4BM7A

Crystal structure of igg fc f241a mutant with native glycosylation
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
207
structure length
207
Chain Sequence
GPSVALFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords IG GAMMA-1 CHAIN C REGION
publication title Engineering Hydrophobic Protein-Carbohydrate Interactions to Fine-Tune Monoclonal Antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bm7A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bm7A01
2D7OA 4XP6L 4LPCA 3WLWC 1PFCA 3E0GA 5DJZA 4JO1H 1BQLH 4JG0L 1A5FH 5IHBA 5SWZD 1KJVA 2VLJB 1UWGH 2W38A 4J6RL 1VA9A 2C26A 4TRPH 4N8PA 4R2GB 2CDGB 2R0LL 2V2WB 2BSTA 2Z8VC 1I85A 3K1DA 5BJTB 4FZ8L 4JFFB 1KN4L 5GRJH 3HLAB 5FV1L 4K3EL 2LAAA 3ALWA 2HTKC 2XTLA 3ZTNH 4RX4A 2I60L 4NC1E 4DQOL 4Z7NE 5KANI 5BRZB 4OIAA 1EFXB 2IPKB 4Z7OF 4LFHD 5IQ7L 1ORSB 1KB9K 1RZ7H 3MJ9H 3HNVH 3FQTB 4LCWE 2EH7H 3FOMB 2XKUA 3GHBL 3L3IA 3S9DB 4RGNE 5FKAA 3CMOH 5E6ID 1I8MA 5ANMB 3QHTC 3VXRD 3SDCB 2ZPKH 4DN4L 3E1F1 5C1MB 3UP1A 5E95B 2YSSA 5E8DH 4PJXF 2ZUXA 5DR5L 3FRPG 5DWUL 5IB1A 1D9KB 5IB2B 2ATPB 2JB5L 3QIUA 1VKXB 1JPGA 1SQ2N 4OCXH 5B39B 4X9FA 5J12C 4AEIH 1BD2D 2QQLL 5JHLH 4MNQB 1T21A 1GGUA 3LEYH 3P4OA 4L4VE 3CPLA 4HWEL 4Z6AT 4JB9L 4X6CF 1AY1H 5EZLA 3LVEA 2WLYA 3QNZB 5GJSH 3QNYA 5I1JL 1P5UA 1QSEE 5MENA 2GTWA 1J8HA 2GFBB 5IM7A 3X3FH 5DDHB 5JHDA 3PL6C 3ZT6A 4JQXA 3W39A 4X4XA 1RZGA 4GKNB 4YEEA 4N68A 1IC7H 4M1DH 1HQRB 3O3AA 5GIRA 3WIFA 1E6OH 4NQEA 1FFQA 2IH3A 5LGJB 1IGTA 1T6VN 1H3UA 4H8WH 1DEEB 2OMBA 2I07B 3L5HA 1RURL 1F4YL 4IS6B 4MDIA 5LXGL 4X4YA 2ITCA 2HTLC 5E70A 1RFDL 4XI5D 1A22B 1IKNA 1KENL 2ZSVA 5L88L 2XNAB 3DMMB 4KAQH 2HH0L 2QHRL 4CNIB 3SE3A 4Y4HB 3FQWB 2HLAB 1U8IA 2CK0H 1JGUH 1XCTB 3H9SD 2E7CA 3S5LG 4HBCH 2DIJA 2VSDA 2Y1VA 3ZYOA 4E0RA 4QEGA 1LO5B 1ZTXL 4XVSH 4HUMB 4WV1B 3ZKSD 1RUMH 5DUBB 4HMCA 2OTWB 3QUKA 3QUYB 3BXNB 1NCBH 1NGWB 4NO0D 4QXGL 1JRHI 3RY5A 1FL6A 3GKZA 3KPLB 4G3YH 1EIBA 1T04A 3TWCL 1BX2B 3DYPA 1QLEL 4NQSA 3G6JB 1VADA 2DQTL 2UY6A 3BPLC 4P3CL 5SWSA 4GG6A 2YWZA 1GHFL 1OCWL 2DDQH 4KGLA 3ZDXF 3TO4B 1E28A 4PJ8C 1N64H 5IBTL 4EQ3A 4EQ2A 1OW0C 4X0KA 3RUGB 3DO3A 1BFOA 5C0GA 1GZQA 3D6GA 4W6XB 4WFGE 4KJPC 3QCUH 4BSVA 3QXDA 3IXAB 3RY4A 1OT2A 1S9XB 4PGBB 5E08L 1DLFH 5IHLB 3D5OF 1AGEA 4FZEL 4WI6A 3WSQH 1QFPA 1RUPL 1UZ8B 4Z7OE 2PTTA 1IAIH 5KN5A 2G60L 1FN4A 4XWGL 4GW1B 1K5NA 1QFWL 4XVTL 5IB3B 1K6QH 1YNTB 2PYFB 3VW3L 2YS4A 5F96H 3L3JA 4PJXE 3L95A 1CIUA 4OLWH 1N6VA 5I9QB 4PJ7F 4R8WH 1SBSL 4OI9A 2DBLL 3K2UL 5HXMA 1JZ8A 5GHWL 3RWFA 3QDME 5SWZA 4YAQA 1TZIA 5I1EH 4Q9BA 2L7JA 2NZ9C 2LTQB 4R0LB 1KJMA 4F7PB 1F8TH 2CKBH 1HILB 1ZHKA 4X6CE 4KTDH 3MV8E 1FGNH 1NL0L 1X5IA 1NLDH 5JPNB 5ESAB 1CK0L 3IB4A 4ACPA 2MFNA 5JIKA 1INQA 1RZ8B 2W65B 3NVQA 1I8IB 1WBZA 5DSCA 4ZFOB 1X3DA 5E7FA 5FYLD 4MB5A 2FJHB 3IDGB 2NX5D 3S34L 2ADJA 2FD6L 4QT5A 5D6DC 5E6IA 5DZOA 3VXRA 3O0RL 2YA0A 1G7LB 3PG2A 3H8NA 2R23B 4HKJB 4NCC2 4V1DE 1M05B 4KZEH 4MQTB 4ISVA 2X41A 1XEDA 3CZJA 1MQKL 3MRIB 4PB0H 5FYJL 4E41D 4IJ3C 2VXTL 1T0NA 3SE9H 2E9BA 5DQDH 3FQRB 3FT3A 4FQ2H 4RIRA 3BUYA 4G7YH 3K7UA 3M07A 3QUXD 3MLXH 2FSEA 2JLLA 4QHMA 2DM7A 2FL5B 1K8DB 3LKNA 3EYSH 5C7XL 3FB8A 3EW3B 2J4WL 4JKWA 3QPXH 4OGXL 1T3FB 5I19L 1QRNE 4GMSL 3JWDC 5BV7L 3GMMA 4NRYB 4ODSL 2ZNWA 1CS6A 1NAMB 1AHWA 3M1BB 3I3EA 3WIHL 3PV6A 5ID0B 2R2CA 4YDJB 4ODUB 3SDAC 4LVNC 3Q6GH 1SJVA 3ZDXE 1HQ4B 3O6KL 4Y19E 2GY5A 3C6LB 1AKJB 5FECA 4QNPE 4LLUA 3TZVC 4LEXL 4FQXC 3OZ9H 3FT4B 5IFJB 1GZPB 4Z77A 1CG9A 4R7NB 1TCMA 1WV7T 3CU1A 1S7TA 4KROB 5I1GL 2ESVB 1S9WA 3DBXB 4O00A 4MD4A 1YN6B 4GRWH 3ARYA 2ICWA 2VL5A 2VUYA 1EEZB 3MO1A 3GSNB 4PJIF 3MLRH 3H9SA 4H88H 4PY8J 4XNUL 3BPOB 4WU5B 3MLSL 4M5YL 2XWJA 4R90L 25C8L 5IFAH 3STZB 1HWGB 4KWUA 2XTJE 1VFAB 1LILA 4NO0A 1KG0B 5IJVB 5J9PA 2APVA 1LMKA 4PJ7E 2A77L 1L6XA 1UWXK 1N2RB 4FABH 2EIEA 2EE3A 4LAJH 5INDA 3QXWA 1IGFH 1ZGLB 4GRLD 1KC5L 2MNUA 5HBBA 3OX8A 4XXDA 4U6XB 1IC5H 1LGVA 2WSKA 1L7TH 1VCAA 1U8KA 5HGAB 2FZ3B 1R3LA 2QKIA 1F00I 2Z35A 5F93C 5JXAH 3BT2L 2NW2A 4D3CH 3IVKB 4QGYA 1AI1L 3BWAA 2X9WA 2J5LB 4PJHE 3HB3C 4HWBH 3TPUB 3C60B 3SE4C 5I1IL 3ZKMD 2PO6B 4J4PC 2H26B 5KVGH 1QHPA 5KSBF 1BM3H 3L7FB 4UMGA 3IKKA 2AJSH 5J06A 3PXHA 1UVQA 2HN7B 4NP4L 4F7CB 3I50L 1PG7L 3TLRA 5F44A 1IAIM 2BXZA 2JELL 5IK3A 4B53A 5H37H 5FB8B 4X9BA 4O58L 2GT9B 5MEOB 3UTTE 3V79C 4HWNA 2WIMA 3RP1A 5GGQH 2DQJL 5AD0A 5DVKA 1MJ7L 1KLUB 5GRUL 12E8L 2Z8SA 2DKUA 3EYQC 3ARGB 4G8GB 2WWMD 1OD7A 3MXVH 2WUCH 2P5WD 4WUKL 5DK3A 1A6AA 1OLLA 2FH8A 3I02A 4L29B 2P8MA 2AI0L 4TNWF 2FO4B 2Q86B 3V4VL 1VSCA 4QTIL 5D1ZD 2E8YA 4FFYL 1N6UA 1T83C 3KGRA 2GYSA 2NX5A 2OJZH 5B3NA 5L2KB 3DHMA 4KJYA 4WI4A 3FZUD 3LIZL 4ZPVB 3G08A 1DBAL 4ODWA 1BFSA 5FUCE 3HI6L 5EOTB 4HC1A 2D2OA 4Z8FH 3DV4B 2AJXL 5HDBE 5I1DA 3EGSB 3QJFA 1AXTH 2ILLA 4JPWH 2DQEH 3DECA 4PJ9D 5C0IB 1T1YA 4TVSa 2EDKA 2X4SA 1OP3H 4WVRA 4N9OB 5T5NG 2H41A 3QUXA 3D1MC 1JWUB 4OB5L 2EE6A 4LRNH 4EDWL 4G6AD 2LV4A 4OM1L 1G9NC 5T33L 3IDJB 3F12A 3PP3H 4HAFA 1NCAH 3RZWA 3FO0L 1N6QL 1NFKA 1Y0LA 4CMHB 4HH8A 4DGIL 2FX7H 3PWUB 1U8NA 4HGKC 2R2EB 3G5XB 3PF2A 4N1CA 2NY1D 5D6CA 