4YBLC 5IESL 3CSBA 4OGXL 1NGYA 3QI9A 2VTFA 4MXQC 4CNIA 5EZJA 2NY3B 4LOUD 2YMXL 2CLRB 4PJFE 3QDMB 3VWJA 4LL9A 5DQJA 4PUBH 1KB9K 2Y72A 1XF4A 4MJID 4G8IB 4QRRD 3UYRH 4J3XA 3LN5B 5BRZA 1FVEB 1FAIH 5IK3B 3MRNA 3V0WL 1VGEL 5JOEA 1RIVL 1SJHB 1S7UB 4RBPH 1BZ7B 3HS0B 3M8OL 1T0NA 4JKMA 1F6FB 2VXTH 1YDPA 1L7TL 4PRBA 3MRCA 3ALWA 5EZIH 3VRLE 4KDWA 1FFQA 3LH2H 4GRWB 4IOSD 4YZFF 3CLEL 4F7CA 2J12B 4S0TD 2P5EE 4HD9A 4NGHH 2DQJL 2P5WD 3CSPA 2QKIA 2XN9E 3SBWA 2DTSA 4N0YL 3MA9L 5C0AB 1L0YA 5LQBL 4WUUB 2NY6B 1D5BA 1U8MA 5IV2B 1MJ8L 2OM5A 4FRWA 4ZUWA 4GXVL 5I17A 4U6VH 1UJ3A 4UINL 1MCIA 2FIRT 3WDHA 4KMQA 1BAFH 2CSPA 3HNVH 2A9ML 3BD5A 4GRWF 4ZXBD 3MJ9H 2XRAH 1S8DB 5D7LA 2UZIH 1IC5L 1S9WA 1PKQE 4ZS7L 4LVOC 2Y5TB 5CJOL 3BZFA 2VLJD 3VFVA 4L9LC 3JWDC 3QHFH 4JFXA 2GITA 5K9KB 3EOBB 4K07A 3QDJE 4PJ9A 5E8OB 4KI5E 4YC2B 1IL1B 4JFQA 3WFDH 2BY1A 3T4AA 5TH2B 3QEHB 2ZUVA 1NMCB 3MZTA 4JM2D 3LKQA 2OYPA 4ZAKD 3T4YA 3PQYA 4XWOC 1WWBX 2P24B 2YPLE 1U91A 1WT5C 4NZDA 2DQFA 2Q87A 1ZS8A 2XKSA 4AL8H 1YN6B 4OLZH 3MNVB 1JGVL 1Z9MA 3SO5A 3WIIL 4PJIB 4MZ2A 4U1MB 5IW3A 3TBVA 2WIMA 4KJWD 5L7XL 4I5BA 3QXDA 4HIHA 3VFWB 3QUKB 3KPSB 1TJGL 5EOTA 3SO3B 4Y5YB 4LHUD 1J9CT 4NSKA 3VXUA 1S5IH 2DLEA 4XVSH 4UUJA 5DK2A 2VDPH 5FEBA 1J0ZA 5ISZA 3LN4A 1E4XL 2WUCL 3GJFK 1CICB 1HSAA 1AH1A 3C6LB 1KJMA 1H3VA 1JV5B 4ZG1A 4JFED 2H8PB 4OQTA 5TDPA 1JTOA 2IAMC 1JUFA 3LHPH 3BQUB 3QI9C 4HMDA 4R97C 3WNNA 3DETC 2HFFB 4WGWB 1PSKL 4NPYB 4MD5B 5D7KE 3MRKB 4GAFB 5SX5K 3JSSA 1D5XB 1B6DA 5I1IL 5E4EB 4L3AA 1YEJH 4NM8L 1OGAA 4YQXH 1F90H 1BQHA 1HSBB 1TJIL 2NMSA 2R56L 4PJIF 5IMKB 5J1AB 3L3JA 2JJVA 4ODWB 2FEDC 2I07A 1U8JB 3T77A 1E27B 4ETQB 3NCJL 5BW7C 1AHWB 2SEBB 4YNYA 4XMKL 1UWGH 4YAQA 5TE6H 1Q9LB 5DC9B 4OF5A 2J6EA 3VGDA 4YFEA 3DX7B 1RJLA 1UWEH 1JFQL 1X5HA 4NO3A 4P2QA 4NC1C 1OP3K 3NIDE 5IFJB 2D0HA 4KJYB 5JLZB 3NPSC 1M05A 4GRMA 4GAYA 5L9DH 4OF0A 3SBWC 4QWWD 2X9YA 3KYMB 4APQA 4LCYB 5DEFA 3L3OA 4YHNA 3FO0H 4MQXC 3VG9B 1Q9WB 1CGYA 1EMTH 4GQPH 1S5HA 1U2HA 5F1IB 3L6FB 4Y5VC 1PZUB 4ODSL 4PJDE 3VJ6B 3BW9B 3WSQL 1XCQA 1U93B 1UJ3C 5I8KH 2HN7B 2QQKH 1P7QA 1BFVH 4QRUB 3SPVB 3VFPA 5A2LH 4WI8A 5D2LE 1N59A 3RA7L 1A7NL 3ARDB 3U4BL 2CLVA 3HC4H 1D5IH 3KXFD 5EU3B 2X70B 4HJGB 3CFBA 3GIZL 5CJBA 4X4MA 1KIRA 1HIML 3MUJA 4MJ6B 4BFIA 3W9EA 1NEUA 3ULVC 3OB8A 2ITDB 3BPOB 5IJKC 4K7PH 1FVCB 3VFMB 3OBAA 3T65B 4DN4H 2ENSA 1YZZA 2BHYA 3LAFA 2V7HB 3SJVE 5D2NE 2R0KL 3FB5B 3H3KA 2YD5A 2FH6A 1HNFA 3SKMB 1O5DT 1MHEB 3HKFA 3L3KB 4JLRA 4OLUH 4Z7VB 3EKCA 5T1MB 4F7MB 5HI3C 4QXWA 4QY8B 3S88H 5FCUL 2J88H 1NC2D 3MV7E 4UAOC 5TGBA 4FABH 3ARQA 3B3IB 1NDGB 2Z9TA 3F7YA 1EAJA 2ADFL 5D6DA 1WFTA 4QHNB 4L8CA 5B22A 4KTEH 4RAVA 1FH5H 4XCNB 2BNUA 1OTTD 5I66A 2OL3L 3EYVB 4XNMB 2PCPB 5FKPA 4N8PA 1I8LC 4KZEL 3MRRA 3H9HB 1CXIA 4IRSD 1SJEA 4XP5L 2Q76B 3IDNB 5BVJB 3SE9H 4XCCH 5DWUL 5AWNH 3MNZB 3MROB 3U4EB 1A9EB 1AD0A 1XIWC 2YRPA 2O5ZL 2ZUQC 4NQCE 3VE0B 2YPKA 3TN0D 3AREB 4K7PX 4Z7VF 5JXED 3CC5B 3KPNB 4OFDA 5B3NA 4RDQF 4X98A 3JUYA 2BERA 2XA8L 5FCSH 1EFXB 4P3DA 1LEKA 2VZUA 2DTML 2HJLA 3MOBL 1FYTD 4BZ2H 3PGCB 1DLHA 3VFRB 3EYOB 3UPRA 3QFDB 2VZTA 2V2TA 5HY9A 3LKOB 5E2TL 4G7VL 4JHWH 1XF2B 2NR6D 