4NQSA

Knob-into-hole igg fc
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
210
structure length
210
Chain Sequence
LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Antiparallel Conformation of Knob and Hole Aglycosylated Half-Antibody Homodimers Is Mediated by a CH2-CH3 Hydrophobic Interaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 210
sequence length 210
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqsA01
4DZ8A 5BQ7A 1OF2A 4OM0L 1JPSL 3F12B 2R0KH 3CX5K 1YQ2A 1F4AA 1QFWH 4KTDH 5ITFB 3RGVA 5CFHA 3QPXH 3WXVH 5JPNB 4NZUL 2H41A 5DURD 5F1KC 1IGIH 2CLVB 3SPVA 2MCPH 1UXWB 1WBYA 5GRUH 2WBJA 4HUWA 3AU1B 2DJ4A 3QRGH 4PJ7E 3TEUA 5CJOL 4GRWB 3NVQA 2CSPA 1CFSA 1JP5A 5F1NB 4LCYB 1IAKA 3DI2B 2DM7A 3NN8B 3MTRA 2LE9A 3LV3B 2GJZA 3GJEA 1M71A 4U1MB 4NJAL 2F5AH 1Q0YH 1ODAA 4ODHH 5DA4A 1OB1B 3L5JA 4UT6H 5DJ8B 2OP4L 4NQDA 3WLBA 3ISWA 4Y4HB 4P4KA 1DBBH 5CBEA 5JXAH 1A3RL 5JUEL 1JUFB 1J10A 3GSQB 4RZCB 3U0PB 3QEGH 1S9VA 5E1AA 1K6QH 2EEAA 3BQUA 3CPLA 5HYJB 1YECL 3D85B 3QDGB 3TP4A 2P43B 4P59L 2HFGL 4LDOB 3ZL4L 1QFPA 2WLYA 3IFPA 1TPXC 3BKYH 4YDVB 3VGBA 6FABH 3G04A 3H7BB 3BUYA 3MBXL 3VFUA 3ZE2F 3BP5B 3TZVD 1YYMH 4IOIB 4PJGB 1BIIA 3S5LG 5C08B 4WW1A 3PABB 3JWOL 1HZHL 5DK2B 2ZUUA 1NC2D 3MX0A 3VGAB 4LASH 1ZT4A 4Z78B 3FFCE 4L8SC 4LFHD 2OZ4A 2XN9A 4KHXH 1N59A 3HUJF 1OAXL 3LPFA 1AIFA 1G0XA 3CX2A 1ZKAA 5C86A 3SJVA 4XBGB 4MB5A 4P99A 1J87A 1CE1H 3LS5H 2XRAH 2G5RA 2P5WE 3FB5B 5ETUB 3C6LC 3V5KB 4LSRL 1SMOA 1Z9OA 5MP6L 5TQ2H 5JW5B 1NAKH 4A6YL 4DOHE 1KCRH 1ETZB 3SDCA 3HMXA 3GMNB 1F02I 5CLWA 1FO0A 2P8PB 1MJ7H 4LAQL 3L3HB 3L5WA 3RHWF 4MCYB 1R5WB 1Q0XL 3UEZA 4IRZL 4PJBF 1YEJH 4YX2H 1XT5A 1T1XA 4N8PA 5F7HA 4GUPB 4PRBB 1ES0A 1FSKC 3RL2A 5DHXB 1UC6A 3IXAA 3QIBC 1TITA 5TDNA 5IMLB 3IFOA 3PIQB 4L3AA 3F6IA 3G6JF 5DR5L 2HKFL 3OKYA 4LLYA 3CFBB 4MCZB 4ZXBD 3VXRE 3VFTB 1XCTB 4KUCD 4OKDA 4ZNEA 3TNNB 2VLJB 2YPLA 4UUJA 3QUYB 5F72S 3IXTB 4WFED 1A7OH 1CFNB 4NNXB 4PRIA 4YPJA 3ARBC 3MRDA 3TO4C 3VFMB 2N4IA 1EV2E 3JWDC 2PYFA 3L7FA 3TBSB 3PL6A 1OAKL 2PO6A 4HLZH 4Z7VA 5DFWH 2DJSA 1OD7A 1FDLH 1AE6H 3SE9L 1DBJH 2DD8H 4U31A 4S2SB 4V1DE 5IJKA 5I8CB 5DGQA 2GJJA 4RRPG 1JNNH 2CUIA 5GJTL 1YMMA 4OZ4A 4JPVH 3EOAB 5IJVA 4WUUD 4L9DA 1HXYB 2OTUA 1KJ3H 3SE3A 5CBAA 5JHLL 3QDHA 2YD2A 2C1OA 1YJDH 1FH5H 1RZJL 1CLOH 3QCUH 5TQ0L 2OXGA 3SY0B 5D7JA 3I75B 1T83A 1WWBX 4WO4A 3MODL 3UDWA 5J06A 1IGML 5SV3A 5H2BA 1MWAA 3WDJA 1YZZA 2FBOJ 5GSVB 4JLRA 2EDKA 3QDJD 1M7XA 3DOSA 5TE7H 5DJXA 5C0AA 5EU3A 5C6TH 3MQIA 5DC9B 4R4ND 4ZUSA 2EICA 4LSUH 4RWHA 5I8KH 1MREL 1JCKA 4JO3L 5EOTA 1YA5A 1HSAA 2DKUA 3WO4B 4Q9CA 2VDQH 5GRJH 1W0YT 4O5LL 3VWJA 2W1NA 4DGIH 4WV1A 5C7XL 2YWZA 3S3PA 3GJFA 1L9MA 2GITB 1B4JL 3ZKXB 3ZDXE 3GHBL 1J8HE 1HQ4B 1JZ3A 2PNDA 3NIDF 1MFAL 3MRMA 1G1YA 5SWZE 2EYRB 1INQB 2G75A 1BFOB 4I48B 4OCRL 4HIEB 1U8IA 1FZKB 3LIZH 3C5ZA 4KTDL 1GGBL 1IGFH 1YEEL 2FX8H 3HMXL 1XF3B 3OKNA 5FF6B 3U0TB 5FFLA 5IWLA 2E7LC 4MQ7B 4MB3A 4PJHF 1FO0L 2N1KA 3W0WD 1E4XL 2MCPL 4Y2DA 2M8XA 4HWZB 4DVRL 3ULVL 2I9LA 4GMTL 3MRKB 3MCLL 3QRGL 1J0JA 4KK8C 1FNEB 2J12B 2ADFL 1WFNA 2VZTA 5KSAC 3FQXA 3MNVA 4OLYH 4C56E 4L9LA 3RY6C 3SDDA 4K3DH 1RZFL 4ISVB 3GSRA 1LD9A 4U05A 1MH5B 2BSRA 2W60B 4OZIB 4NC2B 3IDGA 1DDHB 2VQUA 5DC4B 3U4AA 2B1HH 3QHTC 1WAAF 5ILTL 2DLHA 5HGDB 1I9RL 3B6SA 5JXAL 4NC0B 2DTMH 1WGOA 4AEFA 3LN4A 1RJLA 4QRRE 4Y4FB 3I50H 1NDGA 3ALPA 4G6KH 2E7BA 1QYGL 2VISA 3PWLA 4Q9RL 2NY1B 1Z3GL 1TIUA 3MYJA 2BVQA 3G5XA 3ROLB 5KAQG 3RP1A 4P5MB 2P24B 3BKMH 4K3JH 3S4SB 3TH3T 2C1PB 5I8OH 2R0LH 3MOBL 4K9EC 1A6VH 2YC1B 3BKYL 4EUPG 3RWDB 3LDBC 4TRPL 3ULUE 5KSBA 4FFZH 3MNZA 4UV7L 4PTUA 4RGMB 3JTTB 4OCNC 4JN2B 3SOBH 2GW5A 1LO5B 3JV0A 3OSKA 2MOVA 1SJVA 2HFEB 3D5OF 2QADD 3HNTH 2Z31C 5EPMB 4LASL 4LK4A 1QTYT 4H88H 2I07A 4KRPD 4B0MM 5TE4H 4KHXL 5J12C 4TTDC 1ZVYA 4K23L 3O3DB 3N1GC 1RK1A 1FE8L 3K1KC 1I75A 3MGTB 4GAFB 3SO3C 4PP1C 4JZJC 2OQJA 2WIIA 1P7HL 4UV4L 3QQ4A 3D3VB 7FABH 1NCCH 1GC1H 3FQRA 3C6LD 1KUMA 2XRAL 2P8MB 3DSFL 2IBZY 4QHNA 3PWPA 1X4ZA 3QISA 4LPYA 4ODUB 1UADC 3OMZA 3VMOA 4JRYD 5GGVY 3ESUF 4LNVA 2IBZX 3FO0H 3TESA 4NN6C 3NCYP 3IS0X 2ICWI 3PWJA 4UOJA 1X5XA 1MQ8A 4P2OB 2IH3A 3VG0H 3MA9H 4ONGL 5F71A 2FR4A 1C5CH 2GJ6A 1FVCA 3I6GA 5HHQB 4YHNA 1TVBB 2CKBH 2UZIL 5D7LD 5HHOD 4Y16C 3VXSB 1JK8A 2FL5B 1H8SA 4Z7WE 3WHE1 5JPMB 1YY8A 1TZGH 1LEGA 1A6UH 4JG1L 5JW3L 4KZEL 1XGQB 1A7QH 2YD4A 4XP9H 4Q0XH 3PDOA 3ARBD 3TO4D 5DJCA 4XMKH 3BZEA 2VXSH 1KPRA 4FQ1L 1CU4L 5D71L 4UAOB 3S36H 2CIIB 5I75C 5SWSD 4GKOA 3WNPA 1BJ1H 5IW3A 5D6CB 4Q2ZA 4YHLH 3CDFA 4PGCB 4S1DC 1YNTA 5T3ZD 2GSIA 2L7UA 3SDAA 2WBKA 5C71A 5D5MA 5EWIH 1SEQH 3M1BA 4K3GA 1RUQL 2F53D 1A9BA 3DXAD 2ITCA 2GUOB 4KDTA 4LMQE 2NNAB 2G5BB 1DSFH 2RBLA 1GHFH 4PJAF 4KVNL 1T04B 1JPGB 1IM9B 1HCFX 2AK4A 4NRXA 3DBXB 3T2PA 3QCUL 2FH6A 3ES6A 3L5HA 1OGTB 1QQDA 4HS3B 4FQXA 3U9UA 1LP9A 3D25A 4MYWB 5JA8B 4G3YH 4YQXH 3PXJA 2I27N 1W72B 2XWBA 4LLWB 3P9LB 5C92A 1P9MA 4KY1L 3WMSA 5HJ3B 3EO9H 3QXAA 3QNXB 4LSUL 2FEEI 3P0GB 4GFTB 4OLUH 3IGAA 4K94L 5F70A 4YXKL 2D9QB 4WWID 1VFAA 4Z0XA 2VDQL 2DAVA 3HRZB 4XMLL 3UTPD 