1CFSA

Anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-unrelated peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPSRFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN))
publication title Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity.
pubmed doi rcsb
molecule tags Polyspecificity
total genus 44
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1999-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfsA01
1IQDB 1MHCB 5T1KB 2WANA 3RNQB 4UMGA 3QH3B 2WLZA 4GXVL 4OF7A 3QHZH 2UZXB 2Y1VA 2YZ8A 4MZ2A 4UTBH 4OGXL 3VGEA 1WTLA 2YPLD 3LPGA 3WBDA 5C9JB 4ELMB 3RI5F 5AEAA 4LSPL 4P4RA 4X98A 2UZYB 4MX7A 4MD4B 2PYEE 5F88A 1BAFH 2P5EB 2BFVH 3IU4H 1JPTH 5JORA 1UB5B 3I75A 4NKIH 4UT6H 2E3VA 3JTTA 2YN3A 4LCUA 1S7XA 2A77H 2I9LB 3HMXA 3UPRB 4WO4C 2YK1H 4Z7NF 4MSWA 4PJ7A 2V2XA 3FOLA 4JM2B 5IFJB 4PG2A 4M48L 4BK4A 4PRHE 4NQED 5GRJH 4PRDB 3BP6B 4ODXA 4DVRH 3TVMB 3P4OB 1UWGH 4H8WH 2C7UB 2CR6A 4TNVK 3WFDL 3MRBB 4EDWH 3SGJC 4JPWH 4P2QA 4HQQL 4XPGH 1XFPA 2C1PA 3GK8L 4CVZB 1B3JA 4Z7UA 4I3SL 4PB0H 2DDQH 2BX5A 5D96C 4CNIB 2CXKA 3Q6FA 3ARDA 4K7FA 5HHOE 4FP8L 3VXSA 3SJVD 5D2LF 4K55A 5FHAL 1YNKH 3VRLF 2P5WB 2JJSC 5HXMA 2OBGA 1A1OB 1M7XA 5GRYA 4KROD 1BVLA 1DBBL 4Y4FC 3RVUC 4J1UB 1T0PB 4HLJA 5CZVL 3S4SA 1AGFA 4JFOA 1IQWL 4M4RA 2RGSA 3PV6B 4N0CD 2ILLA 1D5MA 3AXLA 2GTWA 5E00B 2L0DA 5I1IL 4PRPA 1G7LB 4FFZL 3NAAL 5D1QA 2QADD 4JHWL 1FE8H 3KGRA 2F5AH 1I85C 1I7RB 3EOBA 4UV4H 4XX1E 2OZ4A 2WUBL 3JWDL 4C54A 1HKLL 4J7RA 5J6HB 2PTUA 5IQ9A 4MA8L 3VXMB 4MA7H 2V5TA 5D7SL 4Y0GA 2Z8SA 3EJYC 1WT5C 1RHHB 3ARED 4OZFB 3SGDI 2YD4A 2QJDA 4EI5D 5C0CB 3S3JA 1JWUB 1OL0A 2A73B 2OK0L 2R2EA 2EEAA 1VGEL 4CJ0A 1LEKA 4HWNA 3DO7A 1UM4L 3QQ9C 1LE5B 5F9WB 4LOUC 3NACL 3SE4C 5IW6B 1Q1JH 4YQXL 3QDJA 4JFDD 3BZ4A 3QPXH 5EZJA 2JCCA 3ZKNC 2DS4A 4PJCB 3CXHK 4XPBH 1EO8L 4RBPH 5JOPE 4JJ5B 3T65A 1JNNH 1XGRB 1RK1B 2VE6A 5JPNA 1INEH 3K4DA 4M6NL 1FN4B 2JKXA 1FDLL 4XVJH 2XQYG 4XVSL 4JN2B 3SO5A 4JCLA 1U8MB 5MENA 1KEGH 2VXVH 4LLDB 1G7QB 1NCTA 1Q9KB 1RUQL 1NUGA 3H9SA 2CDFA 4JLRA 1GGUA 3TC9A 3LMJH 4ZXBA 3VRLE 3B9KD 4UILH 4CMHC 1OTSC 2DWEB 4NC1C 5EU6D 3S35X 3RWHB 1T22A 1CF8L 1QA9B 4K3EL 3D48R 4WJ5A 4YPGA 4G8GD 2EDTA 3QDMB 1P7QA 1NCDH 3W2DL 3RX5A 5T3XD 4M9PA 1I7ZB 1UJ3C 3Q48A 4MB4A 2BMKA 3LEVH 3NTCL 2E9IA 2I07A 4CDGC 1JMZA 3W9DB 4DGYH 4D2NA 1UEYA 5F9DC 5T1LA 1RU9L 3LD8B 2EZ0D 3WJJA 3ZMRA 5FGBC 5CGMA 5AAMA 1G0YR 3V52H 5I1EH 3F62A 3UO1L 1OPGL 4Y16C 1MPAH 3O4OB 3ARGA 5AD0B 2AABH 3KPOB 4YDVB 4HKBB 3ALPA 3PQYB 4I4WA 3U46A 1LK2A 4XNUL 5B3NA 2GI7A 4HXBH 1QFWI 3E6FA 1I9IH 4MS8D 4X6CB 2BY2A 2Z93A 1SVZA 4NWUL 5ADPH 2D9QB 2R0LL 4M7KL 3HFML 4M03A 2WP3O 1JGDB 2C9AA 1L0QA 3SO3B 3IDJA 3CX5J 3AB0B 4XBEL 2B1HH 5D7JB 3BKYH 3DROB 3QUYB 1PLGH 2ZPKL 2M2DA 4X7DC 4IIQB 1OAQH 3DVGB 3BPCB 2IH3B 4KHXH 5DD3L 4JGMA 1A64A 1T1WB 5K9KB 3B43A 4Y88A 1H3WM 1U9KA 3CH1A 3DTXA 1KN4H 5JDSA 1A22B 1XGPA 4NQXB 2ESVE 3QEQD 4P23B 1JE6A 4WI6A 2IFFL 1IEBB 3NCJL 2OTWB 1QQDB 4XRCA 1K3ZA 4OIBA 2ZOLB 1RK0B 1VCAA 1DL7L 3WFCL 5B38B 4HJJL 3C6LA 1BJ1H 4CKVX 3VFSA 1MFAH 1UB6B 4FTVD 2AKRB 5EU6E 3SDDB 4XP9L 3ROOB 1JI2A 4PGCA 4QRRD 3FRUA 2ICEB 2MFNA 3F12A 5HJ3A 4K3JL 4G8GE 3KYNB 5EO9B 5I15L 2QTEA 3QP3A 4LSSL 5T3XE 3KPTA 4FQHB 1H0DB 3QEHA 5AG8A 3VXQA 4DZ8B 1Y6KR 2VJXA 1AH1A 4BFEA 3ZT5A 1ZEAL 1TQCC 4M5ZH 2X40A 2IAND 3D0LA 2HFEA 5GRVK 3QHFH 3OXSB 1WICA 5INDA 5A3ID 3DRTA 5CGYC 2XA8L 4NHCH 4G8FB 4OLYH 5I8EB 4OLUL 5DMYA 1RIHH 5J1AB 4OTXL 2D31A 4FZEL 4PTUA 5I75B 3SDXA 2ADFL 2FNBA 2J5LB 1S9WA 3LZFH 3V4UH 5HYSG 3STZB 4PLJD 1WIUA 1H3PL 1R3IL 4NO2B 1LO5A 3MR9A 3DUHA 4F9PC 4NN7C 2C3XA 1WAAF 5IBUG 4Y1AD 2FSEB 4OFYD 4DAGL 3OV6A 2AK4B 3ZYOA 2VIRB 5E2UH 4WUUD 3P0VH 4LQ1A 2NZ9D 2NY4B 4Q9RL 3PDDA 3CD4A 2QQLL 3ALWA 1GZQB 1UACH 4WNQA 3QUXC 2MQCA 1JYVA 5JHDB 4ZMAT 4S2SA 2W07A 3DV6A 1QFWL 5FUOL 1CLOL 2IPTH 4W4OC 1JNLL 4AZ8A 2QSCL 2YUVA 4G6JL 1DQMH 2Z31D 3RL2A 4YZFF 5I1JL 1WISA 4D0DB 1WFUA 1NBZA 1R5IA 2ICES 5DRXB 2ZUQC 1AXSA 2NW2A 2OTUA 1RZGA 2PTVA 2ZSVB 2ZKHL 4HAFA 4R7DA 1EV2E 3KLDA 1YEFH 4BZ2L 3MLPA 4OF6A 5GRWA 5TE7H 1JHKL 2VKXA 4R4BA 5DFVD 5CBEB 1G9MC 4H0GA 5ILTL 1C08B 3QNYA 3P11L 1LNUA 3U0PA 1ITCA 4FTVE 1JTOA 2C3HA 3RJDA 5EZOL 5LJYH 4QRRE 3UTTD 4IRSB 4HJ0D 5C0RH 2R4RH 4JDVA 3RPIB 5BJTB 1HKFA 5D70H 5BVPH 4FXGA 3B5HA 4UQ2A 4FQLL 4POZD 2Y06H 5C07B 4FQXA 1S7TB 1BJ1J 1H5BB 5GGRB 2IANE 3VWJC 4PP2A 3VD9A 3KJ4C 4MHHI 3MBEC 4Q6IA 2PXYD 5BOPA 1YMME 5F7YC 3GMNA 2L7UA 4PJ9B 1IZKA 1A7QH 4Z18A 1KB9J 5E2VL 3HMWH 1KIRA 3ULUH 1CQKA 4R4FL 3V6ZB 1RMFL 1TCRB 2MKWA 3TBYA 1EJOH 4LCWB 1CD9B 4Y1AE 4K94L 4UDTB 2VSDA 4WUKL 2A9NH 1AD0A 1TPXB 1PKQA 3WUZA 4XMKH 3WE6B 2FEEI 5HVFB 2E7HA 4YHPB 3O6KH 2YR3A 5ESQA 1WC7B 4YZFE 1MQ8A 1M71B 5BQ7A 3L5XL 2FR4A 1FL6B 5CUSL 1PFCA 3KLAB 1AFVH 4F2MB 2AK1L 3MNZA 5FB8A 1T03L 1FZOA 4G6AC 2HRLA 3H6JA 4RMRA 4KUZL 1MCIA 4Y4KA 1NAMB 1OAYL 1KIPB 5I66A 4L3CB 3RZWA 3I3EA 2ZG1A 1ZWIB 3FO1A 4WDIB 3BZDA 2A74B 2XG4A 5DVLA 4ZYKA 4E41E 1ZTXH 1EZVX 4HEPG 1EHNA 1QLFA 4D9LL 3LKPB 3MA9L 4LSUL 2Y7QA 4W4NA 5L0QC 1FCCA 3L1OH 4ODVH 5EH1A 1NFIA 1YQVH 2XQBL 3FFDA 