1AGFB 4JFHE 1U8KA 3C60D 3UJJH 5J12C 3D2UB 5E5MB 3G6JE 4Z95L 1NL0H 3ZDZE 1TETL 1MCDA 5FOBA 2MCPH 3RVWD 2MOVA 3O4OC 4U6XB 4JKKA 4DZ8A 2Z8SA 5TQ2H 1T66C 5F72S 1DEDA 3RZCB 4APQC 3NCYS 1VDGA 2IQAB 3E6FB 3H9SA 4I3RL 4ODHH 4DTGH 4JFDD 5FECA 2JB6B 1RHHA 5IB1B 5IOPA 1F4XH 3RGVB 3PJSB 4S1DC 1PX4A 4EI5D 4GW4B 4K7FA 5ITFB 5IVZB 2H32H 3N06B 5IB2B 1QEWB 2FD6H 4G7YH 5ITBL 1NFDB 1RZJC 4TUJB 3SGKA 5ADOL 4HWZB 4I3GA 2CGRL 4AIZB 4L5FH 4FZ8H 1CVSC 4LKXA 4PJ8D 1UM4H 3ARFD 4MA1B 2BVOB 1J8HE 4PRAA 5D1ZD 3WIHL 4R4NC 4M1CD 5MHSD 4JY4B 5CP7A 5FF6A 2BCKA 4LQFL 5CJXA 4MXVF 3SDAB 3SDXE 5CIPA 2JJSC 4ODTL 5HHNB 2PTUA 3OKKB 2DQEH 1NBYB 4H5SB 2J5LC 3UTQA 1UJTA 2D7MA 1P9MC 2V9QA 1M4KA 1W0WB 3BMVA 4G8IA 3LN5A 3T0AA 1FPTL 3LDBB 5IK3A 5E8DL 2Y06L 1R5WA 3MRIA 3RPKA 2KPNA 1QOKA 4LLMB 5EOQL 2X4TB 1NFDF 3MXWL 4K8RD 5I76A 3DTXA 2DKUA 4YXKL 5IVNA 3PHSA 2R4RL 3H9YA 1I7TA 2AK4D 1J0YA 1BBJA 3INUL 2V2WB 5F21B 4TOYH 3NAAH 4ONFH 5CP3A 5C0CE 5HHMB 3EO0B 5CKGA 1N5AA 4V2BA 2IFFL 4PG2C 4HWEL 4MA3A 2VSCA 3FO1B 2HVKB 3B8SA 1NBVH 1DE4B 3TA3B 3MX0A 4CVWA 2HLFC 1EZVX 3RWIA 5CS7A 5E00A 1T6VN 4QHUB 1UQSA 1U92B 1IGCH 1CG9B 2XXCB 2PN5A 4WI7A 4WUUA 2BVUA 2P8LB 3WN5B 5GJSH 1IFHH 2CXGA 4LLDB 5J1SC 1I1CA 3RY6A 2Y6SD 5SWZE 3N1QC 3ROLB 3ULUH 4WHCA 2AKRB 4EEEA 2DWEB 2DIJA 3KYAA 2UZYB 3N1PC 1NAKH 1X5IA 2VLLB 2VQUA 2COQA 1KLUA 3RPIB 1S8DA 4XP4L 3U0TB 1FL6A 4H1LG 4OM0H 4ODVH 3EYUL 5DHVH 3PHQB 4GW1B 3EOBA 3GBML 1FNSL 5E8OA 2X7LB 5D96C 2HT2D 4K23H 1G7HA 4P3CH 4ENED 2KH2B 3CK0H 1AGDA 15C8L 2AGJL 3O8XD 4WFFE 2WP3O 1E0OB 2P24A 4JDTL 4NKIL 2AEPL 3P9WB 4YPGA 3EFDL 2QADB 1NCDL 2Y36H 3B2UD 3BUYA 5C7XH 1QSFB 2H3NB 4WWKA 3VGAB 3BPCB 2EC9U 4GW5A 3KPSA 3GMPB 4BQ9A 1I75A 1KJVA 3QRGH 4OZFA 3IU4H 1VKXA 4UB0L 1KELL 4H0IA 2EYSA 4XAKE 3KPOB 3KPQB 3UO1H 2B1AH 2NY4D 3H3BC 4LBEB 5CJXC 2H8PA 5J56B 2Q20A 1GVIA 3BQUA 3DSNA 4C56B 3EDKA 3BEWB 4MB3A 3K74B 3RX7A 1YNKH 2NY3C 5IHUL 4YDKL 5LXGH 5I18H 4MD5A 4WDIA 3O2VL 4XHJD 3MRKA 4YE4H 2FX8H 1X5KA 2ICES 5EO9B 1D5XA 2A38A 4LMQE 2DBLL 1CE1H 4XPHH 4Z7NE 2Z8VC 4H88L 5KANI 2RIKA 5IMKA 4TNVF 1GZPA 4LCWB 2R0LH 3WS6C 4ODWA 4XPFL 1YNTA 1Z3GH 3QQ9D 5C0FB 5FFLA 4MX7B 1E27A 4PREB 2SEBA 2EE6A 1KF9B 3H42H 1G7QA 3MLWH 1Q9LA 1QSVA 1CLOH 5F9OH 5JIKA 5GJTH 3D0VA 1TZHB 2EICA 3JBG7 3DX7A 3ARXA 1JI1A 2X2YA 4PRIA 4DVRH 1MELA 4KJYA 2CKBH 3JVGC 1HYSD 4HIIB 3GRWH 4YIQB 1JHLH 4CVZA 4LSUL 2VN4A 2XZCH 3I3EA 1MI5D 3I6LE 2BRQA 4KHXH 3P11H 3OJMB 5HVGB 2IJ0C 3I85A 4YHKH 3U83A 2IBZX 4LCYA 3LPGA 2W60B 2NY6C 1PD6A 4PRNA 4POZC 3ZE0E 2OSLA 3HI6L 3F12B 3PDOA 4HEPG 4NO0A 1T1XB 3VRIA 1H0DB 5F1IA 1RURH 3L6FA 1O7VA 1CXKA 4JFFD 5TPWL 3C5ZB 3D0LB 2OJZL 4G9FB 2FYYB 3VJ6A 2Z31B 4YDLC 5AG9A 1ZT7A 5GZOC 3EW3B 1U93A 2YN5A 2HN7A 3I75A 1S7QB 1G6RL 3SPVA 3MUGB 4GQ9H 3EJZC 2BSTB 1AY1L 1RK1A 5FGCE 2WINB 5GSRB 1D6EA 5FK9A 4PPTA 1LGVA 1B0RA 5DVKA 2V5YA 4OLWH 2J8UB 5EU3A 3ZMRA 2X70A 2VOTA 1V7ML 4XCEB 5M7QA 4TSCL 4LEOA 3DMMD 2ITDA 1DQMH 3GHEL 3Q5TA 3ABZA 1FVCA 5BS0D 5E8PA 2J8OA 1MJ7L 2V7HA 5F8QC 3RVTC 3SDCA 3FB5A 3BEVB 3CX5K 1GSMA 2XXMB 1JF6A 1MHEA 3B6SB 5F7DA 3TJEH 3PP4H 4Z7VA 4RGND 4F7MA 1R5VB 2C1OB 1B0WA 1A6TB 4NOFA 5LAXA 1TENA 4P9HL 4FP8H 