4D8PA 4MQSB 1QR1B 2EDHA 4O2EB 2D0GA 4G5ZH 4LKCA 4JPKL 5GHWL 5IBTL 2GAZB 3TYFB 1VFBA 1HWGB 1ZAGA 1CK0H 5ICYB 4PG2C 3BW9B 4YC2C 3QYCA 1S5HA 1FLTX 3WUZA 2JB6B 2FX8L 2O5ZH 1OP5K 3WJJA 5ICZB 1YEDA 4RGND 3DMMC 1ZSDA 4I0PB 1I85A 4FQHA 3PGFL 3STZA 1UXSA 4JFYB 3MV9E 5FOBB 4M8QB 2ORBH 3DYPA 3N85L 4ODSH 2V17H 3QWOA 3WFDH 1KENH 4XXDA 3CD4A 4WJ5B 5DMKB 5A16A 3BAEL 4LCCB 1KFAL 4NBYB 4F7MB 4DGVH 1K4CA 2H2PD 3QO0B 3CFEB 4WU7B 3QXTA 3SCMA 3MCG1 4PJIE 3X13A 4QHMB 5CSZB 5LJYH 1ITBB 3QXUA 4A2LA 1UWGH 4U6HB 4Q6YA 1J8KA 5KSBF 4OQ1A 4XXCA 3RTQB 4HFWB 4NC1C 1HNGA 4PRHB 3WLWD 3QT2A 2PKDA 3QZWB 4L3EE 5KSUA 3V6ZB 3EGSA 3F8UB 3NCYS 1FVEB 5E0QA 1Y6MR 2QR0B 2YMXH 5C2BH 1T80A 4E42B 5I9QC 2ICWB 2NY0D 4LSQH 3HUJB 4W4OA 5DHVB 4Z7NE 3FN0L 1O7VA 3BKML 2HYMA 4UOW0 5I0ZA 1R5VA 4JHWH 3QUMB 1CDIA 1A6VL 4YFEA 3C60D 2DQTL 4FFZL 3BP7B 2OI9C 3UJIL 4JM4H 4OZHE 3QIUC 3BN3B 3VXUA 5FHAH 4EN3C 4YHML 4ZTOL 4ELKA 3S35H 4NRZB 4OLXL 3HNTL 4R2GD 4JGMA 1A6PA 1TETH 4K8RD 3LHPL 2NCMA 1ZEAL 4TTDD 4BH7A 1FG2A 2ZUQB 4X6CB 4K7PL 5IIEB 1RVFL 2HVJA 3REWA 3P9WB 1NUNB 3QHFH 2NX5E 5FUZH 3EAKA 5FHBH 5JA9A 3KAAA 2CRMA 4M7ZB 3SKOA 4KJQD 2A83B 4MHHI 4RRPA 3QQ3A 1GC1L 4IRJA 2IALA 3O3AA 1J0ZA 1HEZA 4ORGA 4XVTH 4X6EB 1MEXH 3RUGB 3NZHH 5F8QC 3G5YB 3E8UH 2OX5A 2VC2L 3UC0H 1VGEH 3WE6A 4BSJA 3HNVH 1CXHA 4FXKA 2AJXH 5SX5H 2ADIA 1NEUA 5DQJB 1E4XI 3IDYB 1IT9H 4NN7B 4EBQL 4J8RB 3RGHA 1RU9L 4ZTPH 4PP2B 3VMPA 1RZIB 2NXYD 2FO4B 4PLKD 5F9OL 1ZLVK 3R06B 2R2EB 1FV1A 1NC4A 32C2A 4NKDB 5D5MF 5KZCB 5FM5O 2DLEA 4JFZH 1TZGL 5ID0B 1Y6KR 5EZJA 1I3VA 4E41A 3QG6A 2EE9A 1S7RA 4G9FA 4XNZB 1VB9A 2D7OA 3LKNA 1I3RA 3EYFB 1HDMB 3CFCH 4Y2OA 3VFOB 1EBAA 4LCWB 1E4KC 4YFLF 1LO3H 4A6YB 4XGZB 4PBXA 2HRPL 4ZOAA 4YHLL 4OTXL 5I74C 4Y19D 4NPYA 5F44A 4DZ8B 5BQ7B 1OF2B 5GJSH 3VXMA 4XAKE 1NQBA 1CGSH 2JIXD 2ZNWA 2HKHH 4RGOH 5GPRA 2I26N 1F4XH 3LQMA 3RGVB 1WTLA 1GIGL 1IZKA 3KJ4C 4FTVE 3B8YA 3B83A 3QUXC 3SPVB 3ARED 1WBYB 2WBJB 4HUWB 1PY9A 2WLZA 4V2BA 2IWGA 4QXUH 4N0UA 1IAKB 1IE5A 1UQSA 2GJZB 2ZSVA 1E6OH 3O3EA 2Q8AH 3AVEA 4K3EH 1M71B 5GS3A 3ILQC 1T22B 2C4FU 3W5MA 1OP3H 4GAJH 4NQDB 3WLBB 4JQIH 3EO9L 4P4KB 5CBEB 1P5VA 4PTTA 3MXWH 4M62H 3ZE0F 1OTSD 4XNUL 1IFHL 1IKFH 1S9VB 5E1AB 1YNKH 1D7FA 3BQUB 3CPLB 1MHPH 1T03H 1FCCA 2YUWA 1A2YA 4N90D 4Z7UA 5FYJD 4XTRD 5H35A 1QEWB 1FVDA 4AM0A 4OM1H 4XPAH 3T0ED 2RR3A 4EUPA 5FV1L 1F3DJ 3QO1A 3IFPB 1W72H 4QOKE 3DMMD 5D2NC 3G04B 1IC4H 4NZRH 3RVVC 2XZQH 3BUYB 2DRUA 1F6LL 3VFUB 3VFSA 1PVHA 3VRLF 5JORA 4U6YA 1BIIB 5A1AA 2M1KA 4WW1B 4JO2L 1MFNA 2QV2A 5HI5C 4M00A 2UYLA 1OAQL 5IGXL 1ZT4B 1WK0A 2XN9B 4NOFA 1N59B 4J6RH 2PXYA 1YJDC 3QNZA 4I18A 3V6OC 1AIFB 4HZAA 5C0ND 2VOTA 1MNUL 1TJHL 4PJXA 3R8QA 3SJVB 4OZFG 5DMGC 5EU7C 3NIFE 4F57L 1QSFE 3MLTA 1W0VA 1UWGL 4TSAL 4CL7A 1V7MH 1SYVA 4JDTL 1A7NL 4K71B 1J7VR 3TC9A 5L88L 4G6AD 4LU5L 2DQEH 3DROA 3L7EA 3SDCB 1F58L 4CRPA 2YMXL 2I25N 3RZCC 3DV4A 3CSPA 1XIWC 1X5FA 3KYNA 1I9IH 3GRWH 1HWHB 2EDWA 3SKMA 2FZ3B 1T1XB 4JHWL 1ES0B 3RL2B 2EIZA 3IXAB 5TDNB 5GGSA 3O6FB 3IFOB 4W68A 4TSBH 4LARH 5F7LB 4ODVH 3QIUD 4LLYB 3ZHDA 4QHUA 2HJLA 4JM4L 1CTOA 3DI3B 2OR7A 1E4WL 2R4RL 2YPLB 4UUJB 5C6WH 4R8WL 1S9KC 1R3LA 3FB7A 3HFML 4YZFE 3RY4A 3HA0A 3GK8L 3LQAH 3MRQA 3G9VA 3MRDB 3VD7A 3B2VL 4M61A 2KL6A 5KVFH 1QBAA 4G80B 4YDJA 2NYYC 2DTSA 2PYFB 5C8JA 1X5YA 3L7FB 3QHFL 3PL6B 1DBKH 3T4AB 5FHBL 2PO6B 5AEAA 2HVKA 1FYTE 5F9WC 3OG4B 4OIAA 3X12A 4XWOC 2XA3A 4XVTL 1IGCH 5ALCL 3QUMH 3B2UC 4OZ4B 4KI1A 3T3PE 4GH7B 3BT2H 4PRPA 3ARVA 1U8HA 4ONFH 5IJVB 4H25A 3H9SD 1RJZA 4LEXL 1LEIA 2OTUB 4HEPG 1WCBA 5CBAB 5J56B 4CW1A 4IDJH 2C1OB 1KPUA 1MPAH 2WWKO 5D7JB 1KULA 5AZ2H 3LSOA 3NFSH 4WO4B 2FCBA 2V7NA 3O2DA 4GBXC 4MD4A 1QO3A 2CRYA 5F7EH 4WEBH 4O4YH 4OV5A 5H2BB 1MWAB 4YEFA 4JJ5B 1JYXA 4JLRB 1INDL 3A67H 1J18A 5HHXH 3MRCA 1AKJA 3BEWA 5DJXB 5EU3B 5C0AB 4HH9A 4JFZL 3JV4A 4ZUSB 4MA8L 1I8KA 5E8EA 4NO0A 5EOTB 1G0DA 4KKAD 2JB5H 4XNQA 5C0CE 1JYWA 2AJVH 1MI5E 3VG9B 1HSAB 4UZGA 4TNWF 5DUPH 2NY5C 2Z9TA 4Y4HC 1ZHKA 1DCLA 1BFTA 2PW1A 3QCVH 1QBML 5IKCA 4OB5H 3HE7D 5BW7C 1N5YL 4PV8A 3QNYA 3VWJB 2JK5B 3O2VH 4P49A 5DFVD 3CFCL 4WV1B 3GJFB 1CFVL 2Y1VA 3JV6A 2AXHA 1BZQK 3CH8A 5HPOA 3JVGA 3H9HA 1N3NA 1XGYL 3MRMB 4RGOL 4N68A 5D1XA 2G75B 4LQFH 4WEUD 1U8IB 4AMKH 1KGCE 4J4PA 4PFEA 3OKNB 4ZSOA 3ZTNH 1HYSC 1XF5A 2GFBA 3DRTB 4OCMC 4KUZL 4JN1H 4FQ2L 3ECBA 4Y5YA 2FD6L 4J23A 3QDMA 5F7FA 2I9LB 4M8VA 5TH2A 8FABA 3X3GH 2W0LA 2J7LA 1KACB 4LHJB 3TFKC 4LRIA 4DKEL 2KPNA 3FQXB 3MNVB 4NFCA 4DKAA 4JM2F 4YFLI 2QQLH 4L9LB 4OIBA 5GSRA 3ILQD 3SDDB 3WNOA 2VQ1A 3VGAC 1U8PA 1LD9B 2CLZA 4K3EL 2BSRB 1NUGA 1AO7E 3IDGB 5CJXA 4MJ6A 4ZS7H 4F37F 2B4CL 2QTEA 3MJ9A 1CL7H 2A6JA 4ZFFA 5IFHH 2ZWLT 4JQIL 3B6SB 1KB5H 2Y7QA 1U8NA 3CK0H 4JKLA 4HK0A 3MXWL 3LN4B 1RJLB 4UINL 5M95B 1KCLA 3S3JA 1NDGB 1IKFL 3ZDZF 1QLEL 2YK1H 4Z6AT 2R23A 2VISB 2Z35A 3PWLB 5ITBH 1C16A 1EEQA 2EEDA 4ZS6C 1MHPL 1T03L 4CNIA 4OZGA 4KV5E 4XPFL 2EO9A 5CSGA 3TJHC 4D0BA 3MYJB 3ZDYE 2BVQB 2WK2A 1MJ8L 4LPUA 3G5XB 3ULVE 1GOFA 1TZHA 5TE6L 5L0QB 5F93C 2B2XH 3B3IA 2VLKD 3RVVD 3GBNL 1FP5A 2HT3D 4NZRL 5KSBB 3MNZB 4PTUB 2I60L 