1CFSA

Anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-unrelated peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
214
structure length
214
Chain Sequence
b'DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPSRFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN))
publication title Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity.
pubmed doi rcsb
molecule tags Polyspecificity
total genus 44
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1999-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfsA01
4MJ5B 2Q7NA 4ZS7H 4CMHB 3HHRB 3BMVA 4NO2A 3PL6D 3VWKC 2V2WB 1MEXL 4S10A 3SGDI 4OZGA 5IV2B 4MNQD 1MUJA 3VFSB 3OKMB 3RX7A 1IT9H 3FKUS 5JNYB 2FR4B 4PRNB 4ELKB 1BZ9B 1GGTA 2HT3D 1OSPL 3D18A 4OLUH 3FOMA 1KBGL 5DFWH 5EOQL 5EU7C 4JO2L 4PJIB 3DMMB 1N3NA 1A1NA 1I1RA 1AO7A 4KTEH 1P7KB 4K7PY 4Z7VB 1CDYA 2E27H 1PJ9A 4YGAB 3MLUH 5K9QG 4HPOL 1C7SA 1K9TA 3BEVB 1PZ5A 3IYLW 4WFGE 2P43B 3F12B 1CICA 1VFAA 1HKLH 4PJCF 2Z31C 2H41A 5MEPB 5LGHH 4WDIB 4ODHL 4I2XE 4D94A 3UZVB 5EUOF 3MRJA 1BD2D 3LKOA 4BSVA 2H2SC 3QQ3B 3OR7B 4FXLA 1JPFB 1BM3L 4FP8L 4NQDD 2OYPA 3W2DL 5B8CA 4XC3H 1JHKH 3VDBA 4N8VB 1TCMA 2CRZA 5EU6B 4XPBH 2JCCF 1Z5LA 1GGIL 2BSTB 4U1GB 3BFOA 2EYSB 2M1KA 1UT9A 3IDYC 5IVXA 4H25A 1BQSA 1JV5B 3QUXD 3VE0B 2O5ZH 2GTWA 1CLOL 1ZLVK 4PJGB 2BY1A 3V2AR 4GS7C 4AJ0A 3I84A 3B2UD 1GXEA 3SDCB 5EOTB 1EJOH 3G04A 4U1LB 3BP4B 4J4PC 4J1UB 2YK1H 3H9HB 1ZTXL 2AI0L 1AKJB 4D9RE 3OHXA 4QHUA 1I8KA 3OGCA 4U1KB 4KVCH 3WDIA 4DFIA 2XQBH 4WVRA 3A67L 3DSFH 4X80H 5I73C 2EEBA 3K4AA 3MUHL 4KK5C 4AIZA 2HJLB 5ERWA 1MAMH 1NBYB 4NO0D 4YE4H 3RHWF 4GKNA 5EZJA 2CRMA 3SKJH 2Q8BH 5DTFA 5HDQL 1Z0MA 4JGMA 2ZUSA 3FRPA 4P9ML 1MSPA 2VXUH 2OTUA 2DLEA 2VDLL 3X13A 3C5ZB 4PTTB 1BMGA 4YXHL 5IGXL 4C56E 5I8OL 2YBRA 4RQQA 4KI5C 2ED9A 2EH7H 2PNDA 5GSRB 4FMKA 1JF6A 2FB4L 1C16A 2ESVA 2XIDA 2C1OA 4BFIA 3DYOA 1F3JB 3MV9B 1OGTB 4NM4H 1T2QH 1L9NA 4O00A 3UTZA 1XMWA 3AREA 3BP5A 3U4EB 5D1XC 2F8OA 3D0LB 5D1QD 3GO1H 4QRPE 4E0RB 2EZ0D 4ZNEE 4Z7VE 3LEXB 3M07A 4NHCH 4YAQA 2DQGL 3P2TA 5DK3A 3MRHB 5HVFB 4UV4L 5C09E 2FZ3A 4PB9H 2E7LC 1WICA 1A7RH 2NY4C 4OI8A 4DK3A 3MCG1 3I3BA 4UI2A 1DQQB 2NR6C 4NQEB 3QPQD 4M43L 1I1AC 4LAJH 1T7YA 3WDHA 1DBKL 5IB5B 3I50L 2FEDC 3DGGA 4NC1E 3V4UH 4NNPH 1BPVA 4OTXH 5DD5L 5EU6E 3TJHD 1MCSA 3N06B 5C07B 1HILB 4PRHD 1JCKA 5I66A 4K2UL 3JWOH 5FDWA 3Q1SH 1NAMB 2BNUB 1XR9B 3TJEL 4EQ2A 2UUDH 2DLIA 5HHNB 4FABH 1S7UA 1CQYA 4HDIA 1YNTA 4NHUA 4P48A 2XZQL 5L2KE 5D2NB 3JSSA 1YMHB 3JWOC 3SE9L 4PJFF 1S7RB 3S5LB 3HCVA 4KPHH 4XP5L 4HF5L 4KTYA 5F7NC 3RI5K 1OSZB 1CU4L 1X7QA 2BY2A 3AUVA 3M8OH 5HHPA 3BZEA 1QEWB 2ORBH 3DURA 3MRLB 1JZ5A 4Y4KC 3OKDB 2IH1A 1LO5B 3NCCB 4I13B 1M7DA 1D5MA 2YS4A 4CMMA 5M7QA 1M7XA 1S5IL 3ALPA 4HIJB 4XMLL 4ZUUA 1SY6H 5ENWA 1RULH 3ARDD 1D5BA 3IFOB 1DEEB 1GGCL 2EO1A 3G08B 4G9FA 5E03A 4V1DE 5L8JB 1A7OH 2HTLC 2ZUUA 4TULH 1OLLA 4Y5VB 3AB0B 2FJHA 3DUSA 4XC1H 3CD4A 3QCUH 2VABA 2BVPB 3BKJL 2XQYK 5D70H 2NY7L 4LCCC 5F1SA 2I27N 3GMRB 4K3EL 4N8CL 4L3AA 4GXVL 5KSBB 5D7SH 3V6ZA 1QFPA 3RFZC 3QCVL 1FNGA 2AXJA 5I17B 5E2JA 1OGAD 2VDKH 2VRAA 3WIFB 2EXWC 3IB4A 3U7YL 1UACH 3UTTE 1DANT 3EYVA 4BKLB 1A7NH 4W68A 3O6FB 1AGDA 3VFVA 5HI4D 4NQEE 1CD1B 2EDYA 2PYEE 3UBXA 2DQJH 4FQQB 3P30H 5CLWA 1OAXH 4NQSA 4IJ3C 2X44D 3FTGB 4ZOBA 5C07E 5HPOA 2N7AA 1WFTA 3GBMH 1FP5A 4G6AD 4L8CA 1IGJA 5DD0L 3GIZH 2AJ3A 1U8NB 3IVKB 4I9WE 1OW0C 5FB8A 3IDIA 2C3VA 5LAXA 3HE7D 2G2RB 4ZDHA 3THML 1ZANL 4JJHA 3W9EA 4YPGA 2YUVA 2HFGL 1UH4A 3MXWL 4L8SC 3UYRH 3PABA 4MNGB 1ORQB 2WINA 3ARSA 1SQ2N 1HXMB 1CVRA 1F90H 4FTVA 4X83A 3GMOA 1NGYB 3WD5L 5ALBL 2R0ZL 4TN9A 2YXMA 1FIGL 2MPAL 3GJFA 4JO4H 1TJHL 3VGDA 4Y88A 4LEXH 4DGVL 5J9PA 2BVTA 1CXEA 3CFJB 4MCZA 1FGVL 4TUJA 2Z4QA 3C09C 4LVOB 4K23L 4FXGA 3X3GL 5HYQB 5C9JB 3ARXA 2A0LD 2W0FB 1PD6A 1ZHKB 4K71C 4P46C 2C26A 4HFUL 3QWRA 4HH9B 5JPMA 3TESA 5E2WH 2CMRL 4M9PA 2WUCH 3MLXH 4X4XB 4WW1A 2VLLB 5DMIH 1IQWH 4LBEA 5DRXB 3TA3B 1KB9J 1Y0LA 3GUTA 4J3VA 1RUKH 2DKMA 3B9KD 1OTUD 2YSSA 2BHYA 5FHBH 3NA9H 4OJFH 1T20A 3FFCB 3QO1B 4RGNB 4XTRC 4UDTB 2ADGA 3WJJA 1KV3A 3NPZB 5CHNB 1G6VK 4M4RA 4ZFFB 2H45A 3PWJB 3DLQR 1PEZA 4ZAKD 1H5BB 1URLA 1W0VA 3HG1E 1MCFA 1YPZF 3VXNA 1HK6A 5C0AB 3BIKB 4ZXBB 3HI5L 1QP1A 2V9QA 4MAYA 4UT9H 3A6BH 3SEPA 4YXKL 1OY3B 4I0CC 1SVCP 1E6JH 5GJSH 1QBLH 4Z7WF 3QIBB 3B2VH 5DK0A 4PJ9A 3RAJH 4LU5L 4S0SD 5GS2D 3IFNH 3TO2B 3F58L 1MFCH 2J88H 4L4TD 4MNHA 5F93C 4QWWD 1PQZB 2O61A 4IBLT 1ZGLA 5EN2A 4LNRB 1N64L 1HZHL 4TSCL 3OG6B 1S9YB 3TNNB 4PJHB 1G0YR 3D2UA 3MJ7A 4O51A 4G42A 2ZG3A 1NBZA 1RY7B 2Y4SA 3UTSB 1RVFL 1NCUA 1LGVA 2XQYG 3RP1A 1EV2E 2H2PD 4PGDB 4Y19D 3U4AA 5I1LA 1MPAH 4KKAD 4PJ7A 1WT5C 3QJFA 3E2HC 3MA9H 1H3PL 4ZOEA 2PYFA 5D7JA 2H1PH 5I1HH 4J8RA 2YPLD 1RJLB 2OTPA 2BSSA 2Y7QB 4HIHB 1QUNA 4HUKB 5E08H 1C12A 1BFTA 1S7VB 2CD0A 3ZE0E 3GSXB 3CUPB 1HSBA 1MY7A 3VFMB 2CQVA 3ULSB 3RZCD 3L1OH 4XP9L 1QSFE 1IAIH 4JG0H 3EGSA 4MX7B 5ALCH 2R69H 3VFGL 4U1IB 2VXVL 1QSED 4JLRB 1N26A 4DJMA 4UV7H 3RWFA 3V6OC 2VSCA 1E4XL 5SV4A 4LLQB 1RK1B 4XB8A 3SDDB 1GHFL 4HHAB 3FFCE 3HTLX 4HGWB 4OM1H 3SJVA 5T3XH 