2VSKB

Hendra virus attachment glycoprotein in complex with human cell surface receptor ephrinb2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
138
structure length
131
Chain Sequence
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMAGGLUTININ-NEURAMINIDASE
publication title Structural Basis of Nipah and Hendra Virus Attachment to Their Cell-Surface Receptor Ephrin-B2
pubmed doi rcsb
source organism Hendra virus
molecule tags Hydrolase
total genus 26
structure length 131
sequence length 138
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vskB00
3G5WA 3PAUA 4ZK8A 3H4FA 1BQRA 3L45A 2IDSA 1MG3C 2QDVA 5AZUA 1A8ZA 1ZIAA 2GSMB 3WI9A 2FQEA 1AG6A 5I5JA 4DP1X 2CCWA 4A68A 2PCFA 3QQXA 1NIDA 2EIMB 2PCYA 2UXGA 1AS7A 1KGYE 3FT0A 2HRHA 5AKRA 2BW5A 2GB2A 4AKOA 3FPYA 8PAZA 4G7RB 1PLCA 4G7SB 4UAHA 2IH8A 2DV6A 4GP5B 2FNWA 1RKRA 3AY2A 1A4BA 2WSDA 2BO0A 3FU8A 1EZLA 2P80A 4HCGA 4NERA 1OE3A 2Y1AA 2XVBA 1A65A 1IUZA 1ILUA 1NIEA 3NJKA 2BWDA 1IBYA 1RZPA 2BWIA 4DP8X 3IE9A 4HAKA 2I85A 1KV7A 1GSKA 2AZAA 2GC7C 1A4AA 2H47C 4WTQA 1AANA 3X1GA 1AZCA 1J5CA 4NB7A 1XMEB 3FSWA 1JXDA 3X1NA 4DP4X 2W88A 1NINA 1EHKB 2XX1A 7PCYA 1ASQA 4AX3A 4YSPA 1AIZA 5PAZA 5E9NA 5B1JC 5PCYA 1FWXA 4QLWA 1J9TA 1KBVA 3V9CA 3TBCA 3PXLA 2YAHA 3NYKA 1QNIA 4E9VA 3AW5A 1OF0A 3HEIB 4BWUA 4DPAX 5I5MA 5I26A 5B1KA 5B7EA 1NZRA 4KO5A 2PPEA 2YAMA 1WA1X 2PLTA 3H56A 5F7AA 1MZZA 1TEGA 2OV0A 5AFAA 3GDCA 2DWSA 1IBZA 2E86A 3IN2A 3SBRA 3S3DB 3UABA 3UAAA 1GY2A 2HLEB 1CYXA 4E9XA 3NJFA 3ZX1A 2BZCA 3FSVA 3GXUB 3AG4B 2EIKB 2XXGA 4BWTA 1SF5A 3CVBA 4YSAA 2TSAA 2UXTA 1ID2A 1MZYA 4KNUA 1E5ZA 3NJGA 1AS8A 1KBWA 1XB3A 2FT8A 4KO6A 2HZHA 3NP3A 3S8FB 1SNRA 1GYCA 1ZV2A 5ANHA 1F56A 4N8UA 2ZONA 4UF7C 1W6LA 1AOZA 1M56B 4HHWA 4WKXA 3SBQA 1JVOA 4YSOA 2HX9A 3KW7A 4E9TA 5I6LA 1ZPUA 4AKPA 1PMYA 1PAZA 3IEAA 2HX8A 1KYAA 2MTAA 4JHVA 5I28A 4EF3A 1CYWA 2CJ3A 3UADA 3DTUB 3FQ2A 4HHGA 4DP9X 1HAUA 3ZBMA 1NWPA 3AG3B 4CSZA 5F7BA 2DY2A 2IDUA 1ZDQA 2QPEB 1RCYA 4YL4A 1T5KA 2FTAA 2JKWA 4AZUA 4QKTA 4W9ZA 4A2EA 3CVDA 4E9WA 3X1BA 3WNIA 2IDQA 1IC0A 1L9SA 1VLXA 4YSTA 1TU2A 1NDTA 2FWLB 1AS6A 3ABLB 3H4HA 4KOCA 3T6XA 1AR1B 2P80D 2QDWA 3PAZA 1SJMA 3SBPA 2XU9A 2XUWA 4KNTA 4G72B 4FAAB 2N0MA 1OCCB 3FPXA 3T6VA 2WO2B 3TBBA 3IBOA 4A2DA 2YARA 2IDFA 1L9QA 3NJHA 1BXAA 1AZRA 1IKOP 2GBAA 2BHFA 2WO3B 2EILB 1J5DA 1JZIA 1NPNA 1AZNA 2FQFA 2YAOA 1AZBA 3WIAA 4L0PB 4PAZA 1NTDA 3NSDA 3EF4A 3CVCA 2J57A 2Q5BA 1L9PA 2EIJB 4YSSA 2YAFA 5I6PA 1OCZB 2XV2A 3OM3B 4CSPA 5IY5B 1GY1A 2VMJA 3EH3B 2VM3A 2UXVA 1AQ8A 4A2GA 2AANA 1PLBA 1GS8A 4F2FA 2DWTA 3TU6A 1OV8A 4P5SA 2QT6A 1X9UA 1PZBA 3MBWB 2VN3A 1JXFA 2LLNA 3OMAB 4E9QA 2A3TA 3C75A 3NJIA 2RACA 1PZAA 2PPDA 1L9OA 3OMIB 5B7MA 4HCFA 1BQKA 2AFNA 4PCYA 3OQRA 2R7EB 1N68A 2R7EA 3SQRA 3NJJA 1B3IA 4UANA 3HB3B 1JZFA 4DPBX 1PY0A 1BAWA 2YXVA 4BWWA 4AKQA 3WNJA 2J5WA 1CURA 2IH9A 1JVLA 2ZWNA 3PLYA 3QJUB 4GYBA 4HIPA 3NSYA 1FA4A 1OOWA 1SF3A 4GP8B 1KDIA 3U25A 2B08A 1W6WA 3CG8A 1JZJA 2VSMB 1WAEA 2XYBA 2H3XC 3NT0A 4DPCX 3N2JA 2OJ1A 3ERXA 1ADWA 3ZIYA 5FC9A 2BP0B 1A3ZA 2BP0A 3OMNB 1E30A 4GP4B 4K9JA 4A2HA 1CUOA 1V55B 3NP4A 3T6ZA 3UGEA 1YLBB 4A66A 5B7FA 3NJLA 4RH4A 1SHXA 3DKHA 2GHZA 3ASOB 4TXVB 2XWZA 3S3CB 1OE2A 3NSFA 4KNSA 3X2QB 1E65A 5D4IA 1WS8A 3FSZA 1L9RA 1BXUA 2XX0A 2CBPA 1PF3A 1BYPA 2CALA 3ABMB 3ASNB 1PZCA 3NJNA 1J9SA 2DYRB 4DP6X 2UXFA 1NIAA 1URIA 4MFHA 1GW0A 3DIVA 2VW7A 3QJTB 1MG2C 5TK2A 1X9RA 2HX7A 2UX7A 1E5YA 3BQVA 3FYIB 2YXWA 4X4KA 2Y69B 4HZ1A 4E9YA 2QPDB 4YSQA 3AG2B 1ASOA 1SDDB 1XB6A 3X1EA 4P5RA 