5BW7C 3MJ7A 5CJQH 4Z77B 3TZVD 3RI5K 2B4CL 3VFRA 3MV8B 3X3FL 4F7MA 1XR9B 3ULSB 1ZXQA 4L4VD 4GAYB 2XWJB 1G0DA 5DUBA 2H2SD 2W92A 4EOWH 4OV5A 2C3VA 2V7HB 2XPGB 3D69A 1P84K 5C6PB 4NKMB 5I1AB 1E6OH 4KK8D 1CVSC 4JFED 3WYRA 2ZCHH 4ZD3H 3NIGE 1Y0LB 2VLKD 1MNUH 3PGFH 1K85A 2N1KA 4MXWH 5EBGA 1F4XL 4YHIB 1YC8A 1X4ZA 4NGHH 4ERSH 1T21B 3CFJB 1EAJA 2VAJA 5E4IA 2OXGA 4P57B 1NSNL 1RVFH 1ZLVH 4LLUA 1C5CH 5ACZA 1SMAA 5F7EH 3VCLA 1HHHA 3MV01 1FQ9C 3KYOA 3V95A 2VAAA 3VXOB 4IRJD 3THML 4W6YB 1R3JB 1JYXA 4HUWB 4PJDB 5I1LA 5T1DL 3T0DA 4JFYA 4NNYB 5GQBA 5DUMH 2BERA 3MTRA 1NCCH 3W39B 3KJ6H 4O4YH 5L2KB 1JGEB 3CPLA 4LSVH 1VFMA 2V17L 3W0WB 2WUCH 1CGWA 2O5XL 3M07A 2WZPD 1HCVA 4PJEB 3VXPB 4P59L 1T7ZA 4XP6L 1C16B 5IV2A 5E6IC 5EPMB 4G7YL 4DKAA 1JHTB 4OFIA 3DX8B 5HYSA 3QO1B 5HYJB 2FEEL 5DFWH 5I1GH 4M4PA 4WWKB 5F7DA 3G9VA 3QA3A 4RMWA 2OX5A 1HH6A 4HS6A 4N1CA 4FQ2L 2WQRA 5CD3A 2CDGB 5JW3L 3WNOA 2XNAB 3BPOC 3BD3A 3MOQA 1KLGB 3BQUA 4YHZL 5C8JB 4K71B 4JPIB 1N4XL 5J12B 3L5WB 5GRZA 2FLBT 1LO4L 1DQLH 4J8RB 3MRKA 1C1EL 4Y2DB 5KVEH 4U6XA 1AD9B 3NCEB 4S1DD 5DLMH 3P77B 5D7LD 3WIHL 2YBRA 5D2NB 5E8DH 4L4TD 2EECA 3BN3B 3GSVB 3QG6A 4L4VE 3O3DB 2E7LA 3N9GH 4MXVE 3VXUD 1FO0H 4ORGA 4PJGB 2AJ3A 1CDBA 5DJCA 3FOMA 4LVNC 1EVUA 4FFVD 1OSZB 1ZHNA 2LAAA 4P4KC 3O6LL 1VKXB 4OT1L 1OGAA 3IDMB 2VLKE 1DBJL 5HVWA 1YQ2A 2GK0A 2A0LD 3QCUH 2D0FA 5IBTH 4LIQE 1I4FB 4QT5B 3MNWB 1KTDA 3CXDL 2P5ED 4LU5L 4QOKE 4MNQB 3QUKA 4XC3L 5F7UA 1Z9SA 1N7MH 1QLRB 3L7EA 3GJFB 1OCWH 1M7DB 3CUPA 2A83A 1DEDA 3GZKA 1WBXA 4NZTH 3GJEA 1NCUA 3OGCA 1V5JA 4HZLB 4H20H 3AAZA 3DURA 4NNPL 1WJ3A 4D9QD 1QFWM 4NPYA 1JGLL 2CRMA 5K9OA 4MQXC 1U8KA 5HSFA 3UBXG 1L9MA 1CU4H 2I5YL 5T1MA 5HI4D 5HYFA 5IM7B 1WGOA 1BZ9A 4JM2F 3FT4B 4LFHG 4HG4J 4M6OL 1IVLA 1A3RH 2X42A 4O51A 4EQ3A 2EDQA 4TSAL 2EH8L 3PIQB 1X5XA 4PR5A 1QO3A 4NN5B 5GJSL 5AZ2L 1YDPB 2QLVB 4GO6B 1CGSH 3QCTL 5DD1H 5F44A 2HJFA 2FHCA 3TH4T 4HDIA 1P69B 5CILL 5MP6H 2X1OA 5DC0A 1N0XL 4V1DA 3V5DA 1BQUA 2DI8A 2F53D 3JTSA 2WIMA 3TIDA 4KQ4L 3RTQB 2D7NA 3CFKB 4POUB 3VFWA 1DANT 3FT3B 1G9NL 5EA0H 5D7LE 4PJ8C 1ACZA 1VEPA 3PP3K 4RAUA 4MDIA 4L4TE 2A38A 1MCWW 4UTAH 3HE6B 1F97A 2FO4A 3QXTA 2A6IB 1AE6H 1H15A 3WDIA 4ODSH 2VSCA 4NO5B 3O11B 3W5NA 4LCIH 5TH2A 3BUYA 3OMZA 3BYYA 3VXUE 1J1XH 1GH7A 3ZO0A 4HWZB 3PP4H 3O6MH 3UDWC 4JO1L 2W9LA 1K5NB 2VDRH 5BXFB 4JG0H 4OLVL 1ZHBB 4P3DA 1IGMH 2IH1A 3O8XB 5GIRB 2Q7NA 3NH7L 1RY7B 4M3KB 5H94B 3V0VB 4KK6D 4MNGE 3EO9L 1X7QA 2IADB 1A47A 3QIWC 4XMPH 4JRXB 4YK4B 2O26U 3HI6H 1RZIB 4HWUA 4MWFB 4H1LH 4L3ED 2ID5A 3H7LA 3S36X 5MEOB 5DT1L 4YGAB 3S88L 1DSFH 1IM9B 2XICA 4LBEB 5I1DB 2X4PB 4JZJC 3KHOA 1A6WL 2W0KA 4FQJL 4PJCF 1OGTA 4TN9A 3MRRB 4D9QE 1BD2A 2EE6A 2FD6H 3GMRA 4PJXE 1Z9LA 4YBHA 5FOBB 2OTPA 2DQTL 1E4WL 3HC0A 2BNUA 3MRGA 3D85A 2FB4L 4JDZB 4YE4L 2GFBB 4KVNH 4MA1C 1NAML 4DW2L 2DJSA 3L9RB 3UZQA 3EO0B 3Q0HA 1V7NH 5F9JB 2MQ0A 1JRHH 1DUYB 3OX8A 3C60D 3QHZL 3U0WH 1U8LB 3O2DH 1MQKH 2AXFA 4LDEB 2VLLB 4UTBL 3S35H 4I18C 1TFHA 1OP3H 1CICA 5SWZA 1FJ1A 4L8BA 3U30C 5I0DA 4Y4HA 2DJ4A 1BAFL 5EOTA 3IU4L 1JPTL 3HG1A 3ARFA 3QXWA 1R5WA 3T0VA 2F53E 5L2JB 4NKIL 4UT6L 1LP9A 3DV4B 2A77L 5IHZB 2YK1L 5CEXA 3MRLB 1G7HA 1SBSH 3KPRB 4IOIA 3WLBB 5IKCB 2BHYA 1UH4A 5A40E 5D1XB 2FBJH 1YN7B 2NY7H 5GRJL 2W9EH 4DVRL 1HIMH 4HKJA 4ZO7A 1J18A 1UWGL 5GGSY 4H8WL 5SWSD 3M45A 3PABA 2EXWC 3IB4A 3V4PL 4EDWL 2VDMH 3I50H 4JPWL 1YA5A 4XPGL 5TDOA 3WLWC 4XBPA 1JF1B 2DIAA 1IAOB 4Z7VE 1KENL 1AO7B 2IJ0C 5EIQA 5E2TH 4PB0L 4X6CF 1INDH 3QDGA 5KAQF 1EFQA 3IJYA 1FZMB 2BVUA 1TVHA 1YN6B 2CKNA 1YNKL 3QUYD 3ZHLA 3W82A 3C5ZC 3V9FA 1TENA 2VLJA 1Z5LA 2EYRB 4CUCA 1F13A 1YPZA 2PO6A 2HFFA 2EEDA 4L3EE 2J4WH 4P46B 5DEFA 2ADIA 2HG5A 4YBQD 3WFHB 1OW0C 2F5BH 1RZFH 1RJZA 4PYGA 4HKXB 3ROLA 4P23D 1ZGLA 1FE8L 3TESA 2F5AL 4X6DA 5D9SA 3BESR 5C0DA 5E94A 4XNQA 12E8H 4U6YA 4Y5VA 5DO2C 1ZA6B 3PWNA 4MJIE 1T1ZB 3MJ6A 3MRJB 4WTWA 4NM8L 4QRPB 4XT1C 4MA7L 1A7NH 4E9LA 3RFZC 3KPMA 4LLMA 2ZUXA 5DMGD 3EKCA 4ENED 3VG0H 3EGSA 2X1WL 4X4YB 3SDAA 3SDDD 1FVEA 1A3QA 2BY0A 1E4XH 2ICWB 3VXRD 2EDHA 1Y6NR 2A6DB 1JN6B 5GSVB 3VWKA 4Y89A 1OD9A 4AQ1B 2XN9E 2ARJB 3OAYK 3SDCD 2J6EA 5MERB 4ZAKB 1KJ2H 1Q1JL 4PFEA 4Z5RA 2NTFB 2EDJA 3QPXL 5BRZD 3GSXA 2IAMB 1MHEB 5HYQB 3RGVA 4YDLB 3TN0B 4XPBL 3FQUB 4QCIA 4LSRH 5IOPB 4WRLA 1INEL 3EYFA 3QFJE 3UBXA 5INCA 3VGAC 4ZUSB 4ZNCD 5IROA 4QXTB 1A9EB 2H45A 1QPPA 1UWXH 4XVJL 1XIWB 3D18B 1U3HB 4P5TC 4YXKH 4R4ND 3TA3C 2VXVL 5E8PA 5HI3C 3OJDB 1Q9WA 2NY0C 5SWSE 3QSKB 3K8KA 4X5XA 3ES6A 3SE9H 3IU3B 3OKNA 5IBLD 3I9GH 4XBGB 5J06A 3R06B 1AGCB 3LMJL 4U1LA 5E4EC 2AK4D 4UILL 1OF2A 3JSSA 1YY9D 3T8XB 3QJHB 2BNRD 1L7IH 2NY4D 5KVDL 1KCSH 5FYKH 2J8UA 3RDTC 4CN1A 3PUCA 5AAWA 1NCDL 5JHDD 4NZJA 3DX6A 1B0RB 1LILA 3BEWB 3FKUS 4JQVA 4LP4A 1CFNB 4NP4H 2CGRH 3LEVL 3QIBB 4M43H 2HAZA 4OB5H 3OXRB 5DHXB 4W70A 1NKRA 3GM0A 4DGYL 4XX1G 3TEUA 4M7LH 3RVVD 4XC1H 3UAJC 3MREB 5EC1A 5BZDB 3D87B 4NO3A 3HNVH 5GGTH 4R2GD 1KCUH 1MPAL 1R5VA 4ZS6D 3K3QA 5FKPA 4UU9A 1QEWB 3UJTH 4G8EB 1JTTA 1KIQA 3MQIA 4X9FA 4HXBL 3O6FC 4KGJA 1NGZB 4I48B 1RZJH 4JFFD 2ZOKB 4MA3A 1NGWB 1G6RA 1LVEA 