2QBWA 5FO8B 4X6CB 4JFPA 4RGNE 4Z7OE 3U0WH 3RJQB 2HN7B 4L4VD 1U95B 5EBLB 5KVEL 5CZVH 4PP2A 2AJYL 3GM8A 5TDOA 4LCWE 3FB6A 4Z7QF 4TVPH 1R3JA 1OAQL 3LN5B 2KZWA 5C0AE 5GRVK 3QEHA 1FSKC 3OX8B 2X89A 1GC1C 3CJJA 5ID0B 2R1XA 4OLYL 3FQTB 5CUSL 2YD9A 3GSNL 1FGNL 4XCNB 4YGVB 5LGKA 3W9DA 4YPJA 4JDZA 1A6WL 2FSEA 4FFYL 1MREH 3EO0B 4Z77B 3QO0B 3ULUH 4BK4A 1HCVA 3TIDA 1OPGH 2K3TA 1KNOB 3DTXA 4DVBA 5ICYB 4KY1H 4LARH 3NFNA 1OAZH 4JKMA 2W65A 2VDRH 4Y4HB 4NN5C 4Q0XL 1JTPA 3MLRL 5KJRH 1WV7T 1QFOA 4PJ8A 4I2XA 3IT8D 4PGBB 5IIEA 3PV7A 4GW1A 1UXWA 1YUHA 2NY3B 4MLSA 2KH2B 3X14A 1QLRA 4MJ4A 1P7QB 1MQ8A 2ESVD 3G5XA 4AIOA 4HXAL 1YZZA 2V17L 4WW2C 3PXHA 3MSPA 1BQHA 4OKVA 1YQ2A 2P24A 5JXEA 4LHUG 3RY4A 5T3ZE 4JDTH 4LNVA 3QRGH 1ZMYA 1OLZA 3NCEB 2DJ4A 5EZIL 3D1MC 3BT2H 1F8TL 4HFWA 3SHSA 4JZOB 43C9A 3EKCA 2AEPL 4P99A 2RJMA 2WIIA 5I8EA 3UJIH 1I9JL 3MRQA 2I9LB 4Y5XB 4MXVF 3MGTB 4I3RH 4C58B 2VITB 1WFNA 2NNAB 4D2NA 1A9BA 5E56A 3MR9B 4MJ5A 4X6CE 4JN1L 5FM5M 5DA4A 4R96B 2D7MA 2MQ0A 2QL1A 3FT4B 1U8KB 3SGDH 1JZ3A 5IT2L 4PLKC 1RZKL 4C56A 1JZ2A 4W4NA 1IZJA 4M5YH 1JFQL 4ACPA 1B0GB 2QQKH 3ZHDA 5IV2A 2X4PB 3TV3L 3VFSA 1NC2B 3OKMA 1KT2B 3ARGC 2G9HB 2OCFD 4WI3A 2IQ9L 3E6FA 3RWIB 3BN3B 2E7BA 2FR4A 4Q9RL 3TEUA 4PRNA 4ELKA 1BZ9A 1R5IA 1UWEL 5INCB 4Z9KB 1G6RH 2A9MH 4RA3A 4G5ZL 3MOBH 3FO9B 1HH6B 2DBLH 2JELL 3DMMA 3ILPA 2BP3A 4NKIH 5DF0A 2YD2A 1P7KA 5FUCC 5GISH 4ZNEA 3ARPA 4Z7VA 4XNYH 3B43A 3OAYK 3SKMB 4JO3H 4YLQT 3PGCB 3BEVA 4F9LC 5F7MC 5MEPA 2X10A 3ZTJH 4WDIA 2YKLL 1PYWA 4NQCB 2D7TH 3MBXL 1F3RB 5C0BB 2WWKT 1V3KA 3QQ3A 3OR7A 1XCQB 4HK0A 3STLB 4UQ2B 1AFVH 2VN4A 2LU4A 4DOHB 1W0YT 4NKDA 4N8VA 3O6LL 5EU6A 2J8HA 2BSTA 3EYOA 3H42L 2EYSA 1CBVL 3C6LC 1BF2A 4PJCE 5KS9F 4K9EH 4RGOL 3VE0A 3BKCH 2OBGA 1J1XH 3HRPA 3MV7E 1G1CA 3L5XL 5IF0B 5FYLE 2VZSA 2HH0L 5HJ3A 3SDCA 4UQ3B 4OV5B 4U1LA 4E41B 2OI9B 4J1UA 5BV7L 1AKJA 5TE7L 4KK8D 3MJ9A 3FOLB 4U1KA 3EO9H 1MQKL 1RUAH 3HNVH 3LQZB 1EFXA 4RA0C 1KN4H 5MP6H 4U3XA 3RVVD 4LFHG 2HJLA 2L7UA 5BVJB 5HY9B 1KOAA 2HFTA 2VIRB 3ISWA 3TN0C 2VXQL 4PJFB 2NYYD 1NUGA 3C5ZA 3HMWL 4PB0H 4PTTA 5F44A 3CXDL 2XNAB 4V1DA 1N0XL 1ZVSA 5E00B 3ZKMD 2WNGA 4LSSL 3UPAA 3QUZC 5SWSB 4PGEB 4LASL 5E8PB 3TCLB 5EOCJ 1NGZB 3N0PB 5I9QC 5AYUH 1HSAB 1F3JA 4IRZL 3OKKA 1Y6KR 4XVSH 1OGTA 3JUYA 3HS0B 1LHZA 2FBJH 3ROLB 3RTQC 2GJ6E 4OZFB 3VXSD 3U4EA 5GQBA 1XCTB 3MMEB 3D0LA 5I2IA 3HAEA 3QXUA 3EFFB 2PO6B 4E0RA 1FFOB 1RSFA 4FTVD 5BJTB 3NIGF 1BLNB 1CDBA 3MRHA 1CZ8L 1A8JH 1DVFA 3S96B 1CGSH 3UTTA 3O8XD 3L6FB 2W1NA 4RBPK 4F15B 1JZ4A 3FQUB 1QNZL 2RHEA 3IFLL 4NQEA 5J4MA 5C0BE 4U3HA 3ZSTA 1A4KA 2PYEA 3EYFB 4G8GB 5IB5A 5K9JL 2K7QA 1CE6B 5FKAB 3QUYB 4DOHE 4LK4A 4Z5RB 1I9RL 1I75A 1IKFH 4ZFZB 5C07A 4WFFD 1YJDH 1ADQL 2D0GA 1FNEB 5EBMB 4KKLC 1D5XB 1KXQE 4JM2C 5DMKA 1B4JL 2ZUVA 1NAMA 2BNUA 1F4YH 3UMTA 1XR9A 1HYSC 2ADFH 5CP3A 4YK4C 4OLVL 1DUZB 1Q0XL 3VI3F 4HWEH 5HHNA 1YJDC 4AEEA 3LSOB 1JNNH 3GHBL 4FXKB 5IHUH 3QIWC 1YMHA 2O5YH 1S7RA 3DV6A 3S5LA 3U9PL 3LQAL 3JVGA 2VLJD 1OSZA 3BN9D 1QEWA 1C1EL 3MRLA 5F9DC 3OKDA 1LO5A 3PL6C 3NZ8B 3D9AH 4PJFE 4MWFB 2AJVL 3IFOA 1DEEA 3G08A 4M03A 4OKDA 4MXWH 1KPVB 1PY9A 5KW9L 4Y5VA 2R4RH 1ITBB 5SWSE 4OGYL 4K7PL 3L5WB 4ZODA 4EKXA 3X3FL 2HT3C 3FN0L 5BOPA 2DJUA 4HUXB 2VDPH 1WZMA 5GHWL 3UJTL 5ICZA 4FFZL 4MGXA 5CMAB 5EO0B 4O4YL 2VDQH 2V9RA 4Y5YC 4W81A 3N9GH 1QA9B 3KPPB 5KSBA 1G9EA 3D2UD 2ARJB 1L7IL 2DICA 2VLKB 3ABZA 3WN5C 1WIOA 4U4BA 3O3AB 3ZHKA 5I17A 4PRAB 3GRWA 4IM8A 3WIFA 5LKNA 3MV8D 3LQAC 1RZGA 3GSQB 4EOWH 4KXZH 3BPNC 2MFNA 2IALB 4BKLA 4XAWL 2XKUA 2C3XA 3O6FA 5D7JD 4RFEB 1UCBH 4G8GE 1NFDB 1YEJH 3GMQB 1NFIB 4FQQA 1AP2B 3O6KH 2H26B 3IRZA 3QUXC 4PS4H 4XBEL 3FTGA 4M62H 1F4HA 2ZKHH 3GKWH 1KCSL 2DMKA 2NXYB 4OUUB 3GNMH 4PJDF 5F1IA 2OMBA 4HXBH 4XPTL 3JTTB 3IVKA 3BE1H 4M8QA 2Z0BA 3QPXL 4IHOA 2CO7B 3SO3C 2JK5B 4PIRF 1F58H 3Q48A 5T1DL 1YPZB 1JGDB 3MLTB 5JUEL 3UBXI 5LGJB 2YRLA 1ORQA 4TVSa 4YDLC 4IRSA 4LF3B 4S1DC 3CVHL 1UWGH 2NW3B 3SJVD 1HXMA 4RMRA 1NEUA 5CSBA 1DLHB 1MJ7L 2WLYA 3MROB 4Y16C 1N6QL 3K2UL 2ICES 2APFA 4CDGC 3B8SA 4X5LA 4NKOA 1MCHA 3P4MB 4D9LL 2FGZA 4TUOA 1RU9H 1MCDA 4TPRH 4E42A 3CFJA 5HYQA 2X89D 2Z35B 5E99L 5C9JA 3OXRB 2W0FA 1U8LA 2Q1EA 1ND0B 4QXGL 1ZHKA 4QCIB 3B5GA 1FCGA 4F57H 2GSIA 2DTML 3RWHB 4GG6F 1NSNL 2X42A 4X4XA 3RL2B 1QSFA 3BDYL 1WWCA 1TCRB 3LEYH 1OAUL 3LQMA 4X7EC 4WFGD 2DLGA 2DLFL 5DRXA 3TA3A 1L4IA 2J6EH 4PJ8D 5E8OB 4XXDB 1QLEH 3FFCA 4Q9CA 4YDIL 5HI5C 3QO1A 4RAVA 3RWJB 3U1SH 3DRTB 4XRCB 3I9GH 3PF2A 4OT1L 3S3PA 5CHNA 2BCKA 4UT7L 4NGHL 3O3EB 2CUMA 3PWJA 3VD7A 1NFDE 3IF1B 1OCWH 1H5BA 3MLVH 1TZIB 4NJAL 4IOFD 5JXED 4GKSB 4LPUA 5C0AA 3BIKA 4ZXBA 3MTRA 4HS3B 1DN0B 2AXFB 4DGYL 1NQBA 2JB6B 4MA1C 4OQTA 4OF0A 3DX6B 5IM7A 1R6VA 4LIQL 4UINH 3WEXA 2NXZC 4F8TA 5LQBH 4YBQD 3TWCL 3TO2A 4P2OB 1FPTH 1OM3H 2IADB 1YPZE 3STBA 4LNRA 3I2CL 4CW1B 5EUKB 4K7FB 1S9YA 2PW2A 4P59H 1J5OH 3MRFA 3TNNA 4PJHA 3VWKB 4XP4H 2XPGB 2GJZA 1IVLA 4UB0L 4Z7WE 4EDWL 4FQCH 4B7IA 2WM0A 4JHAL 2HKHH 4PJXB 4C56D 4PYHA 2FCBA 3MUZ1 4MA7L 3ARDC 2VJXA 1I1CA 3H9YA 4PG9B 5LXGL 3DBXB 1LEGB 5JHLL 3EOTH 1L7TL 1BJMA 1RJLA 2HVKB 2Y7QA 4HIHA 