4UT7H

Crystal structure of the scfv fragment of the broadly neutralizing human antibody ede2 a11
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
146
structure length
146
Chain Sequence
VQLVESGGGLVRPGGSLRLSCAASGFSYSNHWMHWVRQAPGKGLVWVSRINSDGSTRNYADFVKGRFTISRDNAENTLYLEMNSLTADDTAVYYCVRDGVRFYYDSTGYYPDSFFKYGMDVWGQGTTVTVSSGTGGSGGGGSGGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROADLY NEUTRALIZING HUMAN ANTIBODY EDE2 A11
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 30
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ut7H00
3LAFA 2O5XL 1JGVL 3OZ9L 4P3DB 4P5TA 1G7QB 3QUMA 4UV4H 4PJFF 3B3IA 1K8IA 2I60H 3FQTB 3VFPA 1OGTA 5E2VL 4V1DB 4LVHB 1CT8A 1XGTB 2D7TL 1S8DB 5F9AC 3D39B 1UCBH 2R2EA 4MNQE 1OD7A 3BPNC 5J6GA 4N8PA 1R6VA 2NY1D 4L3AA 2V9TA 3MRFA 2VN7A 5B3JE 4QRRE 2FJHA 1PDKA 4OD2A 4PRIE 4NO3B 4HCRL 1F42A 3HE6A 3TZVA 2EYSB 5IROC 2Z31B 2FDBP 4FFVD 3O45A 2N56A 2Q8BH 4LCUA 1E4WH 1IZJA 4N8VG 1JGEA 3UO1L 3MV7D 2AEPL 4KROD 5GGSY 3T0EA 1LD9B 2R0WL 1HINL 4PBXA 2FATL 1LE5A 1D5ZB 1EAPB 3SE9L 4MSWA 3PHOB 3O2WL 1CTOA 2B0SL 1R3KA 5CSZA 2FJFB 3QUMH 4DKEH 1XGQB 4OCXH 5AD0A 4XCCL 3QNYB 3CCHA 5JPMA 3VWKC 3TJEL 1L9NA 5IB3B 1S3KL 1XGUA 2VDKL 1TQBC 4IMLB 4UINH 4N1HB 3WNNA 5C0CB 4OI7A 1SHMA 4P5MB 1ZT1A 3KPMB 4OQTL 1MRFH 4G8GD 1CLZH 4QRPB 5EU7C 1XIWC 3RPIB 2IH3A 3CSYB 5LVEA 1T89C 1EIBA 1Q8MA 3CFDB 5MHSD 5J3HD 4CU7A 5KZCB 4HZAA 4TQEH 4JM2B 5DRXB 4XGZA 5ECJE 1EO7A 2XFXB 1I3GH 3OAUL 4HDIA 2XICA 5CCKL 3FT2B 1B4JL 3IS1X 1BBJB 3BT2H 4XMLH 5CUSH 5T1LD 4X80L 4XNXH 1RIVH 4F7PA 2CKBA 1F11A 1ADQL 4FMKA 5E8DH 2CQVA 4JHZA 5IV2A 1PY9A 2J4WH 4NC1E 1T1WA 4JQVA 1HXYA 4ZS7H 1P7HL 1ACYL 3B43A 4XT1C 4TTDD 1MWAA 2DJSA 1EDQA 3M17B 3HAEG 3QB7C 1FL3B 3DX6B 4JRYD 5B8CB 4RMVA 3SGKC 2NY3C 3RUGA 5INDA 1MQKL 5B39A 1DBAH 2JIXB 5C2BL 4FQXA 2Y06H 1YEKH 2YA2A 1C12A 3DMMB 1IAII 4QRRA 5E95B 5C07E 2ATKB 4GT7A 4PRIA 3MLXL 4RNRA 1CQYA 1I3UA 5D9SB 2VQ1B 3MLUH 3KXFD 1UENA 3DVNA 4WCYH 4E42B 1S7XA 2Y7QB 4LCCB 4NO0D 4F3FA 3IFPA 3CDGA 3O3AA 4FFWD 2ZUVA 1DBML 3P30H 2EXYD 2VSDA 1LK2A 2R1XA 3MTRA 4ZAKB 3O8XC 5FUZH 2EH8H 5DF0A 1OAXL 1KIUA 2XA3A 3T3PF 4BUGA 3PNWB 4Q9QH 4UUJA 4YXHH 2VWEC 2VUYA 1NMCC 4JFZL 2BDNL 4NYLA 4UOW0 2DQTL 4PP1D 1DUYB 2E6QA 4I18C 1D9KA 2VLKA 3VA6A 4GS7C 2C3VB 2YK1H 5HYEA 4XHJC 2UYLA 2BOBB 5AYQA 1I7RB 4DVRL 2IAMB 4NN5C 3MRBA 4Y5XC 1UGNA 32C2A 1OB1A 4UBDD 4TSAL 2A1WH 3S37X 3PWJA 1SJEA 4JGMA 5ISZD 3AGVA 5KJRH 4HHAB 4YEEA 4JRXE 4ONFL 1GGCH 4HMCA 1K3IA 4Z7QE 2X4SB 3O11B 3GSNL 4KRLB 5C86A 4PJ7A 1BD2E 1IGTA 4WHDA 2A38A 4M93C 4MA1B 3GJEA 3IJSB 2VDRH 1CGVA 3O6MH 1RZKL 5BZWA 5KSBA 2FX8H 1RJLA 2P1YA 5IVNA 5C0ND 1MFEH 1QLRA 3GIZL 5C0AD 3WJLC 4DN3L 2R9HC 3LKRA 1A3LL 3Q5OA 3LZFL 4HT1H 4JFPA 3L3DA 5I0ZA 4PYGA 3B5HA 2D31B 4WV1B 3P4NA 5CIPH 5EFIB 5DA0B 4JJ5B 1KBGL 1S5IH 2JK5A 2ERJB 2RFXB 1JUFB 1EEYA 2E8YA 1H0DA 4U1IA 3BZEA 1QFUL 5FYJH 3DV6B 5T3XE 4GMTH 4N1EA 5AWNH 2IPKA 4F7EA 3EYUH 4P4KB 2BVEA 1INEH 1J1PL 1W72B 3NA4A 4POYA 2X41A 4HIEB 5LGJA 1YYML 5C07A 5IFHH 1ZTXH 2GY5A 1CU4L 1XZ0A 3B2UD 1TMCB 1HZHL 4DUWA 2G75A 1Q0XL 4LLMB 4G9DB 1KN4H 3VW3H 4YHOH 3WNKA 1U0QA 3QEGL 3O6FB 4OZFB 1FFRA 3WUWG 4KVNH 1OCWL 4NZUH 1W0WB 2CIKA 4NNXA 4RMTA 1AH1A 3WEXB 5HPOA 1DEEA 2GHWB 1S7RB 2GW5A 4LSUH 4X8XA 5HGAB 2BCKA 1IC5L 4ZXBA 5JQ6L 5JOEA 1JGLH 3IS0X 4FQ2H 1AJ7H 5KS9E 1LP9E 2L0DA 3CUPA 4M7ZB 5GGTA 5DK0A 1BZ7A 1ZV5A 1P5UA 3I85A 1SY6A 4XCNB 3H0TA 3OKLA 3ILPA 2BZDA 4TUJA 1H5BA 3RNKB 3E6HA 4JRXA 4L4VD 5K9KA 5JA9A 2ADJA 3UX9B 1A9EB 1IT9L 4ZTOL 4CMHB 3MACH 4G3YH 2LABA 1R3LB 1JHKL 2V9QA 1BD2A 1JNJA 4QT5A 3SKUD 5CEYA 3TBWB 3O9WC 4LAQH 4Y4FD 1HYSD 5IM7B 2O5ZL 4PJCB 5IBUB 2HRLA 1E0OB 3JV6A 4JLRB 1KG0B 5L9DL 1ERNA 1X5JA 2X89D 5GS1C 4K3HA 1R3IL 3D69A 4PRHA 4X4XA 4RAUB 2ZZUT 4NN7C 4XP4L 2YKLH 5F1KC 4NO5B 2D7MA 4B53A 1YQVL 3ES6A 3NH7L 1I9RH 3BRFA 5DQ9B 1XR9B 1KELL 4TNWK 4HC1H 3VJ6A 1AXIB 4NZTH 1EHLH 2JTDA 2NY7H 4NCDA 4OV6F 1ED3A 1I9EA 4HIIB 1SY6H 2V5TA 3B9VA 4HW6A 2UZIH 4EXPX 4R7NA 3MLTB 2HN7B 4M8QB 4X9FA 3RVUD 3HI5L 3LKOA 1BWMA 3RPKA 4U6TA 5L2JB 5DD1H 4N0RA 4QHUA 3VRIA 1Y0LA 3GSQB 3SCMA 1T83A 3V9FA 1ZK9A 1YEEL 2DM4A 3RZWA 4GW4B 5IGXH 4X0KB 3THMH 4PJAE 1AXSA 1OAQL 2EEDA 5F9JB 4HKXA 5E6YA 4NUJA 4MA3B 1AR1D 1BP3B 2EZ0D 3P77A 4PGBB 5CSGA 3BE1L 4AEHH 4S1SL 5TPWL 4P59L 4MAYD 3VFTB 5F3HA 1I3VA 1N7ML 1CXIA 3GEWB 5E8PA 3DUUA 3V52L 4YGAB 2AEQL 3MRQA 3QUYB 4QXGH 4QWWD 1HHGA 2R9HD 3MQIA 4BZ2H 1LP9A 4W4OC 2BNRD 5DJ8A 1Z5LB 1C5CL 4Y16B 3CFJA 5T3XH 1JHTA 4HGMA 3EYOB 3QIBB 5SV4A 3F12A 1LEGA 1CXKA 3DPBA 1CGXA 1KB9K 2XY2A 1RUQL 3B9AA 3S35H 5HI4D 1G9NL 5C8JA 2XN9D 1MJ8H 2VABA 1CLOL 2JKXA 5F7EH 5C08D 5EZLB 2X1WL 3RL2A 4GRLC 3C5SA 3IGAB 4PRPB 1XF5B 3KWWA 3B5TA 4P2RA 3SDCD 1OAKL 2H8PB 2LTQC 4OTXH 3HLAA 4LSPL 1G6RB 3KPRA 3SJVB 3DUSA 1IAIH 2C1PA 1QSEB 1XGYL 1YECH 5B4MD 1P1ZB 3KLDA 2VLJE 3KPQB 3HA0A 4U1GC 2VAAB 3TBYB 1UJ3A 1ZGLB 4WUUD 3HFMH 4GQ9H 4ZQKB 2A6JB 4U6HA 4CW1B 4XMPH 2E27H 4OUOA 1AD0B 2VDPL 1U8OB 2AK1H 1IGFH 1AQKL 3S96B 1IGCH 4WVRA 4OFVA 4RAVB 1NUGA 4DJMA 1F4WL 5AEAA 4PJ5D 5DMIH 1MAJA 5CEZH 1SMAA 3KHOA 1YJDL 5I9QB 1ZT7A 5FA4A 2WLZA 