5T3XE 1GOFA 4MS8D 1XGRB 3ARDD 1NBYB 3Q0HA 4NO5A 4Y2DB 2H45A 2X7LA 3OKLB 1Q9WB 4TNWK 5LQBL 1ZT4A 4EOWH 3WFCH 2LVCA 1W2KT 2GK0A 4F15B 3TO2A 1JNNL 3KNBB 1YY9D 4XPFH 4YGVB 2X4PB 3HNSH 4Y4FD 5IKCB 2OL3H 1WIPA 4XNZC 2WWKO 3TA3C 2OK0L 4HJGB 4HG4K 2H32A 5KVDL 3UO1H 4OLVL 1F4WL 1A1MB 3T65B 4WHDA 3MLYL 5GRYA 5HHOD 5DI8A 4BELD 3MLTB 4UU9B 3DXAE 3IFOB 4X6EA 5GISH 3I75B 2KBGA 4EBQH 1YY8B 4BA8A 4NDMB 5ITFA 1MWAH 4HJ0C 2ZCHL 3QRFM 1OAQL 3BIKA 4I2XB 2L7UA 4D8PB 1RZJL 1ZMYA 3Q3GB 5KSBE 3L5IA 5F9OH 2GSIB 3VXNA 4G6FB 4IHOB 4PTUB 4X6FA 3GMLB 3RDTB 3WHXB 2WM0A 2AABL 3UPAA 2BOCA 3R1GH 5C0FA 3KYMB 4FG6C 4Y7MA 2R39A 3IT8D 4GRLA 1NC4A 1FO0B 5CZVL 5HYSA 5FYJD 2DM4A 1ADQH 3N85L 5IVXA 3OAZH 1CICD 1DQQA 1Q0YH 4AIOA 2JJTC 5HHXH 4U1JA 5ESVB 3IU3B 1A6TA 3OJVC 1LE9B 2VZOA 5K9KA 4K7PH 5I18H 3HKFA 1I7UA 4EIZC 1OSPH 3P9WB 2F53E 3QIBB 5IB4B 2BVYA 2YD9A 3NFPA 3ZDZF 2F8VA 3GJFA 3GHEH 5HDQL 3FO2A 3HG1D 4X98A 3RU8H 4XCCL 4JO2L 3X3GL 5DJ2B 2YPKA 2P48B 1RIUH 1S78D 5ICZA 1MJUL 1OAYL 2H6PA 4WTWA 4Q9QH 1OAXL 2DTSA 3BP5A 4PV9B 4YH6A 1EEQA 2Q76A 4OSUL 4DW2L 5FYKH 4GUPA 4LLAA 4MQ7A 4OZHB 3CFCL 2XWBB 2I5YH 4I5BA 1CGSL 2W07A 3W9DB 2CLRA 4YHOH 3MLZH 2P5WA 2Z93B 3K8KA 4LSTH 1DUYB 4Z18A 3PWJA 4M7KL 4OGYL 3UXFA 5C0AE 3UJJL 1T80A 3HI5H 1FLRH 1U58A 5D1ZA 4XPBH 4X99B 1NPUA 3QEQB 1D5ZB 3OKYA 4NT6B 3ROLA 1CR9H 3MRJB 1PLGL 3RJQB 5J1TC 4KHXH 2CLZB 4U6YB 2D0FA 2IAMD 4ERSH 1RUQL 4X9HA 4TSBL 3DX8A 2A6IA 1A4KB 3E2HB 1NCDL 4HX1B 2YXMA 1AGFA 5J6HB 4PJCE 1FFPB 5FOBB 5J6GB 5FF6A 1LO4L 4PJ9A 3BDBA 4XZUB 1EO5A 3EOBA 2HG5A 1ZEAH 2RR3A 4LIQH 4P23B 1OTUC 3SCMB 3NFNB 3KPSD 3N9GH 2A9ML 2O5XH 5IR1A 1EVUA 1N0XH 1Q0XH 2X1WL 4MSWB 5IESL 1ETZA 4PJ5D 4WGVB 2C1PB 1AO7D 4LAQL 1MLBA 3JUYA 4L4TE 5ACZB 4QF1B 1H5BA 5FO9B 5CD5C 1RUAH 1NDMA 4R97B 4CL7A 4KK9D 5E2WH 4HS3B 1CDHA 4XNQB 5TE7L 4XC3L 3E6FA 2E9IA 1VDGA 4UI2A 4LLVB 4BZ1L 4WO4C 3ARDA 4YX2H 3QULA 4LLQA 5LGHL 2XRAH 4MVBD 5DQJA 1AP2B 5CEZE 4NUGL 2HKFH 2AXGA 4UT6L 3K4AA 4Y4FA 1IEBA 4OUUA 2GITA 1DN0A 4FXGA 2VAJA 3EAKA 1N8ZA 1QO3B 4YBLC 4LARH 4U1HA 2GTZB 1QSFD 3V5KB 4OLEA 4PBWD 3MXWL 1FG2A 5HHOA 4NRZA 4YHPA 1CXLA 1UG9A 5FDYA 3B2UD 3U4BH 3P9MB 4NN5B 4N8CH 3QI9C 3BSZL 1CXKA 4J12A 2PW1B 4WO4A 4HLJA 3ZDZE 3BUTA 3EYFB 1MQ8A 3DOSA 3P0VH 1CDBA 4G5ZH 5DRNB 5F7DB 4NZDA 1KGCE 3GRWL 3JWOC 2DI7A 3MLPA 5C09E 1DBKH 4ALAL 4RAVB 4OGZA 4P4KB 1UCBL 4NQCD 3VG9C 2FATH 2DL2A 1TIUA 4KUCD 2EXWC 1I3GH 2DQUH 2IQ9H 3FB7A 3TEUA 3E6HB 2DLHA 3IU4L 3CDCA 4XPGL 3V6ZA 2NLJA 3KLAA 1CICA 3EYOA 3N1FC 2NY5C 3VFOB 4Z7VE 1AE6L 4NQDB 3S8WA 1J86A 3ROOB 1MFCH 3UROR 1QQDB 4JFDB 1TITA 4MYWB 1XZ0B 3INUL 1FVDB 3VGEA 3Q1SL 2MCPL 3EFDH 1FH5H 3RPKA 3VFMA 4PJAF 4UNUA 5TDNA 4K8RH 2Q7YA 3HG1A 2A74A 4WHTA 4XWOC 4FFWC 2BC4A 4UV7H 3GSXB 3WIHA 2OR9L 4WW2B 3DURB 1NJ9A 5JXEC 3IFNH 4LQ1A 3P0YH 3PHSA 2EYSB 2Y23A 5DEGA 3BGFC 4QTHA 3NCJL 3A6BL 3PGFL 1MF2L 5CSZA 5DJ8B 2FX8H 4I9WD 3NOIA 1OGAB 2Y7QB 3I6GA 3DO7A 5AWNL 2DQHL 2XKNB 5CHNA 3RNKA 1Q1JH 5CBAB 1F3JB 3FRUA 4RQQB 3WXWH 2YN3A 4PJBE 1CTNA 2AEWA 1HXMB 5BQ7A 4PYGA 2Z91A 5CKGA 1S5IL 3B5TA 3QDGD 2VLLB 3PJSB 1NFIB 4X5XB 2DQDL 1IL1B 3QPQD 3PNWB 2IAMA 3PQYD 5BMFL 4GBXD 3V2AR 1PKQB 4MAYC 3WNMA 4YDLB 1NGQL 1KNOA 4JRYB 1A7RH 5L6YH 4G42A 4Q58C 2HMIC 2EIZB 4C56D 5IMKA 1T1ZA 1BOGB 2NXZD 2GQHA 3FQUA 1NBZA 3KPSA 1A21A 1KTLA 2MKWA 1HOCB 3WUZA 1NGPL 1ZA6B 2I9LA 5A2KH 3P11L 4NPYA 3NCEB 1W0VB 2VL4A 4JDVB 5DHXB 4ETQB 1JF1A 5GGTL 1AO7A 3SKJL 2NY4C 5JDSA 1H3TA 3BKYL 3QDJB 5ICXA 4QY8B 3MA9L 1JPFA 2CRMA 1AD0B 3MMEB 1D5BB 4OZ4A 3U9UA 4YJZL 1JF5A 1TFHA 2VLJD 1N3NA 4OBSA 2IBGA 1AQKL 1O0VA 5L8JB 4R2GD 4YXKL 1P4IH 4L8DB 5HHMD 3GSNL 3FKUS 3B6SA 3L3KB 4JFFD 2YXFA 4WHYG 5C08E 4PGCB 2Z8WC 4MHHG 2C1OB 4J1UB 3O6MH 3B2VH 4TOYL 1C5DA 4G8IB 4M6NL 2FWOA 3MJ8A 3MRHA 3FB5B 5IGXL 4B5EA 1NEUA 2Q7NA 1EFXD 4JN1L 4G43B 2IADB 1PQZB 4CVZA 3CH8A 3UDWA 5BZDB 4M6OH 2ITDB 3T77B 3W11C 4W4OA 3KR3H 3SDCD 2R0WH 3QT2A 3CVHB 3EOAB 5FFLA 1K85A 4PJDA 1BHGA 3JWDL 2VLRD 3G6DL 1D9KD 4P5TB 1NCWH 4JJHA 4LPYA 2DQFA 1FE8L 4XBGA 2GSGA 2V9RA 4ZFGL 3BKMH 3MFFB 4CMMB 2A83B 3UBXA 4MNQD 4U0RC 4WHCA 1BBDL 3WFHA 2CUHA 3CD4A 2XV6B 4LLYA 3HE6B 5D93B 4DGYH 4LU5L 35C8L 5F9WC 5IEKB 2DLIA 2HFFA 2APXA 3BQUD 4GRWF 4YC2B 1W0WA 5JZ7D 1WT5C 4NQCA 4ZDHB 2YWYA 5IG7B 5E8NB 1VFBB 1HI6B 5HHNA 5E2UL 4YQXH 1J05A 3GMOA 3SKNA 1RK1B 4D0CB 4Q2ZB 3EHBC 4XXCA 4XP5L 4JDTL 2LU3A 1Z9LA 4PP1C 1KELL 4JFYA 4R4BA 4WEBH 5KZCD 1ONQA 2F5BH 4TUJA 1LD9A 2I9TB 2VUOA 2ZP0T 1YEDB 5FUOL 1NCCH 2Y6SC 5E8PB 1RU9H 4IIQB 4ODTL 1A7NH 4WEMB 1E4XL 3DMMD 3U30B 5MEQA 5B8CB 3MA7B 4EDXA 3PWLB 4PRAA 5EU6B 5C0DA 5ALCL 4AQOA 3EO1B 4OV6F 4WJ5A 1EVTC 2AEQH 4ZODA 1DQLL 1XGQB 3RQ3A 3ALPA 4CRPA 1A7PL 1F45A 3CGTA 1E27B 5CEXB 2ED9A 1CGTA 3HZYB 4JM2F 3SOBH 1K4DB 3QUYD 1S7WA 1U42A 3GGWB 3ILPB 3U9PL 2OJEA 4ZNEE 1B4RA 2BZDA 1X5JA 1P4BH 4YK4C 5C07E 1FYTE 3O6FB 1FVEA 4KI5D 1GIGL 1I1YA 1L7IL 5J57B 5D71L 3MACH 3ME0A 5ESQB 1CGXA 2DWDB 1X5KA 1PX4A 3MX0A 2R1XB 3NA4A 1GAFL 3D39E 5IBUG 3RTQB 5BS0D 3HA0A 4HIJA 2OI9C 3KHQA 3HTLX 1ZE3C 5DJCA 3RWEB 1I4FA 3QDGA 2HT4C 4OQ1A 5JR1H 3CSYB 3U4AA 1WBYA 2ZUTA 3PQYA 1TNNA 4GBXA 