1CFSA

Anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-unrelated peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPSRFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Polyspecificity
molecule keywords PROTEIN (IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN))
publication title Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity.
pubmed doi rcsb
total genus 44
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1999-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfsA01
4G43A 3QI9D 1RJZB 2JK5A 4X6EA 3C6LB 3D69A 5IW3A 4G6ML 1ES0A 4HK0A 2NCMA 1CICD 3OKDA 5I66B 1RZGA 1FO0L 2WBKA 4ZNCD 1EEUA 1A7OH 4CU7A 4JZJC 4BZ2L 1PEZA 1VKXB 1NBVL 1EHLL 5E8NA 3TJEL 4MAYD 3T2OA 1YY9C 1NC4A 1YMMB 4L8SB 4Z6AT 4OGZA 4ONFH 4DGIL 4PY7A 3CGTA 1S8DB 1ZSDB 2N7AA 4NC0B 2DM3A 4KC3B 2VIRB 4Y4KD 3CFBA 3E6HB 2GJJA 4Z7WE 4U6HA 4KI1A 1FE8L 3K0WA 4JJ5B 4LOUD 4X5XA 2EEAA 3LKQB 3W0WB 3NZHL 2VLJE 4HG4J 5EU7E 2WWKT 2YUVA 4AYFA 3B4NA 3WE6B 2Q6WB 4GG6A 2VLME 4L1DA 2Y25A 5HI3D 4FTVB 5ICYA 1VESA 1Q1JH 3IXAB 3LEVH 5DMIL 3BUYB 3EUUA 3RY6A 1KCRL 1LO4H 3UJTL 4BSWB 1PG7L 4PJ8D 3V7AG 5GSVB 1V5JA 1ZLSH 2WSKA 1IQWH 3PWPD 1CQYA 1ZV5A 4NM4L 1ROWA 3RVUC 1BQLL 4JZOB 3DARA 5F70A 4UZGA 1KJVA 1K5NA 2DQTH 4NO0B 2D0GA 3D3VE 2ADIB 4HGKC 3NFSL 4LLDA 1YPZB 1R3JB 1KEML 5JW4Q 3AU1A 4YQXH 3QWRD 2QJDA 4XTRD 1F02I 3RL2A 2VZOA 2NY0D 2F8XC 1CDHA 3MA9H 1GRWA 4DEPB 1ZHNB 3KJ6H 1RD6A 4KK8C 2WZPD 4OLXL 5T33H 3KPLB 2EYTB 1HQ4B 4KMLB 4JFHD 3ZE2F 1QACA 5ADPL 5L2KD 1QPXA 4ODVH 4F58H 3D18B 5E03A 5GRJL 3TVMA 5AYUL 1EO8H 4Z7OE 3X3FL 5DEFA 4AQOA 3X17A 1VHPA 4PG9B 2C4FT 3TA3D 3IJSB 3ILQD 4HF5L 1AO7B 1T5WA 2ESVB 3T0DA 4N0CC 5F7KC 3BIBX 5FYJH 1VGKB 4LGRB 2W92A 3NIFE 4HWZB 1EUTA 3V5KA 1JYWA 3GZKA 5ELIA 5HHVL 3SKNB 1ZEAH 2H2SC 5DC9B 1JPTL 3RKPA 3MV9E 1XF2A 2VDRL 3SBWC 3IDJB 5B39B 5M95B 5EZLB 4C58B 4YXKH 3C2SA 4Z8FL 3GSUA 3ZSSA 4KKAD 2ZNWA 4H8WH 1GGIL 5FUCE 1HH9A 3RFZC 4KUZH 5E8EA 3RUGB 1IMHC 1RULH 4PRHB 5DT1L 5I0DA 4OF6A 3RHWK 1S7TA 5F7DA 4CN1A 3QIWC 1FVDB 2O5YH 5MENA 3I2CL 5HYJA 4RFOL 4Q6IA 1YEKL 5DRWB 3PHOA 5IFJB 4BELD 1AGEB 1WWCA 3GMQA 1A7RH 3MRKB 1JZ3A 1DVFC 3VFNA 5C0JB 2CK0H 3TJHD 4KRMB 4MB3A 3L3DA 2JB5L 5BXFB 3DX9B 5D6DC 1ZK9A 1U8OA 3H7LA 1I1FA 3QCVH 4LBEA 4EIGB 3QFJB 5HHOE 4WHTB 3UROR 2NTFA 4PJGF 4QHNA 4KZEL 4XP9L 3BVNB 5INCA 3ARFC 1UACL 2VDNH 4Y1AA 5C6PB 4I3RH 5E6ZA 4GW5A 5DJCA 3VW3H 2ERJC 3QQNA 3H3PH 1BD2A 2B20A 4PJ8B 2F74B 3QO0A 1MUJB 3S5LA 3L1OL 1D5IL 2Q3AA 2RAMA 1AXSB 1U95A 3K4AA 1BBDH 1NC2A 2P48B 4PYHA 4R4ND 4PGJA 3UTZA 4UIMB 2EH8L 1OW0A 3RKDC 3GGWB 5DRNA 1A2YB 3QB7C 3QP3A 4P4KD 2E7BA 1FFNA 2W9DH 3OQ3B 5E56A 1A0QL 1MY7A 3ZDXF 3G5XA 5EBLA 2QQKH 1FPTH 2ED8A 5KG9A 1HK6A 1HDMB 3FONB 4GKOA 4M7ZC 3IFPA 3MBXL 1AFVL 3PJSB 5DQJB 4KTDH 1EGJH 1A8JH 4YHYB 3NCBB 5HBBA 4HWNA 1E6JL 3RDTC 3VMNA 5I1IH 1V3MA 4HKZA 4GMTH 4YDVA 2IPTL 4HXAL 4XC3L 5C6TH 1FHGA 3D2UB 3H3KA 4KV5E 3DXAD 4IIQC 4U1KB 1S9YA 3QUXD 4F7EB 1BZ9B 3O9WA 2AVGA 3HI5L 4GXUN 1CL7H 3DUSB 4Y88A 3ZT6A 3EYSL 4F15C 4I9WD 4HX1A 4XVSL 1G0XA 4LF3A 4HDIA 5FKAA 4JFFA 3ARGD 4MGXA 1MVUA 1X5IA 4ZDHA 4WTWA 1CFQB 1V3KA 5D70L 2R8SL 3P9MB 3PWJB 4JFDA 4QRUB 4ENED 3IU4L 1DL7L 3QHZH 4P2YA 3VXUE 4OKVB 4KJYA 3ZDYE 4WCYL 1QSEE 4QEGA 1MCEA 2GITB 1C7TA 3OJMB 1E27B 2GKIA 3GO1L 4NPYA 1N59B 3QO1A 5EC2B 2VZ3A 5GZNC 2IANE 1GPOL 1WQVT 3TT1L 4ODTH 5DEZA 4ZG1A 5KVDL 2DQFB 3D6GA 3IDYC 4OV5B 4KAQH 5F3BB 4I5BB 4OZHE 4HBCH 2UZIL 3MRMB 4NKDB 5CEYB 5JO5B 3ZTNL 4WU7A 4JKMA 4HKJA 1RUAH 4PJ9C 3MRNB 2F54E 4LNVA 4L5FH 4K07A 2AK4A 3PXJA 1WISA 4DKDC 1YEDA 2DYPD 2W9EL 3HAEB 1FORH 1QKZL 2VH5L 2ZUSA 4PJ5A 1IBGL 3AY4A 4XMPH 5DYOA 1MCNA 4ZQKB 2XN9E 2EIBA 5F9OL 4BFBD 1MJ7L 4H1LG 2FLRT 3CSPA 4M1CD 1DBAL 4G7YH 4K3DH 4KKCD 4LCCC 2D31A 5IEKA 1XF5A 2ICWA 1D5MA 5D1QB 4JDTH 1KSRA 4YLQT 2NR6D 3ARPA 2IQ9H 2VR5A 3IXTB 4RAVB 4WO4A 5D2NA 1C5BH 3FQNA 4ZAKA 1HKLL 1Q94A 5DVKA 4P4RA 3HUJA 3O3BB 4KTYA 4V2CB 3GMNA 1EX0A 5IBLD 1GL4B 1FAKT 1CTNA 2CR6A 4IOIB 5CZXC 1U8QA 1R5IA 4NKOB 3PDDA 5MI0C 4I0PA 2DM2A 3FHQA 4FQ1L 1MAJA 3FQTB 1FVCA 1ZT7B 2ZOKB 5DVOA 4L4VA 3C5SA 1JMZA 5F8RC 1JHKH 1A5FH 2Z31C 3H9SD 3MGAA 4Z7VF 2C1PB 2OXGA 3B5GA 3WLBA 4HKXA 2A6IA 3ZE0F 4YR6B 3G5VA 2P24B 2W1NA 4G8EB 4I48A 5DGQA 3JV4B 3QIBD 3RP1A 1CE1H 2BSTA 3LN5B 1U8LA 4XHQA 2OMBA 3ZTJH 1IAMA 4M1DH 5CKAA 5D6CB 5I8CB 2XY1A 4GG8B 2H45A 2W0FA 1P7KB 1J05A 3KPTA 2ZPKH 3MMEB 1UADC 1KIRB 3ARED 3EIFA 1G6RB 3C9NA 2GYSA 2YWYA 3RGVA 4ZUSB 1ZMYA 3BKCL 3ROLA 2FCBA 1EEZB 4PJIF 3UX9B 1ZANL 3ARWA 2X4UB 5HVFB 1MHCA 3PL6B 3LD8C 4MCYA 1Q0XL 5D72H 1AKJA 3UTPE 1V7MH 2VDKH 1B0GA 4PP2B 4K55A 1NEZG 1TJHL 3O4LD 4IBLT 5IIEA 2WV3A 1TVBB 4WGVB 4RGMB 5ADOL 4TUJB 3WNPA 1I4FB 3SE8L 5I1CL 4GW1B 2DQEH 4MXVF 3JWDL 4LSTL 5BRZA 3UEZA 2NXZB 2MNUA 2YD7A 3VWJA 4CBPA 3B2UD 5HXMA 5DC0A 1TTGA 1H3XA 5K9JH 1GGBH 1CZ8H 4M7LL 4CVXA 4FABL 4BA8A 1XCQB 4XP4L 4XVTL 5CJQL 1G7MA 1A4KB 4MZ3A 4AT6A 3C8DA 5IB3A 1FZJA 3MZTA 4UQ3A 1RJZA 4LHJB 3DO7B 1NFDE 1P4BH 3C6LA 2FX8L 2NY3B 4HHAB 5J8OA 1JPFB 4MJ4A 4X7DC 4F8QA 4YDIH 5IHBA 3HC0B 4ODXB 5FECB 1VKXA 2OCFD 4AEHL 1Y6KR 4QXGL 3LKPB 