4S0TD 3I6GB 5ADPL 5ICZA 3OB8A 3CVIH 4OZHB 1GSMA 1TJIH 1QRNB 4P9HH 1CI5A 4KRPB 3BE1H 1S5IL 5AZEH 4FFYL 2IWGA 2X1QA 5SWQB 1XGUA 5ECJE 4KDTA 5BS0E 3VXRE 4YHYC 4HUUB 1VESA 4JY4A 3SDYH 1HSAA 4E5XA 2B1HL 4R3SB 5I6XB 4TUOA 2APXA 3BKYL 1PLGL 1HQRA 4GG8B 3B4NA 1OAQL 4L8CA 1U3JA 5BRZE 1HDMB 4KHXL 1NCWH 2D7OA 3KPQB 4JPVH 1T5WB 3OJVC 4NRYB 3MLYH 3T0EC 4P0DA 5KTEH 3X12B 3HUJE 2NY2B 4PJ9D 2ZUSA 5JOEA 2YD7A 4G9FD 3MRCA 4YNYA 4YXHH 3RWJB 1P4IL 1Y18B 1IM3A 4KRLB 5DXWA 3JVGC 3BIKA 4PRAA 3ILPA 3C2AH 3ZDZF 3L6FA 1A7PH 4LCWD 2E9JA 3WSQH 2G75B 4WU5B 4X80H 2P49B 1D5BB 1MVUA 1TXKA 4KJQD 1ZT4A 1MFAL 4X9BA 4UDUB 4O2EB 5GGQH 3IDNB 2BNRE 1JHLH 2EKSA 4RFEB 3B5GA 1A02N 2P46B 2E6JA 4I13B 1Z9OA 2WQ8A 1JF6A 3BRDA 2X5PA 4F7EA 3BH9B 2ZSWA 5IG7B 3DUSA 3T4YA 5KS9B 1PW3A 2I26N 4EN3D 4LCCC 5EO0B 3QEUB 4DKFH 4Y5YC 4M5ZL 4MCZB 2YHGA 4GRLB 2BSTB 2CLZA 3G9AB 3QHFL 3V0AC 3GEWB 1UZ8A 1OAUH 1QBLL 4MJ4A 3RGHA 4HUVA 3NZHL 3SKNA 4DOHE 4NHCL 1XGTA 1FO0B 5FOJA 4K8RD 5DJAA 1RIHL 3S98A 2VQ1A 5DTFB 3DX7B 3VDCA 4JFFE 1KJMA 3MUGB 3LZFL 3BZFB 3NFPB 4U1SB 3V4UL 2HKHH 1ZLUK 1M7IA 5C0NC 5TFSH 4QF1B 1ZS8B 1BM3H 2GJZA 2Q8AL 2ATPB 4N8PA 1Z6JT 4LHUD 1FFQA 3OR7B 4L9LC 3RWGB 3JZ7A 5CP7B 4XVUC 1Q9LA 4PLNC 3TWCH 2WIIA 1HSBA 1UACL 5D96B 2F8VA 2WBWB 5FYJH 4X6EA 1KGCE 4A2LA 3B2UC 3IDYC 4JZOB 4Q74A 2EO9A 2IPTL 1CFVH 4JY5H 4JRYB 4Q6IC 5C0AD 1DQML 4G8IB 5EN2B 1UXSB 2P24B 1F6AB 2P8MB 3UEZA 3WDJA 1VA9A 4ZFFB 3VFMA 3U6RA 3ZDZE 4AG4H 3E6HB 4CBPA 1U8OB 4G9FE 1MRFH 4OAWB 4LRIC 5HVGB 4RGNC 2PYEA 1K4DB 5DJ6A 4X99A 5TE7L 5HHNA 3MFGB 1A4KA 4E0RA 4V2BA 5AYUH 2APTA 2EYTA 5JZ7D 2WWMC 1DBKH 2BC4A 1FZKB 1T1XB 4J3TA 5DD6A 1RIVH 1NJ9B 3WN5A 4PRHA 4D3CL 5C0RL 2R4RL 2GJ6B 5D70L 5ICYA 5L2KD 4DVBB 3MRPA 3KXFB 5FGRA 1RQ5A 1INQA 3BPLC 2Y06L 5IP4A 4HFWB 4JFXA 3W0WD 3EJZC 2AEWA 1KEMH 1FHGA 4PJDF 3BW9B 3CJJA 3UTSB 4GW1B 4JKKA 3OF6D 1C5DA 1XCTA 4NT6A 5HHOA 5JTWA 5B8CB 5KSVA 1ZA3A 43C9A 4WWKD 4KTDH 4BZYA 3HMWL 4PJEF 3PL6B 3ULUL 4XCYB 4Z8FH 4GBXC 4DZBB 5ITFA 1IBGL 3JWOC 2EO1A 3BP4A 1V3LA 5DJZA 1XH3A 1G1YA 5D1ZD 1EJOL 2YD9A 3L3GA 1UFUA 4N9GA 4F7TA 1AQDA 5I2IB 2A9NL 3NFNB 5I71C 1BOGA 4FXKB 4XMKL 3REWA 4H0HB 1I3RA 2ENSA 1BWMA 5CJXC 3S96A 1W72A 4N0YH 1JCKA 3BVNB 5IEHB 2Q86A 1SEQH 1J8HB 5FYLD 3HE7D 5SX5K 2PW2A 3L3KA 2I9TB 4M8QB 5LAXB 3EOAB 4JGJA 1AFVL 1UQSB 5I17A 1ZHKB 3RQ3A 3UTZB 4IRZH 4PGBB 5C0AE 3MLXH 3QIUC 1XZ0B 3VFOA 5JXAH 2AXHA 4OM0H 1OB1A 4RDQF 4U0RC 4LPYA 4NC0B 4FFWD 1HILA 1A8JH 4HCRL 3BP7B 4QYOA 3LV3A 1XF2A 5KVGH 4LCYA 4PJGF 1B0GA 3TO4C 5CHNB 3N1MC 1ZTXL 4MNQD 1OP5H 1HEZA 3ET9F 3VFPA 1MAJA 3IETA 5FKAA 1XMWA 4FQQA 3DSFH 4PJIE 5DRWB 5HDBF 4OI9A 2HT2D 2F54E 3VMOA 5A2FA 1U8PB 3L1OL 4ODVL 1XF3A 4HC1A 5MEQB 1BZ7A 3WV0A 3F7YB 1SJHA 1IILE 5DI8A 1NDGB 4F7CB 2W0FA 3FO0H 4NQEA 1JPST 2NXYC 2E5EA 3DMMB 3MLZL 1PY4A 2Q76A 3ARZA 1RUKH 3KDMB 5GXBB 3C8KB 4XNYH 4O9HH 1N26A 1A6UL 4ZTPL 1JGVL 1GJIA 3A6BH 5D2LA 1VEMA 3MGTA 4EOWL 3T4AB 4PJEE 2EDBA 3MO1A 3HI5H 3NCCB 5B3JF 5DJDB 3U1SL 3V6OC 1E6OL 3LN9A 4APQD 4I77H 2ZCHL 4ZD3L 4MXQC 1GPOH 1RUPH 5DVKA 3PGFL 4KKCD 1R0AH 1ETZB 4MXWL 4RA3A 1A1NA 2M1KA 3LKQB 1IGYB 3PF2A 3WO3B 4HGWA 2VLRB 4ERSL 4JFHD 1BBDH 1MFCH 5DEGA 4F7PA 4O2FB 1X5JA 4QHUB 1C5CL 4MCYA 5KANG 4BQBA 1AHWA 3OAZH 5C0BE 2O5ZH 4OZ4B 3AFLA 5C0IB 1LDPH 2SEBA 1NC2B 3CNKA 3DXAB 3DETC 3JWDC 1O0VA 5DJXB 5DUML 4XXDB 3KJ6L 4O4YL 5FYLE 4LNRA 3F6IA 4G42A 1T89C 3NCMA 2XTLA 4CMMA 2ZCLH 1LO0H 4WW2B 4JFPB 3AREA 5JW4N 2WUCL 4EI5A 2NXZC 3C5SB 4JAMB 2Z9TA 3FAXA 5C0GA 4HMCA 4P2OD 3VFTB 4XCEA 1U8HB 5C0JB 4AK1A 3JV6B 5I1GL 5J1SC 4HULB 3W81A 4A2MA 4JFDA 4XI5D 3IVKA 3G08A 4XGZA 1KT2B 1WBZA 4HIHA 1DFBH 1KJ2B 4EUPA 3OKYA 3TO2A 4Y2OA 1BJMA 4UV7H 3JWNC 5KVEL 4NN7B 2ZUVA 3GI8H 2VL5A 4LAQH 4YFDB 5F8QC 15C8H 1DN0A 2FWOB 3KWWB 5DLML 5E8DL 3HR6A 4LPVA 4DCQA 3L3IA 5FO8B 3AS0A 4TTDC 4YO0B 4UUJB 5B3JE 2E9BA 4F57H 1KLUB 2UZIH 3OKKA 5C09E 3MCG1 3QUXB 2DM7A 3GDBA 1YEIL 5DZOA 5A2IH 4M5YH 4Y5XB 5EIIA 5F9AC 5F93C 4GQPH 5JLZA 3N9GL 3H9HB 3LKNB 3WL9B 1FO0L 3B9KA 3LN4B 3U9UA 2OZ4H 5EU6A 1BEYH 3QI9D 4KFZC 2B0SL 4G8GA 3EYSH 2C1OA 5DQ9B 3VMPA 5KSAB 4HF5H 3PGDB 2OL3A 4R7NB 2ZUQB 4NFBA 5IBTL 3BKJH 4JFHE 3BPNC 4ZFZA 3W9EA 4AH2A 3K2UH 1N7ML 2BHUA 1QR1B 1OCWL 1F45A 1VGKB 3RIAF 2IEPA 1JRHI 3VRIA 2OLDA 3X17A 4HK0B 4NZTL 3D3VB 2GSGA 1T04B 5EC2A 3KPRD 1YEKL 2H3NA 3GSOB 1MRDH 4WU7A 3F7PC 2R0ZH 5D1XD 4YGVA 1RV6X 5DURB 4H20L 1T83A 4PGEA 4GRWH 5T3ZE 4HIEB 5CLWA 4CN6A 1NFKA 4M1DH 1KF9B 1LE9B 2ADGB 1CU4L 1A3RL 5D7IE 3REVB 1BGXH 1AO7D 4J3VA 4C55A 1MCHA 4HUXB 4OZIE 1FIEA 1KB5A 3VWJB 4ZUTA 1LD9B 4QRQA 1CGSL 1UJTA 1CE6A 5DD1L 1SY6H 4Q58C 2VDOH 4OLXH 2NMSA 3D9AH 1FLTX 2CO7B 5MP6L 5IB5B 3GMLB 3MLTB 1WV7T 2DI9A 4P46D 3LKSA 2BHZA 3W11C 3ECBB 1XGQA 4NZDA 2DLGA 5GRUH 3ZSSA 2KQNA 3C6SB 1ES0B 3QEQA 2I27N 4RIRB 4PJAB 3FB5B 5LQBL 1FL5A 2AJZB 1UEMA 2YRLA 4OFVA 4UTAL 5DVMA 2PTTB 2CIIB 3C5JB 1W0WA 2VXSH 2CIKB 1AE6L 1EAPA 3GSQB 4P5KB 1D9KB 4QRPD 3D0VB 4GXUN 4NUGH 1NLDH 4ODSL 3B3IB 4LCIL 2UY6A 3RAJH 1UXWA 3TCLA 2HJLA 3O6ML 3PP4L 1I8LC 4ZSOE 4FTVA 1MCJA 3OKMB 2GUOB 2VDRL 3P0GB 2IPUK 4JG0L 4KKBD 4L8SC 4ZOCA 3WKMH 