3OKLA

Crystal structure of s25-39 in complex with kdo(2.8)kdo
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
DIVMTQSPSSLAVSAGEKVTMNCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFALTISSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERANGVLNSWTDQDSKDSTYSMTSTLTLTKDEYERHNSYTCEASHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S25-39 Fab (IgG1k) light chain
total genus 52
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2010-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oklA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oklA01
1E4XI 4B7LA 1N6UA 4PJIE 4MJ5B 2AJYH 1YA5A 3IJSB 3S36H 2XT1B 1A3QA 3H0TB 4Q2ZA 4ZXBA 3JZ7A 3EOTH 4QHUB 5C0DA 3UBXA 4EKXA 5J3HC 4N90D 4XPFH 4YK4B 1JRHL 3SDYL 3BGMA 2M2DA 3F65A 3KJ6H 4UT6L 1JGUL 2NY0B 4X4YB 2E7CA 2J88H 3UTSA 3VI3F 3BZEB 5E94A 1A64A 1IAMA 1EJOH 3F6IA 5GRWA 1WIUA 1BD2A 5GGTA 4BFIB 4Y4HD 3ULSA 4K8RD 5D72L 4E5XA 5DLMH 4BSVB 3NCFB 4MD0A 3MLTA 1TETL 4MAUL 3NTCL 5DJAB 3IJYA 1U92A 1EX0A 1FZKB 3PP4H 1YEDA 3C09B 2P8LB 3MJ6A 2A6DB 2CLRB 1U8PA 5IMLB 4O2CB 3P30L 2HN7B 2FATH 1KIPA 3T09A 4FFVC 1MJUH 1INDL 2VR5A 4JM2B 1ZLUH 4LEOB 4ZDHB 1AO7E 4UTBL 4XXCA 4Y4KC 4X9FA 1ZVHA 5FYJD 1FZMA 5KANI 5EIIA 1UYWH 1R3KA 3ZHLA 1EO8L 1ZXQA 3G6AB 2P24A 3H42H 4Y4KB 2EDFA 3GIVB 1A3LH 2DQEH 3AS0A 5KSVB 4JANB 5T33H 2DJSA 3F6LA 3ZDZF 3TT1L 5I1EL 1H15A 1WZ1H 4IHOB 3BT2H 4EVNA 4ODXA 2DN7A 1CT8B 4NC1E 2GY5A 4D9LL 5I1KL 1VGEH 2VH5H 4KHTL 3SDAC 4Z7UB 1JZ7A 3KYMB 4XAKD 4TUOB 5FB8A 4A6YA 3T65B 1PYWA 1HILB 1VACB 1Y6MR 5D5MB 5D70H 1G9MH 2Q7YB 4ZAKB 5HYSB 3JV6B 4LRIC 1JGVL 1XF2A 4IOFC 4MHHG 2SEBB 4OSUL 3SO5A 3HKFA 3MYJA 5EUKB 3GRWH 3LKPB 1OTUC 2XYCA 1VFAB 3A0OA 4H8WH 5DJDA 3SQBA 1CD1B 4DAGH 3S7GA 3WSQH 5FV1L 2K3TA 3V6OA 5A3ID 1S7RB 2VLKB 4LCUA 3SE9H 4ZMAT 4UIMA 3MODH 2R1WA 5DJXB 3GJEA 1U3JA 3OPZH 5F7WC 4CVXA 2A6KB 4JPIA 5CZXC 3OXSB 1MWAA 1UB6A 2VR9A 3EGSB 4K7PX 5D1XC 3FQXB 4KJYA 4LVOB 4LIQL 4ODSH 5J0BA 4KJQC 5I73B 3UTTE 1Q9KB 2BNQE 3QPQC 2BC4A 4L8BB 4MLIA 4K71C 2AJUL 3BAEH 5B8CC 1L9NA 1YEHL 5BJTA 5ADOH 2L0DA 1NUDA 1AGCB 3WUWB 1E0OB 3LD8C 4WO4D 2EDJA 3K7UA 2BCKA 3DUSA 1NC2B 4NRZA 4RFNB 3WFDH 1EVUA 1JPGB 1MFCH 3T2PA 2DQFA 5D93C 1HI6A 4PB9H 4LNVA 1JTPA 1RIUH 1D5IL 1NCTA 1QPXA 4X6DA 4MJID 4AEEA 3QJHA 1HOCB 3QCUH 4JG1H 4HGWA 2DF3A 4AT6B 3ETBF 4O9HL 1T2JA 1E4JA 2AJSH 2YK1H 1TVDA 1PX4A 3QAZB 1NGQL 5D7IF 2MKLC 4FP8L 2I25N 2VSCA 3ZYJA 5EU7C 4PRAA 4QRRD 2C1PA 1UGNA 1DCLA 4DJMA 2Y06L 5CS7A 1LD9A 1HXMB 3MRMB 4HLJA 4X5XB 3FB7B 3TBSB 3C6LC 5DT1H 3Q3GB 1LDPL 2FO1A 2VXTL 4U1LA 1MCJA 1RK0A 1TVBA 4IIQA 4HG4K 2LTQB 5L7XL 1IM9B 1CGSH 3B9VA 1ZHLA 4L3EB 4LLUA 2J5LB 1G9ML 3DIFA 1PYWB 4QHMA 2OR9H 1AO7A 3AREC 5C7XH 1PG7W 3OKLA 3TZVA 5CEZD 1G7MB 3CPLA 4G5ZH 5L2KE 3CDYA 3X3GL 4L8SA 3ALXA 3QXUA 1ORQB 1Y0LA 3DHJA 3O81A 3I2CL 3TT1H 4U3XA 5DJ2A 4MD4A 3QIUD 1EPFA 1A3LL 3O8XD 4XBPB 3A6CH 1AH1A 5DI8B 3H42L 1BVLA 4XHQA 1MREL 2R1WB 2R0WH 1BX2B 3ULVH 3TPUB 4TULL 2A6KA 3RNKA 4E42B 5CCKL 2RCSL 2P43B 4TTDC 3L3HB 1NBVH 4N9GB 3G5YA 3T2NL 1F4WL 4PG2A 1T7VA 2XZCH 2JB6A 4YAQA 2WP3O 1OWRM 3TZVD 4OZFH 3TWCL 1UCBL 3B83A 3LS5L 1XR8B 2FNBA 4Q6IC 3PWPB 3PP4L 5DD0L 1DBKL 1KPVA 1ZTXL 1WWWX 2N4IA 1P53A 1BQHA 4K94L 4U1KB 5F9DC 5DVKA 3PQYD 3MRHA 2BJML 5I1GH 1YEIH 2XWTA 3FB6B 4JFYB 2P5EB 2JLLA 5I8EA 4AH2A 2Z8RA 5D1ZB 4ZUTB 4H1LG 1J11A 3VDAA 1A4KB 2EXWC 4BZ2H 1H3PL 4HXAL 3H6JA 3BZ4A 3CX5K 5TF1L 1B3JA 3X14B 1O0VA 3R0MA 1FV1B 5IESH 2ZJSH 4OFDA 4XVTL 1NBYA 2F5BH 4PGCB 1ZHKB 4XBGB 1J87A 3Q0HA 1DL7H 1GGCH 3QEQD 4H0IA 4HKBA 3M45A 3R0NA 4HIHA 3GSVB 4M5YH 5ACMA 2AJYL 3F7YB 4BKLA 3OSKA 4NGHL 2QKIA 1ADQA 1GPOH 4R8WH 5ESVB 4X5XA 4R8WL 1T0PB 3V6OC 2BHUA 1WWBX 3I50H 3VFRB 1JMXA 1CU4L 1IAOA 1UH2A 4GBXA 2H45A 5HPMA 3ZHDA 1PKQE 5EU6B 4OLWL 3CFEA 1JYWA 4XVTH 3RPIA 2HG5B 4LLYB 4XI5C 4M1GL 2BY3A 5B3JF 4Z7VA 4ZFFB 4B50A 4UQ3B 5FYLH 3DSFL 3FQUA 1CN4A 5D6DC 1R5WB 5I1IL 1P84K 4C83B 2GITA 1XGUB 3SDAB 4OD3L 4MAYB 5E6IC 1DBKH 3MRIB 4CMMA 3A67L 2XV6B 3DIFB 5FGCB 2MSPA 1OP9A 1JPSH 3RDTB 3WIIH 4OCMC 4KK5D 4WWKC 1QKZL 1T0MB 3FN9A 4AEHL 1KLUA 1HSBA 1WICA 3TV3H 1OQXA 2C3WA 4GXUM 5I16B 5F7HA 5BS0B 2IG2H 1F58H 1NGYA 4JHBA 1QFWL 1A6PA 2BVPA 5IF0A 3QFJA 4JAMA 3R8QA 2P1YA 4HUNB 4TTGA 1L6ZA 4W68A 2W9EH 2ZUVA 4LPWA 3EDDA 2X40A 3BKMH 4HEPG 3HNTH 5EOTA 1LE9B 4HIIB 4U6TA 4KI5E 4BSVA 1I1FA 3DWTA 5DXWA 4JFOB 4X98A 1DBBH 4Z78B 2P48B 3BISA 2HT4C 3QI9B 2H26B 4WU5B 4WHYG 1I9JL 3NPSC 3NH7L 1PFCA 4MYWB 1A9EB 3DX8B 4M93B 4MDJB 2WWKT 3GGWA 2PO6A 2ZUQC 2R4RH 1IGFH 5E00A 1MJ8H 2WAHA 1G7HA 2RGSA 1MLBB 3M1BB 3QUMB 5FEBA 5BOPA 4P9HL 3TCLA 4GUPA 5EFIA 1IM3B 4TVPH 3MRCB 3VXQB 2CK0L 1IT9L 2AQ1A 4KUCD 1NGQH 4R26H 5DGRA 5F3HB 1LO2L 2YD7A 2ICWJ 4Y5YC 3PIQB 4QRUA 1B0WA 5FO7B 3PDGA 4Y2OA 1YEEH 3QCUL 4GMSH 2Z92A 4L5FL 5DTFA 4OF0A 4JKKA 4X6DF 4JJ5A 4I3SL 3QUML 4NBXB 3W39B 1KNOB 1J7VR 1D9KB 4OGAC 1NSNL 5C08E 1RURH 4PB9L 3CVHL 4YHNA 5EC1A 1L9MA 4ZOEA 4MB4A 5E03A 2O93L 4X6BA 1XF2B 2WZPD 2CJUH 1YMHB 4NC0B 5ADOL 3O3UN 4NKQB 4JFDA 4MWFA 5AYUL 2H1PH 4Z18A 1KEML 3HPJA 2EE6A 5F7MC 1BLNA 2YPKA 1VGKA 3WS6C 5E1AA 1BQHB 4PJDE 4L4TD 5C0BB 