4BM7A

Crystal structure of igg fc f241a mutant with native glycosylation
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
207
structure length
207
Chain Sequence
GPSVALFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IG GAMMA-1 CHAIN C REGION
publication title Engineering Hydrophobic Protein-Carbohydrate Interactions to Fine-Tune Monoclonal Antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bm7A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bm7A01
4TULH 3VFPA 5DJ6A 3WIHH 1AI1H 4O02H 1LEKB 1BEYH 2ZUSA 3QUXB 1LO3H 2AJUH 1FNAA 4FMFA 1Q0YH 1CGSL 4CGTA 1JUFA 3LH2L 4KZEL 2NY7H 3GUTB 4TUJB 3AS1A 1DUZA 5ENWB 2P8PA 4G9FD 3EDKA 4QHLA 1FFPA 3CMOL 4PJBF 2DQHL 1ZHKB 5TE6H 4N5UA 2OR8A 4X6FA 1H5BA 1P5VA 4JN2A 5D7LD 5B3JF 3HB3D 5IR1A 4U1KA 1QP1A 3S9DB 1ZHLA 1M71A 5EBLB 1JPGA 4RMUA 5K9JH 1SJEB 4QO1A 2D7MA 4M5ZH 2NZIA 3OTTA 4M6OH 1JWMB 3VG9B 2OZ4L 5JXEA 3JTSB 2A0LC 2DWDB 3JWDH 3S36L 1KYOJ 3B9VA 2N1KA 1J05B 3T09A 4AENA 1ZA3A 2BY0A 5JDJA 4U6HA 2OI9C 1SVCP 4UUJA 1MCPL 1UA6L 3S35X 3BKMH 3EJYC 3TWCH 3BUYB 3H9HB 3SE4C 5IKCA 1YEHL 1MWAH 43CAA 4NBZB 4WTXA 2PXYA 1IKNA 4K9EL 1J1OL 3GSVB 3HRZB 5GJTH 2R1WA 3MXVH 3IDXL 4WEMB 1U6AH 4KV5F 1OP5H 4OZIE 4FNLH 4JFED 1SYSB 1S7XB 5JOEA 3O3DB 5DK2A 1FQ9C 3SCMD 5D4QA 4GW1B 5JIIA 5IP4A 3SGDI 4ZNCD 3EYSH 1Z6JT 4RMWA 1WZLA 4ODUA 3SJVB 4F57H 1MCHA 1FYTA 3FRPG 1V7MH 1M7DA 2HJLA 2NZ9C 2NY5C 2V6HA 5JTWA 1CXLA 5GSVB 5F93C 5IESL 4WHYH 1BVZA 4UT6L 5F97E 5IJKA 2W1NA 2CIKB 5EO9B 3RNKA 4JFPB 5KW9H 2X70A 1MLBA 5EZIH 3SDAD 5BOPA 1JGVL 5IWLA 2XG4A 1I3RA 3V0WH 3BT2L 1MFCL 4Y4FC 2F5BL 3DV6B 1E4WL 1K9TA 1UYWL 3U0WL 4HZLA 4UOJA 3SDCB 1SJXA 4MSWB 5GXBB 2D2OA 5EUOE 2XG5A 4OCNC 1QVOB 5DVNA 2RCSH 4Y5YA 5J56B 1P4BL 5FO7A 5C08A 1JNNL 1CCZA 5DGQA 3ZL4L 4EKXA 3PWLA 3NH7H 4GG8B 5MEPB 5CP7A 1SEBA 4DN4H 3HE7A 5JXEC 3F65A 4QEGA 2VDQL 4HD9A 4PY7A 5FGCE 3BPOC 2UYLB 1BOGB 3G5VA 2EIDA 4Y2OA 3ZYIA 2MHAA 1T5WB 2GK0B 5FUOH 5F71A 4HJGB 2Z93A 3CSYA 1QUNA 4G8GA 4ONFH 4CN1A 1DQMH 4DW2H 2WANA 3MLYL 2PXYC 3ROOA 4IHOA 4OGZA 4XHJD 4OLWH 4U2ZA 5L7XH 3ULUF 1AXTH 1R3JA 2FEEL 3ES6A 1TCRA 3WS6C 3MLTB 3WDHA 2HLFC 4PB0L 4F7MA 3OKLB 2OX5A 1A0QH 3HZYA 4YDJB 1G7PA 2AJ3B 4M4RA 2EXYD 3MJ8B 3TH3T 1RJYA 3PE9A 3GMMA 3MYJA 4JZJC 2P7TB 2P8LB 1JN6A 1Z0MA 1LE5B 4U6XA 4A6YB 1MREH 2CGRH 1U3HB 2X4UB 5MI0B 1VESA 1GZQA 1GIGL 3OKNA 1XIWB 5F6IC 3VFGH 1EHNA 1R3KB 8FABA 4JFYB 5BMFL 3P4MA 3QEHB 3BH8B 5GGRB 4XX1G 3T4AB 3W2DH 4GRWE 4NDMA 2J7LA 4IRJB 4WTZG 5CEZD 3MOBL 5FA4A 4L9DA 2GEEA 3IRZA 1WJ3A 3QEQD 4LVEA 5EPMA 5F3BB 3GZKA 2J8UF 4YBLC 4Y5YC 5HHPB 4FQXB 1BFOA 4LU5L 5BW7A 2H9GB 3BGMA 1HH6A 1ZXQA 2Z9TA 4HJ0D 2W38A 1RUQL 3HE7C 3PABA 1INDH 1FGVL 5FUZH 4IMLA 4NQVA 3VCLA 1CLCA 2FJHB 4FHBD 1BECA 1WQVT 4FXLA 4XNZC 3JV5A 3U7WH 3DETD 1A6VH 1F2XK 3DECA 5E5UB 5DFVD 3TCXA 3V95A 2JB5L 1ZHBB 5E99L 5I1EH 2AEQL 4IBLT 3RA7L 1IZJA 1P4LB 1UVQB 4YO0A 3Q6GH 4M48H 5D1XB 5MEOA 2BNUB 4HLZH 4D9RD 5C7XH 2BC4B 4H8WL 4JKPH 4JR9H 2H26B 1XGTB 2CDEB 3H3PL 3OHXA 5F1SA 4R0LB 3HUJB 1HHKA 1CFNB 4HJJH 4M03A 5EU5A 4M1CD 5FOJA 1U3YA 2AK4D 4HIIA 3QXUA 4MJID 5DA0B 5IW1A 1J0JA 4DQOH 4JFOA 3FN9A 4HC1A 4OGXL 3K81A 4Z7VA 2R1XA 2K9UA 2NY6D 3MXWH 5C0BA 3MJ7B 2LABA 4Y7MA 3VXME 3TBYB 4W70A 3GFUA 2PYFA 4M61B 2EEDA 3PGDB 1HI6B 1RUPL 3C5JA 1CG9B 3RX7A 4YR6A 2J8UA 4EI5C 3IDYC 4UTAH 4KAQH 2FEEI 5MERB 4QGTA 4U1GB 1MCBA 3DVFA 4S1SH 1BVLA 5C86A 4AK1A 4F9PA 4XVJH 1RFDL 4MA3A 2D31B 2A6IA 4FQLH 4IRZH 3NZHH 2R0ZH 4IOSD 5CZVL 5DLML 4PJ8D 4X6BB 4YHZL 4WDIB 3W81A 3NCJH 4KHXL 4Q2ZB 3C2AH 4HLJA 4KJPD 1IMHC 1KPRB 4Y5XA 3WD5H 4YXLL 1UM5L 4KI5D 1YN7B 2VLME 5LG1A 4HUUA 4KVCH 1KB9K 1DLFL 1AY1H 5I30H 1TPXB 5I75C 1MCNA 3C2SA 1T1ZA 3IGAA 3KS0J 2A77H 2D9CA 2NY1C 4HQQH 2QQNH 5D8JL 3QZWA 1IILE 3H7BB 1U8PB 5D7IE 4LDLB 4AMKL 2VB5A 5IOPA 1NEUA 3VFVA 2H2SD 5DMKB 1B0RA 5DSCB 1HSAA 1YZZA 3T4YA 3I6KA 2VDOL 5IBLC 1MFDL 4UZGA 4ZDHB 3ZTNL 4KMTH 4G8EB 1MUJA 1A6PA 3PGFL 1SJHA 2BVEA 1FVCA 4RGND 3G9AB 4UU9B 4LSSH 4XPAH 1BPVA 4APQD 5DEFA 4J6RH 1QACA 4M1GH 5J8OA 4L4VB 4O2FB 3LN4B 1V3JA 5D6DA 3NABL 3KYNB 4I9WD 3MRNA 3ZHDA 4QHMA 4YZFE 2MOVA 5E95B 3RBSA 1U8OA 4Y8DC 2ID5A 5IF0A 3HNVH 4P2OB 1QLEH 1CLYL 1BZ7A 3H7LA 4PRBA 3QDMB 5E56A 2J88H 2C3VB 2R23B 5L88L 5FYKH 3QG6B 1F3JA 3S4SA 3BIKA 3NCMA 3EOTH 1NCWH 3TF7C 3UTTE 1KOAA 1BIHA 2VC2L 3SE9H 2OXHA 5TQ0L 3VD9A 1I3VA 1A7NH 4F9PC 3PHOA 2DKUA 5E03A 4E41E 5AWNH 4LCYB 5CKGA 5DD3H 1NMAL 5KS9A 4GAJH 2IFFH 2WLYA 2P5WE 1DBMH 3W0WB 4FTVB 5H35A 3SE8L 1FG2B 1CE6B 2HJKB 3FCTA 3L7EB 1DBJH 4QXWA 3DTXB 2AJYH 2ZG1A 4WUUE 3FZUD 4NZDA 4X5WB 1XF5A 4WY7L 3KYKH 2YWZA 1OGAD 4Y5XC 4TOYL 5C0IB 3GBLA 4O4YL 3T0EB 4JO2H 4CADB 4UQ2B 3Q3GB 2RJMA 4P5TB 5FYLH 4MA1B 4AH2B 3MA9H 4QHNB 2BVQA 2EH7H 1WBYB 2ICWI 2JLLA 1IZKA 3BEVA 3W9DA 1U93B 2CRIA 1ULVA 1Z3GL 4YIQB 3GB7A 4KQ4L 1FFNA 3DWTA 5E7BA 2J2ZA 4P57A 4TSAH 3MRGA 2E9IA 2R4RH 1HWGB 2OTWA 1N64L 3MNZA 5DTFB 2IALA 3VI3E 5I75B 2CLVB 4X9IA 1RVFL 4Y5VA 3U9PH 1KIRA 3P11L 3A67L 2CRZA 1SBSL 3QUZC 3UZQA 1VGKB 4U6YA 1PDKA 4F8TA 1TCMA 4I4WB 4MCZA 2GYSA 4FABL 2K7PA 3SBWC 3SGKA 1NFDE 1FFRA 3MA7A 1VADA 4JPWL 1PSKH 