4A67A 1KDJA 1SDDA 2XLLA 1BQ5A 2I7OA 3BVDB 1L9TA 1I53A 1ZIBA 3CDZB 2X88A 3CDZA 4NAJA 4DP2X 2J56A 1JZHA 1AAJA 3JT2A 2GIMA 1WS7A 1HAWA 3WG7B 2VM4A 2YAQA 1OCOB 2FJSA 2Q9OA 7PAZA 2CUAA 1NICA 4M4RB 4BXVA 2AVFA 1WA0X 2VW6A 4Q8BA 3NJMA 2PPFA 3V9EA 3FS9A 2H5UA 3AZUA 2BW4A 3QJQB 4HALA 5I6MA 1OCRB 1SFDA 4YVUA 3CZUB 4YSUA 3WKPA 3N55A 2UX6A 2AZUA 1E67A 4F2EA 1OE1A 1J9RA 2ZOOA 2MRYA 1R1CA 3PPSA 4N4YB 4DP0X 2X87A 1ZDSA 2HXAA 1TEFA 3EH5B 4KO9A 3FQ1A 4FA7B 3UAEA 3RYMA 1JZEA 3EH4B 1FFTB 1SFHA 3FYEB 1NIFA 2OCCB 1NPJA 4GXFA 5I6OA 3QJRB 5EHFA 2JFCA 4JKNA 2NRDA 1A4CA 3ABGA 4W1TA 1UATA 2IAAC 4ENZA 2PPAA 4DP7X 2I7SA 6PAZA 1WA2X 6PCYA 2J55A 4F7KA 2XXFA 3IN0A 5TK4A 4BDVB 2JXMA 3JTBA 4BDVA 1BEXA 3PAVA 3FU7B 2GC4C 3KW8A 1W8EA 2XV3A 3FU7A 4YSEA 4GY4A 5A7EA 4G71B 3S3BB 3QPKA 1DZ0A 4YVNA 5B1JA 1ET7A 1QLEB 3ABKB 1BXVA 3FQYA 5I5IA 3TA4D 4DP5X 2VSKB 2YAEA 3GYRA 2B3IA 3QJVB 5B3SB 1AACA 4KO7A 2BZ7A 3ZDWA 3S8GB 1KCBA 1JERA 1ASPA 4YSDA 2DYSB 5I6KA 5I6NA 4M3HA 1JXGA 9PCYA 4KOBA 3MX0B 3EHBB 4YSRA 1GS6X 3UACA 5B1BB 4Q89A 2PPCA 5B1AB 1MDAA 5D4HA 1GR7A 1CC3A 2FT6A 1PNDA 2FQDA 3D12B 1ET8A 1M9WA 3PCYA 2EINB 1HFUA 4G70B 1KCWA 2XV0A 1M57B 1NIBA 2GI0A 1V10A 2W8CA 1NWOA 1TKWA 3T6WA 1PLAA 1ETJA 3QJSB 1QHQA 2PP7A 3FSAA 1AZUA 2HRGA 4JHUA 1RZQA 1V54B 4HCIA 3T9WA 1JZGA 3WKQA 1J9QA 1XB8A 2CAKA 2YQBA 2YAPA 3NSCA 5D4JA 4AI7A 4E9RA 2IWEA 1GS7A 2IWFA 3X1FA 1N70A 1PCSA 3FU9A 4G7QB 1ILSA 2FT7A 2IDTA 3T71A 2PP8A 1DYZA 2ZXWB 5LDUA 1SHWA 3AG1B 4E9SA 4YSCA 2BP8B 4BK5C 1BYOA 2BP8A 2IWKA 3OD3A 1AG0A 1JOIA 2VW4A 2FQGA 1PNCA 2TSBA 4BXSV 1ET5A 2PP9A 4A2FA 3TASA
chains in the Genus database with same CATH superfamily
5DJ8A 4N20A 1A6PA 5IB3B 1GC1C 2F2HA 3BUYB 5IB3A 5E9DE 3BUYA 4OZIB 3VFGL 4M61B 4UDUB 4Y2DD 4OZIA 2BS9A 3DYPA 1FNSL 2XN9E 3KJ4B 4M61A 4UDUA 5BRPA 5JR1H 2JE8A 4RMRA 2W0PA 3O81A 3ECQA 4A04A 1NMCB 4EI6B 1VRSA 3L4CA 2FX8L 4F2ME 4EI6A 1JWMB 1YEGL 3TIDB 5E7FA 1QEXA 5I19L 3TIDA 1A7NL 1J1XH 3HLAB 1S7WB 3IFOB 1T0PB 3HLAA 1S7WA 2BW5A 3IFOA 6CGTA 1MCQA 2HSIA 2Z3FA 5EZOH 1NQBA 4NQSB 4OGXL 3WNPA 4J39A 5F96L 4NQSA 1UENA 3HI1B 2DV6A 3MLSL 2ZICA 3HI1A 3QB7C 5CCKH 3TA3B 1I3UA 3EDDA 4P4RB 3TA3A 4XX5A 4P4RA 3T08A 4PIBA 4XMVA 3EGXB 5T3XD 3EGXA 4FFZL 4JUSA 1FVEB 1IBYA 3DXAE 1FVEA 3FHAA 2JB5H 4XC1L 2KLTA 3RJDA 2VITB 3L81A 2OBGA 3IE9A 2VITA 3FN0L 2BOLA 1KV7A 2GC7C 3CXDH 5CXPA 1OAYH 2AQ2A 4YPGB 2CXGA 5ECGA 4P3CH 4YPGA 2X1WL 3VD1A 3VVVA 4C4KO 1KGJA 1TTAA 2VDLL 1YYCA 4EBQL 1U0QA 4KKBC 2V33A 1AIZA 1NLDL 5AB1A 5E9NA 5H94B 2QLYA 4EIGB 1J9TA 5H94A 3F85A 3EFOB 1QASA 1JIBA 1KFAL 3EFOA 1KENH 3FW6A 3QVAA 4X6EB 4ZW7A 4X6EA 3UJTL 2VDKL 3IWUA 1LVEA 4JDEB 4JUTA 2VRAA 2WGNB 2PTUA 4JDEA 4XWOD 4AJVA 4QAMB 3UP1A 1XWVA 2I26N 4JCMA 5I8KL 1MQKH 1A6AB 4Y2OB 1A6AA 3N41F 1HCFX 4Y2OA 3U7WL 5A2LH 4W93A 3LKOB 3LKOA 4LCCB 2YSSB 3ARFC 5ALBH 4LCCA 2YSSA 4BWTA 1KN2L 2JKSA 1F4XL 5EB9A 4Y2LA 5E00B 2UZPA 2YGQA 5E00A 5AZ2H 3SKOB 2W9EH 2BM3A 3JWDC 1MPAL 3HUJF 3NJGA 3SKOA 3M7FB 4NQDB 2HYMA 4NQDA 3ZE0B 3TJEL 2L04A 4MHHG 4F8TA 4XX1E 4XAKD 5J1AB 3HNVL 5J1AA 3ZDXE 1OT4A 2Z8VC 4PW9A 3AXIA 2E27H 5INCB 5INCA 4YSOA 3OKYA 3LX9A 1H0DB 1J0KA 2VABB 1H0DA 4KKZA 2VABA 3VSTA 4Z7WB 3QISA 4NC1E 4PJDB 4G8IB 4Z7WA 5FW6A 3S4SB 2MTAA 4PJDA 3BDXA 1NCAH 2ATKB 2FATL 3S4SA 4N2KA 2ATKA 4YC2B 5AWNL 4TLSA 3AJ7A 3MOBL 1CGSH 4ZAKB 2UZIL 1KGXA 4ZAKA 1ZRUA 1EHAA 5I73C 4BELD 3Q5YA 4PJHE 3LCYA 4X80H 1PG7L 2N7SA 2N7AA 1GSMA 2VXQL 4XVUC 3M86A 1E7VA 1FIEA 1WCQA 3CVDA 1GPOH 2AQ3A 2Z31B 1BFOB 1NCUA 5JOFB 2Z31A 5GRVL 1BFOA 4HK3J 5JOFA 2AMUA 1MKFA 2K3HA 