4BA8A 3PNWA 4TNWK 1S7VA 4WHYH 3GSXA 3CUPA 5B4MD 3VFMA 1D6VL 2XZAH 4QRPD 1FORH 3EJYD 4MX7A 4OGXL 2XRAL 3GI8L 4U1IA 2KQNA 1XR8B 3PP3K 4JLRA 5C09D 5EIIA 3ZDYF 3ZYZA 1ERNA 2DQCH 1X4ZA 4LLQA 4DQOH 3KR3L 5T33L 3IETB 3OJDA 1RK1A 1FZMB 5KAQG 4HW6A 5F7DA 1LE9B 2FWOB 3V52H 3SDDA 4Z7NF 3F65A 1W2KT 3MFGB 4XP1H 5JW5B 4HWBH 5HI4C 1YNKH 3MLYH 4HGWA 3WFZA 5FO8A 4X6CA 2VZ3A 3IDYB 3K1DA 4JKPL 2AK4E 5EU6D 1U95A 4JR9H 1XH3B 3TT1H 2R56L 1J12A 1VERA 3L7EB 2EKJA 4YHKL 1XFPA 2DOCA 1UWXH 1KJMA 4U7KA 2VDNH 2AEWA 1VDGA 4G6AC 1CF8L 2Q3ZA 3H3BC 5H94B 1NLDL 1TJGH 3LN5A 4DEPC 2VH5L 1WZLA 4QGYA 2I5YH 2OR9H 1IBGH 3JTSB 2D03H 3HE7C 4HBCH 1I3RB 1WFUA 4UNTA 1ZWIB 5L2KD 1AKJD 3PE9A 3PHQB 1A02N 5L7XL 2FIRT 1VESA 1ZSDB 4XCNA 4YGVA 3LZFL 3I75B 1OT1A 1EFXD 4OCLC 3EO0A 1FIEA 3BISA 3HR6A 4Z7QE 1FZJB 2BMKB 1KNOA 1GOGA 5ICYA 1J8HE 2AP2A 2X4SB 1CE1L 5C6PB 5DWUL 4JFZL 1F4WL 4JY4B 1T80A 4LDLB 3C5ZD 2OM5A 4JFYB 1HWGB 3GK8H 4PJXE 4PGBA 4V1DD 4UILH 1MIEH 3G6JF 1P7QA 3O2DH 4LSUL 1NCAL 3SDAB 5L88L 1ZGLP 3QG7L 4XHJD 4HS8L 3DOSA 5SX4I 4PJCA 1KLGB 5D1XB 1JNHB 4L9LB 1F6AB 1NCBL 5DA0B 4O58H 2GW5A 1AJ7H 1A21A 1CLCA 1KLUB 5DMJB 2DWEB 2G60L 2UWEF 5JIPA 1ZK9A 2Y1VA 2QTEA 3BI9X 5FEBA 3PGFH 4LLAA 1DVFD 3B9KC 3F7RA 3O45B 4JZOA 1OTUC 3TM6A 4BSJA 3UTTD 4BQCA 5DO2D 5IW6B 1CGYA 5IW3A 1I1AB 3EO1A 1NBVL 3WFEL 2V5MA 3HMXH 1UZ8B 2I9LA 4Y5XA 3OPZH 3MGTA 1ZVYA 2VITA 2NNAA 2PYED 3MR9A 5INDB 1KBGH 1WAAF 3IDNB 4P49A 3SGJA 1L0XA 2W9EH 4R96A 1U8KA 3BX7C 1NH6A 5C07D 1EEZB 1BFVL 1XAUA 1B0GA 2X4PA 1K3ZA 2QQNL 1U0QA 2CLZB 4HPOH 1NC2A 1JP5A 1KT2A 4MXVE 5CP7B 1K8IB 1QOKA 2G9HA 4GBXB 5GXBB 2BJML 2D2OA 3RWIA 2NY1C 3PWVB 1IKNC 4N0YH 1GGYA 1I7TB 4DVRL 1BVLA 5INCA 3WXVH 4WFHE 1WTLA 1BM3H 5F7EH 1V3JA 3GSRA 4IMKC 4BZYA 3FO9A 4R3SA 1HH6A 4PRPB 1CXKA 1HQ4B 3VXTB 4Z0XA 1WEJH 4HAFA 3CFCL 5DC9B 3MC0A 4NQUA 4JFEB 4MQSB 1K6QL 1CLYL 2IFFL 1MFAL 5GS3A 3TPKA 3VGFA 3PGCA 4PV9B 2H2PC 2I24N 5K9KB 2BNQB 4KKAC 5TQ2L 4XZUB 4OCSH 2Z8WC 2AI0H 4KDTA 5C0BA 3KPRE 4TOYH 3B9DA 1XCQA 1UKSA 4FQXA 4LCCB 1DDHA 1KN2H 4CU7A 5I1KL 5IB4B 3CFBB 2COQA 3QHZL 2I26N 1ITCA 3CSYB 5ADOH 1ZHLA 2VAAB 2VTFA 2NY5L 4KJPD 2XTJC 1UQSB 1CTNA 3HPJA 5HDQH 4M7ZB 1LO2H 3TPUA 3QZWB 4P9MH 4K7PX 5IF0A 4K3GA 5GGSB 5C9KA 1ZS8A 4OV5A 5I8OH 1CICC 2AABH 5JQHC 3PQYB 5GRVL 1QPXA 2FB4H 1EBPA 3RRQA 3WKNA 3FOLA 4M6AA 2MWCA 4UAOC 4LQFL 5DK2A 5KS9E 3LQZA 1N5YL 3PDDA 4H1LG 4M4PA 1LQSR 4NZUL 5B8CC 4TUKL 1NGPL 5FCUH 1U92B 5BVJA 4NM8L 1ZT4B 3IDJB 4IJ3B 3Q6FB 3VFUB 1EDQA 4WU7B 5H37G 1OF2B 3LPFA 1P9MC 3F7PC 2DN7A 2VIRA 4PJFA 5IMMB 3HG1D 3C87A 5I1CL 2IFGA 5HYSA 1DEDA 4XVTH 1I1FB 3VRJB 2DQGH 2XNAA 5AG9A 1F2QA 4MHHI 3TLRA 4UV4H 4TTDD 5SWSA 4PGEA 4GJTB 5E8PA 3TCLA 1K85A 5B38A 5E2UH 2ICWB 1PLGL 1KC5L 4L8SB 2XOTA 5GGRB 4LHJB 1HSAA 1IARB 4PJEF 4YIQB 3UTQB 3HS0A 1CYGA 1XGRA 1DBKH 4OZFA 1I3UA 5FYJE 2GFBA 4IRSD 4Z95L 3MMEA 3EFFA 2PO6A 3VXRE 1FFOA 2CGRL 5EFIB 5BJTA 5C0IB 1BLNA 4NC2B 4HIEB 2XKNB 1DQML 3QDGE 4OFKA 4MA8L 3ULVF 3EZ8A 4I3SL 5D7LB 3TJEH 2OXHA 3FQUA 1U6AL 3PG2A 3H6JA 4HSQA 3RGHA 3T77B 1DQJB 1A6ZB 4NIKB 2HWZL 3BPOC 3RGVB 2F58H 2OK0L 4NWUL 4JKWA 4K71B 1ZHBB 4G8GA 4P46B 4LPWA 1CE6A 4LKCB 5FKAA 3QUYA 1RUPH 4W6YB 2JB5L 3WLBB 3AREC 4ZFZA 4OCXL 1NKOA 1FNEA 3OAZH 2CDFB 2CJUH 1D5XA 5JOEA 3EZJB 1QSFD 2D9QB 3BOVA 5EIVA 2EDWA 2WBKA 4I48B 3KPSB 1S3KL 4JFDB 5I16A 1KIUA 1UG9A 1DUZA 2VR5A 3QDJD 1MELA 4YHLL 1RHHA 1GGCH 3LSOA 4POUB 1I85A 1DR9A 4FXKA 4R26H 3B4NA 2F74B 1NLBH 3PQYE 2MSPA 1HCFX 3FFCD 4OCWL 1X5JA 2EE6A 3I02B 3BKJH 4OCYH 3RWCB 3U30C 3T2NH 2NY7H 4G9DB 3BESR 2D7QA 4EN3D 2N56A 5E6IB 4LSQH 2JJVA 5ITBL 1T0NB 3NABH 3VI3E 4K3EH 4N8CH 4AYFA 3NZ8A 1YQVL 1S9XB 5EO1B 4LCWD 1U91B 2R39A 4MWFA 5FGSA 1MRFL 2VDML 4ZXBD 5C0AD 1MJ8H 4M1GH 4KUZH 3G6AA 3OKOB 5ITFA 4PUBH 1KPVA 4D0BB 4Z6AT 4PY7B 3U7YH 3PWPB 5BS0D 3L5WA 2JJWA 1QRNB 1A6UH 4HUXA 1X5LA 5JORB 2N4IA 1GZQB 5DVNA 5T5NF 2VMFA 5CMAA 5EO0A 1TQBC 4ODSH 4HLZG 3R8BB 1IILE 5DEGB 1ZLSL 1RZFL 1A14L 3KPPA 2ARJA 4FZEL 2VLKA 3O3AA 5KVDH 2EH8H 4WHCA 5DGQA 4HZLA 2P45B 2JJTA 3NCJL 3KXFB 2F15A 1N4XL 3DGCR 1CDCA 3GSQA 2BOBB 3QDAA 4GG6B 5F7FA 1FFNB 2IALA 5D7LE 5DD6B 2HMIC 1WIUA 3PP4H 2OL3L 1OL0A 4H8WL 1IFHL 3CGTA 5F7LB 4XBPB 5DR5L 4M6NL 2HFGH 5I74C 4KGLA 4RFEA 1NFDA 3GMQA 1NFIA 4XPAL 1X3DA 4UNUA 1AP2A 2H26A 4ZFOB 3F8UB 1P5VA 3SDXB 4F37K 3LEVL 1FRGL 5DD3L 1OAKH 2D7PA 1CLZL 1FIGH 4GRLA 3WYRA 2MPAH 1TVDA 3NACH 3JTTA 3LIZL 4JFDE 4DGVH 4KK8C 4PY8J 3VG9B 1JL8A 1J1OH 5A16B 2JK5A 3AXLB 5TQ0H 1QBBA 1FNFA 1W8OA 1YPZA 1JGDA 4HGKC 5LGJA 2Z8SA 3SDDD 3CC5B 2P5EB 1F97A 3WUWG 3RVVC 3QBTB 4LF3A 4MLIA 2WP3O 4Z7WA 4TQEL 4GKZB 4WTZG 3MROA 4HT1L 2NYYC 1EO8H 2MKLC 4LHUD 3WNMA 3ZKMC 8CGTA 1MJJB 3P4MA 4EBQH 4QXTA 4DN3L 4ZO7A 2W07A 1YEHL 3MFFB 4YHOH 2Z35A 2PR4H 5DRWB 2B5IC 5F89B 4OLXL 5AWNH 3L3GA 2F8XC 4FNLL 1PY4A 1BEYL 4XCCH 3RWHA 1MF2H 3RL2A 3O6MH 1I7UB 2DM4A 2WW8A 3ARWA 1DL7L 2R0LL 4LRNH 4KVNH 3FQRA 1C5DB 8FABB 1DJSA 1WBYB 3O8XC 4XPHL 4FQLL 5E8OA 3KXFE 5EO9B 4I0PD 1W72L 5IQ9B 3QUMA 3BMWA 3CMOL 5FO9B 3W0WB 1S7SB 3IDGB 5GS0D 4GG6E 2NY3D 5D71L 4HEPG 2F5AH 1P7QD 3RWJA 2AK4A 3F58H 4XRCA 4LLVB 4F8QA 