2GJJA 3HMWH 3UJIL 3LEYL 4D0DB 4DUVA 1NAMA 2XNAB 3LEVL 3NFPA 5D1ZA 4XCNB 5KVFH 5D2NA 5FXCH 4Y2DB 1CU4H 2A9ML 1A2YB 4Z7UF 4QOKD 1QSEE 1XCTB 3ARBC 1C5BH 3IYLW 3QHFL 3SKJH 4F7PB 4FQIH 3DHMA 3RUGA 2R8SL 5E4IA 3WXWH 1MVUA 3BGAA 4DUWA 4W6YB 3U83A 5MP6H 2VH5L 2MNUA 4RGMC 4Z7QE 4JPKL 3NBNA 4JAMB 1QEWA 1IAKB 1O5DT 4GMSH 2P5EE 1RHHA 4OIIL 4P9HL 1ZTXL 3QDGA 5C0RH 4L8SC 2WSKA 3QUKA 3QUYB 1A8JH 2YD8A 4Q9QL 1RZGB 2YBRB 3O11A 1CD1A 5MENA 2FGWL 4HUWA 1I3GL 2ENSA 4DGIH 3T1FB 1VA9A 4NUJB 4YAQA 3WO3B 1KBGH 4P3DA 4KJQC 2FZ3A 1A7PH 4PREB 1SHMA 2Y5TA 3UJTL 3O0RH 1JHKL 4WFHD 1DQQA 2V9RA 2DMCA 4OZGE 3IDNA 2H1PH 1RZJH 4N0RA 2Q1EA 1TQCC 4NKIL 1YMMA 1MHEA 4PTUB 5BXFA 3MGOB 5L9DL 3ZYZA 5MHSD 3THML 4R7DB 4QRPA 1C1EH 5HHVL 5D71L 4M1DL 5HDBE 4H1LB 4Q0XL 1DP0A 2AKRB 3DVGB 3O4LD 1KLUA 1UENA 5EUOB 1OGTA 1CI5A 4I0CC 3X3GL 3F5WB 4IDJL 4M9OA 4Z7UA 32C2A 3TLRA 1K6QL 3D2UA 5DEGB 1F58L 1TTUA 4IJ3C 2IGFL 4OLZH 5E7FA 4ZOEA 1JYXA 1F8TH 2ITCA 3OR7A 1J5OL 3WEXA 1ZS8A 4HCRL 5F7FA 3SGKC 1J0YA 3ARUA 5FGCB 1T0MB 1UG9A 2AEPH 1QSFD 1H0DB 2DQGH 3NPSC 5D1ZC 4L29A 3GSQA 1ZGLM 2YA2A 5D2NC 1KCRL 3FOMA 1YJDL 1WLHA 2R69L 5DRWA 1XGQB 3UTOA 3BKYH 3B2VL 4FXKB 1A6ZA 5MEQB 3WHE1 1AGBB 4QF1A 5CIPA 3ZT6A 1CZ8H 4XNUL 4N0UA 1LDPH 5E2VH 1VGEH 1G7HA 4LEOB 5DRZA 2G9HB 2MQ0A 3O3AA 4H0GA 4F58H 1T7VA 5JPNA 4PV9B 3K1KC 3PF2A 4HWZA 4NP4H 3C60B 3DBXA 1SMAA 1T22A 5BS0A 3VH8A 4G6JL 3B2UD 5K9KB 4XZUA 5DD1L 1FFOB 1JPSH 1FIGH 1RZ8B 2WBJA 4WO4C 5K93A 1MI5B 4Q97A 2WINB 5A16A 3LQZA 3FAWA 2QEJA 1SM3H 1LK2A 1NDGB 5EC1A 2J4WH 4OM0L 4AT6A 1SY6L 4OGYH 1YY9C 4NQSA 4RAUA 4YUEH 1F4AA 5GJSH 1I1FA 5CJQL 2VABA 4OTXL 4P59H 3VFNB 1JNLL 1L7IL 1EO8H 5TPWH 3I3DA 4S0SD 5LVEA 4N8VG 4QYOB 5EIIA 4P23A 1CFTB 2FYYA 5CD5D 3R0MA 2EIZB 2DBLH 4NQED 3VRLF 4GRWB 4ISVB 1HH9A 1VFAA 3CDGA 2JJTC 7CGTA 3HE6D 5CEYB 3MLPA 1NC4D 1VDGA 2J6EA 4JDTH 4R26L 4B7IA 3FB6A 3C5ZB 1T6VN 2PKDA 5FA3B 4LLVA 2DLEA 4UDUB 5C0NC 4FZ8H 3JSSA 1ZVSB 1PKQA 2M2DA 3BPCB 3EYUH 3OKDB 3NIGE 5IM7A 3ZDXF 5F89A 4JO1H 1EMTH 1WTLA 2VAAB 2IEPA 2VISB 3MV9D 3UMTA 5ACZB 3MLVH 1EO5A 3OKOA 1CT8A 4AL8L 5KTEL 2OR9L 2BDNH 4TUOB 2PTVA 1T03L 4WHTA 1RU9H 1M05A 4BFGA 5INCA 2Q76B 3C87A 1F4WH 5I8KL 1JWUB 3HI6L 4GW4A 4NQDB 5EBWA 4V1DD 1EFXD 3VJ6A 1YECH 3NOIA 4XCEB 1KPVB 1KIQB 4M6NH 2VN7A 5DJ8A 5I18H 3LB6D 4D94A 5L2KB 5A3ID 1KENH 2EYTB 4U1SA 4PRAB 3P9MA 5TQ2L 3TH4T 1AGFA 2V2WB 2A6KB 3RWGB 3ARED 2VKWA 2MPAL 3JXAA 3IETA 4N5ED 4GKNB 3QI9A 4TVPH 2BVUA 4F3FA 3QIBD 5FO8B 2Y07L 4LOUC 4TVSa 2P45B 3VXMB 3ROLA 3CFDA 1F6AA 5ISZD 3NA9H 2GJZA 3L3DA 3DRTA 2BVOA 1WT5A 4HXAL 1RK0A 2P44B 4PRPD 3QJHB 2B1HH 1T5XB 1BM3H 4JE4B 43C9A 5IG7A 3DLQR 1BQUA 4EUPG 1PX3A 1QRNE 3WJJC 3PV6B 4XCCL 5FYKE 2HT2C 3OJVC 1KXVC 4XRCB 3WO4C 1WEJL 5F7KC 3EYOB 3EOAB 3KLHD 4HC1H 5E8NB 4OLYH 4N0YL 4ORGB 4Y4HA 4F9LA 1OTUD 5BZDA 4O2EA 1N26A 5D6CA 1P2CA 5KVDH 1TVHB 1NEZB 1UKTA 4XMLL 3IAPA 1Q0XL 3C8KB 2HRLA 1T21A 3PDOA 4PGBB 2IAMD 2O61A 4AEFA 4BSVB 3F58H 3KXFB 4CW1A 3BMVA 4NNXB 3DX6B 4M02A 4HW6A 1D9KD 2VLKD 4X6DE 4KKAC 1OAYL 3I2CL 1J8HA 1WFUA 3KLDA 2ARWA 5DK0A 4WI5A 5C1MB 1U3ZA 5CUSL 2FB4L 5EO1B 2GCYA 5EOCH 3G04A 5D7JA 2B1AL 4M8QB 4ZTPL 3RTQD 4PJ9C 5I74B 1TJHL 3D25B 5BRZA 3RWDB 5AD0B 4MAYD 3QO1A 2Z31D 4NKQB 2UV3A 4HKBA 5K59F 2PYED 1CXFA 5F8RC 4KHTH 5E1HB 4EJ1C 4LSVL 2F54D 3LD8C 3QIUD 1K2DA 4KPHL 4ZUTB 3T8XB 4MNHB 5FCUH 1Q72H 3P0GB 2CSPA 3MRQB 1WZ1H 1A4JA 3L5XH 5I1HL 3O41B 1JRHL 4XAKD 1G7LB 3OAUH 3JV4B 4P2YA 3UTTB 2DQEH 4HS8L 4LCCC 5C0AD 4UDTA 4OLEA 3L1OH 4ETQA 3DARA 1I4FB 3F62A 1HEZB 4N8CL 4ZFOA 1EHAA 4OGAD 2APWA 3TNMB 3F7YB 1OSPH 3L3GA 4E41B 3MRBA 1ZHNB 2HFFB 3DPBA 3RU8L 3ARQA 2VDMH 4ZSOA 1OB1B 3PWJB 3WN5B 2Q86A 2P5WB 1S7VA 3QAZC 5IFAL 1X9QA 2HT3D 3X3FL 3RVVC 3HR5B 4HFWA 4I0PB 1U3JA 1IGTA 4K3DH 4HIHA 4WUUB 4Y4HC 5CJXA 4F9LC 4YDKH 2R2EA 4DVRL 4JDVA 2EDEA 2CK2A 4TSBH 1IGML 3EJZD 1HKLL 5GRJH 1IM3A 4M7JH 3RGVC 1GYAA 2LU7A 4JQIL 3SEPA 4WI6A 3WL9B 1RULL 1QLRB 4KTEL 1GOHA 4XH2A 5LGJA 5KAQG 1W0VA 4XNMA 5K33A 1VEPA 3E6HB 3OZ9H 4ZAKD 4XT1C 3SDDB 2C3HA 5C2BL 1YQ2A 5I1AB 1ORQA 1YNLH 5HVHB 1FVDB 2DDQH 1UGNA 3BFOA 3FO9B 3FL7A 4HK0B 4WI9A 3D39E 3S3JA 1H3UA 2JIXD 5KSAC 3QT2A 3FT3B 4HWNA 1P7QD 4NQCA 2QL1A 1AGEA 2AV7B 3RPIB 1NFIA 2APXA 4CMHB 1FDLL 2XZZA 2D03H 3C6LB 4LSDA 3BP5A 4BQ9A 3IDMA 5JZ7C 2ENYA 4HUNB 5DD0H 4LHUD 1FYTE 4WJ5A 5ACMA 2EDFA 5DJCA 1RZIA 1YEGH 1D5XA 2CDGB 3CGTA 3UEZA 4NCC1 5JOPD 1YEKL 4KGJA 1KT2B 2RGSA 2X4SA 2Z8WC 3HNSL 5KG9A 2R29H 4G9FA 1QSEB 3MBED 4MWFA 1CQKA 5GQBA 4B50A 2HTLD 3M45A 2N7AA 1H3PH 1UJ3C 4Y19D 4X8JB 1RUAH 4QRSA 2ZUTA 2P5EB 3HHRB 5DS8B 3ARXA 1JE6A 2OSLB 1LWRA 1PJ9A 4LBEB 2ARJQ 4LCCB 1BAFL 5HSFA 5IMMA 3U82B 1NGPL 5C08E 1U91A 3FQNA 3ULVH 2R0KH 4GQ9L 4GMTL 3LQMA 5E6YA 4O51A 3UJJH 1NAMH 3K1DA 4S10A 4OD1L 1JRHI 1IEBB 2NY2B 4OCWH 4PGCA 1XF3A 3MRJB 5C09A 3N85H 4HS3B 4Z7NE 1WCBB 2R4SL 3H9SE 1QBLH 3QUMB 1DQLL 1ZT7A 2GSIB 1OW0A 4OZGB 1MAJA 3L3JB 3IDJB 1AHWC 5D72L 4ZO7A 4YGVB 3IDUA 2XWBB 3IB4A 5CBAB 2W0LA 2YD4A 3RY6C 4DTGL 2X1XR 3CLFH 4PRHD 4S1RH 4RFNB 3AU1A 4WFFD 2QADC 4JFEA 1QNZH 4YEEA 3SCMA 1PG7W 5BV7H 5I1IH 4S1QL 1MQKH 2ATKB 4ZUSB 