5D72L 4BZYA 2AK4E 4L9DA 4HFWB 3ZPDA 2DQEL 1MEXH 5KYYB 4HFWA 4LNRB 2N0KA 5KYYA 4GUQA 2VDMH 4LNRA 4M6MH 5I8OH 4X9HA 4LMQI 3RBSA 4RISH 3VXSD 3NFPB 3N85L 4XMKL 3DI2B 3BVXA 3NFPA 1I9JL 5MI0B 2AAVA 4YL9A 5LJYH 4JRYE 5A3IC 4L0PB 3QAZC 5IESL 1ONQB 3QUZD 4KK5D 1ONQA 3UAFA 1FV1B 4XC3H 2H2SC 3QWOB 1ZT7B 3EBHA 5T5NG 1FV1A 3CCHB 3QWOA 1ZT7A 1OEZW 5I8CB 3CCHA 3MJ9H 3GJEB 4MAZA 5I8CA 2HKHL 3GJEA 3L1OH 4H8PA 4L9LB 3KL5A 2PWEA 4L9LA 4F1SA 4UT9L 4YHML 4BRVA 3GMMB 2XTJD 5EWIL 3GMMA 3Q5OA 2VWEC 1B4RA 4DN4L 5FFLA 5F93C 4GLRH 3U6XS 1CI3M 3QJFB 5JXEC 5D2LE 3QJFA 3TWCH 4QGTA 2OJZH 1IAMA 5IMLB 4ZUTB 1I1AC 3GXTA 5IMLA 1BFVL 4ZUTA 1J0ZA 1FRGH 3L08A 3NA4A 2E8YA 3DO4A 2J73A 2LLGA 4LOFA 3W38A 3AQYA 3MOAH 3ZSSA 2J72A 2NY5L 4J27A 4OZGE 4I7ZC 3CZGA 1I31A 3SDAD 3NCXA 2BRQA 3RI5F 1N64H 3V4LA 3L9YA 3QCVH 3SQOH 2KT6A 3FTSA 3KVDD 1VKXB 5FYLH 2CA4A 1VKXA 4HISA 1T6VN 2J88H 2L3BA 1N18A 5F1IB 2AS5M 2R9HC 2OA9A 1J8HE 4HSCX 5F1IA 3RVTC 2OJ1A 1ADWA 4ORGB 2VB5A 5IVXF 4ORGA 3QUMB 2K0RA 3L2MA 3QUMA 4WIQA 4TQHA 2ZG2A 1ZT1B 3JT0A 1AHKA 2OYKA 1NLBL 1ZT1A 1YECH 3L3GB 4P2AA 1EFXB 2Z7UA 3L3GA 4R7XA 1EFXA 3GSVB 1HH6B 3IU4L 4ICXA 3GSVA 3QFJB 4FNUA 1HH6A 3QUYC 4WW2B 3QFJA 3E1ZA 4WW2A 1Q9LB 5T3XE 2AJYL 2MNWA 4XCYB 4M6NH 1Q9LA 3MRNB 4XCYA 1PF3A 2Y6SC 3MRNA 4PI0A 1SEQH 3WFBH 1XV8A 1HL4A 3HIZA 5HHNB 5HHNA 1URIA 4HC1L 4F58H 4GQZA 5J1TC 4BFFA 2D31B 1ACYH 3ARGC 1MI5D 2VDPH 2D31A 3SGDI 4JZJB 2DDQL 3ZE1E 4JZJA 1OTSD 2HX7A 8FABB 4JQXA 5E03A 8FABA 2FBJH 5AW7B 4QMEA 1CD1B 3HR5B 3QG6B 1CD1A 3HR5A 2AAAA 3QG6A 1BMZA 1XB6A 3R06B 3NCFB 3R06A 4DKDC 4Y88A 5GJSL 5GZOC 2X2JA 2YRBA 4NAJA 1XD0A 2H8PB 3JWOL 4IIZA 2H8PA 1FSKB 4WNQB 1WS7A 5CLWA 3ULUD 2VO5A 1HX0A 3AS0A 1QHOA 4WNQA 2G60H 1QBML 2OTUB 3AS3A 4NC2B 3VGDA 4H1LB 4F20A 4YJZL 2OTUA 2ZXEB 5FGCB 1DO5A 2FJSA 3BHBB 4H1LA 2QQKH 4QI3A 3BHBA 4M4RB 1V3MA 2CPUA 3F5WB 4M4RA 3F5WA 3FUDA 1RMFL 4NENB 3TNNB 4L5FE 4S0TD 1URZA 4NENA 4XTRC 3TNNA 3NIGE 4WDIB 2A73B 3QH3B 3KWUA 3ZE2F 2HVBA 4WDIA 2A73A 3QH3A 3AGVA 1T83C 1ZLEA 3ZDZE 2PWFA 4I3RL 3DHJA 2OK0L 4L1HA 1NOLA 5I75B 4JL1A 5AZEL 1AI1L 1UD2A 3HI5L 1NMAL 3DHPA 4XAKE 3PPSA 3A6OA 4OCXH 2EUWA 4B95C 5BXFB 3B5TA 1RURL 5BXFA 2IV9A 3ZLQC 1A25A 3HAEH 5BQDA 3ZQXA 3MUJA 1NC2D 3SDXF 3BPLC 1Q1JL 4H13C 5DCCA 3DMMC 3ZHKA 3TF4A 3G6DL 4FXTA 1I9IL 4AYEC 4LGSB 3T2NH 3IDIB 3IN0A 4GRWB 2JXMB 3IDIA 5TK4A 4KDVA 4P57B 1YJDC 2JXMA 3HS9A 1OSPH 3NN8B 1R0AL 4P57A 3CVHL 2J1XA 2Z34A 3NN8A 4WCYL 5D2NE 1CGUA 2XA8L 3NMEA 4GY4A 3P0YH 4KXZH 3CAFA 4TOYL 4TQPA 3BLKA 3O9WB 1PD6A 1QA9B 3REVA 3X3FH 3NSJA 3O9WA 1CXKA 1QA9A 5L8LB 2WYZA 3FKUS 4KRPC 3RDTC 3F7RA 4QKXB 4TL5A 4ZOAA 3VXTB 5ITBH 5I6NA 3RJOA 1TMCB 3VXTA 4HOXA 3N50A 2JJVA 3QS3A 3QDMD 4PLKD 1GS6X 1JNHB 3BDYL 4ABUA 2MCPH 2P5PA 2QSCL 5DD6B 1JNHA 5BNXD 5DD6A 5LG1A 2AABH 3E3QE 3BVTA 4RBPH 3VXSE 2X4UB 3L95B 1EAPB 3IYLW 2X4UA 3L95A 1EAPA 3NJVA 5LBVA 1DJWA 3WO4C 4G70B 3WTXA 2YSTA 3RLSA 1X5MA 1RVFL 2VDMB 4O4YL 3QXVA 1P4BL 5AYUL 1AY1H 2K45A 1SMOA 3BE1L 1B4JH 2GG1A 4GAJL 4XPAH 1UA6H 2NLJB 4AG4H 2NLJA 2QPFA 2FK9A 4ANWA 5MP6L 3T1WA 4IGBD 3ZYJA 3EOTH 4I0KA 2XTJE 5KVFH 4ZMNA 2WLIB 2C8NA 1YYML 1YVLA 2WLIA 3C60D 3T8MA 2FL5B 3ALPA 4R5XA 2FL5A 5IT2H 3O4LD 3HCVB 3PJSB 1NSNL 4KH2A 3HCVA 3PJSA 1RZFL 3QRGH 5E99L 4ZS6C 3BAYA 4K8RC 3OR7B 2FT7A 4LSSH 3OR7A 1ND0B 1WZ1L 1ND0A 1O5DT 4XOAA 1DYZA 2WWKT 2ZXWB 4AVHA 4DJMA 5IK3B 4YSCA 5T3ZD 4ZW6A 5IK3A 2NYYC 2FB4L 2VLKB 1MUJB 3QJOA 1JOIA 5EZLB 2VLKA 1MUJA 5EZLA 4XE5B 4RWHA 1XF5B 1X5YA 4MKTA 1XF5A 4YXHL 1SJHB 1TXKA 3IGAB 1QFOA 3NG5A 1SJHA 3QXDB 3IGAA 