3BGAA 4TSCH 5CIPA 3HZKA 3MREB 2HLAA 5CZKA 3U0TA 1T6VN 1HYRC 1MHPH 1AD0B 1EEUA 4OZGA 4X6BB 2LAAA 1BQLL 2BSRB 3DX9A 5IT2L 3NCCB 1AXTL 1A6AB 1SJVA 4QKXB 2P8PA 5CUSH 4Y5VC 3FFCB 5HVFB 4F57L 4RDQG 4HD9A 5D2NE 3N9GL 3L5XH 1V7MH 4GQPH 1EBPA 4LFHG 4YHYC 2G75A 3GMRA 1D6EA 3F7YA 1CFBA 4XH2A 4LMQI 1MCIA 1C16A 4YE4L 2ADFL 4WCYL 3LN4A 2XKNA 4OSUH 3IFOB 1FG9C 1T0NB 1KG0A 3CXDH 3MMEA 2MPAH 5GSRB 5LKNA 4EOWL 3VG0H 4N0RA 3ZL4H 2HJFB 1X4ZA 1IEBB 2I07B 1VGEL 2VH5L 5J1SC 2VO5A 2I9TA 4M7ZC 1U3ZA 5DR5H 3WFCL 1HWHB 3B43A 3I3DA 4Y4KD 5DEFA 1Q72H 1RZFH 5SWSE 1ZVSA 3MV8D 4N1EA 4ZSOB 4F7MA 2ITDA 1PZ5A 3RUGE 2DQEL 2H26A 2QEJA 4DZ8B 1K85A 4YGVA 1M7DB 1C5DA 3HCVB 4NQED 3DO7A 5DWUH 4M6NH 5DUPL 3QO0A 5HYFA 3L9RA 1FH5H 2APWA 3VGFA 1RU9H 3UZQA 3HFML 1INDH 4PBXA 2Q8AH 4I5BB 4F9PC 4OM1L 1S9XA 1SYSA 5C0CE 4Z0BL 4QXUH 2Z93A 5E2JA 5IVZB 4M6ML 1KSRA 3L1OL 3PJSA 1QFOA 1R0AH 3IB4A 1CD8A 2OBGA 5JIHA 1NGXB 4NKDB 2IPUG 5C09D 4MHHI 3TBYA 5IFAH 5FUCE 2FEEI 3S35X 2DWDA 2IPKA 4HKXA 1T89A 3OF6A 4K23L 3Q6FA 1UJ3A 5D1ZC 4FFZH 4XCCH 1YPZE 4V1DD 4HIJA 1Q8MA 1CF8H 5JW4M 5FKAB 1CVRA 5F1SA 2X7LA 3KJ6L 43C9A 4R2GB 3QBTB 1D7FA 1VPOH 2IFFH 5I76A 4PRHD 5HGDB 3AVEA 1MCKA 1I1AA 3GM8A 3HAEG 5ITFA 3HUJF 2FZ3B 4JPVH 1V5JA 4OI9A 4YDKH 2A77H 4U6HA 2EZ0C 1UWGL 1RK0B 1TVBB 4OFVA 3HZYA 4LSRH 4LSVH 1Q9OB 5J9PB 3ARDD 1NAKL 2GEEA 1MI5A 1CL7H 4XMPH 3WE6A 3MGTB 3HE7D 3HZMA 4FQCH 5I73C 1B88A 5B3JE 3K81A 3OKDB 4EXPX 4FQ2L 4Y4HB 3GMLB 4FMKA 4J3SA 2VWEC 1I7TB 4BZ1H 4EI5C 4FZEH 1QFUL 5I19H 1QSFB 1FYTB 1CZ8L 4ZYKA 4FTVE 1I9IL 5F9JB 3LD8B 2XZZA 2FSEA 4LRNH 3NZ8A 4BH7A 2FIKA 2Y1VA 3ZYOA 2EIEA 1T7WA 2ZPKH 1S7QA 4XVUC 2VXUL 5JIPA 1ZKAA 3BFOA 3O11A 3VW3L 1X5FA 5JR1L 2Z8WC 5KAQG 1FJ1B 1HZHL 1EGJH 2FJHA 3O2WL 4M7LT 3MXVH 5DEFB 1ONQB 1DSFL 4JO4H 1Q0XL 3O45B 2H9GB 5HGAA 1MVFA 2AK1L 1P6AB 3L3KA 3STZB 4HS8H 4QHMB 2EIZA 4OCLC 4G8EB 1QVOB 2AK4A 3AFLA 3TZVB 1T2QL 1MCNA 4JDTH 4X6CF 2FEDC 1WAAF 1QLRB 2WWMD 1LO0L 1JFQH 5E6YA 3RGVD 3VXNA 2BNUA 2X4SA 4WDIB 1A4JA 4PJBE 1WUNT 3PWPA 3QIWD 4XC3H 1Y6KR 5D2LB 1F11A 1SYSB 1G9NL 1OW0A 1IRAY 3F5WB 2ERJC 2VDOL 5I1JL 1N0LA 1WVZA 1GHFH 1U3HC 3EO9H 4X5LA 3WFEL 1QACA 3ARZA 5D2NA 1T03L 1R5IB 1X7QA 4OCYH 2A6IA 2DMBA 3CMOL 4P5TD 3VGAB 1OL0A 5KSBF 4N0UB 1P7QD 1I9EA 2WSKA 1A7NL 1ZANL 4YHIB 1U58A 1BOYA 4LHQB 4L9LC 3WLBA 4YX2H 5CKAA 5E8EB 3G9AB 4QRRE 3ARGC 1A6ZB 5HGDA 3MLPA 3I6GB 2XKSA 4PJXE 2R56H 2GT9A 1KGCD 1N8ZB 2VDML 4LIQE 4U49A 3O2VL 4KGJA 5E1HB 1FPTL 1LP9E 3KYNA 1N4XH 1FRGL 3O8XA 1L7IH 4X4ME 5HYJD 1IC1A 4UB0H 1AGEA 4OD1L 2ICCA 3D6GA 5HYEA 4NNYA 3D0LA 3BKJL 2NY4C 1NUFA 5D9SA 2HG5A 4LLYA 3GIVA 4HUVA 1HQ4A 2VISB 1HDMB 3QUZC 5L8JB 1ZV5A 2PYEB 4OCSL 1OAZL 1I7TA 2IH1B 3CDFA 5BW7C 4H1LH 1RJYA 1DVFA 1K4DA 4YK4C 1KJMA 2W1NA 4PLJC 2DLFL 3EFFB 5J12B 2VXQL 2DQHL 3H3PL 1JZ4A 2HA1A 3MRRA 1IKNC 4AEIL 1A6AA 1ORSB 1JPTL 2AP2A 2I24N 3HZMB 5LGHL 4TQEL 1S5HA 4HDIA 2DICA 3JV0A 4BELD 4OLEA 3TIDB 4OZGE 4N5UA 5DJAA 1YMMD 4CL7A 3G5ZB 3I9GL 2GHWB 1MAMH 4XXDB 5SWSA 3RAJH 3CSPA 3O4LA 4FXKB 4Z8FH 1QRNE 1IEBA 4PD4J 1R5WA 4O5LH 3IRPX 5KBNC 2GK2A 5B8CA 4KAQH 2L7UA 3LHPL 1G6RB 2DTMH 3CAFA 5HXMA 1CGYA 1YJDH 3A6OA 5EU4B 1MPAH 1J1OH 1RZJH 1X5LA 2CUMA 4NQSA 5GGVL 2R1YA 4M43H 4NN5C 4P57A 4QRPD 3CX5J 4IJ3C 2AKRA 3GSXB 4UBDD 5TE6H 3K2UL 5HJ3B 3Q3GA 4MA1C 5EIQA 3BOVA 3BIBX 4TQEH 4NKIL 2X41A 2C3GA 2NXZC 2DKMA 3QNZA 5IB1B 4XNUL 5I6XB 1KJ3L 2R69L 1CI5A 3CVHA 1XR9B 5CGMA 1H0DA 4MSWA 4R2GD 1RUAH 2XTLA 2GQHA 5IHZA 2WUBH 1WFNA 1K4CB 4G43A 3LQZB 4WFHE 5D7JC 4O58H 5F1OB 5I1DB 4J4PD 1OAZH 3QEQB 5A3IC 3GSOA 2M26A 1ZEAL 3QG7L 3BKJH 4DGIL 4PJAA 3WL9A 2G5BB 1FIGH 4I13B 2VLRB 1JGEB 1FYTE 4D3CH 5DMKA 1N4XL 4WU5A 1AO7B 5EZLA 4NO0B 5SWQB 4OCXL 3Q6FB 2R8SH 4ZUUA 5IMKB 1IZKA 4WI6A 5EO9A 3RUGB 1P1ZA 4XCFL 5TQ0L 4HS6B 1Y18B 3NCBB 5EU6E 1T0NA 4Y0GA 4WWKA 5CHNB 2BOCA 35C8L 2E6JA 2Y9RT 3IFOA 3HB3C 1FDLL 1I9RL 4YHMH 1HKLH 3WBDA 4CW1A 4GO6B 1OVZA 5HHQB 4IRJB 1P4IL 3OKDA 4OCYL 1T03H 4J3UA 2OL3H 3O9WB 1RMFL 1INQA 3MV7A 3P9LA 4QOKE 3LEVL 4RRPG 3AM8A 3EJJX 1DBMH 4OCNC 1HNGA 3QUZB 5I74B 1TTFA 5GS0D 4NT6B 4DKFL 5BV7H 4JQVA 3LEYH 3RVWD 3MV8B 2HT2D 5DFVC 1JRHI 1FV1A 3D0VA 2CKBL 3NCMA 3QIWB 1WV7T 2HVJB 4X6FA 4E5XB 2BXYA 4ZNEA 1MOEA 1CXEA 3WUWA 2AV7A 4GSDH 3RFZC 5INCB 3O6FD 4A6YB 3RWJB 3MLZH 2XWTB 5BO1H 1N3NB 3MV11 4PJEF 4QRQB 4Z77A 5E8NA 3TVMD 2FH6A 5IG7B 4NZUL 1TTGA 1YN6B 2BDNL 3GMPA 4G6KL 3L7FB 5CLWA 1HZHH 4PR5A 4U7MA 3TO2B 1J10A 4Y88A 1P2CA 3P73A 3BPLB 5MEND 3N1PC 3NFNA 2BVOA 4OZHE 4P3CH 1R3KB 2EYSA 2A9MH 4LRNL 3OKEA 5L2KA 4ODWB 4ZDHA 3RWFA 3P11L 3BJLA 4FZEL 4W4OA 1EIBA 1F11B 1MJ7H 3OGOE 3QQ4A 4GBXD 1G9NC 3R8BB 1FHGA 4G6KH 4F9LA 1W0WB 4XP5H 1CL7L 1SHMA 1ZHKA 2E9IA 4GW1B 1G6RA 3H7BA 1NAKH 1D5ZB 2FWOB 2P5EE 5K9QG 4HJ0D 3V7AG 2VN7A 3PWUB 1XIWD 2EO9A 4CRPA 3CSBA 4YDKL 5C0AE 1DUZA 1WEJH 2OI9C 2NY3C 4KQ4L 1HINH 5MEOB 1PD6A 1VPOL 2IFFL 3GSOB 5D6DA 4W81A 1CDIA 5CGYC 3STLB 4P23A 1KCLA 2DAVA 4HCRH 4PJ8D 4XCCL 3TBTB 1U8IA 3BP6B 4H1LA 5BV7L 5KZCD 4K7FB 5JOFA 1FNGB 1BZ9B 1EGJA 1XR8A 4R7DB 1UKQA 2AEPH 1MVUB 1PKQA 1AD9A 2AVGA 43CAB 3RTQB 3AREB 1BZQK 1OARL 3BIAX 3IDYC 1T20B 3W0WD 5CINH 