4WI6A 1YMMA 5E95B 4L8SA 3BSZH 3BYYA 5L8JB 5ICXB 1S8DA 5EULV 4ZS7L 5I8KH 2I24N 2DJ4A 2VIRA 3E6HA 2DLFL 4JJ5A 4OM1H 3T3ME 4OZGB 3LKQA 3OKOB 3W0WA 3JUZA 3O0RH 3WE6A 2Q6WA 2E27H 3DO3A 4U1MB 3HE7C 4FTVA 2OK0L 3K1DA 2CH8A 3IXAA 4UDUB 5C0BE 3TFKD 4WW2C 3BUYA 4RMUA 4S2SB 5F3HB 2PR4L 4BSWA 3SCMC 4OCLC 2DTSA 1QSFB 3QEQB 4ELKB 4D9LH 3U46B 5GSVA 3PIQB 4YBHA 2VOTA 4HIXL 1JNNL 1WZKA 4HS3A 5BW7A 1PSKL 4JZOA 2DOCA 4JFZL 3VXMB 1AI1L 1TDQA 1OOAA 4NO0A 4FXGB 3BMVA 2ADIA 5LGJB 3FO9A 3IFNL 1YPZA 1R3JA 5B4MD 3MOAH 3CLFL 3QIBB 1C12B 5J3HC 4D0BB 2DQDH 4PRBB 1KB5L 2GK2A 2XZZA 1CDYA 4Z7QF 1EZVX 4MQSB 3BFOA 2EH7H 2H1PL 1BEYL 1ZHNA 2VDQL 1B3JA 4OCNC 3HI6H 1A4JB 3KPLA 2EYTA 1HQ4A 5IWLC 3S98A 3PGCB 4NKMA 4OD2B 5AG9A 4KROD 3D18A 5IW6B 1EIBA 1JRHI 3OGCB 1YQ2A 5GS0C 3GRWL 4NQDA 2FX7H 4WU5A 3QULB 4PG9A 3IJSA 3MXWL 1AO7A 5JQ6L 4RX4D 2ESVA 3G04B 1XGUB 3NA9L 3RZCC 3VXSB 1BFSA 1VGKA 4G80B 4A2LA 5FB8B 4LFHD 1A6ZB 5GQBA 4HWZA 4M1GL 2HJKB 3CK0H 5J1AA 4NWTH 1A9BB 3SKNA 3MO1B 1S7RB 3VFUB 1AD0B 5K9QG 4GRWF 3IDJA 5B39A 5EZLA 1YZZA 5CZVL 1QRNE 1V3JA 3UPCA 4KRPD 2BNRA 2C4FU 4MLIA 3RTQB 1MCQA 4GRWH 3RUGA 5HVGB 3VFSB 2EE2A 2AJXH 3VD7A 4Z7NE 5GJTL 4K7PX 4HV8B 1CS6A 5JW3L 1F58H 2C3HA 1FVDA 1RJCA 2A74B 1FO0B 3FB7B 3MV7E 5DRWA 4W4OC 1JN6B 3EOTL 2OJEB 1AGEA 1CF8H 2HWZH 3QXDA 4M6ML 4DFIA 2J6EH 5C0JA 1JHLH 1SJEA 4IRJC 5KSBB 4NRYA 5BXFA 3N9GH 3DX9A 2UWEE 2Y5EA 5FDWB 1K8IB 1K9TA 2ICWJ 3QFJA 1BJ1J 4WHTA 5E6YA 3HNTL 4OZIB 2H3NB 2VZUA 2PN5A 3UO1H 4WHCA 3BVNA 3EO9H 4KUCF 3W11C 1S9KC 2HLFC 4KGJA 5FGBA 5LQBL 5I1EL 1F3DH 2WANA 1KLGB 5FUCC 5I8OL 1CDJA 5I75C 2F74A 1MUJA 4GG6F 1BIIB 3ILPB 3TNNB 1AXSA 3D1MC 2ZUQC 4YUEH 2Y1VA 4AL8L 3IRPX 4UIMA 3PV6B 4KK5C 3GGWA 1A2YA 1RURH 1TPXB 4JN1H 3BPOC 2KUTA 3HKFA 4RDQG 3MLZL 1X5YA 3DX6B 1HDMA 3MJ9L 3A6BL 4OF3A 2VAAB 3NCCB 3CDCA 3EJYC 2VUOA 1AR2A 3FONA 3KPQB 3TV3H 1MCDA 2MKLC 3PJSA 5DQJA 4V1DD 4DVBB 4PJHE 5CKGA 3B9KD 4QO1A 4PJCB 5H94B 5L88L 2FJGB 1U3ZA 2P5EB 3FQRB 4XPFL 2ZCHL 3D2UA 4PJDE 1PW3A 2OP4L 1GYAA 4N0YL 4U1KA 5DUML 2YZ1A 4F7EA 4E41A 4YXLL 4F9PA 4J12A 1GGUA 1F4AA 2V9TA 4YWGL 3DUSA 5CINL 3NVQA 4BQCA 3O6ML 1IKNC 1PFCA 3MBEB 1GOHA 1N3NB 4ONGL 4U7MA 4Z77B 4HPYL 1CFQA 1N2RA 5IF0B 2GHWB 5C86A 5ALBH 3P9MA 3PWJA 4QRUA 5IJVA 5JDJA 3OGOE 2Q86B 4R90H 5CD5D 1FL6B 1JPSH 4OKVA 4JFEA 3VG9C 5E7BA 4P57B 4JM2B 4GUPA 1L4IA 2GITA 4NNXB 2APTA 4G8GE 3VXRD 1E27A 1MCCA 1N59A 5EC2A 4J3WA 5D93C 2DQFA 1LEGB 4P2QB 4OV5A 2GUOB 4FFZH 2W0KA 5F3BA 4I5BA 3VCLB 2L0DA 4JZNA 4NKDA 3DUHA 2ZOLB 5JO5A 2GQHA 3N1QC 4UU9B 4NZTL 1S7VB 5DQ9A 1FGVL 1UZ6E 4ERSL 1CGYA 5HDBE 4PRID 4NSKB 2OR9L 3HAEA 1UWEH 4LQ1A 5HI5D 4ZQKA 4XX1E 2H2PC 2YK1L 5F1IB 1A7QL 2VMFA 5T3XL 1MFCL 4OLWH 4L3AA 32C2B 3ALPA 3BJLA 5CEZL 6CGTA 4GQ9L 4LHUB 2HJFB 3HZMA 4ZS6C 4TQEH 4X6BB 1U58B 4P46D 4EI5D 1Z9SA 5D1QA 3WFEL 4EN3B 2JJTA 3EOAB 4WI5A 2A9MH 3SQOL 4TUOB 1L7IH 3OJDB 5GGTL 3H9YA 5FCSH 5BVPH 1SEQH 3IXTA 4H88L 4RAVA 1QRKA 2HKFH 2X4PB 4YBQC 4GKNB 3MLWL 5K9QI 2R15A 4BK4A 4D9QD 5CFHA 4GH7B 5ANMB 1DDHB 1I1RA 3OZ9H 1RJYB 1C08B 2OQJB 3O3BA 3U4AA 4IOIA 5GGUB 3T1WA 1JNLL 3B8SA 3D0LB 3U0PB 3LSOB 4NKOA 2AEQL 4TSBL 3W2DL 2EDOA 5C08D 4GAGH 5DJZB 3FQTA 1ZT7A 2ZOKA 1UM6H 4PLJC 3HRPA 5FM5O 4ZTOL 3MV11 3PF2A 5TQ0H 5GS0L 1JUFB 4OB5L 4WIQA 2X4NB 4YR6A 4K71C 2P24A 4QRPE 5SX5H 3A6OA 5FO7B 4G8EA 5SV3A 5CGMA 4GXUM 1LP9E 4YZFE 1HXMB 3LN5A 1CGSH 4XAWL 4D2NA 4APQD 5D6CA 5I8CA 4GG8A 1T1WB 2YOCA 1P7KA 1RV6X 4HUVB 3MMEA 4FQ2H 4CNIB 1OAZL 1KIRA 1T5XB 4OIIL 1G6RA 4YDKL 1DQDL 4PJFE 4ZUSA 5E24E 2QSVA 2NXYD 5TF0A 5KS9B 1EEZA 4FZ8H 1IILE 2R0WL 1X5JA 2X4UA 4MX7B 3PL6A 3P2TA 5C0CB 1JTTA 3IKCB 3S7GA 4PP2A 1T3FB 2GT9B 2BRQA 2VQTA 3GMOB 2WLZA 3CVIL 1FYTB 4LLWB 4HT1L 1TVBA 4CVZB 2Y06L 1KFAL 2WBWB 4KMTH 2N4IA 4TUJA 1I4FA 3ARBD 4GW1A 2QBWA 3MLTB 3I75A 4NQEE 1K2DB 4OD1L 4JZJB 1CBVL 2EE3A 3O6KL 4L3CA 3OWEA 3STLB 3GBML 3BEWB 4S1SL 5LCVL 2BY0A 4JKPH 5CUSH 4U3CA 1A4KA 1EMTH 3UP1A 5GS2H 5FUZL 5I1GL 3DO7A 3F7RA 4KZDH 2V9QA 3EJZC 1JPFA 2YA1A 1M7DB 3P0GB 4LGSB 2P47B 1U8KB 3KS0H 3QDMD 3HRZB 2VZVA 1DEEB 3HC0A 4ODXA 5FECA 3U6RB 1ODAA 3I6GB 2DQUL 4P23D 4Y2DC 3SGDI 3TNMB 3L3IB 3LKOB 3LKPA 3PXHA 3T09A 4EXKA 4HC1A 5ICXA 4P46B 1YJDC 4EI5B 2GY5A 1NCCL 4JVWA 3T0XA 3OKOA 2QSQA 4JQXA 3HNSL 4S1RL 5HDQL 3WYRA 2DQIL 2D7TH 2QR0B 1I8IB 5D71H 2BVTA 4U1MA 3C09C 3LKRB 2DQHH 5DJ0B 4UDUA 3TBWB 4S2SA 5F3HA 4QOKB 1J1PH 1S78C 5L0QC 1QSFA 3QEQA 4ELKA 4HEME 3IDMB 3U46A 3K74B 4WFED 2C7UB 4S1QL 5DD5L 3WUWG 4PJXF 1ZGLP 3STZB 5C8JB 4DK6A 5HD8C 2E9JA 4NQTA 2K1MA 3NH7L 1OP3K 4MS8D 3OKNB 3T2NH 3VXMA 3BO8B 2X05A 4HUXB 5J6HB 1YA5A 4FXGA 4DQOH 5LGJA 2DD8L 1HXYB 5KSUB 3RX8A 2YA0A 2BVOB 2IADB 5IESL 3QHFH 1C12A 1MCOH 1KB9K 4D0BA 1R3IH 4PRBA 1H8NA 4M6AA 3QNXB 2K3TA 5E4IA 5HHMB 1QTYT 2G60H 2DM4A 1IGCH 1ZLVH 1F4YH 2WNGA 4KY1H 3U4BH 3PGCA 4EUPB 4OD2A 4PJ7B 3F7YB 4J7RA 5CS7A 1OT2A 5IW6A 3V6FB 3SDDC 2ORBH 2EDDA 3OGCA 4OZ4B 2MQ0A 4MNQE 2UY7A 4X4MA 4XCCH 3QULA 2NXYB 4JHWH 2XPGB 5JOPD 5DO2D 4Y4HD 1ADQH 1XGUA 1H3TA 3VXSA 2P43B 1VFAB 4G80A 2ARJB 5FB8A 3T0AA 2VLKE 1A6ZA 1TCMA 1NAMH 5D7LE 1NUFA 3EDDA 4XPGH 2HJKA 3CIQA 