1A6WH 5L8KB 4KGLA 4LSTL 4HGKC 4JB9L 4L8DA 2FX9H 1I9JH 5EUOF 2X9YA 3MZGB 1T0PB 2I07B 1GGUA 1ZANH 2DN7A 3BZ4A 3FFCD 3GHEH 1RK1B 3QUYC 1ZMYA 2D7MA 2OQJB 2WIIB 4MD0A 4MZ2A 5KSVA 1ZTXH 3QQ4B 3CMOL 1UCBH 3UXFA 4Z8FH 1AR2A 3RU8H 4DTGH 2Q76A 2J4WH 3D69A 3BD4A 1A1MA 2E7CA 2P5WD 1EO5A 3PWPB 5BZWA 5FO9A 5K9QG 2AEQL 3P9MA 3P30L 4U1HA 1F3JA 3PWVA 1T3FA 2F19H 3RZCD 4MNQA 5HDOA 4I8DA 1IAOA 5FGSA 3PWJB 1OGAD 1J5OH 4P46D 4HMEA 2OZ4H 1NC2A 2IH3B 3UBXG 2GJ6B 5F6IB 4RWYH 1FVCB 1QFUL 3I6GB 4HSQA 4PD4K 4YHNB 1CVRA 2VXQH 1BMGA 1EA9C 3EOTL 1JK8B 2Z92A 1UCTA 2FJGA 4OF6A 4LARL 1MOEA 4JFDD 3WIIH 1YY8B 1LEGB 3OGOE 1S9XA 4ALAL 2RFXA 1MRFH 4M6AA 3VI4F 2OM5A 3MXVH 1JIBA 3PDOB 1RZ8A 1ZLWK 2AP2A 3IDJA 5D4QA 3D39D 3EYSH 3E3QE 3EW3B 3BZEB 1KPRB 1YPZA 4TUJB 2BVUA 4HLJA 1SY6L 1I1RA 4MAYA 1DTUA 1FNFA 3FCTA 3WO4C 1BOGA 1DBKL 1OTTC 4Q2ZB 4Z7QF 4ODTL 1RIVH 4X8JA 1CDUA 1YNTB 4TVPD 3B2UD 2GSIB 3SDAB 5EU5A 4KI5F 5D5MB 3HLAA 5I1IL 4MA3A 3M1BB 4GXVL 3ZKXC 1T1ZA 1L4IA 3QB7C 3D0LA 2E5EA 4X7DC 5K9OA 5MENA 1UZ6E 5DVKA 4EQ2A 2EDXA 1TJGL 2JJUA 3AY4A 4L5FL 4ENEC 3VGHA 4Y5XA 1UM6L 2AK4B 4HD9A 2GTWA 4NRXB 2WWKT 1I1YB 1EBPA 3ES6B 1MPAL 4PLOB 1QQDB 5IESL 4FQXB 1KV3A 1LP9B 5HGHA 4LEOA 3D25B 3EYOA 5KW9H 4WEBL 4O4YL 1QBLL 3GO1L 2XWBB 4YHKL 4HAGA 2UUDK 4U1IA 3QXAB 4B50A 2OJZL 5E2VL 3RQ3A 2FHCA 1B6UA 1DQJA 3ROOA 3IGAB 5D2NE 4OB5L 1VFAB 2ZCLL 4Z0XB 4DN3H 1JV5A 1OTUC 4Y4FC 5ESVB 3O2VL 4D8PB 2QJDA 1V3JA 3D85D 1MVFA 2NY1C 4LKCB 5MEOA 1AFVL 2DS4A 5A40E 1EHXA 1VFBB 1KYOK 4XPHH 1MWAH 3ARWA 5IBLC 1S5HB 2MQ3A 4AMKL 1X5HA 4JO4L 5HVGB 1X5AA 2WBWB 4HWEH 3DUUA 1YEDB 1ZSDB 4FQHB 4JN1L 2IQ9L 1U8LB 3STZB 2D0HA 1UXSB 2VZOA 1I3UA 4UIKL 5T1DH 3S34L 2E3VA 3MRHA 5C08D 3IJSA 3QWOB 4RGMC 5T5FL 2VR5A 2YKLL 4XXDB 5A16B 5INCB 4ZPVA 4OZFA 3VU2A 1K4CB 4C56D 1F42A 1V05A 3SCMB 5ACZA 1QSEA 3WDIA 5CCKL 3X13B 5J7CC 5DMIH 5CP3H 5C09E 3QUKB 1EGJL 3OBAA 4EVNA 4HWBH 1KB5L 3BD5A 3HB3C 2J5LB 4QRRD 2APBA 3FTGA 1ERNA 3UTSA 5KSUB 3AXLA 4HEME 4NJ9H 1IAII 3TJHD 3EGSB 4X6DA 1J86A 5DO2D 2HH0H 4QRPD 1BZ7A 5E7BA 2WQ8A 4PUBH 4WUKH 2J3SA 5DD0L 1PLGH 4K3HA 3HMWH 5HI4D 1R5VB 1V5JA 4XP4L 2NXZD 2WZPD 2G60L 1G7LA 1DR9A 2JCCF 3T04D 3DVNA 4L8BA 1A6WL 4M9PA 1A4KA 3VXUB 3U0WL 3O45A 4ELKB 3MUZ1 4HIIA 4HXBL 1A6TA 2AXGA 2CUHA 3BH9A 2ZPKH 3HG1A 4BH7B 3QUYD 3RVWC 1FG2B 5BRZD 4PJCE 2DYPD 3V7AE 1I7UA 2HVJB 2HLAA 3REWB 1P7KA 2PCPA 3SKOB 4LOUD 4TNVK 1ZTXL 2EYTA 4UAOC 5F1SA 1NANH 3G6AA 3QQ3B 4ZD3H 5KBNC 4IRJB 1OAYL 2IALB 3O3AB 1HEZB 4I1NB 3MLSH 4ORGB 3IDUA 2PTVA 1I8LA 1DEDA 1JNJA 1CN4A 3C5JA 3VI3F 5C0FA 5CEZH 5I1GL 3WE6B 5C70A 1UENA 2NQCA 4FXKB 2BJMH 1Q9LB 4OF0A 5E2UH 5K59F 2ADIB 4LHQB 1DQML 5I71B 4JY5L 1RURH 2O5XL 1TDQA 1TFHA 2DQFA 1VFUA 1EZVY 1G9NC 5DD6A 5ID1A 4L4TA 5HVFB 1MCSA 1FV1B 1NC4B 3GI9L 5AYUH 3GBMH 1EZVX 1WC7B 3WHE0 1EXUA 5GGTA 5C1MB 3KXFA 5EZJB 4E41B 3QG6B 1RUPH 3FQTA 4ZUUA 1MRFL 1EEZA 1LK2A 2Z8RA 1FLRL 1SVCP 1S7RB 4G9FB 2HLFC 1CDJA 3LKNB 5GS0D 4KUCF 1IARB 1I3RB 1YY9C 4M1GH 3S88H 4LGSB 3C8KA 4F33A 4JGUA 4ODWA 2X1XR 4NPYB 4PBVC 3SQBA 2P5EA 1IL1A 3VXMB 1CF8H 5CS7A 1X4YA 4Q9QH 4R7NA 1EO8H 4HQQL 1W0WA 4X5XA 2WUCL 2FEDD 5HHOA 4RFEA 2W9DH 2W91A 2GI7A 2WWMD 3QI9A 4HUNB 1KC5H 4HPOL 3GMLA 3MLWH 4B7LA 4I0PC 4U3HA 3T0BA 1HQRA 5DRZA 4N0UB 2VH5H 3SDXA 1OVZA 3FT4A 5IVZA 1UQSB 2ZSVB 4MVBC 1H9VA 3CLFL 4LCCC 2YBRA 1LILA 2L4OA 1FZOA 1H3UA 4U7SA 2YD6A 4MXVF 1RZKC 4PTTB 2HT4C 1L0YA 1CLYH 2J8UE 2BSSA 3S37X 2J88L 3THML 3TV3H 4KXZI 3KLHD 3DXAA 2YEZA 3GM8A 3VGDA 1F5WA 2IGFL 4GG6E 5CAYB 1N8ZA 1JPFA 4OAWA 1DQTA 4Z7UB 3R0NA 5H35B 1FVDB 4X4MA 5EZIL 4AM0B 1E6JL 2RCSH 4OGYH 1NGPL 3O9WA 3QO1B 5J6HA 4TQEL 3CDYA 3MLRH 1EJ6A 1NCBH 1SM3H 4WEMB 1CXFA 3VGFA 2AJSH 4XNXL 3VFSB 1HHKA 5JORB 4U6YB 4QNPE 4UI2A 4R4BA 1IEBA 5J1TC 4OUUA 2LAAA 5K9JH 1EHAA 3W2DH 4LHUD 3MV9D 4JFFE 3O3BA 1HHIA 1WJ3A 2UYLB 4KKLC 4EDXA 5J89A 1ZT1A 3T08A 1I1FA 2EO1A 2PXYB 4JFOA 3QNZB 1UEMA 3MOAL 4I18B 3B9KD 3V4PH 4Y1AA 1BF2A 3LPWA 1JHKH 3PHSA 3HPLA 4PJXB 4R90H 3I2CH 3IFLH 2ZUQC 5L2KD 1TXKA 3MLTB 4O58L 4HJJL 2VDRH 1W0VB 3PQYA 4NIKB 3SQOH 1NMBH 4M7ZC 5TFSH 5CWSA 2X89D 2F8VA 4N8CH 1SYVB 1U6AL 3WJLC 1X4XA 2XXCB 1YUHA 1BAFL 2CJUH 3AS0A 3BUTA 3DURA 1FC2D 5HBBA 1DN0A 4GXUN 3DROB 3L7EB 4OLWL 4POYA 4NZTL 4BELD 5HXMA 2OTPA 3DV4B 3UBXA 5JXEA 4IJ3B 3Q1SH 4WUKL 1KTLA 3KYNB 4J3OC 3RPIA 4P2OD 3SKMB 3IDYC 4NN7C 2EIZB 5GGSB 4W6XB 3JWOC 4PJDE 4JPWH 2C3GA 3VXSD 2MQ0A 1J1XL 4FS0A 4QHUB 2HJLB 1J1PH 1TNNA 1JRHL 2KZ1B 1T1WA 4X6FA 1R3LB 3FB7B 5C0BE 2BVOA 1OQOA 3N9GL 1MFDL 3MRQB 2D0FA 4FQQA 2Z8VC 1BWMA 2W38A 3S96A 2YD7A 1IGJA 2WSKA 4M61B 3LZFH 4YDJB 2EXYC 3MRJA 4G9DA 5C8JB 4RMTA 4XNZC 1DFBH 4NKMA 4WHTA 3QH3A 5IW6A 2HVKB 4M3KB 2APVA 4YPGB 1QRNE 1F90L 1DE4A 4WCYH 2X09A 3X12B 4TOYH 1JZ7A 4ELMA 4RISL 4PB9H 1ONQA 2FLRT 5DUML 1P1ZA 2CK0H 4PRPB 3RVTC 1U8HB 4L4JA 1PZ5A 4H25B 4ETYA 1RJZB 1LEIB 4BZYA 5J1AB 4PREA 2WM0A 3L3JA 5EZOL 3RGVC 4CW1B 1KPUB 1IM9D 4IM8A 2JJSA 3LSOB 1LQSR 1CT8A 2WBJC 2VWEC 1GPOL 2V7NB 4MD4B 1QO3B 4U7MA 4OV5B 1C5BH 2F15A 4M6ML 2OK0H 1J12A 3F58L 1OARL 1AKJB 3BEWB 4QXGL 4QGTA 3JV4B 1N0LA 1I8KB 5E8EB 4NO0B 