1IGML 4QRRA 3OHXB 3EYQD 4YHKH 1TVBB 5IVXB 2D4FA 2X7LA 4BKLA 3BRFA 1O7VA 4XMPL 1U6AH 2X44D 3PHQA 4HLZH 3T2PA 1FNGA 3HI6L 5DS8B 4YHLH 3PWVA 4ODWB 4W6WB 1QLEH 1XCQB 3G5VB 1DP0A 3IFLH 3ZE0E 5T33H 1E4KA 4LL9A 5KN5B 2IANA 1E4XI 3VXTA 2AS5M 1E0OB 1D5XA 1DSFL 3LCYA 4TSBL 5L0QB 3S8WA 1X5KA 3TBTA 1PAMA 4LEOA 4HIJB 2W65A 1IJ9A 2AJXH 1XIWD 1U3HD 1CIDA 2NY1D 2GAZA 4U4BA 2FD6L 5E8NB 5KSBB 5H35B 5HGAA 2FJFB 2GY5A 3WEXA 1CLCA 4KVNL 5LGKA 1FVDB 3EW3B 4YEEA 5HD8C 2VMFA 1KELL 4Y1AA 4OFYA 1V7NL 3RL1A 4NFDA 4JDTL 1GGBH 1JRHL 4NO0D 1AJ7H 4WUUA 3IFNH 3U0WL 5I8KH 3O2DL 1MQKL 3P30H 3S35L 3L95A 4QHNA 5HDOA 2HT3D 1T0NB 3KLHC 1T5XB 3NGBB 3QIBD 2PETA 4JM2C 5IEKA 1RJLA 1IE5A 4ZOEA 2HVJB 5F89A 2Z31A 4NOBA 1FZJB 2AXGA 4Y5VC 4C4KO 1SBSL 5ACLA 3OKDA 3MV11 4IM8A 5D6DA 4DFHA 2FBJL 2B2XH 3GUTA 1ONQA 2W9EL 3PXJA 5D71H 5JNYA 4UQ3B 3T0XA 1HIML 2JCCE 4YBLC 2XFXB 3KHQA 4DUXA 3MCLH 1MLCA 2Z4QA 1ZHLA 4L4JA 2BVQB 2F19H 2VDML 3I50L 4FA8A 1N3NB 3P3YA 5DMKB 4KRPD 1ACYH 3F5WB 4PD4J 2W60A 5IWLA 1P7KB 4S1QL 3SPVA 4GQ9L 2Z35B 1CDHA 1J1OH 3DWTA 4Z7WB 3UTTA 3GMQB 1BIHA 4CW1A 3D6GA 4G6KH 5E6IB 1CT8A 4TVSa 3OKLA 2AV7B 3TV3H 1S7QA 3OKOB 4KI5C 3K1DA 3BDYH 4H25A 4X5WA 4QRUB 1KG0B 3ZE2F 4P2RB 3O9WD 4HBQA 3GM8A 2J4WL 3EZ8A 1HXMB 4KDVA 3BPOB 2F5BL 1A14H 2DQFB 1RZFL 3CFCL 5KG9B 2DKUA 1KTLB 3UX9B 2PXYA 3PHOB 5HHPB 4G6ML 1CDYA 4IEFB 3MMEB 4GOSA 2AV1B 4PREB 2VWEE 1OTUC 12E8L 1OWWA 3T04D 2ZCKH 3MBXH 1C5BH 1DQQA 4YC2C 2VXTH 1I1AB 1A7NL 4JM4H 4K94C 3ZDXF 1LEIA 3MRIB 1G7IA 3VG0L 2X70A 4KU1A 5CGTA 4KJYB 3DOSA 4GMSH 5AUMA 3ZE1F 2AEIT 2VABA 3CX5K 3GMMB 3O3AA 5TF1H 3DIFA 5I1HH 4OF8A 4KI1A 4NJAH 1MJJB 4FQPA 2VDNH 1HNGA 4LVNB 1KJ2L 4C57C 2CXGA 1ZSDA 4HGKC 1WCBA 1VACA 1AP2B 3KYKH 3N1PC 3QBTB 5JHLL 1FV1A 3HLAA 1MWAA 4NQVA 1VFBB 3SCMC 1IMHC 1FNHA 2ZJSH 4U1NA 5FAAA 5KS9F 3PWJB 2V7NA 2X4OB 7FABH 4OQTL 1PZ5B 4UNVA 2JJTC 3EYVA 4OZFG 2NLJA 4WO4D 5I16A 1XGYH 4KC3B 3S7GA 4C59B 1FNFA 1QSFD 1IGFH 1MJUL 4M61A 4TUKL 4YXKL 5FO9B 1F00I 4U1JA 4C83B 1N6UA 3O3BB 1K8IB 2KDGA 4PGDB 5E0QA 4G9DA 3I9GL 1S5HA 2R0KL 3L3DA 1E4JA 2RJMA 3FQXB 3LSOA 3VH8B 1L7IL 1A4JA 2DYPD 1BZQK 1QBAA 2ZWLT 5FYKL 4NSKB 4NDMB 1KJVA 3TZVA 4XNZC 3LD8C 3GSUB 4LK4A 1ZMYA 4NP4L 5F1NB 2CGRL 4L4VA 3G04B 1YUHA 4OB5L 2EDYA 2V9QA 3O4OC 3ZKSD 3QR2A 5ERWB 2D9CA 2UUDH 3RRQA 3VFGL 1CL7H 4M7LL 4YEFA 5J57B 5F7WC 4CVXA 4XC1L 3RVUD 4Y4FD 1E6JH 3PG2A 3HI1B 3H7BA 2FJGA 2IQ9H 1U92A 3BHBB 2XV6B 3HNVL 3QXAA 5GGTL 2AI0H 4JFEA 3VE0A 3GJFK 5DRNB 3UJTL 1GIGH 1HHIA 2E6PA 2VLKA 1U95B 5F70A 1RZJL 5HDQH 2XOTA 2OS7A 2AAVA 1BFVH 1TJHH 4XB8A 1WLHA 2F58H 1AIFA 3CVIL 3AB0C 2DRUA 1A6TA 3NZ8B 4P9HL 4ONGH 5D7JC 4NM4H 3BE1L 4OZGE 3EJYD 3BT2L 2YMXH 1CS6A 4U0QB 4IRJA 3QHTC 4IIQC 3ARQA 3SDYL 3SDXE 3KPSB 4MMXC 3F6LA 3GB7A 4KGLA 2GJ6D 4P4RB 5D8JH 3KXFD 3PV7A 3EFFA 5DK0A 3QQ9D 3ZKXC 3JWOH 4PV9A 4LOUD 4E42B 1E28A 5JORB 1NCWL 3DGGA 4J4PC 4JPVL 3HZVA 4HUKB 4LCUB 3MGOA 3EJJX 1NH6A 5KAQG 3ZKND 4JG1H 5KTEL 3INUH 4PJ7B 2V2XB 3RNKA 5CJBA 5ANMB 4PRID 1T66C 2KQMA 3HHRB 4WFFE 4ODXB 5HHMD 3LRSA 4MAYA 1QSFE 5JIKA 1F4YH 4RWYH 4TPRH 2B1AH 2YPKA 4P2QB 1XEDA 3C2AL 1A7PL 3BDBA 3WSQL 4LVEA 4Z7UB 2BRRH 5F1IB 2M26A 3TJEH 5GGQL 1EEZA 3WO4C 2IQAA 1JHLL 3EDEA 4LPTA 4XB7A 2W59A 5D7LA 1MIEH 1JJUA 1OTSD 3P9LA 3VXSB 4D0CA 1BFTA 2P44B 3LN5A 4L4TA 1J8HD 4U2ZA 2R56H 4XH2A 1CFTA 1FGNL 4JQXA 4D9RE 1QKZH 1BVLB 4BFIA 5DRZB 4DKFL 4OLEA 5EUKA 1BIIB 4ODUB 1AGFB 4JFOB 3HNSH 3VXUA 1IQDA 3RNQA 4HBCH 1AKJD 1D5MB 3AXLB 3FB8A 5EB9A 5I75C 1K6QH 5DMIH 4PRPB 4MAUH 3IYLW 2JE8A 2BK8A 5D1QB 4BSWA 3IKCA 2Q8BH 2QQQA 1KB9K 1HWHB 3EOBB 5C9JA 4Y16D 1EZVY 4MNGA 4MD4A 3U2SA 5IQ9B 3B8YA 3U0TA 2P5EA 5EORH 2HKHL 1NMCC 2G5RA 4OF5A 5A43C 5TFSL 1ZOXA 1X5AA 1MCDA 4K7PY 2I9LA 4U1GC 1GC1C 3WS6C 1LEKB 2XY1A 2BVPA 3QXDB 3DO7B 5IFJA 2GQHA 3S3SA 3TWCL 4RX4D 3H8NA 4PRDA 4QTHA 3LKRB 2FLRT 3E0GA 5FYJL 4J2XA 3QDJB 1DZBA 1CZ8H 3P4OA 4PJXA 3BZ4B 3VW3L 3MRBA 2CJUL 5IF0A 1CFVL 4JY5L 4RMSA 4G3YL 4GRWB 5HHQA 3RIAK 3DX9B 1WBYA 1PKQE 3BDXA 3T65B 2AEPH 1OAZH 2VE6B 1MCPH 2YPVL 3HN3A 3QEGH 4AG4L 1RZ7H 3V4VH 4PRIE 5EU3B 2G9HB 1MRFL 5HHME 5MENB 5TQ0L 2VLRD 3T2OA 5JIPA 1A5FH 1A1OA 3I02B 4XWGH 3H9SB 4NFCA 4OM1H 5CEZD 4TOYH 1WWAX 2AXJA 3H3KA 1C8PA 4IRSC 2F53A 3PV6A 3I3BA 4QWWC 5AYUL 4OCNC 1B88A 3Q6GH 1DBKL 4HZAA 1T22B 4LPUA 1AQKH 4JO2L 3R4DA 1RIVL 4WJ5B 2HTLC 4YPGB 2B8OT 4JVUA 2VXUH 3H3PH 1I7RA 4NC1E 5ESAA 5C7XH 1IKNA 5J6HA 1FYTB 2BMKB 2I07B 1YC7A 3GMPA 1QNZH 5TDNA 1N64H 1RHHA 4OZFA 1KEML 2R2HB 3L3JA 3SGKC 4Z7VA 1JWUA 5HI5C 3GGWA 4OCXH 2XZAH 4M02A 2HWZL 3ARGB 3DHMA 1W8OA 3BMWA 3U46B 4EBQH 2UYLA 5CGYD 2EICA 3E6FB 4R26H 3BGFC 2VDPH 3VGAB 5CINH 2Z93B 2Y9RT 2QQKH 1CFSA 4Z8FL 2XTJE 3MC0A 4B50A 3TA3B 4L3EA 4R90L 3ARBC 3QZWB 2NY0B 3C2SA 3C8HA 3L3HB 2IPUG 3T2NH 2DQEH 3IDJB 5E4EB 3ZYZA 1CXKA 1UKTA 4N0YL 5LXGH 4JN2A 5FDWA 1U8MA 1L7TH 2J88L 3L5JA 1SEQL 3V0WH 3RDTB 4JO4H 1Q9KA 3QUXD 2EDOA 4WV1C 3FT2A 4UOJA 1CBVL 3WJLC 2COQA 5K59F 2HLAA 3G6AB 1NDMA 3DYPA 4UIKH 3WHXB 3P0YH 4IRZL 4LPCA 3MLXL 3LKOB 2BNQB 5JXAL 3DTXB 2DQCH 2I25N 1XGPB 1QYGH 1NBVH 4OM0L 3C60A 4NOFA 4Z0XA 4HWBH 3BZEB 