1CFSA

Anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-unrelated peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPSRFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN))
publication title Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity.
pubmed doi rcsb
molecule tags Polyspecificity
total genus 44
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1999-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfsA01
4WVRA 3VXUD 1M6OB 4PRHB 1IGCH 5FV1L 5ID1B 4MNQD 2VXVH 3UDWC 2NY0D 4LGSB 3U9UB 3VXUB 2E7LC 1P2CA 3UC0L 1ZHLB 1Y18B 5I66B 4MNQB 1N64L 4LKCA 2NY0B 1NC2D 3QFDA 4OZGA 4MD5B 4AIXA 4UTBL 2GJ6E 1J0KA 4M1DL 1NC2B 4JM2F 3CMOH 3RKDD 2AJYH 3O6LL 1EBPA 1YNTA 4M7ZC 4ZUWB 3WIFA 5TDPA 3SKJH 4XPFL 2WUBL 2ZNXA 5DJ2A 3QWOA 3REWB 2GY5A 2H3NB 1OARH 1Q0YH 3SY0A 1EFQA 2ZOLA 2ZZUT 4YK4C 5GHWH 1GXEA 5BS0D 3RDTA 3WLBA 3PDOA 4HGKC 5GRYA 4DOHB 3GSNH 5BS0B 2G2RA 4DGIL 5EU6E 5CIPH 3K8KA 1OT1A 5SWZA 3NCYS 3TNMA 5DHYA 3T77A 2CRYA 5FYKD 3IFOA 2FL5A 4X6BA 4Q2ZB 4WW2F 4Y4HA 3EDJA 5KS9A 3LH2H 1SBSL 5FUCE 1EJOH 4U6HB 4NZJA 1J8HA 3VXRD 3TFKD 3RP1A 1QFUH 1CLCA 1FO0L 4XWOC 4D94A 2DQGH 3VXRB 4OLXL 3LKRA 3EJYD 5LXGL 1T66D 3MJ7B 4QCIB 43C9B 3LKOA 2HVKB 5D7SL 5IOPB 4X6CA 1FBIH 4K71B 2QSCH 4QF1B 5D7JC 4ODVH 3PGCA 2DICA 4AH2A 4HH9A 1BP3B 3NN8B 4NN5B 4LCWA 3S3PA 3ULSA 2XZQL 4G6KL 5ESQA 1HHKB 1T1YB 5FIEA 3SQOL 3OAUL 3C5ZC 4JFDD 2NY2C 4NM4L 4WI6A 2LV4A 4OUUB 1NAMA 3UCRA 1WZ1H 4S10A 5IG7A 2JLLA 4JFDB 2Y36L 3BZ4A 5EB9A 3GMNA 5EZIH 4XMPH 5DURD 4KAQH 5BQ7A 4R0LA 3M17A 4NN6B 2ED8A 2W38A 1TQCC 4U1KB 5DURB 5FKAB 1N0XL 4X8JB 1S5HB 4HEME 3D85A 5DQ9A 2GSIA 4NNPH 2XZCH 1FLRL 4KDVA 4NN7C 4LPYA 4Z78B 2AEPH 2FWOB 4P2RE 2AV7B 3W9DB 4MA3A 4I4WA 2IBZY 4HMDA 4PR5B 4HKBA 5IF0B 5B39G 4GRLA 5FK9B 4OIIH 5GS1A 3VFMA 3DROB 2FSEB 5H2BB 3RWEA 5BRZE 2VH5H 2BDNL 3IRZA 3CK0L 3HKFA 4YX2H 1FJ1B 4JAMB 3GSOA 4ZFZB 3BH9B 2C3VB 4FQXA 4GH7B 2AJUH 7CGTA 5JXEA 2Q8AL 4OSUH 1HYRC 4PRID 2VL5A 5DYOA 3S4SA 1INQA 2QV2A 4PRIB 4ODHL 2M1KA 2ATPA 3H9HA 4NHCL 5ADOL 4RNRB 5KVDH 3H3PH 4GQ9H 1I3RA 1SJHA 1F42A 4J7RA 4U1JB 1QUNA 2H6PA 3FRUB 3LEYH 1LK3H 1JGLH 4PTTA 4OZHE 3FFDA 1LEKA 3TGXA 1W2KT 5D2NA 3T4YB 4NZTL 4FQ2H 5MEQB 1XGPA 3MRGB 4BKLA 3QQ4A 4Y4FA 5D1XD 4WY7H 5C0EB 3KPSE 3G5ZA 3ARGA 2P5WA 2NZIA 1VADB 4U6XB 1GVIA 5D1XB 1NUGA 1OD9A 2E3VA 1VFOA 4ZFGH 4NFBA 1QTYT 4OD3L 4GG6E 4G9DA 4LHUG 2D7PA 3MUY1 1PLGL 4OI7A 3SKMB 4LNVA 5B39A 4DUVA 2AEQL 4NC1C 3B6SA 1CE6A 4YBHA 3EYQD 1BFOA 2D7TH 1D5MB 3I85A 4S1DD 1WFOA 5D6CB 1OTSD 3KLDA 4ZPTA 5J1AB 4LP4A 5FDYA 1D3CA 4PRNB 2OR9L 3T0ED 2NW3A 4L3CB 1D6VH 2X1XR 6CGTA 4L9LB 4MXWH 4ZO8A 4LHJB 3TN0D 3T0EB 3QHZH 3CFBA 4OZHF 4LRNL 1RUAL 5CMAA 2BRRL 3TN0B 1SVCP 4KV5E 1NL0H 2GFBA 2MCG1 3O3BA 4JPWH 5DZOA 2AK4D 2CLRA 4LRIA 3CDFA 1AGBA 1CU4L 1VPOH 4JHAH 4Z95H 4L4VD 2G5BB 2AK4B 4OI9A 2EDXA 5D1ZC 3QWRD 4TQEL 1FVEB 1KB5H 4GW5A 1B6DA 4L4VB 1JMZA 3MOAH 3VWKD 2R15A 4IRJD 1GGBH 2VNCA 1FFNA 3U36B 3F5WA 4GG6F 2VXSL 3VWKB 4IRJB 5HHQA 3L95A 4OAWB 4Y1AD 3NABH 1MNUL 4PV9B 3O41B 4KK9C 1RK0A 1WIUA 4Y1AB 1NGPL 5E2VL 3GMRB 3SGJA 3ARBA 1F4XH 3V7MA 1DVFA 5EC1A 1K5NB 3K1KC 3MNVA 1YNLH 4L8SA 4LHUA 1TTGA 3O9WC 1MIEL 1UH3A 1NAMH 2YRZA 5I1KL 3T3PE 4G9FA 5TE4L 5I1CL 1DLHA 3OJVC 3QG7H 5HVHB 3DYPA 3HI1B 2HWZL 2EC8A 2HFEA 4N0UB 2DIBA 2C5DC 4PJ7E 5EU5B 3MRJA 4KV5F 4WO4C 4KK6C 4WIQA 4LVNC 1DQDH 4R2GD 1TCRA 4DN4L 3F7YA 3FO2A 1OP5H 5D7LA 4R2GB 3P3YA 4PB0L 4PLKC 4XBEH 2VXUL 2BNQB 2X09A 5CEZE 1TPXB 3S96B 3P9WB 2PTVA 2VQTA 5F7EL 5IVZB 5J11C 1CK0L 1YNKL 4F58L 1FAKT 1NQBA 2PTTB 2Z91A 1A9EB 1WJ3A 1IGYA 4C83A 3IXTB 4HK0A 4XNXH 2UV3A 3A6BL 4H25B 3R4DA 1AI1L 1AE6H 4GKSA 4RDQG 3VE0A 2QSTA 3EYVB 4AT6B 1MRFH 4NKMB 4IHOA 1WFNA 2OJEB 5FGBC 1V3LA 3KJ6L 4GBXC 3FQUA 3T3PF 5DJ6A 4HXBH 5CJ8A 5IEHB 4WV1B 4PTUB 3T09A 5CBEA 2HLAB 1NGQL 3LD8B 1I4FB 3MREA 3TJEL 4F57H 1R5IA 4PJ7F 1OWWA 5ESAB 2YBRB 4F9LA 3T8XA 4P9HL 1E4WH 1UJ3A 4P5KB 3DX7A 5TQ0L 1W8NA 1MRDL 2CGRL 2ZJSH 4DEPC 1JWSA 1VACA 1RY7B 2DLTA 4K94C 2R23A 1LVEA 2P8LA 4U1GB 4GLRI 5F3BB 4LLAA 5EBWA 2BOCB 3EHBD 4UQ2B 3M07A 5L7XH 2DQEH 1I9IL 3TH2T 4JFPB 5JW5A 3QDJA 4GS7B 2VSDA 4LLUA 1VESA 5IB1A 1YEJL 4KDTA 1U8KB 3MRFB 1MJUL 4HXAH 4MJIA 2F8VA 4C54A 1A21A 2EKSA 3DETD 5FM5O 2HT3D 3OHXA 3RGHA 4X4MA 2DM7A 1SJXA 1WVZA 2FX7L 2ZCLH 4UINH 4PRDB 1YZZA 4K7FB 2L7JA 2YD5A 4K7PL 4OKVA 3PGFH 4YWGL 4HMCA 1SYSB 2J7LA 5CILH 4IOFC 3LV3A 3V52H 1HQ4A 4LCYA 4U49A 4WRLA 3UTOA 1WEJL 3I02B 5C0RH 1YDPA 2YWYA 1P7QA 1A4JA 4HFWB 5DTFB 2XOTA 4GXVH 5EU7C 5FECA 5ERWA 2MWCA 3F7QA 1ACYL 1BOGB 3H2WA 1R3KB 3BVNA 5HGDA 1A14H 3IDNA 2Y5TB 3LKSA 4GMSL 3QUZC 4DQOH 3VFVB 4MQSB 1VFAA 3U30C 2BFVH 4M7ZB 1FG2B 4ONGL 4FQ1L 1KJVB 1NCCH 3HZYB 4HS6A 4U7SA 3F7VB 3HZKB 5DZNA 3DI2B 1KELL 5HHXL 3UTPE 2RQ8A 2XWTA 5ADPL 3GKWL 1AR2A 1GGTA 3I6LE 4FP8L 4GUPB 4PG9B 4QXGH 5IFJB 5EUKA 4YGVA 1MHPL 1RIUL 1FLTX 4NKIH 3ULVE 3DGCR 3WJJC 4Z7QE 1OGAD 1JI1A 2OJZH 4L4JA 1XAUA 5DI8A 1A7RH 3NIDE 3L5IA 4D3CH 1OGAB 3BPOB 5EOTB 4S1QL 1N6VA 3BKYH 3AU1A 2HFFA 2YC1A 5DT1L 1KENH 3VXSA 4XWOD 3D39D 1I9JL 4KMTL 2I5YH 4KGJA 3QXTA 4NC2B 2VLJE 