2XWJA 2HLFD 3WS6A 5ERWA 1TCRB 4XNQB 2ZKHL 4HX1A 1YY9D 1ZHKB 2KDGA 4P4KC 2PW1B 5IKCB 1BQHG 1RY7B 3AGVA 4PV8B 5GRZA 5LGHH 3QNYB 4ESKA 3FT3A 1CGTA 3FMGH 4BYHA 2AKRA 4OGXL 4D2NA 5IHUH 3JV6B 3BQUC 4H0GA 4POZC 4OLVH 4ZUTB 2DQGL 1BFVL 1CF8L 1NAMA 3H9HB 4WI2A 1N3NB 1DLFL 4GAYA 4XAKD 3FQWA 1RV6X 4Q9QL 4S1RH 5D1XB 3EJYC 1OW0A 1F4WL 3GJFK 4KAQH 1EHLH 5IW1A 1YDPA 4HJ0D 4ZSOB 2D7NA 1FFPA 1XF5B 2GFBB 2W9DL 4ZFZA 1IQDA 3ECBB 4Y5YB 1N2RA 3QDMB 4I0PD 2AW2A 5TH2B 1JJUA 2XV6B 3TA3D 8FABB 4YHPA 1KC5L 1ZT7B 1ZGLA 5KJRH 4Z0BH 1EAJA 4HUKB 5EOQH 5GSRB 2VQ1B 5DJ6A 5JQHC 4GSDL 2CLZB 1NGZA 4ODXA 4S11A 4MJ6B 3VGGA 5EBLA 5IM7A 1IBGL 2A6JB 3HI6L 3LS4H 4ZFFB 4Y19A 2Y7QB 1U8NB 1WCQA 4HK0B 3H6JA 5F9JA 1K8IA 3ZTJG 4AEIL 3AS2A 3V0AC 3TPUA 3RTQD 4I3RL 2Y06H 1T2QL 2R23B 2Z35B 3RX5A 1C16B 3TPKA 4OCYH 4CNIB 4OZGB 4K71C 3NA4A 4D0BB 3AREA 4HG4K 2AJUH 3CFKA 5A2LH 3Q48A 1AGEA 3ARYA 3IU4H 3RIFF 2APWA 3SDCC 3ETBF 1TZHB 4F80A 5JOPD 1GJIA 3JSSA 3B3IB 2VRAA 5KVEL 3GMOA 2GHWB 4QOKD 1H3WM 3T0AA 4Y5VA 3L1OH 1IZJA 4FG6D 1BQSA 1MIEL 5IOPA 3O6FC 5K9JL 3NMEA 1I3GH 4KKLD 1AQKL 3W2DL 3RPKA 1WFOA 4G6JH 1T0NA 1VDGA 4L8DB 5CD3A 4IHOA 3QXDB 4M7KH 5ISZE 3V0VA 5DVLA 3MJGX 1MCLA 3BZ4B 1IAIH 3GSNL 1H0DA 1S5IH 3D1MC 3KHOA 1JHKL 5IFAL 2VDMH 4R90L 3RNKA 2EC8A 5CJQL 1ZV5A 4MD0B 2R2HA 1JYVA 3T2QA 1GZPA 1IQWH 2Q76B 3D69B 5T5NF 4PPTA 3PL6C 1A1MB 1NMBL 2PO6C 4LSVH 3BZDA 3T0EA 5BZWB 4WFFD 1D3CA 5IVXA 5FO9B 4IMLA 5LBSL 1CXEA 5M7QA 4LP5A 3P9MB 2DBJA 4U1HB 1KXQE 1F3JB 3KYMA 3PWVB 4PJFA 4KZDH 4NT6B 1VKXA 3W11D 1T3FB 4J3WA 3NACH 2VLLA 4GAGH 4MNQB 3BD3A 5D8JH 3BPLB 1A3LH 1N6VA 2UVEA 5D2LF 1UGNA 1CGWA 4PYGA 2QQKH 3SE3C 4WGVB 1NC2B 2EDDA 1NLDH 2H8PA 1MCWW 3ARFA 3EDEA 2C4FT 3D2UA 1RUAH 1WV7T 5D7JC 1JHLL 4P2QA 5BS0E 3JZ7A 4WO4C 4HUUA 1FL5A 2Z92B 5I1EH 2FJGB 4JPWL 3UDWC 4U3CA 1XR9A 5EIVA 1P4IH 2DI7A 4YE4L 1S9XB 3C6SA 2OYPA 1EO7A 2RFXB 7CGTA 2NW2A 4KROD 1FIEA 3ZKNC 3LB6C 4X80H 3VD5A 4LCIL 2H1PH 1RZ8B 2G2RA 2UWEF 3G5ZA 2EXYD 1N6QH 4CU8A 1YPZB 3P4OA 4ETQA 4Z5RA 1MLCA 3VG9C 4FABL 1UH4A 2DIBA 4MAYB 3RWCA 3FCTB 1SBSH 5LAXA 4XNYL 4HHAA 1BOGB 3MZTA 2O5YH 1G7MA 4X8JB 3VWJC 3CFJA 5H37H 4WV1C 4WCYL 5F7NC 4LVOB 1KT2A 3QUZA 4S0TD 5EU5B 3HLAB 1U41A 4MA3B 3RVTD 1AC0A 1T1ZB 2OR8A 3D0LB 2D9CA 4ONHA 5K9OB 5MENB 4RFOH 5KS9A 5DGRA 2OBGA 4HIHA 4RAVA 4Y5XB 3KS0H 2GTWB 2MMXA 3QCTL 4HIXH 4H8WH 4LEOB 5E08L 1JNHA 3EYOB 3MUHL 4XC3L 4L1HA 3ZE2E 4C4KT 1F45A 3W82A 5BVJA 3O2WH 1PEZA 3QQNA 4YBQC 2K1MA 4L9LC 2LQRA 1KJ2A 3SDDC 4U1IB 3DO3A 5HYIA 4XCEA 4AG4L 5I1CL 2IFFL 1O5DT 5D7IF 1JL8A 3HUJE 5IB4A 3EO1A 1DQJB 3ROOB 1MI5D 1WFTA 2IMMA 4D9QE 3IDXH 1JV5B 3H9SA 2ESVE 3LMJH 1AGCA 5DJ2A 2OCFD 3EIFA 4FQLH 4N5EC 4OQTA 1ROWA 5MEOB 1PKQB 4PRDA 3EJYD 4MXWL 2Q6WA 4HKXA 1ULVA 5IP4A 2RIKA 5L0QC 4M4RA 1MRDH 1M05A 3DUUB 2BRRL 1MRCH 2VMFA 4YBLB 4YAQA 5C07A 4PJBE 3MRHB 4KQ3H 3IJSB 3W9DA 1SMAA 5J13B 1KBGH 3ABZA 3IFNH 1S7UA 4KXZH 2BY0A 1JRHI 3GIZH 4ZPVB 4Z0BL 3G6JE 1PYWA 2C4XA 5EOQL 3BHBA 4D9RE 1S78D 4UB0H 5ACZB 1OT1A 5E99L 3BPNB 4EXKA 2HJKA 1AO7D 4JRXA 4BQCA 4K94C 3GBLA 1MFBH 4EVNB 2FHFA 1CG9A 4GG8A 3K80A 2A38A 3FTGB 3UTSB 4CJ0A 3AXLB 1DQLH 3KPNA 4X6DB 2H32A 3Q5YA 3KPMA 4IOFD 3TBVA 2Q20A 1DUZA 1HH6A 3BE1H 1BZ7B 5B4MD 1KEMH 1A0QL 4PJ7A 3ULVD 2OMNA 1Z6JT 3GI8H 2R0ZH 1G7LB 5F6IC 1F3RB 3FRUA 3MRNA 1SYSA 3NCCB 3DVNB 2IAMA 5D7SL 4L8BB 4LCWE 1A4KB 5DEGA 3O45B 1WF5A 5MHSE 2NY6D 4HIIB 4HBCH 1FFRA 1A6TB 3H8NA 2AXGB 3ARSA 3BH9B 4J3TA 3HG1B 4NO3A 4WWKD 3BP4A 2X5PA 1BQUA 1MCOH 2QL1A 3O3UN 1I7UB 1MQKH 2HLAB 3CVHA 4PRID 1OQXA 3CZJA 3MJ7A 2VDML 1P7KB 3D18A 2EYTB 1XH3A 1C1EH 3PL6D 3V0WL 2PO6D 3G6AB 4ZG1A 1BWWA 5K9QI 5FAAA 2I5YH 2A9NH 5CZXD 4RBPH 2J6EA 2NTSP 1YMMD 3C5JB 1V3KA 1X5KA 4LSPH 3SDAC 5C0FB 3U1SH 1H3PL 4OQTL 1LO4H 4TUKL 4NFBA 2Y5TB 3NACL 2DMKA 5D8JL 1IM3A 4KDTC 3NIDE 5C0GA 3UBXI 2QADB 5D7JD 1JPTH 3HAEG 1U2HA 2D31A 2DQFB 4UILL 4PJHE 1FFOA 5DD6B 4LHUG 4KRPB 4AYFA 3FFCA 5ID1B 1WEJL 4L4TB 1A3QA 1BQLH 3VDBA 1HSBA 4FQXC 2R0WL 5B38B 1U3JA 2EDRA 1S7XA 3RZWA 4EOWH 3IJHA 4LLAA 1BJ8A 4EI6A 3VD9A 3MFFA 1EXUB 4FHBD 5TGBA 3KXFB 4WFGD 3ZKND 5LXGL 2H2SC 3MROA 1U0QA 1ZOXA 4ZUUB 2VDNH 1EEZB 2BNRE 2P5WA 1LK2B 4X7FC 3TWCH 5I8EA 2R4SL 3LEXA 4TUOA 2BVYA 4ZAKD 3WIHH 1WAAE 4XVUD 3C8KB 4F33B 4HGWA 4ODWB 2HT2C 4K7PX 1AQDA 1M6OA 2GCYA 4P46A 4F8TA 2FYYA 4NKOA 4R7NB 4ZPTA 2DQIH 1W0WB 4X5XB 1IAIM 4HUXA 4GRMA 1XF2A 5HHOB 3C5ZD 4RFEB 3MLVH 4QEGA 1A7RH 1CR9H 4Y2DD 3KJ6L 3GMLB 3WJJC 5HGAA 4AQ1B 2WINA 3VXRA 5SX4H 1HQRB 5DRZB 4H8WL 3SDXB 3FT4B 3T8XA 5IVZB 3GSVB 3MSPA 5I2IA 2W65A 4U6VH 1A02N 1R3KA 1KELL 2X4RA 2YBRB 2IH1A 2ATPA 1KSRA 3B9DA 3GNMH 3SCMC 2MKLC 4V1DA 2WANA 4PG9A 3V8OA 4LGRB 2D7TH 2BSSB 3RJDA 2P49B 3IDXL 2F53B 4U1GB 4P5KA 5C0RH 3T09A 3DXAB 2YEZB 4XXCC 4RFNB 1KIQA 1XGPA 3NH7H 4C54A 2J5LC 4N5ED 3LMJL 3GGWA 1N8ZB 1JPFB 4JCMA 3IAPA 2BSTB 4Q7DA 5HYEA 3V4VL 4FFWD 3MFGB 2IQAA 1KTDA 5J6HB 4W4OC 3UROR 1AD0A 2BC4A 1NFDF 3U4EA 1MRDL 3G5VA 1HHKB 1YC8A 3ZKMC 4R4BB 1IEBB 4OD2A 4OUUB 4Y4KA 3ARGD 4HKBA 2ICEA 1GAFH 5KANG 4KKBC 4KQ3L 1RUML 3O3BB 1CXLA 1HHIB 5CINH 4NHUA 1KBGL 4DAGH 3IFNL 1ZT1B 