5HHNA 2NY3C 3PHQB 5E94A 5GGTL 4NZJA 1ND0A 4G43A 3X13A 3K46A 1KFAL 3FQUA 3HNTL 4NNYA 3AVEA 4PGDA 5D9SB 3SDAA 3IT8D 2D0FA 2RR3A 3T2OA 4K3GA 4M5YH 2DQTH 3IXTA 4X98B 4CVXA 3QJFB 1Y18B 1OSZA 3D0LB 5E8EA 4J8RA 1MEXH 3R06A 3BPLB 1X6LA 1NMCB 2ZNXA 3S96B 1KB9J 1ITCA 4XBEL 4JCLA 4WWKD 3FT2A 2Q6WB 3HB3C 2NY4B 2FL5A 3MLUH 3HCVA 5CZKA 2A83A 3CSPA 4JHWL 2CLZA 3QXDB 3LPWA 1BVKB 1KGCE 3P9LA 1I7ZA 2VQ1A 1L0XA 3P4OA 2VZSA 1KPUB 1PGRB 2VMFA 4UT7H 3QCTH 5EOTB 5GRXG 1N7ML 2LQRA 1TFHA 1PZUB 3IS0X 5CWSA 4NN6C 4DEPC 4YQXL 3PWNB 3ARRA 3BP7A 3HRPA 3JV6A 4EVNA 2EYSA 5K9QG 2DJ4A 4OV5B 5J13B 2C1OA 1AD0A 1WIUA 3MR9B 1BX2A 1VPOH 4JFHE 3UTSE 4L1DA 1CGSH 4B53A 1H9VA 2YRPA 1YNKL 2G60H 2EDXA 4DZ8B 1W72L 1OW0C 4WV1A 1YMHA 1QHPA 5CIPH 2AXFA 3B8YA 1B0GA 5KZCB 1A9EA 3C9NA 1JF1B 2XI9A 1XGPB 3TNNA 2FIKB 3ILPA 1UWEL 5KJRL 4EOWH 3QQ4A 2PR4L 3CFBA 5D2LF 1NGYB 2YK1L 3SCMC 4Q9CA 3EHBD 1U8IA 4MD0A 4P46D 5JXAH 5DZNA 1MH5B 5J89A 1WAAE 1W0WA 5D7SL 2VKXA 2KBGA 1JGLL 4OT1L 2HVKB 1WISA 1JJUA 4Z7VE 2JB6B 4NZTH 5C92A 5C0BE 5JHLL 2VDPH 5GGRY 3SDAC 1MCPH 4Y0GA 1PEWA 4BJLA 3WLBB 1DVFA 4TN9A 4YHIB 2X09A 2ESVB 1UWGL 1S5HA 5BVJB 3G5ZA 2LV4A 1NBVH 2J6EH 4DVBA 3UYPA 3IDXH 3OX8A 1FSKB 3QEQA 4NCC2 4ODTH 3SY0A 6CGTA 1HHJA 1OAUH 4UNUA 5KSBA 1GZPA 5EU6D 4MQ7B 4NC1E 4RMQA 4KTYA 3S37X 3VG0L 5E0QA 1HHIB 4MNQB 4KK9D 4XAWH 3GKWH 1NKRA 2QHRL 3R1GL 5JO5B 5F7DB 1IEAB 4XP4L 5KOVC 5I1KL 2OR7A 4ZPTB 1CR9H 1ZA6B 3AUVA 4HS6A 4UNTA 4HEPG 2ILLA 1PZ5A 2VJXA 1NGXB 3NMEA 3P0VL 1GC1L 4QTHB 2ZSVA 3KPPA 3GMPB 4KI5F 1T1XB 1X5LA 5CSZB 3FFCD 1QRNB 4XHJC 2DQFB 4FG6D 4J3SA 2PTTA 1A3LH 1QFWM 1UXWA 2EC9T 4NQXA 5JDSA 1CD8A 4NO3A 3CAFA 3KDMB 4D9QD 4UT9L 4YE4L 2W60A 4MJIA 3DRQB 4NOFA 4KDTA 4LLQA 3DSNA 2NXZC 4LHQB 3MRDB 2W07A 1YDPB 4O58L 2OP4H 1NSNL 3ME0A 3NAAL 4XI5D 2EXYC 2X4RA 2BNQE 4NRYA 1A6AB 1SMOA 5IBTH 1IAOB 1MAKA 2G2RB 1E4KC 5L2JB 2UWEB 3DGCR 4YK4C 5DVLA 4HUVB 1UH4A 5F7LB 1Y6MR 3QDAA 1YYML 1MJJB 3BHBA 5CSGA 3QNYB 2ADJA 3BE1H 2VNCA 5B8CB 3UPCA 1RJLB 4HKJA 5EA0L 1S7UB 3S5LB 1CFSB 1GOGA 2XTLA 3ALPA 4N8PA 3MLYH 3MUGB 1ZSDA 4OAWB 3VXNB 4P2QD 3W9EB 1C16B 2FD6H 1MLCA 3A6BH 4P99A 1RZKC 3CFKA 1KTKE 1KCUH 5F72S 4OCSL 1AP2B 1TQBC 3VMPA 1JHLH 3GI8L 3PJSB 2BMKB 4ERSH 4LP5A 5T3XH 3RDTD 2YUVA 3K2UL 5KS9E 1U8QB 1QBBA 2J5LC 1VHPA 1BHGA 4NO0B 5T33H 4Y1AA 4LVOC 3EDEA 4UIMB 2FRGP 2AJSL 3UPAA 1A1MB 1AJ7H 25C8L 3P40A 4U6VH 4XP9H 3LS5L 3ULSA 2D4DA 4HAFA 4RNRB 4WTZA 5DFVC 1P9MA 2D0GA 4XWOC 3MLZL 5DJ6B 4OBSA 7FABL 4XNQA 5GIRA 1MRDL 2B8OT 5FO9A 4NNPL 4JRXB 3H3BC 4QNPE 2BNRD 2IPUK 3KS0H 3AM8A 4RMSA 5DQDL 5HD8C 4WW2F 3UZEA 4MJ5A 1DUZB 3PDGA 5D5MF 2P8PB 3RY4A 4WHCA 4APQA 1I3UA 1Y6NR 4M1CC 4AIOA 5GGSA 2R1YA 3E3QC 4X6FB 1H5BB 1MCEA 4WW1B 4JN2B 3FO2A 5IR1B 4U1KB 1ZHLB 4DJMA 5IK3A 3FONA 3KLAA 2NY6C 2HP4A 5AZEH 3EYQD 1T2XA 4EIGB 3LKNA 3ULVE 4GS7B 1AFVH 2XZCL 1NGZB 2YA1A 1IAIM 4AENB 1ZA3B 2R39A 5D2NE 3N1QC 4U6HB 3U7AA 2IAND 4FA8A 5CHNB 3VGBA 3V5DB 4Z7WE 3HLAB 3TYFA 3D3VE 5ERWB 5IKCB 2ORBH 3ARYA 3RUGE 5FM5O 3IU4H 3BQUD 3H3PH 3KPOA 4JRWA 4LGSB 4HGKC 4PJ8C 4CVWA 1LE9A 4MVBC 5I0DA 3GSWB 3VWKD 3D39B 3CSGA 1ZLWK 4XPGH 5H8DA 2HH0L 3TYGH 4KJPC 3OJ2C 4I18A 3QDGE 3QR2A 1OGAA 5CJOL 2YPLB 4KI5C 5DK2B 2OK0H 3OF6D 4AYFA 4XC1H 4DUXA 1TVBA 1WUNT 3DXAD 1MF2H 2OL3B 5I1JH 5MENE 2YN3A 2EEBA 2QQLL 3EO1A 4Y88A 4LLYA 1FYTB 2CMRL 5JHDD 2WV3A 5E2TL 5ESVB 5IV2A 3RHWF 4OJFL 4DCQB 1N6QH 3U48A 4JFDD 1JMXA 1S7QA 5I15H 5I73B 1K8IA 2ZWLT 1MLBB 1TNMA 2H2SC 3IU3A 5GS1A 2GUOA 2NY0B 5FGSA 1JGUL 3BW9A 1YMME 3AM8C 1FLRH 3QXWA 1MJUH 4M8VA 5I16B 2DD8H 4QRPE 5EC2A 4Z95L 2IPUG 4PJHF 2AV1B 3GMOB 5DYOB 5CD3B 4HZLB 4APQC 4LEXL 4OIAA 3MRKB 5CINL 3STLB 5C08B 5FO7B 2AJVL 4OUUB 5CP7B 1SEBB 1E0OB 1GPOL 3EO9L 1AD9B 1ZT4A 4PY7B 2A2QT 1A7OL 2YHGA 1JZ4A 2KH2B 3H9SB 4QOKA 2XXMB 4JPIA 1L6ZA 3GK8L 2HFGL 1UC6A 5D8JH 5DJZB 3G5VB 3IJHA 3V6BR 1O0VA 3BWAA 5AAMA 1Z5LB 3WHXB 3LEXB 3ZDYF 1AXSA 3DO3A 2Z93B 2VDOH 1MFDH 3VE0A 3HFMH 5I6XB 2VLRD 4N0UE 1H3WM 2YEZB 1OP3K 5CSBA 4NYLA 3HC4L 5DMIH 3ZYJA 2X1QA 1I1AA 1U9KA 2BRRL 5FFLA 4LVHC 3B5TA 2H6PA 4PG2A 5BS0E 4MAUL 4JM4H 2F8XC 3QRGH 1INEH 4JY5L 3IFNL 4F7EA 4K3EL 4LK4A 1ZGLA 4HUMB 4LLUA 1J12A 3O6FC 4WW2C 4F7MB 2IMMA 5IQ7L 3IKKA 1IC4H 2BVYA 2ZCKH 3DMMD 1ZGLP 2Z35A 5L88H 4JN1L 3IKCB 3MYJB 2XQBH 2FWOB 4RIRA 5JW5A 5HYFA 5HJ3A 3C6SA 4MJ2A 1FZKA 4I2XA 2G75B 2WW8A 4CN6A 4FQJL 4P0DA 4CN4A 3RVWD 1GZQB 3OKNB 2IQAA 5IBUB 1M6OB 3O4LA 4HFUL 1QTYT 3P4MB 4NO5A 3JWOH 1QOKA 5DJ0A 5IB1A 4PUBH 2ZZUT 1AO7A 5M95B 3PNWB 4Z77A 1JK8B 4WI3A 1T7YA 2AP2A 3QEUB 1FYHB 3MROA 2IMNA 3B3IB 4BUHA 3GRWL 1I9JH 2FH6A 4JRYD 1PKQE 5E5MB 4TOYH 2DS4A 4O4YH 1BFOB 4JG0L 1ZLVH 1QSFA 3BGMB 1HH6B 4MS8D 2CUMA 3PIQA 3DNKA 5H37G 4DKFH 4K7PL 2Q7YB 1S9WA 5EG6C 4LRNL 4I3SL 1V7NH 3UTSB 3VCLB 5GS2D 3MV7E 3VW3L 5I1CH 2WNGA 2E9BA 3QWRD 1OCWL 4KROC 5JLZA 3T04D 2XKSA 1QKZL 4YO0B 1YUHA 1SBSH 1URLA 1J7VR 1GGIH 2D7TL 1R3LA 2XA8H 4YWGL 5DQ9A 1EGJL 3ECBB 5ILTH 3OHXB 3QUXD 1HHKB 3WS3B 3OB0K 5DUML 4JO4H 1GXEA 4PG2C 3O6KL 1G9NC 2M8XA 2ZOKB 4PJDA 1KG0B 4N0FB 4QHKI 4ZUWB 4HIIB 3CLEL 3LEYH 5IW1B 3M1BA 4JFOB 2Y6SC 4K23L 5J12C 4Z7VB 1T6WA 