3C2AH 3T09A 5KSAB 2VKXA 1RURH 1HZHH 2QV2A 4B5EA 4XX1E 3IF1A 4GKSA 1FG9C 3MV7D 4YDVB 5FYLD 2M26A 4HS3A 3BO8B 3L95B 1DN0A 1T4KB 2AXFA 2JE8A 1VACB 3F7VB 2JB6A 3OR6B 3DX6A 3T3MF 5F6IB 1N5AB 5I1GL 1N8ZB 3BD5A 2DYPD 2AKRA 2HFEB 1KIRA 5EORH 2IADA 2HKFH 4G8EA 3WJJC 1NBQA 3S36L 1I7RB 1OP9A 4LMQE 5KVMC 1UM6H 3BN9C 2P5EE 4R0LB 5EUKA 4K7FA 5IWLC 1J8HA 2DF3A 2XPGA 3B83A 5EZOH 2I9TB 3FO1B 4M7JL 5DD1L 3SGEI 1A3RH 3VW3L 2YUXA 5HGHB 3AY4A 5T3XE 4PJXA 4OGZA 3VFGH 3ARGB 5F8QC 4G6JL 1NGWB 1RUQH 4PG9A 4RISH 2Y07H 3QXDB 1NC2D 3DBXA 2XN9B 1LEGA 1T1WB 4H0IA 4MJIB 1MLCA 4PJ9C 2HVKA 2DQDL 1P53A 2GKIA 2FRGP 1DN2A 2R2HB 3MJ6A 5CFHA 1NCCH 1KPRA 2GJ6D 3UYOD 5L6YL 5HHVH 4M02A 1YN7B 2L4OA 4M1CD 1G6RB 2A9NL 3CFEB 4X6BA 4LFHD 2AQ3A 1VKXA 1WISA 3DVGB 3MUGB 4NN7C 1UB5B 1ORSB 3BGFC 3VFNB 4L5FL 2OSLA 2W9DL 1XR8A 2NY6B 2EC9U 1JYVA 4I0KA 3ULUE 1P6AB 1UJ3B 2LAAA 1Q72L 4HS6B 3IETA 5IFHL 1LE9A 1FZMA 3LKSA 3O2WH 2FWOA 4ZUWA 4KMLB 4OLYH 2J5LC 1N7MH 2J12B 5C0BD 4GAJH 5CUSH 5D7JC 5JW5A 1Q9OB 3GSNH 1J0ZA 3H8NA 4FQXD 2KPNA 5CD3B 4NZDA 3AU1B 3C6LB 3WIIH 4WI6A 4DZBB 3UC0L 2YR3A 1C5BH 1BOYA 1XH3A 1G84A 5E94B 3VFWA 3L7EA 3K4DA 1A6TB 2IPTL 3VH8A 2IJ0C 5HGBB 1BX2A 5H94A 3CMGA 1EHAA 2YD8A 3IDMA 5E8NA 2ZP0T 1QKZH 4Q0XH 1INEL 5DMGD 3JTSA 2GYSA 2Y5TA 4ODVH 5BO1L 1DBAL 5TE4H 1I3RA 1ZWIA 4Q7DA 4IMLA 2DM7A 3PHQA 3O4LE 2FH6A 3TIEB 3V7MA 1JF1A 1ZSDA 2V2TB 4NPYA 3WFCL 4WWKD 3I75A 4ELMF 1P7HL 4FQHB 4R7DB 1HINL 5FF6B 4JPVL 1FZJA 3UYPA 1P4IH 1RIVL 1TPXB 2V17H 1FFRA 1UKQA 4GKOA 2X4SA 1VCAA 3ZYOA 4JY4A 3SGKA 5JR1L 2F53B 2QHRL 1PG7L 4CKVX 5D7IB 3LV3B 2ZG1A 4LRIA 1SEBB 5I9QB 3LMJL 4GQPH 1MH5B 1VADB 5SWSD 1U41A 2XN9E 2GHWB 4KI5F 3SDAA 5FOJA 5EA0H 3TYGL 4MJIE 1AI1L 3IU4H 5SX5H 5C0ND 3OF6A 3FN9A 4OD3L 2AQ2A 3U79A 2F54E 1OARH 1KLGA 5D1XA 5C6TH 4PRDB 4IDJH 1AGEB 4X9FA 4L9LA 3GMLB 1KIPA 1F6AA 5IEHB 5CINH 2AQ1A 1CXHA 2X1PA 1JRHL 3PHOB 4AEIL 2PO6D 1RZKH 9CGTA 1KLUA 2DWEA 4XBGB 2BVOB 3NMEA 4S1RL 5C0GB 5KVGH 5GSVB 4PJ8C 3TV3H 3LS4H 1UVQB 1K5NB 3O45A 3OXSB 5C8JB 5IW6A 1UCTA 1SEQH 2IQ9H 1HHIB 3SBWA 1A3LH 1PKQE 2B39A 1UZ8A 1UWEH 1JYNA 2R1WB 3HC0B 4G8GD 2UWEE 3BWUC 1OP5K 3IDNA 1JGVH 1KXTB 1FAIL 5JXEC 4IOFC 4YHNB 2DQUH 4DTGL 1JI1A 5GRWA 4APQB 1Z9LA 3MGOB 2CLZA 5HVHC 4MS8D 3NZHL 2VYRE 5CP7A 1K8IA 4R90L 4GBXA 1H9VA 3QIWB 5TDPB 3QCTH 1UH3A 1WAAE 3PWVA 4YBQC 2ZPKL 5F9WB 4HPYL 1I7TA 3QB7C 5J1SC 5J0BA 5TE6H 3NFPB 4ONOA 4K8RD 2NX5D 3WSQL 2DIAA 4CJ0A 4K3JL 1FG2B 3MV01 4PRPA 3O6LH 1HQ4A 2X9WA 3VXTA 4WI7A 4MNQB 4CMHC 4PV9A 2M8XA 1CFNB 3LKPB 5F3HA 5K9KA 4P5KA 4EXKA 5J12B 4XZUA 3OBAA 5EU5B 1BGXL 5BV7H 1R0AL 3ZSSA 1NDGB 4GT7A 4LCCA 4YHYB 5IB4A 2E9IA 1S8DA 5IFAH 5JO5A 1JN6B 3EJJX 5FKPB 15C8L 5K9OB 3V4VL 4G6FB 4Y5YB 5E1AA 1NEZA 2IAMA 3ILQD 5M95B 2J8UF 3VGAB 3DMMC 1LO4L 1UQSA 3L5IA 3EJYC 1X5KA 4YH6A 2BXZA 1R3IL 2C3GA 1HOCB 5GGSA 1TJIH 3HMWH 4HZAA 5D93B 4PLOB 2ATKB 1BD2B 3RKDD 5GZND 1N0XH 2HT2D 4LSSH 3PQYA 4NQDB 3MYJB 5FV1L 3NFSL 5IG7B 4U0QB 1MHCB 3P0VH 4NC1C 4NT6B 4PLNC 5F6HJ 5C86A 2FJGB 1LDSA 1U92A 3NAAL 3E3QE 1ZT4A 4KRNA 3QUXB 3VMNA 5FYKU 1ZLWH 3VFUA 4U1GC 1OF2A 1E28A 3DRQB 1RIUL 1LP9B 3EAKA 4M00A 1YYLL 3HI1B 5IMMA 5C0EB 4ERSL 4HUUB 4S11A 2R2CA 1JHLH 2A6KB 1BVZA 1I1FA 1FQ9C 1TZGL 3HFML 1XGTA 3PV6B 4GRLD 3SDCC 3SO3B 4CNIA 3CX5K 4M7LH 4MD0B 1RIHH 5I1IL 2Y06H 3CK0L 4S0TD 4QTIH 3FZUD 1AC0A 3OB0H 4YDLB 4YIQA 1I1YA 4NO0B 3UTQA 4K07A 1V05A 2HRLA 2YMXL 4RFOL 1GSMA 2EIDA 5ISZE 2WQRA 4RMTA 1QHOA 4XPGH 2CR6A 5EFIA 1OP3H 5C0IA 4HIEA 2XKNA 3G5ZB 1PSKL 3C5ZC 1VEOA 1L0QA 1CFTA 4PJEE 5D7LA 1KYOJ 3CSPA 4OLVH 3T77A 4LCYB 3GHBH 4X7CC 1A6ZA 1U8IB 3RGVA 3KPTA 1ZHBA 3HAEH 4D8PB 1PFCA 3PXJA 5J89A 4KC3B 7CGTA 4LKCA 4MCYB 1KTDB 3T1FB 2E5EA 4ODXB 3WLBA 5D1QB 5E5UB 3ULVE 2YD4A 4C55A 2CDFA 5I0ZA 1RZ8A 1E6OH 2P42B 2E7MA 3SDYL 2EYTB 1S78D 3KPSA 1I9IL 4G6ML 4JFDA 4G3YL 2BRQA 2BC4B 3RY6A 2LABA 1DVFC 4LSRL 4AENB 2EC9T 2OXGA 3QHFL 1KCUH 5FDYA 5DO2C 2H6PB 5E8EB 4HJGA 1ZVHA 4D0CB 3MJ8B 2F74A 3AVEA 4R4BA 4OGYH 3K74B 4P23D 3LS5L 3I02A 1MHPL 1NDMB 3UJTH 2AK4D 4G9DA 4M61A 5E6IA 3DVNA 4PRHB 5D7KE 1N59B 1OQOA 1QFWM 1T0NA 1WJ3A 5D9SB 4WY7H 5CP3H 3KJ6L 3RVXD 4LLUB 5EO1A 2E6PA 4FQJH 2YPVL 5T5FH 2E8ZA 4RMSA 2P7TA 4MA1B 3ZYJA 2R0KL 2RCSL 1IAOB 1ZLVH 1MVUB 1FJ1B 1HI6B 4O9HL 2FJFB 5IHBA 1LDPL 2VXSL 4ORGB 4D0BA 4PY7A 3PWPA 4Q58C 2EKSA 2HLAB 5JORA 1GZQA 4HCRL 4JCLA 5ADPL 1IC5L 1DUYB 3CH1B 5DEGA 3JVGC 4XNQB 4KQ3H 2FDBP 4NOBA 1F02I 2X4OA 1J8HD 5TPWL 4WTZA 4LOUD 3ARDB 2IPKB 2CO6B 3T3PE 1M05B 1KCSH 3BUYB 2DMCA 2E6JA 3KXFA 3B3IA 1FVEB 4EEEA 2BDNL 2BOBA 1U8QB 3LHPH 4GG6A 4HJJL 1FFNA 5I1JL 1FDLH 3ECBA 4WUUD 4X7SL 5DD6A 4Y5VC 3AB0C 4JFFE 5I30L 4U1JA 5L9DL 3MNZB 5E8DH 3EYUL 3T0WA 3LPGA 4KJPC 3ZZ1A 1AXSA 3L3JB 3GRWH 2QQLH 4NP4L 1NAKH 1JPGA 2UZYB 5HI3C 2MHAA 4BH7B 3BKYH 1U58A 1FNSL 2GTZA 1H0DB 3BD3A 3W81A 5A16A 3ZL4L 4XPFH 2WANA 3P0YL 4XVJH 5GRXG 3W5NA 4HC1H 4RZCB 1AGBB 3O3UN 4EI5B 1JYWA 3CC5A 2P5EA 4QYOB 3O6FC 5FYKL 5FV2A 3SE4A 4EUPG 1LK3L 4GKZA 5LCVL 2DM3A 3DPBA 3DX7B 3WCYA 3QEQD 1CGTA 4DEPB 1IGFL 1CWVA 2LVCA 4NNXB 3LRSA 5GRUL 5D72H 2ZNWA 2JKXA 3I6KB 4WFEE 4TTDC 1MJJA 1WTGT 1GOHA 