5C8JB 3BQUB 2F58L 1HKLL 3W5MA 4PY7B 1T66D 5BCAA 4Z7QE 2IBGA 3OJ2C 2J4WH 5TDNB 1QD0A 1MH5A 2BXZA 1DQTA 3HFMH 1V3KA 4YNYB 1CGVA 1NEUA 4UAOC 4R97B 2GAZB 5EUOB 2R8SL 2V5SA 5IFHH 2DIJA 1YNLL 3SOBL 5IIEA 1T1XB 4JDZA 3DMMC 1GGTA 1XCTB 1CLYL 4S1DD 1E4WL 4PLOB 2ENYA 2Q20A 3WFCH 3CH8A 4DGIH 4LDEB 3GSQA 2E8YA 2GFBA 3MLVH 2G5BA 4XNZC 2DQTL 4H26A 5EORH 3EO1A 3UBXB 1AKJB 1YUHB 5IK3B 1JZ3A 3DRQB 2DYPD 1D9KA 1PBYA 5INDB 1VFUA 1A47A 2VIRB 4OV5B 4Z0XB 1IGIH 1F3DJ 4FHBD 1AJ7L 5FO9A 5AWNH 2BNRE 2X9WA 4FN0A 4N9GA 5D1QD 3HC4H 3QUKB 3ZKMD 2X4NA 1V7ML 3GSXA 1A6WH 1YUHA 4HPOH 1GAFL 1DEEB 2OQJA 1CQYA 1YEDB 5GQBA 3BRFA 4KK8D 1J1OL 1MPAL 2QSCH 4OZIA 1HQ4B 1XIWC 4I8DA 5E5RB 1T0MA 3VI4F 4XNMA 2DTML 2YEZB 5DC9B 1XH3A 4OF6A 5IVXB 4DKAA 2GCYB 1MHPL 5D5MF 2DQIL 4O5LL 4AQ1B 3GKWL 3U2SB 4F7PA 1E6JL 5IR1B 3G9VA 3HRZA 4Z8FL 3BZ4B 1JF5A 4IS6A 4DUWA 4WJ5B 4U3CA 1MAML 2K7PA 5C0CB 4XI5D 1MFNA 3MUHL 1LEIA 1MFAH 1J1PL 3MV8E 4YHZH 1MRCL 5CLTA 3TJEH 4OZFG 3QHZL 3HE7A 1X5JA 4HXBL 3RVUD 1TJGH 4N8CL 2EKJA 2OR8A 2LAGB 5GPRA 3MJGX 4B53A 3SJVD 3H3PH 2O5XL 1FYTA 1YPZB 1TFHA 5LBSL 1NCNA 3LV3B 5I1CH 4FQLL 4HFWA 3MXWH 1G0YR 3RPKA 4Z7VE 1IT9H 5GGTL 1OGAD 1HSBB 4E0RA 2VDRH 1N2RB 1P7KB 5GGUB 5C0RH 2X44D 5D9SB 4N8VB 3PNWB 1OPGL 2Z4QB 2A73B 2XFXA 2AJ3B 3UCRA 4D0BB 1HCVA 1XGTB 4NJAL 3VE0A 3LEXB 2BMKB 2DQJH 2B2XL 4PJGA 2BSTB 4Y2DB 4GW4B 1DN0A 4NUGL 3MJ9L 3WO4C 3NIFF 2VDMH 3T1WA 4G3YL 1OGAA 1S7XA 2VLRE 4ZPVB 1N0XL 4QXWA 2ENSA 5B4MD 3QEUB 2XPGB 1HHIA 4FZ8H 4OZ4B 2JJUA 4WHCA 4LEXH 2VL4A 1I9JH 4RBPK 3H3KA 3FB8A 4Y8AA 4XCNB 2XKNB 1QBLH 2R0ZL 3N1FC 1DBBL 1IARB 3E6HA 1AXSB 3BH8A 1I7UB 4ERSH 5I71B 2AJXH 2FBOJ 3EDJA 3MUJA 1RAMA 2ORBH 1WITA 3WKML 5B38B 2Q6WB 3WS6A 3IXTB 3CUPA 2W65A 2OSLB 3QUXB 4U0QB 1NAMH 3EO9L 1GHFL 2YMXL 3UZVB 3IF1A 3BD4A 1T22B 4PRHB 4WI5A 5KSUA 3G5VB 3T3PF 2FL5B 1ZS8A 1J8HE 5E08H 1F45A 4XGZB 5IQ9A 4JM4L 3NIDE 3LQAH 3FZUD 4XC3L 3OJVC 3BH8B 1OP5K 3T8XA 4O2EB 2JJVA 5E4EC 3TV3L 2A0LC 2GFBB 1M7DA 3HCVA 5ETUA 2YD8A 3DO7B 3HUJB 3ILQD 2VITB 4YGAB 2YA1A 1BD2B 3H8NA 3WIIL 1HHHB 5IQ7L 2VLJE 2XTJD 2OMNA 3MGAA 2AK1H 5E2TH 4TUKH 4Z5RB 4DCQA 1BZ7A 4JO4L 4RIRA 2DM7A 4HIJB 1CE6A 3JTSB 3MXVL 4G6FD 5DUBA 5D1QB 5JR1H 1M1SA 1K8DA 2QADB 3QUZA 5ICZA 5KS9F 4ZFOL 3JTTB 5EUOF 3NABH 4NQXB 2F53D 4M1GH 2OQJB 4ZUVA 1I9IH 4QEGA 5F44A 1BFSA 1CG9A 2WUCL 2FIKB 3EIFA 5F3HA 5DZLA 4NQDE 1FZMB 1MFEH 1LO5B 5BRZD 1DZBA 3I50L 4O2FB 2IGFL 1D6EB 3V79C 3KPQA 4FQCL 4XPAL 5E5MB 3CFIC 5FM5M 1A7BA 1W0YT 3ZKXC 1JNHA 4UI2A 3DX9B 4M9OA 3ULUC 1GPOL 1EZVX 4LSRL 1CFVL 4LSVL 3LRGA 3T3PE 2H3NA 3H9HA 1RK1A 5EA0L 3EYQC 3MNWA 3K8LA 4G9FA 4M5YL 3QEGH 3IS0X 4JPVL 1Q9OA 2XN9D 3JUZA 5B39A 2W9LA 1NFDF 3DX8A 4RNRA 3PG2A 3KPNB 4PJDA 1XZ0A 3SGJA 4S1SL 3S9DB 5FHBH 4FFWC 3LPWA 5HGAB 4XNQB 4Q97A 5H2BA 5IGXL 1P7QB 5E7BA 1NMCC 1YEIL 1N6QH 2NY2B 5K9OB 3H7LA 1IILE 4OGZA 3C9NB 3S4SA 4AZ8A 5DD0H 2GK0B 1T3FB 3QG6A 5J06A 4FXLA 2DDQH 4NQDD 3L1OH 5DTFB 5ITBH 2GJZA 1EZVY 2DQUH 4RMUA 3TWCH 4KKCD 1JN6A 1QSFE 4UV7L 4JM2C 4HUXB 1SJXA 2DI7A 2XZCL 3H9YA 1F4WH 5CEYB 3UTTD 2IAMA 4I3RH 1NBVL 4OLXH 1EERB 4XP4H 1OAUH 3KLHC 4M6NL 5DUPH 4P2OA 2D9QB 1KCVH 1BZ9A 3C6SA 1FORH 3ARGB 4X8JB 4CN1A 5DJZA 3MRFA 2F5AL 3VFPB 3BI9X 3I2CH 3U6RB 2O5YL 3QH3A 1YQVH 1X5AA 5C0BA 5IB3A 5MP6L 3B6SB 1HILA 1VACA 2VKXA 5GGQH 4OLUL 3HPJB 1GOGA 4K9EH 1NDMA 4G5ZL 1TCRB 4Z7VB 4OIBA 3NZHL 4KTEL 1KFAL 4HUUB 5C9KA 3HPLB 5C7XL 3SKNA 1H3WM 3RDTC 4NQCE 4NN5B 4TPRH 3MUZ1 1AQDA 3WN5B 5I1AB 1CGSL 2JE8A 3ZYIA 2ADFH 3EW3B 4S1DC 1IM9D 2FJGB 4U1GB 3FCTB 5BQ7A 4OLYH 3GJEB 5DMYA 1E4KA 2CK2A 1DE4B 5J7CC 1ZLUK 1S9XB 4C55A 3QQ9D 2I60H 5SWZD 2NXYD 3THMH 3MBED 1YY9D 1A7RL 2P7TB 3RKPA 2R2BA 5CUSL 3ZDZE 3STBA 4FP8H 3CFBA 2EYRB 3J7HA 1BQLH 4O9HH 2QQKH 4P4KA 3VXOA 1P5UA 1BFTA 1J1XH 2BNUB 2X4SB 4G9DB 1IAKB 2D3VA 4TSCL 1LNUA 2O5ZL 3G5XB 2PCPA 3U9UB 3WHXB 5DJ8A 1EA9C 1C5BH 3BPLC 4Y5YA 5AYUH 4PJGB 1IGML 4RAVB 5E2WH 4NZTL 4Z78A 5BXFA 3U1SH 2DMCA 3IU3B 5EBGA 4FQXA 4G7YL 1CT8A 4PJDB 1YEHH 1TNMA 2XWBA 4PJIF 5DQDH 3CVHH 4YQXH 2I27N 1ZLVK 5JXED 5KS9B 5HVGB 2PO6C 3QZWG 4HGKC 3ARDC 3VWJB 5ACLA 3ABZA 3FQWA 4OUUA 2PXYA 5F9WB 1LP9A 3CDCA 2X4OB 5CWSB 2AXFB 4F37F 3RVVD 2G5RA 4U7SA 2ZSVB 1BQHG 3E6HB 3RX5A 1KJVB 2YRZA 1UG9A 4K94C 1MEXL 4TNWK 3WSQL 3WD5H 3GSRA 5EN2A 4EDXB 1MQKH 4ZO7A 4X6DE 5JHDD 2Q3ZA 4CDGC 5A16A 4PRDA 2R4RL 3RI5F 1Q38A 3C08H 1X9QA 2ARWA 4ZUSA 4JVUA 1N8ZA 3EFDH 3STZA 5ANMB 5AAWA 4HK3J 4P46A 4PJXA 3UAJD 1D9KC 5ETUB 1R3JB 1ZGLM 1X6NA 4FG6D 4PGJA 3KPNA 4R4FH 3QH3B 4KHTH 2Y5TB 3KPSE 1F5WA 5I1KH 2W9DL 4K2UH 3UJJL 4JQVC 4HDIB 3H9SE 5KJRL 4JY5H 1F3DH 3QIBB 1NJ9B 5I1EH 1F8TH 2W9EL 1SMOA 1MCLA 2Z31B 4ZUWA 1RZ8B 2VLJA 3W81A 5IVXF 5JORB 1CIUA 4L8CB 1QP1A 4TSAH 4QRPE 4LSSL 4UTBH 1XMWA 4TVSa 4N9OB 4WTZG 3RY6C 5LQBH 4Z7WA 1FSKB 3MBXL 4LLDA 3BUTA 4XHJD 5JW5A 4XCNA 5EBMB 1XGRA 12E8H 2W60B 1UZ8B 3BN9D 5ISZA 1NC2A 4NRZB 1Q9WB 3QCVL 5IMOA 1VESA 4UNTA 2PYEE 3GSUA 3A67H 2AK4B 3V9FA 4MAUH 3AMLA 3KXFD 4PS4L 3EJYD 4P5KA 2HT3C 4PJFA 2CRZA 4Z7OE 2B0SL 2P5WB 3HTLX 1CWVA 3CFDA 5FYLL 3LZFH 3T1FA 4MNQD 3MRHB 3VD5A 3RY4A 4ZSOE 3G5ZA 3D2UD 5F3BA 4NM4L 4MA3B 