3QIWB 1WEJL 3KPPB 3MLVL 1NGQL 4WFGD 3V5HB 1S7RA 3VFUA 1AD0A 3SDYH 4NCC1 2AXJA 4KQ3H 1VADB 4XPTL 3H42L 3PQYB 2OL3L 3KPSD 5DVLA 1H3UA 3DETD 4FQIH 4GO6B 3MJGX 4F9LC 1DTUA 2QADC 3S36L 4MVBD 4X6DA 5ID1B 4WUUB 3THML 2R2BB 3ULVE 3EDJA 4QWWC 3P0YH 1T0MB 3RTQA 3V0AC 3WFHB 1JP5A 4EBQL 2EECA 2VTFA 3OBAA 1E4XI 2V7NB 1IRAY 3MRPA 3VFSA 5FUOL 3HC4H 3ARDD 4HV8A 4L3EE 5IJKA 2NY4C 3FB7A 2A74A 1FCGA 1FO0A 1G9NH 3ARFB 1Q9WB 3SGKC 4ELMA 1JN6A 2OJEA 2FO1A 4XCNA 3WO3B 1EJOH 1C5DB 5EIIB 1K4CB 1T1XA 2ERJB 1CGUA 3MCG1 4XPAL 4JHZA 3GM8A 2R0LH 4GAJL 1UB5B 4JDVB 5EZOH 4CN6A 5TH2B 2FB4H 5KSBA 4DWHA 4IOFD 1MFDL 5B8CC 1T20B 1LK2B 5FDWA 1B6UA 1K8IA 4AG4H 2DB8A 2PTUA 3BRFA 3AUVA 4OZIA 2H3NA 4KPHH 4NZUL 1QBML 2EE6A 1EDQA 2YEZB 5SX4I 4M7ZB 4H25B 4PREB 1JWMB 5FGCB 1KLGA 1JRHL 4HW6A 1JNHB 3BUTA 1KNOA 4YBLC 3SY0A 3LPFA 1OCWL 2XZQH 3QG7L 3MJ6A 4KJPC 7FABL 2LU7A 4R0LC 3ILPA 3TNNA 3V4VH 4YX2H 2ARWA 4NZJA 3OPZL 4M6OL 1H5BC 4IIQB 1EPFA 3PV6A 4LU5L 3BT2L 3W9EA 2HTLC 3FJTA 1W0VA 3V0WH 4RWYL 5KW9L 5EUOF 2NY5C 3QPQC 1YQVH 3UTTD 3U9PH 3QQ9C 1WTGT 4F15B 3OL2A 3DX6A 1E28B 2VAAA 3HZKB 1EVTC 1TZGH 2YD1A 3DV4B 3AMLA 3D39B 3LQZB 4HIHB 4CDHA 4DVBA 4M8QB 5C9JB 3C5JB 2X1PA 3NPZB 4PJCA 5H94A 25C8L 4MNGE 4OF7A 2FJGA 2P5EA 2DQJH 3FQRA 4PD4J 3DNKA 4U0QB 1DANU 5KSAD 3GI9H 3SGJA 4FQXD 1MI5E 1NKOA 4DKAA 5ISZD 5IMOB 3VD9A 5HSFA 4LK4A 4AQ1B 3MBEA 1PKQE 1N3NA 5EO0A 4J1UA 3TZVA 3IDYB 5F7UA 4MD5B 4Z77A 4NUGH 5D7IB 5C0NC 5IF0A 4HWBL 1NPUA 4M1GH 1F4XH 4UB0L 4PJ9B 4OGYL 3RJDA 3CFCH 1GAFH 2Q86A 4KJWD 5BS0D 1EBPA 1FL6A 3O2VL 2APVA 3PWNB 5KN5B 4B7LA 4HK3J 4QRRB 5D9SB 4P57A 4JM2A 3K2UH 4NNXA 1HIMH 4HAGA 4K9EC 3INUL 1CU4L 1WV7T 3TO4D 4LEOB 1T7XA 4PG2C 2DICA 3MJ7B 3UYRH 4P2QA 1MJ8H 2GUOA 2XRAH 1YNLL 3UDWC 1IAIH 2Z92B 4LCCB 3VCLA 1EHAA 3SEPA 2ZOLA 2FJHB 2XTJE 3LB6D 3IDNB 4P48A 5D7SH 4UU9A 1RZKL 3ESVF 1KYOK 1S7VA 4XBGA 5SWZE 5DMJB 2HKHL 1S7QB 2OS7A 3VA2C 1HYSC 4NSKA 3RL1A 2M2DA 5E99L 1I7TB 2NX5D 3HZYB 2GI7A 1I1CA 1CYGA 4MJIE 1OAKH 5F1IA 1X5ZA 1YYLH 3KLHC 1I9JH 32C2A 5CBAA 1OP5K 3MR9B 4RMQA 1FH5L 4LHUA 4MQXC 1B90A 2HJFA 4P5TD 4NQCE 5C0AE 3T08A 1U58A 2G75B 1INQA 1H3GA 4X0KB 4EN3A 3MPCA 4XP6H 1DQJB 1SY6H 4F57H 2Z31B 2BK8A 4ZUWB 3DJ9A 3NTCL 2A77L 1HHKB 2X4PA 2JTDA 4GKNA 4M61B 5CILH 4WY7H 3H0TB 3I6LE 1P53A 5ANMA 1DDHA 3T0ED 1RJYA 1C08A 2OQJA 4MB5A 4JN2B 1UXWB 5GGUA 1FGNL 2CK2A 3D0LA 5BJTB 3LSOA 2VLJD 4BKLB 3NIGF 2UVEA 5C71A 3UTTB 3GM0A 2J88L 3M45A 5DJZA 3ZKXC 5K93A 5KAQF 1RFDL 4I77L 4V2BA 4DW2H 5TDNA 1JUFA 2FECI 3ZZ1A 2X4NA 1T80A 2AJVH 2EYRA 5HGBB 1LO3L 5I19L 3LD8B 1HXMA 2K9UA 2D4FA 2B1AH 1MIMH 4HWUA 5FOJA 1DJSA 5HHXH 1A7NL 1T1WA 1KULA 3FT2B 4OZFG 4HUVA 4FQXB 2Q87A 3D3VD 5FYJU 4CNIA 1OTTC 1CN4A 2OP4H 1T5XA 5HPOA 2NY7L 1OWWA 4M03A 2DMCA 5MP6H 2IBZX 3FZUD 5K59F 1TCRA 2YPKB 4OCRH 2Z0BA 3MODL 5GGVH 1XF3B 3FO0H 2ZKHH 1T21B 4KK6C 4OBSA 4Y19D 1BPVA 2YSSB 5KS9A 4IDJL 3K4DA 3WS6C 4MJ6B 2YMXH 3S34H 4MX7A 5C9KA 4ETYA 5GS1C 5C0CA 5I0ZA 4ZTPL 1I8MB 3IKCA 5T1KD 1T3FA 2GT9A 5DTFB 4GSDL 1JGLL 1G1CA 1NCAH 3GMOA 1EEYB 1FYTA 3DMMD 4LLWA 2VLRE 3MZGB 4CVZA 3ZYZA 2D7PA 4ZFGL 1A7BA 2H41A 1VERA 3MLTA 2EDJA 1K2DA 3NCJH 1UQSB 3F5WB 2PYFB 4G9FE 2X44D 2HRPL 4JZJA 1KF9B 1MAKA 1LO0L 5EO9B 1TJGL 3STLA 4LIQH 3LRHA 1F3JB 3LZFL 3O81A 2VDOH 3M17B 3BEWA 3IDGB 4C4KT 5TE6H 4PV8B 1OAQH 3LPWA 1IGJB 2RBLA 1FNSH 3P0VH 3MV9D 3V9FA 1XGTB 2AGJL 5L2JB 2CJUL 2BVQA 1Q9KB 4L1HA 4LRNH 3UPAA 1PX3A 5GRXG 3BX7C 4P3DB 4W70A 4TULL 1NCTA 1M7IB 3OAUL 4KJQC 4DUVA 3HE7B 4PRPB 1M7DA 3N85L 4LP5A 1W72L 4DJMA 1U8KA 1JGUH 4WW2B 1BAFL 3HRZA 5GRVL 4XWGL 1DEEA 2BX5A 3U6RA 1VPOL 3I6GA 2IMMA 3TNMA 5EOTB 3HPLB 4Q58C 3L3IA 3LKOA 2BFVH 4LPYA 1UEYA 5CWSB 4NJAL 4GAFB 4NBXB 2H8PB 4P5TB 4ONOA 3GSWB 4EI5A 4M4PA 1H3VA 2H32H 5T5NG 4P2RA 1CXLA 1DSFL 5EZIH 4Q2ZB 2IJ0C 4JG1L 3VFVB 3LMJH 5DD1H 4OLYH 2YD6A 1NEUA 2QR0A 1I8IA 4GFTB 2ZUYA 2A73A 2V7HB 5DJ0A 3TBWA 3WFDH 3MRHB 4QOKA 1OAYL 3LS5L 3F12B 3IDMA 4PJBE 2B1HL 4Z7WB 3CFJB 4GKSA 3STZA 5C8JA 4M43H 5IP4A 2VLJB 5AZEH 4UTAH 4NFDA 5TDPB 3QZWG 2VDML 2AABL 3OKNA 2I60H 3VXPB 3BO8A 5IQ9B 4HUXA 5J6HA 2WLYA 3VWKD 4OI8A 4KDTC 3U83A 5KSUA 2B7DT 5FYJE 2XY2A 3RZCB 3ZE2E 1OAXL 2BVOA 2RCSL 2PETA 2IADA 1Q9OB 3I3EA 4DN3H 3SDAC 1QNZL 1J11A 4K23L 2ENSA 3B9VA 3QNXA 1NAKL 3R06B 4CUCA 5HYIA 5DK3A 2CIIB 1HE7A 1AQDB 3HG1E 4JO4H 4Y4FD 5SV4A 4EUPA 4PJ7A 1JHTB 3ZDZF 1FIGL 3D3VB 3F7YA 2V6HA 3SBWA 2XQBH 1VCAA 3QDGE 4KRNA 3V6FA 4LCWD 4OZ4A 4XWOC 1RJLB 1IGFH 2QKIB 4R97C 3OAYK 4X6CE 2XPGA 4HJJH 2DLHA 3GJEB 1T2XA 2NQCA 1LDPL 1VFAA 3TYGL 8FABB 4OIAA 2ARJA 3VGAC 5KVMC 4EOWL 2YKLL 5LBSH 2GJ6D 1A6WH 2M26A 1EXUB 3F8UB 2P1YA 3KPPA 3QIWA 4NP4H 4HIEB 3LQAH 1RZFL 2FGZA 3V5HA 1YNTA 4H20L 1C5CL 3JWOL 2Q3ZA 5GRYA 4AEIH 3JXAA 1UYWH 4POZD 1VADA 3PQYA 1DBJL 3MREB 5IVZB 3MOBL 4MCZB 1NGXA 1YEJH 1A1NB 1VFMA 5ID1A 1KELH 4WUUA 1DQML 2R2BA 4Q0XL 4O2EB 1FP5A 1T0MA 2DLEA 3WFHA 3N0PB 5D6DA 1FV1B 2V7NA 2AW2A 2IG2H 3B5TA 4YHOL 2JCCF 3C6SB 2FGWH 3ARFA 5E2UH 1Q9WA 1S7SA 5EOQH 5IEHB 3BKJH 2ADFH 4XCFH 2BXYA 5EIIA 1KN4H 4PB0L 2IAND 5A2KH 4AY0A 1UB5A 4JDVA 4PJGE 2B5IC 5TH2A 1FQ9C 3W5NA 2ZUQB 1T20A 1LK2A 