3GKWH 3MV9A 4EBQH 5FDWB 1NDGA 5LGHH 1G6RB 4QHNA 4G42A 2ARWA 5DJYA 3DXAB 1MY7A 2J8UF 2F58H 1FFNB 2VXQH 5EUOE 4ZUTA 4Y5YC 4D0BB 3H9HA 1JWSB 2ZSWB 3W2DL 4FQ2L 5KVGL 4HXAL 4AH2A 3F7QA 5BVJA 5MENE 4OFPA 4PY8J 1CICC 1DVFD 1T4KB 2ITCA 1FC2D 3MROA 3U4EA 4EUPB 3C6LC 2P49B 1YQVH 5CJQH 5DD1H 3AS2A 2ORBL 2VITA 3VE0A 1IQDB 2W9EL 3K8KA 3BQUC 4C59B 2NX5E 3ARSA 1OSZB 3AREA 3GMOB 1JNLL 4HHAA 1MPAH 3CC5A 4G6AD 1J5OH 5HGBB 1EFXA 2AQ2A 3QT2A 4HZAA 5E4EC 1EGJL 4GS7B 4M48H 3GSNL 1D5ZA 1MRDH 4AQOA 1BM3L 3VFRA 4RFEA 3EYOA 3QFDA 4QOKA 2BX5A 2LFGA 4XWGH 3LKOA 2N1KA 1YUHB 1AHWC 5J0BA 1AXTH 5DGRA 3UBXA 2KQMA 2VZOA 3B9EA 3ZDXE 2OL3A 4XAWL 5A2JH 4KXZH 1D9KD 3D2UA 4MNQB 3O6FD 5E5MA 1IARB 3WHE0 1OTUC 4U1NB 5HSFA 5IVXA 5D1XA 4N8VB 5I74B 2X4RB 3O9WB 4IBLT 3C2AL 2HA1A 4PJ5A 4KJPC 4KVCH 2OXGA 1JWMB 2I60H 4U6XA 1EDQA 1OPGH 4TSBH 5GRUH 5GQBA 2QSQA 4XNXL 5JR1L 2AJYH 2CLZA 3QCUH 4S1SL 5HBBA 3U2SA 1W8NA 1IGTA 3RZCA 4LQ1A 2QV2A 3Q1SH 5EDXA 1IAOB 3VG9C 3E6FA 4KGJA 1JGUH 2VDRL 1HHKB 2ZSVA 2JB6A 5A2FA 3BYTA 3QUMB 3RGVA 1TITA 3PJSA 1GGIH 3GSNB 1KB5L 4GW4A 3H3PH 5ITFA 5IVZA 1QEWA 3FN9A 2WV3A 4BKLB 4KRNA 5GXBB 4Y1AE 4NC0B 1GAFH 1C5BL 4AIZA 1OSPL 3FT4B 1IKNA 3FONB 2ZCLH 3LCYA 2VLKE 3ARDC 1VCAA 2BVOA 1PX3A 4QT5B 5C9KA 1YJDH 1CFQB 4GAGH 1T22A 1T83A 4MXWL 5DDHB 3FOLA 3BPOC 5FYKE 3UTOA 3SDAA 4RBPK 3OKKA 3F7VB 3RY4A 1HXMA 5MEQA 2PW2B 5TE4H 3RIAK 4XRCB 5C08D 1IGFL 2IADB 5IIEA 1ZANH 1KFAH 1Q94B 5HDOA 1KB5B 2LTQB 5H37G 4LLMA 1J0IA 2X4TA 4IOIA 5F89B 2DQUL 1N7MH 4HS3B 1G9EA 2IG2L 3P77B 1HYRC 4GBXD 1U8NB 2A0LD 2A6KB 4F9PA 4WNQA 2A74A 2V2WA 4LCIH 1OGTA 1IGIH 1ZVHA 5GZND 3SE4C 3HUJA 5C71A 2FJFB 5B3JF 2GTWA 5FKAA 3WIHA 1MAMH 1F45A 1NCWH 2HVKA 2IFGA 3TA3A 1OWWA 1YMMA 3E0GA 3G5VA 3O0RL 1NCCH 4JRYE 4M7LT 4QHUA 4N5EC 1BWWA 1KB9J 1H3PH 3AREC 1S7VA 3QNXB 5DRZB 1PAMA 5C0GB 5D5ME 3E8UH 5ICZB 3WN5A 3HRZB 1U3HC 3IJHB 4PJAA 4RMVA 4LLDA 2FBOJ 3FB7B 3BWAB 4N90D 3ROLA 5ACMA 2BSED 3GMNB 3IS1X 3M17A 1VEPA 3D3VD 1A21A 1UH4A 5F93C 4AMKH 2VLLA 3MGTA 2MTPA 5E94B 3RPIA 3U0TA 5J6GB 3T2PA 3HE6D 2EEBA 2QSCL 4P46D 4GG6A 3ZL4L 4GW1A 4IM8A 3MMEA 1GRWA 5IQ9A 1ZTXL 2X7LA 1HEZA 5E9DD 5E08L 1IM9B 5L8JB 2P5EB 4AYFA 5T3XD 4ZSOE 3WNOA 3TGXA 4HIJA 4KK6C 5F1SA 5D72H 5C0BA 3GMMA 4QRQB 1OAZH 3D48R 3AROA 3EHBD 1P5VA 1TZGH 2Z35A 3ARUA 4EXKA 3UTTD 3O4LE 1V7NH 1SVZA 4L4TE 2OK0L 3PL6D 1CE6B 4NZJA 1G7IB 2H41A 4MWFA 4O2CB 4MVBC 1QSFA 5KTEL 4LMQI 3ZO0A 4NBXB 1BOYA 3BPCA 2IMNA 4NN6B 2L7JA 1IKNC 3GMPA 1MCRA 3A6BL 3OSKA 4OIIH 3LV3A 2GKIA 4E41E 3VXRB 2Y5EA 3WDJA 5DEZA 4YUEH 4U2YA 3KPOA 3BVNB 3TV3H 2YWZA 5F6IB 5A3ID 4LBEA 5HPMB 4W68A 5DJ2B 3SDAC 5I71C 3I2CH 4NQEB 1SYVB 4C56A 1FCGA 1WIOA 3BEWA 3K80A 3R8BB 3NGBB 4JJ5B 2C3HA 4Y2DB 4U6HB 3ECBA 4A6YH 2EIDA 5K33A 3LDBC 5EO9A 4P23D 3WFCH 1SBSH 1H15A 3JWOH 2AEWA 1UADC 1LO0H 1CR9L 1CL7H 5JPNB 1OLZA 3ZZ1A 5C0FA 1VGKA 4MX7A 4ALAL 2XIDA 4PREA 4PD4K 4JN1L 3MLSH 1KJ3H 5DJDB 4OCYL 5H35A 5DC4B 3KS0J 4R2GB 1XZ0A 4F9PC 1UM6H 3CVIH 3U1SL 5FYJH 3VGFA 3E2HB 1XF3B 4HIIA 4DVBB 3B4NA 4YIQA 1YEEH 4Y4FB 1T1ZB 4U7MA 4J12A 3OJDA 5EUKA 5C8JB 2WIIA 4FMKA 1L9NA 2VYRE 2I5YH 1JPGB 4TYUA 3MA7A 3L5WB 3U46B 4M7LL 5IB4B 3O2DH 5GS0D 