3VRLE 2EYRB 1UM6L 5C0BB 2NTSP 2VTFA 1MCLA 1QHOA 3ZE2F 3C5JB 1FJ1B 4FQCL 4NQEA 2ICCA 4YR6B 2YPVL 3QHTC 2NW2A 4NCDA 4ONOA 1LNUB 3N50A 4F7TB 1V5JA 1INQB 1NC4A 3TO4D 3ZDXE 4R90L 5K9OA 5DURB 1BVLB 4MQTB 4Y89A 3VU2A 5GRWA 4P4RA 5DJXA 3V0VB 1IGFH 2DQIL 3TPKA 3GNMH 4P2RB 1KEGL 4X6EB 3EZ8A 4PB9L 1VEMA 4JM2B 1ZV5A 4YHPA 2FJFA 2C7UA 1GHFL 3MV9A 4WEBL 4K7PY 4JFFA 4R4BB 5HI4D 2LTQC 3MBXH 1T7ZA 3Q6FB 3EBAA 4TULL 5CZXD 2PW2B 3WIHL 1MHCA 4HUUB 1S8DA 1AI1L 2UZYB 4O02L 1LO3L 2AJUL 2H32A 1T1ZB 3IGAB 3EZJB 4NKIH 5CEZH 4V1DA 3D69B 1Q0YL 2HLAA 2ZCHH 2HKHH 3QH3A 1YEFH 5E2UH 3EFDH 5FYJD 4WVRA 1KTDA 2NY7L 5TDOA 2JF1A 3AAZA 4Q0XH 1J8HE 5IOPB 1A9BB 1JNHA 3IFLH 5TE6L 3SJVD 3K4ZA 5FHAH 5A2JH 3B2UC 2IPKB 2X5PA 1QFHA 2YRLA 3VI4F 2ICEB 1SJHB 5JOFA 1FVCB 1RPQA 3DIFA 4TTDD 5K9JL 1XH3A 3QIBA 1O7SA 1QFOA 4ZPVA 4HH9A 1MCFA 1N5AA 2YD3A 4M5ZL 2BNQB 3F7RA 4M6OL 1T4KB 3I02A 1RQ5A 5ISZA 5BRZE 2RB8A 4UAOB 2VDKL 2NTFB 2XYCA 2DIBA 3JWDL 3MRNB 4QHMB 1WFOA 1DR9A 2V17H 4ZUVB 5HGHB 3SDCD 1I8IB 1MCRA 3QQ9D 3VXUA 2VL5B 3PL6C 2VERN 5CD5C 3BKML 2DLFH 2EE6A 4YBQD 3BIKB 4KUZH 4OZHF 3TZVB 1MWAL 3HE6C 4PJCA 4MXWL 1V05A 2C1PA 1FBIH 3GMNA 1ADQA 4JPVH 4JKMA 5GJTL 1PBYA 4NFCA 3V5HA 3MXVL 1U6AL 4IS6B 1BQHA 3REVA 2AABH 4FNLL 4AIXA 1FL6A 5KS9B 3P4NA 3MOQA 4NJ9H 1I75A 3QWQB 4NGHL 5H35B 5DWUL 4LP4A 1CE1L 2IAMA 4U1IA 1DCLA 3EYSL 1A1OB 3BRDA 1XF5B 3QDJD 4F57L 2A0LD 1V7ML 2RFXB 3UP1A 4GKZA 1NCTA 5AUMA 1V8HA 1I7UA 1CVSC 1JNLH 2XY1A 1BZ9A 1D9KA 5KW9L 4ZFFB 1WCQA 4PRIA 5EZIL 4ALAL 4JY4A 3B9KA 2BVQB 1JI1A 1EXUA 1BBDH 2D7NA 4PJIE 3RZCB 1MFEL 3GB7B 5A3IC 1FFNB 5DJ2A 3T65A 2OTWB 1LEGA 3MNZB 4EBQH 2IALB 3RTQA 4YLQT 3K0WA 2P4AB 4Y5VB 3AREC 4XMKH 4XNXH 1KIRB 2J8HA 2MQ3A 5T1DH 2RCSL 1NCDH 4U6YB 1AR2A 2PYEA 5SWSA 4JZNA 1G7IA 4NQCE 1CDJA 1KJVA 1U3HD 4MCZB 1R5VB 2OTUA 2VXQH 3QIBC 4NT6A 2PO6B 5EOQH 4DN4L 1OWWA 1XIWD 2F54A 3QIUA 4XHQA 1JHTB 4YC2B 3MA7B 2DI7A 3ZE1F 1Z0NA 4LLDA 1HHHA 5IB4A 2OR9H 1NJ9B 4IRJD 2RHEA 3MRCA 3VFMB 4OKVB 3NFPB 2ERJC 3QFJD 4BK5A 3VFTA 5C0AA 1BJ8A 1BBJB 2CKBB 5T5FH 3BVNA 3S88H 5I8KH 3B6SA 1T83C 5L8KB 1H3GA 3I84A 3FRUA 3MV01 4J12A 5FUOL 3SPVB 4Z7WB 4G9FE 3EFFB 3D3VB 4FQXD 4PJ5B 4ONFL 1DQML 1G6RA 5ITFB 4Y4FD 3RUGB 3DURB 4LAQH 1P7HL 2R0LH 3G6JF 1MVUB 2IJ0C 3HC0A 4M6MH 1BP3B 1FNFA 4ENED 3V6ZA 5ABDE 5L7XL 1QEWB 1JIBA 5C2UB 4EDWL 1RHHB 2GTZA 3SKOA 3LRGA 1II4E 3VGDA 3QDGB 4U1HA 3SDXF 3QUKB 3MO1B 5I1DB 3O11B 2EDRA 4NRXB 3SGJC 1FO0A 2IAMC 4HUWB 5MENB 5I2IB 4EUPA 5BV7B 4LGPB 2DLIA 1VFMA 3MLRH 1H3TA 4WI4A 3CFEA 4YAQB 2C26A 2EC9U 3TV3H 5C09E 4P3DB 4YFEA 2FZ3B 3GSUB 4G80B 4K9EC 2X2YA 5ACLA 2CGRL 1D9KC 1DQQB 4ZAKA 3UDWC 4E42A 4F37F 1FN4A 4K55A 1K5NA 1Q9LA 3VFGL 1YMMB 2Z92B 1S3KH 1S9XB 1HOCA 4QRPB 2JIXA 4AG4H 2BX5A 4PYHA 1GGUA 4KJYB 1AQKH 1XCQA 1P7QA 2VLJD 1F11A 4BH8A 1NMBH 1OGTB 1ES0A 4MAYC 2Z31C 2BVTA 4PTTB 2EDJA 1LO4H 3LCYA 2WAHA 4LHUA 3X17A 4EXKA 5IMLA 2ITCB 3MMEA 3QIUC 1ZS8B 3WEXB 1LMKA 2ZOLB 1ORSA 1YY8A 4UINH 3OKEA 5FUZL 4XMPL 1DQTA 2VXTH 4H26B 5IVXF 3TBSB 3MBEA 3U7WL 1A6VL 4L29B 1FNHA 3MRRA 2R56H 3T0DA 2ZUUA 5I1EL 4PJFE 4TPRH 4Y19A 1S5IH 4OGAC 4PJXA 5KAQF 2JJWA 4UV4H 3Q6GL 4M48L 2W92A 1F45A 15C8H 4QF1B 5FF6A 3MCG1 1P7KA 3D9AH 4YX2H 5C7XL 2MJWA 1G7HB 4JKPL 5DRZB 5EO0A 4JR9L 2ADIB 4R96A 5IMKA 5JPNB 2HT3C 4HWZB 3DBXB 5KVEH 3QIWC 4OLVH 1X5IA 1T22B 4X7CC 4XGZB 5ALCH 5BS0B 1PG7H 1T2JA 3G9VA 4PR5B 4XZUB 1DEDA 5C70A 1T1WA 2WBJB 3HAEA 5A16B 2W9DH 3EJZC 3LQZB 4WU5B 1DBAH 2X10A 4WU7A 1LK2B 3MXWL 4M7ZB 5ID0A 5EC1B 2ZJSH 5E4EC 1UXSA 4GFTB 4JREC 1OY3B 2H8PB 4X4XA 1KIPA 1DLHB 1I1FB 2VABB 4PRHA 2DMBA 4ZAKC 5TJWK 4UTAL 5HHMD 5KOMC 4S1SL 5IVOA 2OTPA 4L4VD 4P23B 2FYYB 4G8IB 4XVJL 2NPLX 5HHOA 1HH9B 3DX7A 1FZMA 1VFAB 3MLWH 4FQLL 3MV11 1CDIA 4IRZL 2C4FT 3NZHL 1J11A 1G9NH 3VXSE 2R0ZL 3FO1A 1PEZA 3UAJD 5AYUH 1C7SA 3AMLA 3FB6B 4P2OD 4PJ7B 3JTTA 3U30C 3L3OB 3NCJL 3QDMD 2COQA 1PKQB 3C2AL 3O45A 2RQ8A 1EEUA 1NANH 2MKLC 2NR6D 2EDHA 5C0CB 3WD5L 3FFDA 4LNRA 4OI8A 2GTWA 4GO6B 4KVCL 2WP3O 3RWFA 2DIAA 1AY1L 5I30L 4HIJA 3MPCA 4JQIH 1NDMA 3MV7B 4KXZH 5C9JA 3EYVB 3MBEC 3OKOB 4KTEH 1CT8B 4HQQL 5F9OH 2DBJA 1GL4B 2QQNL 3W0WD 4EI5D 4FTVD 4WHTB 2HTLC 1M05B 3BD4A 5FGRA 5INCB 4H1LG 4IIQA 4C56A 1T7WA 3BPNB 4GW4B 5EBWB 3OGCA 5DJ8B 1XAUA 3QEQE 4KMTL 3T0ED 1J86A 1OD9A 3KPMA 5C07D 2HWZH 4U1SB 5KSBE 1HQ4A 4P5TD 3P9MB 2X4OA 1JNJA 4LSSL 4XPAL 2VUYA 5KBNC 4J6RL 5ECJE 3L9RA 3KHOA 4M1GL 5TGBA 1N4XH 3HZKA 4JB9H 4YGAB 1KELH 3QI9B 2HVJA 4F3FB 2EDWA 4XPTL 1LD9A 1YEKH 3TFKD 3PWUA 1MCKA 3ROLB 3QIWB 1A1NB 5F21B 3SHSA 5LKNA 1QLEL 3ULUD 1TZHA 3L3DB 4H8WC 3DRTB 2Y36H 1RD6A 3EOTL 1NCWL 3NFSH 2BK8A 4RWYH 5IG7B 1BD2D 3SE9L 5IB3A 3MTRA 5F3HA 3K80A 1A7NL 3P3YA 4P46A 5IBLD 3WFZA 5AWNL 5D70H 5DD3L 1BAFH 4GAJL 1R3IH 2IFFL 1DBML 2X4PB 4OZ4B 1UQSA 3CC5B 1IRAY 4Y2DD 1DBJL 3F7QA 2AJYL 3R4DA 4R97C 3KYKL 3ISWA 4KKBD 4O2EB 3W39B 5D6CB 5J11B 3JZ7A 4JO2L 2OBGA 1T21B 2FCBA 1R5IA 2D9QB 5FYLL 2O61B 1J10A 5CMAB 4HV8A 4OB5L 1RZ7H 1KCVH 3MA9L 4CW1B 1JGDB 2X89D 2EH7L 2P24A 3QUYD 2R15A 4WWKC 4TSAL 3BGFB 4QRUB 3QHZL 2R4RL 2BSSA 2KPNA 5FECB 4ONGL 4IIQC 5EU6A 2BERA 3AB0C 3O8XA 