1N6QL 5JIKA 1BREA 2DIJA 1RZJC 2G2RB 3BPOB 3PWPE 4JKWA 3QA3B 4KVNL 4OBRA 4PJEE 2A9NL 2YEZA 4HFUL 1U6AL 3B9AA 3K2MC 4F7MB 2VE6B 5LG1A 1DBKH 4H25A 4PREA 1JWMA 2JIXD 15C8L 5JA9A 1JNHA 1Q0YL 1UM4L 5I1JH 3RDTA 1DBML 3KPMB 3G6AB 4HC1H 4ODWB 5HHOB 3WIIL 4PP1D 4GS7C 2OZ4H 4MZ2A 4N68A 3FO1B 1OARL 1UM5H 5GRUL 4IIQA 1JGEB 3LY6A 4JKKA 2F8OA 1U41A 3NN8B 4J2XA 1DEDA 1I9EA 3DHJA 4GRLC 4JFHE 2BY3A 4TRPL 5L2KE 2AJYH 3FMGL 5K9OB 1GC1H 1E28A 4F2MB 2Y07L 3SKJH 3WNLA 5ENWB 4L8CB 2X09A 3HZKA 2LVCA 3ULUF 2VDPH 3DV4A 5IFAH 3LQZA 3D39A 4HIHA 4Q9CA 4DVRL 5LWYL 5C9JA 3C5JA 1J8HE 2MWCA 1AH1A 2Y5TB 4JPKL 4P3CL 3AS2A 1HI6B 5GGQL 5I16B 3GRWA 3E8UL 1E4XL 4FOMA 3CCHB 3VG9B 4U31A 1HH6B 3U30C 1OPGL 1I1AC 2DKSA 4LQFH 5IMOA 4MA1C 3DGGB 2VXQH 1F11B 5B21A 5D7KD 5D93B 4P9ML 4N0UE 5DS8B 4ODBD 1CE6B 4OTXL 3ZL4H 5INDB 3IFLL 4Z76B 1LD9A 4MD5A 5D7IA 4QY8B 3QCTH 1UA6L 3S35X 1MREH 2FHBA 4Y5XC 2OM5A 3GHEL 2F58L 4GAYB 4PJ9A 4DN4H 3UAJD 5C0RL 2Q7NA 4NIKB 3PWNA 4S1DC 5KN5A 4QRRA 5D9SA 1BECA 3FOLB 3HE6D 1QLEH 1BM3L 5ETUA 2P8PB 4LEOA 5JIHA 3MJ7A 5DFWH 1C1EL 3UTPD 2Z92A 2IBGA 4LCCA 4X6DF 1HWHB 4JM4L 1FVEB 3VXUB 1KIQA 2FJHA 3EFFB 2FJFB 3IDNA 1QSEB 5F9WC 3KPRE 2EDQA 4IJ3C 3WN5C 3CZFB 5C09D 4FQLH 3TPKA 2NYYC 1S7QA 2DQGH 2IANB 4R2GD 1NLDL 2R29L 1NMAL 4XNZC 4P3WA 4OZHB 4ELMF 1I7TA 3HZYA 1J9CT 4FFVC 5F1KC 4ODUB 3OB8A 2P45B 1M05B 2E6JA 4P99A 1IKFH 2XKSA 2PCPB 1FG9C 4TTDC 4NGHL 1DCLA 3VXQB 3MR9A 2F54B 3BN9C 4QRSB 5TE7H 5KSBF 4LRIC 3VMPA 4L4JA 2VABB 1YEHH 4JO3H 1JYVA 5DHVB 2FHFA 4FQCH 4CMHC 4DZBB 4HQQL 4W6YB 1DQJA 1BVZA 2DDQL 2Z31A 1S3KH 5AUMB 4ZUWA 3R0NA 4UT7L 4OZIF 2PTTA 2XN9B 1A14H 4K71B 1CR9H 1HHKA 2O5ZL 4Y5VB 5F93C 3MGTB 4XCEA 5JXAL 1X5KA 4M61A 4MD0B 4H1LH 3H0TA 1KCUL 5FM5M 3KNBB 3HCVB 5EORL 5IB5B 3U0TB 1BWMA 1MCBA 1D7FA 1UZ8B 1KJ2B 1BVKB 4Z7VE 3ZTJG 5GZOC 1ZHBA 4JN2A 5M7QA 1UXWA 5AWNH 1FC2D 2HP4A 1FLTX 4BKLA 4YXHH 3MJ9A 4DKFH 2DI7A 3RA7L 2VO5A 1EV2E 1WWBX 5I1LB 4BZYA 2YPVL 3WSQH 1B4JH 3DXAE 1XMWA 1IGIH 2WAHA 4OFKA 5F96L 5C0BD 1WZMA 4WI3A 1N4XL 1RZ8B 3EKCA 4NRXB 4I9WE 2YBRA 1A6VH 4N8VB 4LVHC 3IJHB 1AD9B 1WBZB 3I50L 4MDJB 4HG4K 5JZ7C 2F19H 3FT2A 1MCWW 4XZUB 4JO1H 4TVPD 1MCPL 1TLKA 2PO6C 4AMKH 3NA4A 1K6QH 2EC8A 5I17B 2YPKA 2FBJH 4RBPK 3LIZL 1XF3A 1T21A 4FP8H 1T22B 3LH2L 2YSSA 1GSMA 4P2CG 2IGFH 4KK9D 4MJ6A 4E0RB 4MXQC 3C87A 4MXVE 1I8MA 4Y2OA 4MYWB 4Y7MA 1DBBL 5DTFA 5EU3B 4BFGA 3CX5J 4X7SH 1EEYA 4TTGA 2CGRL 2KQNA 4Z95H 3HTLX 4IDLA 2D3VA 3BKMH 1FN4A 4FMFA 3V4PL 3UTQB 1UQSA 3F5WA 2PYFA 4FG6C 4NZRH 4Y2DB 4ODHL 4LSQL 3BWUC 5EO9A 4JM2F 4DGYH 1F3JA 3H3BC 2BY1A 3VI3E 3M17A 3IDGA 4PV8A 4PRNB 4NN5C 4FN0A 1XGTA 1CL7I 4WI2A 5L2JA 3NACL 4JE4B 4P3DA 1P4IH 1IFHL 4JPIB 1G9MC 3CVHL 1RZJL 3K3QA 1M7IA 2C9AA 1RZ7L 3HE7A 3C09B 1A7PL 4PRPA 5K33A 3TBVB 1L7TH 5T3ZH 1X7QB 4TSAL 4WW2A 4Q9BA 4JR9L 3FB5B 3SCMA 1IAOB 5L0QB 3WNNA 3ULVL 2DJUA 3X13B 5EOTA 2ID5A 3E3QE 1MFNA 1I3GL 3EOBB 2E3VA 4MAUH 3S97C 3T04D 2FECL 1TMCB 5JW4N 5CWSA 3VE0A 3MACH 2H8PA 4P5TA 1NFDB 2LABA 3MV7D 3RWFB 1MFAL 1YEGL 3ARRA 5FO9B 4OQTL 4Q2ZA 3VFVA 1I9IH 2I9LB 3EJJX 4KTEL 2AKRB 3WKNA 5E2WH 4YEFA 1P7QD 2CUHA 3GBNL 4HFWB 2V7HA 1LEKB 4O51B 5HJ3B 1KCSL 3C60D 3H9SE 3EFDH 4N90E 3X12B 4HWEH 3F12A 4Z7WA 1JL8A 3SE9H 4Z78B 5TDPA 3SDDB 1NSNL 2AK1L 4ALAH 4WI4A 3WKML 4Z7QE 5IQ9A 3FT4B 3U0WL 3D85B 4FHBD 1HSAB 4NDMB 4U1IB 3UCRA 3WXVL 5E8OB 3RZCA 5E4EC 5A16B 5IB1B 2QQLL 1Q9OA 5IG7B 1VA9A 4XNYH 1MVFA 1HINL 5LKNA 3PWVB 4J3OC 5HDLA 3DROA 2XACC 2CIIA 3EYVB 1AQDA 1E6OL 1UWXH 2VXSH 2VYRE 2PYEA 1JHTA 1NL0L 3D3VA 5GISL 3O4LE 3V52L 3BQUC 3BDYL 1RJLA 1V7NH 1YEFL 2QKIA 1MEXH 2OJZL 5A43C 5C07D 4TVPH 4JO2L 3I84A 4P2OC 3GJEA 4K94C 4N8CH 8FABA 4GRWE 3GJFK 1RIVH 5DK2B 5JR1L 4FA8A 3MFGB 2X89A 1ZS8B 1EXUA 3VDAA 4JJHA 5EZJB 4HIEA 5KS9F 2NY4B 2VXVL 4DEPC 2F15A 5C2BL 3WJJC 1HCFX 4UIKH 4W4OA 2AI0L 4X99B 4RGND 3SJVE 3UZEA 3MREA 3EZJB 5IVZA 5E6ID 5IW1B 1CG9B 4QGYA 3MV8A 4MCZA 1DR9A 1A1NA 3QPXL 3O3EB 2W38A 3OF6A 1B6DA 2WBJC 3FFDB 1FFQA 4O2EA 1AR1C 5B8CB 1S7UA 1FV1A 4QNPF 5KVGH 1FL5A 5C7XH 5JXED 4LSPH 1MFEL 2PXYD 4MDIB 1DVFD 1HHJB 1IEHA 1QVOB 1KN2H 1FLRL 2QQNL 3C6SA 4KHXL 5D7JC 1W72B 3MLXL 4UT6L 1G7PB 5DI8B 2OYPA 1QRNB 4UV4H 4OLZH 2J4WH 4E5XB 1SQ2N 3QWQB 2CD0A 4YBLB 5D1ZD 3RNKB 1MRFH 4C55A 2APWA 2X1QA 4KI5D 4R0LB 1R24B 2HN7B 5E2VH 5GJSL 12E8L 1CGWA 1H5BB 3EO1B 3C8HA 3G5YB 4X7CC 2DKMA 3GHBL 2LV4A 2G2RA 3QI9C 2QSCH 4K7PH 3QA3A 5JHLL 3LPGA 1P7QB 3NFPB 4YO0A 1CICC 4F7MA 2X2YA 2VE6A 3W81A 2XZCH 3C60B 2UWEB 1DLFH 4OFDA 2WUCL 3MQIA 3KPMA 3G6AA 4ODWA 3KHOA 4MAYC 1A3LL 5HHOA 2XZAL 1KCVH 1KJ3H 4D94A 2LQRA 3FO1A 5J6GB 5FIEA 2XFXB 2B4CL 4Y4KC 3NN8A 5KOMC 1L9NA 3GKWH 4LOUC 2BOCB 2X70B 4G6FD 1PQZB 2O5XH 5K9OA 1IKNA 3FB8B 1JI1A 4O9HH 4F2MA 2XG5A 4L8CA 3IVKB 5HI3C 1JI2A 1MJUH 5FHBL 3STBA 4HUNB 4TNWF 1QYGL 4PJ8C 2Y5TA 3G5ZA 1MPAL 3OKKB 3O8XD 4G9DA 1NAKH 4X8XA 1HI6A 5I16A 3HA0A 4G7VL 2EDTA 3TWCH 5IFHH 4Q9RL 3CCHA 1HH6A 3VRLF 1CLCA 2BRRH 4C56E 4PJ7F 1AE6H 2Z4QB 3DGGA 1X44A 1F11A 4LLUB 4PJHB 1WUNT 3QYCA 3OR6B 5DS8A 2XV6B 4Z76A 4G3YL 43C9B 1Z6JT 4XTRC 2X9XA 4PPTA 5E2TL 4YHPB 4MJ5B 4PJDB 1RUML 2E9WA 