1BM3H 3HNSL 1LP9B 2BJMH 4YBQC 4XC1H 3D39B 4PJBE 3MNWA 1EZVX 1U3HA 1PW3A 2HVJB 3LQZB 2Y9RT 3QPQC 5HYJE 1OPGL 2VAAB 4LSTH 4OFKA 5EO9B 3MV9A 2OTUA 5D7JD 4AEIL 1EEYB 1FNAA 4NRYB 3ULVL 2FEDC 1NSNH 3HMXL 5D7JB 1KLGA 3B8YA 4BYHA 5CEXB 3EJZD 2G75A 3C5ZD 4XGZB 2NY2D 3ZT6A 2HFTA 4P2QD 3RNQA 4K3EL 4D9RE 2R56L 3C5ZB 2NY2B 1IZKA 4FTVA 3M8OH 4P2QB 5IMMB 1F2XK 5E4IA 1JZ6A 3Q1SH 2FCBA 3P11L 3O6FA 3ULVF 5E4EC 4Z7QF 3ZDXE 1F2QA 4IRZH 3RZCA 1UEYA 3NIDF 4DZ8B 2P45B 5DJCA 2EIZB 3U2SA 1ZHBA 4NSKB 4N0YL 4XNMA 2CXKA 1Z5LB 1TQCB 1MI5A 4LSVL 3QIWD 4LP5A 3JUZA 5T1KA 3UXFA 3V4PL 4TSAL 3MBXL 1U3JA 3QIWB 1ORSA 2DWEA 4PJBF 3VFRA 3GUTB 3H9SD 4NN7B 3DUUB 5ID0A 1UB5B 4XC3L 3DSNA 1OTUC 4K9EL 3H9SB 4HJ0D 1N3NA 1RZJL 1AQKH 4NHUA 5A1AA 4NJ9H 4JR9L 4LKXA 4OZ4B 5FYJE 2ICEB 3BGMB 3GKZA 2D4DA 4NO2B 1FL5A 3P30L 4OI8A 4JVUA 4L8DA 3ROLA 4KK5C 1FYTA 2IGFH 2DQUH 4WEUD 4HJGB 4ZPVB 1DP0A 1X5XA 4HZAA 1UQSA 2DTSA 5EUOE 4XVTH 4HFUL 4L9DA 1P4IL 4F7EA 4ZTOL 2D7QA 3ZDXF 1T2JA 4HWZA 4DCQB 3UPRA 3ZE2E 3FCTB 4NDMA 2YPVH 1VFBB 5DR5L 4XAKD 4XCNA 4KC3B 5KVEH 1XH3A 3TH4T 1S3KH 3QPXL 5IW1B 4PJAB 3HG1E 4E41E 1IARB 3J8F7 1AIFA 4U31A 3ARFC 1FRGL 3DO7A 4IM8A 3LRHA 1JHKL 3V6BR 4KVNL 1I7RA 2ORBH 4LPXA 4QOKD 1X6LA 4ETYA 1IKFL 2IJ0C 2ADIA 5F7NC 4QOKB 1MCSA 2AK1L 4QTIL 4ZSOB 2G60L 4DFHA 2Q7YA 3JV4B 1PZUB 4LCUA 1CQYA 4M5YH 5JNYA 1NFDA 1ED3B 4XVJL 2W60B 2UVFA 5EUOF 1KC5H 3PXJA 3GSUA 1CFNA 4BZ2H 4D0CB 1DQLH 3I50H 1Q9KA 5JW3H 1OWRM 4M5ZL 4ZODA 3V5DB 3L5WB 1CD9B 3B9KC 3ZE2F 2FLRT 2P7TB 5CKAA 3X14A 4LSQH 5GGVH 5LAXA 2Y25A 2C3WA 3MLXL 3MUZ1 2Q76B 2J8OA 3HLAA 4MD4B 1CFVL 4RA3A 5DD1H 4H5SA 2X10A 1A64A 4KY1L 3VRJA 1PKOA 4YJZL 4YXHH 2RJMA 4M4PA 4F33B 5C0DB 3DURA 1DBAL 1NCWL 4Z7UB 5CD5C 1RIVH 3QJHB 5EZJA 1J05B 4Q6IC 3CGTA 2OK0L 3PNWB 4MLSA 4F8QA 4X7FC 4PJFA 2EH8L 3I6KA 2EDJA 4GW1B 2FJGA 1ZEAH 4KK9D 4P49A 1NBYB 4KTEH 5CHNA 5E5MA 1JP5A 3OGCA 3MXVL 1DSFL 5HI4C 4HAGA 3JWOH 4TUJB 2APBA 2B1HL 4MXVE 3O9WD 4W4OC 4ZXBA 1YJDC 2B1AL 3O9WB 1KJ2A 3W39B 3U7WL 4DVBB 3B83A 5GPRA 5CINH 1RUKL 1S7WA 3STZB 4A6YB 1FHGA 5FHBL 3NTCH 2NNAB 4WO4D 4KK6D 1F4WH 4GG8A 1EAPB 1FCGA 5ANMA 4PJ8D 2LAAA 4WO4B 2RHEA 1D5ZA 4P2CG 3RWIB 2IG2L 5IHZA 5GGRY 1LE9B 4PJ8B 1T83C 4HPYL 1BGXL 4QHUA 5DJ8B 4PLKD 2FR4B 5C0IB 4IDLA 3V2AR 4NBXB 4NCDA 5CEYA 3IF1A 1N6QL 4NZDA 3P40A 1YYMH 3EOAB 3RA7H 4JO4L 1JYVA 1AGDA 3S8WA 3VH8B 3WO4C 4MYWB 3L3HA 1XF3A 4X5LA 5J6HB 3VXQA 1B2WL 4O51B 1W72L 3VDCA 2XQYK 2AV1A 4MXVF 1WBYA 1H0DA 1AKJA 1RVFL 1KEGL 4I18B 3MRRB 4GBXD 4TSBH 5E6ZA 4M8QB 2GEEA 2R2BA 5EN2A 4GBXB 1JF1A 3D18A 2GITB 4RAUA 4AL8L 2K9UA 3QDGE 2H32A 4LSSL 4NGHH 4WFGD 3EYOB 3DTXA 3Q6GH 4XPHL 5D5MB 3GSRB 4OZFG 1OP3H 1O5DT 1S9WB 3HZMA 1JPGA 3PGDA 4L3AA 3VFOB 3MSPA 1ONQB 1XGQB 5EORL 1NBZA 2IADB 4HCRA 5CUSH 3QNXB 2Y7QA 4XCEA 1YMHB 4JFXA 5A2KH 5J9PB 4I13B 1DN2A 4DEPB 4LRIC 4FQIL 4YUEL 4X83A 2PNDA 3LN4B 1MPAH 1T21A 1JZ8A 3QEGL 4HUXA 1MCRA 5DHXB 1CDCA 1CDUA 2X44D 3VXTA 1FC1A 4NRZB 4RMVA 1KTKE 3N85H 2ZSWA 4BH7B 1ADQL 1QLEH 2BSTA 4HC1A 3BW9A 5E9DA 4FXKA 4KJPD 2ILLA 4KRPC 5C8JB 1A3RH 1JZ2A 2IPUK 3ISWA 2AJXH 4FXGB 4PLJC 2AJVH 3HPJB 4CVUA 5H35A 5IB2B 2GI7A 3UBXG 2ADGA 3SDCC 1MHEB 4MAUH 1A1NB 1RZGA 4QHKJ 5HXMA 2Q8BL 4F7CA 3GIVB 4WHDA 3QUMH 1CCZA 3OF6A 4H26B 1CD1B 2NTSP 3MXWH 1FQ9C 3KPLA 4OZFA 4EI5C 1HHJB 2KQNA 3VD5A 2LU4A 4PRHE 3BMWA 3GIZH 3MBED 5EFIB 3VXUE 2YD8A 2J88H 5CSZB 4DK3A 2MCPL 3DX6B 5DMIL 4J6RH 2R1WA 4MNQE 2IPTH 3HFML 3MBEB 1F90H 4LARL 2CLZB 5CGTA 5I76A 1MFDL 3MRPA 2A6KA 4TVPH 3W2DL 3EOBB 4ONFL 4IDJH 3WFBH 1AHWC 1PY9A 5GGUA 2OLDA 1ZVYA 5EO1B 5I75C 3U4BH 5GJTH 5JUEH 2VL4A 4F7TB 5J0BA 3DV4B 3NOIA 2WLYA 1CZ8H 2MSPA 3KYOB 3MRQB 4UQ3B 5CJXC 1CFBA 3CXDL 3HHRB 3SE8L 2EE3A 1HWGB 4BH8B 2A2QT 2ZOKB 4UIKH 3W0WD 2DDQL 4DOHE 5I74C 4GAJL 5BS0E 1S8DB 4LOUC 3KPOB 3W0WB 4MMXC 2A6DA 3HE7C 3UZEA 5GS0D 4KTYA 1QQDA 1EGJA 1KT2A 1OW0C 3UBXA 2CKBA 4PBVC 1YN6B 5ITBL 5SWQA 4HS8L 3S5LA 1BZ7B 5TDOB 4KQ4H 4NOBA 1F8TL 1I1FB 4IS6A 3PABA 3CFEB 5FYKE 3T2PA 2XZAL 4WENB 4PJHA 3GNMH 3QPQD 3VDAA 3VXRE 2V5SA 3LS5H 3LVEA 4DAGH 3U0TA 5FFLA 2FEDD 1H3XA 4QRPD 1F6AB 4Z0BH 3LAFA 1T1ZB 4F9PC 1NGWA 3FFCA 4QRPB 3FKUS 3QIBC 2CD0A 1MELA 3IJSA 1B0RB 1GGIH 3NZ8A 5FYKL 1DQJA 3BD3A 3S34H 1H3PL 4JFDE 2E9JA 4U1IA 3VGHA 2H32H 2R29L 5D71L 5E4EB 5E5UB 2PW2A 5EOCL 2EH7L 2EZ0C 4OGXH 5IQ9A 5C08D 2O5ZH 3DVNA 2BVOB 5C08B 4PGCB 4MDJB 2A74B 2HJFB 4HCRH 3WIHL 4RAHA 5T3XH 4YBLC 3IDJA 4J4PC 4P3DB 3T2NH 4CU6A 4POUB 4LCIH 4JM2A 1QKZH 2A1WH 3P4OA 4P46D 4Q0XL 1IKNC 4V2BA 5TJWK 4C56A 2VXTL 2A0LD 5GGQH 4JFYA 1BVKB 1PDKA 4P46B 4X6EB 1ZLVK 4PJGB 4JHWL 4KK5D 1NCUA 3R0NA 2VABB 4FNLH 1PKQA 3MGOA 4JPVL 1BFSA 4D0DA 4OV5A 4UV4L 2C7UB 3DIFA 3LS4L 1SYVB 2X1OA 4H20H 4RSVA 1ZT4B 3HE6A 2H26B 2LQRA 3AAZB 1KSRA 3NH7H 2ZSVA 1NANH 3EZJB 4PRIE 4KJYA 1GJIA 4BQ6A 4HGWB 3L3GB 5HYFA 2EE6A 5LQBH 1I1YB 3VXPA 5K59E 3QFJE 1IC7H 2GJ6A 2IFGA 4OZFH 2APFA 3QQ9C 5DA4A 4LBEA 4PREA 1JWUA 3TH3T 3SE4A 1GHFH 4NNXA 5DRZA 1NLBH 1QRKA 3TCXA 3X17A 2R69H 4CU8A 1A0QL 1FO0A 4YDKL 3ZSTA 1OAQL 3MOBL 2ZKHH 1QA9A 3HMWH 5DJXA 4P2OD 3DVGB 3ZZ1A 2CR6A 4ZS6C 3MZTA 4P2OB 3B9KD 