5KVGL 1S9KC 3ESUF 1ORSB 2KH2B 5DSCA 2VITA 3W9DA 4F80A 5CEZE 2Q3ZA 1I3VA 4NYLA 2KKQA 4IMKC 3S3PA 3C6LB 3D3VD 3RX7A 2FECL 3MLVH 4PGCB 1MHHA 3FRUB 1EERB 4YDVA 2O5YH 3F12B 5HJ3B 3O4LD 4P3CH 1JI1A 1U0QA 1X44A 3HC4H 3WNKA 2CMRH 4OLWH 4KV5F 3CFBA 4XTRC 5ISZD 1JWMB 4YHYB 2EDLA 4H8WC 5E8EB 1RUKL 4O9HL 4YIQB 5CS7A 3VXQB 4U31A 5SWSA 2K7PA 5GISL 4LRNH 3A6BL 3F58H 2HFEB 3LQAC 4CVUA 2DL2A 3PGCB 3SEPA 3RZCC 3KPLA 1G84A 3CDGA 1JGDA 1DEEB 5INDB 3HI5L 4QXUH 1R3LA 1MJ8H 3DRTB 3VWJD 4RMQA 4I77L 3T0EB 4LKCB 3MBED 4LHUG 1RUPL 4JHAH 5IESH 1RIUH 2BVYA 5LKNA 1OAXH 2JELH 1RURH 3HS0B 3QUYA 5J6GA 5ITBH 4WI7A 4NBZB 4NQTA 1EO5A 1BBDL 2NX5B 1OSPH 1LO5B 1S3KH 4IOSD 3BPCA 2IH3A 4AM0A 4XZUA 5K9KA 1T1WA 1KTRL 1KXVC 2XWTA 4XHJC 1SEBA 3DVNA 4J3XA 2O5ZL 2R9HC 5DHVA 4NQXA 4LQFH 1MCCA 4ISVA 2OSLA 4KAQH 4WNQB 1IEBA 4PV8B 3DV6B 3MRDB 3QNZA 1DE4A 5CD5C 2ZOLA 1OP9A 5D4QA 2HFGH 2ZCLL 2Y4SA 4HV8A 4XPHH 1M6OB 1UB6A 2YS4A 7CGTA 3SDDA 4AMKH 1NBZB 1FNAA 1RZKH 3EBAA 1R5IB 3MOBH 2VZUA 1T0MB 3VXRA 5L8LB 1A2YA 4G6AD 1ADQA 4OFPA 2NW2B 1JZ5A 4IDJH 1RZGB 4K71C 3U4EA 3SDCA 5E8OB 4FQHA 4R7DB 4YHML 4Y2DC 3MV9D 5BRZA 4U3CA 5I0ZA 4X4XA 1OT1A 2B5IB 1DFBL 3D39B 5IVXF 1H3XA 1LNUB 3NOIA 1WZMA 4UV7L 1FFOA 3GI8L 3QRGH 3G5ZA 3S36L 4LAQL 1H8NA 1X5GA 4TULL 5I8EA 4R96B 2ATKB 3O4LE 5EZIH 3Q5OA 5J1AA 4JDVB 4L9LB 5KZCD 1KFAH 5ISZE 4FXGB 4UQ2B 4F57L 1EX0A 2UZIL 3GI9L 4NO2A 3SE3A 3IDXH 1RULH 5CWSA 3UZVB 1MVFA 1J7VR 2AK4A 1WTGT 4PP2B 1CD1B 2HLFC 4N0RA 2OZ4L 5TGBB 5KSBF 2BNRA 4Q6IB 1BEYL 5D6CA 1G0XA 3CFEB 5E9DD 1ZLSH 3GMNB 4O02H 3EYSL 3L5IA 2D0GA 3VU2A 4PIRF 1KIRB 2NY3B 3WNPA 2BOCA 5F7KC 5JMRA 4L29B 4GFTB 4OLZH 1T2QH 5B39G 1JK8B 1CQYA 3K2UL 5HPMA 2RQ8A 3FCTA 4PJHF 3BWAA 4RDQG 5I8CB 3MV7D 3VI3F 2J6EH 4GKNA 4KRMB 2AJVH 4N0FB 4PP1C 1MRDL 4PRBB 1C12A 2R0ZL 5ESQB 4QHMA 1WVZA 5DJ2A 1FH5H 4OUOA 3F7VB 5BQ7B 4JFFA 2FR4B 4M1DL 4X8XA 4NN5C 1LO3H 1VSCA 4PJBF 4C56B 3MNZB 5FB8B 1DN2A 3BPLB 1P6AB 2NTSP 1BGXL 4PG9A 1D7FA 3AS3A 4Y4KB 1IFHH 2X4TA 2CDEB 2APWA 1IGCH 1DVFC 5E6ID 3RPIA 1MCFA 3CC5B 3FO1B 1Q0XH 4OD3L 3RTQC 3LQZA 1MOEA 1SY6L 2W0LA 3MV9E 3IJSA 4OLXL 2Y36L 1QLFB 3D9AL 4Z7WF 1S7TA 3D5OF 5I9QB 4CAGA 3OG4B 1H5BA 1NC4B 4BFGA 4U1HA 4DFIA 3ULVH 3HE6C 3RVTC 1PBYA 1HN1A 3FFDB 1ZE3C 3MJ7B 5CFHA 5E08H 4PJ9A 3LOWA 4G9FA 5I18H 4F7MB 4WGVB 4PS4H 3WCYA 2JB5L 2VXSL 4GKZA 3HG1E 4Z7QE 5DUBB 1UM6H 2N7BA 4A6YB 2J3SA 1NLDL 4NN6B 3O8XC 1B90A 2G2RA 4XNMA 4Y8AA 3RAJL 4OV5B 2P42B 1NAKH 2C3VB 2HA1A 4XCNA 4HX1B 1Q0YH 4YK4C 4BQCA 2DQUH 2YN5A 3WKML 1AXTL 1G6RH 4YHPA 5E9DE 4OSUH 3T0BA 4YHKL 1KBGH 4PJHE 5I8OH 3B9AA 3WHE0 3K74B 2R39A 4U0RB 1M71A 1JZ8A 3VI3E 4P4KD 4EN3A 3KLAA 5J4MA 2FZ3A 1Q9OA 5JUEH 2AERT 1RHFA 4F2MA 4YHLL 3HCVB 1QLEL 4LLUB 3TO4B 5T33L 3MRNB 2GCYA 3VCLB 1HHHB 3CXHJ 3QDGE 3KYOB 3MV7E 4ODBD 4KKLC 2VAAB 2A2QT 2IBZY 2WM0A 4PJBE 5ALBL 5DVNA 1ZWIA 2MHAA 5CAYB 4NC2B 1I1FA 4KDWA 4ZUWB 5TE4H 2AJXL 5FM8A 3MJ9A 3RWFB 1YPZE 3ZTJG 4K23H 3CPLB 1DBAH 4MQXD 5M7QA 4LSQH 4NQDD 3G6JF 4LHUA 1FFPA 5IV2B 1GGBL 4X6DE 2AJUH 1AJ7L 5GGUA 3IFNL 4GUPA 5HYSB 4WI2A 5HHVH 3P30L 3UYRL 3L3OB 1XR9A 3QA3B 5IBUB 3ULSA 5EU4A 2DQGL 2XWJA 5L7XH 2P8PA 5C0AA 5IB1B 5F7HA 2XPGA 1PYWB 1B6UA 4NKMA 4U6XB 1NFDE 4OD2A 3BN9C 3V2AR 4TVPH 2YBRB 3V8CA 1H9VA 4JE4B 4DN3H 2B2XL 1V05A 5D71L 4YHIA 4PJ8D 1QOKA 3CFJA 5D7KD 1FSKB 3CSBA 5DQDH 3UJIH 3VGGA 1K2DA 3MCLL 4P57A 1CL7I 2ITCA 3TGXA 2F19L 3WKNA 3ABZA 3K81A 1NL0H 1ACYL 1T20A 2AJ3B 5ICXA 4PTTB 3FOMB 1X5FA 1PY9A 1ZHNB 1R3JA 1JFQH 3FFCD 3KPSD 4HUWA 4PJDA 1OGAB 1ZT7A 4G6KL 5I1KH 5EU7C 5L2KA 1YJDC 1A21A 1KTDB 3IF1B 4NIKB 3FO9A 1JGEA 3QIWD 3BDYL 3L7EB 1NUFA 4OIIH 3SQBA 4X7FC 3W0WA 3CUPB 1UVQB 4PJEA 1WBXB 3BO8A 2APFA 4HW6A 3RUGE 3HB3C 3OGCB 4XVTH 1A14L 4F37F 3ULVE 1J0JA 3AAZB 1CXIA 3DURB 4NCDA 3G6JE 4OFKA 1B9ZA 4WWKA 3TH3T 1VFUA 5L6YL 3ULUC 2YEZA 3CFIC 4HJGB 5K9OB 2PUQT 5BMFH 5A2LH 1U8KB 2ZCKL 3MBXL 1C5BL 1NCNA 2XNAA 2VXTL 4YFLI 1KLGA 3GKWH 1UYWH 4JM4L 5F97E 1TTUA 4JPIA 1MRCH 1F4WH 4NQDE 5D1ZA 4J8RA 5BVJB 2I60L 4ZAKC 1AD9A 3B5TA 4PR5B 3AS1A 5TF1L 4KMTL 5IW1A 4X8JA 2IAMC 5D2NA 2UWEE 5B39A 4NJAL 4QGYA 4YDLC 2VDNL 5F1KC 1DJSA 3RKDC 4Z7UF 3TN0C 5LCVH 2MCPH 3QFDA 3HE7A 4HDIB 4HEME 3QDHA 3MRQB 3KYKL 3QUZC 4V1DB 4PJGA 1JP5A 3VFWB 4LPWA 3SY0A 2ZJSL 3O3UN 3G5XA 7FABL 4MMZC 5C2BL 4LMQI 4MDIB 1CE1H 1XGYL 3IXAA 5FM5O 1EEQA 1BFOA 1IGFL 1QSEB 1BWWA 1RD6A 2FO4B 3MNWA 5DHYA 2H9GA 4IMLB 4MNQA 5MEPB 3GJFA 5TH2B 3TIEA 3BUYB 4K3HA 1HQ4A 5FEBA 2EXWD 5BO1L 2XWBB 3T0AA 3WLWD 5JA9A 1GGCL 3UXFA 3FFCE 4RWHA 1CDUA 2RCSH 1NGYB 1X7QB 3IKKA 1LQSR 4O58H 2FRGP 3C5ZD 3FT4A 4X5LA 1RFDH 1CL7L 4HS8H 1NEZG 1XF5A 3UMTA 1W72H 1RJYA 1E6JL 3VG9C 3PIQA 1FNEA 3MUHL 4LLQA 2AI0L 4MAYC 4APQA 1P2CA 4I3RH 5IMOB 3MUJA 4PBVC 4GRWF 5ANME 1GIGL 4HUMB 3AM8C 5FA3A 4JB9L 1BD2B 5HDQL 3GMRB 4U7KA 4U33A 1EK3A 2DBLH 5DUPH 1BFVL 3MRGB 3D85B 3RY6C 2BSRA 1J10A 1NGPH 1TJHL 2FYYB 5DO2D 4F15B 2AJSH 3DO3A 2F58L 1F11A 1EHLH 1KPVB 3NFSL 5I6XC 4ONGL 3CFKA 4NM4L 2MJWA 3U4AA 2YOCA 3FT3A 4OCYH 3OX8B 3STBA 3SBWC 4GG6F 3I6LE 3CGTA 5D93C 2AXFB 3QYCA 2HH0H 3IAGC 1G7JA 5D5MB 1N5AA 3DI3B 5SWZB 1FJ1B 