4J3WA 1QR1B 3DI2B 4MNGE 3U9PL 2DM3A 4I48A 5I76B 5DK0B 1OT1A 3O3EB 3G04B 5D7JB 1C08B 2CO6B 2PNDA 3QA3B 1FNSH 3CVHA 4Y1AE 1U8LA 2JK5A 5BRZB 1GGCH 1PSKL 2WWMD 12E8H 4JG1H 1JVKA 5F96H 4N90D 3VD5A 4W68A 1CIDA 2H32H 3BD5A 3HMWL 3K7UA 3IXAA 1QLFA 5KVFL 3NZ8A 3FFCA 1GSMA 2HKFH 1S7RB 1U8NA 3RGHA 1A4JB 3KYOA 1C5BL 1A14H 4XBEH 3SKJL 3WYRA 4FQIL 3VD4A 3WXWL 5GRVL 4UDTB 1Q94B 3BMWA 5MP6L 2V7NA 3ARGB 3H9YA 4RGNE 3EHBC 4M7LT 4ZFOB 4P46C 3FO0H 4GMSL 3L95A 4R4ND 3MRBB 3E2HB 5C8JA 3GBMH 1KJ3H 1DQDL 2QR0A 2XN9A 3GGWB 4WUKH 5C0GA 2EZ0D 4KK8D 3SKNA 4I9WE 4YQXH 4GRMA 5J9PA 2XWTA 4DGIL 2ARJB 1UM4H 4HFWB 4HIEA 1IGTB 4HIHB 2GITB 4OCYH 1KBGL 2R2EB 5GS0H 4JDVB 2ZCLH 1A7PL 3DVNA 3NN8A 3O0RL 3FAXA 2BY1A 2EE9A 1IM3B 3C60D 3ZKQD 2H1PL 1RZJL 3DYPA 2F74A 4P2QA 1OF2B 4EXPX 2EDKA 3LKOB 2KQNA 3ARDB 5IJVB 4PJIB 1UWEH 5LGJB 1JWSA 1ADQH 1MI5D 1C1EL 4QT5A 4XNMB 3L3IA 2YD7A 1OP5K 3RDTA 4G7VH 4J1UA 2JCCA 1ORQB 5EN2A 3DGGB 3KPLB 4GOSA 5SV4A 2EIBA 1LQSR 3TC9A 1KCSH 5GZOD 3GIVB 4NQCB 1NEZG 5HDLA 1OGAE 4OLZL 2H2PD 1NFIB 1A02N 4U3HA 5I1LA 4C83A 4GKOA 3IFPA 1CFQA 3T3PE 1UZ6F 1PQZA 4KJQD 2AEPL 2WWKT 1RK1A 3IDMB 2DQGL 4Q74A 1KULA 2X4QA 1VFBA 4WJ5B 3ARSA 1FRGH 2YUWA 3GSOA 1BWWA 1UWGH 1D5XB 1RJZA 2NW3B 1DN2A 2Z4QB 3MX0A 4FG6C 5KG9B 3BKYL 3CU1A 4MWFB 2RIKA 4HHAB 4BFIA 1LDPL 5E2VL 1NUDA 1VGEL 3C08H 2VZTA 4F58L 4PG9B 4NP4L 2NXYB 3U7YH 4NIKB 3GSRA 1ZMYA 4XI5C 3R1GH 1UB6B 3O9WB 4M93C 1JPSL 2E8YA 3T3MF 4JFXA 1FIGL 3WSQH 2VITB 3QISA 3FQNB 5DJYA 2EDTA 1SM3L 3CX5K 4NQDD 3FQXA 2J4WL 5JIHA 1S7TA 4OGYL 4DKEH 1XF3B 3IFOA 5C09B 4H5SA 2X9WA 2IANA 5I8EA 5GJSL 4YUEL 5L2KD 5HYEA 1AE6L 4P59L 1ZT7B 1J0HA 3F12A 1G6RH 1EO8L 5TPWL 1OOAA 5E6IB 1IJ9A 1WC7B 1OT2A 2JJUA 2Y9RT 4P9HC 1C12A 4NN5C 4R9HA 1IAMA 2DL9A 2P48B 3VWKA 2DBLL 1GH7A 2VRAA 2W59A 1VACA 1JFQH 4ZOAA 1ZLSH 3AU1B 3RDTC 3DUHA 3CD4A 4JDTL 5DFWH 3VXMD 1AC0A 1HNGA 3OF6A 4OD3H 3ZE0F 4FZ8L 1FO0H 4JFZL 5DJDA 4EUPH 3EYUL 3RNQA 4JO1L 5JHDA 5E94B 1EMTL 4MA8H 4MD4A 3X13B 2ZUQC 4LSRL 2DTML 3MLVL 5GGVL 1HIML 2O93L 4XBPA 1YNTB 2Z8VC 3PWPE 1YY9D 4BQ6A 5J6HB 4WHYG 3U46B 1R6VA 2BDNL 2IBBA 2J12B 1RU9L 2ZNWA 1OSZB 5E8EB 3REWA 4I2XE 2FLRT 5D93C 1F4WL 4PJFB 5HYJD 2XPGB 4J23A 5LAXA 1YECL 4M6NL 1IFHH 5I18L 3O4LE 4Y4KC 1MAMH 3OKMA 3ZKXB 2VLMD 3FT2B 4NFDA 1KENL 5DMGD 1AO7E 4GBXB 3MLXH 4GG6A 2A83B 2OQJA 3U79A 2WIIB 3S97C 2CLZB 5INDB 3KXFD 1BZQK 3P9LB 4ONHB 3GDBA 4POYA 5T1MB 2VQ1B 3EYQC 1A4KB 1QA9A 3ARFA 4XXCC 1ZWIB 4BKLA 1FNEB 1DDHA 4TVPL 5J4MA 1QSFE 3WV0A 4MCYA 4EVNB 3NA9L 1UH3A 4DGYH 2C1OB 3QWOA 3NVQA 5IHLB 1D5BA 4L8BB 1YEDA 4OD2A 4WTWA 3VGAC 1NFKA 4WV1B 1BM3L 2VLRA 1YMHB 5I71C 2JJVA 2W9LA 2B0SL 2AXFB 4PV8B 3NCCB 3BQUC 4J3OC 4OF8A 5FUCE 4ZFGL 5DUPH 5CLWA 2CLRA 3VWKC 3C9NB 4N0CC 1NCBH 4ELMA 4PS4H 1KUMA 1FZOA 3TNNB 4YEFA 3ILPB 5HPMA 3VXSB 3CFBB 3BRGC 1BQSA 3HAEH 2YUZA 2W0PA 4HC1L 3L7FB 1U8IB 4HKXA 5T1LB 3MSPA 5IEHA 5FM8A 3DMMA 4PJDE 5KVDL 3UTTD 2FO1A 4PGJA 3LDBC 3ARTA 5F1KC 1LP9F 1VKXB 4G6MH 4NWUH 1WBXA 3F58L 5J1AA 4E41D 4MXVE 5CLTA 4FOMA 4LLWB 2V2XB 4PRDB 2P5WD 1DVFB 3Q5TA 4GQPH 2EKSA 5FGBA 3MRFB 4I0PD 1ZT1A 3CXHK 3QCVH 4WUUD 4I1NB 5GRUH 2XTJE 4Z7OF 4DVBB 1C7TA 2K1MA 3OX8B 4QRQB 3RRQA 4JZOA 3SY0B 1Z9SA 4PLOB 5I66A 4D3CH 2GAZA 5DO2D 5CJOH 5KSBB 5EOCL 3D85B 2F53A 3MRHA 4QRRE 1NGWA 5IMOA 3WFHA 5ESQB 2DQUL 2YPKA 3L5JA 5E8PA 1FVEA 5JA9A 3L6FB 3MV9E 4Y4KB 2R2BA 3QXAA 5D1QC 3QEGL 2DM2A 2JJSA 2YSSA 4JFFE 4KHTL 5TDNA 3NGBC 3SDDD 4HS6B 1ED3A 3QWRA 1LEIA 3HZVA 1PZ5B 1U42A 4NFBA 2BP3A 4JO3H 5FCUL 1WZ1L 1CXEA 3L5XL 1T2QH 3P73A 2ZSVB 3GJFB 5DD6A 4U33A 3OAUL 4V1DE 1JV5B 2DQEL 2IADB 2F8VA 3L1OL 1K4CB 1KTLB 3DOSA 4E5XA 4HGWA 3C6LD 4HLZG 3RWJA 1UXWB 3QUXA 1OSPL 4NO3B 3JWNC 2VDML 4MDIB 3EGSA 3S98A 1E27B 3GMRB 3MODH 5KSUA 4LLQB 4PJ9D 1IQWH 5ENWA 4K3DL 4LVNC 1QSED 4YDKL 2RAMA 4NRYB 1ZHKA 2OJEB 3FQWB 4HPYH 4X7TB 1GAFH 4NM4H 2BHYA 4CVZA 5GRJL 5EBLA 2AQ1A 1AR1D 4M7JL 3VA6A 4JLRA 3RVWC 2P5ED 3TO4A 4GRLC 3VXUE 4HKJB 1JWMA 2CKNA 4NZUH 4S2SB 3JTSA 4Q58C 3OZ9L 4A2LA 2DWDA 3HKFA 3ELAT 1JZ5A 2YKLH 4PJCE 1YNLL 2NY2D 1EAPB 2ZSWA 2DDQL 4MNGB 2X7LB 1IGJB 4MAUH 1JZ6A 1A7RH 3IFNH 1WK0A 4NPYB 3WKMH 2FEDD 3BUYA 1PX4A 3I6GA 4MS8C 4K3EH 4XP1H 2E9WA 3SKMA 3MNWA 4Y1AB 4RFEA 2D03L 1FL5A 2Y23A 2VZ1A 4CU6A 1L9MA 8CGTA 3HRZA 4YJZL 2CUIA 2JJSC 5DD0L 1MCIA 4AEIH 5J6GB 5JW4Q 1QFWH 4Z8FH 3LQAC 1SYSA 1YEGL 3O3DA 5GGUA 2C4FU 4QKXB 5JNYA 1HZHH 3RGVD 1JTPA 3EOBA 2GIYA 3B9AA 3MJ6A 2R29L 1BJ1J 1XF2A 4PRIE 2NLJA 4MLIA 1R24B 1JL8A 3GJEB 2AQ2A 2C3XA 4M62H 3NGBB 3MJGX 3FB8A 4OCRH 4D8PA 1AIFA 2JTDA 5GSVA 4MJ5B 1H3PL 3LN5A 4RGNB 2DI8A 2CIKA 5EO9A 3QUXC 4OZFA 1KF9B 1RUMH 5TFSH 2R1YB 3HN3A 3CVHH 5DC4B 4FFYH 3SO5A 1HXYB 4P3WA 5L8JB 1CFVH 3NCYS 3G6DH 3ULVL 1CK0H 2R0KL 3RI5K 5SWSE 3EIFA 4ODBD 5IK3B 5KVMC 3DV6A 3UJJL 3MJ9A 1NAML 3SDCA 4PJEA 4MSWA 3BH9B 3HMXA 4K94H 1ERNA 3EKCA 5DT1L 4X6CF 4YHYB 2NY4D 4XTRD 1QBLL 3LV3A 3NACH 4XAKE 1OCWH 2BFVL 3DO7A 5B4MD 1RY7B 1YEJH 5C0AE 5MEPA 3VG9C 4RWHA 1PYWA 3TYFB 4LF3B 4S1RL 1BOGA 1BF8A 3G6AB 1QNZL 4J2XA 3KPOB 1LE9B 1H15B 5ICYA 1IQDB 3O81A 5BV7L 2GK0A 3QYCA 2VWEC 4HJGA 5I1IL 1MQKL 5HI4C 3QDJA 