4YGAB 1B0WA 4JPVL 3FB6B 4DAGL 4OFIA 3P4LA 1YYLL 4OZGE 2DICA 5T1KD 3TT3L 4OCNC 1JTTA 2C4FU 1FVCA 5HY9A 1VACB 2XA3A 3MZTA 2QLVB 5JQHC 3TYFA 5EZJA 2CKNA 5F7YC 3SPVA 2YK1L 1QD0A 3LHPH 3FT2A 1W8NA 2FLRT 2VABB 1MIEH 4I8DA 1YECL 2QBWA 1N59B 5KTEH 2P42B 5DURB 2ZUQB 4NGHL 2BK8A 4ZTOH 3ARXA 2VLJA 3V4PH 3N1QC 3SBWC 3VXUE 1G9MC 1T03H 5I8CB 2CRYA 4AEHH 1Z3GH 4UTAL 2CDGA 2V2WA 4M1GL 3NBNA 2NYYD 4GRWE 5BJTA 4JFFA 3RWDA 2DQGH 2BP3A 3UTSE 3HLAA 5HJ3A 1U3HD 2RJMA 3MRBA 4P2OC 3SKMB 1A6UH 2APFA 5B22A 1JTOA 4XAWH 3V4UL 4KTEH 4PG9B 1EERB 5C0NC 3KJ4B 5L7XH 1EFXA 3HUJE 2IPKA 4GAYB 4ZQKB 1WLHA 3FQTA 2PUQT 1CXIA 3FOMA 1UB5B 2OTPA 3VRLE 1ZVHA 3O6LH 3H7BA 3U6RA 1T4KA 5TF0A 3SDCA 3MGAA 3ULSB 4PJGB 2EDRA 4BUHA 4DZBB 4MHHI 1FO0L 4JKLA 3T1WA 4RA0C 5EOCH 5D4QA 5IB2A 1D9KA 2ATPA 4LCYB 4KY1L 1OP5H 3S98A 2BNQE 1VKXA 3WE6B 5B39A 3QEHB 4YDKH 4MNQA 3BRDA 2QQNL 1WFTA 1S9VA 1AXIB 2HFEB 1YEEL 4OCYL 3FN0L 4JFQA 1EGJL 3BQUA 3QNZA 1TETH 2YOCA 4QRRE 4U6VH 1RJZB 2GFBA 4JFEB 4Y4HC 5DDHA 4LSSL 1YPZF 2D7TH 4LCUB 1OP3K 4OQTL 1MRFL 1WUNT 4GKNA 1ED3B 1HQRA 1OQOA 3NACH 3ARWA 5EIIB 3BEWB 1SM3L 1DBJL 1YNKH 5EO1B 4W81A 3PP3K 2PTUA 1AKJD 2I07A 3GSVB 3FFCE 1HEZB 1NANI 2B4CC 4IS6A 4ONHB 4KROD 2WMPA 2ESVD 4P2CG 1A4JB 5DFTA 3WYRA 5ADPL 1MREL 1BP3B 2XNAA 3TNNB 1S7SB 4Y8DC 3DMMA 3BP7B 3TO4C 2CPCA 3ULUL 4CNIA 5E8EB 2HLAA 1KCVH 1XCTA 4P9HL 4APQB 2J6EL 3V5HB 5CJ5A 1Z6JT 3OSKA 1O5DT 1TQCB 1LO5A 4WV1A 5DUBA 1LO3L 2Y25A 1P1ZB 1EZVX 2KQMA 4OCLC 2OTWA 4JN2B 2VDKH 3BXNA 3QUYA 4PJFF 5D1QB 5DUPL 2PYEE 4LHQB 2W9DL 2XIDA 5BOPA 1I8KA 1BX2A 4NZJA 7CGTA 1ZS8B 3V7AE 3G6JA 5F89A 4X4ME 5I30H 3RY6C 3EBAA 4FMKA 1NGZB 5FO7A 4XNYH 5I9QC 3RUGA 1F3RB 4PLOB 5AYUH 1L9NA 2XICA 2PR4L 2VDNL 3GRWA 2YPLE 1DCLA 2UVEA 3V0WH 1HH6B 3IXAA 3QXVA 3OXSB 1E4XI 1S9XA 1YEGH 3SN6N 2ZG2A 3T0EB 3RJDA 3KYKL 4WWID 4C58B 1NMBH 1UZ8A 3C60D 2D4DA 4M4PA 5T1KA 3OAZK 4YUEL 2PO6D 4GW1A 1GXEA 5LWYH 5IB3A 2VITB 1YNTA 2DOCA 4LK4A 5I73C 1X4ZA 5FYLH 4PUBL 2YPVH 3X17A 2F58H 1CDGA 1UKTA 4PP2B 4XPHH 2I27N 4RMRA 4TTGA 1AXSB 4JRXB 4R0LA 4F7PA 2W91A 2XYCA 1HILA 4RGNB 1A0QH 4NWUH 4ORZC 5MHSE 1E4WH 3THMH 2BSED 4HC1H 4ONGH 5JPNA 5ESAA 4R4FL 3L5WB 3ARGD 4O51A 5FGBC 5C0EB 4G8GD 1S7QB 5DT1L 1U3HA 1RZ8A 2W65A 1CZ8L 5FA3B 1I8IA 4LVHC 5C2UB 1YPZE 2QSCH 4ZFOA 4M3KB 1WZLA 1RPQA 4S1SL 2FJHA 1D6VL 4KKCD 3NCYS 2BJML 5GS3A 3ZO0A 3IDGA 1CFVL 2VQTA 1C5BL 3ZMRA 3PDGA 4F57H 4KV5E 1ND0B 2HJLB 5E00B 1G7LA 4IBLT 2VAAB 2R23A 2DD8L 1M05A 5A1AA 4LCCC 1NEZB 4U1NB 4UDUB 1QSEB 4H1LB 4J3XA 5F7LB 3TIEB 3JZ7A 3ARFC 4P46B 3HPLA 3MRIA 1EJOH 3CK0H 3QO0A 4MQXC 2DS4A 2P5ED 3LCYA 5FGBA 4OD3H 4R7DB 5JMRA 1N5YH 3VWJD 3FQRA 2ZNXA 3C6LC 4IOFD 1BVKB 4XP6H 3WIIL 3MZGB 4QRTB 1J88A 2FHBA 2JJWA 1BQHB 2YUXA 1GSMA 4JG0H 2EDQA 2FL5A 3C9NA 4YHNB 1ZOXA 4P5MB 5DVOA 1T3FA 4J6RH 3K8LA 1YJDC 5DHYB 1I75A 4PLJD 1CE1L 4IRZL 3JV0A 5FGRA 4PJFE 3TC9A 2R0LH 3MV9B 1WEJH 4MA1B 4N0YH 3BPOC 4FZ8H 1NAMA 3M1BA 4ZO6A 1TZGL 2J8UB 4Y2DD 5ID0A 1KEML 3HCVB 4YDJA 1ACZA 4ODUA 5HHPB 1A3RL 3QQNA 2N4IA 2YMXL 4FQCH 4PRBB 1HQ4A 1AKJA 3CDGB 3V6OE 5GGTA 5IQ7H 3FT4A 5IFJA 3GHBH 4R7NA 2NXYB 4YFDB 2ESVA 3DBXA 2UV3A 2AEIT 1MRDH 1EAJA 5TE6H 2CQVA 5FYKE 1YN6A 5TQ2L 3T2OA 5D2NE 5D7KE 1EEZA 5D5ME 4YHYC 3MR9B 5GRXG 3GSNA 5DR5H 5SX5H 1KTKE 1Q9LB 4Z0BL 3DTXB 4WU5A 1OARL 3RX5A 1MCSA 2EDDA 2BRRH 4FHBD 1BVZA 3STZA 4LLMB 1PSKL 3ECBB 2JCCF 1I7ZA 2NY5L 4HWEH 5DUML 4NNPH 1KG0A 4G6FD 3RDTD 4OCSL 4TN9A 4J7RA 2Y07H 2B1HH 4LPVA 3O2VL 5I1JH 1SJEB 1N2RA 1VGKB 1IEAB 2PCPB 3KAAA 3GJFH 1VGEL 1CXHA 3OB0H 3UJTL 1ZGLA 3DNKA 1U3ZA 4U6XA 1OB1B 3F62A 5M95B 1JI2A 3K3QA 5IHUH 5GGSB 4N5UA 1AIFB 3HRZB 5HGAA 2FZ3A 5C9JB 1BVLA 4LIQE 3D3VE 4DK6A 1ZV5A 3IVKA 4EI6B 1F4YH 4KHTL 3VFPA 2AKRB 1FP5A 4N1EA 3K2MC 3TPUA 4ZS6D 3C60A 4TTDD 1IC1A 2X4RB 3QIBD 3VMOA 2XN9B 3CXDH 4KK8C 4DCQA 1ZVYA 1RVFL 2PO6A 4L8BB 2HH0H 1A14L 2H26A 3BX7C 5CBEB 1ZTXH 4NBZB 1UEMA 2HN7A 3U1SL 4F7CA 1CD1B 4FXKB 1YMME 4I18C 4KUZL 1UCTA 3CZFB 5CS7A 4ZMAT 4HK3J 3Q5OA 4K23L 5FB8A 1IGMH 5GS1B 2GT9A 4KK5C 5MEOA 5J89A 3TWCH 5F6IC 1QLEH 4F7MB 2EDJA 3WNPA 3UEZA 1KLUA 2DQTH 4KKNA 4V1DB 2YEZA 3CVHL 1CLZL 1OCWH 3OWEA 3ULUD 3ARGA 3AVEA 4G8GA 4PGZA 2H2SC 2YRPA 5CGTA 1XFPA 5IBTH 5CKAA 1ZHBB 4L29A 1HSAB 4DUWA 1J1PL 3EOTL 2FO4A 2Q86A 3LD8C 4JFHE 1I8LA 1GPOL 4F7TB 3QEQD 4L9LB 4FZEH 4CMHC 1RUPH 4HMEA 4KMTL 4U1MB 2NR6C 2G60H 2HVJB 1KYOJ 2BX5A 3LQZB 1IQWL 5EOTA 4CJ0A 3QRGH 5EZOL 4YHIB 3DV4A 1QFWH 2V7HA 2P5EA 3EGSA 5C0IA 4C54A 2R4RL 3RVVC 1P6FA 3DUUB 4MLIA 2APWA 3VWJA 4P23D 5ITBL 2NPLX 2ZWLT 3KPMB 3IDUA 4W70A 2RCSL 3D0VB 4MNGB 4ODHH 2VC2L 4LMQI 3VXSE 1SBSH 5I15L 2DBLH 3LKSB 3K2UH 4UINL 4Y19B 1ZWIB 3B83A 1M7DB 2KZ1B 4YDIL 1UEYA 5GHWH 3IDJA 1I9IL 4N8VB 3BFOA 3EFFB 1Q72H 4NJAL 1VERA 3QSKB 3BKJH 3PWUA 1JV5B 4GAGL 2O26U 4X7SL 1A1OB 2R2EA 3MQIA 3G5XA 1NL0H 4NOBA 4F33A 4JEGB 4K7PX 1XGRA 3O11B 1NBYA 2LAGB 4Y2DA 3RWHA 1BJ1J 1Q9WA 3OKLA 5JOEA 5DYOB 4FQHB 1SJXA 4U05A 3SO3C 3KNBA 4WNQB 4I0PD 2K7PA 4NNXB 2YBRB 4YGVA 2X4PA 3E3QE 5IKCA 2ERJC 3S34H 2XTJB 4LF3B 5I76A 4Y0GA 3ET9F 4S1RL 2FD6H 4HJGA 2AEPL 2IEPA 3O0RH 3OKEA 4JQIH 1A1MA 4ZO9A 3T65A 