1FYTD 3WUWG 1EIBA 4L8BB 3TH2T 5B21A 2EIZA 3HZKA 4OD1H 3JWOL 2HN7B 2X4SA 1KNOA 2E9WA 2NY2C 4HC1H 4HK3J 5EOTB 2NY6C 3O11A 2OXHA 1R5WB 35C8H 3ELAT 4HWZA 1LP9B 2DM3A 4M62H 4EXKA 4KTEH 3U7AA 4UIMA 5E24E 2VB5A 4JG1L 2H26A 4P2OA 5CEXB 3INUL 1G7HB 4IOIB 3DJ9A 1WF5A 1ZHBA 1SHMA 4PY7A 5GIRA 1PGRB 1S7SA 1SJEA 1G6VK 3GHEH 3V0VA 2IADA 3GSRB 2Y5TA 4HKJB 3NVQA 1R3KB 3MNVA 1F4YL 5DR5H 5FUCC 4TPRL 2B1AL 3VFUB 3PABB 4RWYL 4MWFA 1HI6B 3TA3D 1YMHA 4P5TD 2R4SH 5TDOB 5HI3D 2NY0D 4XBPB 3KR3H 1QP1A 5MEOA 2BRRL 4IBLT 5BV7H 1IEAA 4D0BB 1N5YL 1P9MA 3SKMB 4AEIH 4LBEA 5I1DA 4OGYH 5JXEC 4K3DH 1MIEL 3AY4A 1TVHB 1OM3H 4J6RL 3RBGA 3JUZA 4WW1B 3V7AE 4GRLC 3RDTD 3FN9A 2R56L 3ARWA 2VLJB 2BY1A 2OQJA 1Z5LB 4JDZA 1QKZL 4I0KA 1P4BH 2HFFB 3U9PH 1I3GL 2RIKA 2BNQD 4I2XB 3HNSL 2ADIB 2HG5B 4QY8A 4ZSOA 1HOCA 1K6QL 5DMIL 1HWGB 1CGVA 3QI9A 4Q6YA 4RMUA 3ROLB 2VLLA 3UAJD 3R1GL 2Q8BL 5D9SB 5C0DB 3STLB 5E94B 4KJPC 4U6YB 4Y5VB 3TNMB 4XPAH 3FZUC 4GG6E 2P43B 4ZOBA 2UV3A 3O6FD 3LY6A 4AEEA 2ZUTA 5EORL 4MB3A 1CR9H 3KPMB 4M3JA 4LLMB 4CU8A 4YBLB 3LQAH 3GNML 1OTTC 3EGSB 1IARB 1JZ7A 1JTPA 2JJUA 3SDAB 1GZPB 4JQIH 1FVEB 1GGIH 1GGTA 3ARUA 3MRLA 3KPRA 4EEEA 5HGDA 3VWKB 5IKCA 3T0WA 5D1XA 3I6KA 4MVBC 2B39A 4D8PA 2CRIA 4R8WL 1HXYB 1I1CA 4XPTH 2VUOA 4UT9H 3GSXB 3O2WL 3RGVB 5EDXA 1KCRH 2R23B 1IAOA 3TNNB 1NUDA 1AO7A 4LARH 4PJFB 1IGIH 2AEPL 1OAZL 1HZHL 3MRHB 4QCIB 3EYFB 3UBXB 5INCB 3T0ED 3QEGL 1I7UA 2M8XA 1RZ7L 4QHLB 1FZMA 3V4VL 1YN6A 3EIFA 3IDIA 4OGAC 3U79A 4KZEH 1IAKB 2BCKB 2R69H 2NX5D 1Q9WB 5IB2A 1YECH 4XWGL 4OM1L 4X5XB 2HJKA 3ES6B 3OKNB 4TOYL 4P46A 4U1LB 3P9MB 5IW3A 3T1WA 1OF2B 4YC2B 4QXGH 2OL3H 3Q6GL 4Q2ZA 5T3XH 4U6HB 4DUWA 3AGVA 2YPLE 3RVXC 5BCAA 2J8UB 1H8OA 3V5KB 2VXUL 3H3PL 3ILQC 4QNPF 1S78C 3DX6B 4Z7NE 2A6KA 3EHBC 1ZA6A 3VI4F 3S97C 1T1ZA 1MREH 1H3TA 1JZ3A 4FN0A 4QRPA 3A67H 2AQ2A 1QNZL 1JZ2A 5B4MC 3ZTNH 1N64L 4N0UE 4RFOH 5B8CC 1CGXA 1FORH 3EFDL 5ESVB 3RPKA 5EC1B 4OCXL 1NANH 2XXMB 3PL6C 2ICWA 1G9EA 1LEGB 1WITA 1R5VB 1FVCB 2A6DA 4NQEE 5IIEB 5FKPB 2Y5EA 4UU9B 3SCMB 5F6IC 4EBQL 4X0KA 5IMMA 4DQOH 2KZ1B 4MA3B 3PP3H 4ETYA 2VDPL 1G6RB 5CINL 3WXVL 2QQKL 3VJ6A 2BJMH 5D2LE 3A6CH 3UJJL 1WSST 5ICZB 1MHEA 4Y19D 2Y6SC 3D39D 4OFDA 3KYMA 2EE9A 2CLVA 5C0ND 1TETH 3FQUA 4YAQA 3BGAA 3T2NL 4KKNA 2DMBA 2DQEL 4I3GA 4ZUSA 3SJVE 1HSAB 4E5XB 5I30H 3UYOD 3OKEA 5IK3A 1XF4A 3NIFF 5LXGL 1A1MB 1MUJB 2AEQH 4XVUD 1XIWA 1L7TL 1U3HA 3D18A 1NEZA 5EBWB 2IPKA 5DVOA 4R0LA 1HQRB 1NGXA 4HCRA 2FATH 4JO4L 5GS2D 5H2BB 1FBIL 2FX7H 4XNZB 4L8CB 1K8DA 3B2UD 3IU3A 3VD4A 5GS1A 3T3PF 3P0YL 3GMOA 1MCOH 2X89D 1E27A 2DQCL 1PKOA 2V2WA 4NO0A 3LHPL 5FA4A 1MI5D 2L4OA 3L7FA 3QT2A 2WP3T 2ZP0T 4HWBL 2D7QA 3MRCB 4YNYB 5JW4R 3BEWA 1CFNA 1TLKA 4NQCB 5F1SA 1IM3B 3QIBA 2X4QA 3BIKB 3EAKA 4RGND 4JGUA 2GJJA 4QNPE 3L6FB 4Z0BH 3EYOA 3VI4E 1EFXB 1EEUA 1MVUB 3MREA 3DMMC 3MLVL 3WUWA 2EKSB 3NIDF 4MLIA 2P4AB 2O5YL 2WWMD 1QEWA 3F8UB 3MROB 4P3CL 4CU7A 4G8EA 3HC4L 4YLQT 2BSSA 2CMRL 4OLWL 1NGZA 4F7EB 4I48A 1BQSA 5FGCE 4JFDE 1OP5K 2A1WH 3V6FA 2ZSWB 4YHOH 1NGWA 1JZ6A 1G7MA 1HINH 4NRZA 4C56D 1I8MA 3ZKXB 1QBBA 3JV4B 2CLZB 3F58L 4PJ5B 4NRXB 3EJZD 4QXUL 1UWEH 2VR9A 5HVHC 4HUVB 1MJ8L 4HFUL 1XGTB 4KK9C 4LSPH 4JHAL 5IESL 4I9WD 1RIUL 1TNMA 1HHKA 2JELL 2JIXD 4U1IB 1JUFA 3WMSA 1KJMB 5ITBL 1U58B 3B83A 1YY8A 2CK0H 4MQ7A 3E8UH 1OSPL 1M7IB 1S3KL 3UBXI 2X1PA 1SBBA 1PQZA 1HDMA 2PR4H 5L8KB 4Y19E 3MCKB 3NIFE 1NC4D 3O9WA 4GBXD 4JY6B 3GSWB 5EUOF 1MCBA 4JVPA 4NRYA 1MCQA 3TBSA 2DKSA 3IGAB 3QQ4A 5ETUA 2BVOB 4FG6C 4LQFL 1K4CA 1TZIA 1FNLA 5IQ7H 2JB6A 3ME0A 2WIIB 1UENA 4F9LA 1AGEA 4KAQL 4WW2C 1DBMH 3WO4B 5HPOA 1JF5A 1Y18A 3TCXA 4WFGD 4Y7MA 5TDPA 3BD5A 2DQHL 2G75A 1D5BA 4XPHL 4OZGA 3U36A 4O2EA 3V5HB 5ENWA 4AMKL 1JL8A 3VFMB 3MOBL 3CMOH 3QIUD 1MH5B 4RFEA 1JIBA 4F37K 1BREA 1MI5E 2D7PA 4FP8H 4H26A 1T7YA 4RFNB 5EOCH 3S34L 3H0TB 2PYEB 5DJ6B 1QFUH 4HKZB 2HVKA 2P48B 4X99B 5EO0A 4NKDA 5EBLB 3QEUA 1A4KB 1VEOA 4RGNE 5CZVH 5J13B 3TO4D 5EIVA 4UT7H 4MCZA 2BSTA 2EYTB 2C26A 4F3FA 1NMCB 3RIFF 4JPKH 1B4RA 1YEDA 3Q2CA 3QRGL 5CP3A 5DD6B 3CZFA 1FO0A 4XWOC 5IFAL 1BBJA 1FAKT 1QSVA 4U1GB 4Y5XC 5EZIL 4WEUD 4WO4A 1KFAL 2WUBH 4CRPA 5DTFA 3DX7A 1QSFA 3MRPB 3MUGA 1INQB 3BZFA 3NFPA 4U1SA 5L88H 2NXYD 2OR7A 1A6AA 3FN3A 2UVEA 1F3DH 1RULL 3OTTA 4QF1A 4JFXB 5KSAC 5HGBA 2VRAA 3SGJA 3OR7A 3RWGA 3QEQE 5CP7A 1C5DB 2BP3A 2DYPA 4NT6B 1ZLSL 1UM4H 4ZFOA 1ZA3B 5EUOE 43C9B 2HP4A 1TQBC 2YD1A 3ZYJA 3WNNA 4I9WE 3DYMA 2MQ3A 4JZOA 4URTB 3DHJA 2UY7A 5FM4A 1DCLA 4MXQD 4X6BA 1F6FB 5IB3A 4OLZL 5E6YA 1T2QL 3FTGA 2JJSA 1CXLA 5DJZB 4ONHB 1XH3B 1NMAL 1S7VB 3C87A 1EO8H 4YR6B 3L3GB 2P24A 5F3BA 1SQ2N 4Y4FA 5LVEA 1OT2A 5JDJA 3I3DA 5LG1A 5CBAB 1ZVSB 2J6EL 1BOGB 1D6EA 2AJVL 4KK5C 4MJ5B 1EEYA 5E2WH 4LVHC 4J3SA 2VZOA 1RZJC 1U8OA 4HIIA 4XVSH 2Q86B 1VFAA 3RA7H 1FH5L 1YJDH 1MWAH 1FCGA 1K4DA 2VISA 3DETD 1I85A 4N8VG 1LO3L 2P45B 4P9HC 4GJTB 2AJYH 3M17A 2WBJC 2GT9A 1KIUA 4Z76B 3KS0H 2LVCA 1WT5A 3R0MA 1WAAE 3J8F7 1IFHL 3AC0A 3PDGA 2NXZD 4IJ3C 3E3QC 1IGCL 4QYOB 3HAEG 3LV3B 5J3HC 1S7WB 1ZGLP 2GJ6A 1LGVA 1Q0XL 2HYMA 3NABH 4LCYB 4G80A 4DVBA 3KXFA 2R2BB 3NTCH 