2AJZB 2DLFH 3HE7B 2V7HB 4JO1H 5DMYA 5EH1A 4Y8DC 1Z3GL 3KLAB 1J88A 5DRWA 2GK2A 5F89A 1S9VB 1D5ZB 4WFHD 4YDIH 1IL1B 5JW4R 1JGUL 4CVZB 5H35B 4OT1H 4IRSC 2OQJB 1AGFB 4UT7H 4NGHH 3QI9B 1B2WH 1I7UA 1J1PH 1HQRB 1JWMB 4JQIL 1SYSA 1RFDH 5ESAB 2XA3A 1IM9B 4JM4H 1F4XL 4YHPA 2FL5B 8FABA 1JPTL 1C5DA 2DDQH 2E9WA 4LGSB 4QRRE 1WBYA 2H9GB 3P11L 4YBHA 4PGJA 4JFOB 5EO9A 1VFOA 1MCJA 5IQ9A 2NW2B 2HG5B 4PGCA 3KPRD 3RU8L 2ICEB 1S7SA 3IDGA 3W0WA 3MOQA 4DW2L 3SDAD 3IJSB 1YEFH 4AG4L 3RIFF 5EOCH 4U31A 3UO1L 2VDOL 5KSAA 3DSNA 5C70A 1A7PH 3OF6D 1PG7X 2O26U 1UA6L 5BOZG 2AEQH 3U4BL 4YC2C 4UB0H 4EDWH 4NO3B 3EDJA 4WW2F 4U6TA 3QR2A 4YDVA 4JKKA 1ZKAA 4PR5B 3BO8A 1VFBB 1VACA 3F7VA 4MA7H 4BYHA 3CU1A 5CEZE 4RIRB 3OR6A 1FNHA 5EIQA 1N5AA 4OCRH 1N8ZA 1K4DB 1XGPB 5GJTL 2HFEA 4GW5B 4RGNC 5ETUB 3JWDL 1J0JA 4ZAKB 4EN3C 4ONHB 4G8IA 3H9SE 4R0LA 3SGEH 5E2TH 1YEDA 2I9TA 3FO1A 5D8JH 5DJDB 3BJ91 3RBGA 3T3ME 1H5BC 4OQTH 5HGHA 5IVZB 2XRAH 2VKWA 1EERB 4ZXBC 5CZXD 1NGWA 3RUGB 3ZDZF 1A47A 3QXDA 2XN9A 1JWSB 2FX9H 4JEGB 4MJIA 2C3HA 4GBXD 1B0RA 3KR3H 3BEWB 5T33H 1NC4B 3LOWA 4YBLB 2DAVA 4BH8B 2R2HA 1Y18B 2CXKA 3NIDF 4H20H 5GGTA 4CU8A 5C0CD 2R9HC 2EDBA 3U2SB 5FYJD 3LH2L 3GBLA 1DQDL 1YN7A 1G6RA 3CFEA 3VXRD 4NO2B 3CDCA 3DVGA 5TGBA 1UB5A 4OZGB 3UPCA 4Y19B 4P3WA 3LRGA 3QDGD 1RMFL 2FX8L 1UJ3A 2VH5H 3S37L 5CCKL 4OCNC 2GAZB 1G7QB 2YPLB 4TSBH 4HG4K 4ZOCA 4H0HB 3LN9A 1Q9OA 5EZLB 1RJYB 3LZFH 5CD3A 3AU1A 3MLZL 2G75A 4DZBA 1DLFL 4GUPB 1A1NB 3RZCB 2Q3AA 5E94A 4AL8L 2IAMD 1A6TA 1ZA6A 1QSEB 5HGBA 3O9WB 3LB6D 5GRZA 1U8PB 3P4NB 4RMUA 1WAAA 1MJUL 1ZEAL 5GGRY 4HKZB 4F80A 3Q0HA 3V4PL 2N7BA 4XT1C 3PQYD 3GDBA 3TIEA 3QDME 4X9HA 4Z7UF 5C92A 4ZYKA 2E7HA 1GJIA 3DXAB 1OQXA 3SDDC 5B8CB 1A0QH 2NLJA 1EA9C 4L4VB 3BAEH 1Z5LB 4FQHA 4R7DA 2OZ4L 1JWUB 5IVXB 1KENL 2DTSA 2YRPA 3KPQB 4WHDA 3SO5A 3M1BA 3ZMRA 3U7AA 2GTWB 1XGYH 5HDBF 2Y5EA 3EOYG 1FCCA 4KV5F 4LSVH 2F53A 1IQDA 4ELME 3HRZB 2XY2A 3ZLQC 4KJWD 3LV3A 1LEKB 4DAGH 1SEBA 4JB9L 3RUGE 5JIHA 1MH5A 1VADA 4KJQD 2QSCL 1CGUA 1G9NL 3G5VB 1QFWL 3MRPB 3WFEH 4YUEL 4HUVB 1KJ2L 1UM5L 1BFSA 4LSTL 4ODTH 5ERWB 1WWAX 4PRDA 3H7LA 1DBML 1AGEA 5FM4A 5SWZD 5IEHA 1XT5A 1HXYB 3PHOA 5TH2A 5GS0H 5KBNC 2BVOA 2X6MA 5C0GA 1NCWL 4G8FB 2AVGA 4M1DL 2BY0A 5DJ2B 3RL1A 1C16B 3ARVA 3QWOA 5C8JA 5D7LD 4N0RA 5ESQB 1KELL 5GS0C 2ESVB 4D3CH 2NY3C 2XG4A 2C1OB 5I19L 4QHLA 4WWID 1HHIA 2R8SL 5CZKA 2DD8H 5DQ9B 1E4JA 1DZBA 3NCYP 4MQTB 5FYLH 2R1WA 3HC0A 4Y2DA 3HC4L 32C2B 1RD6A 5DURD 1AC6A 4J6RH 2C1PB 3MA7A 1JZ7A 5IJKA 3CFCH 4YHNA 1JUFB 2E3VA 1U8MB 4ZTPL 4LDOB 1G9NC 5DGRA 4DKEL 4APQA 1YEKH 3VD4A 5HHXL 3VA2C 1JNLL 3VGHA 1T3FB 1GPOH 2R4SH 4JM2F 3KYAA 5TQ2H 2IBGA 2IC2A 5J11C 5MEQB 1UADC 3NFPA 2B2XL 4EZMA 4QOKB 4UU9A 1JTOA 1FV1B 4OZHF 4Y5XC 3DXAE 1FG2A 1QSZA 4K3DH 4JVPA 4L4VE 2D9CA 5IUSA 3O81A 1KUMA 3SGJC 4LQ1A 2Q8AH 5E6ID 3RVUD 4WUKH 2KKQA 1EBAA 4PJEA 5FDWB 1CFNA 4P5TA 1FC1A 1MY5A 3LKPA 2F5BL 1QTYT 5EU5A 4LCIL 3KLSA 1BQUA 5CJXA 5JXAL 4ZTOL 4Q9QL 4FMFA 1NDGA 5C2BH 2NPLX 1KACB 2LTQC 1LO3H 4U1MB 3BPCB 2XICA 1JN6A 5FKPA 1MCWW 5K9OA 4NZUH 1V7NL 3WUZA 1NCDH 3S9DB 3BZEB 5DRNB 5E70A 3DI2B 5CILL 1M7DB 1D5MB 3O41B 4YZFE 1HOCA 3DVFA 2V2XB 1D5BB 2ATKA 4L29B 1BD2A 1PDKA 2EIZB 1YEGL 2V5YA 3JZ7A 3MYJA 3ZT6A 2J8UE 4KDTC 1PLGH 2F19L 3EYSH 1FYTE 1KC5H 1MHCA 4NT6A 1F00I 1VGEL 4FQXC 4M7KL 1WBZB 2Y9RT 4X9GA 5KTEL 2A6DB 2FD6L 1IGCH 3DRQA 1CFQB 1Q0YL 4Z95H 3F6LA 1ACYL 5C0EA 4HUUA 1FNGB 2EDKA 1MWAL 5IB3B 4P9HC 1X5ZA 3A6CL 5DMGC 2FBOJ 1DQMH 3PV6A 5D6CB 4MA8H 4Y4FD 3O2VH 4MD0A 4YHIA 5JDSB 3MOAL 1MCOH 1BWWA 3L9RB 3WV0A 2HWZH 3VFVB 5DT1H 4BZ1H 4NO0A 5IESL 4KGJA 4QOKE 5KANI 3T0VA 4ZG1A 1H8OA 2IBZX 3FQWB 5FGRA 4J12A 4AEHL 5B39G 4WU5B 2FLBT 3MODH 4QXWA 4Y1AB 5ILTL 4WV1A 4UIMB 3G5ZA 3VXOB 3QH3B 5JQ6H 3ARTA 3V0WH 4F7TA 4FFVD 2ICWI 3EDEA 3W11D 4EIZC 4NNYB 2C3VB 3H3KA 4HWNA 4KU1A 3WFDH 2QEJA 4JFFA 4WCYH 4LCYA 4JY5L 1U8IA 2X41A 1MFEH 4NC0B 4X98B 3MACL 5IEKB 1BBDL 3B6SB 6CGTA 4D8PA 3VXSB 4RMQA 2A73B 4NCC2 1HKFA 4OCWH 4MCYA 3T1FA 4ODXA 5D1QA 3T0AA 2BSED 4FTVB 3GMOB 3W5MA 2Y36L 2XT1B 2PO6C 4IOIA 1RUML 1H3WM 3O8XB 1TETL 3ULUD 1LILA 4AENA 3MRBA 4QHMB 3RX5A 4YDKL 2H6PA 5E8EA 4TUJB 1GGBH 4D0CA 1B6DA 2ITCB 5CIPA 4F15C 4EI6B 3WNNA 5DDHB 1FL5B 5JIKA 5J6HB 2HRPH 2B0SH 3ZTNH 1NDMA 5JPMB 3QUYC 4PRHA 5D9SA 4X7TA 5DJAB 5D2LF 4WW1B 2CDEB 4U1NA 2DJSA 1ZLSH 1RZFH 4LLUA 1N6VA 1GYAA 4ZO9A 2AGJH 2B7DT 3WHXA 4K8RH 2V9TA 1IE5A 1IAOA 2V5RA 3KHOA 3MRKA 1MVUA 1XZ0B 1HI6A 1N4XH 2FJFA 5F1NA 5BQ7B 3O4LD 2VL5B 2VQTA 1I85C 5EWIH 2P5WB 4EDXB 2VLJB 4YEFA 1NMAL 2HLAA 4ALAL 2ZCHL 3BGAA 3DJ9A 1QFUL 1DUYA 1CR9L 3QFJB 1UM4L 2C5DC 4XPAH 3CSGA 4MYWB 2EDFA 4IS6A 3ARFD 3DO3A 3LEVH 3QEGL 3TP4A 1MRCH 4GSDH 3VXNB 1FRGH 4QRRA 1LWRA 2IPKA 5DD3H 1M05A 1TVBB 5F70A 3BUYA 4Y1AE 1FVEA 3OZ9H 4OZ4B 2LAGB 2AK1L 1UYWL 1U8QA 2E6QA 4OM0L 1KEML 3TO4D 5CGMA 4I1NB 4N1CA 1RZJH 2CPCA 4QRSB 1I7ZB 4MNHB 3U7WL 3MNZA 5EG6C 2HP4A 3MLWL 3AGVA 2F54D 3VXSE 2DKSA 3ILQC 3RI5F 1A7QH 4Q6IA 4XMPL 3L3JA 1RZJC 4CU6A 3QA3B 3BGFB 4CVUA 4FQ2H 4CVXB 4F7MB 3MV8B 4QXUH 3RKDC 2JJTC 2NY6D 1DSFL 2HT2C 1J0KA 1H0DA 4DN3H 2PYFB 5D7JB 3O3DA 3I6LD 