4MRCA 3QXDA 1TQBC 1GW6A 4OLZH 5GS1C 1S7SB 3RVXC 2CSPA 2GVYA 5HHMB 1S7SA 3WHXB 4GG6E 4GMSH 3QG7H 3WHXA 2XIBA 2DQIL 5C09E 1D2PA 2DEXX 4K71B 4Y19E 2OI9B 4LB8A 3NIDF 1O7VA 1H3UA 1E7UA 3A4EA 3VXRB 5LGKA 2AV1B 3BP6B 3VXRA 3LNHA 5CLZA 1SDYA 2AV1A 3BP6A 2XSKA 4G7SB 2GFBB 3SOBH 4JKWA 1YN7B 4U33A 2GFBA 1M7DB 2QSTA 1YN7A 2OMUB 1M7DA 4A37A 4FQXC 2OMUA 5EORH 5GGQL 1DJHA 3JWNH 2Y1AA 3I6SA 1J87A 1GGCL 1DFBL 4ZOCA 4N0FB 3VTMA 4N0FA 1E4KC 4S2SB 1HN1A 4MNGE 3U0WH 5FLUA 4S2SA 5AVYB 1PSKL 4WWKB 4WWKA 1YAIA 3KPRB 3MV8B 1OF2B 2FJUB 1LNUB 1TCRB 2CKBL 3KPRA 3IDXL 3MV8A 1OF2A 1LNUA 1MCPH 1QWUA 1TCRA 4L1DA 2VDPB 4ONOA 3HFFA 4NUGH 4Y5XA 4HOMA 1H6FA 1CZ8L 3QUXD 3RGVC 2X9XA 4NB7A 1HNYA 2CUMA 4FULA 3DDGA 4XOCA 2E59A 3FSWA 4HUNB 4M6OH 3ULUE 3DVGB 3DVGA 1DVFC 4L8DB 4X6CE 3MBED 1BAFL 4L8DA 5PAZA 5PCYA 4DVBB 1ZD6A 2R56H 4DVBA 4QLWA 1UJ3C 2HLFC 3SSGA 3CQQA 3W5MA 1F6LL 4NO2B 1B2WL 4X7SH 4NO2A 4PV1C 5B1KA 3QRBA 1NZRA 3MHZA 1IIIA 4KKQA 3O6FD 1OZUA 4ODUB 5AAPA 1OO2A 3D08A 4NZUL 2ZKWA 4ODUA 3A6BL 5DZNA 1F42A 4TNEA 4IOSA 4KVPA 4OF6A 4RA3A 2PYEB 2F7OA 4PTUB 3TV3L 3W11C 1I8MB 2PYEA 4PTUA 1I8MA 2BWQA 5DK2B 2AJXH 2XWJB 5DK2A 3RFRA 3U1QA 3TTSA 1SUHA 2XWJA 2XXGA 4GIPD 3CVBA 1TJIL 3RTQB 3VFUB 3RTQA 2R29H 3VFUA 3L16A 1KY6A 4NAQA 3ZYIA 1ZV5A 2O4EA 1IBBA 2O5NA 4KUZH 2C5DC 4JM2C 2R0KH 2JIXD 1IC4H 3B2MA 3KVQA 1OHQA 2FEJA 1UXSB 1BW8A 1UXSA 2GITB 5T3XL 1JVOA 3SBQA 1WEJL 2GITA 2JCCE 3EOBB 3HAEB 1Z9SB 3HUJE 4JM4H 3HG5A 1NCTA 3EOBA 3HAEA 1Z9SA 4AQOA 1PAZA 4K5MA 2IIJA 2NY2D 5E6SB 4EF3A 3NPZB 4KAQH 4YDJB 5HDBE 1WAAF 3RZCD 4MCNA 4YDJA 4MMXC 3DIDA 4QNPF 1USQA 5HI5D 2DY2A 3GZOA 1QHPA 2A0LC 3AM8C 2QPEB 4UIKL 4J5VA 4JHAL 3BUBA 5GHWL 1CDCA 3QDME 2DKMA 2WXKA 1CL7H 3GPSA 4QY8A 4H8WH 2ZPKH 2WXIA 3KH3A 1FG2B 2J43A 4RGNB 1FG2A 2X2HA 2J5LC 2ROXA 3IK2A 4PGDB 4PGDA 1C1EL 4G72B 2DZEA 2VC2L 1WD9A 2C7UB 2P5ED 3QQ3B 5EEYA 1VFAB 3QQ3A 2C7UA 1VFAA 1OXYA 5JNYA 4CSSA 3TONA 4I1NB 3VGHA 3GRBA 4AYDC 1NCWH 4JO3L 2NY5C 4CKVX 2MNJB 2CR3A 1X5ZA 3U6RB 4L5FL 5GS0H 3BUPA 3U6RA 2EE2A 1X9LA 2AGJH 4YIQB 4AYBA 1WQVT 4YIQA 5GIRB 1II4E 1KSRA 3CE1A 5GIRA 5C0FB 2YXMA 4JFQB 5I71B 1GCYA 4AJWA 4BHUA 3FUIA 5C0FA 4JFQA 1UWYA 1G7PB 3O4LE 1TFPA 1G7PA 1RULH 4G9FB 4K9EL 3S8WA 4MS6A 3NCCB 5DT1L 4G9FA 4JGUA 2JKLA 4BE6A 2FEDC 2APWA 4QGYA 4LPXA 4TVPD 3BC9A 1QYGH 1THAA 2WLZA 1KT2B 1Q0XH 2UXVA 1AQ8A 4FADA 1KT2A 1PLBA 3GKWH 3DUUB 1KWKA 5TH2B 3DUUA 3TU6A 3PHQB 5TH2A 1KBBA 2WIIB 3PHQA 2DTML 2VN3A 5CP3H 2BS8A 3OMAB 2WIIA 1PZAA 4OD1H 5E8EB 1SXAA 3RDJA 3OMIB 5E8EA 2C9XA 3F84A 2APXA 2PO6D 3VA6A 1WBXB 4OR1A 4EXKA 4QDGA 5LCVH 3ZYZA 1WBXA 1UURA 2IPUG 4LSUL 3LRGA 3F6JA 1XGZA 5CGYD 1CF8L 4BIKA 4RDBA 2HFFB 2JELH 3OVUB 2HFFA 3J27A 2NY6D 1D9KD 3TBTB 4HWBA 4GP8B 3FT4B 3TBTA 1J5OH 3U25A 1RZ7H 1AXIB 3FT4A 2QV2A 4XB8A 1MRDL 2EDDA 2V5MA 3CTTA 5CIPH 3WLBB 2RH0A 5DYFA 3WLBA 5IIEB 1O6VA 2HKFH 2E74C 3MV9B 3Q13A 5IIEA 2BRRH 4S0HA 4G8FB 3MV9A 3JVFC 3K2UH 4G8FA 5MEPB 4DF9A 1OP5H 5MEPA 3FT3B 2FRGP 3FT3A 5SX5H 1YMMD 1EK3A 1HYRC 4KNSA 4GQRA 3X11B 5IVXE 3X11A 3F64A 4I0PC 5KANI 3EBIA 1L9RA 2BSEA 4P5TC 2Q8BL 1CK0H 3CZFB 1P0SE 1WWAX 3G7TA 3OPUA 3CZFA 4HETA 4N2HA 3ZRSA 4JFXA 5L7XL 4ELME 2WK2A 1TSHA 2PR4L 2V2WB 3SPHA 1SXCA 2V2WA 1JZ5A 5ID1B 3SKMB 1YC7A 4B7IA 5ID1A 1NGWB 3SKMA 1NGWA 1F18A 1HESA 3QHZL 4BZ1A 3GBMH 3V95A 1X5GA 3ECVA 5C6TL 3U0PB 2CPCA 2DMGA 2CLRB 12E8L 3U0PA 4H40A 1KJMB 1KJMA 1EFQA 5HYEA 4Q6IB 2NY3D 3JV4B 4Q6IA 4YUEL 3JV4A 4X9BA 1RIVL 2NDGA 3B5GA 4HJIA 4PJGB 5B4MD 4PJGA 2VXSL 3U4KA 5C0AB 4TVUA 2BC4B 5C0AA 3C2AH 3VXQB 2BC4A 3VXQA 