3B5HA 4AIZB 3MLTA 4HUXB 1XAUA 3IFOA 4UU9A 5JO5B 3HC0B 3SJVB 4UIMB 1K8IB 1YY8A 4ZUTB 1MQKH 4K3DL 1LWRA 1CIDA 4NDMA 5FYJH 3MRMB 4I2XA 4D8PA 4F8QA 4UBDC 3Q3GA 3B9KB 1CYGA 1PDKA 3BMWA 2GSIA 1QFUL 2VMFA 5FYKU 5HVHB 4PTUA 4IHOA 3RDTA 3GMLA 5EU4B 2OXHA 2YRLA 1B4JH 3QO1B 1D5MB 3BJLA 4E5XB 5I19H 4OGXH 4PJHB 1C5CH 3KYMA 4GG6F 4GMSH 4O4YL 5BV7H 4P4KD 2VOTA 3S97C 1BZ9A 3GM8A 1FO0A 1JN6B 3KXFB 5F7MC 3C08H 3WIHH 3QQ9D 1IGYB 1X6LA 2X4UB 5ESVA 1XR9B 5HGGS 3UPRB 3IU3A 1LE9A 4JFDD 4HUWB 4ZOBA 1IAMA 3S6CA 1EAPB 4I48B 5EC2A 3H6JA 2CMRL 1G7JB 5DD6B 3GUTB 1EGJA 2EDLA 4JG1L 5CJXC 4JM4H 4XMLL 1BIIB 3QIBA 5IB4A 1FL3B 4KKLD 1RD6A 5CUSH 3ELAT 3PWNB 4Q6YA 1P7KB 4HKBB 3BEVB 4XB7A 3RHWF 4NBXB 2X2YA 2NY0B 3B8SA 5DJ2A 2A73B 3MLSH 1HNGA 4M5YH 3ABZA 5IBLD 2ADFH 4P3DB 5DMYA 5ENWB 2FJGB 1RV6X 2X89D 4HSQA 1NMCB 4MQSB 3HI1B 2ADIB 3RGVB 2QADD 4NZRH 2AJYL 2QTEA 8FABB 5DJ0B 3E2HC 3MJ7A 2Z9TA 2XWBA 2DYPB 1OGAD 3ARUA 4J2XA 1FSKC 3UZQA 3W9DA 3GKWL 4Y5VB 3AM8C 2AJUL 1XR8B 1KC5H 4FFZH 3VXOB 3SCMC 1DUYA 4HZAA 1S7XA 3S4SB 1E6JL 3HHRB 3QQ4B 5FDWB 4NQEE 3HMXA 4X99A 4DFHA 1F58L 1D5ZA 2ZOLB 3QEQA 4R97C 5KVEL 4DKEL 1AI1H 4NT6A 3DGGA 2R8SL 1GGBH 3MRJA 2DKMA 2XG4A 3VA2C 1JGVL 2CLZA 4U6YA 5BW7A 5I1IH 3VWKD 1A4KA 5B4MC 2H8PB 1MCDA 5J6HA 4WFEE 3RHWK 4JRYD 1FFPA 5FOBA 2HT3D 4NZUH 5J6GA 1DANU 5C0BD 4P23A 4NCDA 3SCMA 3NFNA 3MODH 4B50A 2FB4L 3WMSA 4NP4H 2C7UB 3HPJB 1PG7H 4OLUL 2RB8A 4MSWA 4M7JL 5ISZE 2C1PA 4C57C 4QF1A 1NMAH 5FO9A 3SGEI 3QDJD 1OSZB 4YXLL 4HS3A 2ZUSA 4Y4KB 4XNQA 2DQJH 5B3JF 4NZTL 4NN5C 3G9AB 4LLVA 1MOEA 1J1XH 2BSTB 5SWSE 3WUWG 4WUKH 4LRIC 1AP2A 5I74B 2OLDA 3VI4F 3BGMB 4I0PA 1BMGA 4I77L 4QTIH 1IAKB 4X9IA 1T1XA 4ZOEA 4XTRC 5I6XC 4TVPL 1WTGT 2MPAH 3LH2H 4NN7B 2GTZA 3V5KA 1DBAH 5FKAB 4RWYL 3P9MA 4HEME 2AJXH 4PRIE 2QV2A 2PW1A 2ICES 3WO4B 2YSSB 1DJSA 3VH8B 3EYFA 3WN5C 4P5TD 5IB1B 2IGFL 1RIVL 5DRNA 5F7DA 4LKXB 5T1DL 4OB5H 4DTGH 4PREB 4EDWH 4EUPB 1FNGB 1SEQL 2XFXA 5T33H 5HI5D 3GSQA 3LSOB 3HE6D 2EC9T 5CIPB 3FO0H 3KWWB 4RAVA 4JHBA 3HAEH 1N6QH 2F53B 4DGIH 4P4KA 1DSFL 4L1DA 3RKDC 4M7LT 4HIIA 5FHAH 1MCPL 4TQEH 1RUKL 4WW2C 3E6HA 1FNFA 1RZGB 1JZ3A 3VFOA 4FTVD 1IARB 4WI2A 3WIFB 5IROC 1QQDA 1T22A 4JFDA 3GI8H 1XZ0A 4TULL 3OKDB 1SY6L 4RNRB 1FVDA 2OK0H 1SEBB 2O5YH 4HPYL 4YWGL 2ORBL 5KVDH 4OLVH 1F4WH 2ITCB 3MLYH 2Y36L 3P9LB 4LPXA 4ZAKC 2MKLC 2M1KA 3P30L 3S96B 1EEYB 1HYRC 1T89C 1GL4B 2AERT 3GSXA 3UAJC 2EKJA 4KKAC 5EU6D 3MOBL 2F15A 1FORL 1OAQH 5DFWH 1HHIB 3TH4T 4WW2A 4JY6B 4GW5B 3DURA 4E0RB 1RZJH 2X89A 2EYSA 3RVUD 3BOVA 2AQ3A 3U7YL 1MPAL 4NM4H 1DFBH 4Z7UE 4GS7B 5DJ8A 5ERWB 5GGSY 1OGAA 2Y7QA 1RZKC 3QFJE 4G6ML 1B9ZA 1VEPA 2H9GA 2XKNA 3MNVB 5CZVH 4PJCB 5CBAA 1BWWA 3P2TA 5B3JE 4PJEA 4RQQA 3NN8B 2R29H 4BFGA 4CN1A 2XQYG 4OTXL 4ELME 1KFAL 3H3BC 5BZWB 1HXMA 2G5BB 4XMKL 5JNYA 1KULA 4HIEB 4BSVB 3VI4E 4M7ZB 4NUJB 2VLLA 3PJSA 1NFIA 3KJ6L 3QXDB 3H7LA 4QOKB 4X5XA 1OT1A 4ZXBB 3WJJC 4QO1A 1IL1A 4L4TB 3PNWA 1ORQA 2E6QA 2CXGA 2JJVA 4RMSA 1PKQA 3DX6B 4CU7A 2FH6A 2PTTB 1CBVL 4JRYA 5HDQH 1UZ6E 3ISWA 2EIZA 4S1QL 3X3GH 1HYSC 1U95B 1KJ2L 1BOGA 3BIBX 1UA6L 2NY3C 3OKNA 2F74B 3H9SE 2VZ1A 3NTCH 1HOCA 1YNLL 1DQML 1KCUL 1ZA6A 5B38G 3QDHA 1W0VA 4JDVA 1MFBL 4ETQA 4WGWB 2OTUB 3RAJH 2B0SL 4FNLL 1CVSC 4ENED 3QDJA 2AXFB 4QY8A 4YE4L 5SWZB 3CFCH 1AGCB 5EOCJ 1CGSH 1G9MH 4L8DA 5KSVB 3L3KA 4NKQB 4LEOA 4PGCA 2C1OA 4Q6IC 4M7KH 1PEWA 4J1UA 4RGMB 5E2VL 4CUCA 3BJ91 4G8IA 3MBXL 1A9BA 3FB5A 2WV3A 3WKML 5DLMH 5I75C 3TPKA 4G43A 2IADA 1DL7L 2EO1A 1PQZA 2VZ3A 3PHOB 1P84J 1FZJB 5BZDA 1PLGH 1XMWA 5C09B 1NH6A 1RUQH 3T77A 1XF2B 1F90L 1NCDH 3QCVL 4KRPC 3CVHA 4D9RE 4JGMA 1KCSH 3OJDB 4HT1H 1T5XB 2Y72A 4P5TA 2X1QA 2AGJL 4NN6B 4LGRB 4HKZB 4TUKL 4CMMA 4Z7VB 3SHSA 1BD2B 1RULL 2A83A 5H94B 3FT3B 5IESH 4LAQH 5FEBA 3HE6A 3T3MF 1DBML 1X4YA 3SY0B 3WXVH 5GS2D 4QHMB 1OY3B 1DE4B 1BQUA 1T66D 4PRPB 3LKNB 2GAZA 5TE7H 4XC3H 3CLEH 4ZDHA 5IG7A 3WS6A 1MUJB 4P2QD 5E8NA 1WZKA 4BZ1H 1VFBA 2AVGA 4F9PC 4FMFA 1HI6A 3MTRA 5IVXF 2V17H 1QR1B 4WRLA 5F7HA 1RK1A 3BKCL 4AMKH 4D0CA 4UNVA 1NC2B 4Q2ZA 1AC0A 3RVTD 5AEAA 3OHXA 4OKVB 4NUGH 4F9LA 4NQUA 4UT6H 1G7PB 2R15A 1OGTB 5FYLE 1KJ3L 4OGAD 5FECB 2FX9L 3SGJC 3BZEA 1T6WA 3VCLB 5LCVL 3MGOB 1CLYL 2I9TA 2X70B 2NX5E 1CG9B 4PG2A 2B4CH 5GS0C 3T0WA 1P6AB 3RZCB 3O6FC 5E8PA 5C6PB 3OL2A 4IIQA 4Y2OA 1IKFH 5B8CA 4QHKI 3HNTL 3MA7A 3PWLA 3RTQC 5EU6A 4WENB 3EO1A 4MXVF 2GI7A 3O41A 1JPTH 2V9TA 4AT6A 1NLBH 4JFZL 1UB6B 2XWJB 5I8OH 3K46A 2V5MA 1E27A 3GRWH 4GH7B 5HI3D 1S7VB 5CEXA 3EYUL 3HZYA 2LFGA 1K4DA 2CH8A 1QR4A 2VN4A 4G9FD 4TVPD 3GGWA 1NQBA 4NO0B 5HYJD 3ILPA 4YR6B 4E42B 3R06B 5J9PB 4J3UA 2P4AB 4XX1G 1F02I 2JJSC 2EDEA 3VA6A 3GK8L 5ESQA 1G6VK 2DWDA 3C2AH 4XPGH 3C5ZC 2R1XA 2GJ6E 3BH9B 2PF6A 3G5VB 1I9RH 3F7YB 5EN2B 1MCEA 4Z7WE 1MHEB 4BUGA 5C0CB 2YD7A 1R3LB 2QKIB 3RWEA 2O93L 2XI9A 3INUH 4LP4A 4ZO7A 3Q1SH 1G6RB 2GJJA 2APTA 4ORGB 2MCPH 4ESKA 3GJFK 4L3AA 4FQ1L 3FB6A 3RBSA 3TBYB 4DKFL 2J8OA 3MCG1 2DQCL 3BPCB 2Q6WB 3QUML 4PGJA 1B3JA 3I9GH 4JO4L 1MSPA 5HDOA 1VACA 1YYML 3QXUA 2JIXB 4YHMH 3BO8B 2OR9H 2HT2D 1IVLA 2X9YA 1CL7L 3KJ4C 1WJ3A 1GOHA 2VABA 4YHZL 2AK1H 1OPGH 