4APQA 4PGEA 3VXMB 5C0FA 5HXMA 4EQ2A 4WFGD 4D0DB 4X7TB 2IMMA 1FYTB 2VAJA 4IOFD 4L9LB 5DFVC 4QTHA 2FHBA 2X40A 4PJAA 2NZ9D 2YD6A 5I1HL 1N8ZA 5IMKA 3MRPB 2EDLA 5KANI 2IEPA 3UJJH 2Q7YB 1QSFE 3FHAA 2WNGA 4KI5D 3U36B 5DVNA 1JZ5A 3REWA 5EULV 2DIAA 4NQED 4L29B 1P7QA 1QHPA 3SBWC 5JMRA 2AP2A 1IGMH 3I3DA 1U6AH 4XCYA 2LU3A 4BH8A 5EO9A 2F54D 1NEZA 1FIGH 2PXYC 3EO9L 4RBPH 3WO3B 1KTLB 3VFVA 1QRNE 4ELMB 4HXAL 5J1SC 3QCUL 4LSRH 4D9RE 5BVJB 1GGUA 1QFWM 1I3RB 2CJUH 3BPCA 3CZFB 3CSBA 4KRMB 4HEME 1EGJA 2Y5TA 4XP6H 1MJJA 2DLIA 1E28A 1DQJA 3VFMB 3GMPA 1R5VA 4AH2A 4PJ8D 3BKML 1FNSL 4QRQA 3HMXH 5HDBE 5IEKA 5MEOA 3MOBH 2W0FA 2Y9RT 2XZCL 3BUTA 2NX5E 4QYOB 1CE1H 3LQZB 1AP2B 4Y1AB 4K7FA 4NBYB 4R4ND 2JB5H 4OLVL 1IGYA 3OKMA 4XPTH 5MP6L 3O41B 4XPFL 4RX4A 4DCQA 1T1XA 4O58H 3LS4H 4F57L 3QNZA 3BHBB 2OSLA 1UQSA 2AK4E 2VLJA 1QFOA 2DWDA 4JO1L 4AG4H 3MCLL 1T1YB 3IDNB 5ETUA 5J6HA 2XIDA 5IFJB 1MHHB 4XP9L 5F7KC 2B1AH 2Y36L 3K4ZA 3UDWC 5HHPA 4HQQH 1F4XH 3QQ3A 4CADA 4NQXB 2FR4A 4KDTA 3MZTA 3WUZA 3GSUA 2HKHL 5JPNB 3CK0H 4ONHB 1S7WA 2VH5H 4OFPA 5GRUL 3ZT5A 1CGSH 1WCBA 2F74B 1I9JL 4M8VA 4LLUB 3QWRD 4PJ9B 3NZ8B 2VZTA 3V4UH 2QADB 4YHKL 1AQDA 4LDEB 3CIQA 3IKCB 3O3EB 1B6DA 2NXYB 5HI3C 2QLVB 4JFFB 4KRPB 5DT1H 1DQQA 2V7NB 4QO1A 4Z5RB 1QSFA 3PHSA 5C0BB 2ZCLL 2CDEB 5JTWA 3PDDA 5EUOE 1IILE 4PGDA 3OXSB 4PV8A 5EA0L 2OXGA 4PBVC 2DL9A 1FDLL 4QF1B 3QQ4B 3PQYE 1OTSC 1HDMB 1QRNA 1Q9KA 1G9ML 4HUNB 3FOLB 3JV0A 5J9PB 3C5ZA 2A6IA 4HD9A 2A77H 4P3CL 5L8LB 1QFWL 2XTJE 5I19L 2XQBH 1JF1A 2MPAH 3H2WA 2GSIB 2BY3A 3QDJD 1YMMD 5BS0B 4XVTL 1A22B 5FM4A 1S9KC 2NX5A 4U3CA 3DSNA 5C0JB 5DQJA 1FJ1B 1H9VA 3UBXA 3LKQB 1T7VA 4JPWL 4ODVH 5JORB 2HG5A 5C0DA 4YHPA 3GI9L 2FX9H 4X6FA 2J12B 5GGRY 1B0GA 4P48A 4XXCA 1OP3K 5EOTA 3VG0L 4MVBC 2HH0L 1L7TL 3D25A 4BH7B 1KPVA 5AG8A 1PVHA 3G5VA 2AK4A 2DQUH 3ILQC 2YXMA 3MBXH 2BVPA 4LLVB 4RGNC 4Y8DC 5B39G 3T65A 4RQQA 5GIRB 1F2QA 4PRBB 2ADGB 5JHDB 3FO1B 3NN8A 2HFTA 2X4QA 4IJ3C 4JY4B 4JFEE 2XNAB 4M6AA 2NNAA 4G43A 1BWWA 2PXYD 3BGAA 2OI9C 5EPMA 3PE9A 4YC2C 1SVZA 6CGTA 1X5IA 1SJHB 3L5XH 4TUOB 4S0SD 4TULL 5HHOA 2DQHL 3D18B 1CG9A 2VDMH 5EU4B 1A6WL 4P4RA 5D1ZA 4F7MA 2QQNH 4X9IA 3C9NB 4I0PB 3DVGB 3ABZA 3LMJH 2AXGB 1FH5L 2YPLD 2YC1A 3E3QC 3HE7B 1NC4B 5DJ6A 4X5XB 3VXSE 1TENA 1BOYA 3TNNB 4K8RD 5DRNA 3UYRH 1T80A 2X4PA 3V7MA 3JSSA 2CGRH 3MV9B 2P8LA 1CZ8L 2BSED 5IP4A 2UY6A 4JG1H 5EUOA 1T5XB 3BPLC 1DTUA 1QA9A 3QIWD 4Q6IB 5I8KL 1QNZH 2BVUA 1FL5A 2YUXA 5INCA 3QEHB 5H8DA 2YMXH 2J8HA 3MV8D 3U9UA 3CDYA 4ZFGL 4OT1L 1S7UB 4UAOB 3U48A 4H88L 1MI5E 2NTFA 4C54A 4FQHB 4XBPB 1QQDA 1DBJL 5J13B 3DXAB 1F3JB 3OKOA 4RWYH 4RGOH 4WNQA 5CWSB 5DI8A 4NJAL 1F6FB 1IM9D 3FMGL 1V7NH 4OFYA 2IGFL 1T1ZA 1L0XA 4Y2DB 2PYEB 2IG2L 4ENED 1DL7H 1SEQH 1J5OH 1BFSA 5I71C 4UDUB 1SM3L 1UVQB 3WXWH 4WFEE 3T1FB 3MCKA 4AL8L 4NO2B 3CFEB 5IR1A 2Z93B 4EKXA 2OL3A 1Q94A 4OZHB 2A74B 1NGWB 2Y6SC 3LN9A 4PJGE 3L95A 2FJGB 2P8PA 5HI3D 3RVWD 1K9TA 3JTSB 5I16B 4MX7A 1TVHA 3OV6A 5FK9A 4N0YH 3QUZA 4FP8H 4TRPL 2D7QA 3FN9A 4U2ZA 2ZOKA 3PJSA 3FQWA 4HEPG 1JGVH 3OZ9H 2R4RL 3EFFA 4P5TD 5DJYB 4K55A 2EDRA 4U05A 2K1MA 3L7FA 5F96L 4JFEA 1NFDB 5E2VH 1G7HA 4XPGL 1OTSD 3I84A 3MRFB 1N64L 1Q9OA 2D7TH 4HMDA 2VQTA 1MJ7L 1TVBA 2DS4A 2QR0B 1P4IL 2G2RA 2J1KA 2VN4A 3PGFL 4JPKL 3VRJA 3W39B 4OQTA 3T4AB 1F4HA 4BQBA 1UH3A 4QRSA 5C0RL 3BFOA 2AI0L 1JGEB 3VXPA 4U49A 4HCRH 3IXTA 1XT5A 3P0YH 4GXUM 4OF8A 3TZVD 1JJUA 4GAGL 1I85A 4P46B 3VXSA 4MSWB 2RIKA 3BMWA 2WWMD 3ARSA 2IPUG 5MEPA 5CSZB 1YEDA 2AEPH 4PJBA 3T0ED 3Q2CA 2R0WH 3NOIA 2FATH 1RZIA 5AD0B 3SE9H 4XAKD 2DQCL 1CFSA 4MVBD 1F4YH 3O2WH 2B0SH 3VXUE 3JXAA 4QRTA 1N26A 3IDUA 4NM4L 5HJ3A 4DN4H 3DX7A 4YJZL 3WIHL 1MI5A 3HCVA 3TJEH 1S3KH 2VDKH 3KNBA 3W9DB 3RWGB 2R56L 1J10A 3U0WH 5GSVA 2CH8A 4JKWA 4KUZL 1QZ1A 5IIEA 1DJSA 3CJJA 4NHCL 3CC5B 3OKYA 1IJ9A 4X5LA 3V7AE 5BZDB 3RX7A 4CNIA 3GM0A 5EG6C 3S3PA 2VDNL 4GG8A 1Z9SA 3QPXL 2LU4A 5DK2A 2C1OA 1JRHL 3OAUH 5DFTA 3EOBA 1KC5L 1K5NB 4ZS6D 5DFWH 5BRZE 1B4JH 4WDIA 4YHML 4X80H 4NKIL 2IALA 1N3NB 3RZCB 4PJGA 1Q1JL 1ADQH 1RULL 1FNFA 3M8OL 4YXLL 1SMOA 3EFDL 2F5BL 3N1QC 1KEGL 1KUMA 2XV6B 1OT2A 2BY1A 4Z7WE 2Z31C 3RUGB 3I6KA 4ZUSA 1WBZA 3QNXA 3QO0B 3UPCA 2MTPA 2VXSL 4Y4KA 1AKJA 1W0VB 2EDDA 4HK0A 3UAJC 1A6TA 3TO4B 1E27A 3OXRA 2VZ1A 3HPJA 3QZWA 5M95B 4ZUVB 1AHWB 5FO7B 2BRRL 3BDYL 4G8IA 4XVSL 1U8QA 1PKQE 4HIJA 4KMLB 1WTLA 3Q5TA 4MNQD 1LK3L 2G5RA 4FQXD 3PF2A 3RVXC 2UUDH 4JDVB 4L1DA 1SBBA 4ZTPH 5F1IB 4QRRD 2G5BB 3TWCL 4PRID 3MLXH 2CO7B 3F7VA 2X4TB 4QY8A 5D1XA 4LIQE 3WFBL 2GT9B 1LK2B 5FYJU 2VO5A 1MQ8A 2ARJB 2YBRA 4MZ2A 1WFOA 2IBZX 3O3BB 3GSNA 5DHYA 2ICCA 4GW1A 2IQAA 2D9QB 4J3TA 1JGUL 1DBMH 5FOJA 1ZVYA 3ZMRA 4KDVA 2M8XA 5ITFB 1UWGH 2OR7A 3VDCA 4OGXL 1OAXH 5CJOL 2VLKB 4JM2C 2EKSA 4PV9A 2EYRB 5B21A 2Y6SD 5I76A 3SGEI 1FNHA 2PNDA 3LEYL 3U7YL 3VD5A 3S3JA 3ZZ1A 4JFZH 2YRPA 5F9DC 2DQTH 3T8XB 3VWJA 1ZLUH 2OR8A 4DVRH 5HD8D 3NFPA 2B20A 3G9AB 5ALBL 2B4CL 5JOPE 4XVUD 1YN6A 2F53E 5FYJD 1JWMB 4TSAH 2WUBL 4W6XB 1O5DT 4PJ7B 1NBVL 3U4EB 1IGTB 3MLSL 4OM0L 4KV5E 1ITBB 2XWTA 4ONFH 5GRVL 3KPPA 4KKLC 1BM3H 3LEVL 4OGYL 5KSBB 4YHYB 2FNBA 5B8CC 