2DS4A 4OI8A 5A2KH 2W60A 5E2VL 4PR5B 5FUZH 4P4KB 5E99H 4YHMH 2C9AA 2PF6A 4MS8C 1UVQB 5HVFB 5GHWH 2EDFA 3C5ZA 5HHOD 4G9FA 2FYYA 3CFDB 2Z31A 2HT4D 4CGTA 4PJBB 1NCUA 4LU5H 1JHTB 1S7QA 1RJYB 2W9LA 3MUGA 4G3YH 4XBEH 1AO7D 1ZXQA 4OZHA 2CRYA 1F58L 1YEIL 2NY0D 5GSRA 4Z7UA 1HINH 5BMFL 2FL5A 2J8UA 1YY9C 4XCEA 3IETB 4O2FB 2ZPKH 4OKDA 1NCBL 4ZFOL 4QRPD 1A7OL 2EDEA 1ZHBA 1INEL 1W0VB 1RZ8A 4J3OC 2OCFD 1GGBH 5F3BA 1JPTL 4P5MA 3F65A 3BEVA 3S4SG 5MEPB 5H2BB 5JIPA 1S78D 3B6SA 4MA7H 4BYHA 4JGUA 2A2QT 3MRJB 4HK3N 1HI6A 2A83B 3FFCE 1OWRM 1R5VA 2C1OA 2E3VA 4PV8B 5ICYB 3V5KB 3DUHA 4XCYB 1HWHB 4PJBF 2FECI 3QFJB 4Z0BH 3FRUB 5KSAD 4BK5A 5FDWA 3SQOH 2QHLA 5DA0B 4GLRH 1G6RA 4OFYD 3L3GB 1LEGB 3DXAA 2NY1D 3DLQR 4TVPL 4PGEB 1JPSH 1P53A 5IHZB 5ERWB 3RVUD 5IG7A 5GGTA 4D9RD 1ED3B 1A14L 5D2LB 3UJIL 4DW2L 5CSZA 4YEFA 4L3EB 1FP5A 2XZAH 5CIPH 5F7MC 4W70A 3AS0A 4WO4D 1YYMH 4LGSB 2YKLH 1QLFB 4FQXD 3NIFE 1IQDA 1DP0A 3D9AH 1DBAH 1NCNA 1OSZA 1VFMA 4EZMA 3WKNA 5D2NB 3CMGA 1IBGL 3DURA 4LDLB 3CJJA 4F58L 5SX4H 2G5BA 4LSTH 1K4CA 4GMSH 4UT6L 4E5XB 4GKNA 2B2XL 1YEKL 2AV7A 3NFSH 1RVFH 5ADPH 4Q9RL 4JKWA 2DM7A 2J4WL 5GS1A 5FV1L 3RAJL 1XGUB 2YD6A 5EU4B 4OJFL 1YC8A 1DQQA 4U1NA 5FDYA 5IMLB 1BQSA 1G7LB 2HFGH 1W2KT 4L3CB 4N8VA 1BZ9A 1JPFB 2X4RA 4PFEA 5KN5B 2YMXH 1JWMA 4LCUA 3VD9A 3BT2H 5C0IB 3SGJC 1QHPA 2DMKA 1M71A 4NYLB 4H8WH 35C8L 5K9JL 1T3FB 1YA5A 1EVUA 1V5JA 1VGEH 3GMLB 1IAOA 2BVPA 1AGEB 4U2ZA 3MCG1 3CH8A 3O3BB 5LG1A 3MCLH 1NEZA 3TZVA 1I1AB 1HHKA 3HC0A 2Z91B 4YO0B 1EGJA 3GSNA 3P40A 1T5XB 5JZ7C 3MCKB 2Z31C 2F54E 3GK8L 2YPVH 2ICWI 3DSFL 1Z6JT 3FT4A 1I8IB 3FONA 1HHIB 3EDJA 2VH5H 4NHCH 5D6CB 5I19H 2JB5H 3K2UH 3GM8A 4QT5A 4YDVB 1CFQA 3UC0H 25C8L 4N0FA 5F7EH 2L7UA 1MUJB 4HLJA 5K9QI 5D7IE 4H26B 5LQBH 3F7VA 2VWEC 5I1EL 3JTSB 3HMXL 3VMOA 1C1EL 4KZDL 4ZPVA 2ICEB 1MJ8H 4XRCA 1X5XA 2OZ4A 1BOGB 1RZGA 4LSVH 4H0GA 1KB5A 1FGNH 3V9FA 2ZKHH 4Y4KD 3QIWB 3QZWG 2A9MH 5I1HL 5F89A 5MP6L 5JOPD 4HS3A 3AMKA 3EDFA 1A5FL 3QA3A 5DSCA 2HJKB 1NGQL 3HNTL 2ERJB 4UV4L 5TE7H 1DJSA 4OZFH 4I4WA 1F2QA 1MVUB 1DEEB 1IC1A 3R1GL 1ZV5A 1UEMA 1UH2A 4RNRB 3AAZB 1H8OA 4OZGE 2YK1H 1RUKH 3ILPB 4XWOD 1JJUA 2KZWA 5HHXH 3OKNA 5LCVL 2LU7A 3DYOA 2C4FU 4P2RE 5CZKA 2HH0L 1OTSC 2UY6A 1FE8H 1X7QB 4XVTL 5F6HI 5KS9A 3N1FC 1RD6A 3QG7H 5EPMB 1YYLL 3HRZA 1NLBH 4G6JL 4LLWA 1JTTA 3RTQB 2VLME 2AXHA 4NUGL 3FB7A 1F4WH 5I6XB 3ARVA 4X0KB 4BK4A 1QSEE 1MHHA 3V4UL 3GMNA 1A2YB 1KT2B 2BFVL 5C0EA 3T8XB 5I1LB 5CMAA 3TC9A 4X7DC 1R3LA 4P2YA 3SEPA 5K59E 1FZJB 2IAMD 4P59H 3BUTA 2NPLX 3QI9D 3SN6N 3ULUE 3DETD 1R3IL 4PGBB 1INQB 3O41B 3T0EE 5I74C 1XR9A 3O9WC 5BRZD 1KXQE 2IPUG 2JTDA 4JO2H 3ULSB 1E6JL 3W5MA 1IM9A 2GAZB 2P5EA 4HPOH 2R15A 1KC5H 4PTTA 4P4RB 1CDGA 3LQAC 4NKOB 2FEDD 4FQ1L 1EHNA 4QRQA 4JDVB 2D7NA 3ORJA 1NMAL 3MRQB 4XCFH 3VMPA 3MUY1 3PF2A 4PGZA 4OBRA 1JN6B 4F33B 1CE6A 1A4JB 5KVMC 1QVOA 1G7IA 5INDA 1VFOA 4KQ3L 4O2CA 4QXGH 4QRRE 1A0QH 4GKZB 1NFKA 2B7DT 1EPFA 3QHZL 4M7KH 1AFVL 5HXMA 4XVJL 4G80B 4IDJL 3VXRA 5IMOA 2R1XB 4MQXD 4WTWA 5DMKB 1T04B 5CGTA 4IRJA 1A6PA 5DJ2A 1PKQA 1JHKL 4Y8DC 1BHGA 2XICA 4OZIE 4OBSA 4W6XB 3QDJA 4CJ1A 1WLHA 1II4E 4MB4A 3B2VL 4U6HA 5FYLH 5L2KB 