3EYUH 1PVHA 1HEZB 3VFPB 5FKAB 3BGFB 1ORQA 3SE4A 1NGQL 3BW9A 4UBDC 4ZNEE 4WUUE 2Z8VC 1OPGH 1XF3B 5CLTA 3QXVA 2QR0A 4M7JH 1D9KC 3O41A 3ARBB 4B0MM 4V2CB 3CSGA 2W0FB 3MLSH 3G6DL 5E08L 2R29H 5EOCJ 3KLSA 4PRIA 5HYEA 5I18L 5IVZB 4IOFC 4PS4L 3PHSA 4NWUH 2NYYC 4XCYA 5LBSH 2X10A 2OJEA 2FJHA 1MFBH 3BXNB 4TTDD 3J7HA 1KPUB 1UM6L 2R0LH 5IJVB 4KKAC 4TUJA 3MGTB 4WV1B 1TVDA 2CUIA 1NAKL 1MFDH 3BUTA 3P4LA 3CIQA 3NFNA 4NNXA 4KVCL 1Q0YL 5IR1A 2DQUL 4LIQH 1PG7H 4L9DA 1TTFA 2JK5A 1G6RL 4XBEH 2IALA 4OSUL 2V2TB 1KBGL 1A1NB 1J8HA 4Q0XH 2EE3A 4HGWB 2FGWH 2C3WA 2I9TA 1F3DJ 5JUEL 1J1PH 4KROB 4ODHH 1UQSA 1EBPA 1YEGH 1WIPA 1UJ3A 3NPSC 4LDLB 1BVKA 3CCHA 3PXHA 3RWEB 4MCYB 1QTYT 3TFKC 1WUNT 5F71A 1AKJA 4X7TB 3UTTE 3PWPD 2Y72A 1F8TH 2CKBA 2SEBB 5IMKA 4QTIH 2GK2A 5FGBA 2XZQL 4GAFB 3BP7A 2FX9H 4Y16A 5FYKU 1QSED 3TBVB 5TE4L 3O2DA 3MUZ1 2GITA 2ERJC 3V79C 1BHGA 5CHNA 1BQHG 4K23L 4CMMB 1OOAA 3AREB 1W0VB 4P48A 3NCBB 1FL3B 3NGBC 2LABA 3MSPA 4XCEB 4F7CA 4YXLH 5HHVL 3RZCB 1P1ZB 3L5HA 2QSTA 4RX4A 1B2WH 3KDMA 5IHBA 3IVKB 2P7TA 2D3VA 3G08B 4XGZB 5TJWK 5I1CL 1WBZB 4HIHB 4BQ6A 5IJKC 1RSFA 5L7XL 3KS0J 1IRAY 3TBWA 3IRPX 2DLFH 1MY7A 4N8CH 3QUMA 2ESVB 2LAGB 1DN0B 3W11D 1MJ7L 4TVPL 4OTXH 3ISWA 4FXLA 4DN3L 4FZEH 4DCQB 2PCPB 1MAKA 3LKQA 1IGYA 3DUUB 1HYRC 2JTDA 3FB7B 5DQDL 3R8BB 1A7BA 1D5IH 2EDEA 5EIIB 1T7XA 4RAHA 5C08D 1NL0L 3B9KB 1MSPA 3U9UB 2EH7H 5EU6B 3I84A 1U2CA 4G8GB 3ZDYF 2C1OB 4P3WA 3GIVA 4M6AA 2OL3B 2V9RA 4JKLA 2XI9A 5I1KL 5FUOH 1CLOH 1EMTH 3W9EB 4ZS7H 1MELA 4OIIL 1VADB 3C5SA 3LRHA 4LEXH 5D5MF 3VRIB 2GSGB 4GW5B 4OBSA 4XVTL 3GRWA 3PWPE 5JQ6H 2H3NB 5J11B 4AJ0A 1T7WA 1U8HA 3UTPD 1BOYA 5C0JA 1I1AC 3DRQB 3JV6A 4PGEB 2O93L 4ZUUA 4TRPH 3BAEH 4Q9QH 3MYZA 1F90H 2NCMA 5BMFL 3NN8B 4I0PC 1KT2A 5GSRA 3GKWL 5T1KD 3T1FB 4PB9L 3LEYH 2K7QA 2BDNH 1MRCL 1F4WL 3KPPA 4K3GA 3DNKA 3FMGH 4CADB 1QACA 4JFEE 5HD8D 1X5HA 1FRGH 4ZUTB 4QRQB 4WIQA 5CJOH 1N8ZB 1S8DA 5FUZL 5FO8A 4OQTA 3CLEH 4YO0A 4UUJA 3FAWA 5LCVL 5DJ8A 2MCPL 3QUXA 3IFOB 2FO1A 3AROA 3KLHD 3DBXA 4ELMF 1U93A 3H9HA 3LKSB 3WL9A 4W4OA 3OAUH 1GC1L 4JM2D 5F6HJ 2RFXA 3LH2H 4HUNB 4XP1H 2Q20A 3TVMD 1FL5B 4MD0B 1TZGL 4N8VA 1IGJA 3PGDA 4YHNA 1CE1L 3B2VH 5A2JH 4OZFH 1W0WB 1EAPB 1L4IA 1CIUA 4R4FH 5FYJU 1RMFH 4PRNA 4S1SH 5SX5H 5JIIA 1KCVH 1ZGLM 5C08E 1VGKA 3TCLB 4HK0A 3HAEA 3D3VA 4I5BA 4FTVB 1MAML 1GAFL 1NCBH 4RQQB 2YD3A 1Z0MA 2VQTA 2P5WD 3O4LA 2X6MA 3C09C 2RCSL 2X7LB 5GGTA 2V5RA 5ISZA 3VRJA 2XQYK 2VL4A 2VERN 3PHQB 4O58L 3LB6C 1DVFB 3QWOA 4KHTH 4XXCC 4JRWA 4OCLC 5HY9A 3PWVB 2YD6A 4GW4A 4UINH 3REVA 4KI5D 1ZVHA 1W72L 5GZNC 4K2UH 3FQNB 4KUZH 5GGRY 3OJ2C 4HUXA 1P4LB 1YMMB 3VWJA 1LD9A 3UTPE 5E1AB 4I3RL 3TBTB 4WFHD 4LEOB 3HPJB 2W65B 3MBEA 4KI5F 3VA2C 3VXMD 5JOFB 4KJWC 4PJFF 5GRXG 2DBLL 5HGAB 1OTUD 3WEXB 5C0CD 1NGPL 3G5YA 2AJSL 1EHLL 4Y1AB 4JCMA 2NQCA 3RL1B 3NMEA 3C6SA 4ELME 1ES0A 4RIRA 3C9NB 2AJZA 3KNBA 4L3AA 5SX4H 2GIYA 2P5EE 3C5JA 3RJQB 1OWRM 4U1MA 3GSQA 4X9HA 3RVWC 2G5BB 3TPKA 2J8UF 1RJLB 4PG2C 1RUAH 1T4KB 1UKSA 2X4RA 3B3IA 5F89B 3RWDA 5GZOC 2F8OA 35C8L 3HR5A 4M62L 4JN1H 4EDXB 5LGJA 2AXGB 4ZQKB 3OKMA 2XRAH 1JPSH 3LVEA 3SCMD 1CDCA 1TVBA 5IVXA 1BQHA 4CN4A 3QISA 4O5LH 3GUTB 3GHEL 2OR9H 4YX2H 2CLRA 5JNYB 4E41B 3MV9A 3LRGA 5DR5L 1NSNH 2Z4QB 1ZHLB 4ODWA 2V6HA 3ARDC 5T5NF 1I9RL 1SM3L 1I1YB 2R4SL 3G5VA 4I0CC 5KN5A 1NANI 2W38A 3KR3L 1B4JH 2W60B 5BV7L 3SPVB 3MXWH 3QDMD 4AEIL 3THMH 3PNWA 1T1YA 2P5WE 5TPWH 1CT8B 1OM3L 1JBJA 4MDJA 4EKXA 5DC9B 3NA9H 2BFVL 5H35A 1MLBB 4GS7C 3K0WA 2MMXA 2VQUA 4X5WB 1DQJB 5D1QC 5DHVH 1NQBA 2I24N 3U9PL 1J88A 3RIFK 4X7EC 1U8QB 3PQYD 3N85H 5E9DA 2OJZH 1W8NA 4M6MH 4WFHE 1JYNA 5EWIH 4PJHA 4NQCD 4LGPB 4XPAL 1T5XA 3VXME 1MCRA 4GSDH 4YHZH 5C0CE 1CR9L 2AP2A 2HVJA 1ADQH 1G7IB 1EFXD 3LQAL 1UCBH 3QWRD 2E8YA 2DDQL 2OM5A 2DWDA 4JQIL 4ZO6A 3MV7A 1GGIL 2VABB 2P8LA 3A6OA 4L8DA 3DIFB 1EGJA 1X6LA 5D7JD 4PJBA 5AYQA 5C92A 1KCKA 2LV4A 3VFVB 4UQ3A 2XFXA 4DEPB 4XPTL 4UT9L 4PJCE 3SHSA 2BVQA 1VACB 3D2UB 1IC4H 2ED8A 4BSVA 1FV1B 1KCRL 1MWAB 4PJ5D 4LARL 4XAKD 4U1NB 3BJLA 1II4E 1IGIL 4GT7A 3B8SA 2V7NB 4J4PD 1I8KB 2F8XC 1JPGA 3EYVB 4M1CC 4UV4L 3T77A 2VZSA 1F2QA 3M1BB 5E6IA 4ZXBC 2DJUA 5AWNH 3GSNA 4M61B 3AVEA 2R69L 3ZT6A 1T66D 4YFEA 3OKOA 4WGWB 4U1JB 5DJYB 1A6ZA 1TZHB 1YECL 5CSGA 4QRUA 1KG0A 3V7AG 1S5HB 2K1MA 3IS0X 1XR8B 3LSOB 5E2JA 3ZZ1A 1NFDA 2DQFA 3QDME 2OL3L 2VWEC 5T3XL 3WFEH 3DPBA 5HHPA 1KJVB 1R3HB 2H6PB 3MMEA 4NNPH 2AV1A 3BJ91 3WJJC 1JGLH 1LK3H 2EIDA 3E2HC 1IC1A 1MREL 2R1XB 4HSQA 2I5YH 4OF0A 2Z0BA 3ARGC 6CGTA 2PF6A 5FK9A 1ZANH 1X5LA 3A67L 3ZTNL 2L7JA 4LAJH 4RFOL 3ARSA 1FORL 4BH8A 1JNNL 4KJYA 3FQRB 3H7BB 1IL1A 3OWEA 2FJGB 5KANI 3PQYE 3GHBH 3QUZB 5GJSH 1A3LH 2VDKH 5C0EA 2H1PH 3VE0B 4HH8A 4QRSA 5KSUA 2VLKB 1HHJB 4OQ1A 1MJJA 4IDLA 4X6CE 5JW4Q 1KEGL 1Y6MR 4FHBD 3DECA 4DQOL 1UA6H 4P4KA 3K4ZA 2CUMA 3OL2A 4RNRB 1KCLA 5DWUH 4QOKB 2BJML 1SYVA 2DD8H 3A6CL 5H37G 1U8NA 1N0XH 3X13B 3QQ3B 4FMKA 3QQNA 5DD0H 3BH8A 3FRPG 3X14B 5GS0C 1TETL 3RUGA 5I73C 32C2A 2XY2A 4HS3A 5DK2A 2X4OA 1PZ5A 4Z78B 4IRJB 4MB5A 5HTSA 2A6JA 5I30L 2DQJH 3G6JA 1BLNA 3SOBH 1IC5H 3K80A 2AEQL 2QSQA 