4PP1D 4R6UA 5FHAL 1TENA 3HC3H 1X4YA 3B9KB 1XIWA 4LFHG 2X4TA 2KL6A 2VDOH 2VDPH 1JNNH 4ISVA 4ODSH 5I17B 3FB5B 3FOLA 1JZ5A 4MXQD 2BC4A 3T0EE 2JK5B 5K59F 3ZDZE 1G7IA 4B7IA 4S1RL 3FQRB 3F58L 1H3WM 2GJJA 1RURH 2FX8L 3NCMA 5MEND 5I8CB 3WUWB 2AK4E 4AZ8A 2CH8A 2VQ1A 5MENB 3LB6D 4L4VE 1NMAH 4PJCB 5FO7B 2JB6B 1PVHA 5IK3A 5HHMD 4YHYC 2GAZA 1D5IL 4H0IA 3O0RL 5HI4D 5JQHC 5HHMB 4HS3B 4UILH 1TZGL 2X7LA 4Y5XC 1OVZA 2R0KH 4Y1AE 1XF2A 5F7YC 1LO2H 4X4XB 3DX9B 1TCMA 2I9TB 4UOJA 3NPSC 4CVXA 5MP6H 1W0VA 5FYLD 4ZUTA 1FL3A 2BERA 4ODXA 1T7XA 5HHNB 4EUPG 1BBDL 5L2JA 3U7YL 5J4MA 3ZDZF 2H9GA 4N0UE 1KIPA 1HEZA 4JFOA 5KG9B 1IVLA 2WBJD 1MUJB 3AMKA 2RR3A 3EOTL 5J6GA 4P2RA 4X9FA 3WFEL 2Y72A 4OD2B 2NY1C 3WXWH 3ET9F 1RUPH 2WBJB 3QUXA 4Q9CA 3LOWA 3TBVA 2MQ3A 4LPCA 5HDLA 2X4NB 1KCLA 1T0MA 3TZVA 1TVHA 3KLAB 1F3JA 5T1DH 1G9NH 4XP6H 3QXVA 2QTEA 1NGXB 1JPFB 4GRMA 3ARZA 1MFEL 1N64H 2BSRB 4X6DB 1NMCC 1K2DB 2VDKL 4RAVA 4UTBH 3S3JA 3GI9L 5FOBB 1MCOL 1KEMH 1NMBL 1RZKC 2QKIB 3FTGA 3K46A 2CMRH 1KCSH 1JPTL 4E0RB 1XGTB 2NCMA 2APXA 5E8EA 3JWDC 4LIQE 3BE1L 1Z2KA 2XNAA 4KKNA 5DMGC 1YEIL 1D5BB 4X8XA 5HGBB 2EIEA 3GBLA 4FFVD 4I8DA 3KPMB 4DGIH 4EUPA 1MQ8A 4HWEL 3DWTA 5INCB 3IVKB 3KPSA 4XBPA 4K7PX 1KCVH 4X9IA 1KLUB 4LMQI 5F93C 4GG6A 3QT2A 4U2ZA 4XT1C 4ZOEA 2KPNA 4KRLB 2AI0L 1MJJB 4X7TA 4Z7OE 2JJSC 1JWMA 3BESR 3FQXB 4KRNA 5JPNB 5F7KC 2V2TA 1FO0H 2A38A 2QQNL 1R3LB 5IM7B 3IU4L 3WJLC 2UY7A 2A6IB 4OLXH 2BSED 5LXGH 4CW1B 1SY6L 5D7SH 1I8KA 1HYSD 4OF8A 3LQAL 3SDCD 2X2YA 1K4CB 3U1SL 3OR7B 1AO7D 3FL7A 4JN1L 3SDCB 3BIKA 1YEGH 1AO7B 5B3JE 1U93A 3OAUH 2WUCL 3IETA 4XX1G 4EI5D 4K3JH 3CC5A 4WNQB 4NQCD 1R0AL 3BPLC 3FRPG 4EI5B 3FZUC 4G8FA 4NFCA 4NQCB 3BPNC 4KKAC 4Z5RA 2EYSA 2ITCA 4P5TD 5I16A 1RZ8A 4NT6B 2HMIC 4P5TB 3ES6A 4U1NA 1IGTB 1KYOJ 4Z7OF 3FO0L 3SPVA 3T1FB 1BFTA 1MCLA 4NZRL 4AG4L 3G6AB 3TCLB 4TULH 1FV1A 1AHWB 2PN5A 5IMKA 3IDIB 5IMOB 4OD1L 4O9HL 1AR1C 1GZPA 3V6ZA 1AGCA 1RUQL 1U92B 3HRPA 5BV7C 1GIGL 1JV5B 4PJ7A 3SDYL 3HE7D 1FFRA 4XCCH 5B3JF 4GFTB 1KJMA 2X70A 5I74B 1OM3H 2BDNH 3HE7B 1JUFB 3UX9B 4AIZB 3CK0H 5AYUL 4HX1A 4KZEL 2Q8AH 2NY5L 1I7TA 1OGAE 3OKOA 2F58L 3BQUC 3QDMD 4R7DB 5B38B 3BKML 1EFXD 2WWMC 4R26L 5ADOH 5DUML 4DKDC 1KN4L 1R5WB 4APQC 1A9BB 5DMKA 3QDMB 1LP9E 2ZUYA 3FRPA 4ONHA 1H5BA 3D39E 1EFXB 3MA7B 4S11A 2IPKB 1LGVA 4V1DD 1A3LH 1UWXH 1AC0A 2B0SL 3GJFB 4WU5A 2Y06L 5IV2A 4GSDH 4HUWB 1QFWH 2AW2A 3C8KB 1Z0MA 2OI9C 3QIBD 4XXCC 4DZBB 4U6VL 3M1BB 1BFVL 3PWUA 1YEHH 1R6VA 1EHAA 3FB8A 1JPSL 3TF7C 5D7IB 3QIBB 4ODWB 2N4IA 5JLZA 1S78D 2CPCA 4QXTA 5BVPL 1JYWA 3DRTA 3IRPX 3RWFB 4P2QE 3BDYL 3PIQB 3WFHB 1JHLL 3VD9A 1PLGH 1QO3A 5FV2A 4WHTA 2AQ1A 5JQ6L 4DW2L 4NO5A 2AEQH 1SEBA 3L3DA 4PJDA 5HDQL 3U4EA 3L6FA 4LSUL 4LVOB 2BP3A 4E42B 1V7NL 4JDVB 4DKEL 3FT2B 2DQDL 4WCYL 4YC2C 3IFLL 4GOSA 3TWCH 3OAYK 4J4PD 4EUPH 1S9VA 1LP9F 4DTGL 5F9DC 1EA9C 4D8PB 3PDGA 1RUAH 3D0VB 1AC6A 2BRRH 2HKFL 2VLMD 2ATKA 3H9SE 2W9EL 5D96C 4ZNCD 3RX8A 1CD0A 4JY4B 1MHHA 4LLWA 1WBZB 3WBDA 3W5NA 3F8UB 5D93C 4LEOA 4J3WA 1NEZG 4TQEH 5GGSB 3LEXA 1JGDA 1U91A 3GZKA 4JFFD 3MRDB 4NKDA 1Z9MA 2AXFB 3PDDA 2VXSH 3R0MA 4Z0XA 4JFFB 4CN6A 1I9RL 5CBAB 1M71B 4DUXA 3L7FA 1NGPH 5E2VH 5E2UL 3M45A 2H41A 3C5JA 3OKEB 4OF7A 4CJ0A 4YHZL 3V5KB 3VXMD 3WS6C 2XQYG 1UKQA 5E08H 1XF4B 1JGEA 3VXMB 1MIEH 4LNRB 4Y19D 3TBWB 4C55A 3VWJC 1ZSDB 2DM3A 5I1KH 2ICES 2P47B 4XAKE 1G0XA 4PJAE 5TE4H 3VFSA 1YN7A 4AEHL 4Y19B 4BJLA 5I1CH 1OGTA 3U46A 5KSBF 3C87A 1XGYL 2GTWB 3P0VL 2YUXA 4X9HA 2HWZH 3WKNA 5HYQA 4IRSC 4RZCB 1LILA 1MH5A 3B9VA 5CS7A 3EFFB 2ID5A 1ZLUH 4QOKE 5ICZA 3UBXI 3RPKA 2XXCB 1FZMA 4ZSOE 1NH6A 4PB0H 1MCCA 2VXUH 3WN5C 4EJ1C 5F96L 3EUUA 3BD5A 5F7EH 3V6OC 4BM7A 4Z8FL 1YNKH 4F58H 1I1CA 3JV6B 3PHQB 3KPNA 4L8CB 4M7KL 3LN5B 1ZTXL 3HMXA 4OCNC 1NFIA 3SCMA 1U8LB 1EHXA 1MWAB 2GK2A 3IU3B 3DUSB 3KJ6H 4JDTL 1TZIB 2E6PA 4KKLD 5CJQL 1ZVSA 4WFED 3KGRA 4R90L 2FO4B 2CIKB 3MCLL 4OF5A 2WZPD 1NGQH 5I1AB 1U6AH 3IDYC 3N1PC 4RMRA 3TJEH 2YZ8A 2ARJB 3H8NA 1RHHA 5K9JH 2HYMA 1T1WB 4Z7UE 3MGTB 4LLYB 2I07B 2A77H 5L88L 3NCBB 2VC2L 1MRDH 2CGRH 1IGML 4N0RA 1K3ZA 2EE2A 4YHYB 1N5AB 4Q7DA 3SDAA 4FQJL 3RWGA 4Y5XB 3FQWA 3ABZA 3GMQA 1GC1C 2BOBA 3NMEA 4L8BA 3NFPB 3QDHA 5D2LA 3NPSB 2OMNA 3GMPB 1DEDA 3PWLB 4O4YH 1YY9C 5C0JB 5IJKA 3ZO0A 2FZ3B 3VA6A 3SE3A 3VFNB 3DUHA 1Z3GL 1N59A 4LCCA 8FABB 5KVGL 3HRZB 1QSZA 2UY6A 3T1WA 4KZDL 4QHNB 2D0GA 2VR5A 1EHLL 3CZJA 3TBTA 1K85A 3L3KA 4C4KO 4FZEL 1C16A 4WW2C 3MROB 5JR1H 4JN2A 4W6YB 3RWJB 2FX7H 2YRLA 3MYJB 4HLZG 4EDXA 3KPQA 3TP4A 5MI0C 4J8RB 2NXZD 1MCEA 1IC1A 1X5LA 3GGWA 4Z7UF 3G5YB 3FB7B 4BSVA 2IANE 4YWGH 5J8OA 4MNGB 2NXZB 1FZJB 4R7NB 4MAYD 2DWDA 4I0KA 3R1GL 1WEJH 4M48L 2R1YB 3T4AB 4E5XB 2VLKD 4MAYB 3ZTJG 4PJ5E 2XTJC 5A3IC 5J7CC 3P73B 4A6YL 5EUOA 3UAJC 2GK0B 4QHMA 2VLKB 3VFPB 4PGEB 3MRCA 5KSAA 1ACYH 4OLVL 1NMCB 4OT1H 5T5NF 2XI9A 4LLDA 4NP4L 4PGZA 1JZ4A 5AWNL 2G9HB 2ZUUA 2PUQT 1BIIA 5DMGD 5SV3A 1PSKL 3I6GB 3L3JB 1ZWIB 3HG1A 5EOCJ 4E41A 1A7QL 3KPRD 4OLEA 2VXQL 5D5ME 2OQJB 3AMLA 1CI5A 3KPRB 4P3CL 3FT4A 1EERB 4JFHD 5IFHL 3U9PL 1GH7A 1WCQA 3H7LA 2J12B 1L9NA 4JDZB 5ETUA 2EE9A 3R8BB 