1MCDA 3GSNH 2ICEB 2VB5A 5BRZA 1RIUL 2IANE 3MGOA 3IJHA 2J2ZA 1RZKH 3OSKA 1MPAH 4JY6A 3INUL 3PWVA 5CJQL 1BVKB 5IVOA 3CFKA 3DMMC 5FA3A 3GIZH 5TE7L 4F7TB 4LQFL 5ACMA 1ETZA 4DN3H 2YZ1A 4P9ML 4W4NA 4AENA 4K7PX 4Z7WA 1CDJA 3LZFH 1P5VA 5E0QA 3P0GB 1EJOL 3LRSB 4LCCC 5JIIA 1MCKA 2BHUA 1EFQA 3ARFA 5DZLA 5FM8A 2DOCA 4F7EB 1KBGH 4K3EL 5IUSA 4LNVA 1VSCA 5DC4B 3GJFA 3ME0A 1QFUH 3S36L 4ZAKC 3OKEB 1QKZH 1F00I 1NGZB 1XZ0B 3WHE0 2R1WA 1FRGL 3C09B 1IGIL 1YYMH 3CFCL 4QCIB 5TE6L 5C07D 4KI1A 3SE3A 1HZHH 2KBGA 1Q0XH 3RL1B 5KSUA 5FHAH 3T09A 1JPTL 2IAMC 4GRMA 4BQ8A 5M7QA 3EHBC 3VRLE 2EE3A 1FZOA 2DM7A 1DEEB 2WBJA 3QEGH 3QH3B 1WUNT 3UTSE 1OCWH 4UU9A 2V2TA 2NY5C 2HYMA 4OLZL 3C5JB 5DVKA 3D39D 2OTWA 2DAVA 1J0YA 3C87A 1UM6L 1J9CT 5GZNC 2B7DT 1CIDA 5JQ6H 3H9SB 4ZXBD 2NY0D 4PIRF 4MA1C 3TA3A 3QXTA 2XACC 1X7QB 2OQJA 2GK0A 3H0TB 5E2WL 4O5LL 1HHKA 1H5BB 1P84K 4UDTA 3E6HB 3V8OA 4GQPH 3SHSA 3D0VA 4DAGL 5E94B 3RI5F 1M6OA 2C4FT 1FLTX 1E6JL 4X4YA 4QT5B 5CEYB 4WV1C 2JCCE 4K9EH 4ZTOH 5HDOA 4HS3A 1WZ1H 1YUHA 1S7VB 2ERJC 4BA8A 1JHKH 5E8EA 1ITCA 1VADB 4GBXB 3TESA 2P48B 5KVDL 5C6PB 2IANA 5I0DA 4CBPA 4PRHB 1LO2L 3MRCA 5BMFL 2O5ZH 3G5ZA 4P4KC 1M7IA 1DLFH 1AGFA 3LB6C 4OCWL 1JNNH 5L9DH 5TF1L 1R3IH 4QRPD 4XP4H 2V7HA 5L8KB 4HUXA 1QFWI 1YQVH 5MENA 4POZD 4DZBA 3ZLQC 1AR2A 4GAYB 1ZHNA 4JM2D 1KELH 4TVPL 1K4CB 3O6FC 4M43L 1A9BB 3MNZA 5IHZA 1A7RL 1U8JA 3GSWB 4WO4B 3D2UB 1Y0LB 5T3XD 3SCMB 1A4JA 4PLOB 2CLZA 2HJLA 1PSKL 2ADIA 4QHNA 3HI5H 5KAQG 4CVXA 1T03L 2D4DA 2BSRB 1NFIA 1JE6A 1IBGL 4NUJB 3GIVA 1YEEH 1Z3GL 4UQ2A 3MRNA 5I1IL 4M7ZC 4GG6B 3JBG7 4XBEL 3LN5B 4G80B 1GGTA 3UTSA 3F7PC 1U9KA 3BE1H 4S1SH 1CFVL 1H3TA 3OKKA 3LKNA 4LDLB 1N7MH 5DJ8B 4CMHC 1WEJH 5CGTA 4BZ1H 3V52H 1EXUA 1C1EL 2AEQH 5EBWB 3CFJB 4KK6C 4U1KA 2P5WA 5DR5L 4Q58C 1RIHL 4QTIL 1KCVL 4KQ3L 1MCRA 3TC9A 2OS7A 3RWCB 1QO3B 1MFDH 4X4ZA 5E5MA 4QRUB 1MREH 1C5CH 3Q6FB 3RU8L 4WW2F 4QXWA 1MHPL 4MD5A 1O7VA 3IDMB 5CHNA 1R0AL 4NZRH 4NRYB 3UJTL 5E4EB 3C60A 1RUQH 3QQ9D 3CPLB 1G9NH 3TNMB 4P2RB 1DANU 5A1AA 1CLOH 1XF3A 5EBLB 2PW2A 4KJWD 4BSVA 2JCCA 3KPRB 1UJTA 2C1PB 5SWSE 4XCFL 4Q9BA 5C0EA 4IRSA 1D5MA 1OAKH 4EN3B 4LSPH 1ZKAA 3MYJB 1XGYH 2ARWA 3O4LE 5ALCL 3NTCL 3VGGA 1HNFA 3BOVA 4NM8L 2X9WA 1NCNA 1ZLWH 2VDPH 1C08B 4LASL 1G9EA 1AQKH 1KPRA 3VH8B 2BERA 1DE4B 1WBXA 3OR6B 5F72S 3T2QA 2KH2B 4RMWA 4RFEA 5IBLD 1F4WH 3H3KA 4AT6B 4TOYL 5GS2H 4WFFD 4R4FH 4RA3A 3MUHL 3CNKA 1YJDH 2AGJL 3VFSA 5ERWA 4F15B 3S4SB 1PJ9A 4APQD 1TNNA 2W59A 4A2LA 1KT2B 1T2QH 2IQ9L 3QUYC 3VXTB 5DDHA 3FTGA 3GDBA 1RQ5A 4FABL 3EYFB 4XWOC 4Z77A 4Y16C 3TYGL 5FAAA 3L5JA 3MREB 2ZSWB 5I1HH 4UOW1 5KANG 5T5FL 3QIBC 1MIEL 4C83A 4EXKA 4IRJB 3VXOB 4JGUA 2NMSA 1HCFX 5EO9B 1AXTL 1NEZB 4JZJA 5JNYB 4I1NB 5FYKE 5KSAB 5SWQA 2I24N 1A6PA 2LE9A 3NABL 1F6AB 4HF5L 4CVZB 1P7QD 4BFBD 3S3SA 3BPCB 5DUML 5CINL 1A6AA 3EO9H 3VMOA 1U8LB 4HS6A 2Y5TB 3JV4B 2YD4A 2I9LA 1L4IA 4HXAH 4OCYL 1DQJB 3QCUH 4I0KA 4X99B 1R5VB 1SJVA 2BVTA 5AUMA 1KXQE 2YN3A 4HIXL 3GMRB 1QSZA 1U8MA 3UPRA 2GSGB 1FNLA 1EPFA 4NHUA 1HOCA 4K7FB 3MRJA 1UXSB 3BKMH 2WIMA 1RURL 1HEZB 3KPNB 1KJVA 1FNSH 3HRPA 2ITDA 4NGHL 1S9XA 4OF5A 5EO0A 5EZJB 1DUZB 4J8RA 2XZCH 3LV3A 1HILA 1NBYA 3UROR 1OARL 1IGJA 1MHEB 4A6YL 3BKJL 1T1XB 1YYLL 2PCPA 3WL9B 4NQUA 3HC4L 3ZDXE 3EJYC 3EZJB 5SWSA 5JXEA 2ZWLT 2FEDC 3IAPA 4DOHB 5I9QC 2AV7B 1FQ9C 5MP6H 4XPFH 4RX4D 3NIFE 3V5KA 4F57H 4KJQC 4PGCA 4OV5B 2VLJD 3O4LA 2ED9A 4JO1H 5EC2A 3MCLH 4CADB 1BF2A 4L9LC 1OOAA 4HIHB 2LVCA 3ZKSD 4XP9H 2Y36H 4S11A 2VR4A 1YY8A 2GJZA 5DVMA 1LILA 4K2UL 1SYSB 2GUOA 2ID5A 3DETC 3ZE2F 3LN4A 1JRHI 1T6WA 1TXKA 4J3WA 1FG9C 2WV3A 7FABL 5GRUH 2DQEL 5IOPB 3G6DL 3HPLB 4EI5A 5FCUH 1CXHA 2HLFD 5T1KD 1ZT4A 2PR4H 1DQQB 3D6GA 2G9HB 4YHKH 1Y18B 3X11B 1QUNA 4HKBB 3KG5A 3TBTA 3GI8H 1VCAA 5KAQF 4UB0L 2UY7A 3MRKB 3V6ZA 3NIDE 1QSFD 2ZCLH 3M07A 3L3HB 4OCSL 5F44A 3STZA 1J05A 5EA0H 3W0WE 2BNQB 2AKRA 4F9LA 1J1OL 1X5XA 4CMMA 1FDLH 1K8DA 1RPQA 4ZPTA 3BN3B 1ZHBA 2AJXL 5DWUH 1X4YA 5I15L 5F3BB 1G9MH 1DDHA 4Z0XB 3BQUA 3R0MA 4P49A 4WHTA 4E9LA 4NQDE 3RWHA 3C5ZD 1JNLL 1A64A 2DBJA 2HMID 4P3CH 1QFWH 3BKYL 4IHOA 5DQJB 3RA7L 3ZHLA 4ZO6A 1MNUH 1CE6B 1QLFA 2HG5B 4OFDA 4W70A 1EMTH 3WS6C 5DLML 4P23D 3KLHC 2Q76A 1FZJA 3SDXB 1B0GB 4XVTH 1QPPA 2LAAA 4I4WA 2NX5D 4NQCB 1WBYB 4UT7L 4OIBA 5IMLA 1A14L 4JPWH 3RP1A 3D25B 3BIKA 2IPUK 4XWGL 1T3FB 3GI9H 1I1YB 2AJZA 4YUEH 4O51A 1A1MB 1CXFA 1CBVH 3VG0H 4JQXC 4MS8D 3O2DL 4M7JL 1N59A 3QZWG 4BFIA 5D93B 3KPLB 2AK4D 5E6IA 5CGMA 3UTQA 4PJ9C 3EDJA 1MCWW 4G7VL 4G9FE 2QADC 3MNWA 3TEUA 2E3VA 3WE6B 2W60A 4K94L 3B6SA 3SKNB 1OGAB 2P42B 3B9KA 3BZFA 4U6VL 4HSQA 2NXYC 1KLGB 4AEEA 2DDQL 5HHOB 4KRPC 2VTFA 1CG9B 1BBDH 2ZOLA 3UTPE 5HHME 1HWGB 1VGEL 1VFBB 3STBA 1HH6B 4B5EA 5I1KL 2DQHH 3QUXA 2YUWA 3H9HA 2YC1B 2X1XR 1A6WH 1CFTB 4ZD3H 5D1ZD 3BGMB 3KLSA 4ORGB 1I8LC 3QDME 4JFXA 3GK8L 1FH5H 2OR9H 4M3JA 4G6AC 3UZVB 4JR9L 4TN9A 4KVCH 2QQKL 5FKPA 1UWXH 4U6YA 3SDDA 1JWSA 1CD1B 3RHWK 1FL5B 2HVJB 3T1WA 4QXTB 4AY0A 3LH2H 3EJYD 3H6JA 3F5WA 4OLEA 5JW3H 1PG7X 4HJGB 5I8KH 4MCYB 3DO7B 4G6JL 5CZXD 2E9WA 1X6NA 3VFUA 4U0RC 1V8HA 3V7AG 1QQDB 3PQYD 2DLGA 1L0QA 