4I3RH 3MRCA 3PIQB 4WFHE 5F88B 2A6JA 1IAOA 3B43A 3NCJH 1HSBA 4UUJA 1HINH 1MF2H 1WVZA 4LCWD 1MEXL 4G6KH 1L0QA 4RGND 5I8CA 3IRZA 3T3ME 5GZOC 5CMAB 5ICYB 1MCWM 2R0KL 3S35L 1UWEL 4EN3C 4JVWA 3SKMA 3MRGB 4KQ3L 1EXUB 1KTRL 4PG9A 3QXAA 2LU7A 3RVWC 3KPRE 4GAYA 4ZQKA 4FFVC 4M8QB 2DQDH 1UB5A 2C3HA 3F7RA 1A9EB 1WICA 5BMFH 1MFDL 3H9YA 3WCYA 3PWPE 2HLFC 4KJYB 1BQSA 4DZBA 1QSED 1DVFC 1J87A 2PETA 5DJYB 1NAMH 4NHCL 1NSNL 2XPGB 3BYTA 2B7DT 4LCYA 5TE4L 4E41B 2HAZA 3WE6A 3QEHA 5IV2B 5SX4I 1T1YB 1NGPH 5LJYH 3EDFA 3P11H 2DTML 1T7ZA 2J3SA 4RZCB 3SGDI 3GBLA 4MXVE 1QSVA 3QUXB 4PBVC 3BPNB 3BKYH 4M1CD 1YEFL 5J3HC 4YPGB 1A6ZB 3MA9H 2D7NA 1FCCA 3F12B 3T2NL 1AQKH 4P2QA 1RJZA 4JFEA 4YXKH 1XT5A 3ILQC 1UENA 3GSNH 4APQC 4A6YH 3L3OB 3VRIB 3LY6A 5A2JH 1ED3A 2AQ1A 3AREB 3LAFA 5EIIA 2X7LB 3BEWA 1ZT4B 4M6NH 5EO1A 2WBWB 4IOSD 5D1QC 3GSVA 2A9NH 1L9MA 4TSCH 3NPSB 2J88L 3JVGA 3VGBA 2YHGA 4X4ZA 5F21B 2KH2B 2NXYD 4ONHA 3U36B 4AK1A 1A4JA 5FHBL 4R4NC 3HE7B 5TGBB 4FA8A 3TNNA 2KKQA 3VD5A 1S7SA 5EWIL 3ZYIA 3MREB 5E8EA 5FGCE 1NANH 3SE8L 4NNYB 4O2CB 5F1KC 4EIGB 5EBLB 1ZA3B 1T5WA 5EO0B 5EZIL 2VDPH 3V5HA 1UYWH 4ZFGH 3QAZB 3VFNB 2OR8A 6FABH 1GVIA 5JOPE 4OM0L 1EJ6A 1P1ZA 3T0EC 1UC6A 2DRUA 4WFGD 4JN2A 3TV3H 4L3CB 3CVIL 2OZ4L 35C8H 2VWEC 2B8OT 3LB6D 5IFHL 1LO2L 1ZS8A 1OTSD 1X5LA 1KIPB 2AQ2A 1D7FA 3TNMB 4NO2A 5DMGD 4OZGB 1XCQA 3GSRB 5E2UH 3GDBA 3U79A 1NGZA 5T3XL 3DVNB 3O3EB 5CZXD 5D7SL 4NO3B 3KG5A 5HI4C 3DARA 3UYPA 2BY0A 1HH6A 1TJIH 3OXSA 3BD5A 1A6TB 5C86A 5AZ2L 4JM2C 4DVRL 3QDMD 4UOW0 5FUOH 5IT2L 4OZFG 4XMPH 2QHLA 3MV11 3BI9X 3SQOH 5MI0C 3NGBB 2BFVH 4ODTH 2XN9D 1FLTX 5A2FA 1FNSL 2V7NB 4HKXB 5HHOE 1JBJA 3CCHA 1UH4A 1IRAY 1TVHB 4X6DE 5ALCH 1T2QL 2NY2C 2VITA 4JO3L 1H8OA 2EC8A 3FN9A 4LBEB 1B0RA 1DQLH 4WUUE 4QHLA 4Z95L 1X5FA 1A7PH 3RFZC 1CT8A 4M5ZL 1YQ2A 1FCGA 2ZCKL 4PP2A 3S5LB 1QVOB 2MQ3A 1F4AA 1SY6A 2N7BA 3HUJB 4MJ4A 1LDPL 2ZOKB 4Y5XC 5E8OB 4D9QE 3BP5B 4LCWA 1AXSA 2Y5TB 2VNCA 3U9PH 1NUDA 2MHAB 2FR4B 4MQ7B 3RKPA 3BRGC 4P46C 5D7JC 4V1DD 2Q8AL 5D71H 3TT1L 3FTGB 2LE9A 1S7QA 2VDMH 5FA3A 3QIWC 1GAFH 1BLNB 4XPAH 3T8XA 5FYJE 3PWVB 4KMQA 3MUGB 4DOHB 3IGAB 1U58B 5D1ZB 1IT9L 1H15B 4U4BA 3EJZC 3KDMB 3BDYL 4XP4H 2VYRE 3HFMH 1ND0A 2HJLA 5E6YA 5E00A 4HFUL 4JPVH 4KZDL 1I1AC 2VAAA 3CDYA 4HF5L 4U1NA 4UDUA 1QSEA 3M8OH 3DX8B 3OB8A 2A6IB 3TIEA 4PJDF 3ZKXC 4M7LL 4CW1B 3UTPE 1KSRA 3HG1E 3EDEA 5HGHB 1MFEH 4HCRL 4XNMB 3QA3B 2YK1H 4R7DA 4UV4H 1OAZL 3LS5H 3X14B 1BVKA 3C8KB 1YUHB 4I3GA 4QRTA 3ARBB 4Y16B 1BQHA 1Q8MA 4Y19D 2C3GA 4NFBA 3TVMB 1ETZB 4K94L 4P5MA 2WBJC 2AV1B 3O9WC 3BN3B 5DHYA 2MQ0A 4KUCF 2NY6B 5DJXB 4H0GA 4UTAH 3DSFL 2BVEA 4M02A 1CFTB 4DKAA 4HULB 2FRGP 2G75B 1FJ1A 5IJKC 4UIKH 3QULB 4Y89A 5AAMA 1I1RA 4JZJB 1Y18B 5EBMB 5HHPA 4X5LA 3LQAH 2A6KB 3A67H 2YKLL 4ZFZB 4PRBA 5F9AC 4N0CD 2P47B 4PGDA 3IDYB 2W60B 2APBA 1MCNA 4KVCL 2GITB 2XTJD 5CP7B 1FZMB 4HIXH 4PTTB 4CN4A 1U92A 4K3HA 2PYEB 4CDHA 3IKCB 1FG2B 2F5AL 1J1OL 4YHPB 1FO0H 3LS4L 3MR9A 1Q9LA 4YZFE 4XB8A 2WWKT 3DTXA 3EJYD 4RFEB 2P46B 3AC0A 3QUZB 3MRQB 1B88A 2QQNH 4LLMA 3ECBA 5KOVC 3U7WL 3O81A 5ADOL 4NKDB 1HHHA 2YPLB 1ZLUH 4GMTL 1YEEH 4OCYH 5INCB 1ZXQA 1AO7E 3FN0H 3OR6B 1SJEA 1VGKA 2PCPA 3O8XC 4KQ4L 1UM6L 5DHVA 4CU6A 4L8SB 1MRFH 4HLZH 1OB1A 3S37H 1EPFA 3VG0L 1C1EH 1SM3H 1DBJH 1AIFA 1KBGH 4F8TA 5C9JA 5D1XC 2MWCA 4JKKA 1K3ZA 1QKZL 3LN4B 4HFWB 1EHXA 4EI6A 1FL5B 2AKRA 5CJQH 4OZIB 4NCC1 4IRSB 5D7IE 4U31A 3UTTD 2X4RA 3T4YB 2XN9A 1MREH 1JVKA 3RI5F 2JE8A 1JNHB 4L8BA 5IOPB 3ULUH 5TDNB 1TJGL 2WBKA 1JHKL 3W82A 1C12B 4NOFA 5CWSB 1TMCB 5CBEA 3V6OC 4LLDB 4ZNCD 4CKVX 1CD1A 4FXKA 3S3PA 3HMXH 3VFWA 1M71A 1KTDB 3MGTB 1WAAE 5C6TL 3CZFA 4JHAL 5DEGB 4P0DA 3JV5A 4IM8A 5DUPH 2V2XB 2UZYB 5GS1A 1RJLB 4QTHB 3TYGL 4F7MA 5K59F 1V7ML 2DYPD 4V1DA 4JHZA 5E6ZA 1TTUA 4NQCE 5CILL 3V9FA 5JQ6L 3OKMB 4KI1A 4NWTH 1P7QB 5JMOC 5DGQA 3VGAC 1ZHBA 1AJ7H 4M93C 4M8VA 4YIQA 2HWZL 2BMKA 1DEDA 5DMIL 4F7TA 4Z78B 4L9LA 4F7EB 2B1AL 4U6TA 4U1MA 2R9HC 3L5XL 4JO1L 3RI5K 2HVJA 1A5FL 2IAMB 3LQZA 3QNXB 5FYJU 3IAQA 5GQBA 4HWZB 4YHIA 2A38A 3OGCB 2MCG1 5T3XD 1CGYA 5HD8C 2VQ1B 2AXJA 3WHE1 3DUUA 4PUBH 5FCSH 3KPMA 3VGFA 3WJLC 3D0VA 4MNGA 3LKSA 4Y19A 2X6MA 3GSOB 1ZWIA 1M7DA 1SJHB 4Y5YB 3UYRL 4PJ5B 1A3LH 4H20H 3C6SB 4C83B 1E4JA 4N8VA 5DFVD 1MJ8H 4QCIB 1RZ7L 4OT1L 4Y4KD 3U82B 3HNVL 2EH7L 3KPOB 1JV5A 4K3JH 4O2FB 5GZND 1A1OA 1N3NB 4ODVL 4HAGA 1GGYA 3QUMA 4HK3N 4LSPH 4R4FH 3O11A 3FL7A 3DXAD 3W5NA 5DT1H 1KCRH 3B6SB 1OF2B 5DYOA 3B9KC 4FQHA 3BE1L 3OXRB 5CSGA 4WNQA 4NNXA 1D6VH 2YBRA 2BJMH 4AEIL 5KSUA 1IM9D 1CQYA 1CFVH 1C5BH 5SWQB 4LF3A 5JHLL 3Q6FA 3QDGE 4N5EC 3IS0X 4CVZB 3LEYL 2Y9RT 2DD8H 5DD1L 1AY1L 1QSFB 3SQBA 4EI5C 3DPBA 1S3KH 4HUXA 5JO5A 4GAFB 3HC0A 3SJVA 5GJSL 1K8IA 4U1GB 4NSKA 4ZUTA 1SYVB 3K81A 1A8JH 3MRMA 2L4OA 2V5RA 3LMJH 3HC3H 2BY1A 1LEKB 3WIIH 5I66A 1J9CT 3RBGA 5DRXA 5K9JL 3ZHKA 3D3VB 3HMWL 3H2WA 5EU4A 1GH7A 1G6RL 3QO1A 4H8WL 1D5MA 2Z31C 4E5XA 3LKPA 3T0AA 1UT9A 4PJHA 4KI5F 2ZSWB 3G6JF 5FV2A 5D2LE 2HFFB 4HUUB 5E5UB 2F53D 2VLJE 2EEDA 3CSPA 4Y8AA 3SDDD 2XXCB 1EO8L 3CMGA 4MXQD 4KKBD 2NY0C 3KXFA 1R5WB 3MYJB 4GQ9H 3RUGF 2P8PB 