2P5WE 3BKYH 2GJ6B 4BFBD 4HZLB 3MR9B 4ZFGH 5CLWA 2LTQC 3HZMA 2DI7A 3QEGL 3VXME 2R0WL 1WIUA 2BNRD 4GKOA 5DJDA 3RBGA 3ULVD 1U8OA 3IT8D 2Z4QB 3G6DH 1A7QL 1HIMH 2O93L 4LKCB 3NCMA 1XF3A 2W0FA 4DVBA 5CEXB 2AEQH 4M6NL 1YEHH 1QLEL 1BX2B 1XMWA 3PQYD 5I30L 4R9HA 1JPGA 4UIKL 5HI3D 1DQTA 5I8EB 1V3LA 2VLJE 1S9KC 5CHNB 4R3SB 4PR5A 4P4KA 3ARRA 1U58B 4JZNB 1F4YL 3OF6A 5FCUH 4D9LH 4YH6A 4AIXA 3SDDA 5JNYB 5I2IA 3MRGB 5F9WC 1NANH 2RJMA 3VXUD 2OL3H 4PJBA 1WAAE 1RJYA 2Q8AH 4H20L 1G7MA 3DHMA 1KBGH 1XIWD 3ARTA 5AYUL 5KAQF 4WFGD 4WFED 1I1RA 1VEOA 4K7PY 2AJVL 1HCFX 1DR9A 4JY6B 4R26L 4O2FA 3K1KC 1RUML 2B1HH 1MREL 3ARGB 1RUPH 1FSKB 5GIRB 1NLDH 1W0VA 2OTUB 1BIIA 4ZUUA 3NH7L 1RU9L 4KH2A 3KJ4C 1PQZA 1ZAGA 1JRHI 4DZBA 1NBZB 4PJ7B 3LPFA 3F62A 4M6MH 4AG4H 4X4YB 4HJJL 4PV8A 5ICYA 1A6WH 4JJHA 2NCMA 4P5TB 4G7VH 4PBVC 3QFJA 3UTSB 1FDLH 2HJFB 3FRUA 3ALPA 2EDBA 3FAXA 4OZ4B 2A6DB 3C6SB 2H9GB 2O5YH 5C0RL 4NN6C 4Z7WE 1SM3L 3PV7A 1VFBB 3UJTH 5DEGB 1TCRB 4L1HA 1ED3A 5D2LA 1R24A 2O5XH 1T66D 1X5GA 3CFCH 3DGGA 3Q5OA 4L3EA 3VA2C 4G8GB 4APQD 4ZFOA 4JZJB 4F57H 1CGSH 1SBBA 5DVLA 2OQJB 1QLFA 2PNDA 4PRHD 4I3RH 1F2XK 3IDUA 1AC0A 3NGBC 4PJ7F 1LE5B 1PJ9A 1RIUL 2H45A 4OT1L 4Y2DC 5HDBE 2O26U 1L7IH 3MLUH 2DM3A 2ZCKH 1BBDH 4PGDB 3SJVA 5D2NA 3VI4F 2LABA 1YPZB 3ZE0F 2FECL 4ZDHB 3QDGE 3FZUC 1MFBL 2CGRH 4E5XA 5IGXL 4X8XA 1UB6B 1MFDH 3Q6FA 4HKJA 1CDHA 4NQXA 1XGUA 4DEPB 1K5NB 3MV7A 4R2GC 4Q74A 1TJHL 4I13B 4WTZG 5EU4A 3PG2A 1UKQA 4X80L 5IMLA 3E2HC 5EU7C 1G9NC 3WV0A 2HP4A 2GYSA 4L3CA 1JPFA 2IPKB 4Y4FC 3MV8D 2W91A 2X4QB 5EUOB 2APTA 3DRQA 5KN5A 4KKAD 4X4ZA 2EDJA 5C0IA 2VZVA 1LHZA 5HDLA 3KXFE 3C08L 3HZVB 4NYLA 4I8DA 3JTTA 5TQ0H 4ZPTB 1DQJB 4HGMA 5ID1A 5IT2L 5E8DH 3GMLA 1YPZF 3O3BA 4P4KC 1I8KB 5EOQH 4F37F 3MXWH 4YO0A 2VO5A 3Q3GB 3QPXL 4M4PA 3SE8H 5EZOH 3MCKA 4I77H 1ZA3A 2HRPH 4M5YL 4YHIA 5IB3B 3WIFA 4DFIA 3INUH 2MKLC 3TT3L 4XPTH 3WJJC 3OZ9H 4KK5C 2UY7A 5KW9L 2HLFD 2A9NL 1I8IA 3IRZA 4M03A 4FXLA 1HHIA 4QRSA 4LLYB 2X4OB 4HWEH 5D6CA 1Q0XL 5EUOF 1G0YR 2H1PL 1PLGH 2VXVH 2NLJB 3O6KH 1CU4H 4P0DA 5D1QA 4J3WA 1MUJA 3G6JA 3QUZB 5ESAA 2WNGA 1HDMB 1WBXB 3EOAA 4Z6AT 3JTSA 4HQQH 4HMEA 2ICEA 3DVGA 1MFEL 2VLRB 3WNLA 4I0PB 2UV3A 3V95A 3G08A 3RFZC 3WXWH 1JGDB 4YFLI 2C3GA 4NM4L 2DAVA 4NFCA 3QIWA 4Q9QL 2VZ3A 1KNOA 4ZO7A 5I1AB 2C7UB 5JIHA 4F7TB 4XP4H 2H6PB 3SCMB 4O4YH 3FQRB 1FYTE 1MVUA 3P4NB 1M7DA 3GBMH 4DUXA 4XXDA 4UIMA 2VLKB 1I9JL 4DKFH 3W5NA 3VG0H 1BQUA 3AY4C 3H9SD 4WWID 3RVVC 3U6RB 3SGDH 3FQUB 5I1JH 4DKEH 1J8HA 2MKWA 1K4DB 5IR1A 15C8H 3HPJA 3D39D 3HMXA 1X7QA 3MBEA 5E7BA 3SDXA 1AQKH 2AEPH 1CD9B 5EZIL 5C07D 1MIMH 4OCXH 3QO1B 4JEGB 5CEZD 3LH2L 4QXUH 3NIGF 1NCDH 5DUPL 4DUVA 1AD9A 5DFWH 3QO0B 4X7TB 3BRGC 1I3VA 1ZKAA 2FRGP 3K7UA 4X0KA 2X40A 2ZG1A 5B39A 1IAII 2ICWB 1A2YA 4JFDE 3T8XA 2H26B 1WBYB 4C55A 1KELH 1JGEB 1FZJA 5T33H 3ARPA 1QFOA 5EB9A 2NY3D 1IEHA 3QDMD 3E6HB 4PGBA 3TO4A 3OAZH 1V3MA 3HRPA 3V52H 5C0CA 1S7TB 4FFWC 3BPLB 1DBMH 1QZ1A 32C2B 1XT5A 1A22B 4U6VL 3OV6A 2GAZA 4JR9H 4P4RA 1BAFL 3HNVL 4AEIH 3GGWB 3L7FA 1E4JA 4X7SH 5MHSE 1CXEA 2XWTB 2YSSB 2XRAL 3MJ9L 4Y4HB 3G6AA 1LDPH 2UZIL 1I1AC 1UT9A 3CFEA 4ORGB 1CFBA 3MRQA 1T20B 2MPAH 3VFNA 