4ZFGH 3CXDL 1RUPL 5C6WH 1KXTB 4KI5F 4H1LB 3CLFL 2EYTB 4H88H 4PS4L 4L4TE 4E41B 3ZKXB 1IEAB 3FQXB 4NQDA 5KG9B 1ZHLB 3WXVL 2NW3A 3VFWB 1T1ZB 2XTJD 4D2NA 1HSBA 2A6KB 4NJAH 1NQBA 5GS0C 4YNYB 3FMGH 4GRWE 5L7XL 3QULA 1JNHA 2IGFH 4OFYD 4L8SB 3RKDC 5IR1B 2IG2H 2VQUA 4UV7H 1ACZA 3BW9B 2OL3B 4ELMF 1JYWA 1SM3H 1LEKB 2CKNA 5D1QA 3TFKD 5ACZA 4WEMB 3L95B 5FGCB 5I1EL 4AL8H 2HTKD 3RWIA 3ZE0E 4FQ1L 1WWWX 5D6CA 1AIFA 3VD4A 2XWBB 1FVDB 4RCAA 4I0PC 3VXQB 3DV4B 3L7FB 3QFDB 5IHUL 4TTGA 4G9FA 3WFZA 3QUZD 3WFCL 2Z8VC 1JIBA 3FRPA 3HE7C 3BI9X 3VCLB 2EDEA 4XB8A 1CICB 1D6VL 1EV2E 4YGVB 4OCMC 4GFTB 5F96H 4JFED 4U1LB 2JJUA 5F97E 3DYPA 1TVBB 3WIHA 4XPGH 3UMTA 2VZSA 3FOMB 3FO0H 2HVKA 3IFOB 4Q6IC 4AIZB 1N64H 4I77L 3RRQA 3VXPB 4X5WB 5TGBB 1MJ7H 3V6FA 2P8MA 3HTLX 1P4IH 3PGFH 4JPKH 3GMNA 4LGSB 3K8KA 5C0RH 4UAOC 1NCUA 2CLRB 2AI0H 2BP3A 3F62A 3IRZA 4G6ML 4WEBL 4PJBB 3QEQE 1ZLSH 1HKFA 5T3ZL 4M7LL 4RBPK 5DRWA 1UCTA 3PWPE 4JHWL 3HG1B 5J13C 2OTUB 2RCSL 1FC1A 3CVIL 3VXSD 3FO9B 5IT2L 1CFSB 3B8YA 1NDGB 2C7UA 2CSPA 4S0TD 2WP3O 3FO2A 1CFQB 1LQSR 1I1AA 3NVQA 1CDHA 4QRTB 5CEXB 5AZEL 3M45A 3AM8A 4Y19B 5KSVB 3ALWA 2DQCH 3RX5A 8CGTA 2MQ3A 3AB0B 4YDJA 5BQ7B 2MNUA 4Y2DC 4WGWB 5EC1A 4AM0A 4OSUL 1IQWL 4RGMB 1H3PL 3ARBD 2P49B 4NM4H 1CF8L 4IIQB 2X44D 3OKDA 3EO1A 5CJ8A 1WGOA 3WIHH 1FORL 1MI5D 3G6JE 4L4TA 3RVVC 4DUXA 4CU8A 1TJIL 4LBEA 1I7UB 2R56H 1G7PB 2PKDA 4CNIB 2F58L 5EORL 3GBLA 5IKCB 1RAMA 1DN0B 4KRPD 4NHCH 3D85A 5DK2B 2EC8A 1HK6A 5KOVC 4FFYL 4FQJL 4YO0A 2NLJA 5I1AA 4P3WA 4K9EC 1T4KB 4Y5VA 1MOEA 1MRDL 2DMCA 3BP7B 4WDIB 4ISVA 3QPXH 5TQ0L 4RMSA 2HT2D 1JRHH 5FGBC 2X10A 2IALB 1MVFA 4M1CD 2P7TB 4WFED 1FAKT 3VD9A 5CAYB 1INQB 2DIBA 4G6AD 3PABA 4YHMH 4MB3A 3REVA 4AMKH 2GAZB 5JMOC 4NKIH 5I74B 1WBZB 1QR1A 1DFBL 2KQNA 1FZMA 3M8OH 4YXLH 3ROOB 1EFXB 3EFDH 4YHNA 2F5BH 1D7FA 5HHNB 1GC1C 3SGDH 1MHCA 3OXRB 3GGWB 4KHTL 4DGIL 1KYOK 4FQCH 4P46C 4G8IB 4Y4KD 4HWBA 5F9WB 3S5LB 1AKJD 3A0OA 4EUPB 5K93A 3F7YA 3V4VL 4PJHE 2H32H 5C09E 4F9PC 2BRRH 3C6LD 4XVSH 1N6UA 4RDQF 3V0AC 2CRZA 2I07A 4GRWH 5K9OB 2CDGA 1LK3H 2W38A 3BX7C 1EO5A 1GGIL 5HI5C 3FCTA 2HFGL 4YDIH 4OD3H 3TWCH 3QEQA 4Y7MA 1ORQB 3B9DA 3PWPA 5D1XD 2Q8AL 4MXVF 2APFA 3ZYJA 3L9RA 3ZKMC 2ESVE 3IDIA 3L3GA 3HNSL 5L0QB 3WIIL 1JGUH 4JFYB 2IPTL 4PJFE 3GSVA 3R8QA 1N0XL 4PJIE 1S7SA 2PYFA 2AV1A 3VXUD 1A2YB 4ZDHA 5CJOH 4YR6B 2H41A 4BKLB 4LCWB 3SQOH 2VZUA 2FIKB 3LEYH 4D9LL 1JPSH 5EU6E 3G6JA 3PDOB 4UILL 4GKNA 3HR5B 1UC6A 4LNRB 3L1OH 1MCLA 3DIFA 3VWJD 1IZKA 1XCTB 5E5UB 1EERB 3RZCC 1BQLH 4PREA 1KCUL 4TVPE 3NCMA 5FDWA 3MUGB 4YQXL 5ALBH 2B4CH 3QDGB 1G9NC 3MV7E 1HHHB 3KS0H 2WUBH 3MLSH 3MGOB 3LS5L 2O61A 3IJHB 1X6LA 3TPKA 3LEVH 3ARGB 3TO4C 3U0TA 4PR5B 1JVKA 4WENB 3VFGL 1AHWC 2X70A 1EVTC 3QJFA 1RIUH 5BRZD 3EYVA 1X5KA 1J1XL 1REIA 5B3NA 4R2GD 1IKFL 1FFPB 3INUH 5FKAA 4NOFA 3UEZA 2YPKA 1UXWA 3S7GA 4YPGA 4HKJB 5TE7H 4LQFH 4U31A 1ZMYA 4K3JH 2VLME 4P9MH 3NAAL 4LEOA 4ZFFB 3EDDA 3ARED 5JLZA 4A6YB 2XKUA 1NC2B 4ZUUB 3ARFD 1FG2A 2CO6B 4YHIA 5CILL 4K3EH 4CGTA 4PJHA 3T2PA 5C09A 3S36H 2AXFA 5EU3A 4OZHF 5E9DE 4R8WH 1KN2L 1FNAA 2NW2A 1P69B 3UC0L 5ENWA 1FRGH 1ZLVH 1XH3A 4DGYL 1IGIH 1QACA 3CFCH 4GRMB 1IKNA 2V5MA 5TE6H 1FFQA 2MHAA 4HUMB 3OMZA 4UT9L 4EDWL 5DJZA 4ZO7A 3IU3A 5IJKA 1MY7A 1NFDF 1JPTH 2ESVA 2I60L 4XH2B 1OF2B 2WBJD 4PJFA 2VSCA 3MJ9H 3KPSB 5HY9A 4ZSOB 2D7NA 1UWEL 4PJIA 1LNUA 4OLZH 1F6LL 1S9VB 1KIPA 1UCBL 2YEZB 4YXKL 1U8HB 1UM6H 1EEZA 4YHYC 5JDJA 4M61B 5GGSA 1WT5A 1CFNB 5C9JB 3K74B 3QUKA 4Z7VB 2GIYA 5EU6A 2BMKB 3TA3D 1AGEA 1KLUB 2AXJA 5E2WH 4O5LH 4NWTH 4P46D 1NAML 2Q8BL 4F58L 1ES0A 5HGDB 5FB8A 1CR9L 1T0NA 5JOPD 2F53D 2EE6A 3K8LA 3MV7A 4MXQC 3G9VA 4OF7A 3VD7A 1E6JH 2XZQH 3O3DB 2A83B 3HNVL 3F58L 3FQNA 3RVTD 5CKGA 3G5ZB 5EH1A 1MSPA 5HVHB 4P2OB 5KVDH 4OCXL 2IAND 4KKNA 2JF1A 1LO2H 4UIKL 5BMFH 1UM5L 4UINL 1I75A 2ENSA 3CZJA 4KJPC 3C09C 4HUXB 4U7MA 2X05A 5MENB 4OCWH 4XP5L 4RISH 4WTWA 5IG7A 2OLDA 5TF1H 1J0HA 4NRXA 4KXZI 5C0IA 2BJML 3VFOA 2OZ4H 3JWDH 4G8GA 1CLZL 4X9BA 1N5AA 3QDHA 4HUWA 3PUCA 5CBEA 1CD9B 2VRAA 4M9OA 1A4JB 2CLZB 4TVPH 4JB9H 4XNYH 4J4PA 4M43H 4XTRC 1FO0L 2WIIB 3BPOB 1N6QH 3U9PH 3FT4A 2LAGB 3QPQD 5E9DA 1ZWIB 5T1LA 4YBQD 1PSKH 5ICZA 1QVOA 2AABH 3AMKA 3RGVB 4ZFOA 5HPMB 1T03H 4MA8H 5SX5H 4O2CA 1KJ2L 3GMLA 3R4DA 3RUGF 4UTAL 2VL5B 1IBGH 3V6OC 4I13B 1JYVA 1A7NL 1BIIA 2R4SL 1Z3GH 3LCYA 3MJ7A 2GY7B 3BSZL 5J06A 5I1IH 1H5BC 2HJKB 1AD9B 4XBEH 4MQ7A 2NY2B 4YFLF 2P5WB 3TN0B 3RWJA 3OKNB 1GSMA 4LPCA 1ONQB 5E00A 1CFVH 3BO8A 3EO0B 2GEEA 3QI9B 4OFKA 1BGXH 2ORBL 4QHMA 1DBAL 5E5MB 3G5YB 1C1EH 5DD6A 4QOKE 5HVGB 5K9QI 5L2KE 4GBXC 4U1JB 5DR5H 1RIHH 5IW6A 3VXRB 4MNHA 1KCVH 3KYMB 1TZIB 5EU7E 2B8OT 3C60B 3MFFA 2PUQT 5EIIA 3HHRB 3MLUL 1M71A 4JFQA 1DQMH 1MHPH 4C58B 4DVBB 1R0AH 3MA9L 2YXFA 1Q0YH 2E7HA 5GS2D 3T77A 3TVMA 1T0PB 4JDTH 4KHXH 5A16A 5IHBA 1IC1A 4QXUH 5CZVH 5D6DC 2EH8L 4DKDC 3QXDA 4WU7B 1IQDA 4E0RB 3ARDB 3L5IA 4Q9QL 4XCFH 4IRSD 3DI3B 4WO4C 4JFDB 3SCMC 1MFBH 1S9WB 4KTDH 2VL4A 4NKMA 4M4PA 2BVQB 3JTTB 3RJDA 5J1TC 2VLLA 5FOBB 2J6EA 5ALCH 4DGVL 4PJ7F 5MI0B 3NTCH 4ETQA 1WBXB 3FFCE 4MLSA 5E8NA 4NM8H 2VZ3A 4YX2L 