2XKUA 3STLA 4BFGA 1I1FB 1KN4H 4JFOB 4Y1AB 5DD5H 1K2DA 5I18H 4GKSA 5FCSH 4AY0A 5DJ0B 4GMSL 5F7DA 1X5GA 4FMKA 3ZE1F 2VL5A 1ZK9A 1A14H 3PQYB 2NMSA 2DMCA 1MFBL 1CZ8H 4OFDA 1J8HA 5FYJU 5CWSB 1WQVT 4IRJC 3W39A 1YUHB 3PWPD 5MI0B 5SWZA 1LO0L 4XH2A 3DURB 4G6FB 1DN0B 4HIJA 1DQLL 4H20L 1Z0NA 5E70A 4RGNB 2R56H 2OL3H 5T1KA 1F4YH 3BE1L 3UBXB 2LTQB 1WZ1H 2NR6D 3SKJH 1KTLB 5IG7A 3RPIB 1H15A 4X7EC 3BPOB 1UVQA 3BI9X 5I71C 4PJAE 2GJ6D 1RZ7L 4C56A 2IPUK 4ZODA 2Y72A 3GI8L 2Q7YA 3MR9A 3TJEL 2Z4QB 5GQBA 3BMWA 2NY7H 3VFRA 2P7TA 2CH8A 4U1KA 1AC6A 2AK1L 4M5YH 4DN4H 3FN3A 3O81A 4X6FB 2FWOB 1K5NA 1A8JH 2BVOB 4QRRA 1RI8A 1AHWA 3NCEB 3DX9A 4FQQB 2WQRA 3S96B 1IGJB 1OP3K 3MRJB 2X4PA 4CVZA 4JREB 4S1SH 4WHTB 4CDHA 3QH3B 3FHQA 2NY0B 3SGJA 1C1EL 1DE4B 1HE7A 5DTFB 2WUBH 4ELMB 2BK8A 1ONQB 4LP4A 4PS4L 5IF0A 1YNLH 3MUGA 1P1ZB 5E94A 4LSPL 1PZ5B 4HULB 4G8GE 5EB9A 3U1SL 3C60B 4PREB 3L3JB 3N50A 1NUDA 5FCUH 5FGCE 2H9GA 4R2GB 1CT8B 4U1SA 2E9BA 2DYPA 5DJDA 4OD1H 1PEWA 4UQ2A 2Q3ZA 3NTCL 3OKLA 4L4VE 4AT6A 1BM3H 4Z77A 4M7LT 4UT9H 1C5DA 3U7WL 1UT9A 2XWJB 2AXJA 5ERWB 2X05A 4HX1B 1G9MH 2IANE 1Q9OB 5B39B 1AD9A 5CEYA 5BOZG 3PGCB 4NQEE 2AEPH 2BCKA 2VDKH 4EI5A 4JCLA 1JTPA 3FT3B 3HZMA 3TN0A 5H8DA 2AKRB 5CEZE 4KMTH 1NCWH 1VPOL 1BVZA 4BK4A 3FAWA 1NAMB 5L6YH 1NFKA 4GAYB 1NMCB 1GGYA 3FQWB 2UZYB 3VRJA 1CGYA 2W0PA 5HYFA 3RWEA 3TBYA 4OFYD 2NXYB 1YDPB 1UA6H 1FFPB 5T1LA 3Q3GA 4WI5A 2XKSA 4ZFZB 1IQDB 5GGTH 1N2RB 5JZ7D 5J57B 4BKLA 4Z7WA 1CR9L 1U3HD 3LRSB 4TN9A 4YHPB 2V2WA 4PD4J 1ZGLB 1AGBA 3LN5A 4JFHE 1QA9A 5HHVL 1OSPH 2ENSA 4Y89A 5DJ6B 3LEYL 1NGZB 1VA9A 2XZCL 4GRWF 4ODXB 4DGYH 2PXYC 3IF1A 3SCMD 4I18C 4WI9A 5EBLB 5IM7B 2ADJA 3A6CH 1OCWH 2V7HA 3O6MH 1DBMH 1P84J 4Y19B 3X14A 5F9JB 1K8IB 3HI5L 3TPUB 2D7TL 2YWYA 1RQ5A 4O9HL 3DV6A 4M43L 1P69B 4X9HA 4JQXA 3AREB 3CFKB 5ENWA 2CXKA 2CDFA 2CR6A 1CGVA 1GGCH 1PBYA 4G7YH 4QHLA 2V9RA 4TSCL 4CU6A 4OFIA 4RAUA 4TVSa 5JIIA 1KCUL 3JWDH 4IJ3C 1KN2H 3WHXA 3GMOB 5E8DL 3ZKMD 4Y5VB 3HPJA 1PW3A 5IOPB 3FO2A 4NQVA 1CDYA 3QG7H 4J3XA 5CIPH 3EZJB 2DQUH 3VXUD 5CD3B 5I19L 1ACYH 4IHOB 5TJWK 1NBQA 5LVEA 3V0VB 5GGSY 2APFA 2B4CC 2BOBA 3DGCR 4PJGF 5DJZA 4M6NL 1H0DB 5DD5L 1T89A 3RNKB 4X99A 2R2HB 1GZPB 1A14L 5B22A 4XNMA 4R7DA 5LWYH 3T0EB 5IVXB 4UOW1 1XMWA 5FO8B 4IMLB 2DIAA 3KYOA 4PJFB 4JFEE 1VKXB 3PGDA 3QJHA 5DWUL 1BBJA 2R56L 5DD1L 1EEYA 3HAEA 2VR9A 2OL3L 1F4YL 1RMFL 4LHUA 3MV9A 1NBVH 4JKMA 1KCVH 25C8L 4NKIH 2H8PB 2O26U 2HTKC 3D2UB 4P2QB 4BSWA 5IV2A 4HUUB 4U6XA 1FL5B 3I6LD 4JDVB 1XR9B 4PJIA 1NL0L 2E8ZA 5MEPA 3C6SB 5C3LD 4QRTA 1JFQL 2NW2B 4KI5C 3GKWH 4E41D 4KJWC 5GS1A 1MAMH 1NH6A 2G2RB 3G5ZB 4ETQB 3P4OB 4YWGL 4Z5RB 3MACH 1MLCB 1MCBA 4L3EA 3RWCB 5LAXB 3V79C 2FBJL 4OD3H 4P9ML 4K2UH 4S1SL 1G7MB 2F74A 1P6AB 3CFJB 1JF1A 1QRND 5JW4M 3QUZB 2WUBL 5MERA 1UFUA 2KZWA 3JVGC 1YNLL 4ONHB 4RDQG 2P45B 1PGRB 5KS9B 5D1XC 3N0PB 4HIHB 4RAVB 3P73A 1S9YA 4FQJH 4J4PC 4HS8H 1H8NA 1QPXA 5ADOH 4OZHA 2QLVB 4CADA 1CCZA 4Y5YC 1FZJA 2BNUA 3X3FH 5JR1L 4N0YL 5LQBL 1JNHB 2CDGA 3S98A 3VRLE 1FL3A 5HVWA 5BVJB 4GKZB 4UTAL 5F3HA 4YDIH 1M7IA 1KJ2B 1J05A 3MRBA 2NX5A 1REIA 4XCEB 3BOVA 2X10A 5HVHB 1UWEH 3U83A 5CJXC 5ECJE 1D5XA 5FGRA 5IB4B 4BH8A 4WVRA 2MCG1 3EO1B 4JFPA 3OB0K 4JR9L 3GMRA 2R2BA 3EJZD 5ANME 4NQCE 2XZAL 1DN2A 3H9SB 3LD8B 5DJ2B 1G6RA 2B39A 1YEIL 1U36A 5A3ID 3QEQE 5DMJB 4PRDB 3QFJE 4K8RH 4HBQA 4HKXB 4LCUB 1Y6NR 5CUSH 4JO1L 1FNSH 1Z2KA 5D6DA 1G7JA 1M05B 4I77L 4R26H 5JLZB 2QHRH 3A6BL 5E2TL 1FFQA 3RX8A 4YAQB 5L8LB 5B3JF 2VXTL 5C07B 4GW5A 1CQYA 2VZVA 3W9DB 3KPRE 1A5FH 5D1ZD 1S7UB 5LG1A 1FBIH 4LLQA 1PYWB 3K4AA 3BHBB 3HE7B 3V52L 2PXYD 4JVPA 1XF4A 1S3KL 3FZUD 5DJAA 4JRXB 2IC2A 1T1YA 1NAMH 2Y6SD 3BGMA 3T0WA 4NQUA 3NOIA 1Q72H 3WFEL 3UTTE 1CG9B 4JFQA 4OBSA 5B8CA 4GG8B 4NM8H 2R9HD 1L7TH 4TYUA 3M07A 4XWGL 3KPNB 3NFPA 1BPVA 2H32B 2EDTA 5BV7L 3KPMB 3TBVB 4FTVA 3TYGH 1DUZB 1CGXA 1HH6B 3TA3A 4PJ7B 3BPLC 5IHLB 4FQIL 5DK0A 4WTZG 3UYRL 3OHXA 1OAUH 3LEVL 4ZO7A 5DC0A 2IEPA 2KUTA 5FUOH 1WTGT 4WHDA 3VW3H 3FRUB 5EBGA 3MRNB 1SYSB 4MJIE 5KOVC 2IAMB 4HPYH 4XPBH 4XCFH 3H0TA 5DEGB 4JVUA 1B9ZA 4KDWA 1ACYL 4YEEA 4PJ9A 3PHQA 1JGDA 3BP4B 1WISA 2A6DA 3RA7L 1Q9KA 4TPRL 4QHKJ 5ADPL 1B0WA 1NGQL 3CVHB 4HLZG 4PB0L 3WFCH 1BD2E 1QNZH 3MJ7B 4MLSA 1A6ZA 1XH3B 3ZSSA 1AGDA 4AZ8A 4MAYC 4XVJH 3DX7A 4X9BA 2Z31A 2Z91A 4ZNCD 3MNWA 1TENA 5AD0A 2XA8L 2VSDA 1RK0A 5DD3L 1BGXH 4QOKA 1SJXA 4JDZA 5E95B 4U2YA 4TTGA 5E4EB 5IMOA 4NZJA 3RWGA 4Z76A 4F15C 1GVIA 3STBA 5C0GB 3VJ6A 4HC1H 1NCDH 1Q1JL 3AY4C 1U95A 4Y5XC 1KCVL 3BYTA 3KPSE 3MMEA 4EJ1C 2D31B 2HN7A 2R69L 4N9OB 3KR3H 1FFOB 5L9DH 3ARDD 3FFCB 3IAQA 5I1KH 2YA1A 1VSCA 3TGXA 3KPPA 5DQDL 4Z7NF 1HSBB 5BS0D 4ZFOL 2X4NA 1S7XB 1V3MA 1JGVH 3IJHB 5FYJH 4JQVA 3GMQA 1RIHL 4EI6B 1C8PA 3MFFB 5TGBB 2FGZA 1QSFA 5E03A 4KJWD 3L5XH 2C3WA 3MROB 2P5WB 4HFUH 1MJUL 1VHPA 4PGEA 5I8EB 3LEXB 4TUOB 4GW4A 2EYSB 4Y16A 4XP6H 1EH9A 1NMAH 1EMTL 4OD3L 4I0CC 4HGWB 4MAUL 3X17A 1AQDB 4NSKA 4DKDC 3VXTA 3ZDZE 1C12A 1M6OB 1TVHA 2GCYB 2VXVL 3OAUL 4P46B 5FK9A 2R8SH 1EFXA 2FYYB 4NKOB 5TPWL 4ZPTB 2MKWA 3UTZA 5C9JA 5I76A 1IC7H 5D1XD 5GZOD 1N64H 4HUXB 