5C07A 4UU9B 3SGDI 3SDYH 3G5VA 4L29B 4HLZG 3K2MC 3VXMB 3DNKA 5CEXA 3MOAL 1LD9B 1DUYB 1JK8B 1R5IA 1X7QB 2NY0D 2ZSVA 2Q8BH 3MRGB 2EE3A 1CDCA 3SKOA 4JPWL 1HHKB 3KLSA 4KQ3L 4LEOA 3B5HA 1IJ9A 5DK2B 1QBMH 2ZNWA 8FABB 3MRRB 1A1OA 3T0BA 4PIRF 5DURD 3T4YA 4NGHH 1YJDC 3L5HA 4K3GA 1Z2KA 1DFBH 4N68A 3KPLB 2PR4L 2QKIB 4UINL 3MV9B 1GGCL 3K8MA 5K33A 1GJIA 4HS6A 1B0RB 2VLLA 1OAYH 1R24A 4LPCA 3FRPG 3NCYP 2ZJSL 3MROB 1K8DB 2FH8A 4RRPA 2OTWB 4Y16C 3CCHB 3O8XB 4HKJA 4HXAH 4JG0H 4JFDB 4NOFA 1F97A 4ZFGL 1DN0B 2IPKB 4HKXB 4KTDH 5JO5A 4U1KA 1G7QB 3O11B 3U4AA 3GNMH 1TZHA 5JXEC 2YN3A 4Z76A 4ZOCA 4JGJA 1U95A 5J57B 1REIA 3SY0B 4P2RB 1RUKL 1NC2D 1ROWA 4WHDA 4MQXC 1NL0L 4IRSC 5CCKH 3ES6B 2ZKHL 4NFBA 4TULH 3AXLB 5I17A 4D94A 2AW2A 1DQDL 4XWGH 3ZE1E 5T1DH 1UEYA 1VB9A 2ESVD 2OXHA 1V8HA 2CRYA 3DUUB 4Z76B 5EZJA 2B4CL 1U95B 1Z5LB 2R4SH 2P44B 3JTTA 1KV3A 3S3JA 1GGIL 3FO2A 4LOUD 4NHUB 2BCKB 4Y8DC 3PDOB 3VXRA 5DMIH 3U0WL 4X5WA 5CJBA 1A9EA 3VD9A 3T1FB 4PLJD 3OXRA 4WUKL 3CFKA 5DHYB 1H3TA 2PCPB 5F88B 1YNTA 4PJHA 4RGNC 4YZFE 3EZJB 3QUZD 3VFWA 4DQOL 1FSKC 3F8UB 4P59H 3MQIA 15C8L 3JSSA 5DRZB 5IMMB 1I3RB 4L3ED 3EOYG 5ISZE 5CD3A 4KRPD 1KELL 2GY7B 1MH5B 2UWEE 4NQCB 1UACL 2YRPA 3T4AA 2E7HA 4J2XA 3KYKH 1S3KL 5JW3H 3T0XA 4NO0D 4ZOBA 3ZYZA 5SX4I 3DVNA 1KXQE 1Z9LA 5GJSL 3JWDH 5FXCH 2PXYB 3MV01 4LPXA 3U46B 5E9DD 5KVGH 3E6FB 1DBAL 1T6WA 1KIPB 1CLOL 1JHLL 3BIKB 3KPSB 4R96A 1FE8L 1R3IH 4M6OL 5J11B 4JG1L 4GT7A 3SKOB 3SKNB 3HR5A 1D5IH 2VISA 2CLVA 2NY6C 1U8IB 1D5BA 5IW3A 1K2DA 1QEWA 3EO1B 3PGDA 1FNGA 3GMOA 3FL7A 4CVWA 3LPFA 1IEHA 3OKMB 3Q1SH 4ZUSB 4R3SB 4IDLA 2QSTA 3C60B 3C8KA 5FKAA 4FRWA 1MNUH 4GRLC 4HC1A 3RWGB 1J86A 4B7IA 2A74B 1MF2L 2OTWA 2EIBA 5GSRA 3NIDF 4MQ7A 2JCCE 2R9HD 3KPLA 1JPFB 2KPNA 3TH4T 3WIHH 3MCLH 1E4XL 1H3VA 2PETA 5HDBE 4WEBH 1EHAA 4GKSA 4ZUWB 1N7MH 1YMME 1YYML 4OBSA 3TBVA 1FNEB 1CGWA 3QO1A 4H8WL 1TNNA 4JN2B 5EUKA 1QA9A 3IAQA 3PQYA 1X5IA 1C5DB 2OJEA 1U8MA 3DROA 2VDQH 4FQJL 4HWBA 5C0BD 3HAEA 3QQ3B 1A7QL 2CD0A 5C08A 2NCMA 4EUPH 1FNSL 2DLHA 5BV7B 5D70L 4A6YL 3QEQE 5FIEA 1N3NA 1YEJL 4XPGL 1ZT1A 5IOPB 3J8F7 1XZ0B 4OJFL 1I1RA 4KDWA 1U8QB 5JXAL 3X13A 1QQDB 2E6PA 3L3KB 4P9MH 5E2UL 3NBNA 4DOHE 4MCYA 4LKCB 3O3AB 1YEJH 1G1YA 4A6YH 1FNSH 2EH8H 2QADC 3BT2L 3LQZA 1A7QH 4GRLB 5DVNA 3LAFA 3HR6A 2YWYA 4FQJH 1EHLH 2XN9E 3NACL 3VGDA 4AY0A 3VMNA 1SJHB 1XCQB 2HKHL 4EI5D 1EO8H 4KROD 3U82B 4KPHH 1EAPA 1FNFA 1KCUH 3DXAD 3E6FA 4YAQB 4EDXA 1CDYA 1VKXA 5ICYB 4HMCA 3TA3B 2Z31C 5D1ZD 4F15C 3EDEA 2H2SC 1J05B 3RWEA 2X1PA 3F12B 5F1KC 3VG9B 3MRCA 2FX8H 2ATPB 3D48R 2F19L 2P42B 3HNVH 2DI8A 5FCSH 4U31A 3P30H 2Y07L 3SEPA 1M71A 5EU4A 5L8KB 2ICWA 2IAMD 4YPJA 3DRQA 4L1HA 5C07E 3IKCB 4JFFD 2YA0A 3DV4A 3TO4D 3ZT7A 3VXSE 3C8KB 4CMMB 3RWGA 1IC7H 2E5EA 4WNQB 2ED9A 3CH1A 4EUPA 4UDTB 4X0KB 2YS4A 1NDMB 1EJOL 3U79A 2NY5L 1EFXD 5C1MB 4GMTH 3D69B 4I0CC 4W70A 4OCRH 3OKKB 1JGUH 3RHWF 4UT6H 1QSFD 1X5ZA 4Z7NE 2EIDA 5E94B 5JXEA 3WL9B 2RR3A 1JP5A 4ODTL 3VWKD 1QO3B 5EULV 1A7OL 4WY7H 5FYKE 4MXVE 4ONOA 4M6OH 1G7PA 4ZXBB 5IVXE 1JHLH 2BNRD 2CSPA 1KYOJ 2CRMA 4YFEA 4HX1A 2PTTA 1T5XA 5IBTL 4PY7A 3E3QC 1CG9B 4G8FA 4M7LH 2X4OA 5CWSA 3BXNA 4LLMB 4LBEB 4MD4B 1S3KH 4LCYA 5HHMD 3BEVA 2VABB 3ECBB 1A4JB 3VGGA 1ES0B 3QJFA 4YHLL 5C3LD 5CHNA 5J56B 4NC2B 2LABA 4S1RL 3TIEB 5J6HA 3T04D 1CLZH 1T7YA 3VCLB 2FR4A 4YFDB 3IJYB 4LCIH 3MRIA 3QXVA 4EI5A 3EOBA 2YUZA 2XY2A 2ZUWA 4JREC 4OQTH 1KB5H 3CFKB 4RNRB 1KJ2L 5DEGA 4TOYL 3T0EC 4KVCL 1RIVL 5DMIL 3U0WH 3SQOH 2BY0A 1ZT1B 1J88A 1T21A 4KMQA 3OKNB 25C8H 5IROA 5KG9A 1YY8A 3MOQA 2GKIA 3ZE2E 1IFHH 4YDJB 3QDMD 4IM8A 4PV9B 3ZTNL 3TEUA 4F7CB 1MELA 5CBEA 5HHXH 2C1PB 2BFVL 2B1HL 1MFDH 3D3VB 1ETZB 2IMMA 4P2RE 3S34L 2ZKHH 3MRPA 4M00A 1KBGL 3MCKA 3DBXA 4G80A 4UNVA 4YH6A 4V1DB 3V4VH 1T89C 3UTOA 2BZDA 1JN6B 2FEEL 4V2BA 2CGRL 5C0NC 1TZGL 2DI9A 3P73B 3PL6D 4HKBB 4HBQA 4JFXA 3ULUE 1UADC 2PF6A 4EN3D 2CO7B 2CDFB 1M7IB 3QPXH 1XF3A 3BDBA 5TJWK 4IS6B 3MACH 4KTDL 5L2JB 4OF8A 2A6JA 3RNQA 2EH7L 1IGJA 4XCYA 4OLVL 2J8UB 5GZOC 3FQNA 3REVA 4ZO6A 4Z5RA 1CLZL 3OKMA 1KYOK 1JGLH 3ARVA 1HHJB 3QRFM 3D25A 1AQKH 1J8HB 3QDJA 1M7IA 1A14H 4YHKH 3KYAA 2WLZA 1B0GB 4M7LL 1MY5A 3UJTL 3BJ91 1RK1B 1UWXK 4ETQA 1CK0L 4S1QL 3X3FH 2YXMA 4JJ5B 3KHOA 3RI5K 1NGZB 3SGJC 5E8PB 3Q5TA 3TH3T 4DOHB 2X70A 1F00I 4Y1AA 4ELMF 5F9OH 3U30B 3HC0A 3KGRA 2VL5A 2Q7NA 4J4PA 1V3MA 3SCMC 3MOAH 2YPVL 4LLQB 5T3XH 5C0GB 1J8KA 3QYCA 1A9BB 4XWOD 2ZOLA 1JPGA 4KKAD 3RL1A 1BIHA 5F1IB 1QR4A 4OCRL 4P57B 1I3GL 4WEMB 4O51A 4PJ9D 1NCWH 4JY6A 3JV4B 3LZFL 4JO2H 5JUEL 4QT5B 1QLRA 2B0SH 3SDXA 2ZCKL 1FL3A 3HMWL 3SHSA 4F3FA 4Y2DA 2V5TA 1Q1JL 5CGYD 2NY7L 5L2KD 4ZPVA 4A2MA 5F7LB 3WDIA 2UVEA 4L3EA 1JJUA 1K9TA 4Q9RL 3QWRD 3QI9A 1ACYL 5EU5A 3BGMB 3SGKC 3D2UA 2YD2A 5F1IA 2VDLH 4NHCH 2EDNA 3DUUA 4OZIB 4JFOA 4AQOA 12E8L 3PQYE 1CXHA 4BFGA 3UTQA 4QRSA 2FX8L 4NIKB 4W4OC 4FS0A 4RMSA 3OJDA 2CR3A 2XQBH 3UTZB 1BJMA 4WO4A 1KTRL 1XR9A 3LKSB 5FF6A 4HUXA 4KPHL 2M8XA 4O2FA 2H32H 5IWLA 3PGCA 2HKHH 4I0KA 5E6IB 1G7PB 4WFEE 4O2CA 4LLAA 2X4UA 3LN5B 1OF2A 2AKRB 4AMKL 4KK9C 1WQVT 1RJYB 1NEZG 2H8PA 3MRDA 3CGTA 3BSZH 5KJRH 3HE7B 1QUNA 