2UUDK 2ILLA 4WU5A 5KSBF 3MMEB 4LASH 2P43B 5KJRL 3U4AA 2H26A 1GGCL 3JWOH 4Q2ZA 3HZVB 4RFOL 3MR9B 2H2PD 5GSRB 3J7HA 2HT3D 3BGFB 1NGYB 2AGJH 2VIRB 2VDRL 3O6ML 4X8JB 2WINB 5IROA 2FX8L 3TIDB 1ORSA 2IQ9H 2QSQA 3LSOB 5J57B 1MFEL 3KYOB 4DWHA 3S4SG 5C0AA 3V0VB 4FABH 3G08A 4YIQA 4PRAA 5IVXB 3V0WL 3QFJB 3TYGH 5CFHA 4M48L 3HS0A 4NFCA 5ADPL 1U2CA 3G04A 4KU1A 4WWKD 1ZLUK 3SGJA 4KKAD 1JCKA 4YLQT 5E4EC 3U82B 1MLCA 1AXTH 2RGSA 1FE8L 2VWEE 3ZE1E 3SE4C 1U91A 2FH6A 3DTXA 3NABH 5EU5B 1MEXL 4HF5H 5ESQB 3VWKA 4KDWA 1BZQK 2VISB 1U58B 4GMTL 5AUMB 2GI7A 3AXLA 5L2KA 1I7TA 1GPOH 5CINH 1INEL 1IAKA 4OZ4A 4KUCF 3WLWD 4R7DB 4EN3C 5ICXB 4OCYH 1DQLL 1ZTXL 4G42B 4RWHA 4Y0GA 3HUJB 4MD4A 1DVFB 1XIWA 5D7LB 3OTTA 4HIXH 5FO8B 5JW4M 1T89A 1KN4L 3VW3L 1FC2D 3F6LA 4LPXA 3S9DB 1IGJB 3TF7C 4H8WH 2N4IA 4X6EB 1N2RA 1OW0C 3BDXA 1HSAB 1RURH 4NGHH 4KVNL 3IYLW 5DEGA 4O4YL 1I8MA 1YEGL 2YZ8A 4A6YH 1CDUA 3BKJH 1YYLH 3FRPG 5ESAB 4G8EB 1U2HA 1Q9LA 3HC4H 3L5WA 5I8CA 1H3GA 5SWSD 5JXED 1PAMA 3PWLA 3CMOL 1HIML 1YEIL 2R0KH 3I02A 4F15C 5A43C 1U41A 4CU6A 4FTVB 5I8OL 5IB2A 1NJ9B 3AUVA 3RIFK 2P4AB 1LO5B 5TDPA 3O4LD 4HGWB 1TJGL 1MUJA 1A7QH 2XRAH 3FFCA 1BVLB 3WHE1 4ODWB 3GMOA 4NNPL 4EQ3A 5FO9A 3SGKA 2SEBB 4NC0B 4GOSA 5HYJB 1FFOA 5EO1B 1BX2B 2GUOB 4L4VA 4L3CA 5KN5A 1WFNA 3LN4B 4IRJC 1P6AB 3KLAA 5IMOB 4WJ5B 4FMFA 1CDYA 1NDMB 3PWUB 5KSAC 4HWZA 4PGJA 7FABH 1OM3L 2DQEH 1EHNA 2GFBA 3SOBL 3TBTB 3BN9D 4EI5D 2I9TA 3GHEL 5DGQA 4MJ6B 5LCVL 1FVCB 4ZUWA 1KIQA 3DRTB 5L88L 1DQDL 1GGBL 4D94A 3PHQA 2J8UB 3NIGF 3T4YB 3O8XA 4HUUA 1FL6B 4IOIB 2AJSH 4H26B 2CUIA 3I75A 3TV3L 4UB0H 1EHLL 2NY7L 3MO1A 4K23L 3PL6B 5D96B 4OCSH 1ZHBB 1NAKL 3D2UD 1VACB 3R06B 3FB6A 1RVFL 3MXVL 4I18A 1XF4A 2CIIB 3EDFA 1LHZA 4O2EA 3ROLB 3N9GL 2F8OA 4Y5XA 5J1AA 2C4XA 5HGBA 5I15H 4J3XA 1HXMA 3C8HA 2Q6WB 3DGCR 4KXZH 5DMYA 1FZJB 4Q9CA 5IGXL 3EOAB 3THML 1JNLH 4I4WB 4I2XE 4UIMB 3BKYH 4LPVA 3RA7H 4XRCB 4KZDL 3BIKB 3NGBB 25C8L 3GKZA 2FZ3A 5DLMH 2AJZB 3U6RA 2LU7A 5SV3A 1IEHA 2KUTA 1U3HB 2UWEA 5GGUB 5C9KA 1BZ9A 4KMQA 5IQ9B 4NKDB 4ZOEA 2D03L 4NT6B 1H8OA 2WBKA 3QO1A 1IL1A 5JDSB 3D3VE 5T3ZE 3WJLA 4HFWB 4M4RA 3O2DH 2BNRA 1U8KB 4M7JH 3U46B 1UZ8A 1SEBB 5E6ID 1VPOH 1D6EB 3PGCA 5FECA 5DJDA 4G7VH 4HBCH 3VGDA 4K94H 3BYTA 3B9KD 4U6VH 2DDQH 4EI6A 5AG9A 3H9HB 4X6DB 4HKZA 1JZ8A 5DHVA 1G1CA 4LRNL 4LF3B 3OGOE 3UTTE 3MRMA 1J8HB 3BRGC 3OJVC 4PRNA 2Z92B 3O81A 5I1KH 1A4KB 4KKBD 4QHKJ 3CH8A 3QUXD 4OCNC 1FLRL 1JWSB 2EEBA 3BMVA 1RZ8B 3GK8H 4TPRL 1B3JA 3HZMA 2XG4A 4OZGA 3GNML 2PF6A 2CK0L 2QQKH 4AEFA 2DICA 4N68A 5BOPA 4FS0A 3TBSA 4Y4HB 3SDDD 1DEDA 1HQRB 1BEYL 4UNTA 3ULUH 4I3GA 1F4AA 2HFFA 2OJEB 3SKMB 1I4FA 2DWEB 2OJZL 4WW1A 1V3JA 1KXVC 5CEZL 1J18A 3NMEA 4NDMB 5F7NC 3CXHJ 4PJAF 4G6JH 3QCTH 3H8NA 3VG9B 2X4UB 4QHKI 3W0WD 1S78C 1KCSL 3QA3B 2C4FU 4OM1L 4MXWL 3CXDH 5DHVH 3CLFH 2NR6C 1RI8A 4TNVK 1Z2KA 5I8EA 5E08L 1HSBB 1II4E 4ZPVB 5E2JA 3AMLA 5JW5A 4L3EE 5D93C 4LLQA 5GRYA 4D0BB 1MVUA 4NQDD 1UB6A 2D0GA 2B4CC 3WXVH 3L3IA 4HJJL 5IMMB 2P5EB 3WBDA 3UJJL 3KR3L 1IEBB 5L7XH 5LKNA 5D7IA 3O9WA 4NSKB 5E56A 4NQEA 4E5XB 4FRWA 2NY5L 3QXUA 1AO7E 1H15B 1ZLWK 4PBWD 1U6AL 3OGCA 4OKDA 5GRXG 2NY4B 2EO9A 2XPGB 5D1QD 3QWOA 4D0CB 3S37L 4M1DH 5I1EH 4Q9RL 3F7RA 4HX1A 1XCQB 4JFHE 2CJUL 2D9CA 3WUWA 1ZA6B 4U1HA 5IHUH 1A1NB 2G60L 1TPXB 1EBAA 5I2IB 1TQCB 3WFCH 1JI2A 2V2WB 3GB7A 1KCRH 2HVKB 3H3PL 5GJSL 5HHQB 2E7CA 3QDJE 3DX9B 4R0LB 3ULVC 2I26N 4DZ8A 4FXGB 5DEZA 2DLFL 1EAJA 5FXCH 2WANA 1CE1L 3FQRA 1NPUA 5BO1L 2ZUQB 1AC0A 5HHMD 2BNUA 1KPUA 3W9EA 1X4ZA 1I8KB 1H3VA 2ZKHL 1MH5A 4HAGA 4I77H 4XPTL 4OLUH 2ZSVB 1JPFB 1IAMA 2IBGA 4FQPA 4ESKA 5B38G 1UYWH 2DYPB 3GMMA 3RY6C 3QDMD 1JV5B 5H2BB 5GPRA 1W72L 3DARA 4G6MH 2EXWC 4WEBH 3AU1B 2IH1A 5ILTH 1KJMB 5J0BA 3ZKXC 2JJWA 4LLDA 2F8VA 4JHWH 3CVIH 5BXFA 1U36A 3PWNA 5IT2H 1EZVY 5ICYA 4H5SA 1I1AD 4C56B 1X5FA 4DUVA 1HN1A 1BFOB 3BEVA 5AZEH 3FQUB 3HRZA 4XBGB 5HDQL 3IVKB 1NUDA 1TCRB 1QD0A 2ICES 4L8SC 4W4OA 1WWAX 3MXWL 4OSUH 3OHXA 1D5XA 1IQWH 1A7BA 3FFDB 1H3PH 3T2OA 5F7MC 5DA4A 1CF8H 1BQUA 1FORH 5HYQA 2ED7A 4JKKA 5C92A 1TJIH 1WAAE 4L3EA 1YC7A 4YO0B 3LEXA 4PJXB 1OTTC 2NY6D 5FDYA 2F58H 3FN0L 2Y25A 4MD0A 3RBGA 5K59F 4RIRA 5DXWA 3D85D 2WZPD 4GRLA 3MRLB 5F88B 5E24E 4FQJH 1BLNA 1NBZB 2X1OA 6FABH 1CICC 1MRDH 4ODUA 1ZSDA 4V2BA 3HZKB 3SEPA 3UYPA 1AO7A 1EK3A 2UVFA 5TQ0H 4YEFA 1RZGB 1GZPA 1UACH 4LRIC 4Q6YA 3X14B 1KFAH 4M62L 4M5YL 3MV8E 4PP2A 4Z9KB 5FUCC 3U2SB 5DJ2A 2ARJQ 5D5MB 4Z78A 4LHUA 3NFNB 5HHXL 1R5IB 1A02N 3QRGL 1YQ2A 5IW1B 1I85C 3WN5B 1DFBH 5GGRA 1IC7L 1B9ZA 5JOFB 1T5WB 4MMZC 2DKUA 3SDXF 3JWDC 1G7MB 2R8SL 3V5HB 1EEUA 3RWEB 1Q9WA 2D2OA 3EGSB 5I1GL 4KHTH 4DGIH 3QDJA 1YMMA 3FONA 3DROA 4LPTA 3DURB 4KK5D 4YAQB 4Z7UB 1UEMA 3MBEB 5FF6A 4ODVL 1S78D 4AZ8A 3V4VH 3WLBB 2R15A 4PRDB 4PY7A 4JZNB 3GUTA 3AB0C 5DJ0B 4YWGL 3AAZA 4FXKB 4RGMC 4K3DL 3MGTA 4WUKH 4C59B 4IIQC 1GGIH 2BXYA 3P0VH 3BYYA 2HFGH 5A40E 2C3WA 3D1MC 4I48B 3QEQD 4HG4J 1CK0L 3GSVB 1FZKB 1P6FA 3PWPD 4XMKH 2Q8AH 1RD6A 1S7SB 5SWZB 4WWID 5DK3A 3IF1A 4KK9D 5D70H 4ZDHB 4GUPB 3HNSH 1KTDB 2VDOL 2DI7A 2AW2A 2PXYA 4P2QE 1F3DJ 2A0LC 4X83A 1W0YT 4LVNB 1JPGA 