4I18B 5C0DB 5I19H 1XGYL 5IB2A 1QPPA 2IBZX 3DSFH 1TZIB 4K23H 5CZXC 3I50H 2F58H 5KZCD 3QP3A 4XVUC 3W5NA 4PBVC 4DOHE 3EO1B 3Q1SH 3CPLB 3S5LG 4LLYB 1S9YB 1HQRB 4M5YL 2YPVH 1MRFH 3SE4A 3MLTA 1S7QB 1MEXL 4R90H 1K8IB 2AJ3A 5GS1B 3IU3B 1J9CT 2BSRB 2GUOB 3QFDB 4NHUA 1ZKAA 2P7TA 2P8LA 5EC2B 1U0QA 3MLUL 3HUJF 6FABH 1LE5A 3T0BA 4G42B 3L3HA 4ODVH 2X4UA 4FQHB 4G6KH 3M17A 3RWIA 1GHFH 1XIWA 1UFUA 3DV4A 1GGBH 3OJMB 1IAIH 4UT7L 3QCTL 3MUHL 2ESVD 3BH8A 5GGRA 2VL4A 3G5YB 3RPKA 3T4AA 3W82A 4IRJA 3SDCC 1LP9B 3QFJA 4LSQH 3QQ9C 4TUKH 1WFTA 4RZCB 2C3GA 1A64A 1VPOL 2YD2A 1QBAA 4DK3A 4YBQC 5HHPA 2G60L 4FQXA 3TIEA 2V7HB 5DHYB 2H9GA 1CYGA 3IJHB 4Y4FA 5EU7E 2ZKHL 3BEWB 4MNQD 2CJUH 1TJGH 2BHUA 4PJXE 4R7NA 4HWEH 3NFNA 4EOWL 1A21A 4HF5H 2GJ6D 1AGDB 4NYLB 4G8FA 3J8F7 1ZHBA 1BQLH 1I1AB 5JXAL 3CFJB 5DZOA 1FC2D 1YYLH 2VDKH 1UVQA 4FMKA 4EDXB 1I85C 1JPFB 4LCWB 5ELIA 1N0LA 5CCKH 2BC4A 3G5XB 5FK9A 3CMGA 4FS0A 1XGTA 5FYKD 4NZTL 4R0LA 4PJAE 5B38A 3NIFF 1CFNA 2VDPL 3CH8A 3PWPB 2Z35B 1RJCA 3QPQC 3T08A 3KPRE 4RIRB 5JW5B 4U4BA 3C6SB 5HJ3B 1JTTA 4MXWH 1FZKB 4I2XB 4PRHE 4QCIA 4WFFE 3GEWB 1NBVL 2J6EL 2VLJA 1C5DA 3MJ7A 4KVNH 4KMQA 4AM0B 1ZAGA 4ODTL 2NYYD 4NO5B 5DJ0B 3ZZ1A 3VRJA 1OAUL 1QQDA 5HHOE 1HI6A 1AO7B 1MCQA 1BIIB 4NGHH 3TPUB 2Q3ZA 1U3HC 3WS6A 4OCMC 5DWUH 2EO9A 4NN7B 5MI0C 1CE1H 5MERA 1XIWC 2QQKH 3RVTC 2VE6A 3MCLH 4AEEA 4L3EE 4XAWL 3GKWL 4RDQG 3X12B 4PJBA 3V0AC 2BOBA 4KGLA 5IFHH 1F3DJ 3N1FC 4JZJA 1DN0A 5EUKA 1CR9L 4IRJC 4ELKB 4EI6A 3PIQB 4B41A 4LASH 3BJ91 3C5SA 1S9WB 3CU7A 4ALAH 4X6BA 4GW5B 1N8ZB 5TE4H 2EDNA 1R3HA 4LPCA 4Q2ZA 3L5HA 4FQXC 2DM4A 1MFEH 2VQTA 1KPRA 4F8QA 3FT4A 2MFNA 2N56A 3K4AA 5JLZB 4NO0D 1FV1A 1A3LL 4ENEC 4LSUH 4C56E 1BLNB 2NX5E 1TITA 1YUHB 2DN7A 5BOZG 1FORH 3TT1L 1ZK9A 3S7GA 3X11B 4LQ1A 5F6HJ 3CZJA 5DQ9B 3H7BA 4KKLC 4PLKD 1YPZE 4G9DA 2OP4L 4JRXD 2BVPB 4LAJH 1F2QA 5DMKA 5D1XC 5IBTL 5DSCA 4PJDB 3AMKA 4QY8A 4ZDHA 4G8EA 3WDJA 2BJMH 4C4KO 4R0LC 4UU9A 3DROB 4TRPL 3BE1L 5GISH 2FDBP 4L4VA 1I9IH 3LN4A 1RV6X 5KSVB 3KYNA 5HGGS 2NW2B 5IROC 4I13B 2XTJB 2FD6L 3A6BL 1RSFA 4EDWH 3E1F1 1KCUL 3QDMA 5C9KA 5DJXB 2R23A 2C3VA 1JHLL 4ERSL 3QG6A 5IIEA 5J57B 5DVMA 5T3XL 3KVQA 4PP1D 1ETZB 4RAVB 4QRRB 2NXZD 4KTDH 5T33L 4U1GC 4YHPB 5HGAA 2E7CA 2C7UB 1AJ7L 3ALXA 2R0WH 2PCPB 4U6VL 3HI5H 4XP9L 4JFFB 4X6CB 4LCYA 4Y16B 4EI5A 4FTVA 5E1AA 3MRPA 4MB3A 1S8DB 2QSQA 1FG2A 1K3IA 2EDLA 2HJKA 5DC9B 3D39D 2B39A 4NRZB 5IBUG 3P77A 4IEFB 1B4JL 3HI1B 2BCKA 2YPLD 5BQ7A 1MCWW 3O3UN 3T0EA 1KTDB 5TDOB 5C07A 2X4TB 3Q3GA 3N0PB 1TPXC 4LIQH 4P5TA 2IPTH 5EU6E 4OZIF 3MCKB 1MOEA 4YHKH 1FYTD 4QHNA 5HGBB 2CXGA 1U93A 2GI7A 4YIQA 5JOFB 3DIFB 4PLNC 3WKNA 1XH3B 4GKSA 4HH9B 1N5AB 3BO8A 4MJ4A 4XMPH 3LQAH 2NY0D 5DTFA 2CLVA 2Z91B 5AZEL 1KEML 5GS3A 3MZGB 1AFVL 1T7XA 1SEQH 1VGKA 4XWOD 5DI8B 5T1KD 4I4WA 4P4KB 1BD2A 3VXUB 3FFCE 1HHGB 4GAYA 1W72B 4ZFOL 3CX5J 1HWHB 5HD8D 1MCOH 2ORBL 4D0DA 2ZUVA 4PJCB 3IU4L 5ID1A 3UAJC 2C1PB 3O4OB 5EUOF 1CDYA 4P2OC 5DDHB 4XPGL 4N1HB 3TYGL 3H9SD 3HPLB 1BQHB 2NR6C 3REVB 3RHWK 1FL6B 3P4NB 2OYPA 4F7PA 2XN9E 2OK0L 3PWVA 2FJGB 1S7WB 4XC1L 5I1JL 1MF2L 4FQPA 3G08B 4U1IB 4JAMA 1OVZA 1I7RA 3KPSE 5BVPH 2FSEA 4GKZB 4YHMH 2XQYG 5AUMB 1N6QL 2EE2A 5EWIH 3VXPA 1I7UB 2YBRA 3V9FA 5I15L 1BZ9B 1ZLWH 4X80H 4WNQB 2CK0H 3H6JA 5HDQH 4PRIB 1EEYA 4P2QE 3T1FA 3B9KB 1B88A 1FLRL 1EXUB 1MJUL 3V4UH 4PREA 4OFDA 2DD8L 3T0EC 3ZT5A 4UV7H 4RBPK 5DJ2B 3T65B 4P5TC 4L9LB 4MVBD 3LMJH 4Z5RA 1A22B 2JCCE 5CJBA 3OJDB 4MA1C 3RTQB 2YR3A 1D5MA 5TDPB 5SWZA 1YEEH 3MGOA 1CXHA 4X5XB 4R7DA 5FB8A 2WM0A 5SWSB 4HBQA 4ESKA 5LCVH 3TFKC 1EH9A 4RRPG 3C09B 3UO1L 2Y7QA 2AKRA 3VXRE 3ULUC 5EUOA 2C5DC 5IB4B 2FX8H 4X0KB 4NKDB 2D3VA 3BKCL 3IJSA 5DEGA 5H94B 3MUJA 1JZ7A 3B6SB 1LHZA 1OQXA 4GRWF 2VDNH 5H37H 4OZFH 3V6FB 3HFML 1HKFA 3QUZA 5FDYA 4OI7A 1N59A 3GSXA 4UTBL 3HC0B 5EZLB 5DMIL 5D7KE 3SDYL 3SBWA 4IOIB 4AQOA 3B5GA 1TTFA 4ZYKB 4Y2DC 5HVWA 5C3LD 3V6ZB 4JFHD 3UTSD 5GZND 1XGQA 3MJ9H 1F13A 3SKOB 4FXKA 1FGNH 4KKBC 4JM4L 4U1HB 4R2GB 4F7CA 1AGBA 3QRGL 4PYGA 1INEL 3HMXH 2E3VA 2ED9A 3HG1B 4NC2B 1HXMA 4LEOA 1UJTA 2G9HA 2HJFA 4XPTH 2EECA 4Y8AA 2J3SA 4MXQD 4DOHB 1S9VA 3CNKA 3D87B 1IC4L 2ZCKL 5EIVA 3MRMA 1OP3H 2FECL 3ARBA 2XQBL 3QUYC 1FFOA 1CICB 2IANE 3S4SG 1FZJB 2DQJL 1DTUA 3Q5OA 1RZ8A 1MI5A 1AQDA 5AG9A 3GBNH 1FN4B 3BI9X 1UH2A 1Q9LB 1B0WA 2VDRH 3JWOL 4U2YA 3RKDD 1EBPA 4YHNB 4Z0XA 4L8SA 4PUBL 2JIXB 1MCSA 2MCPH 3BD3A 2AQ3A 1K4DA 3VFNA 1CLOH 5C0BD 4ZG1A 5A40E 4N9GB 1DQJB 1I9JL 4QYOA 1ES0B 2WWMC 3CXHJ 1CFTA 4V2BA 4IMKA 3X14B 4QXGH 2X6MA 4ISVA 1MRCH 2CO7B 2H3NA 5I8CB 3OWEA 4LHUB 3O6FD 2WLZA 3DUSA 2W0FB 4DKFL 1WWAX 1NC2B 4NHCL 1V7NL 4OB5H 1ZVSA 2VXSH 1JZ2A 5I1CL 4IRSB 1WBZA 4P2RD 3QHZH 1EV2E 1QRKA 4X8XA 4DKAA 3U2SB 1I8MA 5JA8B 4ONGH 4JM2D 4UBDD 5F9WB 1JBJA 2VISA 1B3JA 3RY5A 3VFSA 1TDQA 2JELH 4R4NC 5ACZA 4L4TA 5FKPB 1GGIL 1GCFA 1OM3L 5FAAA 2XA8L 5EO0B 4DGVH 4YDIL 2EZ0C 4KK8C 4BZYA 5TE7L 4R96B 5IMKB 5ILTL 2XV6B 2NY5H 4GG6E 3VWJB 1PVHA 1YC8A 1WITA 3O2WH 4JO4L 3MV8E 4XVSH 4NQDA 3PQYA 5L6YH 1MIMH 4XCEA 1FPTH 3PG2A 4HUKB 3HAEB 1CLZH 3KYMA 1AKJB 1J1XH 2CDFB 5L2KA 3BJLA 3C60C 4PJAB 