3MLXL 3CXHK 1XF2B 4JZNA 4X7TA 4GLRH 3ILPA 4RA0C 3EFFA 5HGAB 2WINB 3VXRB 5ADOL 4KPHL 2BY2A 5JHDE 4D3CL 4YBLC 4MJ5A 5E2WH 1FJ1A 5BJTB 4MDIA 3H2WA 1MF2H 3T8XB 4ZUVA 2VDPL 5JQ6H 3D39B 4D0CA 5FYKL 3KPLA 5I2IB 5J13C 2W65B 2PR4H 1R3KB 4YFDB 3ULSA 1G7QA 2X4RB 2IH1B 3OAYK 2ATPB 2VAAA 5EUOE 1KTKE 3V7AG 1A22B 5CD5D 3VXNA 4LVNB 4KK9C 3BPNC 1FYTA 4V1DB 4JKPL 4K9EL 4PG9B 2HWZH 4F58H 2O61A 2AQ1A 12E8L 1B4RA 4D9QD 3GSUA 4P5KB 4NBXB 3RJQB 3QJFA 1KIQB 5JW4R 1FZMA 3FB8A 5AYQA 1TJIH 4PJ5E 3EHBD 2OJEA 1FORL 2FH8A 2ZUXA 5D72L 3U9PH 4O02H 1J1OH 1AD0B 4OLEA 2BC4B 5DYOA 1MFEH 2X4UA 3U4EB 5IB2A 3L95A 3G5VB 4G6MH 3H42H 4FQCH 5GGVL 3TVMA 4OD2B 4Y4KB 5AAMA 4DW2L 1GSMA 1PSKH 1JWMA 2F58L 4HKBB 2ICEB 3WV0A 5EOCL 2ZOLA 4XPTH 4NHUB 1A5FL 2PYEE 3STLB 5C0CA 4H1LH 1MI5A 5I15H 3BKJL 1JNLL 5ALBL 3CIQA 1GZQA 1K2DB 5CJBA 1IKNC 4GKSB 4HF5H 3U46A 1INEL 1BX2A 3R8BB 3UTQA 3HNSH 5F7DB 3VI4E 4RNRB 2VL5B 2XTJE 3D6GA 4JHBA 2ZCKH 5E9DE 5HHNA 1BECA 1J8HB 1Q72L 3TIEA 3W39B 5SWZB 1EJOH 1H5BA 15C8H 3R1GH 4XH2B 1HINH 4Z7QE 4EDWH 4HIJB 1I8LC 1YEFH 2EH8H 1G9MC 3FFDB 4MNQD 5T1KB 4KI5E 1OAZH 3KWWB 4F9LC 3PV6A 3FOLA 4YDKH 1DZBA 1KOAA 2AAVA 1JHTA 5IG7B 2BOCA 3INUL 1JBJA 1IC5H 4PJEA 4ZOBA 1UVQB 2QADC 4C56B 4Q97A 5FUOL 3CCHA 3MR9B 2Q7YB 1CQKA 4KRPC 3O41B 3RAJL 5J8OA 5F96H 1AO7A 2E7HA 3PHOA 3VFRB 1VADA 2P7TB 5FYLH 4U1KB 1DJSA 4IS6A 3H3PL 3VFWA 1OP5H 4WY7H 1OLLA 4QTIL 3MLPA 3FO9A 1K5NB 4QRRB 1AHWB 5EU6E 1ADQL 1B2WL 3DX9B 3B9EA 3K2UL 2MHAA 4DJMA 5F7WC 2X4PB 4CVZB 4MAYD 1XAUA 4I2XE 4QRPB 3UJTH 4FP8H 4TNVF 4EN3A 4MDJA 4X6CF 4XVJL 5ESQA 3WSQL 4AEEA 1HIMH 4NUJA 3P77B 5BMFH 3HS0A 5IF0B 3BKCL 5E00B 3MUGB 3MV7E 3Q6GH 5E94B 2B1AL 4HG4J 4P2CG 2NXZB 1QKZL 2VLRE 3OKKA 2NTFA 3HN3A 1B0RB 4ONOA 1AY1L 4OCWH 5MEND 4DK6A 3EOBA 1A7PL 1XGUA 4DUVA 1U92A 1MFCH 4ZYKA 3G08A 3RUGF 4MMZC 2ARJA 5GGUA 1MIML 5I1DA 4X7SH 3MRFA 5EBWA 4W70A 5D93B 4O2FA 4U1SB 4WWKA 1N0XL 3KR3L 3CVHH 5BRZB 4G8FA 5I1KL 2DYPB 1EDQA 1IRAY 1DVFD 4UQ2B 2X44D 5DLML 4M93B 4UIMA 4J7RA 5AZEH 3OKLB 4DK3A 1HKLH 4AT6B 2ZOKA 4Z77B 2M26A 1C5DB 3VD4A 4G7VH 2Z93A 2VXUL 3UAJD 3FHAA 5TDOA 2J6EH 1PY4A 5GRYA 1AD9B 1QZ1A 2L0DA 4NM4H 5CEYB 5CMAA 2BCKB 4XP6L 4EI5B 5FDWA 2Q8BH 3HZMB 4QXTA 3TN0B 3HKFA 1D9KA 4U1GC 4I3SL 4P9HC 4YZFF 4RFNC 5ESAA 3IS1X 4WGWB 2V2TA 5I30L 3VRJB 3ZT7A 5BXFA 3TBYB 5IT2L 4MWFB 1AXTL 1F2QA 3RI5K 3KNBA 4AEHH 1ZHNA 3SE4A 5T1LB 1BBDL 3Q3GB 2G9HA 2NPLX 2XQYK 4BKLB 5AWNL 2XYCA 4LNRA 1OL0A 1UM4L 3WS3A 2V2WB 1AGBB 3LN5B 1QA9B 2IG2L 4U33A 3ZO0A 3O0RL 4HCRH 1YC7A 2N56A 4YIQA 1YEHH 2JCCE 3Q6FA 3NAAH 5E8NA 4AENA 4ZAKA 3IF1B 1QSED 2MTPA 4RMWA 3MLUH 4KK9D 2ADJB 4NGHH 3KGRA 4YHIB 3UYOD 2V7HB 1ZLVH 5LGKA 2C26A 3NABH 3VD3A 3I9GH 2MPAH 5D70H 4NP4L 3X14B 1EUTA 1WT5A 2R0KL 5FIEA 4CVXA 4LVHB 2A77H 2R29H 3UTSD 3VFNA 1QFWL 3QPXL 3WXVL 3QRFM 1MCPH 1IGIL 5ENWB 2ERJB 4R96A 5DT1H 2AGJH 2CDFB 4WTZA 4NFDA 2AXFB 4RGNC 4QHLB 2ATKA 5GRUL 3U6RA 5A2FA 2DM2A 2FB4H 3K8LA 3VI3E 4RAUB 5C2UB 4UDUA 1FIGH 2LTQC 3WHXB 4YHYB 5IROA 3FQNA 3BH8A 4MA1B 3V95A 5K59E 3I6KA 5EO9A 3BPOC 3HPJB 2CGRH 2B0SH 2H2PC 2F5AL 1Q0YL 3FO2B 4NQVB 4ODHL 4TVPH 5GISH 4UT6L 3ELAT 1ZA6B 5EFIA 4NNYA 3WUWG 2ITDA 1DBBL 1NEZA 2OXHA 2BOBB 5F6HJ 4FN0A 3HG1D 5D2NA 4IRSD 5DJZB 1JZ8A 3QEGL 1HCVA 1K6QL 4CKVX 3WLWC 4X99B 5FGBC 4IBLT 4NKQB 4WHYG 4OLZH 5D9SA 4GRWH 4XNMB 1F6FB 4R7DB 4NCC1 1JZ2A 1SJHB 2NY0C 4WTWA 5DRNB 5HDQH 2DBLH 1WIOA 3KYOB 1EJOL 4AK1A 3R1GL 1HINL 3PGDB 4XB8A 3QJHB 3UO1H 1BBJB 6FABL 3EO0A 1EEYB 3ARGA 5CEXA 1G6VK 2NY5H 3C60C 1OAZL 1YYML 4LHUB 3MV9B 1MVUA 4KDVA 4YDKL 3U4BH 4IIQA 4U7KA 5KVDH 3PWNA 2JJSC 2P44B 4BSWB 4DKFH 3B9KB 3RWIA 4R2GC 5IV2B 4L4TD 5E8OA 4U6XB 4K8RC 3OKMA 1B0GA 1JE6A 1QFWM 2KKQA 4WUUE 4PJIB 5L2KB 3SDYH 1CLZH 5MEPB 1JMXA 2XG5A 5C09A 4XZUA 5FYLL 4KKCD 4W81A 5D7KE 4QRTB 1VERA 3KXFD 1CE1L 3LS5L 1PKQE 4KJQC 3L9RA 5GS1B 1MCWM 1ZS8A 4P0DA 3FO1A 3WS6C 1KB9J 2XFXA 1NFIB 4MXVE 4L3EB 2FX7H 1PAMA 3HR5A 1TNMA 4HKZA 5TQ2L 1NAKL 5BV7B 4OFKA 3RIAK 2F74B 5DEFA 1KCRL 3QDJE 4JKKA 1X6LA 1JF1B 5CZKA 1WZKA 2XIDA 4ERSH 3MLZH 3D48R 2DWEB 1MJ7L 1BJ1J 2P5ED 3MLYH 5MERB 4Y8DC 4YX2L 1YEJL 1OT2A 2IPUG 3Q6GL 4Z7VF 1KXTB 3LKSA 5L2JA 1NMCC 2VKXA 5DXWA 4JHAH 1FPTH 2NY3B 1KG0A 1OW0C 5FDYA 3P73B 1S9YB 2NXYC 3EYVA 4PLKC 1MFCL 4I5BA 3M45A 5T3XH 4OZHB 3QI9D 4CADB 2V5MA 1FZJB 3ZYZA 2AJYH 5CHNA 3CSGA 4FA8A 2BNUB 4M9OA 2CDGB 1FL3B 1A7OL 1P2CA 4PJCA 5F3HB 1KIPA 1N7MH 1M7IB 5ITFA 2Y23A 2CRIA 1J05B 2NX5B 2FECL 5IVOA 3N1PC 3W0WE 5M94B 4KVCH 4HKJA 4M5ZH 3KYKH 1D5XB 1LK3H 1FDLL 4JFPB 1AE6L 1DBJL 2DD8L 3GMRB 4GBXA 3UTOA 2R2BB 1R5IA 3B9VA 3QPQD 1CFTB 3HZYA 5FKPA 1TZIA 1JNNL 2UY6A 2VUYA 1S7SA 2DLFH 4LPXA 4JPVL 1G6RB 1LVEA 2FSEA 4JZOA 1KJ3L 4XC1H 5EIQA 3AREC 1YJDL 1FH5L 1CLOL 3RWFA 2E9JA 3BDXA 3N06B 5I6XB 1M7DA 4L3CA 5CZVH 3O9WD 5HHPA 4ZOEA 3TT1H 4FZEH 1JUFA 1G7JB 4RZCA 4AEHL 3U0PA 1QPPA 4U1NA 2YSSA 1E28A 2CRZA 1FGVH 1T66C 3WFBH 3ARZA 4GS7B 3ZSTA 2FGWH 4GW5B 5BO1H 4Y5VC 3UP1A 1CI5A 1A1NA 5TE7L 5C6TL 4M6OH 1UZ6F 5TF1H 3BDYH 5I8KL 4FNLH 4HUVA 4LLQB 2EH7H 4ZDHA 1OTSC 1XF4B 1NCAH 4Y1AD 1CGUA 5DJAB 3FAXA 5GRJL 3BWAA 2DLIA 