4OAWB 1J05B 1A3RH 1IGYA 2YMXH 1LO0L 2E7LC 2X4UA 4IRJD 2CK0L 1JGUL 3UPRA 4U49A 3RGVC 2BY2A 1ZANL 4HBCL 4HUWA 1YMMB 4JFYB 4YBQC 1EAPA 5BRZE 4TSAL 4I48A 4MA7L 1RUML 1G7JA 5DD6A 3GUTA 4RDQF 3CNKA 1BIIA 1FL3A 4E9LA 4Q9RL 3MBEC 3PWNA 4K8RC 5GGRA 4GKOA 5ANME 3TBVB 4G3YL 1PG7X 3WNLA 5TQ2H 2YUVA 4URTB 1QA9B 4HKBA 3BEVA 3TN0C 3VDCA 1XIWB 4JFOB 4WWKB 2R56L 1OARH 2A73A 2IG2H 2IC2A 4PRAB 5JW4Q 5KG9B 2OSLA 4P3DA 4TNVK 4UT9H 5ENWA 5E4EB 2B5IC 3E3QC 4G9DB 4M6ML 5I2IB 2E7LA 3IFPB 3L1OL 1MAJA 1MVUB 3F58L 3HI1A 2ADIA 2V5YA 3HR6A 4LDEB 2IBBA 3S36H 5DJ0A 8FABA 5TFSL 3QCUL 3O2VH 2D9CA 1RHHB 4QWWD 4JKPH 5C0RL 3LEXB 1WC7B 2AAVA 2DYPA 3G5ZB 2IPUK 1IE5A 1VGEH 4Y5VA 2J2ZA 1V7NH 2NW3B 1IAIL 5TH2B 3VXOA 3T4AB 2IANB 3IDNA 4S2SB 2JF1A 3S4SA 2E6PA 5FDWA 2H1PH 5DZNA 4HIJB 2ZG1A 3VXSB 1H3VA 2JJUA 2PXYB 2ZOLA 1INDH 2F9BT 4WY7L 4KHTH 3BIAX 4LSRH 4OLWL 4LGSB 2OZ4A 2MSPA 3CC5B 3RVXC 4ZXBD 4L4TD 1EUUA 5KAQF 3PQYB 5A2IH 1CU4L 3AY4A 4GG8B 4PD4J 3FCTB 3MNWA 1ZVSA 4XNXL 1F8TL 4QRSB 3KLSA 4C56B 3GMPB 1UJ3B 1JE6A 1FGNL 3DV6B 4LQFL 1NLDL 5JUEH 3TYFB 2ICCA 4OFKA 5JW4M 3U1SH 1MCKA 2C7UA 1GCFA 4KUZH 2MOVA 3HPJA 3VFRA 2HJFB 2X4QB 2D9QB 4GAJH 3B9EA 1ZKAA 4K23H 1X5YA 1OSZA 4U7MA 1YEHL 4Y4KA 4NQVB 4GJTB 3JSSA 1U8LB 2DMKA 3AB0B 2VXQL 3CVHH 3TGXA 1CLZH 4BFIB 4KI5E 3G6JE 2VKXA 4RSVA 3SGEH 2BVPB 4KZEL 5HHMB 4GXUM 2C3XA 2W1NA 3QIUC 5HYEA 3RWDB 3K0WA 1FZKA 2HRPL 1F97A 1JYNA 3L3GB 5HJ3B 3BGMA 4PB0L 3MRBB 4D9LL 5E99L 4LPTA 1IAKA 5DK2B 1GPOH 1IM9A 1J0YA 3JTSB 5DQDL 5HHQB 1U2HA 4P99A 3B3IA 4FQ2L 3MLXL 4RMWA 4KMTH 4JREB 5C09D 3K74B 1YEJH 3ARVA 3H7BB 3U6RB 1T4KB 1MRCH 3KLHC 1MFAL 3FN3A 5BXFB 4JQXC 5EZOH 4UOJA 2ZCLL 4CVXB 4K9EL 3FQNA 3VFVB 2VLRB 3VH8A 5KVFH 4QHKJ 1G1CA 2P24B 5HVGB 3NH7L 4HPOH 1DN2A 4QHUB 2RCSH 5F1SA 4LKXA 4PREA 3U0WH 4EUPA 1FNGA 2EICA 3Q6GL 3LSOA 1I9IH 1S9VB 4X7TA 5CIPA 3F8UB 3KWWA 4JFQB 4OCWL 1FYHB 4PRPD 3RA7L 3TBWB 3BQUB 1IKNC 2F53A 2E5EA 4GAGH 4X7SH 5I1LB 3F6IA 1JNJA 3CX5K 3SE3C 3LKQB 2F54E 5JTWA 4HCRA 1NC2D 4B0MM 1QZ1A 3OAYK 1R3KB 4X7EC 4IOIB 3BP6B 3P77B 4HIHB 5KZCB 3OKDA 4OF6A 1AGBB 4RNRA 4OFPA 5M94B 5L2JA 1N7MH 1SEBA 2VXSL 2WZPD 2AEPH 1QPPA 3LRGA 4MMXC 4QRQB 4FRWA 4LLWB 3RZCD 3AS1A 4JVPA 5GS0H 3P9LA 4PLKD 4BZYA 2AJ3B 2VISB 3S96A 4KK6C 1EEYA 3TFKD 4ZG1A 1Z9OA 3NCBB 4NKMB 5HYFA 4HDIB 1IGFL 1HHIA 1C16B 2R2HA 4JY6A 4GW5A 2F19L 1FZOB 2ADGB 4KJWD 1S7UB 3SDXB 2FHFA 1QFUH 3ZL4L 2XZCH 1QUNA 4XVUD 5J12B 4MWFB 5JXAL 5ERWA 5DK0A 4D3CL 4O4YH 1R3JB 1I8KB 1D5XB 5J8OA 2A0LD 4HWBL 3MNVA 4PJCA 5F89B 2BSRA 4ZO8A 5A3ID 4XGZB 3NN8A 1JHTB 3MFGB 1QFOA 5FO7B 2E27L 1DR9A 2E7BA 3PL6B 5BZWA 5BS0B 2EXYD 2G5BA 4OIBA 1O7VA 3LDBC 5MERB 4HK0A 4XCYB 2AJSL 3IDMB 3UPCA 5C0CD 5KJRH 4HIEA 4NUJA 2CMRH 5ISZB 4QOKA 4ZXBA 4L4TA 4OLXH 1KB9J 4XMLH 2YD8A 3DX6A 2E9JA 4OFYA 3FOLB 3PV7A 2IJ0C 2FEDD 5T1KB 1J5OL 1MI5E 2CD0A 4RGMC 1U95A 3GM0A 5A16B 4Y1AB 2F74A 2JIXD 3H3KA 2D03H 2UZXB 5C08D 2O61A 1RMFH 1KIUA 2OTUA 5H37G 1IAII 1DQJA 3BD3A 2AXFA 4FQJL 1BEYL 2EZ0D 5E6IC 1NUFA 1NGYB 3LEVH 4JE4B 5C92A 4AEFA 3FHAA 2OJZL 5JA8B 4RAUA 1AGCA 4RMTA 1H3PH 3Q2CA 2AJUH 1M7IB 1TXKA 4X7DC 5KSVA 3OKOB 2FIRT 4PRIB 4O51B 4V2BA 1U3HB 1E6JH 1RI8A 2W9EL 1AXTL 1W8OA 4AL8L 4PJ8B 3UTQA 4R6UA 1F58H 3CLFH 3RWJA 5DD5H 5GS2H 3PHOA 1JZ2A 1FZJA 2BCKB 1JGVH 4FOMA 5C09A 3V7AG 1XF2A 1T7YA 2VZTA 4J3VA 1BAFH 3IJHB 1FFNB 2R0ZH 1AHWC 5E2TL 3OJDA 1T5XA 3HPLB 3HZKB 3QO0B 4XX1E 3OJ2C 4HKZA 4Z7VA 1BD2A 2MTPA 5H94A 4IDJH 3WFCL 1SHMA 1CLOL 3SY0A 2Z0BA 5IW3A 4XPFL 1DE4A 1RY7B 3N1MC 4XI5C 4YHKH 4YXLH 3C9NB 4PRPA 4O9HL 3SGKA 1MUJA 4OD2A 1U8PB 5EORL 4LASL 1S5HB 1QOKA 1QR1A 4OKDA 4YBHA 3O3DB 5T5FL 4QYOB 1NC2A 3NA9H 2NTFA 4OKVA 1VFOA 3ARED 4D2NA 1G7PA 1OGTA 3OR7B 1MWAL 4OJFL 4I77H 3TJHD 1FRGL 1R3IL 4JY4B 5DRZA 1KXVC 1MCCA 1BF2A 1ZT1B 4TVPH 4ZPTB 3VCLA 1WTLA 1PZ5A 3MGOA 2X70A 5F9OL 1MCBA 5DS8B 1R24B 2FJFB 3NZHL 4GRMB 4Z7UB 5T3ZL 5L2KE 3RZCA 3L7EB 3HE7D 4RWYH 3QFJB 1P5VA 4PRHB 2NCMA 1R0AL 4RISH 4OF5A 3QQ3A 5C07D 1FYTD 4PRDA 4G7VH 1JZ7A 1F4HA 2IGFH 5GRZA 4LKCB 1UB6A 3D39D 1TPXC 4PJBA 2XQBH 5T1DH 1A6WH 1U3JA 4ELMB 4LOUD 1S7VA 4IJ3B 3EO9L 4JKMA 4UTBL 1ZGLP 1SEQH 5GRWA 4ONOA 1QBML 1I7ZB 3TM6A 4OZHF 4YR6A 4E42A 3R06A 4K7PL 3ULUF 1JYVA 4B7IA 3D0LB 1J8KA 1BREA 4BFBD 4FQIH 1RUKH 1QBBA 3BZDA 3NPZB 3GHEL 4LHUG 5DC4B 3BH9A 4ZYKB 3RU8L 1GYAA 3G5VA 5EN2A 3F7YA 1ZLUK 4BKLB 3UC0H 1BGXL 1D6EA 2F8XC 1HKFA 2DAVA 1MHEA 2B2XL 5C0CA 1BVLB 4S0TD 3ES6B 4JLRB 5C2BL 4MA8H 1SY6H 5EA0H 3VXPB 4ORGA 1G6RA 3SDAB 3BISA 4LVNB 4YWGH 2ORBH 2EIBA 3VFPB 3PGDB 1ES0A 2BOBB 2CUIA 2BRQA 3TBYA 3TZVB 2Y36H 4FQXB 2VDRL 1XGTB 3WV0A 3VXUD 3BPCA 3DI2B 4KXZH 2Q6WA 4DCQB 3P30H 1OHQA 1KEGH 3ESUF 1F4XH 2P1YA 5FA4B 1BPVA 3MOBH 2JIXA 4XHJD 3BO8A 1P4LB 3ZHDA 3GB7A 3MLZL 4I2XE 3BHBA 3QZWG 4LSTL 5I71C 3PIQA 4BQ9A 4JQVA 5F88A 3ARSA 3TJEL 4QRPB 4BSWB 1EX0A 1FLRL 1ERNA 5DA0B 4XPBL 4PPTA 3F6LA 1SYSB 4IMKA 1B2WH 4H1LH 4G6MH 3I3BA 4KHXL 1FNAA 2BDNL 3MOAH 5C3LD 1BZ7B 2X42A 2YEZB 3DWTA 3QH3B 5CMAA 5ICYA 1WBXB 2GCYB 3O3BB 5KSAD 4OTXH 1KFAH 2BNQD 3MRGA 3QUXC 1EXUA 4O2EB 4LIQL 4MJIE 4FQLH 1BF8A 2SEBB 5IBUB 3N9GL 3KJ6H 2VDOL 4M8QA 