2BW4A 1JRHH 4MAYD 5C08D 3V0AC 1Y18B 2XBDA 4NIKB 1MW0A 1Y18A 2EQDA 3QO1B 3ESUF 4XMWA 3RWGB 3QO1A 4MA3B 3RWGA 2XBTA 4MA3A 2AZUA 3A3YB 1CBVH 1BM3H 4JFZL 1DQML 3OJ2C 3STZB 5IBTH 3UTSD 5EUKB 1J9RA 1WZAA 3STZA 4D8PB 2IOMA 2MRYA 5EUKA 3BRDA 2BIQA 4D8PA 3FQ4A 1U3HD 1JGVL 2AXJA 5E0FA 3BP4B 1ZK5A 1ZDSA 3BP4A 3OAZH 2IO5A 1B88A 1MFCH 5GGVL 1JZEA 4G6KH 3RPBA 3DO7B 4CRPA 4I2XE 2R29A 4RRPM 4WGVB 3DO7A 5AVVB 3T2PA 1W0YT 1S78D 3V0EA 4QJ5B 2QPSA 3BQUC 1I7ZB 1ZS8B 3HOGA 4KJWD 1I7ZA 1ZS8A 1HQ4B 2NRDA 4XRCB 1EV2E 1HQ4A 2LAGB 4UZUA 4XRCA 1MWAH 3OKMB 2OSYA 1SQMA 2ZXQA 3QRFM 3F83A 3OKMA 1TSRA 1KJ2B 3TT3H 3N04A 1DVYA 1KJ2A 5F1NB 3WLWD 5F1NA 1MCWW 1NAMH 1QTYT 4FFYH 2HFTA 2C3WA 2RBLA 4OFYD 5DQ9B 3MODL 3LD8B 1T2QH 5DQ9A 3OKOB 2AQPA 4Q9RL 3ABKB 3OKOA 3P4MB 3S7GA 5KW9L 3P4MA 3I6GB 3QJVB 1I3GH 1FIGL 3DYOA 3I6GA 3ULUL 4J3VA 1ASPA 3O3AB 1S9YB 2Z7YA 4H25B 1I9RH 1N6VA 2P5EE 1S9YA 3O3AA 2C3VB 4M3HA 2MKWA 4H25A 5JO5B 3SN6N 3BKYL 2C3VA 2C9PA 5JO5A 2DRUA 1K8IB 1OGTB 2X12A 2L7QA 4KUCF 1K8IA 3CMGA 1OGTA 4MLSA 1GR7A 3BKCH 2FT6A 3HKZA 2R8SH 1H3GA 3QWRA 1OGAB 1IBGH 3CBJB 4J3OD 4NFCA 1OGAA 4NC1C 3U30C 4NJ9H 4CDGC 1FPTH 1HFUA 3CDGB 1M57B 3CDGA 2GTZB 2DLFH 2Q3AA 1WWCA 2GTZA 2GI0A 5SX4H 3TBSB 3C08H 1PLAA 2P45B 3O8XC 3TBSA 4KDWA 4BYHA 4KNQA 1TOXA 1T66C 3HW7A 2HMID 4XN8A 4TVPE 3AGWA 4N2FA 4GUOA 2R27A 4C58B 2AXGB 1J48A 4NCDA 1JNNH 1T5XB 3SDCB 5FO8B 2VDOH 2AXGA 3WEBA 1T5XA 3SDCA 5FO8A 4QWWC 3PWNB 5EIIG 3D33A 1PCXA 1YJDH 4WJG3 1WYJA 3PWNA 1HYSC 5DUJA 2V7NB 35C8H 2KMWA 5F8RC 1LO4L 1XSIA 2V7NA 1INQB 1UD6A 4ONFL 5AW9B 1INQA 4TQEL 3NBNA 2K7QA 2BJML 4KKAD 2DI7A 4DAGH 3S37H 3O6MH 1SMAA 3GLDA 1EJ8A 4OJDH 3F7YB 2E9GA 4PJ6A 3F7YA 4HPYH 4AUUA 2W9DL 4PJFF 3VRIB 4G7VH 3K1KC 5E2VH 4PV8B 2A9NH 3VRIA 4PV8A 3M1BB 2BVUA 1UM5L 5E5RB 4XPBH 3M1BA 3WTYA 4RAUB 3RIKA 3PF2A 1XGYL 4RAUA 3VM5A 5F9DC 3ENEA 5SWSB 3PAUA 4N1CA 5D70L 5SWSA 3L45A 3HRZB 1RLWA 3HRZA 2NXYC 1XQ4A 5IQOA 1G9MH 4QXTA 5EEWA 3U7YL 2CBMA 5EOCH 3O3DB 1F4YL 2QELA 2ZWZA 3AITA 3O3DA 5DJ0B 5E8PB 5EU4A 1YMME 4DKTA 5DJ0A 5E8PA 2PCYA 2X5PA 3VFGH 3G5VB 4A38A 2HRHA 3G5VA 4PGJA 2RAMA 1FNSH 5F7NC 3QAZB 3VFMB 1E8ZA 2IAMC 5H8DA 4PJ7E 3VFMA 4AKOA 4G7YL 1PLCA 2FX8H 1YEGH 1ZWIB 4HU8A 4BKLB 3GSNL 1ZWIA 5I19H 4XO5A 4BKLA 3BCDA 2BVYA 3WD5H 1TTUA 4QTIL 1WV7T 1YEHH 4XN5A 4BZ2L 4P3WA 3MRLB 5L6YH 3MRLA 5FECB 3O2DL 4OGXH 5FECA 4ORZC 1U8NB 5FHAL 4D8OA 3MLSH 4PJXF 1U8NA 3TZVD 2CJUL 5BV7C 3G9VA 4NP9A 4AEIL 1KXQE 2QFRA 3B9KD 2L8AA 3NRFA 1W2KT 1TZAA 2A77L 5DO8A 3O2VL 4LCUB 4MCYB 1I1AB 3DOHA 4QHMB 3FF8A 4LCUA 2WQAA 4MCYA 3DTDA 4Z8FL 1FGNL 4FFZH 3QFGA 4WF7A 1OPOA 1Y1UA 3QDAA 4XC1H 5C0GB 5C0GA 4WFED 1MIMH 1M3JA 3FN0H 3WTUA 1KB9K 1DBJL 3RVVD 5T3ZL 3KM2A 4LEBA 3ZRFC 4F7PB 2FH8A 5DO2D 2VQ4A 1HCYA 5FUOL 2CHZA 3V0FA 4F7PA 2BSCA 4PWFA 3G6JE 4NPKA 2FWUA 1HE8A 5K33A 5DA4A 2ETWA 3FO0H 2VDLH 5C08E 3PP3H 2APVA 1JPSL 2CRYA 2JJSC 3WNLA 4H8HA 3MZTA 4P2YA 1N0XL 1T6WA 2PLTA 2D3LA 2OV0A 4BFGA 1KFAH 2WB1A 1OP4A 3UJTH 4F9LC 3UTSE 2VDKH 3D3VB 4HFUL 2FGWH 3D3VA 1HHJB 1CFTB 2R0LL 1UACH 1HHJA 2A9AA 4WWNA 1CFTA 1HCZA 3DIFB 4EQ3A 2GJ6B 3QUYB 3VDCA 3DIFA 2GJ6A 3QUYA 4R26L 5CJQH 2YPLD 1KYOK 1WZKA 3CLEL 1MFDH 3C9NA 5IOKA 1AO7B 3C5ZB 3LZNA 4XWOC 1AO7A 1ZVSB 3C5ZA 3MNMA 5HI3D 1ZVSA 5ANHA 1F4XH 1X4XA 5DZ9A 4LOEA 3ARGB 4N8UA 4X4ME 4TNFA 3ARGA 3L4VA 4FKHA 1HSAB 1MPAH 1KN4L 1BBDH 1QLEL 2ZCKH 1HSAA 2IH3B 3CXFA 2HX9A 1HC1A 2IH3A 4YFLI 4BSVB 5MHSD 4KMLB 1ZPUA 4JFHD 4BSVA 1I75A 4XP9L 4JBSA 3HNVH 1TZOA 3NCWA 5CUSH 2FJHB 4J2QA 5DMYA 1CYWA 2FJHA 5H37G 4HHGA 2X3AA 1OGSA 5GZOA 