5CD3A 2NPLX 1NLDL 3L5XL 3MRHA 3P4MA 4HLJA 3HC0B 4PYHA 3P9LB 1T20B 3H3BC 4G6FB 1WLHA 4WHYG 1LE9A 5CLTA 1B90A 1FV1A 3RTQB 4WI8A 4PLKC 4LSTH 2NYYC 4PREB 4D9LH 5BV7B 5D7JD 5IHLB 3N1MC 5IJVB 5D72L 4UILH 2QTEA 3KGRA 3ULVF 2FYYA 4U6XB 3RFZC 4JVPA 1WAAA 1DQTA 4HJ0C 4U1MA 5EBMA 5I74C 1JZ3A 4NKQB 1KCUH 1JTPA 4IS6B 4YQXH 4KJYB 4OUUA 3U0TB 3BJLA 2R2BA 4N90E 1RJYA 4JG1L 3WFHB 4MJIE 1QHOA 4OBRA 3LS5H 4ZNCD 5F9WC 1QNZL 2Y72A 4GMSL 4U1SB 1CVSC 3MV8A 4N9GA 5ID1A 4U4BA 5MEQB 2NXZD 3VFGH 3MRRA 4RGNE 1J1XH 1C5DB 3AFLA 3SY0A 4LEOB 1G6RL 4H0IA 4LPYA 5DQDL 1BJ1J 2HFEB 1YC8A 1FGVL 3UDWA 3HC3L 3NA9L 2WSKA 5CMAA 2A6DA 4RWYL 4RGOL 4YHIB 3STLA 3TBVA 2QEJA 5T33L 4JDZA 5TH2A 5E1AA 4RFNB 1C8PA 5EU3B 3JWOC 3PGDB 5H94A 4IDJL 1UWXK 5CILH 5L0QC 1XF2A 2GCYB 4X9HA 5JR1H 2XT1B 4KKCD 1D3CA 1RMFH 1UH2A 4KRNA 1BFVL 3TT1L 3WO4B 4U1NA 4HUVA 1KN2H 1S7QB 1CGYA 1U8PB 4PJDB 5DHXB 3UC0H 3E3QE 1B4RA 4M6OL 4LOUC 2EICA 4DGYH 1OAZH 5D2NB 4NPYB 1U8IB 5ANME 2VXUL 2PTTB 3BXNB 4UT9H 5DTFA 1MLBA 4EDWH 5JO5A 2B2XL 3V5DB 1T0MB 1WC7A 4XNQA 1CICD 3LRHA 5IW3A 4Z7NF 4KY1L 2VYRE 3TJHD 3RIAF 2ESVD 1KIPB 1MIML 5IVZA 3L3KA 2HWZL 4PTTB 5I1CH 4DTGL 4P2QA 1UWEH 4UQ3B 2NY1B 2NQCA 4LLYB 2PO6D 1TZGH 1I8IA 1IAOB 1WJ3A 3LOWA 1GVIA 4YXKH 1RK1B 3E6FA 3ARGC 4HWNA 4PJBF 4TSCL 1P4LB 2FCBA 3MROB 3IB4A 5EU6D 4OGAD 3WSQL 2DQFA 3ARWA 1T0NB 4FQQA 4KROB 3BEWA 1LO4H 1S7TA 3P0YL 1KIRB 3ESVF 3FB8A 3QIUB 1NAMH 5ESVA 4F58H 2BSSB 4H8WC 5DURD 5TQ2L 3ARVA 4TVPD 2ZUWA 1FO0A 2Z91B 3OX8A 1CR9H 1ZS8A 4MB4A 4HBQA 3NCCB 2P45B 4BSWA 4U0QB 1H3XA 3BVNA 4Y19D 2HRPL 4X6CE 1KB5B 2AJUL 5DUBB 5K33A 2X4OA 1F4YL 3B8SA 3HNVH 3F58H 4X7EC 2FECL 4DN4L 4OAWA 5HVFB 2B1HL 3DECA 5A3IC 5C0IB 3VFOB 4D8PB 4OLXL 4G8GB 2PW1B 4N0UE 4UIKH 1UM5H 4ZUTB 3L7EA 2APWA 3P11L 3WIFA 2W65B 4XP5H 3U0WL 2JB6B 3CH1B 4FZEL 3GSOA 1S9YB 1KULA 2VLMD 2BJMH 5FYJE 3MX0A 1GJIA 2GK2A 2MSPA 4NOBA 5TDOA 2XWJB 5DYOA 2VE6A 1PYWA 1RU9L 3TLRA 4XHQA 4N5ED 5DMKA 3FRUA 4X98A 4J4PD 1FO0H 4H0GA 5E9DD 4GKSB 3BRDA 1AI1L 5DEFA 1M05A 3CFBA 3QRFM 3RKPA 4F7CB 1U92B 1P4BL 4G7YL 4NQSA 5ANMA 1A1OB 1KJ2H 3RQ3A 1AGDA 1EFXD 2Z4QB 4UTAH 3S88L 3X12B 2CXGA 2R1YA 1A7NH 1L6XA 4JRYB 3BP6A 3VGAB 2R4SH 3BSZH 2QV2A 2CLVB 5E00B 4NBXB 3JVGC 4JREB 1JYNA 4P2YA 4O02L 4B50A 2FH8A 1OSZA 2W0LA 3UP1A 2O26U 4N8CL 4ONGL 4PJEB 1MJUH 4NP4L 1PG7W 2ORBH 1NCCL 5LGKA 5K9QG 3OJDA 1J0ZA 4JPIA 4MNQA 1K2DB 3MFFB 4JN2B 5HVHC 3KXFB 4P2OC 4ZTPL 3QG7H 4LEXL 4NO0B 3ZDYF 3OJMB 3HI6L 1VENA 5E2UL 4CVWA 5E7FA 5A16B 3MRIA 4NRZA 3FB7A 3MA9H 1PX3A 5F89A 1WQVT 4O00A 4O2FB 1EA9C 4WW2B 3TVMD 4LKCB 2BC4B 2CXKA 4V1DE 4GKZB 1JN6A 4X6CA 5EUKA 1UWGL 5A2KH 3LIZL 3D39E 3VGHA 5E8OA 4NKMB 1DCLA 1CXEA 2Y5EA 1VB9A 2XXMB 3BPOC 4PB0L 3G6AB 1RJZB 2X4NA 2XZAL 1MFCH 2EIZA 5ITBH 5I66B 3FJTA 1DLHB 4FOMA 3IFLL 3MLVL 4M00A 5CIPA 3RGVC 5ISZB 4MLIA 5CS7A 4DGVH 4GXVL 2GTZA 2DLEA 4F2MB 1AGBA 3I2CL 4OLYL 4K94C 4YX2H 1IE5A 3PV7A 3ALPA 4MCZB 5F1NA 4HAFA 2BSTB 5GS0L 1I7ZB 2NY2C 1BM3L 1YMHB 1CS6A 1BQHB 4FQIL 4RFOH 3TN0C 1AGCB 4OF3A 2WBWB 3HR6A 2FL5B 5C0AB 3QI9C 4OF0A 3UXFA 1FBIL 3M1BA 4PRAB 3H7BA 4NN6B 5IB4A 3KYNB 5C0CE 1MPAL 4F33A 2GQHA 4Y8AA 3K81A 2ZCHL 3CU1A 4JO3H 5BV7H 3QJHB 1U95A 4QRPE 1MLCB 2HT4C 3C60C 5DRZB 3V0WH 3ULUC 1FNGB 3MJ8A 4M48H 1QEWB 5T1MA 5ADPH 5J4MA 5GZOC 4LP4A 1F3DH 2YSSB 3MLPA 2VJXA 2EIBA 1JGDA 5DGRA 3DX8A 1IAKB 4HGKC 1FE8H 3ARZA 2AAVA 1ZA3B 5JZ7C 1MEXH 1Y6MR 1HHIA 1QKZL 3U30B 3VWKD 4WTXA 2R0ZH 2ZPKL 3ARXA 5EN2B 4QOKD 3PIQA 3ARDC 1JK8B 1W8OA 5L2KD 1N5YH 3WHXA 5GRVK 1ZHKB 1DQLH 4S1QL 1XIWD 3SKOB 1NMAL 1KYOJ 3CVHL 1G7QA 3VXNB 1MAKA 5FHAL 3FQTA 5MI0C 4J7RA 4HZLA 4XXDB 1HH9B 2QJDA 5DD5L 5E2TH 3GHBL 3W11C 4V1DA 4M1GL 1IMHC 1XGTA 2AJYH 4BQCA 1S8DA 1R3HB 4O4YH 3D39A 3WDIA 4N8VB 1EUTA 1YEGH 5H35B 4Z7VF 4M7LT 3SDAB 5HYSG 4HK3N 3CMOH 3BGFC 1HIMH 1YEIH 4PLJC 1BJ1H 4NO3A 3IETA 1Z0NA 5I8OH 2Z31A 5CJXC 3MNVB 3ARPA 4L4VB 2IFFH 1TJGH 4HC1A 4J3SA 1O0VA 1FIEA 1XGPB 5KTEL 3FFCD 1ZLVK 5CEZE 4N0FB 4NNPH 1RUMH 2R2HA 1D5ZA 1EAPA 2NY3D 4HWZB 4FFZL 3IXAA 1OD9A 3E2HB 4WI4A 4Y4FB 2FJFA 3N85L 4K9EL 4Z7OF 2YR3A 1WZ1L 3RDTB 1XGQA 5JXAH 5EWIL 1RHHB 5IB3A 4ZOAA 4YK4B 2AQ3A 4IMLA 4NZJA 3PHQB 1OM3H 3RWFB 5C0CA 2V2XB 1K6QL 3SOBH 1KNOA 5FUOL 3QHFL 3A6OA 1DLFL 3GHEH 1JNNL 5LCVH 4P5MA 3KPMA 3C8KB 4JPVH 5L88H 3VFNB 1DQDH 1GGBH 4QRPA 1DVFC 4NBZB 3RPIA 4KMTL 2DBLL 3CSYA 1JWUB 3UTZB 5J7CC 4L8DB 3O8XD 1GC1L 3TV3H 1K85A 4JM2A 5DRXA 3EJZC 2LFGA 2I27N 2XFXA 4K23H 1Z9MA 4LSDA 2PTUA 2VITB 3U7WL 1NAKH 4LPUA 4WFFE 3FT2A 4JJHA 1XGRB 5HGBB 4ODXB 1RVFH 3MXVH 2OMNA 3V8CA 3HAEB 3VRLF 2F9BT 1KB5H 4XHJD 4XNZB 4UTBL 4S1DC 4RZCB 4P57B 3N9GH 3MRDB 4BZYA 4MQSB 2AJ3B 4LVOB 4CDGC 5HTSA 2X9XA 4XZUA 5J12B 2UWEB 4MAYB 3FL7A 3M17A 4GO6B 4LHUG 3GZKA 3WCYA 4KZDH 3K46A 25C8H 5B8CA 1XR8B 2VKXA 4ZFZB 4CJ0A 1A7PL 2JIXA 2ICWB 2BNRB 2D03H 5DSCA 4ZOBA 1WEJL 4BZ1L 3UJIL 3TIEB 2E7LC 2D4FA 2CMRH 3DMMA 1LDPL 1PEZA 5FECB 3ULUF 5KS9A 2MJWA 2IC2A 3QXAB 5DJCB 1MFDL 1MREL 2VQ1A 2XN9B 4E42A 5GZOD 2Y7QA 4LCCA 4H25B 5C08B 4NZRL 1MWAL 3B83A 5SX5K 3WJJC 2ZUUA 3MRMB 3SDCB 3W5NA 5IB1B 3EYSL 5D8JL 4PUBL 4U3HA 4ZODA 3TCLB 1P9MC 3FB5A 4YDVB 