3TVMB 3IETA 2W9DH 4K2UL 5TFSL 5TQ2H 3IVKA 3AB0C 5DJCA 1RZGB 2BY2A 4PBWD 5BZWA 5JXAH 4I0PC 3RWJA 4OJFH 2QHRL 4JN1L 1BFVL 4P5TB 4JR9H 3BO8A 4UZGA 3CH1B 4EUPB 3UYRL 5I18L 3VCLA 2FR4B 1IMHC 4HH9B 1F13A 3C08L 1DVFC 1C1EL 1FL5B 2P5EA 3GI9H 5EC1B 5JW4R 1F6LL 1MCRA 4XAWL 1DN2A 2YD5A 5AZEL 3MPCA 1D5BB 5DO2D 2MNUA 2UVFA 5SV4A 1SJEB 2EEBA 5C07D 3S96A 5IVZA 2EKSA 3IDJA 2WMPA 5J13C 4XVSL 3ARFC 3NCYS 5FV2A 1A02N 4WW1A 2CKNA 3C2AH 5CJQH 1WTLA 4PY8I 1OT1A 5HYJB 2YUVA 5DGQA 5EOCJ 5J4MA 4QHNA 5AZ2L 3ROLA 1QR1B 5KW9H 1KCKA 5CJOH 4X7TA 5GRJH 5EBWB 2Y36L 3TBWB 4FABL 4FQXB 4GAJL 5FM8A 4LKXB 4AK1A 5H8DA 1MNUL 2UV3A 5DFVD 3D3VE 4RZCB 3OKOB 4WUUE 4G7YH 3UTTB 3CSGA 2HLFC 3CDGB 5INCA 1JWSA 3B4NA 1IKNA 4CADA 1HCFX 4EI5B 1MCWW 2ESVE 3QDME 4OF5A 5IB2B 1XCTA 3RNQB 2AGJH 3LIZH 1KGCE 4OF3A 3T77B 5ILTL 4LLDB 4IIQC 3RZCB 4Q2ZB 2FHCA 5EBMA 1A7PH 4ZPTA 4RX4D 5ERWB 2KKQA 2OR7A 3MR9A 1RZIB 3L5WA 2IAMB 1KTLB 3OAYH 5GJSH 3RWFB 3QNYB 2FSEB 1FZJA 2DM3A 4LSUL 3SDXF 3GSWB 1QNZL 3MLUH 3TO4B 4P5MA 4HAGA 1OLLA 1BAFH 3MRPB 4Q58C 5CBEB 3C60C 5GISL 1SY6A 1YNKL 5DJ0B 5I15H 3O6MH 3IGAB 4JKWA 2PW1B 1B6UA 4KI1A 3LB6D 1MHHB 4NZRL 4K8RH 3BMVA 4NP4L 5E9DE 3VRIB 5C2BH 2UWEB 5KS9E 3BGFC 1U3YA 1VGKB 4KTEH 4OCWH 3LRSB 4PRPB 4KJPC 5J13B 3ARED 3EKCA 5JLZA 1KPUA 1BD2E 3MZGB 3K0WA 1MAKA 2V9TA 4Z95H 2NQCA 4HFUH 4PBVC 2DLIA 3ARBD 2F8VA 1RZGA 2F5AH 5L2JA 2B4CH 3V5HB 5I75C 1GC1C 5FHAL 2WIIB 1DQDH 4XWGL 3MV9A 5KSAB 2ITCB 4MZ3A 2DBJA 1KC5H 4YHNB 1J0JA 5IEKA 3VFNA 4QHNB 1FO0B 4JZJB 4HF5L 4F58L 5E70A 1FFOB 3UYPA 5I2IA 1HSAA 1PLGL 2VUYA 2AEQH 3UDWC 4NYLB 1WJ3A 4RWYH 5E8PA 2ZCHH 5CAYB 5DD6A 1IM3A 1I7ZB 4NSKB 1C08A 1V7NH 5C08D 1PKQB 4HUMB 1P2CB 3VFOB 1QSED 3ZKSD 1TPXB 1NCCL 2NX5A 5JDSB 4PP2B 4LCWA 1KT2B 5CIPB 1N6QL 1I1CA 4ZFGH 4NWTL 5IGXH 1LK3H 2Y6SC 3BPOC 2DQFB 5FYKU 3I75A 5FHBL 5KZCB 5BOZG 3WHXA 3MLSL 4GLRH 2AXGB 3UDWA 4PJCA 4MXWL 2J6EH 4X5WB 2NW2B 3PWNB 1QRND 4NCC1 5C0AA 5CMAB 3AUVA 1D5MA 3JV4A 2G9HB 5D1XD 1AC6A 1A6UL 4TSBH 4LCWB 2C7UA 2BRRH 4BYHA 4EQ2A 3BW9A 1MCFA 4YHPB 3PE9A 4TRPL 3V52H 5EU3B 4M8QB 1QSVA 2YUWA 1OTSD 5DD1H 3IDIA 4WFHD 4XP6H 5E56A 4RAHA 3BQUC 5C0AD 5I8CB 5M95B 4KQ3H 3HNSH 1FYHB 3RWDA 4P0DA 1CIDA 4X99A 1RFDL 1FLTX 2IJ0C 5HGGS 1KXVC 4JZJC 3G04B 3IXTA 1MLCB 3WO3B 1K3IA 3MLXL 1ZK9A 1T3FA 2HWZL 3VXRE 2NY6D 5ESAB 3P4NA 4NM4H 4Y4FD 2KBGA 3NVQA 4I1NB 1S9KC 3DVGB 1HK6A 1ULVA 2OS7A 2ZUXA 3DX7B 4HK0A 3QUYD 1S7TA 5B8CB 3SE3C 1PG7L 4KI5D 4IDJH 4WFFD 1S7XB 1R3JA 4D8PA 3LKQA 1ZLSL 4HMEA 1G6RH 4TUKL 1HHHA 5FB8B 4LCCB 1GRWA 3MA9L 3OB0K 1YPZF 4HJJH 3OKOA 1RUQH 3FKUS 4S0SD 3LY6A 3IVKB 4ZFFA 5HGBA 3PWJB 3DARA 1ZSDA 3WNMA 3VFPA 1G9MC 4DVRL 3LOWA 5K93A 1OQOA 3MBXH 4OZIE 1URLA 4MDIB 1JWUB 1NCBL 5DJ0A 4QYOA 2VSDA 4K8RC 4RGND 3B3IA 2K1MA 3CVHB 5E08L 4UMGA 2ZSWB 3LMJH 3E8UL 1F02I 5DC0A 2IPTH 1CTNA 4PRHA 3KLAB 2NR6C 4QNPE 4HC1L 4MD5B 3WFBL 4G8FB 2EDLA 4LQFL 1N5YL 1F4XH 2IQ9L 4M03A 5D7KD 1KLUB 3WKMH 5E99L 3S96B 3TJHD 2AJXL 2HFTA 3N85H 2VTFA 4LVNB 1BF8A 2JKXA 4B5EA 3VXUA 1T66C 5FYLD 3FB5B 3BZDA 3ZKND 2FZ3A 2MFNA 3D3VD 1D6VL 5HHOB 1NKRA 1BWWA 4GRWB 2P46B 3IXAB 2UZYB 3EFDL 1QHOA 1I85A 1D5MB 4YJZL 3U30C 4NRYB 1DQJA 4G3YH 4XC1H 4WU7B 3SBWC 3ULUL 3U36A 4XCYB 3CZFB 5GJTH 5ANME 4NJAH 2XFXB 5I30H 1JWSB 1SVCP 4YPGA 1IGYB 2R39A 5JQHC 3QEHA 1A9BA 1GIGH 5DQ9A 4G9DA 3PDOA 2PTUA 2VDRL 3K4DA 4O02H 1D6VH 4JFDD 2OJEB 2C3VA 2ZUTA 4FTVA 2MJWA 1RSFA 1FNAA 2H6PB 1HHKA 3KPQB 4N1HB 4ODWA 2IALA 1F4XL 4HIEA 4J3VA 5D7LD 4M1DL 1KTLA 4TYUA 4YUEL 4HXBH 1P4LA 2IPTL 3BKYH 1QHPA 5CEZH 3TJEL 1WGOA 1EEYB 3RTQD 4ONGH 1H8OA 1NGWB 1YEKL 5DSCA 4YHZL 1DTUA 3BUYA 3QZWB 5CP3H 4POUB 4U1IA 3P2TA 2I26N 1IE5A 5BZDB 3ARQA 1IAII 3L5IA 3REVB 1X5KA 1OP3K 4MNGE 3UMTA 3GKWH 3TGXA 3FHQA 3QR2A 3WV0A 3QWOB 3VGEA 2VLKD 2DBLH 4X7SH 3OKLB 3QUXD 2X4RA 2QQKL 3TVMC 3GHBH 1ZLSH 1XGRB 3QDGE 1TMCB 2RIKA 3MJ8B 1QEWB 2E6QA 2WWKO 1A7RH 3ROLB 1AE6H 3A6BL 1I4FA 4KHXL 3THML 4QTHB 1MRFH 3NZ8B 3RU8L 4YLQT 4HPOL 4X7TB 3AXLA 5I17B 4WW2F 3FO1B 5DRWB 2CMRL 3PWVB 4OLYL 3D9AH 2R2EA 3OJDB 3V0WL 4GKSB 5C0CD 2E9BA 1T80A 4P4RB 1N6VA 1UWXH 2VZSA 1QSEA 4BA8A 2BSSB 4P2CG 3L6FA 4PJAE 2B5IC 5D2LA 5EOQL 3VRLE 2XA3A 3QXDB 1CFQA 5CKGA 2D7TH 5H35A 2CH8A 5JDJA 3DURA 5CEZE 3FN0L 3Q48A 1DLFL 5IB4A 1RVFH 5AD0A 4PJBA 5DFTA 1ZT4A 4K9EL 1MCDA 5E9DB 4HUKB 3SDDC 2KQMA 3V52L 4JFED 4DGYH 3P9MB 4FFYL 5LGJB 5MP6H 3VFWB 5T3ZL 4BH8B 1YQVL 5F6IB 3BP5A 3WNNA 3TP4A 1E4WH 1RUMH 1CLYH 2Y4SA 5F88A 1XGTA 3O4LE 5C0ND 1WT5A 1YMMB 4ELKA 1A4KA 5FDWB 1BP3B 2HJLB 3NN8A 5AD0B 3VFSB 2HFGH 2PKDA 4KVNL 4EUPG 1R24B 2BC4B 2DLEA 2NX5E 4H0HB 4OLXL 3KPRB 4IMLA 4V1DA 4YDVB 3MLRL 2FX7H 1U58B 2J4WL 3LKSA 1OAKL 4WFFE 4KK9D 3TN0D 5ITBL 4U0RC 4OUUB 2F58H 5CINL 3FOLA 1ETZA 4XRCA 4ZNEE 2C3VB 3IDIB 2MCG1 1SQ2N 2LV4A 4M8VA 3P9WB 3Q6GL 4ZUVB 4IMLB 4U6HB 1T21B 1AHWB 5F1NA 5DA4A 3G6JA 1L0QA 4OD2A 4PV8A 5FHAH 1WBZB 5IW6B 4GXVL 3LRHA 4NBYB 4PYHA 2Q7YA 4X0KA 3L3IB 5JOPE 1HINL 4R3SA 3EJZD 1LQSR 4U1IB 1L7TH 2IFGA 4HK0B 4JJHA 1UJ3C 2DWDB 3SO3C 2J8UA 3ZE0E 3MROA 3ARGA 4X8JA 4Q9QL 2Q76A 3CCHA 4YWGL 3PHOA 4NNPL 4LBEA 1FBIH 3O6LH 4NHUA 4LLUB 1I75A 5T1KA 1BEYL 