4RZCA 1AGBA 4EI5A 4RBPH 4QYOA 2CK0H 4XP6L 1AR1D 4XWGL 2XWTB 5DUBB 1KB5H 2P8PA 5K59F 3HC3H 1S7TB 5DHVH 2X4NA 1J9CT 3GSNB 4XCFH 2ZOKA 3DX7A 5DJ0B 1FZOB 1VENA 4RRPG 3GSVB 4NNXA 2X7LB 1O5DT 1IAII 3I6KA 3RJDA 4F7CB 4JGUA 3X11B 3C60D 1JPSL 2AJZA 4GRLC 1HYRC 3HE7A 2V7HA 1PG7W 2NY0D 2ITDB 1GAFH 3KYKH 4LMQI 3CXHK 1W72H 5MENB 1S9VA 3FZUC 1D5ZA 2MQ3A 5H8DA 1IL1A 2R1YA 4X7FC 3SJVB 1EAPA 2P5WE 4CVZA 3ROOB 5C7XL 2VLJE 4QTHB 4I77H 5H35A 3AS1A 1AGFA 3RDTB 3QI9A 3QFJE 2J1KA 1GH7A 3LY6A 5F7WC 3DHMA 1HQRA 1JWMA 5ESAA 3DX8B 4POYA 5F6HI 1IM9A 1T0MB 5JMRA 2H9GA 3QEHB 4JFOA 2XZZA 2NW2A 2HG5A 4WI9A 2ICEA 2ENSA 2VUYA 3IJSA 3S88L 2FSEB 4PYGA 3S36H 3HNSL 4GOSA 5IBTL 1JI2A 1D7FA 4KAQL 1T7VA 4M7JH 5F7YC 4NO3A 2MCPL 3QUMH 1S78C 1AGCB 2WBJA 1QG3A 3RVWD 4W6WB 4KK6C 1R24A 3N1FC 3OKEB 5J1TC 5FUOH 1RV6X 3P9WB 4F58L 3X14B 1H3TA 1VB9A 3IAQA 5D5MF 1K4DA 1XGPA 1CDUA 4J3XA 1ZV5A 3P4LA 4TRPH 1QHPA 3VD5A 3G5XB 4PJAF 5ETUA 4ZS7L 4ENEC 4ZAKA 2OJZH 1MNUH 1GZPA 5AEAA 4RGMB 3O0RL 1EUTA 4Y2DD 1XF5A 2P24B 1IEHA 5L6YH 3LVEA 5I18H 5DJDA 2RIKA 4ZUVA 3BWAB 3QUKB 5IVZA 3G6DH 1IT9L 4BUGA 3CSBA 2E9BA 4L5FH 2W9DH 2JJUA 3RUGA 4APQD 1CDGA 3RPIB 4UIKL 4U7SA 3KPLB 1IGIL 1LO0L 3DROA 4ESKA 4MQXD 4WI2A 5B3NA 5I8EB 5K93A 1NC4A 3CLFH 2MMXA 1JPST 4BH8A 4KTEL 1FE8H 1Y18A 5MENE 5KN5B 2E27L 4OUOA 4OIBA 3U2SA 4UOW0 3MLUL 1HIMH 2DIBA 5ISZD 3UC0H 3ARBB 1VSCA 5JIIA 4C56B 1HKLL 4LOUC 5DJCB 1ZT1B 2IPTH 5LGHL 4Y19A 3K8KA 1L0YA 3AY4C 4P5TD 1INEH 3NIDE 3E6FB 1E0OB 4XC3L 2GAZA 1JHKL 1G7QA 2DB8A 2YPLA 3ZTJG 5BO1H 1DBAH 4XPBL 5ID1B 1R5IB 3EUUA 3H3PL 1QD0A 2LV4A 4LP4A 5D4QA 5EZLA 1A3QA 1RJYA 1YYML 5BV7B 1S9WB 4WIQA 2AEIT 3ILPB 2QQQA 4GUPA 4QRPB 3EDFA 4ZD3L 1HINH 2VSDA 3RZCA 4G6FD 1V7ML 3ULVD 3ZKNC 4R4NC 3PIQA 4HEME 3NBNA 1QSEA 1XF3B 3HZKB 5C09B 3ZKXB 2YK1L 1U42A 3O9WA 4EIGB 2E7CA 1U8PA 3VU2A 1SBSH 4JPKL 3UJJL 4UDUB 3P4NA 3I6GB 4JKLA 3FFDA 4KMTH 4KVCL 2WWMD 2XQBL 2MJWA 3DSFL 1PYWB 4QY8A 4HKZA 4ODUB 4HK0B 1J18A 1U8HB 3VMOA 3DXAA 4DCQA 3TYGH 5JLZB 4NKDB 3SKJL 2Q8BL 4L4VA 1JHTB 3EYOB 1JWUA 2VXUL 5HHOE 5D7KD 4HK3N 1P9MA 3KPQA 4QHNB 2EH7L 1A7BA 4OLWH 1XF2B 4JPWL 3RWEB 4AEIH 4Z7UE 4OZHB 1MCIA 4J3UA 5HJ3B 1DE4B 3OAUL 3F7YA 3CFDB 3HRZA 5IROA 3HNTL 5L2KB 1LEKA 1AY1H 5F9JA 1EFXB 3G5VA 3MRPA 3CX2A 4U6HA 4F2MA 5HDBE 4GAYB 4DKFH 4HUVA 1GIGH 3BW9B 3GO1L 4KV5E 5GGQH 2WUBH 3ESVF 4NHCL 4KTDH 4NFBA 4Y0GA 2BVUA 1HXYA 4HX1B 3AS3A 4DK6A 1A7RL 1D6EA 3QNXB 4V1DB 2OJEA 3SGKC 1ZVSB 4G8FA 3F7QA 5CBAA 1MLBA 2HJKB 3HI6H 5DJ2A 5T1LD 5DYOA 4LRIC 1FYTA 5ESQA 3TF7C 5J56B 1HE7A 3V4UL 4NNPL 2BERA 4JFFD 3SDAC 3OKKB 1MAKA 4OTXL 4ZFGH 5DQ9A 3CIQA 3WSQH 3MCLH 1BAFH 4XMKL 1AXTH 32C2A 5E4EC 4X7DC 3U46A 3JWOL 1N0LA 5HDOA 5I2IB 3HAEB 3Q1SL 2C1PA 4L9LC 1JUFA 1U8MA 5FK9B 1MFNA 2ZNXA 1DVFB 3F5WB 4HMDA 1T3FA 1MOEA 3UTTB 1WC7A 3EOBA 2IMMA 1BGXH 1R0AH 5AAWA 1CL7I 2ILLA 4OIIL 5MEQA 1HHJA 4QOKA 1A4KB 2PYEB 3U82B 3SBWC 1FV1A 2ORBL 2NZIA 4KUCF 4JQXC 3V4VH 3BDBA 1WBXB 4C59B 1U8OB 4MB5A 1SY6L 3FB8B 1RULL 1U3JA 2W59A 4NO5B 1WWBX 5DMKB 2DQEH 4R4FH 1A7OL 4TULL 1PKOA 4WFED 5CZXC 1Q9KA 5HHMB 4NFDA 4GRWF 4XC1L 4OZHE 1CFVL 4H1LH 5FYJH 3UP1A 4GBXC 2DQIH 3CU7A 4J3SA 3DV6B 4BM7A 5JZ7D 5LG1A 4U1MA 1DBJH 3BPCA 3PWNB 1YC7A 5FECB 1GGUA 2RBLA 5C08E 4P2RE 5DRNA 4MJ6B 2V5SA 1G9MH 1TIUA 4FHBD 4D0DB 2VDKL 3O41A 5DEFB 5D1ZD 1YYLH 5LWYH 2O93L 2V2XA 4JRYD 4YQXH 1UACL 3BUTA 4QRRD 1T6WA 4MSWA 1TZGH 3QQ9D 4L29A 1A7NL 2EIZA 1G9MC 3P0GB 2RR3A 3S4SG 5L8KB 3GB7B 5I1IH 3BP6B 3DYMA 1OAXL 1WBZA 5ICZB 5CEXB 4O5LH 2A6DA 2BNRD 1PGRB 1XIWA 3LKRB 4RFOH 2HLFD 3GBML 1QQDA 1S7QB 2RFXB 1T0PB 1YECL 2XXMB 2IAMC 1CFQA 5B22A 2M2DA 4PPTA 3GIZL 2VXTL 4HUMB 4KK9D 3LB6C 4M7ZC 1M7IB 5FA4B 5IB3A 3WS3B 2FYYA 5CKGA 1RZGB 5D6CA 4F7PB 5CEZD 3ZT5A 1MAJA 5JDSA 4KXZI 3L9RA 4W4OA 5IHZB 1MFBH 1F90L 3V0VB 3R06B 5EU3B 4EI5D 2UZIH 3H9SD 1CK0H 2H3NB 3FQWA 1TFHA 3HG1B 3BH8B 4WU5A 3VCLB 4LEXL 4HMEA 4Y1AA 4UIMA 3VXOA 3QH3A 5F1IB 2A77H 2OR8A 5I15H 1WVZA 3SDYH 2NMSA 1I9IH 4M8QB 1YNLH 3EFDH 4NNYA 2VISA 4IHOB 5HHME 3TBSB 4KJQC 3HUJF 2QSQA 4WHTB 4X98A 2FX7L 4QO1A 5IEKA 3B6SA 3VXSA 5IMLB 2C9AA 5IQ7H 2A73A 1CI5A 2WUCL 1CS6A 3MLXL 4IRSB 3WNPA 5DMIL 3LS5H 5DJYB 3V5DB 4JAMA 4YDJB 2EDLA 5DSCB 1CDJA 1ULVA 1IQWL 1T1YB 3QI9D 3OKLB 3QHTC 5JOPE 1RUKL 3JBG7 3O8XA 1S5HB 4NKOB 3NPSB 5FHBL 1BQLL 1O0VA 1IM9D 3ETBF 3DETC 1QVOB 3ZKQD 4QHMA 4TUOB 2A6JB 2R0KH 3CPLA 4E42B 5I75C 2ITCA 5SWQB 2VN7A 4EI6A 2VXSH 4N0UB 2CIIB 2W0KA 4HLZH 5I1AA 5DDHA 1FL5A 1U8LB 3RGVC 3CFIC 5J6HA 4AQOA 5J8OA 5F3BB 2GSIB 4PD4K 2X1XR 3AS0A 5KZCB 1HH9B 4I4WB 5DJAA 5JTWA 3LD8B 1QSFB 4YC2B 1EJ6A 2CDEA 1R5WA 2Y25A 5HYEA 4UT9L 1YDPB 3A6BL 5FAAA 3RNQA 1CDHA 1E6JL 3Q5YA 3QDJB 5FIEA 3B2VL 2R15A 2Z31D 3RAJL 4G7YH 3TBVB 1T89A 5E95B 2WBJD 1XZ0A 2DRUA 2P4AB 5MERB 3RY6C 4W6XB 1JVKA 4WTXA 1MFCL 2DI8A 5E5RB 5BQ7A 2VL5A 2B20A 3WL9B 3QDMD 5D2LE 2LFGA 2P5WA 4RAVB 4EDXA 5BRZE 1JZ8A 2VLJA 4POZD 2WP3T 2B1HH 4EN3B 2ATPA 5I30H 5IWLA 2BCKB 2VL4A 5L9DH 3QFJA 1IJ9A 3EYUH 1WLHA 2UZXB 2IGFL 1MCRA 4RSVA 5E6IC 3MRRA 4LCWB 5L2JB 4GMTH 1II4E 5AZEL 4CDHA 5I8KH 1TVBA 3MA9L 1EZVY 4AM0A 1UFUA 4HV8A 4NN6B 4OZ4A 