3PNWA 4LRNH 2EE2A 4OKVB 3PL6C 3T0VA 5I18H 5D96C 4NC2B 1C7SA 4WUUB 4WI6A 1X3DA 4OZGB 1DUYA 3O2VH 5TDNB 2GITA 2C3VA 1FLRH 3B5GA 3T0WA 1I7RA 5I1JL 2IAMA 5E70A 1NANH 2FBJL 5IB5B 3P40A 4TPRH 1LO3L 3FKUS 3GNMH 3W11D 1WFTA 2CK0H 3ZYIA 1D5IH 1KENL 2BY0A 4PJ5B 1LEIB 4LGRB 4HHAA 5ID0B 5E99L 4GXUN 1RK0B 1BEYH 3FZUC 1U93A 2X4SA 4N0CC 3O11A 4X9GA 3NGBC 3PP3H 5CP3H 2OJZH 4J3VA 1U3HC 3GSRA 4R4FL 1OHQA 2W0PA 1G7JB 5JW5B 4PJCE 1KCSH 1WSST 4JRWA 5JIKA 1T2QL 4OM1H 4MXWH 3ZE2E 1GCFA 5IVXF 1A3QA 1PD6A 2NCMA 4PG2C 5E08H 3HMXA 3CLEL 3H9YA 4Y5YB 4WV1A 5D7IB 3ZYOA 2P24A 4NQEB 1OWWA 2DQGL 5EFIA 4HJJH 4JJ5A 1P2CA 2RFXA 4X6BB 1JUFA 3KR3H 3LPFA 4L8CA 2F54B 4FZ8L 1VGKB 5CP7B 3DV6A 5DMGC 5LAXB 3O9WD 1BIHA 2NY5H 2CRMA 5IESL 3C08L 4P4KA 1HQ4B 2FIRT 5E6ZA 4HIEA 3HUJF 1VKXB 1T04A 4MNGB 1YDPB 3D3VD 4R96B 5CBAB 3S37H 5T3ZD 4Q9RH 2MKWA 2FWOB 2Z8WC 3LKPB 1V3KA 1DVFD 4OB5L 4LLMA 4PJ8B 4G9DA 1MCQA 1QPXA 4R4BB 4X7CC 1BJ8A 2G60H 3EJZD 3MA7B 3O6FA 1D5BB 4OZFA 2IBBA 1YNTB 4Y4HC 1W0WA 3H3PH 5GJSH 3MYZA 3TP4A 2Q86B 2DLFH 3FT3B 4FN0A 5BO1H 1S7RA 4EJ1C 5HGAA 4S2SB 3UTTD 1CGWA 3GMMB 4XC1L 2ZKHH 1MCIA 2FECI 2ZCKL 3VE0B 3VG9C 4LLDB 4JAMB 3DSFH 3BH8B 4IRZL 3U0PB 1W72H 2YA1A 4XCNA 5KVFL 4L8BB 3ZL4H 1VFAB 1RZJL 3RNKA 1J12A 1A9EA 5D2LB 1B0RA 3JZ7A 4ZYKB 2KPNA 1D5XB 3IT8D 1R3LA 4M5ZL 4NKOB 5HDQH 4PRPE 3MLYH 3TBWA 3ULSB 1JL8A 1X5YA 5LQBL 4LSSL 4OZFH 1VFUA 1BECA 3SJVE 4ELKB 4QNPF 3MXWH 3C6SB 3KDMB 5IM7A 1QSEE 3O6KH 1HI6B 1ROWA 4PJCA 5EBGA 2NY4C 5D7SL 4JLRA 2J8UF 5FCUL 1KG0A 3K8MA 1EBPA 5T1KA 5GGTL 4RAUA 2PR4L 4NO5A 1NL0H 5DD3L 4L3ED 3GI8L 1ZSDB 3FN0H 4WIQA 1TPXC 5DQ9A 1XR9A 1TQCC 1UZ6F 4JG0L 4L1HA 4GRLD 1X4XA 4HIIA 4OZIB 5DS8A 4R0LC 43C9B 4Z78B 1A3RL 3MLTA 2HN7A 4M8QA 4JQIL 3BUYB 2BOCB 1AO7D 1CL7L 2ZUQC 1HE7A 1RSFA 3VXME 4M62H 1QRKA 3K3QA 4M5YH 5L2JA 5L6YL 5IBTL 3GSQA 5DWUL 1FYTE 4LHUD 4JFHD 3X13A 1FNEB 5HHXH 1Q9WB 1CQKA 4GW4A 4X0KA 3QRGH 2FO4A 1NCWL 4LKXA 4R90L 1YMMB 1UB5A 2ZUTA 3FZUD 1IC7H 2YHGA 5F9JA 2R8SH 5FF6B 4KC3B 1MNUL 1EMTL 4JKPL 4PGBA 5I1GH 4P23A 2E7BA 3GUTB 2VERN 4NQVA 3VFTA 2X4RB 2O5YH 3G5XB 2R2CA 4OQ1A 3L3JB 4P2CG 5TF0A 4YUEL 3QUYA 1YNKL 3L6FB 3ARTA 4B41A 4YWGH 4Z95L 4ELME 1CBVL 2R0LL 3WNMA 5DFVD 1Z5LA 4Z8FL 3D0LA 4K3DH 4Y16A 3HAEH 4TVSa 1IM3B 1CN4A 3IF1B 1TLKA 3QIBA 2WQRA 3TO2B 4JE4B 2ENYA 4ODSL 5HYFA 1CK0H 4CVUA 4X6DF 4PTUB 3P4MB 3DRQB 4Y1AE 5EZLA 1BBDL 1FV1B 2VDOH 1ZEAH 1WWCA 1GOGA 1R3JA 2OBGA 3PV6B 4PRPA 1XF5A 3TGXA 3T08A 1XEDA 2H8PA 5CJ5A 3SJVA 1NLDH 1G6RA 1M7DA 2YPLB 1QSEA 1P1ZA 2FYYB 5MERB 4YDKL 1UEYA 4ZD3L 3KPQA 3V79C 2VAAA 1ZGLA 5D72H 3VI3F 2A6JA 4LFHG 2OR9L 4LCYB 4CW1A 3NPSB 1AD0A 3EYQC 1A6VL 2CDFB 2FSEB 1RJYB 4KVCL 1U8OA 3WN5C 3QIWB 3MGAA 4HWUA 2EDHA 3S96A 3GBNH 1RV6X 3NCFB 2ZG1A 1W2KT 1WVZA 3LH2L 3LKSB 2HJFB 3RWDB 2VLRB 1ND0A 5EZOH 5JW3L 3MRRB 2FO1A 1TZHA 3MBEC 4GMSH 3MRGB 3VXMA 2EH7H 3GMQA 1FVEA 4MB5A 3KYKL 3PQYA 4D0DA 4X7TA 1FYTA 2ZG3A 1WZLA 3N0PB 3CVHB 2JJVA 4L9LA 2R23B 1IM9B 1G6RH 2W0KA 1UM4L 5DQDH 1FGVH 3HC3H 3UCRA 4JFFE 3NA9H 2CRIA 2Q7YA 4R6UA 1I1FB 3TPUB 3EBAA 3WNPA 4R3SB 5T33H 5C0BE 3U36A 4Z6AT 3V6BR 4WI9A 3VFRA 4L29A 4U1NB 4WFHE 4IDJH 1UADC 1MCJA 1H3WM 4UV7L 1MAMH 2GJ6B 4MWFB 2Y1VA 3OR7B 1XF1A 1KTLA 1V3MA 4HCRA 4LVNC 1BFVH 3TT1H 3BISA 1YPZB 2APBA 5BVJA 2DD8L 2HLAB 4J23A 1I3RA 3RTQC 3CZFA 4LK4A 4M6OH 5CD5C 1WC7B 4P5TB 3QUMB 2VXUH 5BV7C 2H3NA 3W81A 3B3IB 1K8IB 5D7KE 5IVZB 1LWRA 3VFPB 1OGTB 2B2XH 2KZWA 2EDFA 5BS0E 1CT8B 2YD3A 1FGNL 2VMFA 4KY1H 3LQZA 1AP2A 2QHRL 1MIMH 5DZNA 5F1OB 2HWZH 2R2EB 4DTGH 4Y2OA 4P2QD 5J6GB 3FO0L 1CGUA 4IEFB 4CDHA 2VZVA 2RB8A 2FEEL 2FJHB 3O41A 4OD2B 3HE6B 3TZVB 4DFIA 8FABA 2DYPD 3BHBA 3O45B 4AEIH 4TSCH 4LCUB 3B9EA 2BXZA 2H2SC 3TH4T 1T1YA 3HZYA 1WV7T 1ZS8B 3WSQH 4JM4L 4AIOA 3OG4B 3A6BL 3IDNA 1EGJL 3WS6A 2CD0A 4TYUA 3T0EB 5JHDE 1ZLSL 5IFJA 1MHHA 1LE5B 1BFTA 5TQ2H 2X4OB 5DO2C 5HVWA 1KJ3L 4MXVE 4NNYA 1R3KB 3AS2A 4ACPA 3BKCL 4N90D 1YY9C 5JPNA 5TE4L 2HRPH 2Z9TA 4ONHA 4RFNC 3TCXA 4MJID 3CCHB 1N4XL 2AJUH 2KL6A 4JQXA 5JPMB 1B6UA 1GAFL 1XGUB 3GO1H 1ADQA 1MCHA 3L7EB 3ARBA 5IWLC 2EE9A 2F74A 3ILQD 1IKNC 2B1HH 4LLUA 4RGND 4PJ9A 2CUHA 4PJXF 3NZ8A 3WO4C 4HULB 1ZT1B 4OLXH 4KGJA 2IH3B 3P11H 3IDYB 4MZ3A 4C4KT 3IKCA 5D2NC 5T5NF 3O3EA 4ODBD 4FZEH 4JFFA 3EKCA 1I9IL 2V7NA 3MV9E 3FRUB 4UZGA 4Z5RA 3Q0HA 4XGZB 5C0BA 2CDEA 3OXSA 4HDIB 3IDGA 1RU9H 5DEFB 5AAWA 1QYGL 5D5MF 3X3GL 1C7TA 1OT1A 4QF1A 3OJ2C 3QQ4A 4F7PB 2CKBB 1IARB 1I8LA 1F11B 4LVHC 5BW7A 1HDMA 5KBNC 2NY1C 2XOTA 5IV2B 1AI1H 1T1WB 5FGSA 3EYQD 3FOLA 4AMKL 1P4BH 5C70A 1HXYB 4FFVC 4G7YH 4MJ5A 3DXAE 4XNUL 4ALAH 1MWAB 1OY3B 2X7LA 3S88H 2KZ1B 1T21A 4Z7UF 4KROC 2E9IA 1OAYH 3OAYH 1OSZB 4KTYA 3QIUC 5BS0A 4FQCL 4MQTB 1YEFL 5INDB 5C0JA 1FJ1A 3LKQA 5B39B 5JORA 2PYEE 1DR9A 1B0WA 4O02H 4JPIB 4MNQB 4FQXB 2JJSC 3WKNA 1C12B 4N8CH 4ONGH 4Z76A 4QRRB 1QOKA 3C6LA 4NP4H 4PRIB 1NCCH 4S10A 4HS8L 4BH7A 3WD5H 4RNRB 1OQOA 3MRIB 4OZHE 2YPVH 3GRWL 3DVNB 4LLVA 4LEXH 1JZ4A 1S7XB 4YFLI 4F3FB 3IFPB 3CDGB 3O3AB 4OD3L 4YDIL 5GIRA 3HI6H 4PRBA 5DUPH 5JHDA 5E2UH 3FO1A 3NACL 2W9EL 2R1XB 1MCFA 3QXWA 5J3HC 2XNAA 4EDXA 1NFDE 3DNKA 3E8UL 4OCRL 4XC3L 