3QBTB 1EX0A 4RSVA 1A4JA 2IBGA 3JWDH 3P2TA 3WFDL 4MAYA 5SWZA 5IW6B 3IVKA 1AIFB 4JFZH 3P3YA 2AP2A 4QO1A 3KWWB 4NNPL 2UWEE 2IBZY 3IFNH 3V79C 4LSUH 4G80A 3N50A 1NCAH 3OKMB 2EYRB 3T0DA 5C0AD 2EDXA 5DMKA 1T04A 4WUUD 4JM2C 2APVA 4AL8L 2AK4E 2NY6D 4OLZL 4GRLB 4POZD 1S9VA 1WF5A 1RI8A 2M1KA 3QNYB 4OF7A 5DK0A 4UOJA 3TJHC 1RQ5A 1BVZA 1FO0H 2L0DA 5GZOD 4O00A 2DJ4A 7FABH 4WGVB 2QL1A 3QIUA 3EJZD 5KG9B 1S5IL 1IGJB 4HK0A 1RJCA 4XVSL 1MCJA 1B3JA 2DJSA 2VDPL 4HZLA 5KOMC 4ESKA 3QIWC 1C08B 3LY6A 1AY1H 2GK2A 2QHRL 2CO7B 4IEFB 5I1CH 5HHVH 1E6OL 4XZUA 2ERJC 4L4TB 5GGTH 2Z4QA 1V7MH 1OM3H 3QH3A 2MQ3A 3RWEA 3RVTD 4C58B 3BIBX 2I27N 4YQXL 4P9MH 3CMOH 1F3DJ 2UVEA 1BX2A 4RIRA 4M6OH 5GGRY 5HGHB 3LKNB 1UKTA 2R1WB 1Q0YL 3FQTB 1QFWI 5I8EA 3TBTB 1UWGL 5FYJE 5TE6L 4HUUB 1EHLH 3S5LA 1BZQK 1U58A 5J3HC 4X6FA 4D0DA 1DUZB 3PDDA 1PGRB 2DD8H 3KPSD 4JG0H 3RTQC 3RNQB 2A6IA 5F7FA 2FJHA 3MRGA 5I6XC 2ATKB 4PD4J 5E2UH 5L9DL 1QR1B 4KU1A 4AEHL 1CICD 3C6LD 3W2DH 1AP2B 1ONQA 4HXAH 4WW2B 3FO0L 2OX5A 2AXJA 1A6AB 3BQUD 2HVJB 3KPRB 1EMTL 1MRFL 4JY6A 3UCRA 2Y4SA 2W9EH 1JI2A 2X9WA 1TCMA 5GIRA 5SV4A 4NO5A 5I8KL 1CFTA 2QQKL 1MJJB 1BFVL 3PWVB 4PV9B 3BH9B 3PGDB 1J7VR 3D5OF 1RSFA 2ZG3A 3MJ6A 1BF2A 2FEEI 4FXGB 4PJ7A 5E2JA 4YPJA 3HC4L 4NJAH 1KTRL 1JZ3A 3TPUB 1D5IL 4YDJB 4X4YA 2XQBL 4QNPF 3WXVH 3K4DA 2R2EB 4QGTA 2HJFA 1OTUD 1MQKH 4K7PL 2P8PA 1VACA 4WW2F 1X5AA 1C5DB 3C6SA 3MLRH 4KJPD 4JDZA 1N3NB 2KZ1B 2P44B 5AZEL 1VFBA 4CDHA 5DEGA 3DO7A 2GIYA 4NKMB 4WEMB 4JRXB 4Z0XB 2DJUA 3TVMB 4OLUL 3K3QA 2EC8A 3KYNA 3TP4A 5I15H 3ZTNH 4NQDB 4PP2A 3S88L 3MRPA 4FZEH 4ZNEE 5AD0B 2J88L 12E8H 3GHBH 3OG4B 4FABL 4OCMC 1CCZA 2JIXA 4UILL 2OZ4H 4KTEL 1FL5A 1FH5L 5B38A 3IYLW 1JK8A 1F00I 3MLYL 3OPZH 1ZVYA 1AKJA 2FX9H 3D25B 1ACZA 3RIFK 3P73B 1A6UL 1YPZA 2C1PB 2EIEA 4NKQB 3ARDD 4HKBB 1FNAA 3CUPA 4L8SA 2FNBA 2VDLH 4XCCL 4FXKB 3SE9L 5AWNL 3DECA 1QRNB 3B83A 1UB6A 2HAZA 4JGJA 2UVFA 2MFNA 3K46A 4FFVD 5BV7L 3QSKB 2R8SH 4S2SB 5EBGA 4HBCH 3HAEA 1K5NA 1U8HA 1CDBA 1UXSA 2BOCA 4JFFE 4XBGA 3LRGA 1KGCD 4XX1G 4UT7H 4JGMA 3QPQC 4O5LH 1XCTA 5EUOA 2IPKA 2X4QA 4N8CL 4CMMA 1NUDA 1ZHKB 4BZ2L 2NYYC 1L0QA 3NBNA 4PJHB 5DJXB 1FGVH 2IMMA 1OW0A 3QIBB 5MENA 1S9YA 2FBJL 4ODXB 4ZPTA 4JHWL 1DQJA 4FHBD 3EFFA 3DIFA 1IGYB 1E28B 1WZMA 4Q0XH 2NX5A 3Q3GA 5BS0E 5FM5M 1NL0L 3IXTB 2MCPL 1NMBH 2UZXB 2OR9H 2YD9A 5IB3A 3JV5A 5LBSH 4O9HH 4MZ3A 4RGNE 1F6AA 3MGAA 5TQ2L 1PG7H 2X4OA 4LLYA 3HI1B 5F88A 3WE6B 4N5ED 2AJSH 5IP4A 1HH9B 3QUYB 4J8RB 4PJCE 3ARED 1F4XL 4PJHF 2KDGA 3ARGC 3QUZA 1FSKC 1WBXA 1EFXD 5J11B 4LSQH 2FD6L 1NC4A 3UZVB 1NH6A 1MFCH 1I9RH 1EFQA 3QULB 4L5FL 4FZ8L 4E9LA 1UM4L 3QZWB 5EIQA 1JGDA 3EBAA 3X13B 3LVEA 4OCRL 4GUPB 4P5TC 3ARFC 4WHYG 3D2UD 4HLZH 3QXAB 2EDDA 3M1BB 5I1AA 1JBJA 3IXAB 1CDIA 4F7TA 5EZLA 2DQEL 2H6PA 1HZHH 3SCMA 3BOVA 2DWDA 3FQRA 3LKRB 4LLQA 3P4NA 3P4OA 4XHQA 3LIZH 1CN4A 1ZTXH 2IANE 4KK6D 3RZCD 1X5YA 2VLKA 2Q3ZA 1PG7X 2D9QB 1U3JA 4JZJC 3FQUA 4MB5A 2V7NB 2H32B 1K4DA 1PYWB 2AJZA 3RGVD 1X44A 3CU7A 3T1FB 4K8RC 2X1OA 5FO8B 4WW1B 4MVBD 5TDNB 2W59A 3IDXH 4ONFL 4UQ3B 4BSVB 1GGTA 2IGFL 4FQHA 3D85A 4QTHB 3QO0A 4X7TA 1FCCA 1NBVL 4LDOB 2ICWA 3TNMB 5JDJA 4DOHE 1BVKB 