4XP5L 5MI0B 1LMKA 1C08B 3BHBB 2IGFH 1KN2H 1T1ZB 4ODVL 4P2QA 3QHFL 3KNBB 5EOCL 1WLHA 2AXFA 4MVBC 4CVXB 1BOGB 3O6ML 1YY9C 2BX5A 3V0WH 4JKMA 5ACZB 3KLDA 1L4IA 3IDUA 5I16A 2VLJB 1AD9B 3NABL 4R4ND 2DJ4A 3D18B 2MHAA 4FTVB 1T20A 3OBAA 3SY0A 3MSPA 1B2WL 3BW9B 3RWHA 4NQCA 3CXHK 4JZNB 5GS2H 3V5KA 2GSGA 3RDTD 4YO0B 1KIRB 5IBLC 2UZIL 4QRRB 5E2TL 2DKSA 4NZJA 5F96L 3WLWD 5ILTH 2DBLL 5ANMA 4PRIB 4RAVA 3LIZL 1ZLWH 4KJPD 1MIML 3UROR 1U8QA 3WJLC 5BXFB 2J1KA 1QG3A 3P4MB 1JHKL 3H2WA 4UQ2B 5E6ID 2OCFD 2GTZA 1U8HB 5BZDA 4KZEL 5LGJA 3T0DA 5T3XD 1ONQA 3X11A 4MXVF 3MA7A 3GSRB 4JM4H 5EN2B 5T3ZD 1YEFH 4ONGL 3K46A 4L9LA 4DKFH 5CEZL 3MV7B 2X42A 1KCRL 4M02A 4HV8B 4PJFF 1EFXB 1F2QA 3DURB 4M1DH 4LVHB 4K3EH 4N0YL 4KDTC 3TO4A 4YHYB 3AAZA 1M05B 4X8XA 1FO0A 2J8UF 4JZJA 5DMGD 4ZAKD 4YHML 3LSOA 5HTSA 5DC4B 4FNLL 4LCWD 5CJQL 5I1AA 5A40E 4KKNA 1JZ8A 3LKOB 4R0LA 4Z7WF 1CICD 1WCQA 3L7EB 4XTRC 5HHPA 1KXTB 4XCFH 5TQ0H 1QLEH 1CE6B 4PJ7E 1GGBH 4LSTH 3O2DH 4U2ZA 1G9EA 2E7MA 3DTXA 3WCYA 4XZUA 4NUGH 2W91A 3NFPB 3L3OB 4PJXB 3ULUH 4UDTA 4XNXL 4PJAB 4XC1L 4D3CL 4PLKC 1BLNB 2YPKB 1RZJC 3U6RA 4JVPA 4C54A 3CU1A 1U8JB 3D0VB 4I0PA 3GMOB 5T5NG 4MWFB 5IW6A 3QG7H 2JJTA 3PQYB 3N50A 4NO3B 3DROB 5DK0B 2Y7QA 3MXWL 4IHOA 5TQ2L 5I1CL 3P9LB 4L4VB 2R0LL 5FYJU 3FO0L 3QIBC 4JQXA 3PWLB 2OI9B 1BD2D 3GI8H 5KSUB 5I0ZA 2QSVA 4P46C 3PDDA 1A1OB 4LQFH 4IOIB 3Q5YA 3WFBH 4N5EC 4X9BA 4UT7H 4HC1H 1EH9A 3IDJB 4ODUA 3O3BA 3QHZH 3FRPA 5C0EA 3LMJL 4ZAKC 1U9KA 2IBZY 2PYEA 5TE6L 2X4TB 2HAZA 1MFAL 2EDQA 5MI0C 1RZJL 1WFTA 2CXGA 4HWUA 5K9JH 3LN9A 5BS0D 3QUMA 5CJ8A 4X7EC 3TPKA 3LHPH 1EEQA 2NY1D 4M4RA 2F54E 5H94A 4OAWB 2MWCA 1ED3A 4JRYD 3EDKA 3QCTL 1G6RL 5EG6C 1Z9OA 4BSWA 4MNGB 2JTDA 3U9UA 4PV8B 1PG7H 2EZ0D 3GFUA 3ARDA 1OW0C 4X83A 4MMXC 4ETYA 2L7JA 1BF2A 5JQ6L 3IFPB 1A6WL 4JO2L 4WUUD 5JUEH 3LQMA 4Q6IA 5ABDE 1H15B 2B7DT 4WW2B 2R0KH 1J0HA 2ARJQ 3D18A 3HAEB 4JRYA 3HC4L 5SV3A 2XN9B 2D4FA 2V2TA 1PKOA 3DVFA 5DMGC 5T3XL 3BD5A 2YPVH 5BS0A 5I66A 4LLVB 1MLCA 3CVIL 3UTSD 5T1LD 1RIHH 2FGWL 5CEYA 3MCKB 2A1WL 2BVPB 2DQHH 2BVQB 4KKBD 5ESQA 1F2XK 1I7UA 1AGFA 4U2YA 3VXUD 1H5BC 1J5OH 3H9ZA 4FQPA 3RTQA 3TNMA 3TFKD 4X80H 1LK2A 3VXMA 5EO9B 5EFIB 2NY2D 3QULB 4WWKB 1WAAE 1CBVH 1Z6JT 4XNYL 2CIIA 2X4RB 4Z7WE 5E2VL 4DWHA 4MNQB 3BYTA 4UB0L 5HI3D 2UYLA 1L7IL 4L8SC 5GGRB 4L3EE 1VEOA 1U8KB 4Q0XH 1FPTH 5IBUB 3FQTB 4DVBB 1JGLL 3PF2A 5DQJB 1AP2A 5AAMA 2R56L 5JLZB 1R3LB 4OKVB 1WBZA 4J6RL 4XZUB 1Q9WA 2NY6B 2XG5A 2K9UA 2EH7H 3FN3A 3OB0H 3FQXA 4KJYB 3V8OA 3IGAA 3R4DA 3ORJA 5DURB 1K8IB 3SDCD 3MV8A 4XB7A 4NQEA 2QLVB 3KPRE 2EECA 2PYFA 1I8LC 4U1JB 4AL8L 4NSKA 3IJSA 1JNNL 4AIOA 1I1AC 1G6VK 3C5ZC 3ZLQC 5HHME 3HLAB 5GHWH 2HTKD 3R1GL 3WFEH 3V6OE 1PJ9A 2EC8A 4APQB 2H6PA 2Y25A 2B39A 3EJZC 4OFPA 3GB7A 1HSAB 3MC0A 4L29A 4IMKA 4F8TA 4M62L 3QIBD 3RBSA 2B1HH 2LU4A 3L7FA 3P0YL 4F7TA 4ELKB 3T4AB 3RZCA 5HI5C 4LRIA 5DK0A 4JDTL 2WBKA 3EO0B 2X9YA 25C8L 3ARDB 2HP4A 2PO6B 4LVEA 1TVHA 4PTUA 1Z9SA 2EIZB 3O41B 4Z95L 4AH2B 3MOBL 1RIVH 1T1XA 3MZTA 1M6OB 1UXSB 1UVQA 1KJ2H 2YEZA 3WXVH 1DSFH 2G2RA 4N0CC 4N0CD 4DN4L 4ONFH 1YQ2A 4F7TB 1DVFD 4FA8A 1LILA 5D7JA 2Y23A 1CFSA 4F2MA 1YEGL 2V7NB 3FAXA 5JW4N 3GHEL 1U2CA 2MQ0A 2P7TA 5E24E 2A9ML 2IALB 1EJ6A 4P3CL 5FKPB 1QNZH 3MLUL 4LAQH 2P5WD 2VIRA 3FO1A 4M7ZB 4FQ2H 4XPHL 4G8GE 1JK8A 5DD5L 4P5MB 3PGCB 2XXMB 4U1HB 5F72S 3W5NA 3D39A 5JHDA 1EO5A 4XMPL 2MKWA 2HT3D 2DL9A 2FDBP 3S88H 4X7CC 3EYVA 4Z6AT 5T3XE 4OZHF 2R1YB 3W0WA 4WRLA 4FQHA 4E41D 1X5XA 1G7QA 2WQ8A 3VG9C 3OG4B 4OB5L 4Z7UE 1FL5A 5GGVY 4I4WB 4RQQA 2E9WA 5DS8B 3KYNB 1A6ZA 2FHBA 4D9QE 3SKJH 2NY5H 1KTDA 4MNQA 2JB5H 4AM0A 4K23H 4PFEA 3DTXB 2ZOLB 3RL1B 3I6KB 1EHNA 3IDGB 5K9KB 4EEEA 5JZ7D 3GBML 4GAJH 1U8MB 5F1NB 2Y36H 1LK2B 4YXHL 5B21A 2NZ9C 4OLZH 4MS8C 1R0AL 1A1MA 4LSPL 4PJ9C 5BMFL 3HN3A 2UY6A 1G0XA 2ZSWA 2QBWA 4XMKL 5MHSD 5BS0E 3BH9B 2EDOA 4GRMA 4NQEB 1JGDB 1F4YL 2FJGA 2B4CC 4U1MB 3ZE2F 3O3DB 3UEZA 4S0TD 4K7PH 2HJKB 4H26B 5LCVH 4FQIL 5GS3A 3CZFA 2AV1A 4ELMB 2BK8A 3QFJD 1BVKB 4GKZB 1BIIB 1H3GA 3V0VB 4LHUB 4PJ7B 1OSPH 5DRZA 1E28B 1HQRA 2Z31D 1CD0A 2EH8L 2FYYB 5H94B 3U0PA 1ZEAH 5I76B 5DUMH 1IEAA 3ZL4L 1TIUA 3FT2A 4QT5A 3HMXH 4L4TE 3BSZL 3RIAF 3UPRA 5FO8B 4H25B 2PN5A 4BFBD 4HIEB 4OFKA 3IRZA 4YE4H 2H2SD 2Z93B 5D2NC 1Q94A 2DMKA 3E0GA 5HI4D 5EPMB 1AO7D 3BESR 3DBXB 2DQGH 2PYFB 3U7WH 4F57H 5GGVH 3TN0C 3D85B 4JQXC 4BKLB 3MCLL 2A6DA 2CLRA 2FB4L 3M8OL 4KI5F 5IMLA 4PJEE 4LPYA 1YJDL 2ZZUT 4H25A 5IT2H 5D6CA 4FQ1H 1F6FB 4JO1H 1P7QA 2YA2A 4GS7C 4RAUA 4Q9RH 1FYTD 2NTFA 3JUYA 4D8PB 2F54B 4QO1A 4I18C 3GIZL 4NQDA 1B90A 4QTIL 4F9PA 4PGEB 1NMAL 5GZND 3RVXD 4WHTB 1NCWL 3DVGA 2FLRT 5F8QC 4L8BA 2HVKB 5FAAA 5D96C 3U9PL 2X4PA 5DHVH 2BY1A 2COQA 4R0LB 1YC8A 3PNWA 3BYYA 5FYLE 5C71A 1JCKA 1GYAA 4R7NA 4F33B 1T1WB 4GW1A 3C6LA 1RZ7L 3QUMH 1IGCH 3WJJA 2NMSA 3PXHA 3GBNL 1WC7B 2A83A 1FE8H 3B9KB 4JRXD 1LO2H 1PQZB 2V2WB 3ZTJH 4XB8A 4JFDE 4PRHE 3EDFA 3CU7A 3TT3L 3X3FL 1CK0H 4S1QH 3QNXB 4JQIL 1CXIA 1MLBA 3LKPA 1YY8B 1NJ9A 1MCPH 3TBTA 4G42B 3B3IB 3QSKB 3FT4A 1CFNB 3QHTC 3KYKL 1FRGH 5H2BB 4GAGL 4GRLD 5FUCC 5JOFB 5JMRA 3I6KA 3IDGA 5I9QC 4WI3A 3NA9L 