3IXAB 4PQXA 3MMEB 3IXAA 3BJLA 1NAKL 3MMEA 4UAOB 2CU9A 1XX9C 4K9EC 1N2RB 3D5OF 5IWLC 3RI5K 1N2RA 5HYJE 2FH6A 4BK5A 4FFYA 5HHXL 3FT1A 3MOBH 5AVSB 3GSUB 3RFZC 3RRQA 3GSUA 2CK2A 4W9ZA 1P6FA 1D6EB 2WGXA 1R5IB 1D6EA 1EAOA 1R5IA 1AS6A 4LGPB 2JMRA 5M94B 1DBML 2A4ZA 3PG2A 5JHMA 3SKNB 2Z35A 3RWHB 1AGBB 2RQEA 1B3JA 3SKNA 5IGXL 2KZKA 3RWHA 1AGBA 5GGRB 5AG8A 5GGRA 1L9QA 3LIZL 3CZKA 4FC3E 5LAXB 4P9ML 3FH5A 1B6UA 5LAXA 4ZMQA 1SLWA 3O3EB 2WBKA 3O3EA 2CMRL 4LDOB 5D2NC 2DQEH 2NX5D 4HUCA 4HSAC 4U31A 5AVWB 1T1XB 2D3VA 3AXLB 3H42L 3IJ8A 3KPSD 1T1XA 2VISB 3AXLA 3CVCA 4UV4L 2VISA 4IS6B 5I1IH 2A38A 4IS6A 4KUCD 3LVEA 5AW3B 3COOA 3N85H 4XMKH 4OZIF 3BPLB 4ANKA 1I9JH 1LTXA 5GJTL 2QVTA 2DQHL 3FO2B 2Q7YB 4B0MM 4ZBJA 3FO2A 2Q7YA 5KBNC 2EZ0D 5GRYA 1LWJA 4K7FB 4WY7L 1S46A 5A6LA 2QQQA 4K7FA 2HKHH 4F37F 4D3CH 5IKCB 1V8HA 3AXHA 4GI9A 3NQKA 5IKCA 3TURA 3H9ZA 1BQKA 4OGAC 1EIBA 1E4XI 4PCYA 3QUZC 2JKIS 3KH4A 4TVSa 3KGRA 3NJJA 1IMHC 5C0ND 3ROOB 1LL1A 3ROOA 4KRPB 2OAAA 5K9OB 2KS0A 1B0WA 3RDTB 5K9OA 1MQ8A 3RDTA 4AC2A 3VACA 3WJLC 1UC6A 3FTWA 1GH7A 5J9PB 2V5SA 1FA4A 2HG0A 2V5TA 5J9PA 4J4PD 5IB4B 2XTJC 5IB4A 3JUYA 1BFTA 3TS8A 3EYSH 2CRIA 2E76C 3CG8A 4FTVB 4JJOA 4FTVA 4YFDB 1YPZE 1KEMH 3DJZA 5ISZB 3CXHJ 3ZKMD 4KRNA 5ISZA 3WO4B 1CDIA 1EDQA 1NBVH 4XB7A 3AREB 4A2HA 2GT9B 4BK8A 3AREA 3L4WA 2GT9A 2CD0A 5HYIA 4P49A 3DKHA 5AOMA 5D6DC 5L2JB 5L2JA 5T1MB 5T1MA 3LVTA 4Z77B 4A7QA 3E8UH 2YN3A 4Z77A 4H88L 4A7SA 2N1KA 1V3KA 3SD2A 3KPLB 1NLBH 2CO3A 3KPLA 3VU2A 1OIOA 5CF3A 2BVEA 4JPKL 4F3FA 5DK0B 2CALA 2PW1B 5HTSA 2EXTA 2PW1A 5DK0A 5HPOA 3IU4H 1DBKL 3LDBC 4B27A 1GGUA 5HY9B 5HY9A 1OANA 3DX4A 1QR1B 4PS8A 1QR1A 3UBGA 3WY1A 1E5YA 4LPCA 1DANU 1HL5A 1HTYA 3FYIB 2YXWA 1KZYA 2Z92B 4HP5A 1DVTA 1MRCL 2Z92A 5EA0L 3AG2B 4HC1H 3L7EB 3S5YA 1UFGA 2J7LA 1H3WM 3L7EA 2XZZA 2DDQH 2OQJB 1OPGH 2C4FU 1GYVA 1I53A 2Y4SA 2OQJA 3E7JA 2ZUYA 1DJYA 4LZKA 1BWMA 2ARJQ 4XNYL 4B3EA 4HF5L 5CILL 4UQEA 1ANUA 2IQ9H 5IROD 4C56D 5A2IH 5GS1B 1TQBB 4X5RA 5GS1A 3RU8L 4S1DD 1IRAY 3SDDB 4Z7WF 2XI9A 3JWOH 2WZPA 2L7JA 4PJDF 3SDDA 1OTSC 5L4MA 4OT1L 1UKQA 2F1BA 3F7LA 4H44C 1UYWL 2VDLB 4NZTH 3WKNA 1AGEB 1PTZA 4C55A 1ZHBB 4B9IA 1AGEA 5F7KC 1SFDA 4NQCD 1ZHBA 2H6PB 3MTXA 1A1MB 2ZCHL 3TYFB 4BK4A 1SXZA 1T2JA 3QI9D 1A1MA 3TYFA 4C57C 2F8OA 2YPLE 4O5LL 1RMFH 3KE0A 1X3DA 2PW2B 1Z7JA 2VDKB 4S1RH 2PW2A 2ZOOA 3KYNB 3ULUC 4MQTB 4KI5D 2UV3A 3KYNA 4B9PA 4FQXB 1F11B 1FVCB 4FQXA 4NS0A 1BMGA 2E4TA 1F11A 1FVCA 1TEFA 5IMMB 4I3RH 1E90A 5E8OB 5TTRA 5ILTL 5IMMA 5E8OA 3EH4B 5AZEH 1AI1H 2WLYA 4LIQH 3NSXA 3FC8A 1Z5HA 3HI5H 3LSOB 5MHSE 1YNLH 1E4KA 1EJOL 4RDQF 5EC2B 1CWVA 2VERA 3LSOA 4JKNA 2ICWB 4L3EB 1HXYB 2ICWA 4R97B 4L3EA 1HXYA 4WI3A 4B9JA 1VPOL 2Y07L 2CUHA 3GMNB 4LAJH 1FJ1B 4XP6L 3RGVB 3GMNA 1FJ1A 3EO9L 3RGVA 4XO8A 3LH2L 1UGKA 1Q1JH 2Y36H 1DVFB 2DD8L 4X6DF 4LDCA 1DVFA 2VR4A 1KACB 2J6WA 5K39B 1D5MB 2BIOA 3ARTA 5K39A 1D5MA 2UUDH 1RU9L 4YVNA 2MCAA 1H3PL 2WNWA 5I9QB 1UJ3B 4XMTA 1BZ9B 1UJ3A 2VR8A 2R23B 4J23A 1BZ9A 2R23A 1F3DH 1KYDA 4PS3A 2R2CA 4KO7A 4RQQB 1OP3H 4D0CB 1KCBA 3LTVA 1A6VL 4RQQA 4G6MH 4D0CA 3X12B 1PKOA 4Z95L 4D9LL 2K6WA 4TOYH 3X12A 3Q05A 1SHSA 5E5MB 1TZGH 2BS71 4YSRA 5E5MA 1AZZC 3VJ6B 3VJ6A 2PPCA 4G2AA 5CGBA 2R51A 3GHEH 5LUMA 1Z2KA 5IEKB 1GGBH 5E1IA 5IEKA 5BOZG 4HW6A 3ULVE 3KR3H 2EH8L 2VXQA 5CN1A 4NZ8A 1WZMA 3QJZA 4I87A 3BDYH 1QP1A 4XNZC 3H9SB 3KPSE 2YD4A 3H9SA 2ZUSA 4CMMB 4QRRB 2VJ0A 4CMMA 2V9UA 3B1TA 4QRRA 1CXLA 3NEXA 4JM2B 2E46A 4JM2A 3K3QA 3LOWA 4O4YH 3KXFB 3Q01A 4PLKC 2OMBA 4APQD 3KXFA 1IGML 2JTDA 5AYUH 3UPCA 1ZT4B 