4WHTB 3MV11 3PXHA 2XWBB 4HFWB 4WV1B 2GHWB 3MRMB 4QHKI 1WBYA 3MRFB 3SDAD 4DEPC 1U8LA 4AY0A 1KOAA 5F44A 1GOFA 5GJSL 1IFHL 3E6HA 5KVEH 5IWLA 5FA3A 4PTUB 1X3DA 5DK3A 2GTZB 32C2A 3ULUL 3H0TA 5JO5B 1OW0C 2DICA 3PIQB 4QYOB 4QLRA 1FORH 1NAKL 1DQLH 1MLCA 1QO3B 4GH7B 2ZUSA 2YSSA 4JRYA 3BZ4B 4LARH 1CR9H 3KAAA 3T3PF 1LP9E 3MJ8B 4ODVL 4OM0L 5I16B 4U1GB 1T20A 4JPIB 4FQIH 3QWRA 4U0RB 5EU5B 2XA3A 5SV3A 5D5MA 5HHMD 3KDMB 3LB6C 1ETZA 3KS0H 4K23L 5DJ6B 2AABH 2PXYA 5GS2H 3TA3D 2DI9A 4P3CL 3KWWA 1JYXA 1W72H 2OBGA 3GJFH 1P2CA 2OTWA 1YMHB 5IROC 3R0NA 3LEXB 4MS8D 2YUXA 1U41A 4JQVA 1CL7I 5C7XL 1U8IB 4I18C 3HR6A 2D0FA 1TPXB 4YFLF 2PW1B 4ZUSA 2E6PA 3MJ9A 1T2XA 3WS3A 4I0PC 1HK6A 5HVWA 4ZSOA 5DF0A 3ILQC 5KG9A 3IU4L 3EOTH 5DHVB 1QBLL 6FABH 3UO1L 1BJMA 1C08A 1H8NA 2B1AL 3FQNA 1YY9D 1MCLA 1F58H 5JHDB 3O4LA 5BMFH 4L4TA 3FOMA 2NW2B 2Y7QA 1YNKL 3NACL 5LXGL 5I18L 2D7OA 4N90E 1IEAA 3HMWH 1ZWIB 1CIUA 1UZ8A 2VAAA 2FX8L 4YE4L 1IVLA 1CE1L 4JQIH 4XPHL 2EECA 3D3VE 3PV6A 4XHJC 1FHGA 1OCWH 2R0LL 4Y16B 1CWVA 1KCKA 5C09E 2AEIT 2I24N 5GRVK 5TF1L 3LKNA 4LLAA 2JJTA 2PYEB 3FQTA 1B0GB 4NRZB 2M8XA 5GGUB 4CADB 3H42L 2QADD 3MLWL 1CLOL 1E4KC 3QJHA 1LNUB 4HT1H 5GJTL 1I8MB 2OJEA 1QSFD 1ZGLM 2Z92B 4PJXB 1DUZA 3KLSA 5E9DE 5EFIB 3TH3T 4DVRL 3W81A 5T3XE 3GRWL 1H3WM 1JHLL 3WL9B 3CZFA 2QTEA 2XZCL 2W0LA 2ATKA 4YGVA 4KHXL 4OF6A 3RJQB 3VFOA 4IMKC 1QR1A 4YHKL 3VXMB 3UTTE 4J4PC 5GRJH 1AP2A 4WW2A 4PRPB 3RWJA 1ZA6B 3VWKB 1A6AA 2LU4A 4WY7H 3KPRA 4C56D 3FCTB 5C6TH 4RDQG 1RURL 2E27H 5I8OH 3V4VH 3BPLC 3NCFB 5HI4C 1A6ZB 4LCWD 4PV9A 4GQ9L 4PJXF 2P46B 4OFKA 4MQ7A 5FO7B 1NDMA 1BQLL 4Y4HC 1RIHL 5DXWA 5HYSB 3TPUA 4BFGA 4OLWL 3RHWF 2B2XH 1EV2E 2CKBB 1L4IA 1V3JA 4NNYB 4FFYH 5IFHL 4Q9RH 3D87B 3QXVA 5CEYA 5JW3H 2JCCB 2X89A 4UZGA 5DD3H 4OD3L 3PWLB 4OIBA 2YD1A 2E7BA 2CIIB 4Z7OE 1N3NA 2IPUK 4X5WB 4ELMB 3JV6A 4HMCA 5DHXB 5E8EB 5GGRB 4JRXA 1RZIB 3QG6A 4HAFA 4PBWD 4Z0XA 2ZP0T 3TVMA 3TJEL 3PP4L 5T1KB 5CD5C 3GMRB 3T3ME 1UENA 4L29A 4LF3B 1S3KH 4OLXH 5EU6B 4FP8L 3DYPA 4GRLC 5K9JH 1ORSB 3PWJA 3P9LB 2VUOA 2DDQL 3KG5A 3NVQA 3C5ZD 5JZ7D 5LGHL 4G9FD 5I73B 2Z31D 3B9DA 2VSDA 2XTJB 5KZCB 4P57B 1Z5LA 2F58L 4DGVL 1PY9A 2IALB 5ID0B 3MXVH 1SMAA 1CFNA 3P73A 2C1PA 4WRLA 4HKBA 2JCCF 5ACZB 5C3LD 3DSFH 3FFCA 1SEBB 5CWSB 1OARH 3MLTA 1YQVL 2YEZB 5CJQL 5DD1L 4ELMF 1DCLA 1DVFC 4S2SA 5F3HA 4F15B 4HKXB 3WMSA 4U7SA 5HHOE 3E3QC 1WV7T 3HNSH 4EQ3A 2HT3D 3L3DA 4Z76A 4Z7WB 1ZLUK 3DRTA 1JP5A 1CXHA 1FNGB 3LQMA 3VI3E 1AO7E 3MRBB 1NGXB 4M48L 3WD5L 1ZHKA 3HMXH 1T03H 3L95B 1MCOL 4WEBH 4EDXB 4KC3B 3W0WB 1OF2B 4XWGL 1A6VH 4ZQKB 1FJ1B 1PKOA 3V0AC 4QRPE 4XBPA 3UMTA 3R0MA 1R3KB 2GW5A 2JKXA 3V6ZB 3DXAD 1A5FH 1AE6H 1CF8H 1GHFH 3TH2T 4S1RH 3IXTA 1NGQH 1D9KC 4UV4H 1NGYB 1Z0MA 3O6FC 3GO1L 4MLIA 5CZXC 4CNIB 5EZJB 4KVCL 1OP9A 2WWMC 3MODH 1JZ7A 3VWJB 2F5AH 5DYOA 2YD3A 5GRWA 2R1YA 4I0KA 1OPGL 3QDGB 4TSBL 5ALBH 5GRUL 3R1GH 4U6TA 1Q38A 4WW2C 3MRNB 2AJUH 2C26A 3WE6A 3Q1SL 1KYOK 5JA9A 1JGUL 1OTSD 2QQQA 2VXUH 1HH9A 4J8RA 5BCAA 3G9VA 1T0NB 2HH0H 1GGIL 4OM1H 3V6OA 5DR5H 1YDPB 4PRBB 4G6MH 3H3PL 4Z7QE 3MRCB 4D9RE 1R3HB 5BVPH 1YYLH 1GAFL 4LLUA 2P45B 2FCBA 1RZ7L 4WHDA 4F9LA 4AJ0A 4F7CB 