5ABDE 4UUJB 1NMBL 1SJHA 4TUOA 2VR5A 3IJYA 3LIZH 4NYLB 3D18A 4LFHD 3VXUA 2M1KA 1D9KB 3C9NA 1KLFA 2UYLB 4PB0H 3SQOL 3DVGA 2AXGA 3RX8A 1JPSL 3VMNA 2XZAH 3MRBB 1ODAA 32C2B 1OB1B 3HE7A 3L1OL 1NC4A 2AS5M 3IFLH 3MLVH 4X5XA 3PWJB 1SJEB 3TNNA 1F5WA 1BQLL 4GXVH 5JIPA 4DQOL 4OLYH 3I2CH 3MV9A 3HKFA 3VGAC 1T5XA 2BY2A 4Q6IA 2Z8SA 3F65A 3ESUF 3KYAA 5GS0H 4JREC 3PXHA 3GJEB 5BZWB 3QEHA 4FQIH 1CD0A 1RJLB 3LY6A 3QG6A 15C8L 5DD0L 4NUGH 2EDYA 1YNLH 1MFAH 1S7UA 1QLRB 3IAGC 5LGHH 1AE6L 4FQHA 3DUHA 2M2DA 1FBIH 1NLBL 1TJHH 4XBPA 3LKRB 2MCPL 2XI9A 4JFPB 1F3JA 3L3DB 5F7DA 2ZCHH 5DO2D 3P4NB 4K3JL 2JK5B 4TNWF 1YY9D 2EC9U 3DX8B 3NFSL 1EEYB 3AREA 1H0DB 4U1IB 3BZEB 1ZVHA 4Y2DA 2PYEA 3ZSSA 1TITA 3O6LL 3ULVL 1DANT 2IPKB 3PIQB 4UDUA 1LO0H 1UVQA 4WW2C 4I9WE 3P73A 5LGJB 1JZ7A 2WK2A 4PJDF 3T1FA 1GOFA 4NO2A 5C07B 3CFEA 4R8WL 1PKQA 2Z93A 4PP1C 2ZPKH 1VDGA 4OZHA 2G75B 2A74A 1NGWA 5DC0A 2FJGA 3JTSA 5I16A 4PJIF 1PG7L 4HZLB 4S1QH 1QP1A 4U7SA 2YD9A 4N5UA 4UBDC 1NMAH 3CVHH 2OX5A 5DJYA 3RUGE 5F9OL 3P4OA 4OIAA 2CIKB 5HHVL 4NNXB 2HKFL 1UFUA 1NFDA 1MCBA 3VMPA 3CDCA 4MDJA 4YHLH 5DD5H 5FGBA 3GHBH 4V1DD 4M1GH 2IF7A 3MJ9L 2BCKB 4AQ1B 4ZXBB 2R29H 2NY0B 5I30L 1G1YA 3IETB 4OZFG 2QR0A 3W39A 4ERSL 3T4AA 5C0NC 3CUPB 5FCSH 1A5FL 2OL3L 5DK0B 5LG1A 1BZ7B 1HWHB 4JGJA 3RY4A 4NN6C 1KGCE 2R2HB 3ILPB 2Z31D 3OKLB 3QIUD 4NWTL 4P46A 4TUJB 3IXAB 4JRXB 2D3VA 5K9KB 2ADJB 5KTEH 2F53A 3SGJC 4J1UA 3UAJD 2EDXA 3BP5A 1BD2B 4FFZH 4F9PA 2XZQL 4W6YB 1F58L 3N85H 3IU4L 2VLKE 5LXGH 1G0YR 2QSVA 1KNOB 3RVXD 3JV6B 4UI2A 4HH9A 5EWIH 1CL7I 3U30C 3CXHK 3B2UC 3D69B 3W9DA 4X4XB 3RWGA 5C0CD 1K6QH 5FUOH 3QHFH 3ES6B 4LU5L 4RISL 4X7SL 3MLRH 3CC5A 3NZHL 5IBUG 2OZ4L 4KMTH 3VJ6B 5BZDA 2DBLH 3JWDL 1MCSA 4PJ7E 1ED3B 1GC1H 4R7NB 1JTOA 5KZCD 1JZ2A 3S35X 5KSBE 1S5HA 5FIEA 2JJTC 4JB9L 4XNYL 3LKOB 3U7WH 1K5NA 4QHUB 3U9PL 1N6QL 3VRIB 3MUZ1 1NGQH 1HNGA 1N3NA 3RZCA 2AABL 4UTBH 4XZUB 1AXSB 3SDAC 2RBLA 4MA8L 3AS0A 3DOSA 4HKXB 1HCVA 4M6NL 3P77B 1U3YA 4I0CC 1FFNA 3QO0A 4K3GA 5KW9L 4KKLD 1W0VA 5F3HB 4LVEA 4PJEF 5DSCB 5E8PB 3DUUB 3TO4A 3MRQB 4F37F 4C4KO 4ZUVA 1AHWA 4YFDB 5FO7A 2ADFL 4EVNA 1NCAL 1HHGB 3E2HC 1A7PH 3NCYS 2JIXD 1LP9B 4Y4FC 5I1LA 1BGXL 5KS9B 1HYSC 3BH9A 2DI8A 4Q97A 3RDTC 3UJIH 2I5YL 4JDVA 3NPZB 2AQ1A 3DMMD 5F1IA 1LDPH 1JHTB 3QEUA 2G5BA 2CKBH 3MLWL 4YK4C 3F12B 1GZQA 1LEGB 2X4TA 2GT9A 3S34L 2ARJA 5C8JB 2VABB 3O3BA 1DQML 2FB4H 1DZBA 3FB5B 4MQXC 1Q0YL 1MWAH 4OFIA 5CEZD 2VXQL 3RL2B 4WI3A 3C5SB 4HMEA 4JDTL 4KHXL 5ITFA 4ZAKD 3KWWB 3EYSH 5D8JH 4PUBH 4QXUL 5CZVL 3HLAB 2HAZA 2FRGP 3DUSB 2GITB 3RVUC 2EYRA 5F6IB 3H9SE 1NGPL 1UJ3B 3V6OE 4U6HB 4P9HL 2MCG1 3T8XA 1MFBL 4KTDL 4HK3J 4XNZC 5I1JH 4NWUL 2IAMD 5FV2A 2FBJH 3EHBD 1NCTA 1U93B 1YA5A 4ODHH 1L7IL 1LO3H 1C16A 3DGGA 1JWMA 1AR1C 2EZ0C 4PFEA 1W8NA 2VC2L 4LVOC 3UZEA 1KENH 3U4EA 1RZFL 3OPZL 1Z6JT 3GSRB 5E99H 5J12C 4MAYC 2XKSA 7CGTA 3NCYP 5GRJL 1ZT7B 2ZUXA 5FA4B 3JWOL 4PGEB 4APQB 5C0FB 1FN4A 2VNCA 5GZND 3T0AA 2ICEA 2EIEA 4QWWC 4LP5A 1A6UL 2C5DC 4PRHE 4QTHB 2J7LA 4PJAB 1BVKA 4BFEA 2AVGA 2P24B 5BCAA 5C7XL 1YZZA 4F7TA 1N8ZB 5IMKB 4GLRH 1P2CB 3C2AL 4L8CB 3CLEH 5HI4C 2COQA 1OPGH 3REWB 3LRSA 1UA6H 2V5SA 2DQGH 3NIGE 3PDGA 1P7QB 5IFAL 4WWKA 4M3KB 4XCYB 3LRGA 1T04B 4BH8B 4FZ8H 3OKEA 3SDCC 3VFVB 1NGZA 5IESH 3I6GA 5F6HJ 3C08H 5B4MC 4RMUA 4P4KD 3X17A 1URLA 1GPOL 3LB6D 4QCIA 2FEEI 1IFHL 5J11B 2LQRA 1MJJB 1YEHL 4Z0BL 4OB5H 1E28B 3GMPB 2ITCA 2X2YA 3RL1A 3VGFA 4AH2B 1AFVL 4QRQB 5IEKB 5K9JL 5MEOB 4GG6E 2W0FB 4LARL 3RNQA 4H8WL 1OQXA 2CRYA 3QH3A 4EZMA 3V2AR 3O6FD 4HG4K 3DLQR 2AJVL 3C5JA 1IGYB 3OKMB 3I3BA 1IVLA 5F6HI 4DCQB 3QNZB 3SDAD 4K7PH 2OSLB 3T04D 1UQSB 2VLJB 4XC1H 3H9SA 4BQ6A 2DWDB 4ZMAT 4FXLA 1X7QA 1OSPL 2ZCKH 4IOFC 2R0KL 4ZOCA 3V6OA 4IM8A 2RJMA 3SO3B 1KEML 5ETUB 5J6HB 2DJUA 2NZ9C 4IRZH 4LIQL 2QBWA 3BAEL 1PBYA 5E94A 1B0RB 5HHPB 2BVYA 4BK4A 5KVFH 4BJLA 4FA8A 1A21A 1A7QL 2XRAL 3QQ3B 1AC6A 4MMXC 2FR4B 4R97B 5AZ2L 3GSUB 4KI5C 1RZJH 3K4AA 4P2RE 4Y5YC 3ALXA 35C8L 5HGGS 2AQ2A 1S7WB 3KPRE 3MCG1 2UV3A 1TETL 5I17A 1S7VA 3RDTD 4M5ZH 4FNLL 1TTFA 4KK6D 1CTNA 1VADA 3OB8A 4GBXA 3ZDZF 3ECBA 4HPOL 1WCBB 5LQBH 2VDLH 4LSSH 5T1KB 5IEHA 1JZ6A 2D0FA 1AQDB 4O9HL 3QCVL 5D7SH 5CJBA 4BYHA 3MUY1 3ZE1F 4MQXD 2YD5A 5GGTH 5DD3H 4PJ8C 1QSFB 4F8QA 5DS8B 4PGDB 2APXA 4PV8B 1L0YA 5D6DA 4GAYA 2AJSL 3SGDI 2B5IB 1OVZA 5FFLA 1CCZA 1K4CA 3P9MA 4JG0H 1A9BA 1U3ZA 4R4NC 3E1F1 5JUEL 3GSWA 2Q3ZA 4WO4A 1QRNB 3D2UA 2MQCA 4Q7DA 1A3RH 1Q9KB 4JQIH 3X13B 3DHMA 1CL7H 3Q6GL 2FO4B 4LKXB 5L6YH 1UB5B 5IBTH 3C5ZB 2A6IB 2BSRA 1YEJL 2UWEF 1JF1B 1PX4A 4P23B 2X5PA 1NCWH 4R90H 4GG6A 4XI5C 2L7JA 4YPJA 2NX5B 3LN5A 4NQVB 4G80A 3UBXB 5C0DB 2VXVL 3KPOA 4YHPB 4JKPH 1I1RA 4X4ME 4X6FB 3MODL 4Q0XH 2C3GA 4F80A 1FAIL 5EOTB 5HGHA 3UBXI 3KS0J 5I1DA 3D0LB 5EBWA 1Z0MA 1KPVB 3OB0H 1F2XK 3BP4A 4KAQL 3G5VB 2AK4B 1YNKH 1QBBA 3QUYD 5FYLL 3SKJL 2OK0L 2BVPB 3T65B 2H1PL 3RY5A 4Z95H 2R0LH 3N50A 3QR2A 4RQQB 3RWCA 1QO3A 4XWOD 4QRUA 4YHZL 4Z8FH 3Q6FA 4KQ4L 4Y16D 3NN8B 4ZG1A 1VPOL 3IDMA 2X4QB 4FG6C 3QIBD 3RI5K 3ARYA 4NRYA 4U33A 4ODSH 2NNAB 4G43B 4HBCL 2Z0BA 1VEOA 1R3JB 4RDQG 3EDEA 3CPLA 5EPMB 3TNM<