3DVGB 2O5XL 2YD4A 4ZUVA 1A9EA 4GOSA 3WKNA 5AUMA 1CBVH 1RUAL 3L6FB 4DK3A 1PKOA 4QRRD 4ZS7L 1MHHA 5DJYA 4S1QH 1FDLL 1SMAA 2XPGA 5HHVH 5C3TA 1AR1D 1UA6H 2V7HB 1ZLSH 4E41A 4WFFE 2P5EB 5IV2A 3OAUL 4YX2L 3K4ZA 1DQMH 1KCUH 3X11B 3VWJB 5MP6H 2D7MA 4RZCA 1MFBH 3ARBD 4Y16D 4PJIE 4LPUA 2B0SH 4FNLH 4C59B 2HA1A 2H2PD 4UQ2B 4YPGA 3D25B 1A6ZA 3FFCD 3TVMD 5I1HL 4BH8B 4F58L 2VQUA 5SV3A 5I0ZA 1GC1L 4PV8B 1F2XK 2Q1EA 2NY6D 4OZHE 4I3SL 4PRNB 2AV7A 3GSUB 3L3OA 4F33B 3ULUE 3VRIA 1HKLH 3QAZC 3U4BL 2YUZA 4FQQB 1ZAGA 3RWHB 4M9OA 3CFDB 4N8CL 3W0WE 3AREA 4P49A 2J8HA 3GIZH 5L0QB 5IMMB 5I8KH 3PUCA 2EE9A 5BVPH 1B0GB 1IC4H 1PZUB 3CUPB 3JV4B 5E94B 1ITCA 4X8JB 3SKOA 1P9MA 3U36A 5I76B 3HE7A 2PYED 5ECJE 5TGBA 4ZNEA 5GJTL 1DBKL 3OKEB 3EJZD 2PW2B 3ZTJH 1Y6NR 4GRLC 3G5YB 1I9JL 3MREA 5C07A 4NNYA 5SV4A 1I1AD 4O2CA 5EBLA 1ZA3A 4H5SB 4WW2F 4AH2B 2FLBT 5EO0A 1I3GL 2AGJH 1MCJA 2GJ6B 3VFNA 3D39A 3BW9B 4TUKH 1WISA 1RULH 3DETD 3QUZD 3ZKND 3FRPA 4Z7WB 5EU7C 4QHNB 5F7WC 2YPLD 4L3CA 3NCCB 3F7QA 3ZKMC 1X5XA 1KIPA 1MFNA 3TH3T 1CFSB 3TNMA 1UH2A 3EFDL 4PJEF 1FH5L 4OZGA 3GSRA 1BZ9B 4XRCB 4XBEL 5EB9A 1NKOA 4JFXB 3BKCH 3DX7A 3DVNA 3O3EA 1EHAA 4NO3A 3ZE1F 1K2DB 4XCNB 3KPPB 4HUKB 1KJ3H 4WTXA 3QWQB 1V05A 3P40A 4NFDA 4XP9L 3X12A 2D0GA 3W9EA 2HVKA 5EC2B 1GOGA 1K4CA 3FJTA 4IRSD 1XF3B 3VXUA 4F3FB 4C4KO 2V7NA 4N0UE 2FX8L 4HKXA 4XNZB 3TA3B 3V6BR 2XZAH 1WF5A 1TVHA 1MCWW 3WLBA 2WQRA 3D9AH 3ULVL 4HW6A 4LBEA 1Q1JL 2GJZB 1ODAA 5D1ZC 2EEAA 3WXWL 3E8UH 3S5LA 1QVOA 3HUJA 4XHQA 1C7TA 2ZOKA 1YZZA 5E8OA 3FZUC 2Y5TA 2IBZY 1Z5LB 2MHAA 5T3ZD 3MJ7B 2FR4A 1F6LL 1UM5L 3PWPB 3FO9B 5A40E 3FTGA 4PJ9C 5CGYD 1NDGB 1A7RL 1IILE 1BLNA 5L6YL 1P7QD 3PWVA 2BNQA 3ZE0F 5IMLB 3MUGA 2UUDH 2XA8H 1S7XB 3IGAA 4G6AC 1KV3A 4LHUD 4NQDE 1OL0A 3N1GC 2OQJB 3EKCA 1H5BC 1H15A 1NFDB 1U93B 3F7VA 3KDMA 4NC2B 4X80L 1MHPH 3DGGB 4FQ1H 4A2LA 2NQCA 3BYYA 4XPTL 4HG4J 4BM7A 2NY1C 4PFEA 4MS8C 4QRRA 3WS3A 3ARDC 2BNRB 4CW1A 2NMSA 1JMXA 1YYMH 3D87B 5HGHA 1YC8A 4LNRA 1QG3A 3MLWH 3TF7C 4XNMA 3QA3A 5E4IA 1JF6A 1CL7H 5TF1L 3X14A 4YHZH 3C8KA 1YUHA 1YY9C 4NKOB 3ARBA 4HMDA 4Y16A 5D96C 4Y4FC 3QWRD 4NHUB 4GQPH 3IETB 3TVMA 1U3YA 2AV1A 3S37X 2WP3O 4P2RE 1B90A 5DJXA 4V2CB 3LRSB 1KOAA 2PNDA 1CFTA 3GIVA 1K9TA 4XAKE 2R0KH 2G75A 4EEEA 3S35H 4TUOB 5D7KD 3GZKA 1KN2L 5EBMA 4JZJA 1Y18A 2A6KA 5L9DH 3WFEH 4ZFZA 3ZT7A 1CVRA 4U6HA 2W59A 4I0PB 3PHQB 4IMLA 1JGEB 4R9HA 2W60A 2OMNA 4LSVL 4Z76A 1T1XB 5CP7A 1FZMA 4PTTA 2CIIB 4Q0XL 5IIEB 2PYEA 5GGVL 1RIHL 3O45B 2BERA 4MD0B 4KDTA 5DJAB 3IKCA 2ZUWA 3VJ6A 4PB9L 1WK0A 3IXTB 1JYWA 4NHCH 3T0BA 3LRHA 1EA9C 4RFEA 1CICC 1X6NA 4KDWA 3NZ8B 3KS0J 4YQXL 3QUZA 2ENSA 1BIHA 3MRQA 4BQBA 4MXWL 3HRPA 3D3VD 4XT1C 3MUHL 2YPLA 4NKDA 1YEFH 5INCA 2XFXB 3GSQB 1YMHA 3OR6A 2V5TA 3QDJE 5DVNA 1LK2B 5BV7C 4ZTPH 1CGUA 3I85A 4JZNA 1NCCL 5CZKA 1F3DJ 4L8SA 2HJKB 4HIIB 1S78C 2R1YB 4X6DB 1G7MB 2FHCA 2WINA 4JHWH 2DQIL 3HS0B 3DGCR 1T22B 2EYTA 3LN4A 4HFWA 1YMMD 3ZE0E 2JK5B 4KMLB 1FL5A 3NAAL 1FIEA 4RFNC 5ILTL 4OZIA 4POZD 1QRKA 1UXWB 4IRSA 5FHBH 3SOBL 4AIXA 1WWBX 3EO0A 3T4YA 2Z4QB 3D18B 1JNHA 5IOPA 5D72H 1VENA 4ZD3H 4XC1H 1XIWD 3WHE0 1C12A 4WWKD 4J3OC 4HQQH 2CIKA 5CWSA 1TVBB 1EMTH 4LLDA 1MWAA 1KTDA 3MGTA 1FPTH 3STLB 3CVIH 2OZ4H 3U0TB 2QADB 2V2XA 4ELKB 1RJLA 2IAMC 4MCZB 5IFHH 4Z7QF 3AAZB 4UZGA 1LO2H 1F11B 3U46B 4ETYA 2COQA 5TPWH 3LV3B 3OKMA 2H9GB 3EDJA 1PY9A 1P7QA 1CDCA 1JHLH 1W72B 2IAND 3ESVF 1SMOA 4PJEB 4KJQD 2VXVH 1NGXB 1CN4A 2WUBH 1FNEA 5GRVL 3T0VA 4S1DD 3LHPL 1WWAX 4Z78A 3VXSD 2RFXB 1C8PA 1MIEL 2PXYD 4OCRL 5FUZL 5JNYB 4F7EA 1I7TB 4KK9C 2X4OB 5IT2H 5KTEL 4PJGF 1MIMH 1ORQB 1U8OB 2O5ZL 3QNXA 4ZTOL 3VWKB 1G7QB 4AYFA 4HWZA 4MVBC 2IALB 4AEHL 3OGCA 1T2QH 2VQ1A 2Q3ZA 3FAXA 2YD3A 2LU4A 5C0BB 5EU6E 3RGHA 3OKNB 1LK3H 2DQGL 4JGJA 4L3EE 2B20A 3NFSL 3QWRA 4LFHG 2ZCKH 3GSOA 3BN9D 1T2XA 1SJHA 1AR2A 4Y5YA 1UXSB 2FBJL 1LDPH 3O2WL 4PJ5A 4XAWL 4BSJA 15C8H 3UDWC 3C6SA 2BHZA 4C83A 1QBLL 4LCIH 5FK9B 1MHCB 4QCIA 4W4OC 3ARQA 3RIAF 3S88L 3KPOA 3B2UC 5E1AA 3BGFB 4O2FA 5IEHB 1MCOH 2Q8AH 5E9DE 2WW8A 5D2NA 1OAUH 5D5MA 3FQXA 4XBPB 2QEJA 2ARJQ 1E4KA 1OF2A 4LEOB 3ULVD 4Z0XA 3OXRA 5EOCL 3O4OB 2VB5A 2XACC 4HS8L 1FFOB 4EUPH 1A9BB 2V6HA 2UZIL 5SWQA 3DSNA 5CIPH 1M1SA 2NZIA 4HFUH 5HPOA 3CFJB 5KANG 4RCAA 3VXQB 5EULV 4HF5H 1QSFA 5KS9B 4J23A 4PY7B 3VFGL 4ZSOE 3C09C 1TNMA 3MRRA 1R5IB 1SYVA 4KPHH 4U6VL 3S36X 1INEL 4MAYB 4PJAE 2D7TL 4XXCC 1LEKA 2FEEL 2V5SA 2XZQH 2Y4SA 2HKHH 3D3VA 1A47A 2H3NB 4RX4D 4X6BB 4K94H 2N1KA 3RIAK 4MD5B 3M45A 4P57B 4OF8A 2ZSWA 1OWWA 5F97E 3CH1B 3WLWD 5D7IB 4HUUA 1L0XA 2GAZB 2NY4B 1FAIL 4PD4K 5J11C 4I4WB 5E7BA 2HRLA 1FFRA 4Z7QE 1PX3A 3C87A 1TDQA 1R5WA 3MYJA 2P8PA 4OAWA 3GNML 5BO1L 4K7FA 1KPVB 2YKLH 3ARRA 3QYCA 5E24E 1KCVL 3OHXB 4FTVB 3QHZL 4L8CA 3VI3F 2Y5EA 3L9RB 1YMMA 4BYHA 4OI7A 2HTKD 3STBA 1X5GA 3BZEB 3MV7E 4YFEA 2N56A 2D7PA 1YEIH 3C5JB 3TBVA 1KUMA 3IJYB 3K80A 4K71B 1J1OH 1QA9A 4L5FL 3BWUC 3LS4H 3N50A 4PJGE 1XIWA 4JFOA 4WWKA 5T1LB 3TESA 3DHJA 1LP9B 2JKXA 5KG9A 1RZJC 3O41B 4G8EB 4G9DA 4AT6B 5I2IA 3U4EB 3G9VA 3IFPA 1MVUA 5ADOH 4WW1B 4GMTH 3QPQC 3VGHA 2NNAB 4GBXC 4RMVA 1RHHA 5C71A 