1FNLA 4MA7H 3U9UB 4GAYA 4XB8A 1Z5LB 2VC2H 3M07A 5CSBA 3BIKB 2CO7B 3CSYB 1NANH 1I8KB 4KQ4H 4G6AD 5A2LH 3FOLA 4DGVL 2I26N 1G9ML 4BH8B 2FYYA 3TA3C 3ILQC 3O2DL 2P8PA 3HR6A 3WV0A 5CIPB 3P4NB 4ZO6A 4ZO7A 1ORSB 3WS3B 5MENE 1FVEA 3VXUA 1WAAA 5HYJE 4ZOCA 3QDAA 3EFFA 4X7TB 2FJFA 4BSVB 2B0SH 1QSEA 3D5OF 2ZG3A 2CDEB 2E7HA 3CZFA 4G8GB 4GKZA 2X4RB 2Q20A 2GCYB 3R4DA 3U82B 2F53E 1TENA 5F9DC 5E8DH 3IT8D 2FX9H 2VDLH 1A7OL 3DVGA 4O4YH 1AHWB 2CQVA 2MPAH 4ODUA 1M05A 4HZAA 3Q3GB 2PCPA 4Z9KB 4ONFL 3VXQA 2ZSVB 2X4QB 2F54A 5BZDB 3KGRA 4QRSA 2VABA 3ZKXB 1TIUA 4DZBA 2LAAA 3QG6B 5AUMA 3SPVB 5C3TA 1Q1JL 3LEVL 2WQRA 2XN9A 2AV1B 3TCXA 2DL2A 3MGTA 1LO4L 4LPTA 1CDIA 3TJHC 3PABB 3H8NA 3KNBA 3HCVA 1ZLSL 4DOHE 3S5LG 1IQWL 4V1DE 3U0TA 5IB5A 3ROOA 1UZ8A 1KJ2A 3REVB 3UPRB 4E42B 1TTFA 2L4OA 4OSUH 5IHUH 2Z9TA 2DQTL 4BJLA 2UYLB 1OGAD 4PRDB 5GSRA 4YQXL 5KJRH 1RZ8A 3TC9A 3MA9L 3WFCH 3MLYH 4NRXA 5ICZB 3KJ6L 5GS1B 4Z7UA 2R39A 4N8VA 5T33L 5AD0B 1H8SA 2JF1A 4DVRH 3IJHA 1AD9A 1WBZA 4MDJA 4ODVL 4F58L 2V17H 4R4NC 1J0IA 3BISA 4XZUA 1B0RA 1EO8L 4B53A 5J11C 2C1OB 1OLLA 3FB6B 3KLSA 4P4KC 3JV6B 4QRPB 5I17A 4R9HA 2YUXA 1ZA3B 4CKVX 5FYJL 5C0IB 1FNGA 1ZA6B 3L3GB 1T22A 3ZMRA 4HWBA 3IDIB 2MCPH 1HNGA 5A40E 4GBXD 4H0HB 3Q6FB 4WEMB 2NMSA 1JTOA 5B3JF 4D0DB 4HKBB 5D5ME 3D9AH 1ZEAL 3CZJA 4P9HH 5EU3A 4JFPA 2Z8RA 4PJFB 4W4NA 3CMOH 4WDIA 3QUXC 3WIHH 4LLAA 4YXKL 2D03H 3NABH 2CLZB 4PBXA 4ZFOL 3KDMA 3MNVB 3UTQA 4HMEA 1GOGA 4H8WL 4Y2DA 5ERWB 3O6FD 4JFXB 5F21B 4PRIE 3UTOA 4KUZL 3VRJB 1RULL 3ARGC 4HS6B 4LP4A 2FHCA 2O5YL 4ENEC 2P7TA 1A6TB 4NQEB 2E6QA 5JOFB 3IFOA 4JPIA 3JWNC 4RZCB 2D9CA 1UENA 1ETZB 2GY7B 1A7RL 4WNQB 4RGOH 3TBVA 4QLRA 1X7QA 2CK0L 5GRWA 4YHNA 3FB5A 1IAOA 4Y8AA 2NXZC 5I1KH 2ZWLT 1MWAH 2V5TA 3EOBA 1F6LL 5E9DB 3OX8B 2IPKB 3QCVL 4L3ED 4D9QE 1OLZA 1OGTA 1NFDA 4X83A 3L3HA 3RWFA 4TSCH 4YK4C 3QUZD 5FO9A 3VDCA 2D7NA 1OHQA 3T2QA 1T6WA 4QRQB 2VDNL 1BGXL 2I9LA 1D3CA 2AKRA 4I3RL 3ALWA 1FNAA 2VZTA 1S5IH 4URTB 4PJXE 5C08E 3VW3L 3MXVH 4HFWA 2XNAA 3H3PL 3SDAB 3O41B 1LEKA 4O51A 5HJ3A 2OR8A 1ACYH 1V05A 4NHUB 1PJ9A 4MQ7B 2XA8H 1MCLA 5EO1B 4DTGH 2C3XA 2BCKA 4KHTH 3X12A 5J56B 2Q7YB 1BBDL 1OSZB 4M1CC 2CRIA 4D0CB 1CQKA 3KYNB 3X11B 2QHRH 4KKCC 3TH3T 4JGJA 4Z78A 1WT5C 3SDDA 2W9DL 4L4VE 3EYQD 5D2LF 4XPBH 3FT4A 2QQKL 1FPTL 4XGZB 3VRIB 4LDEB 3D85A 4R97B 1FBIH 1HSAA 3BZFB 4NDMA 1P2CB 4U1IA 4P5MB 3LRGA 5E8OA 2NR6C 3S37X 4KTDL 4XPHH 5A16A 5IB1A 1EGJL 2L7UA 2X40A 3E3QC 3VGAB 5IG7A 3PWUB 3PWVA 1AJ7H 5I1IL 4H5SB 2A6KB 4WWKD 1RQ5A 4GMTL 3EYVA 5C6TL 3EBAA 2E7MA 5IBLC 3KPOB 1MIEH 3HMWH 1QFHA 3EDEA 1OQOA 1ZXQA 4F9LA 1CL7L 1R3LB 1R3HB 1IM9B 1ZLVK 4OGAD 4R8WH 1J8KA 5C92A 1D6EB 2EEDA 5CJXC 2AXGB 3MCKB 1ZOXA 4M5YH 5DK2A 2EZ0D 4F80A 3QH3B 3QIBC 4NQVB 1ZS8A 4HS8H 5EZJA 3QHZL 3MNWB 4MNQB 3F7QA 3SGKA 4WGWB 1XIWD 2UUDK 3BWAB 4X99A 1XF4B 5BCAA 3AREC 5ABDE 3QXAB 4NNYB 5IW1A 1CG9A 4OAWB 2VLKB 5D7LB 4ODTL 3O3EA 3V95A 2B5IB 2V5YA 3FFDA 5ESAB 3ECBB 3KXFB 4KAQL 1TNMA 3NCYP 2JJUA 2ZUXA 4HBCL 5B8CA 1L6XA 4NFCA 2HTKD 5LXGH 1OSPH 4XC1H 5TQ2H 5E94B 4MDIA 5CP7B 1HHJA 1RUAL 1QVOA 4L5FL 5JW4M 2QTEA 1G7PA 5DI8A 1QRNA 5KZCD 4E5XA 1FORL 2HH0H 3CVHH 4XMPL 3R8QA 2EC9T 3RNKA 4JRWA 5CGYD 1H15B 1BBJB 3BD3A 3AS3A 3B2UC 4U7SA 1H3WM 4R0LA 5IB2B 4GS7B 4L3EB 4G7YL 4K3DL 3OKYA 2HN7A 3PV7A 1IARB 2XTJD 3P40A 1MFBH 3U1SH 5GS3A 5F6HJ 4MHHG 1H5BA 3EO1A 3G9AB 2BNUB 3G5YA 4WFEE 5SWZD 4LSUH 4JDTL 4GRLB 4GJTB 4QTIL 2AEPH 1I1YB 5D1XD 3REWB 3G6JF 4MLSA 3NFPA 2IQ9L 3H6JA 1CIDA 3C60A 5FYLH 5C0DB 1XGPB 2UWEA 1C5BL 4UNVA 3H7BB 1WBYB 3QFDB 2DWDB 2GFBB 1Y6NR 3MRDA 1KPUB 3IS1X 5EUOE 4LPUA 3E0GA 4HCRA 3L5XH 3RWDB 2XT1B 4TYUA 4NQCD 3T4AA 5J6GA 3SE3C 3U30B 2XFXA 1I1AB 4Z7WF 2HT2D 4TPRH 2BOCA 2D7OA 2X70A 4D3CH 1B88A 1PQZA 1JHKL 1A5FL 1IEAB 5DURB 1OF2B 3FB8A 3V6ZA 3IVKA 1KUMA 3I6LD 3TFKC 3DSFH 1CDCA 1CE1L 3KYAA 1LGVA 5F71A 1HILB 2V2XB 4M1DL 2WINB 2CKBA 5DR5H 2R2CA 1Q9LA 3OKKA 1UH4A 2WIMA 2ZPKL 3TBSB 4NQDE 4L8BB 5DFTA 4UQ2A 1LQSR 3QEGH 2ZCLL 4YHKH 4ORGB 2VUYA 4D8PB 3B3IB 2UY6A 4L4TA 3BGAA 3OB0K 5J06A 1IGYA 3KPSE 4LLUA 4PJHA 4UBDD 4PG2A 3OR6A 4MNGB 5B4MC 3FRUB 4FQPA 1I7UB 2ICWI 3UDWA 1YUHA 4YHPA 5D72L 1V7ML 3K7UA 2VDKL 4MJ5A 4PJDA 4U6XB 3U9UA 5JMRA 3WN5B 4IJ3B 3HMXA 1Z5LA 2DBLH 1MI5B 3BIKA 3CSYA 4KROC 3QDJD 4ZD3H 4JQIH 2V5RA 2ZUWA 1PKQB 2DQEL 3RWEB 3RX5A 1RVFH 4Z7OF 2BNRE 4YE4H 3S6CA 1UCBH 3QT2A 4WTZA 1MY5A 5K9JL 5CIPA 1GGBL 1CZ8L 3P4NA 5L9DH 5C0EB 2AEWA 1H0DB 3V6BR 8CGTA 3WS3A 5F7LB 5CLWA 4X7TA 1JWUB 4BSVA 1MFEH 1P4BL 2CDEA 4CMHB 4U05A 4G8GA 3VFWA 3CSBA 2X4RA 1NDGA 4KHXH 2GCYA 4G9FD 1OP5H 2GEEA 2JJWA 2CUMA 4YDIL 2EIEA 1XZ0B 4J4PA 2DS4A 1QHPA 3ULSA 4YGAB 1AHWA 4KRPC 2VR4A 3Q3GA 2XTJB 3BSZL 2MCG1 4KRLB 2ZZUT 2VQ1B 2ZSVA 5I8KL 2VXUH 5SWZB 2X4QA 3DYPA 4BM7A 5BZDA 2IFFL 4OCYH 4OM1L 4OFYD 4K3JH 5I1HH 3O0RL 4ZOAA 3QG6A 3UC0H 1LILA 2E27L 5BVJB 2X1XR 1YDPB 3SPVA 4MJIB 3GEWB 4BUGA 3OKEB 2AV1A 1SM3H 3L7FB 4EZMA 1T83C 3EOYG 3NIGE 4RMTA 1SYVB 3PABA 4D9LL 4PLJD 1N64H 5C0AB 4NQCB 1CGTA 3QUKA 2A1WH 2GK0B 3REVA 5F7NC 3UPRA 5FOBA 1QBLH 43CAB 2YPLD 5KAQG 5FCUH 5E8PB 3CXHK 4O02H 3TIEB 3RU8H 1GHFH 