2H1PL 2ZCKH 5BS0B 4ONFH 2BFVH 5IM7B 4ZFOL 1FNSH 3WEXB 2FLRT 5DJZB 5E08L 2P44B 3ZL4H 4QRSA 2YD3A 1AH1A 1EGJH 1I7ZA 5KOVC 1NC4D 3TYFA 3GGWB 3VXQB 1MVFA 2EYRB 2PW2B 3MRFB 4JG0L 5ALCL 2GJZB 2YA0A 3QA3A 2HTKD 4LGRB 4UV7L 4CVXA 5KSVB 4RWYH 4KQ4L 3U0TB 4WI5A 4KI5D 4MMXC 4F7MA 5KOMC 3MV8A 4CAGA 3LCYA 1KCRL 4OM1L 4JE4B 1D5IH 4JZNA 1Z3GH 4N0UE 4PJ7F 3TFKD 3PNWB 4CADB 1GC1L 4XCEB 3K0WA 2B4CH 2XWTA 1I8LC 4NRYB 5DUBA 1JGUH 3QJHB 1FH5L 2AJUH 1XGUB 3K4ZA 1S7TA 4LIQE 4TVPL 3GSNA 5F72S 3VGBA 4U1SA 5J6GB 3S98A 4JQVC 5DJ0A 1FZOA 4L8DA 1WUNT 2X1OA 2D31B 3GSVA 2JTDA 2X7LA 2B4CC 5EIIB 3P9MB 3O9WD 4F7CA 3X11A 1I9EA 2NY4D 1B3JA 3QDJE 1ZXQA 5BVPH 1JGLH 4Y4FC 2ITDA 3P11H 1NMBL 4G7VH 4JFHE 1T1XA 3OJDB 4EXPX 5F7DB 1BJ1J 5K59E 3VG9C 4JRXE 1MREL 5MENA 1ETZB 2FEDD 4PJ5E 2Q20A 43CAA 3DXAD 3ROOA 4QTHA 1OAZL 2NTFB 3RDTA 2ZCLH 4ZO8A 1UA6H 3SE4C 1A6VH 5KAQF 2XFXB 1KJMB 1JGEA 2OR7A 5AZ2H 4LHUB 5CJOL 3DX8A 2CUIA 1T0MA 3FT2B 4FFVC 3W11C 1SBBA 4H0GA 1BVKA 4GXUN 2GCYA 5EU4A 5BS0E 4X5WA 3GMNB 1MCQA 3FAXA 5GJTH 5E7BA 5HD8D 5IVOA 4HQQH 3C5SA 1CIUA 4Y4KD 3QRGL 1SYVB 2V7NB 2CKBH 4P2QD 4LAQH 3BT2L 4S1QH 1AGCA 1G7LB 4L3EE 2I07B 3ULUC 4I0PB 3PHSA 2YHGA 2HTLD 4PRIB 4GQ9H 3OKEA 3MBEB 3BIAX 2BRRL 4I3RL 1AR2A 1Z9OA 1FYTD 4RNRB 2YRZA 2B1AH 2XA8H 3DX9B 4PJCB 5EC1B 4R2GB 3IAPA 2ZUTA 4JGJA 5KSAC 4M5YL 1T22B 4KKCD 4P4KD 5EUOB 2QQKL 2X70B 3MV7B 3EW3B 4MAUH 5DVLA 4HBQA 3BWAA 5CD5D 4Z7UA 4BFBD 3QUKA 2VERN 4LPVA 1NGXB 5D5ME 1IRAY 4M6ML 2FECI 5BXFB 2JCCB 3WE6B 1EMTL 4GLRH 1JTTA 3RPIA 1RMFH 2CLRB 3KPLA 4KZEH 2FX8H 1G6RL 1X5AA 2A9ML 3S37H 2DYPB 5J11B 2W60B 3EO1B 4QF1A 5F6IC 4NKIL 5GISL 3FB7A 4QOKD 5KN5A 2D7NA 4BELD 1N2RB 3QIUB 2AERT 4JO3L 5JHDD 5E4IA 2BOCB 3V5KB 3A0OA 4R0LC 3HB3D 3ARBA 4U05A 3L5JA 3SCMB 4AL8H 5DJCA 1ZT1A 4Z0BH 3RA7H 1UH2A 5D96C 2D7TL 3U48A 5DUMH 3Q5TA 4Q9BA 1AFVL 5GGTH 1MJUH 1ES0B 3CCHB 1ZEAH 3IDUA 5I71C 5ID1A 2R29L 5J13C 1BVLB 2LTQB 4XNMB 4XNUL 2GJ6B 3GSRB 1F42A 2JJSA 4R3SB 1LE5B 1S9WA 3EJZD 3GZKA 3BKCL 1WGOA 1LD9A 1AE6H 1TQCB 2J2ZA 3TNMB 4QRPA 5B3JF 4Z0XB 1J1XL 1Z9MA 2OZ4H 3BPLB 5J1AA 2EEAA 3TBTB 1XF3A 3HZKA 5C09A 3V5HA 3VI4F 2X4QB 3C2SA 5DQDH 4IEFB 2YD7A 3V7AG 4UDUA 4PJIF 3I6GA 2NY6C 3EO9L 1RUAL 2IH3B 3GMMB 1UJ3C 1JBJA 1SJHB 1KN4L 5MP6L 4ODUA 4PRIE 4JB9H 5IBLD 3DVIA 4FQXB 1U8HA 2W0PA 1DDHB 3K7UA 5IHLB 5JLZA 1AR1C 3S35H 5DQJB 1JHTA 4Q74A 3WDJA 1KJ2H 2CLVB 1ZHLB 4LSTH 4TNWF 4KI1A 1AO7E 3FO2A 4PB0L 2ZUXA 4QHNA 1XIWD 3TC9A 3HPJB 4JREB 4J3TA 5EUOE 3IS1X 3TPUB 3GI9H 3N1PC 1XF2A 3RWEA 4MD4B 4OZHA 1ZS8B 4ZPVA 1DE4A 3D0VB 3IJYB 3L7FB 4YWGL 4P3DA 3CFDA 1Q1JL 1NCWH 4K9EC 5AYUL 4N5EC 5L2KA 2JCCE 5B21A 4ORZC 1QRKA 4XVSL 4PJGF 3OJMB 5DEZA 4WWKB 5DK2B 3T0EE 4XTRD 2FBJL 1MCPH 4S1SH 1YMMD 1NMCC 1ONQB 4GAYA 4KRPD 4FFWC 3Q2CA 3BW9A 2NY2D 3FRPG 1HDMA 3VWJB 3S34L 1BF8A 4HIXH 1TPXC 4YX2H 2YZ1A 4MD5B 3L3DB 4HX1A 1CGSL 4XCYB 5HYSB 3QNXA 4PP1D 2VAJA 4Y1AD 3KYMB 3WO3B 5FHAH 3VA6A 4XNXH 1JNLH 2HJKA 4K94H 1ADQA 3HR5B 5B38B 3WNKA 3GJFK 1IC7H 4V2BA 4MA3B 1YJDL 3I3EA 2WZPD 1XGRB 4RAHA 2R2BB 3D25A 2GFBB 5KVFL 3RY5A 1F4YL 5DFTA 2ADFL 2W91A 3TBWB 3CVIH 4HWEL 5FK9A 2FO4B 3L3HB 3NGBB 3RVWC 3F5WA 3NH7L 2IQAA 2MNUA 5IHUL 1UXSB 2O5YL 1BFOA 2F5BH 1CL7H 3ARYA 2Q86B 3UCRA 3ARUA 1E27A 3S4SA 4ZTOH 5MI0B 4Z8FH 4WJ5B 4Q9QH 1KJ3L 3T4AB 4X8JB 3E3QC 3KJ4C 1NCTA 1KFAL 4X8XA 2BSRB 4Y2DC 1CCZA 1V7NH 1BZQK 1RK0B 4ZUSB 1WBXA 2PUQT 1U8OA 2G5RA 3FB8A 2XYCA 3ORJA 5LJYH 4NO5A 5CILH 2L7JA 5IJKC 5I16B 3R1GL 2R4RL 4APQC 1F3DJ 5IOPB 2APVA 1RHHB 3EHBD 2VDPL 2NX5B 3V6FB 5F9WC 4WRLA 4NKMB 2VDQL 2P5WD 3PWNA 2GSGA 3N9GL 4L8BB 5FECA 1VGEH 2XXCB 3BSZH 5DHYB 25C8L 2FATL 2ZOLB 4MJ6A 3QFJD 4GRWE 4A6YL 4Z78B 4OFPA 2BY3A 4D0DA 5GS1B 1P6FA 5DEFA 4EOWL 4OBSA 1FFQA 4P5TC 3MYZA 1MWAH 3G6AB 5DJ6A 5ITFB 3A6CH 2C4XA 1A2YB 2KDGA 4GRMA 1ODAA 3QAZB 5J12C 1PEWA 3GB7A 3ULVH 3RWGA 5CJXC 1IGMH 4HK3J 4UT6L 4OB5H 1YEJL 3MOAH 3BP6A 2BVQB 1CD0A 3O4OC 2NZ9D 4YHYC 1ED3B 4PS4L 5CEXA 4PD4J 4OLEA 12E8H 3E8UH 3LKRA 1V3MA 3ULVC 2ZKHL 2ARJQ 3GKWL 1G7MB 1S7QA 2RFXA 3GNML 4PREB 4JN2B 5F9OH 3VGAC 4DN4H 3BE1L 2GI7A 4EQ3A 3Q3GB 1M7IA 4HZLB 5FA4A 5ILTH 2ZUYA 1M1SA 2WWMC 5D93C 3VFPA 4XXCA 3WS3A 4F7PA 5KSBF 3FJTA 5D2LA 5BRZA 2DQHH 5C2UB 1UWGL 3FMGL 3UBXG 5IHZA 3C08L 4G43B 3V0VA 3R06A 5EU3A 2EDTA 4HWUA 3VFRB 1NL0L 2H3NA 4HC1A 4O02H 3HG1A 1FVCB 3RVTD 1NGQH 3BH8A 3QDHA 4YXLL 3VCLA 2YEZB 1OP5H 4FG6D 1KB5B 3B2UC 1A6AB 4GRLB 4TPRL 4OF8A 5DHVB 1C5CL 1TETH 1EHLH 1T03L 4BZ2L 3TBSA 2MOVA 3C5JB 4F57L 4WHTA 1X6NA 2NX5E 5IMLA 5MEND 2FO1A 5F7KC 3NCMA 5DJYA 1W72B 3V5DA 5HVWA 3LEYL 4XWOD 4Z7WB 4YDJA 5DSCA 5CJQH 4PLKD 1T1YA 3RDTD 3WIHL 2J6EL 3SKUD 4LSPH 1S9KC 3OKLA 4YFEA 4ETQB 3HUJE 1S5HA 3NCYS 4WV1C 3VD3A 1QLEL 5SX5K 1QVOA 3ZT7A 3ME0A 4QXTB 4Y89A 4QT5B 2A6JA 3QRFM 3U1SL 3CZFB 3I9GL 4UTBH 5SWQA 3CLEH 3LDBC 4N0UA 2CIIA 1CN4A 3L3GB 1IC4H 4Q97A 3MLVL 5F3BA 4ALAH 4ZUTA 3SPVA 1QFUH 1A5FH 1QBML 1HH9A 2EDHA 4I4WA 5D1QC 5CGTA 5DUPH 2EZ0C 1YDPA 2EIBA 1ZOXA 5KG9A 3QDJA 3FQRB 5CIPH 1FZKB 3RIAF 3TBVA 5JPNB 7FABL 4NUJA 3IS0X 1A4JB 2Q7YB 2QADD 5MERA 3QUMB 1FPTL 5CSZB 5I8CA 1OM3L 1UYWH 4OM0H 3WL9A 3QPQC 