2HJLA 2XKUA 3NN8B 3LKRA 2MOVA 3PWNA 3S37X 1JI1A 1FLRL 4WUUB 1F4AA 4GS7B 4M1CC 4RX4A 4M3JA 4HIXL 3B5TA 2VQUA 4YIQB 1A22B 5KAQF 4MJIE 5FA3B 3S5LA 3OZ9L 4BH8A 5I1LB 2V17L 1RULL 1IVLA 4ODHL 5IHZB 3MMEB 1T7XA 3TYFA 5T1MA 3CMOH 3HNTL 2VQ1B 2VZVA 2JJTC 1IAIH 1FGNL 3PV6A 1DLHB 1S7WA 4CVZB 5EUOE 4NO5B 1M71B 3GRWA 5AG8A 3P4NB 5E8DL 4J7RA 4GG6F 1KBGH 3E2HC 5T1DL 1HIMH 2IG2L 3OR6A 1MFDL 4IOIA 3MRGA 4KRPC 4PTTB 3NPZB 4NQSB 3FCTA 4PB0H 2QQLH 2GJJA 5T1MB 1LO0H 5AEAA 5ICZB 1ZWIA 1HH9B 1KN4L 5DRXB 1IC4L 4R0LC 2N7BA 3G6DL 1T2QH 1AKJA 2ERJB 4JB9L 3SGEH 3D69A 4YEEA 3V5DB 2BERA 4P2RD 2EE9A 5F9WC 3SQOL 3EZ8A 2DYPB 4KVCH 1UM6L 1NAMB 4TOYH 3DMMB 4ALAL 4MAYA 1Q0XH 3O4LB 4FXKA 4OQTL 4HS3A 5MEOA 5HYIA 3U36B 1E4KC 4XCEB 5GRUL 5IB5A 1EGJL 5I1IH 3IFNL 5FOJA 3T2QA 4C58B 1F42A 1IZJA 5F97E 4GG6E 1CYGA 3DSFH 1KPVB 2C9AA 2ID5A 2NX5B 4X9IA 1TJIH 3L3DB 2ADGB 2FECI 1MHHA 1INEL 5A2LH 3V5DA 1UENA 4YHLH 4ZODA 3JVGA 1DANU 4PGDB 3D85A 2GSIB 1OAYL 3MRQA 5HPOA 3QDGA 3CJJA 4NT6A 3AY4C 3AM8C 2O26U 4GQ9L 2C1OB 1CR9L 2DM4A 1LP9F 2PR4H 4QHLA 2FCBA 5F8RC 5FYJE 4HBCH 5IBTH 3C60D 3TBVB 2LE9A 1BX2A 1TENA 3QQ9C 3UXFA 3HAEH 3F7RA 1LWRA 2ITCA 4KMLB 3VFGH 2PTTB 2UWEF 2RHEA 2GW5A 4JPWH 5DHVB 1OT2A 2DWEB 3QDGB 4M8QA 1A7OH 2PYED 3MV7D 4ZXBD 1K8IA 5LG1A 2ZG3A 3DGGA 7CGTA 1HHIB 4OZ4A 2Y5TA 2GTZB 2X89D 4YIQA 1P84J 1CF8L 3MLTB 3X13B 3B9KC 3WNKA 2R9HC 3BPNB 5TF1H 2NY0C 4OZFB 1H3PH 3TA3C 2IADA 4F15B 4OI7A 1GZPB 5FK9B 4MAYC 4Y5YB 5IIEB 5IFAL 1JUFB 4ELMA 3RBGA 1S7SA 4IOFD 2ZG1A 5IJKC 1Z5LA 4WUUA 4S10A 3FQUB 5T5FL 4CNIB 1G7LA 2ICEB 4PRBA 4OKDA 2YSSA 5C2UB 2F19H 3RY6A 1BREA 1VENA 5D2LE 4M1CD 4HKZB 4KMTL 3SDDD 4RFEB 1UWEL 3F12A 3KS0H 2J8HA 4PJ9B 4LSSH 4QF1B 4TSAL 5IJVB 3S4SB 4IRSB 4P99A 3UC0L 1ZE3C 1DLHA 1MREH 5LJYH 3BP7B 4HIHB 4JEGB 4YZFF 2QV2A 2V5RA 3TESA 3HZYB 4QYOB 4LNRB 1AQDB 1Q72L 4L9LB 4JY5L 5GGSB 3JTSA 3W11C 4L8DA 3WNLA 4LAJH 4IMKC 4ZS6C 3DUSB 2VZ3A 4JFFE 4P5TA 3BPOB 5EZLB 1MCOL 4R4FL 1TQCB 5SWQA 1G7MA 1UZ6F 2IF7A 2XNAB 3VRJA 1SM3L 2GCYA 4MA7L 1IQWL 4PJIB 4PJXF 3BN9C 5GXBB 3LKRB 5BRZE 1S9VA 3AY4A 4V1DE 3ILPA 3OR7A 3MJ7B 4QGYA 2D0HA 2E9JA 3H7BB 3TBWA 3UTPE 3EYVB 5L7XH 3PGDB 5C0JA 2YZ1A 2WM0A 5F7KC 4J1UB 4O2EA 3O3DA 5HHPB 4TN9A 3V4UH 5DT1L 1Q0YL 2IEPA 2EDEA 1JNHB 4LU5H 4ZTPL 2X4TA 2Y06H 3WD5L 2E7LC 3N9GH 3PWVA 3HUJE 1MEXH 5D7KE 1FAIH 4RGMC 4WEBL 3WIHL 3B9KA 3SCMB 1FCCA 2OLDA 1AXTH 4XMLL 1FVDA 1HHGA 5GS1C 4HUWB 5T1KB 4NO5A 3HE7C 4J1UA 3D0LB 1NGPL 3BHBA 1RIUL 1HDMA 1FL6B 5F89A 3RUGF 3MRLB 2NLJA 2ICWI 3OHXB 3VI3E 4N1CA 2RBLA 1MF2H 3EYUL 4F7MB 4L8SB 1MFCL 1RV6X 3WFDL 4X7DC 7FABL 3WO4B 4NDMA 1MAJA 4X6EB 1ERNA 1EVTC 3BP5B 1A1NB 2DL2A 2ZCLH 3Q1SL 4L9DA 4JY6B 2YR3A 2ZCLL 3VD7A 4GAYA 3CLFL 2UUDH 4NQTA 1XGYH 4XVJH 4HULB 5KVFH 4GW4A 3T0AA 5D1QC 3OAZH 3UTTA 2NLJB 5DJCB 1CFTB 2AQ2A 4ENEC 3AU1A 3QQ3A 1NSNH 5E8EA 3G08B 3TNNB 4YBLC 2QR0B 3L7EA 3H9HB 5I1HH 1YEEL 2Z35B 3PJSB 4GMSL 3LB6C 3OX8B 5SWZE 1LVEA 2AEIT 1S78C 3OPZL 1FNHA 5K9QI 3GM0A 4R26L 3ZDXE 1FFQA 3JWOC 5CSGA 2CK0H 1LO4L 3MRJA 1T22A 4TVPL 1FAIL 2I60L 5D5ME 5FUZL 3CUPB 4LPTA 4WO4B 1K5NB 5KS9A 4LU5L 1Q0YH 3TNNA 1MJ8L 1RZIA 3OX8A 3UZEA 3VFTB 2KH2B 1JGVH 4KKAC 5FUOL 2VDNH 4DQOH 3NH7H 4GG6A 3RZCD 5DS8A 1A0QH 1QSZA 4NJ9H 1BZ7B 3UBXG 1ZHLB 4L8DB 1IL1A 2P5WE 5DA0B 2PW2B 2VMFA 3BKML 1EEYA 2NY2C 1Z0MA 5ECJE 2R4SL 3ZTJG 4EN3B 4J3WA 5T33L 1BBJA 4ZYKB 4DW2L 2UZXB 1AIFB 4EI6A 3VXME 4BH7B 1UYWL 1VA9A 1NGZA 4HUWA 1U8OA 4WFGE 5ICXB 4DZBA 1QSFA 1NL0H 4J3XA 4QHLB 1UWEH 1FO0L 4I3RL 5DVOA 3DETD 5LGKA 3Q2CA 3VH8B 2NY4B 2FATL 5FGBA 1LDSA 1DQMH 1OAQH 2AXHA 2L4OA 4NNXA 3SE8L 5EB9A 3GNML 2FX9L 1RJZA 1AIFA 4OGXH 1I4FB 5E0QA 4QXTB 2AEWA 5JTWA 2N1KA 5E95B 1FG2B 3DYOA 5IEHB 2CPCA 3BQUD 1QVOA 3ARPA 5GZOD 1O7VA 3T08A 5E6ZA 4JG0L 2W0FA 4TNVK 5IKCA 2JJWA 3GMMA 1AGCA 3QB7C 4Z7UF 2F54A 1FAKT 4LQ1A 1TVHB 4PTUB 4JFYA 1ND0B 2GIYA 1JF1A 1ES0A 3QJFB 4J12A 4C57C 1WAAA 3FT3B 3PV7A 3SKUD 1TDQA 3EOTL 1CDJA 3DXAE 1TXKA 4UINH 4CAGA 2D03L 5A1AA 4MJ5A 5KSAC 4D9RE 3IU4H 3G04A 3VFGL 3LN5A 1I7RA 3MV9D 2X05A 4CN6A 1QBML 5L2KB 2AJVH 4HBCL 4MJ6B 5HI5D 3ZDXF 2D03H 5IV2B 3W9DB 2H32A 1JPFA 4HSQA 3K80A 2X5PA 3LH2H 3BRGC 5KSAA 5IVOA 1DUYA 4P4KD 4YDJA 3P77B 4KC3B 4U1SB 1PW3A 4FMFA 4I48B 3MGTA 4RDQF 4EDWH 4LP4A 1GGYA 1TZHB 1EXUA 3BGFB 2YD4A 4L4TB 4MD0B 4MXQC 2VN4A 3NA4A 2NX5D 1AGEB 4NPYA 4TUOA 4M6AA 1U92B 3U7YL 1HEZB 1EMTL 4Q6YA 4PLKD 4HK3N 3IAPA 5D5MA 2Y72A 5IVNA 5CP3A 1MCEA 1OGAB 2BVEA 3ARFB 2ZUSA 5E1AB 4M3KB 4RCAA 5GGSA 2FO4A 3FFDA 4XAKE 3QULA 3SE8H 3LS5H 2LTQC 1JL8A 1DQML 1OAQL 4Q9CA 3JXAA 4RA3A 4XBEL 1MCHA 3T2NH 1SEQH 1FO0H 2BHYA 3AB0B 4Z7WB 1T04B 2VOTA 2DWEA 3C5JB 2OM5A 5D7IB 5B38G 4LLVA 3ULVL 3WIFB 4CVZA 5IEKB 3A6CL 2R2EB 2EDWA 4DW2H 4PJHF 5CILH 4P2QB 1DE4A 1IAIL 3KG5A 3ARUA 3VGAC 2LFGA 3PXJA 2X6MA 3BRDA 3TFKC 6CGTA 1FVEA 4R7DA 3UJJH 1X5YA 4ODHH 3BWUC 4OGYH 1E27B 1TQBC 3X3GH 3DRTA 3QDJE 3ALWA 5CMAA 2GUOB 1DJSA 2JELH 2SEBA 2XTJC 5F7FA 1T5WA 3OZ9H 4OAWA 4LP5A 3QWOA 1TLKA 1VEMA 1P4BL 4X4YA 2DD8H 3IFLL 3DMMA 2XIDA 1M6OA 1A1NA 2AABH 1HWGB 2VAAB 3NPSB 1N0XH 1AR1C 4OM0H 5CSZB 3TH2T 5K59E 5D96B 1UM4L 3HS0A 1E27A 