4PRDA 4XP1H 3Q2CA 1KG0B 3MOAL 3MC0A 3FAWA 5ISZE 2DQDL 4JVUA 3WS6A 2EH7L 2VQUA 3LEXA 3V2AR 5ICZA 3W5MA 5CMAA 5GS1A 3HI6L 5AD0A 1SBSH 4KXZH 5K59E 1MPAH 4E41E 4L8DB 5ALCH 3U7WH 4MNHB 4MA3B 3QUYD 2NLJB 4PYGA 2C1OA 5HPMB 3B8YA 3FB6A 1JPGA 2FX7L 1CK0H 1A6UH 4UV7H 5BS0E 5FYJD 4MHHI 3JV6A 4QRPA 5AAMA 1ZA6A 3L3GA 1IT9H 4LIQE 3EGSA 4RFEB 3IDIA 3T0BA 2QHLA 4X7EC 1IJ9A 1X5AA 4NN5B 5DD3L 3Q6FA 5DZNA 5H8DA 4XVJH 1T7WA 4XBEH 3CK0L 3HG1D 4D0DA 3B9KC 4HKBA 4NWTL 2AXFB 2VKWA 4NT6B 1U3JA 4JFEE 3BJ91 3IDXH 3C5ZD 4FNLH 4AEEA 4PJFA 4CDGC 2K7PA 1Z9LA 3MLUH 2CLZA 5KSVB 3MNVA 5IB4B 5ERWA 4JFXA 2DIBA 3U48A 3VRJA 1U8MB 4U6VH 2NX5E 1PEWA 5E5MB 4HS6A 2AJXL 4JVPA 2XIDA 2VLRB 2JB6B 1LHZA 5FF6B 1F58L 2Z93B 4RWHA 1A6TA 4NQEA 4B41A 5CD5C 5JOFA 4K7FB 4G9FB 4M7JH 1ERNA 1WAAF 1CF8L 2HWZL 1ETZA 3ZDYF 4WNQA 4ZFFB 2J6EL 1JHLL 3VFMB 1JGVH 3HAEG 3K80A 3MLSH 4GOSA 1TJIH 2DTMH 5DJAB 4OF0A 3N9GL 4ZO8A 5T1LD 5FO8B 4J3SA 5E9DA 3OX8A 2IPKA 5CHNB 5AZ2H 1CD0A 4PGBB 5DQDH 3SOBH 3V0VB 3C08H 3T0EE 4LSRH 3TH2T 3UO1L 3EO9L 1SYSB 4KDTA 2A38A 5TE4H 1F8TH 5DZOA 4XP5H 5T5NF 1IAII 5E4EB 1YNKH 3SDAA 3O41A 2EE9A 2NY6D 4NHUA 4LPVA 4MQ7A 3V7AE 5HI5C 5ILTH 5BMFH 5EO1A 5J1SC 2Q7YA 4AM0B 1OSZA 4YUEL 2CLVA 3F58H 4D0CA 2XYCA 3X11A 3MUJA 3QISA 1FDLH 3CFEB 1RURL 4JN1L 4P46C 3BQUB 4EI5C 4OF5A 4F7CB 3RX7A 1CXHA 3QUMB 1T66D 3VRIA 1QZ1A 3BZFA 1P2CA 3TV3L 4P2OB 4P5MA 1BIHA 5LGHH 4NC1E 3ZDZE 4PJBB 5CSZB 4M4RA 1BJMA 4I18C 3PWUA 1OD7A 4Y19E 2A6KA 4PJAE 1KJ2H 5I6XB 3OAYH 3GB7B 5JPMB 4TN9A 3QUYB 4Z7UF 3KPOA 3D0VB 2FNBA 1RU9H 3UTSD 1R3LA 1R3HA 4HH9A 1IM9A 5HYFA 1FL3B 4WHYH 2WBJB 3MRBB 2G9HB 5EOCJ 1D6EA 3VGBA 2AXGA 1J8HD 3MCKA 3ME0A 3HG1B 4NUJB 3KVQA 4M7LT 4NQVA 3X3GH 4R3SB 4JRXD 5ALBL 1ND0B 4JANA 3VXTB 4APQC 3QDGB 1IE5A 4R90L 2AERT 1HHGB 5D7JB 3MNWA 4ZPTB 5KANG 4MNQA 2Y6SD 1JPSL 4ZFOB 3SDCD 4UINH 2CKNA 2W60B 3BWAA 4X6CB 1XF4A 4YAQB 3BZDA 5C1MB 4NNYA 2Q76B 3V4UH 2JCCE 3NOIA 4OAWA 5DWUH 2VLKA 4EVNA 4NBYB 5D7LA 4ZNEE 1TETH 1LEIB 2NXYC 3ECBA 3KXFA 1SMAA 3M1BB 4FFZL 4PD4K 5EU6D 3JV0A 4HIJB 5KVEH 1ZGLM 2IH3B 5E94A 5I30H 3QI9B 2IAMD 1JZ7A 1FZMA 3JTTB 4U7KA 5FM8A 4M6NH 2IH1B 1CICB 4K3GA 1U3HD 2HFGH 3JWDC 4Z0BH 1RI8A 4NQSB 3ARBC 2YS4A 5JW5B 1UWEL 3WJLC 2HMID 3CU7A 3DX8B 3OG6B 3L3OB 1H15A 2H6PB 1BBJA 4HPOH 4MAYB 4MB4A 4DKEL 5IB2A 5JHDD 2ICES 4OM0H 2VZ1A 2IBBA 4OLWL 5I18H 1YJDH 1X5LA 3K8LA 4OQTA 2CDGB 3KPRD 4TQEL 2FEDD 2BNUA 4Y4KB 1K3IA 4GRLA 2A9ML 1I1YA 3R1GH 1L7IL 3REWA 2CXGA 4S0SD 5BVPL 1SEQL 1BGXH 4PJGB 3UZQA 2HKFL 5C0DA 4MXWH 1XGPA 5CJ5A 5JUEH 4ISVB 1S7XB 2XKNB 1WBYA 3H7BA 3QFDA 4OFIA 2DWDA 2GFBA 3OZ9L 1KPUA 4I2XA 2AEIT 3FT3B 5F7FA 2NW2A 5GGRY 3RWDA 1YEEH 5IK3B 2GAZB 4XBPB 4XH2B 3PWPB 4PJEB 2XXMB 1ONQB 1MHEB 5J1TC 2YN3A 1DN0B 4MQTB 3N1FC 4GAGL 1I1AA 3DPBA 1WCQA 3TN0D 1UM6L 3T3MF 3W9DB 1J1OH 4QTHB 5CJOH 2PW1A 3ARSA 4JRYA 5TQ0L 4QYOB 3RVXD 4XXDB 1OF2A 5HYQB 4LCWE 3L9RA 4HBQA 4O5LH 2CPCA 1QLFB 2V2TB 5I8EB 3IETB 2NY0B 1Z0NA 5I1DB 1CGSL 4JY5H 1HILA 2V2XA 4YIQB 2WINA 4Y5XA 2P5WD 3MYJB 1F2XK 2I5YH 4PRAB 1NCNA 4F3FB 5L2KB 2GJ6E 2R4SH 4CU8A 3TBSA 4L8BA 1D9KD 4FQ2L 3SE4C 4MS8C 4AH2B 4ORGA 3OKMB 4D8PA 3B3IA 3TA3B 3G6DH 1GGCH 3LEYH 1J8HB 4MNGA 4R6UA 4FZ8L 1I7UA 2W07A 5DMGD 1NFIB 1QPPA 2IFGA 5H2BB 1IL1B 5MERA 4LLQB 2F5BH 4U6XA 1N5YH 3WN5A 2ILLA 2FATH 1MI5A 3SKUD 3GSRB 4TUKH 2YC1B 1RUPH 1WCBB 4KMTL 3FN0H 2ZG2A 4OGXH 4XVUD 4PLKD 4N0UB 3HPJB 1PKQA 5EPMB 3RWEA 4X6DE 5T5FH 3CJJA 4KKLD 4LSVH 2CLRB 5SWSD 5HI4D 3V6OC 5DO2C 4Y4HC 3HS0B 5C0EA 1H0DA 4JKPL 5CUSL 4JLRB 2C3VB 4ZOEA 2BNQD 4JPVH 4Y5YC 3GMLB 5IHLB 1KEGH 4TNVF 1EMTL 2X42A 3BOVA 3TBYB 4JQVC 2V9RA 4LRIA 3PGFH 1JWUA 2AP2A 4OFVA 4ELME 3S35H 4KZDL 3BH9B 1Y18B 2R23B 4WUKH 3DETC 2R1YB 2YRLA 1XZ0A 5F1NA 3S8WA 4MVBC 1D6VH 2C5DC 2XICA 2ADGB 5EN2B 3OXSB 1E4KC 5FFLA 3KPRB 2VQ1A 3BDXA 5SWZA 4K8RD 1GCFA 5CEXA 1FRGH 3ARDC 2AQ2A 1SJVA 4RCAA 4I4WB 4N9GB 5C0GB 1PG7X 4G6JH 2D7TL 4QTIH 4A6YB 5F6IB 5D71L 5BVJA 1G7QB 1QFOA 1YDPA 4CVWA 2DQHL 4MJIA 4OCWH 5EFIB 3L7FA 5KANI 4AIZB 1M6OB 2EDKA 4F37K 1J1PL 1SYVA 4XCYB 3MUGB 1NJ9B 1T2QH 5C0AA 4NQCA 4IOFC 3CU1A 2GK0A 2UWEF 5EA0H 3BP5B 2FBOJ 1ZHLB 5J11B 2NY5H 43CAA 4JREC 5E8PA 3T2NL 4P4KB 1XF1A 4LNRB 2PO6A 4N5ED 5EG6C 1G0DA 3TIEA 1QFUH 1WIUA 4DQOL 1U8IB 5JA8B 1ZLWK 5F7HA 2DLTA 3VFPB 1DN2A 1KG0A 3QHFL 5I71B 1MCOL 1R3IL 4N90D 2G60L 1IGCL 5D7KE 35C8H 1I9RH 1FG2B 3CDGB 4HCRH 1F4YL 1J0HA 3RWIB 4KY1L 3U4BL 1G0YR 2IWGA 3LHPH 1EFXA 5ITFB 2ADJB 3FRPA 4RBPH 1IGMH 1GZQB 2MQ3A 1G7LB 4OCSH 4KK6D 4R4BA 1AIFB 1D9KB 3GIZH 4L8DA 3DXAB 4TOYH 4MNHA 1JF6A 2ORBL 2BSRB 3QUXB 2NLJA 3W82A 3UJIH 5HPMA 1TZIB 3QIUD 2QL1A 2DI9A 4G42B 4XCCL 3B5HA 4XNUH 4JHWL 2ZCLH 1LO2H 1LVEA 4FQQB 1ADQL 1KENH 2ED7A 3EYUH 3O2WH 4DAGH 3BZEB 4IRSD 4RFEA 3ARGB 1NAML 4I8DA 2CKBH 4XPGL 5F7YC 1BLNB 2EXWD 2AXFA 4U1JB 4MA8H 4NT6A 4WFHD 4M3JA 2Z8SA 3SDYL 2OTWB 2RQ8A 4KQ3L 1MH5B 3DX7A 3F7VB 5KSAC 1DE4B 4K9EH 3L7EB 4FQIL 1OP9A 3MRQB 2EDHA 3ZKMD 4FQXC 5KSVA 2R0ZH 3FFCA 4P5KB 3K81A 3VD3A 5IB4A 5C09E 2EDNA 5DXWA 5EOCH 3P0YL 1KIPB 2FO4B 1BJ8A 5MEQB 1QD0A 3JSSA 3GSNH 2NY1D 4MD4B 1U8MA 1SEBB 2RGSA 3AFLA 3UJJH 2FSEB 