4P23B 3T8XB 4I18A 2AK4B 3NCFB 4GAGH 4AK1A 5I1DB 4XP4L 4EN3A 3VXPB 3L5HA 4FQCL 2PXYB 3QNZB 5FUZH 3TJHC 2EE2A 3MLWH 5HHOD 3QEUB 2HKHL 1EVUA 4LCWA 4XMPH 5L2JA 4Z7OF 5ACLA 2DQFA 1L6XA 3KYOB 5DFVD 4KROD 3IRPX 4B41A 1AQKH 5IR1B 2VC2H 1J10A 2JLLA 2VE6B 3EOTL 4DGIH 5BS0A 3MQIA 5IBUB 1ZA3B 1MCEA 2A83B 5DJZA 5JZ7C 2AKRB 1KIRB 3WFHA 4KKBD 4NWTH 3GGWA 3VXQA 4EUPH 2X40A 2A1WH 4G8EB 4WNQB 2XZAL 1WSST 1FORL 2EYRA 2J4WL 1EPFA 1J8HB 4UTAH 3U6RA 3TN0D 1KF9B 1P4BH 4R97C 4PV8A 2X4TB 2LQRA 4L3EA 5D1ZC 5KSVA 3ARBD 2DQCL 3SOBH 3U0TA 1VPOL 1F5WA 1KCVH 4DQOL 1I8MA 2G5BA 3QQ9C 4PJHF 1KGCE 3V52L 3VG0L 3DV4A 4WUUB 4JHBA 1DQLL 4HWBL 1YNKL 1MLCB 5A2FA 1PBYA 4LVEA 2HA1A 4JR9L 1KPRB 4CADA 4XCEA 3KPMA 4NRYA 1EX0A 4XHQA 1BWMA 2HLFC 3INUL 3E0GA 3QJHA 5FM8A 5CEZH 1XGUA 4X6BB 4Q6IC 3HZYB 5A40E 2SEBB 1VKXB 5J6GA 2I5YL 2OR9L 4KK9C 1IBGL 1AHWB 2D31A 2OSLB 1EH9A 1A22B 3KVQA 4LLDB 2D03L 3P9MA 4IDLA 4ISVB 3ARRA 2Y6SD 4PJ7E 2VOTA 4HWZB 1FLRH 4I5BB 3LKSB 2EE9A 4ZUWB 1ZLWK 4HKBB 1RZIB 2I60H 4B50A 1ETZA 3ES6A 5JW3L 1SM3L 3LRHA 4EI5C 1H3XA 3S88H 3HKFA 2NTFA 1IAKA 5F8RC 1G7HB 4KKLD 3FO0L 3VFWB 3QEQB 4JM2D 4F37F 2XFXA 3ESUF 4LHUA 3VH8B 1BX2B 2QR0B 3FT2A 3IDMB 5E8NB 2MCPH 4UILL 5DS8B 2WBWB 1MIEL 3GHEH 3O2DL 1UEMA 2Y5TB 4M93B 2P8LB 4RDQG 4IMLB 4U6VH 3B8YA 4C4KO 1JF1B 3GMNA 4NPYB 2ERJB 3AC0A 3VFTB 4C54A 1OP3K 5DHXB 1FO0L 5C08D 4P2RD 3D85D 2FECL 1N6UA 2CDGB 4O58L 4X9BA 1AJ7L 1TNMA 2PTVA 1SYVA 1MCWM 5H2BB 2V7NA 1JYXA 3O0RH 2DI9A 3QI9C 3D39D 5HYJB 3PGFL 3MXVH 4M6OL 3GBNH 1G7LA 1VFMA 4ZSOB 2I07A 4I0PA 3JV6A 1EO7A 4PRIA 3KPRB 3WKMH 3HMXL 2MQCA 3MBEA 5E2VH 1VA9A 4UIKH 2P1YA 3OPZL 1IGIH 1LO0H 3C9NB 4OI7A 4WUUE 2A0LC 4RNRA 1BQHG 2W9EL 5E4EB 5GGVY 3D3VE 3DX9A 5EC1A 1ZHNB 2CXGA 3BDXA 5DC0A 1T22A 5EUOA 3TVMA 1KIPB 2X70A 3MV7A 1R3LA 2ZG2A 5A1AA 4BJLA 1MEXH 1NGXA 3TZVB 2CUHA 5BXFA 2JCCA 4N0YL 3WE6A 3P73B 2WBJC 4K3HA 2CLRA 3WXVL 3T0EA 5KS9B 2DYPA 5F7EL 2D3VA 2W60A 1TTUA 3WO4C 4WO4A 4POZC 1G1YA 3H3PH 1WEJL 1OSPH 3FONB 4LCUA 1YYMH 1N2RA 3QIUA 2NQCA 3S6CA 5EOQH 2BOCA 4ZAKC 4JO2H 5IMKA 3V5KA 1XEDA 3VXMD 1AD9B 4ZD3H 5TF1L 5K9QI 1AQDB 1V7MH 3SCMA 2YA2A 4N1HB 3QEQE 4F9PA 2MCG1 4OCSL 4TOYL 2Z91A 4JPKH 3UJJH 2IANE 1X4XA 5HHMD 1ES0A 1KN2L 3CCHA 3WXWL 3MZGB 4ZOAA 4ODHH 4GXUM 4OV6F 1U3ZA 4YHZL 3LN4A 4XNMA 5AAMA 1HHHB 4NZTL 5ADOL 1IAMA 4BK5A 4QWWC 4NQXB 1UB6B 2GJ6A 4FP8H 4YBLC 5C0CB 4H1LB 4S1DD 3W2DH 1LE5A 3TNMA 3VXRB 1LO2L 1GGIH 1MCLA 5ABDE 3GSOB 1KSRA 1TNNA 3VMPA 3CH8A 2HTKC 4Y16D 3H7BB 3TBTA 1VHPA 1DBBL 2AABL 4O2FB 1CLOH 3QDGB 2X4QA 3ARZA 5JOPD 3N50A 5HYJE 35C8L 5F3HB 4JPWH 1BIHA 1QYGL 3BQUA 4P5KB 3SKOA 5AD0B 4ZSOE 2IH3A 3OAUH 3GMMA 1C08B 1LMKA 1SJHA 3HNTH 1ZTXH 1ZGLM 5B3JE 2VZ1A 4N8VG 5FCUL 3B9AA 3O11A 5JMOC 1KEGL 3A67H 3TFKC 1S8DB 1Q9WB 5JO5B 3VI4E 4HUWB 1S7XB 5DQJA 2ZUQC 1DFBL 2CLVA 4PJIE 5E1AB 1NEZB 2IAMB 2EDNA 4XVTL 3RZCC 4M3KB 4QRUA 5JW4Q 3GIVB 3C8KA 4UBDD 1G7IB 2VDLH 2YWYA 4MD4A 3O9WC 4YXHH 5IGXH 3D0VA 5E2UL 3IJYA 1XF4B 3FHAA 2GK0B 3L7FA 4MHHG 3S8WA 3HE6B 5HI5D 5C0JB 4RAUA 4WWKA 1LEIB 4JG1L 5BRZD 1D9KA 1L6ZA 1L9MA 1ONQA 2IBZY 5ECJE 3VWJA 1IEAB 4XMKH 1E28B 5CAYB 4MD5A 4N0FA 3L3DA 2FIKA 4PJGE 4XCYA 4OCMC 3SY0A 3KYMA 1XGTB 2NXZD 4CNIB 2F58L 3HR5A 5IROC 2WK2A 2CIKB 1RUPL 4OFDA 5HD8C 4OIIH 4M43H 1I1YB 4MA3A 3MPCA 3TCXA 2H32B 3W39B 3HAEG 3I50H 5C0CE 2R2BA 2CJUL 5SWZB 3FN3A 5DD5H 2VWEE 4E9LA 1WWWX 3WHE0 3TBWA 2FO4A 3RIAK 4K2UH 3L3HA 4U6XB 5E1HB 1CFTB 4R26L 3UDWC 1UXSA 1NLBL 2F9BT 5I75B 2EDOA 4OFYA 2Q86A 3NTCL 3FL7A 1CFVH 1GL4B 4OCYL 4CL7A 2XZQH 4WJ5A 3T2NL 3SE9H 3MV9E 3VD9A 3T4AA 4LSQL 5CS7A 3NABL 4X8JA 3NIGE 1LNUB 3I3DA 4XP5H 4HF5H 5DURB 1HWHB 2BSRA 3B9EA 4KKCC 4P4KC 1CU4H 1RK0A 3FHQA 4ZUSA 1PVHA 1R3HB 5KZCD 5CD5C 5T1MB 1RZ8B 1MJ8L 4M1GL 4KUZL 2E9JA 4OSUL 3S97C 4PUBL 1S5IH 4XMLH 5IOPA 1WK0A 1A6UL 4JFHD 3S5LG 5LVEA 1Q94B 4HJGB 1VEMA 2NX5A 5HBBA 3IXAB 4NRZA 4JRXD 1B88A 3V6FA 4R4BB 3DECA 4ODSL 4NKMA 4PJ5D 4PJDB 3PWLB 4NZJA 1NANH 4JZJA 4ZQKB 4H26B 4L8BA 4NZRL 2I25N 5DHYA 4M61B 3DVNB 5IK3B 5CSGA 2ZOLA 3HB3C 5DLML 4Z78A 5KVDL 2EH8L 2OL3A 5GS1A 4GXVH 1YECH 3HUJA 3W82A 4YFLI 1I3GL 1TITA 2VXTH 1QR1B 2P7TB 3QCVH 3QXAB 3V0AC 3PP4L 1A2YA 5MEOA 4Q2ZB 5D2NE 2KBGA 3FT3B 1BOGB 5E6YA 2BVQA 2EKSB 1ED3A 3EJZC 3WUWB 1T66D 4LLYB 3HLAB 1OAKL 2RQ8A 3U0PB 2QJDA 1G7MA 3ZE1F 4PREA 5SWZE 2X4OB 3NCBB 4JN2A 3NACL 2F8VA 3Q3GA 4P3CL 4L3ED 3UX9B 4L4JA 3RPKA 1J1OL 3B3IB 4CGTA 3OJ2C 4AT6B 5DD0H 5TQ0L 2OMNA 3ZE2F 4LVNB 3N1QC 4JVUA 3MRDB 3ECBB 3BXNB 5IBLC 4P57B 3THMH 1ZANH 4G43A 3MXWH 4U1JB 2FX7H 5DJXB 2W92A 3QXWA 3VFRA 1EO8L 3U9UB 5C0RL 5DJ8B 1AXSB 3MRNB 1MI5B 1XIWC 4I3GA 1FVCA 4OZIF 5KSBE 3BGMA 1JPGB 2YEZA 2MHAB 3WD5H 5ALBH 2R0ZH 4EBQL 2XACC 1KB5A 3T4YA 1A6AA 1NFDF 5GPRA 4A2MA 5GIRB 4Y4FB 1TJHH 4YHOL 1U58B 5DHVA 2PR4L 1BQLH 2GTZB 5HGDB 5AWNL 3PJSA 3C5JA 1FGVH 3X3GH 4K23H 4RMVA 5AUMB 4KRPC 4XCCL 1MF2L 4W4OC 1DQTA 2NY2C 4PJDE 3O6ML 1W72A 3Q6GL 4WEBL 4HFUH 1RZ7L 4NFCA 4LRNL 1T83A 4KVNL 2CMRH 2PCPA 4ETQA 3LRSB 4PP1C 1WZKA 5A3ID 4JFQB 4QT5A 2NY1D 2F5AL 2FHFA 2YD5A 3CZFA 4ZPTB 2XG5A 3C2AL 2FGWL 1RURL 1FN4B 4MNGE 1A9EB 5F7HA 2VNCA 4LL9A