4WU7B 3MNVB 2V2TB 1UXSB 3RWGA 5ESAB 1R0AH 1KJ2A 1OAXH 3SKUD 3KPRB 3NA4A 1Y6KR 2DLHA 1EUUA 5D7IF 3ESVF 4KROD 3OB0H 3LVEA 3VGGA 2VZ3A 2VLRE 4HEME 3BDBA 3VXMA 2BNQD 3WDIA 5SX5K 4HDIA 4OZIB 3V6OE 4ELME 1DQDH 3GSNA 5GZOC 5HHOB 3OAZK 1IGFL 1FZMB 4WO4A 3GNML 1T5XA 3FO1B 2H2PC 2VIRB 4WFGE 4D0CA 4EIZC 5TH2B 2FECI 4L3EB 1CVRA 1U8JA 3JTTB 3JVGA 4KKNA 4IMKC 5I8OH 3PV6A 4NBXB 4YZFF 3O45B 5E9DD 1EX0A 3TZVD 3FFDB 1P53A 3MBXL 2Y6SD 3GM8A 1M7IB 4P5KA 2GTWB 2PETA 3NIDE 4XRCA 1KN4H 1ONQB 3C5ZC 3KPTA 3EOAA 5HHXH 1NDMB 4MB5A 4S11A 5HYJA 5CILH 5CEZL 2O5ZH 2BY3A 4ORGA 2ZCHL 2HKHL 1YEFL 5E2UL 3EFDL 2JJTA 1RZKL 1CXKA 3N9GH 3C8KA 5EH1A 4MQSB 4PGBA 4K2UH 4GT7A 4C56B 4BSWA 2NX5B 3IFLL 3L5WA 3KXFA 3OGCB 5FHAL 1CDBA 1G0XA 1G0YR 1BFSA 3DX8B 3DX6A 3VFWA 2ATPB 4K71B 3KPMB 5HVFB 4BQBA 4M43H 4LIQE 5E70A 1HQ4B 2X4OB 1YPZB 3K8MA 4OFYD 2F53E 4OM1H 4Z0BH 1QSZA 3T1WA 3ZKND 3HZKB 3RZCD 4JHAH 5A2IH 4X7SH 2V17L 5EO1A 1LD9B 2GFBB 3PWUB 3WIFA 1BFVH 4QLRA 3TBTB 5F9DC 3D25A 1TZHB 5IVZA 3RWDA 5AD0A 4OI9A 4PRNA 1MQ8A 2DLFL 3MOAH 2G5BB 1DBBH 3ORJA 4KUZL 5DMYA 4K8RD 4QXUH 3DUUB 5JMRA 2V9QA 4HXBH 2BOCB 3VI3F 2PO6D 2BY2A 3K74B 1FBIL 3KG5A 2ED8A 2L4OA 5L0QB 4MNHA 3HPJA 4JPVL 3I85A 2DL2A 3MRQA 2BRQA 1AGCB 2IBZY 1JYNA 3ULVD 2UUDH 4LPXA 2AABL 4UQ3B 1IGCH 4NJ9L 2AJZA 3JV4A 3UTTA 3OR6B 1NFDF 1PAMA 1KACB 4I77H 1UQSB 3WJLC 1I4FA 3JVGC 1NLDH 2IH3A 3D3VD 3LRSB 1HNFA 4PJ5D 4E41A 1ZHNA 2HFFA 1AE6H 2W65A 4X99B 4UOW0 3K8LA 4YDLC 1OB1A 3WN5A 1EEQA 4OV6F 2DJUA 1QPXA 2PUQT 5JUEH 4XC3H 4QHUA 3EO0B 4I0PA 3WJJA 3PL6D 3VGHA 3MUY1 3U0TB 1EHLH 4BH7B 5JQHC 2P24B 3QDGD 1BBDL 3RWCB 1CDGA 1X44A 4Z7QF 4L5FH 5DMGC 2IF7A 5MEND 4L8DA 4LPUA 3U9UB 4EBQL 3O8XB 5F7WC 4P9MH 4JFZH 4XMKL 4XNXL 5GHWH 1L4IA 5T1DL 4I48B 3WL9A 1QLRA 1MJ7H 3SO3B 2A74A 1NCDL 1U36A 3E6HA 2VXQL 5CBEA 3SDDA 2HN7B 5EOQL 5I1AA 4JY6B 4MHHI 1X5JA 4POUB 3F7PC 4LSRH 2DTMH 1DL7H 2NNAB 1HIMH 5GGVH 1U8LB 5IHUH 4LPVA 4OFKA 4QRPD 4Q6IB 4C58B 1RIUL 4OZGF 2DQCH 3IXAB 2AV7A 3F6IA 3RPIA 5T5FL 5I74C 1X7QB 3S88L 1JP5A 3NZ8B 4HX1A 4LCIH 3BAEH 3NCFB 5KN5B 2QQQA 2FHCA 4J4PC 1U8NB 4NC0B 1X5FA 2UY7A 4XXDB 2EE3A 4R8WH 4RISH 4RMVA 3CIQA 1U92B 5HDBF 4D0BA 3AS3A 4LAQL 5DRNB 2FGZA 2R0LL 4M6ML 2FX9H 1G7QB 3CVIL 2V7NB 3TA3B 2R2HB 4KQ3H 4ODHL 2V5RA 4PJ9A 5EZJB 1OTSD 1WTGT 1G7JB 4O2CB 5FEBA 3LKRA 1MCDA 1R5WA 1QSEA 4NUGH 5LXGH 5C8JB 4PJGE 2QR0B 2XN9B 3AY4C 4E9LA 5C0GB 3ULUH 4E0RB 4XCYA 3SKNB 5EORH 5J9PB 2XWTB 5ETUB 3ZMRA 4F37K 3KPSB 3MLRL 4PGEB 2IG2H 4PJEE 5DS8A 3SQBA 1BREA 3TV3L 1CFBA 4JJ5A 2B5IB 4U1NB 3MQIA 3FB5A 1YQVH 3WN5C 3DVNB 2DI9A 3WUWA 4LCCA 4JKKA 2B0SH 1AC6A 4I0PC 4ZFGH 3FMGH 2F74B 4P2QB 2YD1A 5BS0D 1IEBA 1S3KL 2E27H 1FNGB 4BZ1H 1JWSB 3M07A 4HS3A 1WCBA 4AG4L 4YDLB 3TN0B 5CEXA 4F33A 5DO2C 3QUMA 4UIKL 1AQKL 3L3IB 2GSIA 4J1UB 2JCCB 2WBWB 5FV2A 1ZLUH 1NMBL 4YGVA 3PGCA 5CBAA 4GLRH 1T04A 4GUPB 1Q1JH 1YEIH 1LO4L 1QO3A 4U1MB 3GHEL 3QDJE 3SDDC 4EQ3A 1U58A 5HVHC 2DMKA 4C83B 3RGVA 1NCCH 4UINL 3VXRB 1CFQB 1EUTA 4AQ1B 2VXTL 2XFXB 4LQFL 5BJTB 1PQZB 1N6UA 1MIEH 1DEEB 3U1SH 3NTCH 4YFDB 3T0AA 5FYLE 1E6OH 5D7IB 3TO2B 4ZUSA 2HG5A 2R56L 2XRAH 1RJZB 4CMHC 4LMQE 1MHPH 2WMPA 4TPRL 3C6LC 1LO5B 1S5IL 4DAGH 4UV4L 3ZDZE 1C5CH 15C8L 5C0CD 4YX2L 3D9AL 1ZVYA 3CZFB 5T5NF 5KSAA 2P47B 3TP4A 1XR8A 4FFZH 4QWWD 2XZQH 4X98A 2CXKA 3D0LA 5KVEL 3Q5YA 4OLVL 3DYOA 4W6XB 5IB5B 3D1MC 2DQUH 3VA2C 3MV7D 5B39B 5ALCL 3NIGF 5C6TH 1PG7L 1X6NA 3OKKB 4UILH 3QEGH 3S96A 2OJZH 2W9DL 3E8UH 1DBAL 1AR1C 3UTZA 2ZJSL 5F44A 3FQXB 3QFJE 3W5MA 1S7TB 1A6TA 4MZ3A 1BVKA 1E6JH 2DOCA 2WWKO 3IFOB 1G0DA 2EKJA 2VUOA 4H5SB 3GMQB 1KPUA 3OMZA 3OPZH 3F12B 1UJ3A 2NY2C 1RMFH 3P30L 2E5EA 3LIZH 2FR4B 1PKOA 3WFDL 5FOBB 1MWAB 1V3LA 3QI9D 3CXDH 5D96B 3WE6A 3MLWL 4EN3B 5FIEA 4DZ8A 1G9NL 1X5AA 2FEDC 4BYHA 5DMJB 2YZ8A 2EIEA 1CS6A 3QIWD 5AYUL 3T0WA 2Q8AL 5F7HA 4XPHH 5DJDB 2XKUA 5T3ZH 1JF1A 5F7YC 1XGPA 2UZIL 3RNQB 2FIKA 3P4LA 4ZXBB 2VDLH 1HCVA 4RFNC 5DQJA 1ZE3C 3OV6A 4MD4B 1KC5H 1NGYA 1AHWA 5F7NC 4ZO8A 1MNUH 1MH5A 3OXSA 4CNIB 1OTTD 3RY6A 1QD0A 5F9OL 4DFIA 1FG9C 3KWWB 3J7HA 3QQ3A 3REWB 4XVTL 5ICXA 1T0NA 4O5LH 5LAXB 4NM8H 2GT9B 4DK6A 2JB6A 1XEDA 2VLJE 3U6RB 2WK2A 2IH1A 3WLBA 4YHIA 2ESVA 2HWZL 3IDIB 4XNYH 4ZNEA 4GG6B 4KRPB 1FP5A 2OQJB 1NFDB 5F1IA 3QULB 3MV8B 1P1ZA 3BPLC 1B2WH 1NBZA 1OAQL 3BZFA 1NMCC 1N4XL 2UWEF 3ARFB 4JB9L 3RL1B 3K3QA 4PJBE 3BWUC 2AXGB 2NY4C 1IT9L 4XTRC 1KELL 1H3VA 4BKLB 1DDHB 4MCYB 4G6FB 3N1MC 2QSCH 5B3JE 4K7PX 4Z78A 4MQ7A 2BXYA 5B4MC 3RWHB 5CAYB 1CXIA 1KJMA 4WRLA 3VFUA 4QTIH 4MNQA 3KPNB 3QWOB 2Y36L 4P49A 1D5BB 4X6DF 5LJYH 1YEDB 3NFSL 5D7LA 4RWYL 5D7JD 2CD0A 2I9TA 1ZA6A 4H20H 1TZGH 4ZS6D 2GJ6A 1FH5H 3HS0B 3I6LE 1DSFH 5BRZD 2CLRB 3VDCA 5J13C 3TBVA 4ELMB 1FZOB 5D70L 5F9JB 2EEAA 4QTHA 4MDJB 4U0RB 1GGTA 1R3IL 3UBXA 3GMPA 1P4IL 1HDMA 4WI7A 3EW3B 1BJMA 3WFEH 3HZMB 5E2WH 2DQFA 1XMWA 1I9RH 3QBTB 4HKXB 4CBPA 1S78D 2C9AA 2Z8RA 5DT1H 1A7QH 3DMMB 3WCYA 3BXNA 1HK6A 3BX7C 1CBVH 3CFIC 1KJ2H 4MGXA 4NKMB 3LHPL 2BFVH 4KV5E 4PPTA 3RI5F 3ARGD 2F5AH 1G1YA 3MRDA 4BM7A 1MJ8H 5HHME 1RZ7L 1KCVL 2X41A 3B9DA 1JGEA 4OF6A 3VD3A 4Z18A 2EO1A 4L4VE 4G8GE 1IAOA 