3VXNA 1GOFA 1WTGT 4HG4K 3BDXA 1PAMA 1RIUH 2YUVA 1A7PL 1CQKA 4HIIA 3SDDA 1E28A 5TF1L 3OKKA 2PXYA 2A9NH 3OXRA 4YFDB 2ESVD 4S1QH 2SEBB 3ILPB 5BCAA 5DRXA 5I2IA 4MNHA 3DGGA 5E99H 1BD2A 2ESVB 2EXWC 1T2XA 2BRQA 2YA0A 5KW9L 1QEWB 3QEHA 4KMTH 2W07A 3W11D 4JPIB 4AQOA 5HGGS 1ZT1B 2X4OB 4U2YA 4C4KT 3KXFD 3K8MA 4MX7A 4HD9A 3P77A 3WFDL 3LZFL 1E27B 3KXFB 1OPGH 2OSLB 3I3BA 4GAGL 2AJZB 4NO3A 4AEIH 3HC0A 5CAYB 3ULVH 3VFWB 5IR1A 3HMXH 3V79C 4UDTA 4HT1L 1P9MA 4IBLT 4QTHA 3GHEL 2WWKO 2DKUA 5D5MF 4K94L 3BZEA 1JHTB 5IQ7L 4K2UL 4K3EH 1OL0A 5EG6C 2R56H 4IMLB 1TXKA 4HIHB 3L9RA 3FZUD 3MR9B 1UXWA 4I2XB 3QH3B 2I60L 1G9MH 4UZGA 4ZTPH 1MCQA 4JY5L 3MLZH 1AH1A 5D6DC 4IIQC 5JDSB 3ULUH 3ESUF 3C09C 3CCHA 1H15A 1UFUA 4Y5VA 1CLZL 5JHLH 1AP2B 4XCYA 1T5XB 3PL6A 4N0YH 3GBML 5EU7E 4HIJA 1PX4A 1LO5B 4DJMA 4QNPE 2E9BA 1IC5L 4G8EA 5KSUA 3V4PH 1JFQL 4TSAH 3GK8L 3MBXH 2LTQB 1KACB 3REVA 5M95B 1A6TA 2ZUWA 1Q9OB 3WUZA 2VYRE 2YRPA 4QHKI 3MO1A 2BMKB 1ZVHA 3MACL 4EN3C 1W72A 3KYKL 4JR9H 4XP5H 1ZE3C 2VLLB 1LD9B 2NYYD 3OAZK 1CIUA 2QQLH 3P30H 4R97C 3QNZB 1F4YH 4OTXL 1L4IA 3W0WE 1UA6L 4BZ1L 1QFWI 3FQNB 3X11A 1S7TA 2OZ4L 1K8IB 3T2OA 4HFUH 4ZTOH 3CSGA 1G7HA 2XWBB 3C6LC 3TA3A 2XKNA 4APQD 5DR5H 4Q9QL 3ZE0E 1F97A 4QNPF 2VJXA 4FZ8L 4APQB 3QPXH 1RJZA 2X4UA 1CTNA 4JZNA 1DLFH 2OM5A 1FRGH 1LO3L 5F9OL 3PV6B 4CMMB 3W9EB 4K3DL 3VJ6A 3VGEA 2B39A 2P24B 1MJ8H 2OI9B 2V9TA 5GS0L 2AJSH 4EDWH 2VE6A 3FOMA 4QRPE 2P46B 3ILQC 2AK1H 2GIYA 2NY6C 2G60H 3RGVC 2AERT 1OF2A 32C2A 3MRHA 2IFFH 1YQVL 4M7JH 3OJDB 4W4NA 2BNRD 1MLBB 5JOFB 2VDNL 3HAEG 1ES0B 1JIBA 5KANG 4M5ZH 2BNRB 3FN3A 1A47A 5IBTL 1IMHC 4YC2B 3CD4A 5C08E 5C09D 3WDJA 4D9LL 3QZWA 4Z6AT 4G8GA 5IIEA 1N2RA 3ZE0F 5DQDL 3H7BB 3AXLA 5C09B 1CFVH 3MLVL 4FHBD 1ZXQA 2D03L 4N5UA 4HLZH 3WD5H 5B8CC 5D96B 5KAQF 1Y0LB 4AQ1B 2VKWA 4NQED 4QT5B 1S9KC 1QR4A 4NYLA 4EOWL 5T33L 1NCWH 4U6YB 3QULB 4G6MH 4PJGE 3G04B 4NQEB 1A6AA 2X9WA 5F70A 1N6UA 2GJZB 4X9GA 1QBBA 1UM6L 1CBVL 2Y23A 3U48A 2EC9T 1N26A 3UJIH 5LGJB 25C8H 3ZTJH 4M8VA 2DLEA 4JGUA 4WI8A 1KOAA 4JQXC 1CT8A 2F54D 2PKDA 4DGYL 2RIKA 2D7OA 2B1HH 2PYED 1MJ7L 1MAML 2F54B 2Q86B 4HWUA 1UC6A 5F88B 4PRHA 5GGVY 1ZA6B 5ID1A 5D70L 3VWJD 2PYEB 4OV6F 3JVGC 2QADC 3U9UA 3VXUA 3SHSA 1ZHLA 3MLSH 5I8KL 2Y6SD 4RFNC 1FNGB 4MNQA 1RUKH 2WP3O 3VWJB 5I66A 3TBSB 1HSBA 4MD5A 1CGWA 4NPYB 1MY7A 4U1LB 2RBLA 4JFEA 3SDXB 1KG0B 1QD0A 4MJ6B 1NBVL 3G08B 5IVOA 4ZUWA 2IG2H 3SE9L 4M61A 1FFPA 4HPYH 2V2XB 1N6QH 2FEEI 3REWA 4N8VB 2D3VA 2H3NA 4PJGF 4H1LB 3ZKSD 4YHIB 4RGND 1XR9B 3H6JA 4JO4H 4GW4B 5JORA 4P59H 1CFTB 4UT7L 1TVBB 2VDRH 4RGNB 1T89A 5BS0A 5GZOC 1X5KA 5EC2A 4LDEB 1CR9L 3D48R 4LU5L 4RWHA 2XZZA 5E0QA 2EDLA 1W72H 2JJVA 5A2JH 3WS3B 1GZQB 3P4NA 3SKUD 4QRRA 1DBJL 1Q0XL 1RVFH 1KEGH 1ZA3B 1SHMA 3GMOB 3AFLA 3QWQB 1HIML 2Z35B 4Q2ZA 1R3JA 1HQRA 4U6HA 1PJ9A 3IT8D 3NCEB 5IW6B 3NCCB 2GTZB 3RVTC 3N9GL 2HFGL 4QRQB 5CFHA 4XWGL 1NEUA 2ZCKL 4YHMH 5FF6B 3UTTD 4QCIA 43C9A 3RBGA 5IOPA 4LPVA 4OGYH 3UTTB 1MCWW 5EORH 4BSWB 1Q94A 4H8WC 3CPLB 3MRIB 5CIPB 5MENE 3WIHA 4PJCE 1DQML 3RBSA 3DVIA 1HH9B 2GSGB 1HHKA 4YUEH 3E6HB 4HPOL 3PJSB 1Q8MA 4I0CC 4OUUA 4OM0L 5HHME 3QEGH 5HYSB 4U7KA 2WP3T 4JFDA 1JK8B 1RU9L 3KS0J 2JJTA 8CGTA 4KQ3L 3V4UH 4JO1L 1YY9D 4JZJB 3ETBF 2YA1A 1WAAE 5CSBA 5GRWA 3HPLA 3O2DL 4MCYB 2VSCA 4GMTL 2EYTA 2IAMC 4U1KA 5FKAA 2ICWB 3IDGA 5FYLE 4X8JA 1S5HA 1BQHG 5TFSL 3IJYB 4D9QD 1B4JL 2FBOJ 1TQBB 4M6ML 4P48A 1NKOA 4WW2B 5F9WC 4CJ1A 1I1RA 4LSDA 4N9GB 4PB9L 4Z78A 4YO0B 2FWOA 1FN4B 2Q8BH 1HCVA 2AV7A 3RUGA 5IF0A 3WIIL 5FK9A 1UZ8B 4M7LT 2P8PB 4LGPB 4QWWC 1XCQB 2B2XL 5HD8D 2K7QA 4UB0L 3DROA 4PJCF 2W0LA 5CP3A 3GEWB 4YR6B 1K9TA 5A3ID 3I75B 2GCYB 2XTJD 1C8PA 2WIIB 1RULL 3UAJD 4M1CC 1FNEB 1OOAA 2BY3A 2XTJB 3SKNA 1FJ1A 2MCPH 4JAMA 5DMIH 4ZFZA 1P7KB 3BH9A 2C3VA 5C7XH 4X6DE 4LARH 1KCRL 4YHPA 3S37X 3PV7A 1WAAF 1FZOB 1MFDH 1HILB 2ZG1A 3AY4C 4XXDB 2E9WA 3QNYB 4PRIA 3W2DH 4ONFH 3EYSH 4NQUA 4JRXD 2DQHL 3EDKA 3PQYA 1HKFA 4RNRA 5DD0L 2HJKA 3DBXB 3QUYD 1BOYA 4U1JA 2QHLA 3FRUA 2R1XA 4JRXB 2WV3A 3QUYB 3AS1A 3CXDH 3R06A 4LLMB 1FZKB 5HI3C 3SE8H 4RGOH 3MLWL 4JEGB 3S35L 5LGHL 3HNVH 5IWLC 2DDQH 5MEQA 1HZHL 2AGJL 5ISZD 2FECL 3MRGA 4OQTL 4DVRL 4GAJH 1BQHA 1U8HB 5KN5A 5C0EA 5ISZB 1MCHA 4YXKL 3ZKNC 3BPCA 3VG9B 4MCZB 4U6XA 5D1XA 3HAEH 3T0WA 5ITBH 5AG8A 5E1AA 1FDLL 3VI3E 3H9YA 1FFOB 2R2EB 1F8TH 5DLML 2CQVA 2EXWD 3LRSB 1JNHB 1E6JL 3SKMA 1EZVY 2MQ0A 3IKKA 3E1F1 3O8XA 1II4E 1TJHL 3C60C 4X6DF 2XZAH 1D5MA 3EAKA 5HDOA 2VISB 4Y4KD 1YEEL 4CN1A 1OAUL 5D6CA 4AK1A 1T0NA 1AY1L 1A7OH 1R5VA 1YC8A 4OCWL 1FAIL 4Y4KB 4PRNA 1LNUA 1RZJC 3BHBB 5EBMA 2APVA 3EYUL 2YD4A 4XHQA 5JW4M 5F7UA 1CDGA 2FIRT 5DD5L 4LKCB 1HSAA 1UKTA 3QFDB 4ZOBA 4XVSL 2P5EA 1AO7E 3L3OB 3TN0A 1CD8A 2Z31C 3DMMC 2EO9A 2EDTA 5FYKH 4BSJA 1YNTB 2G5BA 2AK4A 1H3PH 4PJ9C 5FB8B 4F37K 1XZ0B 5D71H 2AVGA 1UVQB 4NQCE 5EOCH 3U36A 2EH7H 3CUPA 3VI3F 3LKNB 1A2YB 5ELIA 4OAWA 4XPGL 4XAWL 3N1GC 3FB6A 5SWZD 4PV9A 2G2RB 6FABL 5CZXD 4FOMA 4WWKA 5SWZB 3WIHH 1X7QA 1K5NA 1P5UA 2GT9A 4O2EA 3J7HA 3KWWB 3IKCB 1KLFA 4GKNA 4DN3L 3DX8B 4X6BB 4EN3D 1T1XB 3RIAK 4Q0XH 3OKYA 2VXTH 