2ZCLL 4IOFD 2CDEA 5HJ3B 4CAGA 3V4UH 2QKIB 4GUPA 4GAGL 4MNQD 5CCKH 5TDOA 4N68A 3W82A 3IXAA 3VXTA 3BN9D 1ZLWK 4WU7A 1TDQA 3O9WD 3OG6B 2F54A 1D5BB 3ZHDA 1U8MB 1QBBA 3QWOB 4B50A 3NFPA 5TE4L 2MQ0A 4S1QL 4ZUWB 1ZANL 3TVMC 1E6JH 5J06A 1KFAL 1CBVL 1LO2L 4R6UA 4JRWA 3I50H 4PJGE 5IMMA 2IH3B 2H32A 3L7EA 5C6WH 1N7ML 1NKRA 3HC3H 2DLGA 2B0SH 1WCQA 5D7LB 3PWUA 3T1FA 5EG6C 3MRHA 5DJZB 1MWAA 1ZT4A 1S9WB 4JVPA 1BECA 4RMWA 2HKFH 4KWUA 4TSAH 4WW1A 3BZFB 4LCIL 3VFVB 1IGIL 1PEWA 2AK1H 4JFXB 5TDNA 2GITB 1OD9A 3WO3B 4PJ9B 5FGBC 3AB0B 3F7PC 5FAAA 4BSVA 1MAML 3S3PA 1NCWL 1UB5A 3T4AB 3OAZK 5GISL 3C8HA 4JCLA 3TNMA 4HUKB 4WHTA 3QHZH 1NCCL 5HYQB 4HFWA 4WV1A 1TQBB 3VXQA 3KJ6H 1BWMA 4IDJH 3MRFA 3ELAT 3KYOB 1ZS8B 1S7XA 1C5CH 3DHJA 1H3TA 3E8UL 4WEUD 1KEMH 4LLVA 2F74B 3TBVB 4QGYA 5KVFH 3QXDB 1VEMA 2DIBA 5EIIB 4OZGA 3QIBC 5EOTB 4HDIB 4BSJA 5JOFA 4UUJB 4AMKL 3DPBA 5ISZB 2CMRH 3BZ4A 3LN4B 3OQ3B 3RL1A 3ZE1F 1HSAB 3MJ8A 4PBXA 5I16A 1KJMB 4PRDB 4JPIA 5TDPB 5M95B 5DLMH 3DWTA 1JUFB 1YC7A 1JF5A 1Z0NA 4P46C 3MGOA 3SHSA 1JGLH 4N1EA 2WBJA 4JHAH 1QSEA 2NW3B 3HLAB 4N0UE 2FHFA 1WTGT 3WEXA 2YUVA 1OGAB 3LKSB 1OAZL 1BQHB 1HHGA 3B9KB 2EKJA 3O45B 5JOPE 5DVOA 4OCWL 1YMHA 1TZGL 2O61B 2EE2A 3QUYC 1MCPH 1U6AH 3LEXA 4G8EA 3T77B 3LEVL 1LILA 3BGMA 3V6OC 1V7NL 4E42B 5J11C 2BMKA 1XGQA 1ODAA 5JIIA 3T0EA 4P2QB 3PWPE 4J6RL 3RP1A 1JPST 1RV6X 1WK0A 4OIIL 4IJ3B 4JY5L 3ZT6A 3NA4A 1I1FB 3DVNA 4H20H 4U1KB 5E6IB 2I9LA 1CLYH 1QQDB 3TV3L 3FFDA 3KPLB 1A1MA 4KQ4H 5DEFB 4BQCA 3L3OB 3BI9X 3I2CL 4M4RA 4PG9B 1S5HB 4KHTH 1IM9D 2P5ED 1RJZB 4A6YL 1MCEA 3UTZA 3WFCL 1SBSL 3PUCA 4DAGH 4IRZH 1N6UA 1P7QB 3JWOL 3VFPB 1CL7L 2F8OA 2PYEA 3UBXI 2P43B 1NANI 2R2HB 4O51B 3MLSL 4NRZA 1KJ3L 3BIKA 1MCWM 1N4XL 1X5JA 2FJGA 1T21B 2X42A 4HJJH 1LNUA 1UM6L 1UM5H 2ICCA 2Z92A 3WLWD 4OZIA 3W9EB 5FYJL 5IBLC 2J2ZA 4NQUA 3OR6B 4XC1H 1YEEL 4EJ1C 2P5WA 4PYHA 1ADQH 3HAEH 4N0RA 3VXRD 2I5YL 4CVXA 1DN0A 4WV1C 1ZHLB 3VXMA 3L9RA 3BYYA 3O2DL 4R0LB 2E6QA 3PWNB 8CGTA 4NQED 1ZA6A 4NC1E 5FUZL 4A6YB 3FCTA 1EVTC 1Y6KR 4Y2DD 3SE3A 5TGBB 5GHWL 4U1IA 3F7YB 4RAVB 4OT1H 5I66B 3NN8A 3Q5YA 4LU5L 4X9FA 1QYGL 3ZSTA 4G3YL 5FKPB 4XBEL 3ZDYE 4ZXBA 2NZ9D 3BSZH 4LPUA 43CAB 2EDOA 1HOCA 1HINL 5IGXH 2VLJA 4U1GC 1YN7A 4R2GD 1N5YH 3BN3B 2QSTA 1KUMA 2EYTA 5DMIL 4NNYA 1EO5A 4U0RC 3MC0A 2JCCA 2YPKB 1DL7L 3V7MA 1TJHH 3PWLA 5E8NA 2FO4B 1TIUA 4Y4FD 1GGBL 2CIIA 2E8ZA 2KBGA 3UAJC 2FH8A 3T1WA 4ELMA 5T5FH 4P3DB 2H2PC 3TO2A 5E8EA 1WAAA 1IGMH 2HJLB 2ID5A 4ZAKA 1RZIA 4QKXB 4MA7L 2CQVA 1DLHB 4NN5B 2BNRE 3UPRB 5IBTL 2XTLA 3ULVE 3C08H 4Q2ZB 2V2TB 4P4KD 2M2DA 4M6AA 5EU6A 4B0MM 2DF3A 4Z0BL 2A6JA 3P9LA 4KV5F 1DBKL 1CDCA 4AEEA 4JANA 3GBNH 5D7KD 4BA8A 4R7NB 5IW1A 3I02A 1TPXC 3FT3B 3P30H 4LHUA 5L8KB 1YEFL 5FOBB 1JPSL 4R90H 3PQYE 4E0RA 4KK5D 3DVIA 2FIKB 2XZAL 2Q7NA 5ACZA 4N8VG 1YYML 1SEBA 5CWSA 2YKLL 2YEZA 1EEUA 4G43A 4RFOL 2X1WL 3D9AL 2H1PH 1UZ6F 3UZEA 4FQCH 4JQXA 4FQXC 5I9QB 5JW4R 3WBDA 4X83A 4J7RA 1NEZG 2W0PA 5DFTA 3RWDB 4Z7WA 2R0ZH 1XF5B 1BLNA 4HIEA 4FQJH 1IC4L 3MRBA 1NGXA 1WBZB 4LSTL 1XGTB 3OAUH 4Y16C 4GMSL 5D93B 5FYKH 5DD0L 4WFEE 4EDXA 4LKXB 3W0WA 1OF2A 2VQTA 2WLYA 2YS4A 1K3IA 5DJCB 1RVFL 5JMOC