2R1YB 1T1YB 4DGIL 1QACA 3O4OB 1KNOA 3BP5A 4R4FH 3BGMB 1IGTA 3I9GL 3F6LA 3PQYD 2XNAA 4JFQB 5D70L 5B8CB 4XP5H 4OIIH 3PABA 4XTRC 4Z7OF 1FGNH 1KJVB 4OFYA 4JY4A 4WTXA 3T0EC 1QOKA 3NFPB 3LIZL 1QRKA 2R29L 4G6FD 2AV1B 1CDBA 1DL7H 1IGFL 3S5LA 4FTVB 2CKBA 3SE8H 1U3HA 3TA3B 5IQ9A 2IF7A 2VAJA 2XKNA 5JXED 1D5IH 5GS0H 1PG7X 3T77A 2EDYA 3BGFB 3V5KA 4XPGH 4QHKI 4OLYL 3V7MA 4NUGH 3WL9A 2D7PA 4K3DL 4JRYE 5T33H 4GRLD 5C0NC 3H0TB 2A9MH 5GISL 2B1HL 3GMNA 4PJ9B 4WI3A 3L3HA 3PHQB 2DTML 4B7IA 1JGDB 2J8UA 2A6DB 1Q9KB 3KLDA 3WKMH 3I50L 3T4YA 4G6KL 3MRIA 4X8XA 5E6IA 5D7LE 1A6ZB 3MRPA 2AS5M 4GG6A 4BQ6A 1AGDB 3O4LE 1P4BH 4G6AC 1XGRA 3EOYG 2DI9A 1U3ZA 2Z91B 3MNWB 4IEFB 1C08A 5AD0B 4OCXH 4K3JL 1A6AA 3L3KB 5HDQL 1RK0B 5I8OL 2DBLL 2H26A 2V9TA 3QUZC 2R0LL 4QOKB 4JDZB 4JFED 4GQPH 4QKXB 3LKQA 3AS1A 3RVUC 3RWGB 5IMOB 5SWSE 4Z76B 3VJ6B 3OPZH 3TBSA 2NY5L 3MREB 3SOBL 4QCIA 2YN5A 1U95B 4JFFA 5DEZA 3MMEB 1S7WA 2HN7B 4S2SA 4OCSH 4BUGA 1A64A 1R24A 3KPPB 3PDGA 4H88L 1UACH 3C8HA 2F53E 3DIFA 1RIUH 5TE4L 5I1HH 2X4NB 35C8H 3GB7A 5HY9B 3GMQB 4M7JH 5DI8A 1PZUB 1QSFB 2IBGA 7FABL 1NCCL 5HVHC 4PGEB 2V5YA 5GGQH 1CYGA 1DQDH 2ILLA 3VXOA 4O2CB 1ZE3C 1ITCA 4GW4B 4Y16B 3BISA 3FOMA 2ZUVA 1QLRA 2NY2B 5JDSA 1IMHC 2A73A 4P48A 3FO0L 4XP1H 2W59A 1YQVH 2DQDH 3U30B 3LD8C 4NSKB 5LGJA 3VXTB 3MLZL 1C12B 1TVHB 5FK9B 1KEGH 1S8DA 1LE9A 1EFXB 3MLYL 2N7BA 3UTZB 3VG0L 5C9JB 5I76B 2E6PA 3MA9L 5J1SC 3LPGA 1C5CL 1MJJA 3O11A 4JZNB 2CKBL 4S1QH 4RX4A 3ILPB 4PJDA 3GSXB 3BVNB 3EFFB 1BJMA 1E4JA 3MJ8A 3KPTA 5T3XL 3QHZH 1A6UL 3CXDH 4KROB 4MJ5B 3F7YA 1FJ1B 4MDIB 1A7QL 5C0BA 4D0CB 1OM3H 3KPLB 4Q0XL 4XP9L 2BSED 4KKAC 2Y25A 2AJ3A 4XMKL 2EYRA 2VXSL 4I48A 3ULSB 5BVPH 5EO1A 3S36L 1RAMA 3HE7C 2VAAB 3VFGH 1LP9F 4MQ7A 3NA9H 2X1OA 3T3MF 3D9AH 5DFVC 3IETA 3VXNB 1QRNA 2QQNH 1JI2A 1HXMA 1FYTB 1H3GA 5EORH 2EC9U 1LK3L 5LCVH 4O51A 2O61B 3BIBX 4NQCD 4DVBA 3GSUB 2BZDA 1SEQL 5EWIL 2JE8A 4W6WB 3QJFB 2FATH 4TULH 3BEVA 1FZMB 4WDIA 3FB8B 4U4BA 1DSFL 2WP3O 2OJEB 1RJYA 5F97E 1GHFL 4OZIA 1RFDH 4RBPK 3QFJD 4RIRA 4LF3A 1CFSB 2UZXB 3P11H 3ARUA 4FZEL 4G43A 5AUMA 1T66D 5DYOB 1U8MA 2X4UB 5IB2B 2E6QA 4UU9A 5FYKE 4G3YL 5D2LE 4YQXL 2E6JA 3C08H 2D03H 3GJEB 4CVWA 3TVMB 3BRGC 3WUWA 1JWMB 1FRGH 1LO2H 2GTZA 5BO1L 2ZOLB 3L3IA 2IAMC 2CO6B 2DL9A 1MI5B 4FNLL 4OSUH 4BK5A 2C3VA 3K0WA 4OLUL 4OF3A 3K7UA 3ZLQC 3QA3A 2K7QA 2OTWA 3WXWH 1G6RH 3U46B 1WZLA 2GK2A 1MUJA 1BX2B 1GCFA 3RKDD 3HE6D 4LLDA 2X4QA 1G9NH 5HHNB 2UWEE 2YPVH 4AIZA 4G5ZL 3UTTD 3TIEB 3OJVC 1CK0L 1H5BB 4JPIA 2ZCHH 4QWWD 2O5ZL 1N4XH 2HT3C 5GRWA 2R1XA 3PV6B 4N1CA 4E9LA 3FOLB 3LH2H 5E4EC 4P23A 1JHTB 1GYAA 2BOCB 3D87B 2ORBL 5D1ZA 4ODSL 2V17L 1D5IL 3WFDL 1KENL 3ARFD 2P8LA 3D2UD 4P2QD 4DGVL 3CCHB 5KVGH 5I9QB 1AO7B 3PHOB 2QKIA 3QDAA 4MJID 3G6DH 1VADB 4IS6B 3VFWB 3EYUH 2IMNA 1NJ9A 5FOJA 3FO9B 4UTBH 5C0JA 4BZ2H 2VDLH 4AIOA 3CFIC 3B4NA 3P0YH 2MHAB 3LKOA 5GS2H 5D7IE 3V4UH 4QY8A 4M48H 1JTOA 4P2RE 3U7YH 2GSGA 5C2BL 3S37H 1FO0B 3NCJH 1NBZA 4LSQL 4NUJB 1WSST 3L5WB 3HS0B 1U8OA 1PFCA 1ZLSH 3QUZD 1EVUA 1CBVH 5GGRA 4P46C 3OKKB 2NTFB 1SJEA 1F11A 3BIAX 3RVUD 3GUTA 1RZKH 1XZ0A 3EOBB 1XGUB 2J8OA 1U92B 3CU1A 4UMGA 4ZYKB 3G08B 5DZNA 4LLUA 4YXLH 4AL8H 5GGUB 4GO6B 5F1IA 2NY6B 5I1DB 1FL6A 3CVIH 3MRFB 3B5TA 5FHAL 5EBWB 3S35L 5ACMA 4O2FB 5ISZA 4WWKB 4OM0H 1QD0A 2HMIC 2GEEA 1TETL 1KLUA 4PGJA 1I7RA 3K2MC 4PJ8A 4PRIB 5HYSG 1QFOA 2VR4A 5I1HL 4UIMB 3UJJH 4NZUH 2GUOA 1H8OA 2ZOKB 5FUZL 5DHVH 3DX8A 4XI5C 5DSCA 4BM7A 2Z93B 4Z7VB 3FT2A 5TDOB 3QSKB 2NZ9C 4YHZH 5CJOH 2K3TA 1DQDL 4LVNC 1MEXL 1YMMB 5CMAB 3NZHL 5FDWB 3E8UL 4JANA 4UBDD 1NDMA 3UC0L 1VGEL 1D9KB 2X1PA 4NJAH 4MNGE 3BXNA 3HNVL 5ESAB 3BZFA 2OP4H 2AJXL 4UNVA 1KEGL 2V2TB 2VSCA 1IT9L 5BXFB 3L3OA 5A2JH 5JUEH 1E0OB 3WD5H 3ARDA 1Q8MA 3CDGA 1QHPA 3KNBB 4ZTPL 5CKAA 5BS0A 1RHFA 2G9HB 1GL4B 2E9IA 4LNRB 3WS3B 5C07D 4P59H 4W6YB 2HFGH 3QHZL 1MSPA 4Y4KC 4QRSA 3CXDL 4YNYA 4OT1H 3DRQA 4Q6IA 4IMKA 4YIQB 2F8OA 5J6GA 4N9GA 4OBRA 3Q6FB 3BPCA 4AENB 3BN9C 4ZAKB 1A9EA 5HHME 4U1JA 4CN4A 3VWKA 3MBXH 4JRXD 5E7FA 1LO3L 5CGYD 2EZ0D 1BZ9A 4KRNA 1KJMA 3JWOH 5GJSL 1T7ZA 1CGSL 2HKHL 1VFMA 4CVXB 1F4XL 1B3JA 1MCHA 3VFNB 3C5ZB 1OAXH 4M1CD 2WP3T 1WICA 1D6VH 4PJ5D 1F00I 2K7PA 4R96B 4Y2DB 4QHMA 3N1MC 2X42A 5CSZA 1DANT 1RFDL 2ATKB 4LQ1A 4M4PA 3U6RB 5D96B 4UDUB 4U6HA 5KAQF 1D5MA 4NC1E 4QXUL 4PJEE 1T21A 3P11L 1P5UA 2X41A 4Z7UF 3FQNB 1P53A 3K8MA 4LSRH 4L8CA 3I6KB 3BDBA 1E6OL 5EO9B 3GSRB 5MP6H 2Q8AL 4QT5A 4A6YH 1SY6A 1U91A 2IAMD 2YUZA 1NSNH 4GAJL 5EFIB 4NNYB 1F2XK 3ARRA 2ITDB 3HUJA 1NEZB 1MCNA 1Q0XH 4M62L 4V2CB 4PIRF 2HTLC 5D2NB 1QR4A 1FNGA 4WHCA 1YNKL 2ESVA 1AHWC 3NCFB 3QIWD 5I1JH 1FFNA 5DR5H 2HKFH 3KVQA 2XTJD 2DIJA 5D9SB 5DO2C 2FDBP 3LN9A 1FYHB 2YRLA 3CAFA 2EDLA 2DOCA 4MB4A 1M1SA 3DSNA 3SGJC 3BMVA 4PJXF 4OM1L 4XPAL 2F54E 4QRUA 1UM5H 1W72L 3P2TA 5I1AA 2DKSA 5HI4C 3EYQD 3EO0B 1IC4L 2NXZC 2YS4A 2XZQL 3ARGB 5CEXB 1N4XL 4PJBA 1OAKH 3ULUC 1MVUB 1X6NA 3SE9H 4IIQB 5JO5A 1ORSA 3V5DA 3FB6A 3G6JA 5GJTH 3O6LH 5E8OB 4J6RL 3OKMB 5D93C 2YA0A 1B0GB 1Z0MA 4JHZA 3EKCA 5C09B 4XZUB 5JHLH 4M93C 3FQRB 3GM0A 1RZJH 1QLFA 3L9RB 