4AMKL 4EN3B 2I27N 3N1QC 3HI1A 4N0UA 5BZWB 1KB5B 4JHWH 5EU5A 1EUUA 2LFGA 4R97B 3LKRB 2Q1EA 3NCFB 3S6CA 1JRHL 1QZ1A 4Z18A 4NWUL 2FIKB 2Z4QB 2R0WH 3LKOB 5DRWB 2CLVA 3MRNB 3OKLB 2VAJA 3LS4H 1Q9WA 2X4RB 1OSZB 1D7FA 1QR1B 3E3QE 3DPBA 2BNQA 4WFFE 3C6LD 4OLYL 3S96A 4ZO9A 4N1EA 3RTQA 5IVZA 1S7XB 3C6LB 5ESQB 2PTTA 4JKKA 1A9EA 5HVWA 1F11B 3IXTA 3ARDC 5DO2C 2YD6A 5IG7B 3QDME 5C0NC 4H25A 3RAJL 1FORH 3BZ4B 1OP5K 2GW5A 3WHE0 4AT6A 5C6TL 5CP3H 4R4BB 1PEWA 1V05A 4U1HB 2OJEA 3NAAL 4V1DE 3CSPA 2W0FB 4LASL 4RFEB 5IEHA 2DD8L 4PTUA 4WV1A 2NY6D 2HLAA 1NCBH 1KNOA 2WBWB 5D7IE 3RGVD 1I4FA 5DQ9B 2NY6B 4N9OB 5ESAA 1I8MB 1OAQH 3MOBH 2YBRA 5IHLB 3RGVB 4K8RH 1VEMA 2R0LL 2A83B 2DMBA 4GRLD 4P5KA 1SY6A 1A6PA 4I4WB 3KR3L 1YPZA 2V7NB 5JZ7C 4JE4B 2BNUB 5GS1B 3VFMB 3MFFB 5FHAH 3FMGH 5ENWB 4KJWD 2E6QA 1K6QL 3AROA 5F6HJ 5F3BA 5F6IC 5LWYL 2XA8L 2F8OA 1LDPH 2BOCA 3K74B 3BH8A 4G6JH 5SX4H 5D72L 2IQ9H 4JFPA 4TSCL 2ADFH 1CDBA 2W1NA 2F5AL 3LRGA 3KHOA 3PL6C 4S1RH 1WF5A 5J13C 2DMKA 1U8KA 2FX8H 2VLME 2X9XA 1FSKC 4Y7MA 1I3RB 1SJHB 5LBSL 5A16B 5D7IF 5CD3A 5HHVH 4PTTB 3BYYA 3FFDB 3L3IB 3VU2A 4PRDA 5D2NB 1JVKA 1D5IH 1T3FB 4K7FA 4Y4FD 4JFFE 3O0RH 1XGPB 3O4OC 4X7CC 3WSQL 1TZGH 2P5WD 4KJQC 4YPGA 4BKLB 3QQ4B 4Y4FB 1NFKA 4ALAL 5DUBB 4JRYD 2W0PA 2QADD 5BZDB 3I02A 5D8JL 4JRYB 4NM8H 5LCVL 1WV7T 3UDWA 1UH2A 2QADB 3VXME 4G9DB 5CEZD 4HFWA 1IM9D 2E7LA 1TJGH 3QA3A 4KI5E 5IB5B 3BKJL 2YKLH 1R3KA 5FM4A 1IM9B 2AXJA 4X99A 4Y19E 1VHPA 5KTEH 3B6SB 1CE6B 3TO4C 2Y5TA 3U7YH 1AQDB 4RMUA 4KH2A 4ZPTB 3EOTH 4JVWA 3BZFB 3WFEH 1HKLL 2E7MA 3BUYB 4U1MB 4GT7A 1KJVA 3BEVB 4EIGB 3HZVA 3HZYA 3CFCL 2QEJA 1HWHB 2V5YA 3MUGA 1UCBL 2BVQB 4U3HA 1J1OL 4EI6B 3CFBB 5GZOD 5HYIA 4GO6B 3ZL4H 1IEBA 4RQQB 4GUPA 5IFJA 4JCMA 4PG9A 4TNWF 3BZDA 1OTTD 1AGBB 3B2VL 3V4VL 2LABA 1IFHH 1MFEH 1WFUA 1D5XB 2XN9A 2FO1A 2QQQA 3LPFA 3GI9H 1MCOH 2D7NA 4KKBC 1FFNB 3F5WB 1XEDA 3DI3B 1I8IB 2R9HC 3RVXC 5HHQB 3L95B 3OJ2C 4KI5F 3VGDA 1XF5B 5FGSA 4PIRF 5FEBA 5L6YL 3Q48A 1DVFD 3BE1H 3D39A 5KSVB 3RVUD 4LHUD 4WFEE 3WL9B 3LQZA 3HS0B 1KCKA 4L3ED 5EC1B 1YMMD 4CMHC 2VAAA 4LHUB 5EO9A 4G9FD 4L3EB 1EEYA 1YMMB 4NRYA 1TVDA 4G9FB 1F3DJ 5D7JA 4XGZA 5AD0B 4OCYL 3CFKB 1MWAL 1RMFH 2EDDA 3C5ZA 2F19L 4P2QA 3H0TA 2H1PL 3NZHL 2DBJA 5F7MC 4LDOB 4MHHG 5D7LD 2AI0H 3S37H 3F7YB 5E2WH 1MFNA 5D7LB 1DFBL 2IAMD 5E94B 4DZ8A 2QQNH 4UT6L 1J0JA 4LLVA 4L29B 1WWBX 2IAMB 1ACZA 1Z5LA 3VG0L 4X80L 1SY6H 1SEQL 4HBCH 3TM6A 1LEGB 3LQAH 3U1SH 3IAQA 4JFZL 2KBGA 3DUUA 5F9WB 4FQLH 3VE0B 2NY0C 1GGCL 3H9SA 5JOEA 4QWWD 5MEPB 2WUCH 3FQUB 4OZ4A 3FN9A 2NXYC 4MNGE 3BGMA 1NCTA 4NO2A 4P4RA 3H9ZA 1NGYA 3AM8C 4M1CD 1JTTA 3RKDC 3DLQR 1MCJA 15C8L 5I1DB 4HJGA 1JE6A 1F00I 3FN0L 4ZPVA 4O2CA 3EIFA 2VLKE 1UJ3B 3NVQA 4CU7A 4XPTH 3I3DA 3DX7B 1INEL 3FO0H 4OCMC 4NZRH 1ZHNA 4JO2L 4AG4H 5KANI 4YHOH 3FCTA 1JWSB 1VACB 2ZCHL 5DVOA 3CU7A 2RFXA 4OD1H 4O9HH 5IW1A 4PJAA 1RUQH 5HI3D 4UNTA 4XVUC 1SM3L 3Q5OA 3KS0H 4PGDA 4JQIL 4IOSD 2VLJD 3KPRE 3VI4F 5AG9A 5T1MA 3O6KL 3SDYH 3CDYA 2WMPA 2VLJB 5DVMA 4JFHE 3TFKC 1N8ZA 4QOKA 5AYUH 3O81A 4ZSOA 5HYJB 1U8OB 5I71C 3JV4A 1RZKL 2Y5EA 2VR4A 3WYRA 4LSRL 2M26A 3OJMB 3RWCA 1IQWL 3GSWB 3JWDL 2MOVA 2ESVE 1R3IH 4NKOB 4OKVB 4D0CA 1MCFA 5DUMH 5I1IL 3DNKA 4F2MA 2Y07L 2KZ1B 4XP1L 4B41A 2IALB 1IBGL 2P7TA 1P7QD 3RVVC 2B0SH 4IEFB 3MLRL 3KXFE 4O02H 1P7QB 4C57C 3GBNL 5TDNB 4MD4A 5F21B 1BFVH 2Z31D 3DMMD 3LSOB 5HGDB 3RY4A 5TE6L 2E6JA 1UB6A 3D6GA 5L2KA 3NCYP 2J6EL 2Z31B 3DMMB 5BVPH 4F33A 5C0DA 2V17L 4HQQL 3BDYH 2X05A 4Z7UA 2JKXA 4I2XE 3QJHA 5JQ6H 4DW2H 1J9CT 3E6FB 1MVFA 1EEUA 3PNWA 2EECA 3WHXA 1IZJA 4GW1A 5SWSA 1G1CA 1V7NH 2R8SL 2UZIL 43CAB 4WCYH 2XWTB 5KVFL 5F1OB 2ARJQ 1B9ZA 5DK0B 3BI9X 1JN6B 1XR8A 1RIHH 3O9WA 5DI8B 3W39A 1UWGH 4DVBA 1ZGLB 5BJTA 3VXSD 2HKFH 3L5XL 1A6WL 2AXHA 4M9OA 3VD7A 5HHOD 5F7HA 2BVPB 2W9EH 4KROD 4KKCD 2XTLA 3STZA 3VXSB 5HHOB 4KROB 1BIHA 1EAPA 5I1HL 1WUNT 3BP7B 3MNWB 4WO4A 3MV9D 4ZNEE 2UWEB 1LE9A 5DJ8A 2FR4A 1AXIB 3MV9B 5C0IA 2OTUB 1I9RH 1CG9B 3MA9L 3TIDB 3IDMB 3EOAA 4QLRA 5E2UH 4YHZH 4WUUD 2G75B 1TITA 3VH8A 4WI4A 3ARDD 4PRPD 4WUUB 5C0ND 5C0BD 5ACLA 2HTLD 1OSPL 5J6HA 4F7MB 1DUYB 3ARDB 5BV7L 4PRPB 5B21A 4M00A 5C0BB 2BVEA 2EIDA 2MFNA 4U1SB 1NGZA 2O26U 3P0VH 5DD6B 5FGBA 5DJCB 3CFJA 3U2SB 2DLIA 4GBXA 4XNMB 4YAQA 3EYOA 2VWEE 5SX4I 3EYQC 3A67H 4C58B 1BX2B 3HN3A 4OM1L 4S1DC 3CLFL 1U58A 3GSRA 4RRPG 5D5MA 1S9WA 1OTSC 3TT3L 1KXQE 3VFOA 1MREH 3F62A 5F96H 2CRZA 4RBPH 4L9LC 3C9NA 3T0EC 1IM3A 4Z8FH 3V0VB 2IADA 1PZ5B 4XH2B 1KJ3H 2YD2A 1N3NB 1DCLA 3QNXA 1UENA 4NHUB 1ZTXH 5IHUH 5F1KC 1VENA 2A9ML 1FL5B 1FYTD 3LN4A 2BNRE 1OP3K 2NW2B 5EIQA 3CLEL 5F6IB 3ROLB 1YEFL 2W65A 1FYTB 1F4AA 1SJEB 3RY5A 1TFHA 4OBSA 4YFLI 4NRZA 5C09E 5CJQH 4PJEB 3ME0A 3VWKC 4BH7A 1DQTA 5ALBH 4IRJC 4DK6A 1YEKL 3MCLH 4PJXB 2AEIT 5J13B 3DHJA 3UPRB 5C8JA 4FXGA 5EU4B 2OP4L 3HPJA 4XMLL 4HHAB 2MHAA 1DBKL 4NQEE 1MHEA 1A1NA 4P3WA 4NQXB 4QYOA 1IGMH 3O3EA 1WISA 3HCVB 2DIJA 3HR5B 3DO7B 4KJQD 5E6ID 4P0DA 1BLNB 5HVHC 4FQJH 1CD1A 4H26A 2IBGA 4YDJB 5ITFA 2CKNA 1HH6B 5E6IB 4BK5A 4WGWB 4XNZC 4RRPA 1HHJA 2V7HA 2QL1A 2F54E 4Z9KB 2Q7YB 3JTSB 