1DBKH 2B4CC 5L2JA 2UWEA 5C0EA 5DUBB 3GSNH 1ZT1B 2AERT 4GXVH 1NANI 5EULV 2EDDA 3OAYK 35C8H 5EZOH 1TJIH 5B8CA 1RJLA 1S7UA 2DYPD 2WIMA 1CFSA 3QDME 1XGYH 1Y0LB 1FIEA 1KLGA 4KXZI 1FNSL 5JW3H 2F53B 4OAWA 3VXNA 3W9EA 3U0PA 1NGWB 1C16A 1I1YA 1BFTA 3WFHB 5IMOB 3ARDD 5LBSH 1GGCL 2YPKB 4MD5A 12E8L 4U1JA 2VZOA 4JG1L 5HYSB 1FSKC 5F96L 3TVMB 2BSTB 1UKSA 4YFLI 1AP2A 2YSSB 5TDNB 2EDQA 2BMKA 1EPFA 2R2CA 4FP8L 3AXLB 1U8QA 5IGXH 3GI9H 4KK5C 4FTVE 1CN4A 2EDYA 4NO0A 2HKFL 1Q9WB 1QYGL 3H0TB 3P73B 1A14L 1A1MA 5DD6B 5TF1H 2UVEA 4NQCD 4PY8J 2VR4A 2BSED 1IBGH 4FQ1H 1P5UA 4HZAA 2OMNA 4RNRA 3T0EE 3OSKA 3VFRA 5C07E 4E5XB 4HGWB 1IC1A 3FO0L 3RWJB 2VXUH 2EH8H 4JRXA 1MFAH 3QG7H 4K7FA 3GBML 1KJ3L 1MPAH 4WUKL 3EGSB 4NSKB 1OP9A 4JANA 5KSUB 4LKXB 3WXVH 3AC0A 5DRXB 4KK6D 4PLJD 1UM4L 1EHXA 1P84K 4RDQF 3CDYA 3GJFK 4OCYL 1E28B 5GS0L 2ZCLL 5ITBH 4TVPE 3ZSTA 1NUFA 2F15A 4WW1A 2QTEA 4RA3A 3ULUE 3F7VB 1TETH 1U8MA 4CVZB 1U8KA 2NXYD 2ZKHH 1EEZB 1U41A 4JLRB 1BD2E 2FHFA 3RFZC 1MHHA 2P46B 3TO4B 3O9WD 5DJAB 1XZ0A 2FLBT 2NYYC 1ADQL 3AROA 3TIDB 1IKFH 3BN9D 5IHZB 1NGZA 3MREA 4G7VL 2ZSWB 5B8CC 2I25N 4KKCD 5C09D 5IFJB 5CHNA 5JQ6H 1KCSL 3V5DA 3HLAA 1E4KA 3IS1X 4OLXH 5ERWA 5M7QA 3I6GB 1N3NA 3SOBH 4KU1A 2SEBB 5E6ID 3RX8A 3SKMB 1W0YT 3RWEB 3BIAX 3MNWB 4DN3H 4RFEB 4Z7NF 3GSWA 1FL5B 3HR6A 2FO4A 3EUUA 4RMTA 2HMID 2E6JA 3D39A 4ZTOH 3KJ4B 3RQ3A 3T0VA 1FRGL 3UPRB 4RFOH 2J8UE 4YNYB 5GGUB 2YPLA 1L0YA 5JNYB 4NQTA 1CQYA 1OPGH 3EOBB 1J88A 2OL3A 4MHHG 1XF2B 2NLJB 2F9BT 2J1KA 3FRPA 1VFUA 3C08L 5ESVA 3FB8B 4D8PB 1AIFB 2AJXH 3FTGB 3I3BA 3O2DA 2DIJA 4LKCA 4DCQA 3LN5B 3U7YL 4PLKC 1RIVH 4OZFB 1LDSA 1KTRL 4HBCL 4PJGB 5SWZE 3CH1A 4M9PA 1EA9C 3WSQL 4C59B 4N90E 5I16A 4GXUM 3E6FB 4G3YH 1CF8H 2AV1A 3GMOA 5DYOA 5T1KA 5CD3A 4LGRB 3CFCH 4RX4D 5D2LA 4PJEB 4DKEL 1FNLA 3S37H 1H5BC 3MRKA 5DD5L 3STLA 5ADOH 1NL0L 4GBXD 2A6JA 3LV3B 2ADGA 1G6RL 2CIIB 3IDGA 4OUUA 3DO7B 1A6WH 4NQUA 3P0YL 4HKZB 3O3BA 4YDVA 3ZTJH 5EU3A 1AD9A 3TT1H 1J1PH 1PYWB 2Y06H 3H9SA 2QKIA 4GS7C 1JFQL 2AK4A 4ODXA 2OS7A 1ZLSL 2B2XH 4PP1C 5EBMB 3H2WA 5DJZA 2Y5EA 1T3FA 1Z5LA 4OD3L 2B20A 2IC2A 3WHXA 3LEXA 5ICYB 1FO0L 3WFBH 1HSBB 2LE9A 3CCHA 4JDZB 3QDJB 3ZT7A 1RZJC 4MA8L 1UB5A 5IB2B 2YEZA 4HWBA 1IKNC 4TRPH 4HT1L 1IM9D 5T3ZE 3KPQB 4NJAH 3QO0B 5IW6B 2A9NH 2OI9B 3MLSL 3FQTB 2E9JA 4M7KH 3VXSD 4C55A 5F1NA 4X6DB 3SGEH 5AZ2H 3QRFM 3GMLB 1MI5E 1Q9OA 1UKQA 3QUMH 4PJ8A 5T1LD 2GK2A 1ACZA 5BO1H 4Q9RH 4X9FA 1IFHL 4NHUB 2XY2A 1MAML 3IKCA 2X4NA 2FWOA 4ACPA 1L7TH 3MLXL 4H88H 5IJKC 3Q2CA 2G75A 3L3HB 5I73C 1I8KA 1WAAF 1IEHA 3LSOB 3EYFA 1D6EA 3M17B 4X4YA 3RWIB 2NY0C 3BZEA 3DV4B 1M6OA 5IWLC 3H42L 3T77B 1DVFD 1E4XH 4WWID 2AI0H 3KLSA 4Z7VF 2AGJH 1RURH 3VFPB 3RIAK 4NZRH 3PNWA 3PP3H 3QFJB 1JK8A 3Q48A 3QEUA 4DGYL 3B3IA 3ZHKA 4WFEE 3LS4H 1B4JH 5E5MA 3TIEB 1JUFB 3D85D 2APTA 4Y4FB 4QHLB 5I1GH 5DUPL 1FFPB 2Q7YA 1NCBL 1OQOA 4PS4L 4Y4KD 5JORA 3UTSA 4BK4A 4R7NB 1U2CA 3NFNB 1KIUA 5HI3D 4L4TE 1A5FL 2DQDH 1M71B 1T1YA 4JM2F 1JPGB 4G8FB 2X1OA 3UC0H 3V7AE 5C0FA 1HCFX 1KEMH 1FFQA 3BKJL 4NQDE 2UZXB 3PQYE 5I6XC 1WVZA 3BPOB 3B5HA 5LWYH 5FK9B 4G6ML 4NWUL 5L2KE 3ECBA 5DA4A 4K3JH 3CUPA 1OARH 5B38B 3WS3A 1NKOA 4UUJB 1WAAA 4OLUH 1HYRC 2ZOKA 4PP2A 1TIUA 1KG0A 4N0FA 4ZUWA 1V3MA 4TTGA 1N5YH 4OFIA 43CAB 2PXYB 3QCVL 3TM6A 1M4KA 4QCIB 5GRUL 2EYRA 2YMXH 4N0CD 3JUYA 2VLJB 5LGHH 1C5DB 2R1WB 5F9AC 3VRJB 4D3CL 4L4JA 1QQDB 1XFPA 1FJ1A 3S6CA 4BZ2H 1UEMA 4F7TA 1LNUA 4WW2A 3O6FA 1INQA 5CS7A 2FIRT 1TVDA 2VE6B 5D5MA 4ODUB 4PJBB 1M7DB 1P6FA 2BOBB 2HJLB 1P6AB 2OCFD 3UTPE 4JZJB 5EUKB 1DN0B 3V0VA 4EI6B 4P2RA 3HC3L 4AEHH 3RL2A 3RNKB 4JO3L 2X70B 3FJTA 4X6EA 2AVGA 2B4CH 3C5SB 3U4EA 1ROWA 4JM2A 5B21A 5F6IB 3V5KA 1T2QL 1R3HB 5HYJE 2C4XA 4U49A 1I3RB 1F90L 5BW7C 4D9LH 4R4BA 2X1WL 3FT4B 3MFGB 3Q6FA 4G7YH 2PW2A 1FV1B 4Y1AD 5ANMA 4RRPA 1W8NA 4X4ZA 2E6QA 4I5BA 3LPFA 2XA3A 5GZNC 5EU4A 5KS9F 3KXFE 4YBLB 1EAJA 4Y5YB 4Z7UE 5JPMA 3D69A 3MODL 1ACYH 4WHDA 3PWLB 1IQWL 1B90A 4ZOBA 4ZQKA 3HE7B 4MXQC 4G9DB 3UO1H 2VXVL 1A9BA 5D1QD 4YXHH 5IT2H 4ZUUA 4LL9A 2IPKA 4XNZB 4ZS7H 3BKCH 4HPYL 4QY8B 1GAFL 4NM4L 3WLWD 3TBWA 2ICEA 4QNPF 2FX7H 5HHMB 1FAIH 1G9MC 2MHAB 3VFOA 1WIPA 2BNQA 3CSYB 1T4KA 4NZUL 5GGQH 2LVEA 4G8GB 3RKDC 3FN0H 3CDFA 2UY6A 2NTFA 3ROOB 4UTBH 3SDYH 2YKLL 4IHOB 4ZUVA 5HGHA 1I8IA 2YN5A 3WHE0 1UADC 1R3JB 4WI8A 2VL5A 3ES6B 1VERA 1A7RL 4OQTA 1TCRB 3FOLA 5IIEB 2KKQA 3WKML 5E9DA 4XP1L 3TZVA 5FCSH 4Q9BA 3HZYB 1G7PB 4PJHA 2AEWA 2FBJH 4ORZC 5HGAB 3ULVF 1RJYB 4I0KA 3GMMB 4AEIL 4IS6A 1QFWL 4Z8FL 2DQJH 1JN6B 4NC1C 4U6XB 5A2FA 2I9LA 4UB0H 1HZHL 4EI5B 5E1AB 3IDYB 3MRPB 4JM2C 4CMMA 4UBDC 4GRLD 4Z7WF 1FCCA 2FATH 1DJSA 5F88A 4U7KA 8FABB 1A1OA 5CJ5A 3P77B 3RUGF 4M62L 2RFXA 4NDMB 1A6UH 2BCKB 5BQ7B 2IQ9H 4OCRL 1BOYA 1DFBH 2MWCA 5FA4B 5C07B 4OFVA 1RUML 2DAVA 5TFSL 3PXJA 4ZFFA 5EPMB 4OFYA 3CVHL 4FFYL 4P5MA 2ICWJ 4PD4K 1CFVL 3RZCA 3G6DL 2X05A 1CK0L 2ZPKH 4GSDH 1NAKH 1REIA 2RBLA 3PABB 1JZ3A 4GKSB 4NHCH 1FCGA 3BO8B 1D5ZA 3OB8A 4IMLB 4NQVB 3OGOE 1CDHA 3UYRH 4K94L 2DJSA 5FYJU 2NY1B 3NACL 1KNOA 5HPOA 3QXVA 4KWUA 2P49B 1R5VA 4L1HA 3BZDA 1YEJL 1BD2B 2PO6A 3QNXA 3BRFA