3OHXC 2BOBB 4P46C 1ZT4A 4X5WB 2BOBA 4GAJH 2IWFA 5C7XL 4X5WA 3BD5A 1TF4A 3VD3A 5MP6H 2NY1D 2FEEL 3BRFA 3EYVB 3EYVA 1WAPA 4HXAL 2JWYA 1UWGH 3FQTB 1YYMH 3FQTA 3S5LG 2IDTA 4MMXB 3ZKXC 1CN4A 2NSQA 2F5AL 4MMXA 1LWHA 3K6OA 3IGKA 3MLTB 3MLTA 4Y5VB 3AM8A 1RZFH 2DICA 4Y5VA 2BP5M 3U79A 5AW6B 3MA9L 4UT9A 2GABA 1V3LA 3GF8A 4IGBC 5E99H 3QAQA 4S0SD 1PNCA 2O5YL 3C60C 3QEQB 1A7OL 1MN4A 3QEQA 4P2QE 3TBYB 4M1DL 3TBYA 5IBLC 4GKOA 4Y4KD 2KZ1B 3PWJB 1S7RB 2FB4H 3PWJA 2OFQA 3SZKC 1S7RA 2WOYA 4MQXD 1YNKL 5IUCA 3KWTA 5L8JB 2E6PA 1A8ZA 3VM7A 4DGVL 4N24A 4RGOL 4UB0L 5D7EA 4PYGA 1HH9B 4TSAH 4CVXB 1HH9A 4WI6A 3WSQH 4CVXA 3FT0A 1JV2B 5AKRA 1JV2A 3AUWB 4HWNA 1LEKB 4N8VB 4K73A 1LEKA 3QXTA 4N8VA 1CGTA 3OKNB 3OKNA 4I0CC 3UBXB 1BZ8A 2OMNA 1HNFA 4HKZB 1IJ9A 3PL6C 3FO9B 4HKZA 2MHAB 3FO9A 2MHAA 1IM3D 1B4TA 2GKIA 3A0OA 1FFQA 2O6FA 5F70A 5GQBA 4X2UA 4LHUG 2Q0ZX 5SV4A 4M7JL 4FHBD 4PI2A 3N40F 3AB0C 4UZSA 4N87A 3EHBD 3ARPA 3TLRA 3IJ9A 2X89A 4M3KB 5J3HC 1I7RB 1N4XH 4RRPG 3TF7C 2VE6B 1PSKH 2VE6A 1QFHA 4PJXE 4XWGH 4C56E 1EHKB 2WN2A 4QJ3B 1CI5A 1Y07A 2OL3L 4BKTC 3DJSA 3SIKA 3H9HB 4HC1A 3I6LD 4G8GD 3H9HA 4PB9L 1CZ8H 3GSRB 2ADFL 3GSRA 5AVUB 4OUOA 2F0CA 3HLKA 4MA8L 4NOFA 5C7ZA 4CN1A 4ELKB 2JKTM 1RSYA 1BAFH 4HA1A 4IBSA 5D1XB 4ELKA 1HZHL 4FMVA 5D1XA 3ZL2A 4NQCE 2BZDA 5JHAA 4GRWF 3IRPX 4B9YA 3CX2A 4XCNB 5K9QG 4XCNA 1ES0B 1I8UA 5KANG 3AT8A 1ES0A 5FX3A 5HGHB 1WF5A 5HGHA 4KI5E 1D5ZB 3LHPL 4QCIB 3TO4B 1D5ZA 2R1YB 4QCIA 3TO4A 5IUSA 2R1YA 5IM7B 2O6DA 5IM7A 1IKNC 1QPXA 1V5JA 2BVOB 4NZUH 5HPMB 1W8OA 3A6BH 3CK0H 5KVDE 4I0PB 2BVOA 1G1KA 3T3ME 5HPMA 5J5EA 4I0PA 3OHMB 4GPVA 2QZ5A 4P5TB 1F3DJ 2HZHA 1INEL 3TV3H 1P7HL 4P5TA 3S8FB 3BMWA 3K46A 3LKNB 4IKJA 4JG1L 3LKNA 1TJIH 2HT2D 4M7LL 5E9DB 2Q1EA 2G5UA 2ZONA 1P53A 2YQ2A 3O6FC 3BKML 5E9DA 2BSDA 5GRJH 4CGUB 2XN9B 1AOZA 2XN9A 1DDTA 1FYTD 2NCMA 5EH1A 1RIHL 1HU8A 3P0GB 3UJJH 1KELH 3BFOA 2O1AA 3DX0A 2JQAA 4WJKB 5LO7A 4XHJD 3DV6B 1G4RA 3K4ZA 2HKAA 3ZL1A 3DV6A 4RGMC 1WP6A 2VXUH 3OQ3B 3WUZA 5T3XH 3NRQA 1WEJH 3L4YA 3CZEA 1FL3B 4V2CB 1FL3A 4UWQB 2DIEA 4KJPD 2WANA 4L2LA 3F12B 1RCYA 4PVLA 4JPQA 3F12A 5DGQA 2DLIA 1JPTL 4UBDC 3OC5A 1OTTD 2EE6A 4QHUB 4HPOL 4A6YH 2WNGA 1GIGL 4QHUA 2VZ3A 3W0WE 2D7TL 3MRDB 1Q90A 4HUKB 1IC0A 1L9SA 3MRDA 4MMZB 3ABLB 3CVHB 4UIKH 1JAEA 4W9IC 4JHAH 3CVHA 4MMZA 3P4LA 3NAAH 3RPKA 3K81A 4K94L 4JDZB 2QFPA 4LLYB 4ZMLA 3V0GA 4JDZA 4FEIA 4LLYA 2N0MA 4O9HL 3VTAA 1XAUA 3IBOA 3H2WA 1ZXQA 2YARA 5CS7A 3UCQA 4OLEA 4L4VD 4KKCD 3GMQB 5C07D 5HI5C 3DJRA 3GMQA 1JL8A 4AW7A 1C1EH 4MNQD 2VC2H 3EOAB 2OJEB 3RWEB 3EOAA 3WIAA 5MERB 3RWEA 3QEGL 2OYPA 5MERA 3CN2A 3U82B 1XSOA 5IOPB 1V7NL 1XIWB 2K9FB 4JFSA 4R5TA 1ESOA 5IOPA 1XIWA 2DOCA 2P7TB 3B3IB 4IBQA 1EUUA 2P7TA 3B3IA 1MAML 1BIHA 4JO1L 3GB7B 3U9PL 3PFQA 3GB7A 1X5LA 5E6ZA 5TQ2H 5DHDA 2YWYA 1D7BA 5CEZD 2UVFA 4P5SA 4K7PY 1X9UA 3L4UA 5DT1H 1FLTX 1J1PL 3LY6A 6FABL 4YDMA 4UMGA 2VR3A 3EGDB 4YK4C 5JZ7D 5B7MA 3EGDA 2AFNA 5FDYA 2VLJD 3CPLB 4A1RA 3CPLA 3ZR5A 1DN2A 1R3KB 2B8OT 1R3KA 3B7UX 4MXWL 5F97E 2DTMH 1JHLL 2N1TE 3RZWA 5IHBA 1U4EA 5D7KD 5I1DB 5DURD 5I1DA 2CA3A 2X05A 3BIKB 5F21B 3BIKA 4JFWA 3NSYA 3ZDXB 4LSUH 4DO6A 5B38B 5JW4M 2JKRM 3ZN6A 3DVFA 5B38A 2JQZA 4XVTH 3CDCA 4P2OB 5ABAA 4P2OA 3BD4A 1F2QA 1ZY9A 1VGEH 3MJGX 2H7WA 1QPKA 1F97A 4GO9A 4ZUSA 3N1PC 2Q86B 3B3BA 3NP4A 3UGEA 2Q86A 2IMNA 3FRPG 1M42A 4AQ1B 3NCBB 3FMGL 4TXVB 4AQ1A 4PJHB 2IFGA 4PB0H 4IU3B 4PJHA 1OE2A 3C8DA 4IU3A 5BS0D 1A3LL 5E4AA 4UQAA 5I24A 3DURB 5DHYB 1JZDC 3D6GA 3DURA 5DHYA 5AALA 2YD0A 3ZXAC 1PW3A 3PQYE 4E0RB 1NEUA 4E0RA 