3GO1L 3I2CH 4U0RB 2VLKE 3LEXA 1WC7A 3G5ZA 3WFDH 4KQ4H 1UM6H 3HAEB 2NW3A 5F9WB 2VE6B 1UJ3C 1PGRB 3QFDB 4JFEE 5TH2A 4WFED 2WK2A 2NXZC 2AK4B 3UX9B 4UAOC 1BFVL 3T4AA 2IANA 1EHLH 3QBTB 4S2SA 4XP1H 4HUVA 1OOAA 3PL6D 4ODXB 3AU1B 1W0YT 3VXSA 3JTTB 3FONB 2PXYA 3BESR 2YPVL 3HZVB 5ISZD 4O02H 3CC5A 1QNZH 3AB0C 2IQAB 5EFIA 1IEHA 4GG8A 2I24N 4R2GC 3FCTA 1TQBB 1RJCA 4QRSA 4NWUL 2HTLD 4C56A 3GMPA 1E4WL 4HGWB 1UJ3A 3THML 5IWLA 4ONGL 5SWSD 4Y1AD 3DV6A 1RZFL 4U1LB 1T7VA 4G80B 2QSCL 2HJFA 2X4QA 3MRCB 4JHAH 2A6JB 4JREC 2KQNA 1IAOB 4PIRF 4RFOL 3R8QA 3TYGH 1HSBB 4NQVA 4UUJB 3SDCC 4EXPX 1U8LA 4NKIL 3LN9A 1MY5A 5EBGA 3FMGL 5CILH 4BFIA 2J8UF 1ZHLB 2BVPA 1D9KC 5F71A 4U2ZA 5T1MA 4PRID 4YK4B 1AQDB 3L3GA 2DJUA 3JV6B 1EJOL 2VJXA 5AYQA 1CDYA 3AS2A 2YD2A 3CFIC 4U1IB 1GRWA 2HWZH 2R4SH 5DK2A 1N4XH 4LPWA 3JTSA 5HHQA 4PJ8D 3QXAB 4J3TA 3LZFL 2B1AH 3BQUC 3VI3E 5JZ7C 2OI9B 3T0EE 3L5XH 3VFTB 2M26A 4KJPD 1FIGL 5D2LB 2VWEE 1G9NL 2C9AA 5BXFA 4EKXA 4UT7H 2DM3A 4WIQA 3WNOA 4CVXA 2X05A 1XGPB 3VFVA 2VLRA 2R69H 1WEJL 2P24A 4N0YL 4F37F 4QHUA 5CINH 5F1NB 1JPST 1R3HB 1OLZA 4FQCL 3UYRH 5H2BB 1KT2B 5KBNC 1HZHL 3EZ8A 4OT1H 5J4MA 3TBWA 4JRXE 2DBJA 5I1LA 3DMMC 4ODVH 5IW6A 4P2QB 3QJHA 1MRDL 3LKQA 2CDFB 5TE6L 2VZSA 2EKSB 2NZ9D 3DRTB 3O2DL 1U8QB 2IPTL 4NQXA 3DI3B 2ZZUT 5EG6C 4JDZB 1QLRB 3BE1H 5F3HB 2JB6A 1R3KA 4WV1C 4IOIA 4OLZH 3BP6A 3WUWB 3P77A 4HIHA 5CJOL 3QUYC 4BH7B 1AGBA 2BRRL 1S9KC 4P2OB 1UACL 3GSWB 4WU7B 4QRQA 2ICWI 3NCFB 4JPIB 4NNPL 4CADA 4LLWA 5DD1H 3MUY1 4KI5C 5EUOB 2FEEI 2Y07L 2B1HL 1JI1A 3S3JA 2AJ3A 2VISA 3QFJD 2A1WL 4PRHD 5HYSG 4GXVL 4NKMA 1MNUH 4F37K 3UZVB 4HDIA 1T5WB 4QXUL 5EC1B 1C16A 3I6KA 1NCNA 1FZOA 2ADGA 3ORJA 1S7UA 3SDXA 5K9JH 1NKRA 5IHUL 3DYMA 3MLUH 3HMWH 3TBTB 4YPJA 4YHLL 1S8DB 1KXTB 1G6RH 1TCRB 1AFVH 4MWFA 4G9FB 2P43B 1XF5B 5HYJB 2UWEB 4XH2A 1V3MA 1R3JA 4PS4L 3QR2A 1D5XA 4P9MH 1EO8H 1S7RB 2RQ8A 2HFGL 4NO2B 3MV9E 3CXDL 4PR5B 1XCQB 1JRHH 4XGZA 1CLCA 1JHTA 1D5IH 2RAMA 3BAEL 2C3WA 1LO0H 3UCRA 2CR3A 2J8UE 4GSDL 3PL6A 5BS0A 4OCMC 1ZANH 3OKKB 1BFTA 5MERA 4XCYA 1SVCP 3IDMA 3BZFB 4TSAH 5I16B 4MA7H 5ISZA 1LE5B 1A6VL 3SDAD 2LTQC 5JIPA 4R0LC 3G04A 4Q9RH 3FOLA 1IGML 3TZVD 3DRQA 4FQXD 3V52H 2EDHA 4M43H 2NYYC 1OM3L 2R56H 4G6JH 3DIFB 3CCHB 1U3HC 2DF3A 4TPRL 3W2DL 4OBRA 2WIIB 4Y1AA 5DD3H 5A16A 2CO7B 4L1HA 4M6AA 2D31B 4MJ2A 1G7HB 4U1KB 3JWNC 1B0RB 3MV01 4M6MH 5FOJA 4QHLB 4QNPF 2ICEA 3L1OH 1J0ZA 3C8DA 3F58H 1EUTA 4RWHA 4MNHB 4DVBB 4NRXB 1CT8B 1X5ZA 1QYGH 2YR3A 4QRPD 5TFSH 3OQ3B 1NGYA 5C0RH 2DIAA 4LCWB 4EJ1C 3KPQA 5C0JB 3UTZB 3MYZA 3IAPA 4I1NB 2ED8A 1M7IA 4M9PA 2YRZA 3M17B 4D9RD 3X13B 3OKOA 2EDOA 1JFQL 4PRIA 3QRGL 3WL9B 5F7EL 3TH2T 2CRZA 1FAKT 3T8XB 5IVOA 3RWGB 2GW5A 3V0AC 4PJ8A 3KYOB 4WY7H 5HPMB 1OW0A 2C3VB 4ODHL 5L8LB 4ZUWB 4YO0B 2BCKA 4W6WB 4L4VB 1WZ1H 2VTFA 1CU4H 4U33A 1OAKH 4QRUB 4MGXA 4UOW1 1FGVL 4XNXH 1GGTA 2XN9E 3IJHA 1Q72L 1FFNA 1NCUA 4R26L 3HB3D 2UUDK 1CF8L 3BKJL 1N26A 3AMKA 2F54B 1R5VB 4OD1L 1HHKB 3HZKA 4LQFH 1LEIB 5F8RC 1MCFA 4NM8H 4J4PD 3D85B 3VXME 2DIBA 4S10A 4PJHF 5I73B 1YEKL 1JWMB 4H0HB 4GKSB 4KROC 1H0DB 5B38B 1YEHH 2HYMA 4UB0L 1I9EA 2H32H 4M3JA 2VXQH 2DLFL 1U8PA 4JQIL 5E2JA 1S5HA 3EYVB 3O3DA 4M4RA 4QYOA 1KN4H 1FJ1B 2HRPH 1KJ2B 4K3EH 3I6LE 3D2UB 2AXHA 4D9LH 5E99H 3OR7A 2I60H 2CLVB 3EYQD 4PGEB 4DQOH 2X4NB 4JY4A 3NIDF 3IAGC 4PGDB 4LVHB 1ZT1A 4ZPTA 3FHQA 5DS8A 5J13B 1R24A 2FJFA 4GRMA 4Z7UA 3L7EA 3MCLL 1U92B 4HWUA 5F3BB 1B4JL 3JWOL 1J0IA 4DN3L 1MFAH 4DN4H 3QFJA 4PRHA 1C5CL 5D6DA 5FCUL 4WTZG 2ZCLH 3GMNB 4K9EH 5DWUH 4LCCB 3NH7H 1W72L 2JB5H 2XY1A 4LKCA 3ARFB 2GJ6D 4ELMA 3C08L 1L6ZA 5JLZB 2QQLH 4MNGE 4U3XA 2J5LC 1HHHB 4KFZC 4JB9H 3C60C 4OCWH 5CLTA 3RA7H 3ZYZA 2Z8RA 1KPRB 1VFMA 5I1KL 2I25N 1PBYA 2PO6C 4JM4L 3H0TB 3D0LA 5HDBF 4WCYL 5CUSL 5DHVB 1WFNA 3QEUB 1MI5B 4U2YA 3RL2B 4N0RA 3DVFA 4ZYKA 4BKLA 4A6YB 1U91B 3IDIB 4FP8L 4HS6B 3ES6A 4JLRA 2ADFL 4PJXB 3RNQB 4WFHD 3VXPA 3SDAA 5GXBB 2VXSH 1RURH 3PGDA 3QDMB 2BOBA 5LXGH 4K3GA 1QACA 4OFVA 4NZRL 3TZVA 1CDUA 1RFDH 4XVJL 4FQXA 5I8EB 1XGTA 1KENH 4KVNL 5L88H 3ARGC 4MZ2A 3TA3D 1ZHNB 4X6CB 2QHRH 5FA4A 4RMQA 3SJVE 3MV8B 1P4LA 2AS5M 1NC4D 3R0MA 2F19H 3KPNB 4QXTB 4FFZL 1Z0NA 4KKCC 4YHYB 1I8LC 2CDEB 3ZL4H 5IVNA 1WZMA 4QRPA 1IQDB 3VFWB 1M71B 4BSWA 4HJ0D 3KPRD 1V8HA 4QXGH 3PABB 2PTVA 1X9QA 3BGAA 1SYSA 1G84A 4HGMA 1GGBL 2YN5A 3PWPD 5HGDB 1HK6A 5JOFB 4P3CH 1BZ7A 3QH3A 1GHFH 1WBXA 2GCYA 2QSQA 4FG6D 5F7KC 3O3BA 3KXFE 4IOFC 3RWIB 3VWJC 4NZUL 2E27H 4AG4L 1EBPA 1UFUA 4O2EA 4RGOL 2NTSP 4YIQB 3MODL 2BMKB 2SEBA 3L3HB 2VZVA 3WBDA 1JIBA 3DVGA 5E08H 3EJJX 3ARPA 3HZMB 4PLJC 3NIDE 1YN7A 3BVNB 1NMAL 3L6FA 5I17A 4N1HB 2J1KA 4HXAL 1QRNB 1VB9A 1J5OH 2BNRD 3NABL 4XWGH 4Y2DC 3SE4A 4JZOB 5L0QC 1J1XL 1F42A 4XVTH 4F15C 1IFHL 3X11A 1HXYB 2X1PA 4J4PA 3VW3H 2BVOA 4NYLA 3G6AA 3VFSA 5D7LE 2VLMD 3LKRB 1IJ9A 4UQ2A 4FQJH 1BEYH 3D25A 5E5MB 3CU7A 2XWTB 4BH8A 1A2YB 4I18B 4PV8A 5IUSA 1QFWI 2JCCE 4F2MB 2YA2A 4PRNA 3B4NA 2MPAL 3LH2L 1KACB 3D48R 5EBWB 5JDJA 3GSUA 4BJLA 3O4LE 5F6IB 3QUMB 5H35B 1CK0H 4FQQA 3LQAC 3CFDA 1U8HB 1YA5A 1IGJB 3MSPA 2W9EH 4RMUA 3NMEA 3V6FB 5IMMA 3BRFA 3UBX