5E5MA 3CH1B 1XGYH 3HC4L 5AEAA 4EQ3A 3HMXH 1KC5H 5E08H 2VLRA 4YK4B 4PS4H 3T8XB 4UILH 2JB6A 1NH6A 1CD1B 5FF6A 5IHZB 1G9NL 2Z93A 1RMFL 3SJVD 4F7PB 3I9GH 4KJWC 4K7FA 1XR9B 5FHAH 1EJOL 1RSFA 1QBBA 3ARUA 2DYPB 4ZFFA 5I66A 4ZXBD 1X5FA 4HGWB 3VFMA 2Q8BH 1SJHB 3BI9X 2R0LL 5EZOL 5DJAA 3BYTA 2FB4L 4JHAH 2YZ8A 4L29B 4NOFA 3TO4C 2ATKB 3SKMB 4BSJA 5FO8A 4AZ8A 2QSTA 1J0KA 5CHNA 2RJMA 3I02B 4AG4L 4PGBA 3GDBA 3V0VA 1F4WH 1ZSDA 4LHUG 2OMNA 3LB6C 4KPHL 2HAZA 2IFFH 1Z9MA 2CSPA 1SYSA 2BVUA 4K8RH 3Q5TA 5HGDB 1NC4D 5HDBF 5J89A 4KUCD 2XZQL 4R26H 4UDTB 3V8CA 4PGZA 4WI7A 3MROB 1FCCA 3V4VL 4HXBH 3FQXB 2CRMA 4YX2L 4AM0A 3P9LB 5TPWH 3AXLB 4P5TC 4YH6A 3V0WL 1F00I 3BQUA 3NAAH 3BH8B 5KVFH 4F7CA 1YQVL 2HFTA 2E9IA 3U9PL 3OKLB 3QUMA 3AMKA 3KR3H 1BQHB 4TVPE 3H9SB 4P2OA 1TZGL 1M4KA 1R0AH 4PJBA 5CSZA 5GHWH 5TFSH 5L6YH 1H3PH 1LK3H 5DJ8B 5GIRB 2NY2D 3T0EC 2DQJL 1MLBB 5D8JH 3FQWB 3WJJA 3GB7A 5JPMA 3MSPA 1K8DB 5DJ2B 3QUYA 5CJ8A 1KT2B 3GI9L 3IB4A 3GJFH 3QIUB 3PGDB 3AREB 3CNKA 3D0VA 4UMGA 5EU7C 4RAUB 2A0LD 1FL3A 3BPNC 2WBJA 4BQBA 3MRBA 3RNQB 2BVEA 2G9HA 2X6MA 4NCC2 2Q8AH 1UWXK 2KQMA 3Q0HA 3HLAB 4NUGL 2VSCA 1KLUB 3HG1A 1X6LA 3H2WA 4NUJA 1DZBA 4R3SA 3TVMD 3VXTA 1ND0A 1F4XL 1GIGH 4LARH 3P11H 3QDGA 5DD3H 2X9YA 1GAFL 3AS0A 3CFCL 3O4LB 5B3NA 1BHGA 4N0FB 5D7JA 4ZPTA 4ZFOA 4U6YB 5IMMB 4EDWH 4KDVA 4C56D 2W60A 2X7LB 4X6CA 4BFIB 4QNPE 4YAQA 3K2UL 1HIML 3CXDH 2DMBA 2Q76A 4GRWB 4NC1C 3FZUC 4PJFF 1YECH 1IGTB 3KYKH 5HYSB 2VNCA 2G5BB 3OJ2C 5DSCB 4EIZC 1XCTB 5I15H 1LEIA 3UYRL 3M1BA 1CVRA 1MJ8L 2XRAL 1IAIL 1FFPB 4NOBA 4HIJA 1G7JB 4PRHA 5D7SL 4B50A 3SJVB 4R7DB 3QI9A 5IVXF 5J9PB 4NN7B 3JTTA 3DMMC 4N1HB 2IH1A 1CICA 5IM7B 4NQSA 5IFJA 5JW5A 3MRJB 5FM4A 3SKOB 3PNWB 3MRKA 3DX8A 1OAKL 2H6PA 2WUBH 1FNEB 4U1HB 2EKJA 4MAYA 1YYLL 3SDXE 5MEND 3D69B 4E9LA 1I9JL 2APFA 5HYJD 3T0VA 4P2RE 3BIAX 2CDGA 4Y4KA 1NLBH 2WIIB 4XP6L 1SY6L 2A6DB 4F57L 5E8NB 2F53D 3JUYA 3WLWD 3EYFB 1OTSD 1ITCA 4YFEA 4ISVA 5CILL 1S7XA 1AXIB 3CFBB 4WY7L 4PJ8A 4QHUB 3QAZC 3FT3A 3WEXB 1TITA 4UT9H 3CDYA 3WXWH 5B22A 4M9OA 5IK3A 2GAZA 4XBPA 3PWPA 4Y1AD 4PJEA 1ONQA 1MHEA 5ICYB 2DAVA 2EXYD 4OLVH 1DN0A 4U2ZA 1YYMH 4UAOB 3W9DA 1BD2D 3IAGC 4QTHA 1EGJA 4DW2L 3ARQA 4QYOA 4XXDA 5HYQA 1BFVH 1AQKH 3TYFB 4RA0C 1QLFA 2AJVL 3QWRA 2V2TA 1NC2D 3F62A 4FQJH 3IETA 4OD3H 4PLOB 3VRLE 5C07E 1KTRL 5I1DA 4YIQA 2YWZA 1VSCA 2B1AL 5F9AC 1MIML 3BE1H 2OR7A 3MYJA 1NCWH 5HHXL 4PRAA 4F3FA 3B83A 5L2KA 4HJ0D 1RK1B 4KROB 3UYPA 4EUPG 4RNRB 3VH8B 1BZQK 4ZFZB 1GC1C 1T6VN 3O4OC 3RL2B 5MP6L 4AH2A 3OKMA 4OCRL 1BZ9A 4K2UH 5GGVL 2HT4D 2KKQA 3FO0L 2ZKHL 4RGNE 1E4WH 3TA3A 3VWKC 5HGHB 2WP3O 5F1OB 5DFVD 1C7SA 2YMXL 1NFIA 3S34L 2FL5B 5H2BA 2IC2A 1IL1A 1Z9OA 5DEFB 4LLQA 4MMXC 1NCAL 3O9WD 5ACMA 4TNWK 2NZ9D 3K8MA 1T5WB 2NZIA 1MHPH 3PQYE 4Y4FC 3GSRA 4C56B 1RIHH 4JPWH 2YC1A 1KTKE 1WCBA 4MSWB 1IC7H 3TBTB 1IQDB 2FD6H 3HPJA 4N0UA 5EPMA 4JFFD 3NCJL 2IEPA 4WUUE 1P84J 2CLRA 3NIDF 4KRPB 3WFBH 4Q74A 1RK0B 4JFDD 4LIQL 3HS0A 2VDOL 5TE6L 1SMOA 4O58H 4JLRA 1OAQL 2C3VA 5GS2D 4K3EH 3GMLA 5L8LB 1FNSL 3P0VL 1DLHB 4KI5E 2XWTB 3MRMA 3R0MA 4JCMA 5CEYA 4LRNL 1GJIA 3MRNA 3BH9A 1KBGH 5IGXH 4POZC 2R23A 4FZEH 5BV7H 4NN6C 2R1YA 1JGUL 1CFVH 4PV9B 4PIRF 4JFOB 1FJ1B 3FAXA 4OT1H 3WHXB 5MENB 2ADGA 2BFVL 1VDGA 2JELH 5EN2A 5HYJB 3CX5K 3GK8H 1JJUA 1A1OB 4U3HA 4DKEH 3GMQB 2AK4D 4M62H 1QFWH 5EZIL 4RRPA 3LMJL 4EDXB 2F53B 1XAUA 4PJ5D 5DD1L 1QA9B 4OLYL 1R5WB 3DI2B 4I4WA 5C0GA 2NTSP 4X9IA 3RY4A 4A6YA 3RAJH 1G7QA 1I1FB 5EFIA 5DGRA 4R4FH 1WGOA 2ZCKH 4ZUVB 4HUWB 3WFDL 4AIZA 1M6OA 2VWEE 2VL5B 4XCYA 1I7RB 5INCB 3MUGA 1J5OH 1UKQA 2AJSH 1OTUD 4M43L 2HA1A 5AZEL 4UTAL 3BP5A 4GW5B 1BF2A 3BEVB 3FOMB 1LE5B 1CT8B 2I60L 4HK3N 4P4KA 3S4SB 4GLRH 3UBXB 4WO4D 1YEIH 1A3RH 1U8IA 4KFZC 1X5HA 4ZAKD 3O3DB 3VFPA 4DN3L 2X10A 3TO2B 4DOHB 3UTZB 2C1PA 2GTZB 3P4LA 4V1DB 4YHMH 1UWGH 1FG2A 4Y5VC 3B9KB 1FFNB 3RWIA 2MTPA 1T7VA 3JV4A 4I0PD 5ITFA 2ADJA 4JO4L 2J12B 4PP1C 1GZQA 1G7LA 5ESVB 4L4VD 1D9KA 4GRMB 2XQBL 3DXAA 3IFPB 3T3PE 3QUXA 2BSRA 1C16B 5DEGB 1IGFL 5ID0B 1J10A 3CFDB 4G42A 5DLMH 5B3JE 4MXQD 3FHAA 2DQCH 1IC5H 4FQQA 4HJJL 2LU3A 1ZAGA 3B6SB 1T89C 4QF1B 2XTLA 1N0XH 3BZEA 3ARGA 4Y16D 1MQKH 1L0QA 1B2WH 5LBSL 1A6WL 5D4QA 4NP4L 3O9WB 1BLNA 5L7XH 5FK9B 3LQAL 2YD3A 4U1JA 3N1GC 3S88H 1JF5A 3RGVD 1J12A 2OTWA 4HX1B 4AEIL 1UYWL 1CD8A 1MH5A 5FKAB 4CJ1A 2GTWB 3F7VA 4HZLB 3WD5H 1HWGB 1YN7B 1DE4A 3L7EA 1U2HA 3MRQA 4NCDA 1NMBL 2QV2A 4P5KA 3VFTB 3VXRB 1YEJL 1KELL 1AKJD 3IYLW 1KIPA 2FO4A 5MEQA 5D5MB 4ODSH 4EXPX 1L9MA 2IG2L 1SEBA 2FSEA 2CMRH 3LKNB 1T03H 1KTDB 1XCQA 3T8XA 1CD1A 5IHZA 2FGWL 3QO1B 5E2UL 5EOQL 3BKJL 4F7PA 2ADFL 3UAJC 5CCKH 4XCFL 1XR9A 2EEBA 5CGTA 2LTQC 1ZVHA 3VWJD 1EERB 1KN4L 2Z8WC 3O6LL 2DYPA 3Q1SH 4HHAA 4PRIB 5SWQB 3HE6C 5FV1L 4HGWA 3ARTA 3AC0A 4QHKI 4WU7B 1K85A 4L29A 4X80H 2ATKA 3SKMA 1NANI 4KVCH 3C6LD 4X9FA 3I02A 1WT5A 1HSBB 1RZKC 1MCRA 1AXTL 3SO3B 1BWWA 1MCJA 5BQ7B 5JMOC 1P5UA 3U4EB 4OZGA 2J8OA 1DBKL 3HC3L 5HGDA 4R2GC 1YMMD 3TH4T 1CGXA 2D31B 1REIA 4XMKH 4I18B 5I1JL 1OGAE 5IEKB 4UDTA 4HC1L 2EDBA 1Q72H 5D2LE 3MROA 5J12C 1PAMA 4KMQA 2BJMH 2OZ4L 1RIUH 