1S7TB 2B2XH 2VXTH 4WEUD 5LAXB 4GAGH 4F37K 4MNHA 5HVHB 1NC4B 5DSCB 3RA7L 1H0DB 1OPGH 1MCCA 3BEVB 5EWIL 1MWAB 3MV7E 2BRQA 5LWYL 1DBJL 5GIRB 4XH2B 5GGTH 1EO7A 1KNOA 2LU7A 2YK1L 3TA3A 1U36A 4APQA 5A2IH 5LBSH 5ESQB 4CJ1A 5I1HL 1J05A 3FMGL 4YC2C 2VDPL 1IGCL 5MERA 2ICES 4LARH 1UA6H 2IANA 1NC4A 3C9NA 1N26A 4YXKL 1ZA3B 3U4BH 5KSBB 5DQDL 3NAAL 3JWOL 3MLYH 1G1CA 4PRNA 1JF1B 1XGYL 4X4ZA 3SE4A 1RJLB 1UZ6E 5IB2A 3MJ7A 4DCQB 3U1SL 4XPBL 3LS4H 5C9JB 5DMKB 1HHJA 1J1PH 3R06B 5F7UA 5E2WL 5E5UB 7FABH 2AJUH 3BAEL 3T0ED 1UH3A 1ZMYA 2DRUA 3KR3L 1OHQA 5D7LE 3GIZH 4DVBA 4JVWA 3W2DL 5MEQA 2NTFB 4Z7UA 3DUHA 3IDMA 1U0QA 4RFNC 4KJWD 4LIQH 1FNLA 1PSKL 4OZGF 2DQIH 3ROOA 1QFHA 1QA9B 1OD7A 3RRQA 2NR6D 2GAZA 3AROA 4FQ1L 4XNZB 3CC5A 1FFPB 4W6WB 3MODL 5TF0A 3M8OH 5HDBF 4DKDC 1CVSC 1TQCC 3L3HA 3H0TA 4GFTB 2DQGL 1C16B 1CXFA 1GAFH 4P4RA 2P4AB 4DAGL 3C8HA 4WFGD 4Y4HA 1HH6A 1SY6H 3EYQD 3V4UL 4YXLH 5GS0L 1KJMB 1L6XA 4RFEA 1T4KA 3KLAA 2WP3T 4KDVA 3CFJB 4HUVB 4XTRD 2VXVH 3W0WE 4ISVA 3WN5A 4ESKA 4TPRL 1GZQA 1OOAA 1J12A 1FFRA 3S8WA 1U8NB 2XWBB 5FA3A 3OKNA 1SM3H 4MA7H 1BGXH 1WCBB 2VE6A 4OFYD 3NZHH 3X14A 2C7UB 1IGTB 1BECA 1H9VA 4Y5XB 4P5KB 4KUZL 5GGQL 2WQRA 4PRIA 4JFPA 2CKBA 3V4PL 3WFZA 3JWDC 4P5TC 2FRGP 1OSPL 3TA3D 2RAMA 1KEGL 1BM3L 1T83A 1TPXC 3SOBH 4NFCA 1JF6A 4HQQL 2R29L 1IAKA 4NCC2 2A9NH 4X6CE 3HE6C 5JPNB 5IFHL 2R23B 1HNFA 4LOUC 3KPSA 2OP4H 1OAUL 1G0DA 4XP4L 4I2XB 3AGVA 4NZDA 4KMTH 4LL9A 5MERB 1MJUL 1GOFA 1IAOB 5HPMB 5FKPA 3MUGA 4DGVH 3AS1A 4UV7H 5MEPB 5BMFH 3UO1H 2OK0L 2MCPL 2DQUL 4P2YA 4PJGE 2AAVA 4CMHC 2B5IB 4LASH 4QTHA 3C5JA 3SE4C 4OLZL 1NCUA 2R23A 3NTCH 1TETH 3JVGC 4U6VH 5F7DA 3SGDH 3GBMH 4NKMA 5DLML 5EU5B 4BJLA 2AEPL 3BE1H 5D7IE 3VFMA 4J8RB 5LAXA 3SJVE 1KTDB 3ALPA 1XGPA 3GJFH 1AR2A 4HCRL 4MVBD 3VRJB 1U6AH 3BPCA 1TCMA 3M17A 2XY1A 1QPPA 4PGEA 3ZMRA 1X6LA 3F7VB 4XPFL 5B39G 2HJFA 1WF5A 3TN0B 2X1XR 1T5WB 3P0VL 4M7KH 1QRKA 2KL6A 1P7KA 3S36L 3QPQD 3BDXA 2VJXA 5CP7B 2UWEA 1CFVH 3Q5OA 3V5KB 4KRMB 1ZWIB 1CFNA 2A6IB 2FHFA 3BH9A 4JN2A 4XPAH 1T4KB 3QP3A 4RGOH 2VYRE 5F9AC 3ZE1F 3BWAB 5DD5H 1MFEL 4LAQL 4XPHH 4GQ9H 1MI5B 4OTXH 1ZHBB 3L9RB 4LGRB 1BWMA 3GHEH 1JE6A 3UTZA 1T1ZA 3I3BA 3KNBA 5AUMA 1CDGA 1KLGA 1UFUA 1VCAA 4TNWF 3D2UB 3HI6L 3VFVB 4J23A 5C09A 3CLEL 3FAWA 1U91B 1NUGA 4MDJA 4MGXA 2BNRA 3GDBA 2XZQL 3RVUC 4GG6B 3U0PB 4NUJA 3V95A 5D1ZA 4JB9H 5FYKD 2E3VA 3RIFK 4WIQA 2Z4QA 1FGVL 1NDGA 2H9GA 2XA8H 4AG4L 2CIKA 2QQLL 2OZ4A 1NLDL 2HTLD 3P0YH 3MNWB 4QOKD 2X4UB 3NOIA 1JHTB 3LEYL 3P0GB 1HIML 2D31B 1JVKA 1A5FL 5A2FA 5E8DH 2AK4E 4RMQA 5JZ7C 3LSOB 2F15A 1RZ8A 2YMXH 2V9QA 4F7CA 2V7NA 4I2XA 1L0YA 4ERSL 1FCGA 1EFXA 1H8SA 5EU3A 1I9RH 1FDLH 3OMZA 1RULH 2OL3A 5CEXB 2I9LB 4W6YB 2ADGA 4F2MB 1N64H 4P2OC 2CO6B 2HLFD 3VWJC 3VWJD 3EHBC 4JFHE 4FZ8L 4XPTH 3HRZB 4PG2C 3VMOA 3K74B 2IMNA 5E4IA 2CDEA 2NXZB 4WJ5A 3OG6B 3B6SA 3MJ9H 3RVXC 4TUJB 4G7VL 4X9HA 2EXYC 3W0WB 3BO8B 4IRJC 3VFMB 3OGCB 4CBPA 3CDGA 2GT9B 3OV6A 1MCPL 1KF9B 1FIGL 4QRRA 3FTGB 2A6JB 4LLWA 1A2YB 1UB6B 2Q3AA 5ENWA 1FVEB 5C0RL 2AV1B 3QRGL 2C3XA 4GW5B 4LVHC 3TT3H 3BXNB 3RGVA 5KVMC 5HGHB 3X12B 5ID0A 5EBWA 2MHAB 1J5OL 3QXDA 4I18B 4FQLH 4LSQL 3ESUF 3UBXI 2BVQA 1RUAL 32C2A 3HB3D 4HFWB 1D5XB 4HWNA 2EO1A 1RIHL 4UIMB 3CVIH 3L6FB 2X1OA 5A43C 4S2SA 3AREA 4MQXD 4JFFA 5C8JA 4NQEE 4M61A 4H88L 3IFPA 4PJDF 4W6XB 2P49B 3RGVB 1CQKA 3K2UH 5FO8A 4OFYA 3ILPB 3OR7B 3VRLF 2ITDB 3UTQB 1F3RB 5CD3B 4GAFB 5CSZA 5M94B 3HZKB 5ELIA 1NMAH 1NBYB 5BRZA 1JMZA 1OCWH 4NC1C 2UUDK 5F6HJ 5KG9B 3VFSA 3HG1D 5TGBA 3V6ZA 1OM3H 1NDGB 3WUZA 3GMMB 1CXKA 3QCTH 5DJ8B 1B6DA 3F58L 1P9MA 4Y5XC 4G8EA 4JO1L 4NDMB 4JDZB 5HI4C 4G6AD 4QY8B 5MENB 3SDCA 2APTA 1M4KA 5B39B 4LHUA 3VXUB 3KPSD 2AERT 3RAJL 3FO2B 2FB4H 2QSCL 3ECBA 4BQ8A 3KPTA 1PGRB 2IANB 2JIXB 3MYZA 3RJQB 5IJKA 5FYKL 5KTEL 1JYNA 3V7AE 1WZKA 4FXGB 1RD6A 3KAAA 4HJ0C 1AJ7H 5AWNL 1SEBB 2G60H 3O6FB 3ES6A 4UBDC 4PRIE 4PJ9A 2BVTA 4AEIH 4OV5A 3GMQB 2GK0A 3KVQA 4TNVF 4Y2DD 1EV2E 2DLFH 2DLTA 3HMXL 2ADJB 4HEME 3C09C 2HH0L 4JCMA 3FRUB 4OCSH 2HT4D 2IBZX 4OQTA 4K7PY 1EAJA 3WHE1 2KZ1B 3ISWA 4KU1A 3DX6B 2P8MA 4C4KT 2ATKB 4OD1H 1AP2B 4KKLD 4BK5A 4IRJD 4HS3B 3CPLB 3LRSA 4PRPA 5J89A 4UDUB 3ULSB 4MJ2A 4XXDA 1YNLH 5ALCL 5F71A 4KKBC 2NY4D 1U91A 1GGBL 3D87B 4K3JH 4LSTL 5LCVL 3FT4B 4P4KB 4K7PL 4PJ5D 3VXOB 1XAUA 5D6CB 1ZA3A 1A8JH 1K6QH 3TJHC 1F4YH 4ZTOL 2NZ9D 5FYJL 3CXHJ 1N64L 2XZAH 5JOEA 1IC5L 4G6JL 3WIFA 3QQ4B 4HX1B 3RIAK 4WWKD 2B8OT 4U1HA 4LSPH 2I5YL 5EU7E 1Z3GH 1GOHA 4R9HA 4QNPF 3BWAA 4N0YH 4JRYB 4K3EL 5DRWA 1CICA 2Z91B 1OAXL 2NY5C 4PJGF 5I1JH 1UM5L 2V2TB 2VDOH 3T77A 4EXKA 1ZOXA 2WW8A 4PGCA 4XBGA 3CC5B 2G9HA 2NY1C 3AU1B 3WHE0 2PXYD 4BSWB 4KV5E 4UQ2A 5TE7L 4BQ9A 3S37H 4KZEH 4L4VE 1JFQL 5E8NB 4OB5H 1W72A 3DV6B 4IRZL 2VLME 3P4OB 1ZHNB 4GG8B 4OZFA 3HC3L 4KQ4H 4D9QD 2F74A 5IEHA 1GZPA 5FK9A 4OZHA 3LEXA 4D0DB 3QDJD 3SJVA 4RZCA 5L9DH 3K3QA 4FQQA 2XZQH 3MBEA 2UZIH 1LNUB 4LDOB 3S88L 3OHXA 2HFFB 3SKMA 3KLHD 4JHZA 4OT1H 4NRXA 4K3HA 5GRVK 4JANA 5IW1B 4OIAA 1JWMA 3OAYK 3AAZB 1CDUA 3MRJB 2HMIC 2DLGA 4X99B 4OTXL 1YEGH 1I7RB 5HGHA 5GGSY 5ID0B 4BZ1L 4PRPD 5SX5H 1KJ2A 5JIKA 4ODVH 2VC2