3GO1L 1G9EA 3BN9C 4JM4H 2PYEE 3D69A 4M4RA 5EFIA 5CSZA 4R2GC 3DX6A 3BAEL 5JNYB 1Z3GH 2CLZA 5KVGH 4U0RC 3ZMRA 2OZ4A 1SQ2N 2EC9U 3SOBL 3RIFK 1EHLH 3K81A 3SDXE 3TPUA 1Q9KB 4FZEH 3EOBA 3QUZA 4F3FB 4TN9A 4D2NA 5EO1A 5E8DH 5DMJB 4EXPX 5BO1L 5ILTH 4MQTB 4F7TA 3QP3A 3QUMB 2JIXD 3DV4A 5JA9A 1X4ZA 4LLQA 3PWNB 3BKCH 3KYOA 3MRQA 4TUKH 2EEAA 2JIXB 4OCLC 4UQ3A 5DSCA 3SO3C 5FM8A 3QDGD 2C1PB 3HLAB 2ZOKA 4H5SB 3UYRH 3QDGB 3V6OE 4RGNE 1A1MA 3R1GH 3QEQA 3T0AA 4ELKA 3BUTA 1S8DA 3KPOA 3W0WA 4FQHB 2AQ2A 1M7IB 4JKWA 4ZFOB 1FVCB 1SVZA 3HR6A 3U7AA 3DURB 2HRPL 1YN6A 1I85C 3B5TA 4KKBD 4OLVH 1EX0A 4PRAB 3LMJH 5EZJB 1V3KA 4NP4H 1BZ7A 1DUZB 5TDOA 3V7AE 2MNUA 2R9HD 4Q9RH 2RCSH 1I1FA 4AIOA 2FJGB 3CFEA 3CDGA 3X3FL 4Z7VF 4RCAA 4ZUSB 2YA2A 3OGCB 4BK4A 3VDBA 4LPTA 1LO0L 1A7BA 3SDXF 2VXQH 2CRMA 4CRPA 3ARWA 3WE6B 1OAYH 1CXIA 4K7PY 5IFHH 3UTTE 1ULVA 1T1ZA 3EFDH 1S7WB 4QRPA 5DJ0B 2FHBA 1A7PH 2DLFL 1B0RA 2DJ4A 5TF1H 3IFPB 3LIZH 3EO1B 1U36A 5F8RC 2AJYL 4LVEA 4PYHA 1D5ZB 3ZTNL 1MSPA 2XICA 3KHQA 2DKSA 5I0DA 2YK1L 4QHUB 4RIRB 5CEYB 3IF1B 2HT3C 2X4PA 1Q0YL 4D0BA 1AGDB 4Y5YB 1E0OB 1UCTA 2BVOA 3LZFH 5C08A 5GIRB 1L6XA 2WM0A 4PGCA 4GAGH 2JF1A 1WZKA 1XF3B 4J3TA 1MF2L 3VXQB 3WDHA 4ZOAA 1WT5A 4X4YA 2AV1B 4NCC2 1ZMYA 4D9QE 4K94H 2W9DL 4QXUL 2NY4D 3ARPA 3OKNA 5IQ7H 5J56B 1CWVA 2NXYD 3LH2L 3S35X 2DM2A 2NY4B 2QR0A 1LK2B 1ZLWH 1GC1L 5DF0A 3AB0B 2H32B 2NXYB 4P46A 2NY5C 4X6EA 3KAAA 4PJGA 3GM0A 1J0IA 2QBWA 3DOSA 4AEEA 1DEEA 3OX8A 3ZKXC 3PGDB 4FFZH 3K3QA 2ITDB 2XTJE 2C7UA 5DJYB 1L0QA 1SYVA 1QYGL 4AY0A 3C5SA 3GBMH 2QSCL 2WLZA 5T3XD 1NBZB 3KYMA 4WW1B 1IC5H 1ZT4A 1IAOB 4PRBA 2OX5A 1JFQH 1Q72L 2DL9A 2H26A 4N5EC 4XCEB 4XP9L 1F3DH 3AAZA 3GK8H 1T6VN 3BO8B 1PYWB 3V8OA 1WC7A 1UM4L 4QY8A 1T21B 4Q74A 3G5XA 4HGWA 3L3GA 4XVUD 4ZS7H 1I1YA 1MCKA 3BPOC 4JRXE 1ORQB 3VXTB 1XF1A 4HJJL 3KYKH 3ARFA 5DS8A 5EZIL 2BSTB 4BUGA 1C08B 3BW9B 4L4TD 2DYPD 2X1WL 4OTXH 1G7QB 4BZ1H 5ISZE 4L4TB 2DYPB 2OZ4H 3MFGB 2ADGB 5E70A 5I71B 5IEKB 4GQPH 5IJVB 1G7PB 3QIUC 5E8PB 3IDXL 2AEPL 5GRJL 5JOPD 1RZIA 5BXFA 4Q9QH 4TOYL 1BQLL 4Q58C 3EJZC 3G5VB 3RVVD 3S4SG 2CUIA 1B0GB 3OR6A 1Z9SA 1T2QL 4OZFB 3B9KA 1L7IL 4HUNB 1S7UB 2XKSA 2VH5L 3FHQA 3BRFA 5I17A 1I7ZB 5F9OH 4XNUH 4K3DH 5E8OA 3FB5A 1BPVA 3ROOB 2EDBA 2JK5A 4GAFB 1UACL 3H3KA 3SGDH 3QG6A 5GISL 3MRPB 4JY6B 3O2DA 4XBGB 4YH6A 5EPMA 5I8CA 2DQIH 3QIWC 2DQCL 5EBLB 2P8MA 3WUWA 5KVDL 4GQ9L 2DTML 1YQVH 4MGXA 3ZHLA 2R0ZL 1DDHA 5MENA 3LEYL 1LK3L 4Q6IA 4PJCA 1T7WA 3MCKB 4WTWA 1R3HA 1VA9A 3D0LB 1R24A 2JB6A 3MRMB 1T03H 4LPWA 2XWJB 3WEXB 4FQ2L 3MC0A 5IBTH 4HJ0C 4HS3A 3RQ3A 1I8LC 4RMQA 4KMQA 3NBNA 1BJ1J 3ARXA 4WY7L 4X4XA 5SWZE 3S3SA 1GAFL 4NWTL 3UBXB 4W4OA 2I9TA 5SWQB 2D03H 2EO1A 2XA3A 3V95A 3PABB 3T2QA 2Z8VC 1AD9B 1INDL 3NCJH 4EOWH 5T33H 2D7TL 3VCLB 5TE7L 4PJHB 1I3GL 3QFJD 5I1GL 3IS1X 1CBVH 4DGVL 4OD2A 1T83A 3QFJB 4OFYA 3U0TB 4X7SL 3DO3A 1BVZA 1UM5H 5DEFB 4M1GL 1WCBA 3KLAA 2NQCA 3L1OL 2AAVA 1NGWB 4MDIB 4Y88A 4DGYH 2OL3A 1NKRA 1C5BL 1PQZB 3JTTA 1MJ7H 4PYGA 5HVFB 1ZGLM 3A6CL 1NGXA 1JPFA 5C3LD 5IGXL 5D70H 1G7JB 4N90D 1VPOL 4JHAL 4OQTA 4MHHI 4Z95L 5I8KH 4F37F 5ICYB 2BSRA 1XCTB 4JG0L 4X6DA 2H2SD 3QCUL 1K2DA 4HDIB 1KB5L 4GXUM 1GGBL 4KMLB 5I9QB 1RUMH 2PW2B 2Q6WB 3S97C 3FT3A 2YSSB 2QKIA 2IH1B 5HHPB 1XGTA 3OGOE 4E0RA 3VMOA 3SE9H 1S9XA 5SV4A 4XPAH 3LKPB 4NRXB 2B20A 5FA3B 4OFIA 5FUZH 5C71A 5HGBA 1YNLL 5J89A 4UT7H 1IAMA 4QKXB 3KPMA 3QCTH 5KOVC 1RJLB 1IAIM 4X6CF 1MCIA 1CR9H 1UH4A 3NIGE 4ZAKD 4JFYB 4CKVX 1J5OL 4ZAKB 5IW3A 3X12B 4URTB 1Q0XH 3E0GA 1CDJA 5C3TA 1IEAA 1HXYB 1MJJA 3D3VD 3DIFB 3FQXA 5JPNA 2IH3B 1JZ3A 1ZGLP 1P4BL 4XBEL 3D3VB 1R3LA 3N9GH 5IM7A 4G3YL 2HFGH 3TBYB 2A6IA 3T08A 2DMCA 4UNVA 5F71A 1FL6A 2ZCKH 5TGBB 4CW1A 1FVDB 3LY6A 4CADA 3FJTA 4I5BB 4KJYB 4JJ5A 5LJYH 1K4CA 4R3SB 3VFGL 2KUTA 1CGVA 5KZCD 3VXPB 1ZHKA 1AE6L 3SDCA 2WQRA 4R8WL 4PY7A 4LSPH 5KZCB 1DL7H 5CKGA 2ERJB 5D2NE 4HPOH 3WNKA 4NCC1 4YZFE 4PREB 1JWUB 5B38G 5F6HI 2AKRB 5DRZB 4G80B 1RU9H 2VLRD 4XNZB 3NIGF 4EI5A 2P5WE 2VKXA 3BN9D 3T0VA 4JO1H 2V6HA 1OHQA 4NQCA 2VLRB 4PJ8C 3THML 4JRYE 3O2DH 4NT6A 1QA9B 3I3EA 1B4RA 5C0FB 2KKQA 1IGTA 2HP4A 3T1FA 4U0RB 5T5FL 1B4JH 3G6AA 3RPIA 4M6MH 3OXSB 1DZBA 1AHWA 4OIBA 4PB9H 5IMOA 1DQQB 2YEZA 3JWNC 3HC4L 1BWMA 1F6FB 4NQVA 4ISVB 1U92A 2ZUVA 4I18C 2B5IC 3RI5F 3WIIH 4YLQT 2DQEL 3SO3B 5CJXA 1N0LA 4LGRB 1YJDH 5JA8B 4UTAL 4UB0H 5EIIB 1G9MC 1JV5A 4X0KB 2IEPA 5GGTL 3E2HC 2J8UB 2O5XH 2RGSA 1RULH 1G6VK 1OB1B 5I8OH 4YZFF 3AUVA 1JUFA 2D2OA 3HE7A 4HXAL 4AIZA 1OW0A 5CEZL 3MV01 3TYFA 4UDUA 1KCRH 2ZCLL 4UINL 3GJEA 4R7DA 5BVJA 5B38A 1J12A 1R5WA 2DQHH 2X7LB 3QDMA 1ETZB 1A8JH 2CUHA 2J8HA 1C5CL 1EFXA 1NCAL 2EDEA 5E2TL 3MA7A 2EDWA 1BHGA 2IPKA 1X5ZA 2OL3H 3GJFA 4YXLH 5C0RL 2Q20A 1WWAX 3GI8L 3MLWH 4G8IB 5LGHH 4HUWA 3S36X 4L3EE 3B2UC 1YECL 2J4WL 2AGJH 1YMME 3F12B 3C8KA 4GXVL 3H42L 4OQTH 4DVRH 4ZD3H 3OB8A 4G9FE 3M1BA 1EO7A 4F9PA 1A14L 4Y89A 5D7IA 3SGKC 3QIBA 5C1MB 3JBG7 4LFHD 4JFOB 3A6OA 4AEFA 4KJPC 2ARWA 1UWXK 3CX2A 3PIQA 1P7HL 3DHMA 2E27L 5DLMH 1E6JH 1I3VA 1IJ9A 3QR2A 1NCCL 1TJHH 3TZVD 3WV0A 2LAGB 3TBVB 3LPWA 4JRWA 5D7LE 4CAGA 