3FQXA 3W0WD 5DC4B 1UM5L 3WUZA 3PIQA 4RISH 4EI6B 2R56H 5CAYB 4FTVD 4PJXB 5I74C 3QXWA 3TPUB 1BJ1H 5C08B 3BH8A 2AJYL 3HUJF 5CD3B 4HMDA 3OKLA 2I9TB 1GC1L 1BQHA 4LVOC 1HOCB 3SKJL 3H9SA 2E7CA 2VDPL 4LCIH 5CJXA 3BRDA 4ZUUB 5IFAL 3VFOB 4KWUA 5BO1H 3QIBA 4GXVH 5DJ8A 4APQB 5GIRA 1MLBA 4L4VB 1KPRB 3FQWA 4NO0D 1A4JA 1K8DA 1IC1A 5DJ2A 1KT2A 4HKXB 1F45A 4JG0H 3PGDA 3AREA 4LQFL 2VXQL 3B2VH 4RAUA 1NAMB 5IQ7H 3ZLQC 2OI9B 3RNQA 4Y16B 3ZL4L 3G04A 1FIEA 3HLAA 2UUDH 1J05B 2BVYA 3QCTL 4ZO9A 3S37H 1MREL 4WEUD 5DJDB 7CGTA 3TT3H 1J1XH 1R6VA 1J0YA 3KHQA 4NQDD 2BXZA 3O4LA 4DN4L 4N0FA 2APBA 1A9BA 4J23A 5I2IB 1DFBH 1FYHB 2ICCA 3MO1A 5IMMA 1INEH 2ESVD 4U0RC 2X7LA 3ARBB 3LS4H 4BFIA 4XMLH 1WFUA 4PTTB 1QLEL 4UOW1 4YC2C 1B0GB 1EZVY 1IGTA 3RWCB 1U8PB 5HYSA 2APXA 2G5BA 5DSCA 3K46A 1XCTA 2IPUG 3Q5OA 5J57B 4X7FC 1S9VB 2WWKO 4H0IA 4KK9C 3JTSB 1FFPA 5DUPH 2OTUB 3MOQA 3LN9A 3EHBD 2X4OB 4R7DA 1MAMH 1CFTB 1A9EB 1WZ1H 4LLMB 4FQLL 3E2HC 1PZ5B 1HKFA 1RMFH 2DQGL 3CLEH 2BNRD 2X9WA 3UZVB 3RY5A 5IM7A 2J3SA 3WHE1 3QDMB 4YHLH 1GVIA 3PNWA 1IKFL 4P23B 1FNEA 4U1HA 4UQ3B 2H26B 2WQ8A 1I3VA 2PUQT 3G6JE 3GIVB 1WICA 4RAHA 3RPKA 1MNUH 3SE3A 1IAIM 3PP3K 5TE7L 2R69H 5GGRB 1ZTXH 5IT2H 4Z0XB 1YEHL 4JO3L 2IPUK 1UKSA 1X3DA 5LGKA 4FQCL 2WIIA 2A6DA 3QCUH 1T7YA 1S3KL 3EYFA 2CO6B 3HB3D 4PY8J 1A14L 2HVJB 1CR9L 2B2XH 4JKLA 2ZP0T 1S9XB 3WBDA 1NCBH 4X98B 3QFJD 4DCQB 4K7PY 4QHUA 3WEXA 1BIIA 2FEEI 5AWNL 1X4YA 4YXHL 4DKFL 3DVIA 2VL4A 1N7ML 3OR7B 1DQQB 4YPGB 3WSQL 1B4JL 4H0GA 1IGIL 1JGDB 3LRSB 4IMLB 3TYFA 1KB5B 5EUOB 1U8JB 3KPQA 4HS3B 3C60C 1A6VL 3QNZB 5GRZA 3QQ4B 1MOEA 3C2AH 2PYEE 4BQ8A 1YPZF 4PJBF 3OB0H 2F19L 3FO9B 2EO9A 1RK1A 1MF2H 2YD5A 3DLQR 4JO1L 1PD6A 1VENA 4RNRA 5JW4R 2A6JB 3GI8H 4ZFZA 3VH8A 2R9HD 4C57C 3QUMH 3KYMB 4AMKL 1K6QL 1BOGB 1MRDH 1AY1H 2FBJL 4K94H 5FYKH 3BKYH 1RHHB 4FP8L 5HGHA 4RX4A 2OLDA 1A02N 4Y4HB 4NKMB 1P69B 2MKWA 1SVCP 2IGFL 4BK5A 4WVRA 2BC4B 3VFGH 3D2UD 4Y5YB 2FL5A 3HFMH 4KKBD 4NQDB 1WC7B 1IZJA 4E41D 4WU5B 2YD8A 5B38B 5DD0H 1TNNA 3PE9A 4X7SL 4DFHA 4C56A 4NWUH 4Z95L 4U1NB 4MSWA 3T2PA 1TZHB 3BKML 3MV8E 3TBTA 5GXBB 3KPSB 1IQDA 3IAPA 3MLPA 1BOYA 4NZRL 4OLEA 4M5ZH 1U93B 5J1AB 4QXUH 4X6CF 1RK0A 4DGYL 1JYNA 3GNMH 1KXQE 1LEGA 1DQLH 4JFED 1Z3GH 4YFDB 1DLHA 2XWTA 3ARDB 4H26B 4YDLC 1S9WB 3JWOC 1SBBA 2D7MA 1UXSB 5C6WH 2BNRB 1JF1B 1P4IL 3RUGF 4XNXH 1KGCD 1RPQA 3N50A 3T65B 4RGNC 4UI2A 1L7TL 4CU6A 5T3ZL 4X6FB 5E6IC 4AEFA 1T83A 2X41A 4PV9A 3NFNB 4JFOA 1FJ1A 4CRPA 3WHXA 4ONHB 1CXKA 4MAUL 3U7YH 3MACL 1A1OA 1K4DB 3RI5K 5JXEC 4FFWD 3QXDB 4JREB 2PXYC 2ZJSH 3MRFB 4EDXA 1I9IL 1SJEB 2F53A 3KG5A 4HIIB 4X6BA 3AS1A 1QA9A 1R5WA 5E2WL 5DUBB 4NRYB 2MFNA 4XI5D 3EOAA 5J7CC 5EB9A 4TUOA 4A2MA 4BYHA 3OJDA 5ITBH 4ZUVA 1IC4H 4HUWA 1ZHKB 5D1ZC 4U49A 3EFDL 2VL5A 3BXNB 4J4PC 4HWEL 4L9DA 1F90H 1RZIB 5I76B 1I7RA 2GSGB 4KI5C 1AHWC 5D1QD 2FIRT 3SE9L 4NKIH 1RUQH 1WSST 3BEVA 3FOMA 3PDOB 1LE5A 4ALAL 1CT8A 4UTBH 1W0YT 3U0PA 2F5AH 3S4SA 3UBXA 4UNTA 4I0KA 4PJEF 3MRGB 3ABZA 1BZ7B 2XOTA 1CLOH 3O3DA 2J8UE 3KJ4C 3TO2A 4XNYL 2R2EB 2GTZA 4V1DA 2A83B 1INDH 4JB9H 3B9KA 5FO7A 3N06B 5F8QC 4NNPH 1MHHB 4J6RH 2VXSL 1OM3H 3MNZB 5ESVA 4GRMA 1U8NB 5KSAB 4LKCB 1VGEH 4S11A 1N26A 1C16A 5DEGA 4X5WB 3RBSA 4CN4A 5ID0A 1V7NL 5ISZB 1PZUB 3CFDA 1MEXL 4B5EA 2O61B 3QDJE 1DUZB 4TVPL 4WJ5B 2COQA 2VWEC 5HY9B 3B6SA 4AJ0A 2JJSC 4LEXH 4LAQH 4N8CL 1ACZA 4QF1A 1PX4A 1JZ2A 1RIVL 1T2JA 3KAAA 2W0LA 4IM8A 4WI8A 3ZE1F 3ESUF 4E41B 1VEMA 5FK9A 2VZSA 3Q6GH 3GSQB 3G08B 3S36X 3O8XC 4UIKL 4NC2B 5BS0B 2R4RH 2GTWA 4HZLA 4OKDA 1B4RA 1YN7A 5T1DH 1F6FB 1N2RB 4QCIB 3VFTA 3VXRA 1OQXA 3PL6D 4UUJB 5IJVB 3TO4B 2OSLB 5D5MA 1R3KB 1EK3A 3ZYOA 3TGXA 1WAAE 4JFEB 5KVGL 5C7XL 5JNYB 6FABH 4LSPL 4P9HC 4W68A 1PYWB 3LKNA 1KTDA 4GUPB 1UJ3C 2AJUH 1KN2L 4JFQB 1NGZB 3QHTC 4UV4L 1WFOA 2NXZD 4OLZL 1J87A 2J4WL 2WMPA 4JZNB 4G6AC 4M93C 4PRIA 2YUZA 5SWQA 1WFNA 3QRGH 1MRFL 3ZKSD 3EZ8A 4FFYH 2NX5B 3ZKNC 1AGCB 4BZ1H 2H32B 4OJFH 5DQ9B 5H37H 5E2VL 1RY7B 1MCSA 1O7SA 4ACPA 2NY3D 3L5JA 1F3DJ 1HSBA 5GPRA 4P46A 2QSCL 3MLRH 5BQ7A 4K7PL 4J3TA 4WHDA 4OI7A 4HULB 3U4EA 2BZDA 2YPLE 2YRZA 1VEPA 2XZCL 3HAEH 3VGEA 1DLFL 3VGGA 4I18A 3LKRA 3HZMB 3S3PA 4N1CA 1IAKB 2Y36H 4X4YB 1KCVL 3T0EB 1KJ3L 3HI1B 2C7UA 4LVEA 4EI6A 4PUBH 1F13A 3GKWL 4PJXA 3TPUA 4J3VA 3VXOB 5C08A 1I3RB 1NCDH 4A6YH 2O5XL 3A6CH 4WEBH 5CD3A 1CDBA 3BPNB 2I9TA 4O9HL 1HOCA 1QSFD 3QEQD 3MRIB 1HXYA 1MJUL 3N1PC 4ZUUA 5FA3B 4Z7UE 3VFOA 4WHYG 2EDEA 2BDNH 5E1HB 5DMYA 1F6AB 4APQA 4OCXH 1T0NB 1DUYB 4N8VG 1YN6B 3VXMD 1EBAA 3ULUD 1KPRA 4NFBA 3TWCL 1UB6B 5IFHL 1L0XA 4PBVC 5TF1H 2PF6A 2R0KH 2X1WL 1ADQA 4NO3B 2BRRL 4U33A 1AE6L 4AIOA 1NAMA 4OLUH 4Y19B 2DMKA 1TXKA 4Y16A 3RVVD 4PJAB 1FSKC 3GBLA 4MA7L 3HNVH 3CFIC 5DJDA 5T1KB 2VC2L 1HZHH 3DMMB 5I2IA 3V79C 2WW8A 1PLGH 5DA0B 2CDFB 4KQ4L 3VXSD 1G6RH 3ARBA 3WJLA 1T1YB 4PTTA 2BERA 4M7KH 2FR4B 5FA4B 2VLLB 3RWCA 4KXZI 1NMBH 1U8PA 4W6XB 2GJZB 2BHZA 1S9VA 3VG0H 5EIQA 4PFEA 4GBXC 3JTSA 2OTUA 1GH7A 4WTXA 1H8OA 3I75B 2B0SL 3MV9B 3KLDA 2X4OA 4IRZH 3HR5B 1CFTA 1AGFB 4M48H 1A9EA 4LLMA 4LSSH 3ET9F 1PGRB 4L3CB 2JCCB 1PZ5A 3IDUA 1P9MC 2RFXB 3RTQD