3ZKMC 3I85A 3EFFB 5DK0B 1CFBA 2FATL 1KJ3H 4KTYA 2FX7L 2H8PB 4PGDA 2DQIH 2OI9C 1E28B 4HGMA 3DGGB 3HZVB 3V52L 5I1EL 4NQDA 1MCOL 3MGOB 5FF6B 5TE6H 2IF7A 4PJ5E 4XAKE 2AABL 1ZV5A 1MF2H 4KH2A 4G5ZH 2ORBH 5F96H 3RNKB 4NDMA 4MD5A 3P4MB 3QZWG 1I9IL 2UWEA 3EO9H 1CG9A 3LRSB 4MAYB 3C6LC 3JBG7 4HHAB 1KPRB 3Q5YA 4HAGA 1R6VA 3HZYA 3S6CA 3G04A 5ERWA 3PWLA 4RGMB 4Z0BL 2MSPA 5HYIA 4ZODA 1PG7W 5E5MB 3HI1A 1JNHB 1DLFH 2VKWA 1TJGH 3BHBA 4IRSD 25C8H 1EEZB 2IQAB 5CEYA 4QWWD 3MJ8A 3BMVA 1R24A 3MODH 5D7LB 5J1TC 4D0CB 1AGBA 3NCFB 3JV5A 4L4TB 5D93B 1NUNB 5C07D 2HTLD 2A1WL 4XH2B 4LLVB 4PJ8A 1CFTB 4ZPVB 1HINL 1NEUA 4FZ8H 5FO7B 4BFIB 2BVTA 3NZ8A 4UOW0 4UOW1 1GOHA 3VXUB 1KN4L 3IDUA 1ROWA 4ODTH 3TM6A 3FB8B 4K8RH 4YDJA 5A2KH 3CDYA 3C8DA 1GVIA 5F3HB 1U8JB 2NY6B 1UWEL 3MJ9H 4PGZA 4BSWB 5HI5D 4ELKA 3IKCB 2ZUYA 2MWCA 3UDWA 3FFCA 3KPSA 1ED3A 4MNGB 4NBYB 2DF3A 4ONFH 5HGHA 4JFZH 3U2SB 1DTUA 3S5LB 3U0TB 2R1WB 4JREC 5JO5B 2CK0L 3E8UL 3QIWA 2PR4L 3LEXB 4E42A 2AK4E 3QNXA 3UZEA 1S7UB 1RUMH 5JOPD 1BX2A 4NCC2 4OCRH 3GIZH 4WFED 2X4NA 5M95B 3ARBD 3EDJA 2BVPB 3ZKQD 5JHDE 5IQ7L 3CU1A 5ANMA 5JMOC 4QTHB 1DBML 2GHWB 3DVIA 4PJXB 1CWVA 1I9EA 2YSSA 4JZJA 5FV2A 3V4PH 3H3BC 1BF8A 5IF0B 5HHQB 8CGTA 1WBYB 1KENH 5F1IA 2DLEA 4JR9H 4OLYL 4LLYA 3CMOL 2OMNA 3SE8H 2B5IC 4KZDH 4OIAA 5EOCL 2YA1A 1SJXA 1QFUL 4I18A 3MRFA 4FRWA 1EUTA 5DRZA 1F2XK 1S9YA 3ETBF 1BIIA 4ODUA 1XT5A 2F53B 4UT7L 3IXTA 1YYLH 5E2UL 3F7RA 3P0VL 1Z2KA 3CSPA 3UC0H 1Q94B 4JPKL 4EUPG 3MV8D 3VDBA 3P73B 3ARTA 3HRZB 4FQXC 1DDHB 5C0FB 5ESAB 1UM5H 1M4KA 5C07E 3TT1H 1NBYA 4NM8H 5L88L 2EC9U 4XTRD 3GMPB 3FJTA 1XF1A 5TDNB 3KPNA 2EDKA 1OVZA 3L3JB 3FB6A 5M94B 4Z7VB 1PSKH 3GGWB 2NY5H 2NY3C 2GTZA 2R1YB 4JANA 3QXDA 4HPOH 3RZCD 4AIZA 3T2QA 2UYLB 3PDOA 3LKRA 4UB0H 1YEFL 3MPCA 1CFSB 1X5YA 3LIZH 4LCWE 4AIOA 3C5ZA 4NKQB 4L3EB 3DX9A 3R0NA 1DR9A 5F6HI 4WFEE 2ESVD 1I7TB 3VFNB 4IHOB 4TNWF 2IGFH 4XHJD 1H3UA 4RA0C 5FYLH 4NKOB 4LKXB 5E2WL 3D25A 5BVPL 1OW0A 2R9HD 3BGMA 5EU3A 1FFNA 2G9HA 1JPFB 2DKMA 5FDWB 1U91B 2LTQB 3RA7L 1B0WA 3OBAA 1YJDL 4MJIB 1MWAL 2QKIA 4GG6A 4Z9KB 3I02A 3FT2B 4Y4KC 2HLAB 1NDMB 3U7YH 2AJYL 1K3IA 1SY6A 4OBRA 4RAVA 1N6VA 5CD5D 2XIDA 5KVDH 5HYJD 4BA8A 3C60B 4AT6B 4NHUA 1A7QL 4MYWB 4Z0XB 4UI2A 2XN9B 5I9QC 1ZK9A 4HPYH 3GJFH 3NABL 3H9YA 1FYTA 1YNTA 3FRPA 3EYUL 5DSCB 5F6IB 2VITB 3TT3H 5GGVY 1MIMH 5KOVC 1S9XA 4Y2DD 4NYLB 2R2HA 3U83A 4H1LB 3VGDA 2QL1A 3HPLA 1U2HA 1A9BB 2FHBA 3OR6A 3O6KL 1MHHB 3QFJB 4M7JL 3MV8E 5ID1A 3CVHA 3MJGX 3MLSL 2R29L 4NN6C 2XTJC 5DJ0A 5CMAA 3CFBB 5EOQH 3LDBB 4UNUA 2XKNB 4N5EC 3PWUB 4P5MB 5LBSL 4S1RH 5SWSB 5GJTH 1MFBL 4J3WA 4ZFGH 3TA3A 4P5TA 2ADJB 3CSYA 1S5IH 1KTKE 3QZWA 5MI0C 4FFYH 3KPLB 4HT1H 1MFDL 3CDGB 4EI6A 3O3EB 3L3HA 1R3LB 2YPLA 4LIQL 1PG7L 2HLFD 2NNAA 1JWSA 4YDIH 3B6SA 5J6GB 3RDTA 3U82B 4Q0XL 1QFPA 2FGWL 4X6FA 3IFPA 4DTGH 2OR8A 3Q1SH 2Z8RA 3G6AA 1J1PL 4ODHL 2EDWA 1YEGL 4S11A 4AM0B 2F74B 4XZUB 1MEXH 4N0UA 3WHXA 5I19H 3LKOA 2XWTB 2BNQA 1SEBB 2X9YA 1YQVL 3DVNB 5CJQL 5DHVB 5T3ZH 1F8TL 4PJDE 4ISVB 4QTIL 3AMKA 1FG2A 2OSLB 5IHLB 2H32A 3H2WA 3BZEA 2FX9L 5L2KE 4WWID 4PP1D 1P4IH 2R8SH 1MCWM 1ORSA 2WV3A 1VPOH 3QNZB 1DE4B 1L6ZA 4PBXA 1JGUH 4EIZC 1I8IA 3O6FA 3LS5H 1P5VA 1WFTA 3W0WE 2VZ1A 3SKOB 1J11A 4NCC1 4HV8B 1WFOA 2MCG1 3ZTJH 3FO2A 2XKUA 2AVGA 4OKVA 5CCKH 5HYJE 5BS0B 3VXRB 1A2YB 1MNUL 2PYFA 3SJVA 3ZYIA 2R15A 4YXLL 3BQUC 4O2CA 5HVHB 1JWMA 4NGHL 1AXIB 3U4EB 3SDCB 1B2WL 5E8EA 4M7ZB 1JMXA 1DVFD 1AC0A 4AY0A 2NR6C 4YIQA 2EYSB 5FDYA 1RVFL 5BRZB 2VN7A 3RTQD 4X4XB 1N0LA 5CSZB 5F7EL 4EZMA 3PGCA 1QBLH 2DLFL 2FIKA 2Q7YA 3BX7C 1J0IA 1DEEA 1FFOB 4N8CL 3HUJB 3NZHH 3G5ZB 5D2NE 1YMMD 1FSKC 1XAUA 5AG9A 1V8HA 3T0EA 3N06B 2E7LC 4LKCA 3HE6D 4FQ1H 3RVTD 1L0YA 1NCCL 2ZNWA 3HS0A 1ZKAA 1PZUB 3HMXH 2Z92B 3P4NA 1HHGB 2NX5A 2YWZA 4LSVL 4YWGH 4GKSA 4PJGE 1D5IL 2RB8A 2Q8AH 5CWSB 2MPAH 1TITA 1CFQA 3WIFA 1IGTA 4R6UA 3JVGA 4EVNA 4MJ6B 2W91A 5HHXH 3O8XD 1V7MH 2EH7L 2BNRB 5D6CB 5HDBE 5FECA 5JPMA 3VXNA 5LWYH 4B53A 1U36A 4JRXD 3N1FC 2V5SA 4PV8A 2BZDA 4JO3H 4MNQE 2BOCB 2FL5A 3MRDA 5EU5B 1EMTL 4RGOH 1KC5H 1J05B 4H5SA 1IEHA 4ZS7L 5E56A 5HPMB 4RMTA 1DQLL 4LCCA 3FCTB 3BWAB 1JV5A 1M6OA 4H0IA 4LEXL 1IM9D 3DLQR 3TJHC 3MA7A 4GKNB 4Y5YA 1T0MA 4R2GB 5JQ6L 4DOHB 1C12B 1YEHH 4QHMB 4KKLD 5SX4I 3BWUC 2O61B 3O2VH 1L0XA 4TRPL 3BAEL 5DJ2B 4Q9QL 4NQUA 5E8OA 2DB8A 4JFFB 1F90L 4E41D 4PY8J 1HH9A 3O45A 1N2RA 4U49A 3MYJA 4U1KB 3LEYL 4Y19A 3D39A 5L8JB 4CL7A 2C4FU 2BDNL 3X11A 3FMGL 4PG9B 4MNHA 1FRGL 1T6VN 2X4TB 4G43B 4D3CH 4R96A 2ATKA 2YC1B 5CJOL 3QCUL 4L9LA 3BKMH 3CLEL 3LQZB 1F3JB 3IJSB 1TQBB 2PW1A 4RISH 1MCKA 3DSNA 4U1HB 2X89A 1CD1A 2JJWA 3OAUL 2NPLX 5TGBA 2VXQH 3CFEA 3KYAA 5CZXC 2ED7A 3LH2L 1MI5A 4XP1L 4G9FB 3BN9D 2FGZA 3WIIH 3B2VL 1DUZB 4N90D 4U2YA 2K9UA 4GKZB 1IBGH 1LDSA 4JZNB 4L29A 4LVHB 2YUZA 1KYOK 1JK8A 4HH9A 4LRIA 4S1SL 3NIGF 1KCVL 2G2RB 4X4MA 4XNMB 5I8CA 4XCNB 1CXEA 4ZDHB 1NCBL 4N0FA 2WBJB 3ALXA 4PRBA 3OB0K 5GGVH 1IC7H 1QHOA 2DI7A 4BH7B 2GYSA 4JRXE 4M93B 3BSZH 3F7VA 4IJ3B 4EN3B 3V7MA 2FZ3B 1Q9OB 4KHTL 3D2UD 3WS3B 3IJHA 3DI2B 4C56A 4UINL 1J0YA 3QPQC 2GCYB 2KZWA