3ARQA 5FDWA 4E42A 1YEEH 5FO8B 1OAUH 4U4BA 1RFDH 4JDVA 3FT2A 1AY1H 1YEDA 1FAIH 1MQKL 2DOCA 3CZFB 4H8WL 3EYUH 1XGUB 4I48B 5FKPA 5IBUG 1CF8L 2AEWA 5I8EB 3IS0X 4J4PA 4D8PA 1A7RL 1CFSB 2BVYA 4XVSH 5T1LD 4ETQB 5DEGA 3MBEC 1VB9A 2FLBT 5T1LB 1S9YB 1TTUA 1IKNA 1KIQB 4JY4A 3D2UD 1WBZA 2I5YL 4PUBL 4XC1L 2XNAB 3D2UB 4MA1C 5GGSA 3ECBA 4YHNA 4ZOCA 2AXFA 3ZKXB 1WWCA 1G84A 3E8UL 3MLUL 2R4SH 4JFFA 4XPGH 5CBAA 4XAWH 4ELMB 1M71A 3GMLA 2XQBL 4N5ED 4AYFA 1BBJB 3AGVA 5FA4A 1Q1JL 3KPPB 4QGYA 4XBPB 4YFEA 4WI9A 2VITB 1KPVB 3Q5TA 1XF4A 3SJVA 1VGEH 3VXMA 4LNRA 4DN3H 4YHLL 4BQBA 5GS0C 5IROC 1ZSDA 1VERA 2QSVA 3HI6L 2AJ3A 1HCFX 3Q1SL 2ZUXA 3IXAB 3WCYA 5GS3A 5K9OB 3FO1B 4AMKH 4IRZL 3QHTC 3P4MA 2GTWA 5F9JA 4KUCD 4X98B 1L6ZA 3EFFA 1JRHH 4NWUH 1NAKL 1NUNB 5CJOL 3QIUD 5DUPH 3JZ7A 2IC2A 3SGDI 1OD7A 2DRUA 3BIKB 4OLYH 5DGQA 3QIUB 2E8ZA 4X6FA 5I0ZA 5C70A 5E7BA 4YQXL 5AAWA 1U93B 3JV6A 1P6FA 3PHQA 4L8CA 3LN5A 3IETB 5KJRL 3RAJH 4CN4A 3PF2A 5GRUL 3BIAX 5ICXA 1MWAA 3EYFA 1U0QA 5I16B 1EPFA 2ITCB 4JCLA 3IU3A 3NAAH 3DUSA 1TZIA 3JV5A 4Z77B 5LKNA 1ZT7B 4LASH 4XVTL 2VTFA 2OTWB 2DD8H 2FO4A 2CIKA 3NA9L 2VDMH 3EJJX 4R9HA 2BCKB 5I1AA 1VKXB 2ARJA 4QGTA 1QVOA 1FV1B 5IMKB 1CLYL 3LEVH 3WNNA 5KSBB 1T1WA 1S3KL 1WT5C 3Q2CA 1A4KA 4U33A 1AGCB 4WEMB 3V6ZB 3TO2A 3MGTA 2H8PA 2I07A 3KR3H 3T3ME 4RDQF 3GJFH 2UZXB 1N5AA 2UZYB 1K6QH 3ARYA 2ORBL 5A40E 4P46C 1KJMB 2XA8H 2X70B 4Y5XA 4J3VA 2IQAA 4XCFL 2A0LC 3GSQB 1YC7A 1A3QA 4KPHL 5D72H 3NFPA 5CCKH 3GMPA 5C0JA 2K3TA 2F5AH 1I7TB 3OKOB 4M5YL 2YWZA 3VFNA 4OUOA 8FABA 3C8HA 3HRZA 4NOFA 3VXSE 5HHOE 4QHNA 2NTFB 1DQLL 2X4SA 5MEOA 1X6NA 2W59A 1PEZA 1VDGA 1QG3A 2UWEE 5FYJL 1H3GA 4J8RA 3MV9E 1YY8A 3G5YA 3FB7A 3WSQH 3MV8D 4MNGA 4R7NA 3BP4B 3K1DA 1KULA 4I9WD 3N06B 3FB8B 3T3MF 3MV8B 3KYNA 5D7KD 2YZ1A 4E5XA 4QXTB 4MAYA 4WUUE 3V0WL 2EDHA 2PO6C 3KJ4C 3IB4A 3VFPA 3L5JA 4PRPE 1C7TA 4BFBD 3L7EB 2DQFB 1ODAA 2DM4A 2R4RL 4P2YA 4TUOA 5C0BE 3TEUA 4NO5B 4PJDB 3CDCA 2G9HA 4UU9A 4CDGC 1M05B 1K3IA 1UYWL 4P2OC 1XFPA 1MFCH 1EMTL 1LO4L 3I6GA 1HKLH 1ZWIA 2CK0H 2VOTA 1I1AC 1TETL 4PP1C 1T04A 2D0FA 3CFCH 5I1EH 2Q7NA 5IKCB 2OQJA 4AENB 5L8JB 4OLZL 1UCBH 1J1OH 1BJMA 4XNQB 3IYLW 4PFEA 5JPMB 2YUWA 2UWEF 4JDZA 1IAIL 2BY1A 3UO1L 4UOW0 4CUCA 4MXQC 3B2VH 3V4VH 3PUCA 4LLWB 2ZP0T 4I3SH 4LEOB 5FYKU 3LEXB 5I1LA 4NO0D 4F15B 2J6EA 1FYTE 3CH1B 5C92A 1PG7L 4NO0B 1GOGA 2JJSA 2ESVA 1IGIH 4PJEE 3LB6C 5DVLA 1CICC 5L6YH 2JJUA 1ZT1A 2X4OA 3MRBB 5K9KA 4PJXE 3WJLA 3C5JB 1FGNH 2ICWJ 4MJ5A 1Y6KR 1E27A 3KXFA 2V5TA 3UTSD 1JGEB 1ERNA 4ORGA 1MOEA 2P48B 5C0CA 3UTSB 4YIQB 3VFWA 1WICA 3VFSB 1A6ZB 3DXAA 1W0YT 3KG5A 4ODTL 1OGTB 2DS4A 5C9KA 1RPQA 1MWAH 2FX9L 4JPKL 4GAYB 3EBAA 2F19H 5D4QA 2LU3A 5TQ2L 3NZHH 3QH3A 1QPXA 3Q6GL 4P9MH 5ICZB 1GRWA 1T4KB 4PLNC 1DFBH 2IAND 2WBJC 4UT6H 3BJ91 2CDGB 1AP2A 1T5XA 5EA0L 2IANB 3VG0H 4X80H 2XYCA 3RWHB 1SEQH 4PJEF 4PJ5D 3KPNB 2OYPA 4JFZH 1VSCA 1DR9A 1NEZB 4PJXF 4LMQE 4PJ5B 3S36H 1CGTA 2C3HA 4JZOB 5MERA 1Q9OA 4M62L 1GGUA 3TT1H 2BMKA 2VZOA 4BELD 4G43B 2B5IB 5IMLA 1ZVSB 2GYSA 4K23L 1HE7A 2VLLA 3ULUD 3TIEB 1LD9A 2VR9A 3E2HB 1A3RL 5CLWA 2YPLD 2AJXL 1QLFB 2VERN 2OR8A 3FN0H 3FQNA 5GQBA 2AJVL 2FECI 3GSVB 4M6NL 2YPLB 3KDMB 1KUMA 1INEH 4MAUL 4H0GA 5GZND 1JJUA 4FG6D 4EEEA 2XWBA 1D6EB 4FFVC 4PJFE 1OAKL 3BQUA 3QUML 2M8XA 4OGAC 4KUZL 1FNSL 1D9KC 2VDQL 5C9JB 3NIFE 3N50A 1ZLSL 1FIGL 5C6PB 4APQA 4RISH 1SM3H 1NDMA 4JQIH 1ZANL 4L8BB 3B2UD 5D2LB 3PV6A 2D4FA 4NJAL 5HSFA 1IGFL 1VEOA 2J88L 4WI2A 3O6KH 3G9VA 4ZFOL 2P24A 3MPCA 5FCSH 4XXCA 4L5FL 3PHSA 3MLYH 5EZOL 4FMFA 3K0WA 4IDJL 1RZKH 4JN2B 3U4BL 4LSRH 1HYSC 1WTLA 2HKHH 4EDXB 2VZVA 3FQTA 1M7XA 3JWDH 3QUKA 3OJDA 1Z6JT 3S5LG 2MKLC 1T5WA 1VCAA 1MLBA 5I1IH 2Y07H 1ES0A 2XG5A 1KYOK 4XP1H 5EULV 2BNRA 1IBGH 4PJFF 2UUDH 3QISA 3MLRH 3NIFF 4U05A 4BFGA 1J88A 1G6RL 4HK3J 4ONOA 3GBNH 3H7BA 5C09A 4QHMB 4N8VG 1QFHA 3DRQB 1QSVA 2C1OA 4P5TC 4JKPL 1IQDB 2J6EH 1Y0LA 4XI5D 3RL1B 4HBQA 1KFAL 1BIIB 4QT5A 2V17H 4U6YA 3QULA 3G04A 4NQEA 3HB3C 1I7UA 2XKUA 2FJHB 2NX5A 4MA1B 4JANB 2GJZA 2GUOB 2NMSA 4QEGA 4FQCL 4W81A 1A6UL 2R39A 2R8SH 1JRHI 4MB5A 2UZIH 5ETUB 3SDDD 1A5FH 2ZUQC 3VRIB 1KJ2H 5T3XE 2PXYD 4LEXH 1E4KC 1FGVH 5IUSA 3SDDB 2JCCB 2B4CC 5F88A 5DRNB 3WS6A 2PXYB 4TTDC 3LN9A 5E5RB 5DJZA 3L5XH 1BD2D 5DA0B 3VWJA 3E3QC 5BW7C 4JFQA 1QBML 5DRXB 5I2IB 4NPYA 3SKOB 4QXWA 4UBDC 5T3ZD 3SDXA 1KG0A 1T0PB 4N0CD 2O5ZL 3G08A 5I1HH 4IRSA 3QO1B 3P77B 3QHFL 3F6IA 2YS4A 3GMMB 5FAAA 5INDA 4DUWA 2V2XA 5JW4R 3QJFA 4L4TE 5ESVA 5JO5B 4N8VA 5T3XL 4H1LA 5IR1B 3LPGA 3KNBA 3T2NL 1XR9A 3Q0HA 3WN5A 4UIMA 1QKZL 1CFTA 2F5BL 4KHTL 1TVBA 5DD3L 5AUMB 1BZ9B 4PLOB 3V6OA 1M4KA 4CNIB 4Y8AA 5EZLA 1KBGL 1OSPH 3U0WL 5JOPE 3L9RB 5BV7H 2CDFB 1HK6A 1UXWB 4E9LA 4S0SD 3WS3A 1GZQA 1KPRA 1S78C 1YUHB 3GMOA 2P49B 2Z35A 3UP1A 2A73B 5J3HC 2VUYA 4Y5VB 2N1KA 5DQJB 4LVOC 1HNGA 3LHPL 2GTZA 4G8EB 5KSUB 5AEAA 1EXUA 4QRQA 4OM1H 5EU3B 1C12B 5FF6A 3C2SA 2PYFB 3MTRA 3REVB 1WGOA 3UTTA 4H0HB 5I15L 5GJSH 4ZUVA 5LQBL 2EYRB 3CPLA 5C07D 4QRUB 3MO1B 1B88A 1IC7L 4Y16D 2DI7A 3PWPA 2K7PA 1HH9A 5C07B 4WHCA 2GSGA 4Y16B 3E6HA 3MLTB 3PJSA 1GYAA 4PJIB 