4LOUC 2OMBA 2YR3A 1ZS8B 4BZ2L 4QHNB 1UB6A 3FO1B 3MA7A 1V7ML 5EU6D 1TLKA 2XFXB 3MODH 3B43A 4HKZB 3TBWA 2DQHH 2DQEL 3WN5A 4EI5C 5DEFB 2DM4A 3TN0C 2A2QT 2CPCA 2KQMA 2LV4A 1JGUH 1MREH 2LVCA 4JE4B 1I9IL 3GRWL 2FR4B 3MV7D 3LKSB 4U0QB 5L2JB 3RFZC 3PP4H 2CD0A 3MV8E 2VNCA 1KG0B 4YHOH 4O5LH 3SGKA 2ZP0T 3EYVB 4TSBL 4XHJD 4ODVL 4I5BB 2JJTA 5C7XH 4LCWA 1B4JH 2GY5A 3VXRD 3GHBH 2HMID 5CHNB 3CVIL 1EGJA 5FYLE 1ED3A 2IJ0C 2KH2B 1NFDE 5I0DA 1MFAH 1KB5A 4U2ZA 1P84K 3I85A 5DJCB 1P2CB 4PJCB 4OCRH 1KIPB 3LQAL 1GGBH 1YEEH 3HMXH 4XI5D 3UJJL 5GS0C 5KVFL 1FO0H 4NCC2 1E4XH 4L1DA 2NZ9D 3ULVH 4HKJB 4DVRH 3KLAA 4GMTH 4JY6A 5HDLA 1HHHA 4JAMA 3MCLH 4GBXB 2BNQE 4V1DD 5J0BA 4YHZL 1R5IB 4HWNA 1P4LA 4KJYA 1IGCL 3HZYB 2ADFH 5FKPB 5I73B 1TZIB 2DLTA 3QQ9D 3QUML 4HGMA 1S7SB 3ZE1E 3BT2L 1A9BB 2ITCB 1RZFH 4ONFL 5AG8A 2EIEA 2FEDC 2FSEB 4JZOB 3AFLA 4LVHC 1T22A 4JQXC 1FQ9C 4IDJL 4HUMB 2J2ZA 2CQVA 3RWFB 5ILTH 2ERJC 2WWMC 1I9RH 3JXAA 3DO7A 1M7DB 4L3CB 5AZ2L 5HHPB 3U9UB 3FRPG 3NFSL 3WD5L 4PJHA 5EZLA 5F7EL 4M03A 4U1LA 3AM8A 1DVFA 2X9WA 4U1NB 2YSSB 1E28B 1QYGH 4Q9RH 4YHYC 1Z3GH 4MA1C 3A67L 4P57A 4Y4KD 5HHXL 1A1NB 3I84A 4LIQH 3RIFK 1QEWA 2BNRA 3OQ3B 1M4KA 4F9PC 1JZ6A 4HUVB 3IJYA 4OT1L 2JB5L 2AJVL 3BN9D 4ZDHB 5DUPL 2VLKE 3MOBH 3QCVL 3BWAB 1WAAA 4TRPH 3KLHC 1PQZA 4UV7H 1T89C 1KNOB 2QQQA 1IGTB 2XNAB 1J8HD 3IB4A 1CDHA 3V6OE 5FO7A 2BX5A 1KLFA 4JY4B 5SWZD 3VH8G 4LQFL 5I17A 1NPUA 2Z0BA 1J0YA 4EIZC 2XQYG 4K23H 4CN6A 3S5LB 1FE8H 1R6VA 3OF6D 3ZTNL 5EU7E 1D6VL 2CKBB 2XQBH 1U3HB 4KK6D 5IQ9B 4R0LA 5T1KD 4UV4H 4XCCH 2YPKA 2XKNB 2FEEL 3X3GL 3CXHJ 4OZGF 3DSFH 2W9LA 3WNLA 3T77B 1WUNT 1S7VA 2AVGA 3OJMB 4YO0A 1A1OA 2QQLL 3WL9B 4RMRA 5C0IA 4X5LA 1UYWH 3B9KC 3GJFH 4G8IA 4ZS7L 1L6ZA 1TTFA 4PY8J 1NSNL 1CL7L 4PLJD 2HTLD 3DHMA 5IFHL 1OGAE 3CK0L 4HAFA 3BFOA 2J8UB 4ONGH 2R2CA 3T4YB 5GS1C 2FZ3A 3MRIB 2YK1L 2R1WA 2UZIH 5E6IB 3ZMRA 3MRPB 5ITBL 4GG6B 4IOSD 2QBWA 1PD6A 1URLA 1DQQA 3O6FA 3MCKA 4JFDE 5I1JL 1XGRB 1GH7A 1OWWA 5BV7C 4JG1H 5JW3H 1C08B 5I16A 4D0DA 4N0CC 4KZEH 3LY6A 1UG9A 1A6AB 3SBWA 4P5TA 2H26B 2B2XL 3D39E 1K85A 4P2OC 2DJUA 1UM5L 3LKQB 4FQ1H 1CU4H 5D71H 1BVKA 1QP1A 3K8KA 4G80A 3ULUD 2NY3C 4BQ8A 3T4AA 4QCIB 1T5XA 1T7WA 1S7TA 2L7JA 4JFFB 1HI6A 2D7QA 4TVPE 1S7WB 3RDTD 1N26A 5HYSA 2FX9L 1I9JL 2VITA 3WFHA 4IRSA 1R24B 4ZOCA 2IADA 1ZANL 5F7MC 1A47A 3DIFB 1RUQH 3GHEL 3O6LL 2XZZA 5JIHA 3CMGA 3GB7B 3LKPA 2OR9H 5DI8B 3ARPA 4P3DA 4KVNH 1CICA 3P40A 1UCBL 4Z8FL 5D7KD 1FAKT 3RU8L 2A6IA 4DTGL 2J4WL 1JF6A 4GRWE 3VXOB 1U42A 3FOMB 1QLRB 5JDSB 4EI5D 2A73B 3TN0D 2DQHL 2F19L 4JJ5A 1F4HA 3F5WA 5LGJB 2XTLA 3DNKA 1YPZF 2V9QA 4KY1H 1ND0A 1S8DB 1LE9B 5H94A 4OF5A 1JGUL 1J5OL 1QFHA 3L3GA 2OZ4L 1K8DA 2W9EH 4WFHE 2OLDA 3IVKA 1MJJB 1U2CA 4PJAA 4RWYL 3O11B 4K94H 2VN4A 2FLBT 3PP4L 2VXQL 4YXKH 4QGYA 1RUKH 5I6XC 4BFEA 3JTSA 4PJDB 5T1LD 32C2B 5D6DC 4YHOL 3M17A 2JK5A 1DEEA 4HT1H 4XMLH 2NW3A 5HYJE 3WIIL 3MJ8B 1R0AH 4N1EA 3QDGE 3MBEA 3F7YB 4GS7C 5CP3A 4JPKH 5GHWH 5IBTH 1P7QA 2C7UA 5C0BB 1V8HA 3MXVL 4X98A 1JPST 1T4KA 4HWBA 2AJ3B 3EYSL 4DUWA 3VRIA 2YD3A 5EO1B 1HYRC 3DRTA 5F3BA 3IETB 3PGFH 1QRNB 4WNQA 1HXMB 1RIVL 2FHBA 4PJGE 5C08E 3N85H 3REVA 4O51B 3O4OC 4DVBB 5E2JA 3U79A 1UB5A 3BAEH 5JW4N 2EDQA 1KFAH 5B8CC 4WIQA 1MHHA 4G8GA 3BEVB 4WDIB 1RJYB 2VZ3A 4HJ0C 3ME0A 5F7KC 4EXPX 3EUUA 4PY7A 3HZVA 4RIRB 3NCMA 5IK3A 1I8MA 3WBDA 4YR6A 1K9TA 2AV7A 4LF3B 1KCKA 3TA3C 1ZVHA 5T3XE 3WDHA 4G43B 4BFIA 5AUMB 3K3QA 1U8MB 3P0VH 5KW9L 3O3EB 2X40A 4UU9B 2YD9A 3EDKA 4UNTA 3BGFC 4DWHA 4DZBA 3WUWB 4YDLB 3QBTB 4L4VA 2GTZB 2VIRA 4QRPE 3UPAA 1ZLUK 3QFDA 3L3IB 4LIQL 3P4MA 1L6XA 2P47B 2FIKA 1ORQA 3FN0H 4XAWH 1RSFA 2IANA 2C3VB 3ZYIA 3OWEA 2DQJH 2OTWB 3QA3B 4PJ9C 4NQEA 5D1QA 3C2AH 4NO2A 1MUJB 4DN3L 3RTQC 3S97C 2DQTH 3EDJA 2X4TA 4LLDB 2X4QB 3UJIH 1U58A 1A2YB 2VB5A 4AQOA 4AIZB 2XY1A 3GSOA 4EIGB 3UZEA 4HK3N 4YHMH 4ZTOH 4EUPB 4P3WA 4OLXH 2VLJE 3V5HA 3LHPH 1ZEAH 3OAZK 4XPHL 1MWAL 4JPIB 5BRZE 4K7PH 5K9KA 1RVFH 4HWEL 3PG2A 2XQBL 2R1XB 4F2MA 4Q74A 5SV4A 3L3DA 4P23B 4XCCL 4FG6C 5T1DL 3HHRB 1Q38A 3OKDA 5D1ZB 4X6DF 5EULV 3IRZA 5CJ8A 3D0VA 2P8LB 2I9TA 1IJ9A 1D5ZA 2Q3AA 3NFNA 2APXA 3B5GA 3ZYJA 5J9PA 5IBUG 2VC2H 1UYWL 2QKIB 4M02A 5DMIL 1NJ9B 4JQVC 1CVSC 5C0JB 1MCDA 4HWBL 4EBQH 1K3IA 1RU9H 3LKOB 3QIBD 4BFBD 5F9OH 4QY8B 4L3ED 4NJ9L 5H37G 3AC0A 2GSGB 2NY2C 4H26A 4NRYA 2WV3A 2COQA 3W11C 3O4LD 2HH0L 2XY2A 4N0CD 1NBZB 5DFTA 1R3HA 2GQHA 4PUBL 1U8OB 3U30C 3HRPA 5GGRB 1PLGL 3HMWL 5IQ7H 1SJEB 2UV3A 1F11B 3GUTB 1XZ0B 4TUJA 3RWJA 2NY3D 1BHGA 4GRLA 4LLUB 4MGXA 5F1IB 2HRPH 1FL6B 4OTXH 2YRPA 5I1LA 5CKGA 5ISZB 2LU4A 4KROC 2ZPKL 1KLUB 5B3JE 1I7RB 4PJ8B 5DVOA 2YZ1A 5E24E 1YEKH 3EDDA 1GIGH 4XMPH 2OR9L 1HKFA 2NX5D 3DX8B 5DSCB 3QR2A 2DL2A 3FT2B 4XBPA 4ZD3L 1QBBA 1EAPA 1I1YA 4AJ0A 3MLSL 4XB7A 4NWUH 4OUOA 4JANB 4JFEA 4KGJA 1NDMB 3MUY1 5CEZL 1SEBA 1XFPA 3BXNB 5EO0A 1WCBB 3BZFB 5IB1A 4OZIE 2BJML 2LU7A 3FRPA 5E2UL 4RMUA 1PX4A 4NN5B 3L3OB 1RURL 4XNUH 1IFHH 2VZ1A 3ARDB 4H5SA 3CDGB 2W9EL 3I3EA 5BS0B 6CGTA 1RUKL 3HC3H 4QO1A 1HHGA 1TQCB 2WIMA 3GSNA 4JG0H 5AYUL 3GBML 5ESVA 4HT1L 3MRCB 3FONA 1R0AL 4HH9B