3VFUB 4LAQL 1GHFL 1YEFH 1KTRL 1JK8A 2F53D 4GKZA 4ZO7A 4WJ5B 4HIEB 4HC1H 4HUUB 3X11B 1DE4B 2F53B 3AREC 4BA8A 4ZO6A 1YEKH 3NFSL 3TA3D 2NY7H 3ESVF 2X40A 1G7HB 2ICWA 2CJUL 2WBKA 2RAMA 1KN2L 2WNGA 3VXOA 4XMLH 3IJYA 1DN0A 3UTZB 2VZ3A 4NNYB 3DV6A 4PJHE 1U8IA 1DBKH 1RJZB 5AZEH 4CBPA 1PFCA 4WW2A 1KTDA 4N9GA 4KI5C 5JXAL 4M9PA 1A6VL 2VDPL 3LQMA 5CZVL 2BY0A 1UZ8A 2P8PA 3V5HA 1XCQA 4YR6A 4JLRB 2VE6B 3INUL 2BVTA 3CFDB 2GCYA 3I75A 2PO6D 4NUJA 2UYLA 3MV7D 3GO1H 1MFBL 4KGLA 4NC0B 1MLCB 2C3GA 5CLTA 3Q5YA 1OF2B 2PO6B 32C2B 3KJ4B 2Q87A 1P7KA 3BAEH 3F65A 3MV7B 3MRHB 4N90E 2VO5A 4J3OC 1NMAL 3SOBH 1YYLL 1FZOA 1HILA 5JHDD 3QNYA 5EU6A 2ICCA 3IGAB 4G8GD 1G7MA 3U83A 5JHDB 3CXHJ 1I1AD 2BK8A 3Q3GB 3DBXA 4G8GB 2YHGA 5IIEB 1M7DB 2I24N 3BWAB 1I1AB 1LO2L 1CDIA 3QCVH 4PJHF 3RX7A 2H45A 1FZKA 4LLMA 5GS2H 3T65B 2Z93B 5MP6L 2W91A 1EGJH 4ZMAT 2CO6B 4J1UA 2CKBH 5DHVA 4KKLC 1U8HA 5ISZA 5HVGB 1CVSC 1CS6A 35C8L 5HY9B 1FFOA 2I9LB 4OIAA 1GPOL 3LRSA 1Q9LB 1JNHA 3X13B 3UTQA 1CICD 4ERSH 1BEYL 4I77H 3X3FH 4J23A 3PWVA 1CICB 4FQQB 3V6FA 2VISA 4YNYA 3D3VE 1S7QB 1LO0H 4XP6L 3D9AL 4Y4KA 1T7YA 3BHBA 1UEMA 1LE5B 5TH2A 3NGBC 1S7RA 5BOZG 1HSBB 4JFED 3L3OA 3CH8A 3HAEB 4N8CH 2DLFH 2FNBA 4JFEB 4FA8A 5I1JL 1KEML 2C4FU 1IT9L 2CMRL 1KCSL 5F44A 2YR3A 1JGUL 2NLJB 3ZTNH 4RMWA 2DQJH 4M61B 1FFPB 5FB8A 2YK1H 1XZ0A 2FJFA 5F7DA 4NUGH 1UVQA 1KF9B 5D6DA 2VLRE 5DK2A 4IIQA 3U79A 5FUOL 3LKNA 1A2YA 3NFNA 4P4KC 3RWDA 5JORB 1Q38A 3RZWA 2NXZC 4MA7L 2APWA 5EC2B 3GSXB 4F8TA 3SEPA 4EQ3A 4QRRD 4YDIL 1KCVL 2HJLA 1O7VA 1MF2H 4M6AA 5BRZA 4BFIA 4MAYC 4PS4L 3QQ3B 2HH0L 3UC0H 3P4NB 4QRRB 3KWWA 2W9DH 3IKCA 4G7VL 3DX8A 4QXUH 4HGMA 2ZPKL 1R3JB 1T1XA 4YEEA 5K9QG 1HQRB 4OF3A 4M1DH 4EN3A 1GC1H 1C5DA 4S1SL 2QJDA 2R2CA 2XG4A 1KB5A 3NACL 5BZWA 2CIIB 3QRGL 5IBLC 3O6LH 1S7VB 2PCPA 3TJHC 4ZYKB 1IGJB 1XMWA 2J8UE 4XPFH 2WUBH 1JTOA 2FIKA 2Z4QA 5DRWA 3OKLA 3MRNA 4OZHA 1QYGH 2YD1A 2X4RA 1Q94B 1OSZA 4EIZC 4OCRL 2CDEA 1QR1A 3UYOD 1J7VR 3O11B 1JGVL 1YEGL 2APTA 4OGAD 1Q72H 4R4NC 4XP9H 4POZD 3QXDB 1D9KD 5DFVC 5C0AD 4N0FB 5HDBE 3PP3H 1CVRA 1S7XA 3C6LA 3UZVB 1BVLA 4M3JA 1UM4H 1D9KB 1F11A 5C0AB 1FIEA 1MVUB 4Y8DC 4K3JL 1UT9A 3STBA 1EEQA 3MJ9L 4HJJH 3GB7B 4R4BA 1MY5A 4U1HA 4LIQL 3Q6FA 4GRWB 1B3JA 3HPLB 1SBSH 4B0MM 5GSVB 2W0FA 1T22A 1AGEB 2EYTB 2A6JA 1MIML 4RFEA 3VGAC 3IDGB 4KRMB 3QI9C 1BAFL 3W11C 3ALPA 4WEBL 4H88L 4HH8A 2WINB 3KYAA 1I8MA 4TULL 4UV7L 3RGVA 3AS0A 2J8UF 2A83A 3IDXH 5F1IB 3LKQB 5GRJH 1KIRA 3RUGB 5E00B 4TOYH 5IHBA 3EKCA 1BQLH 2V7NA 4PD4J 2BNUA 2XZQH 4G6KH 1J87A 3MFFA 3SQOH 4NM4H 2HG5A 2N7BA 5ENWA 4LVHB 1T2QH 2YMXL 4XRCA 1L7IH 5HDBF 4XCCL 3HA0A 2FATL 2Y36H 5DHVH 1OM3L 5FO9B 3SKNB 1FCCA 3G6JB 1UACH 4K8RD 4YHPB 1N0XH 5GISH 2YPKB 1FE8L 5B8CA 3PQYD 3RY6C 3HB3D 2LTQC 2DQCH 1FLRH 3PQYB 2HJKB 2DTMH 4Z76B 4XTRC 2R0ZH 5A16A 5C2BL 2R1XB 1G0YR 4QRTB 1X5HA 4G6AD 1A3LL 1OAXL 3L3IA 5TPWL 3R06B 4GSDL 1T3FA 5F89B 4WU7B 1L9MA 4AM0B 4ELME 5EO0B 1QFWL 4JQXA 5HI5D 5E1HB 1BQHB 4O2FB 4J3UA 5KN5B 1YEHL 5DUBA 2ZUQB 1GAFH 1NDGB 4NWTH 4TTDD 3BPCB 5BZDA 4X5WB 2NYYC 4JRYA 4Y2DC 5E1AB 1K8DA 5HGAA 3JVGA 4WFFD 1KB9J 5GGTA 1F58L 3O8XD 5IB5A 3DYOA 2DLHA 4UBDD 1EEZB 1HDMB 1IM9A 4I0PC 3O8XB 1DBBL 1INDH 3W81A 1U8NB 4HMEA 1AQDA 1ITBB 5TE7H 4ZDHB 5I30L 4ODHH 4NHCH 1I3GH 1T0NB 5I1GH 1R5VB 4DGVH 1K4DB 3BZFA 1LNUB 3P2TA 5EBMB 4RX4D 4U1MA 3BUYA 3TWCL 3BEVA 3WNPA 4NBZB 4X7SH 3TYGL 2OCFD 4JREC 2P5ED 4M1GH 1HSAB 4V1DB 2BVQA 4NZTH 4EI6A 3L1OH 1X44A 2CSPA 1F02I 1EBAA 2P5EB 1C5BH 5D1QC 4R4FL 3EGSB 4RQQA 5DDHB 2VWEC 3A6CH 2F74A 5IGXH 3C2AL 4ELMF 2VQUA 1OY3B 4OD3H 1MAJA 4JG0H 3QCUH 1D5XA 3BOVA 5AZ2L 5J3HD 1H8SA 4MSWB 1OAZL 2HAZA 3CUPB 2BX5A 5E56A 3GDBA 1I8IA 1XF5A 3FB6B 4WWKD 5EDXA 3QXAB 5KSVA 4ACPA 4WWKB 1X7QB 3WL9A 3HS0A 4MD0B 2OR9H 2GT9B 4O2EB 5E08L 4P5MA 2AABL 4L3EA 4GKNB 5KSBE 1YMMA 4KUCF 2ZNWA 4LRNH 5AD0A 5CP7B 3CFKA 4LQFL 1ND0A 4QO1A 5HTSA 1J5OH 1CU4H 4F7PB 4P57B 5GGRB 1UWEL 4I3RL 3CU1A 3ARED 2CLVB 3PHOA 2BNQD 1Q9WB 1JZ7A 2YUZA 5E94A 3AREB 1P4BH 4X9BA 1TJIL 5F1NB 3RTQD 1U8MA 1KXTB 4G3YH 4L29A 1MNUH 2IAMA 1HI6B 3RTQB 3X3GL 4UT9L 3CAFA 5EWIL 2JB5L 4XX1E 1LEGA 5IESL 3VFGH 4M7LL 4NIKB 4KI5D 3BXNB 1RK1A 1EAJA 4S0TD 5KBNC 5HJ3B 4R8WH 1F45A 2XXMB 2O61B 1Y6NR 3SO5A 1MRCL 2CO7B 5MEPA 2Y6SC 4CVZA 4OLWL 3BP6B 4NQDD 4YDVA 2EIBA 1QFPA 2FEEL 3RNKA 3CVHB 1AD0B 4NQDB 1WBXB 3MV8E 3EW3B 3MJ6A 1CFQB 4J3XA 1KNOB 5F3HB 1U6AL 3THMH 4I9WE 7FABL 5I1DA 4DN4H 5D7KE 4JQVC 5K9JL 1PX3A 4JGMA 1RD6A 3TNNB 1G1YA 4HKJB 4HUVB 2Y4SA 3ZDYE 2A77L 3O2VL 4PJDE 5DJAB 1PG7X 1XGRB 3QAZB 4RGNC 1YPZB 1CK0H 3AY4A 5T5FH 5DC0A 2F8XC 4LAJH 12E8L 4HKZB 3A6BH 3HC4H 5SX5H 1AI1H 1J18A 3BH8B 2W92A 2GHWB 5IB3B 2E9IA 4UTAH 1ZAGA 4O4YL 5IWLA 2C4XA 4LF3B 5GGTH 2HN7B 2VLJA 3F7RA 1NJ9B 4PJBA 4HZLB 5HPMB 5CEZH 2EXYC 5HYJA 1U8OA 3HI5L 4P9HH 5GSRA 1HHIB 5CD3B 1QACA 1FP5A 5JR1L 4Z7WB 3SBWC 1U8QB 3CX5J 1FPTL 3GSWA 5TQ0H 3C60A 4NKOA 4HV8B 2R2HB 4YPGB 5ECJE 3ZDYF 1TDQA 4PJDF 1C5CH 1CIDA 1NCAH 2IALA 5E2TH 2Z92B 4P23C 2AXGB 2IBBA 4OLUL 1U8JA 3GI8H 2CXGA 3QEUB 4JZJC 1WZMA 4ODUB 5TDNA 2AP2A 3NGBB 1I9IH 1YECH 2J4WH 3QA3B 3H42H