3AWFA 2B3RA 2ZD0A 3DECA 4W6WB 4U05A 2RJMA 1DBAL 4W9FC 2VW7A 4AVKA 2MOGA 3STBA 4NNPL 5FIEA 4I1PA 4GINA 2DJ4A 3VGAC 4MA7H 2Q8BH 2W5PA 4QO1B 3FTZA 1FZKB 5IR1B 3BVUA 3MRRB 3GHPA 4QO1A 1FZKA 3KPMB 4D2NA 2GUOB 3MRRA 3VWJB 4YSQA 2C3GA 1M4KA 3KPMA 3QIUD 2GUOA 4FYTA 3I6LE 4G8GE 4KDTC 3VWJA 5L7XH 4CKQA 3BO8B 1A7BA 3P9LB 3A21A 4JRYB 3L9EA 4KZ0A 3BO8A 3P9LA 2BCKB 4JRYA 4XBEL 2PR4H 4M02A 5F0LB 4LRNL 2BCKA 1EO8L 3S6CA 2X88A 4CN4A 2J56A 4KTEL 4JMXA 4PVNA 1PX3A 1E8XA 4YDKL 1JV5B 4BUGA 1TYEB 2CKBB 1JV5A 4M6AA 1NGPL 2CKBA 3D87B 5ERWB 3VRLE 3E9UA 1MCEA 3TN0C 2NXYB 5ERWA 1P5VB 12E8H 1P5VA 4FKEA 1PGRB 2BDNL 2W80C 4TL4A 4OLWL 3BAKA 1UWXH 1S7UB 4KKNA 3UDWA 1RIVH 4IMLB 1S7UA 5D2LB 1JMXA 4IMLA 5D2LA 3BPOC 2VXSH 2WVSA 5EPMB 2ESVD 2IAMB 2KKQA 1Q9KB 3F04A 4HS8L 2IAMA 4MYWB 5EPMA 1Q9KA 4ZPVB 1SLUA 2Q2EB 4PREB 5IMKB 4ZPVA 3SPGA 4PREA 5IMKA 3ESMA 1C5CL 1FL5B 4OZGB 2EDWA 1FL5A 4OZGA 1LD9B 4H8VA 4B9KC 1LD9A 5B4MC 2V6HA 3BYYA 2BXZA 4Y2DB 4AV5A 2XVKA 4Y2DA 1FFTB 3WEAA 1SFHA 4JFZH 2OCCB 4HH8A 4PJBB 3IAPA 1FYTE 4PJBA 1FNFA 4KMTL 2G2NA 5CU5A 3V0DA 1JGVH 4MAYC 5DJYB 2J21A 1U41A 5DJYA 1KBPA 3GEFA 4G83A 3DX7B 2L0DA 3KBEA 1AXTL 2FWSA 3DX7A 4LCWD 5ESVB 4OCNC 4S1QL 2XCMC 5ESVA 3DO3A 1E4HA 3PAVA 4KXZI 4PCTA 5HD8D 1A7QH 3IU3B 2W91A 1FNAA 1XL4A 3KEHA 1G9NL 3IU3A 4AMKL 3BGFC 5BPPA 4OCRL 3RVUC 4XOEA 1F58L 2X09A 1S78C 4KJWC 3ISWA 2WLKA 1NFDF 3NPSC 5J57B 3FH8A 4M29A 15C8H 2A4EA 3TYGH 4Q9RH 1XGRB 5B1BB 2DKUA 4Z78B 2ED7A 1XGRA 5KW9H 4L4VE 3FUNA 5TDNB 4Z78A 3WLWC 3B2DC 1PU0A 5TDNA 3ZE1B 5C07E 2EVIA 2AITA 4MNQE 1NMBL 4Z9KB 3BKYH 2BNQA 1GAFH 2XV0A 1NIBA 2XYCA 4TMPA 4XPFL 4BHUI 1EXGA 1A0QH 2ZIDA 1CO1A 4AVJA 1NDMB 5CLYA 1NDMA 4M4PA 3UGXA 4QRPD 3E6HB 3E6HA 2VC2B 3GC3A 3P3TA 1N8OE 4UNTA 5D1QD 1Z9OA 3EO0B 5T1DH 1V54B 3T9WA 3EO0A 3K5SA 4R4BB 5KVDL 1BZEA 3OL2A 4R4BA 1EHXA 1TVDA 4FHJA 5AW5B 5EEUA 5D4JA 1S9WB 4M7ZC 4F7TB 3NK4A 1UXMA 4XVJL 4J3OC 4F7TA 1SBSH 3NIGB 5ADPL 4AW4A 4JKLA 2VLJE 3CD4A 4ODSL 3F58H 1IV8A 1OLLA 2YLKA 2Z91B 4PY8I 3K6SB 3KLHD 4OVVA 2F8XC 2Z91A 3K6SA 3NTCL 4QTHB 4YS4A 5D7KE 4MTMA 1BQHG 1IKFL 4QTHA 4HUVB 2HMIC 5IWLA 3QJHB 1R5VB 1JZ7A 4HUVA 2EDHA 3QJHA 1R5VA 2EDJA 4TQEH 1BYOA 2O6CA 1JTOA 3OXRB 2BJMH 4HK3N 3RFZB 3OF6D 4R96B 2D7OA 2KI6A 3OXRA 3WE6B 2YRLA 1OTUC 3RFZA 4R96A 3WE6A 2NZIA 1PG7X 1IE4A 5HDQH 4Y9FA 1BF5A 2E6QA 4DW2L 2VZTA 4KZDL 1RJYB 4LVOC 1ETA1 1QX1A 1RJYA 1P2CB 1UM5H 1P2CA 3QNXB 4I48B 1YEJL 4CW1B 3QNXA 4I48A 1XGYH 2EVHA 4CW1A 1QW9A 1BVNP 5D6CB 2CK0L 5D70H 1Q94B 5D6CA 1DLHB 4JO4L 1Q94A 1AS7A 1DLHA 5BS0E 1Z0NA 5FGBA 1O6TA 4YBQC 1TPXC 3JV6B 2GB2A 3P2TA 3JV6A 1F4YH 4XNXL 4XP4H 5KJ7E 4PJGF 4GP5B 3L13A 2BO0A 4DOHE 4UT6L 2G4EA 4Q4EA 3KPOB 4HS3B 2NNRA 4HWUA 3KPOA 3N3EA 4NERA 4WTWA 4HS3A 2WZ0A 4JN2B 5FXCH 4ZXBB 4JN2A 3TL5A 4ZXBA 2C4XA 3OAYH 4TKWA 3NJKA 3GSNH 3ZR6A 4Q0XL 3VXSB 4QTIH 4NOBA 3VXSA 2I9TB 2I9TA 1N5AB 1R4XA 2NY7L 3O2DH 1N5AA 3F7VB 3T0XA 3QUZB 3OB0K 3F7VA 3QUZA 1XTMA 3X3GL 3VWKC 3EDFA 2R4SL 2CJUH 2NUTB 1SY6A 3KM1A 3SCMD 5IZ7A 1ZLDA 2NUTA 4JS7A 4M1GH 2PUQT 1NCDL 3O2VH 1H6EA 1AGCB 3DBXB 5C1MB 1FGNH 2LGNA 1AGCA 3DBXA 4HD9A 5FHBL 2XTJB 2QVMA 3EUDA 2HVKB 1EJ6A 2YAHA 2HVKA 3MLYL 3TZVC 4K3EH 2NZ9D 3P9WB 3HBZA 5CJOL 1DBJH 4KX8A 2QR0B 3B9KC 5KAQG 5I26A 5T3ZH 3V0JA 4DSYA 2QR0A 2PPEA 2XN1A 4GMTL 1HJCA 1RY7B 2ESVE 5EOTB 3EFDL 1SJEB 3DC0A 5EOTA 4Q9QL 2OTWB 1SJEA 1MCOL 2OTWA 4LF3B 3FN9A 4LF3A 2VGLM 1JPSH 1NGXB 1EXUB 2G4GA 5DS8B 1NGXA 2ADJB 2K7PA 1EXUA 2Y5TB 1N0XH 1RP8A 4Z7UF 5DS8A 2ADJA 1BZOA 1QRND 2Y5TA 3BUDA 3RVVC 3SDAB 3SDAA 1UT2A 1SF5A 4DUVA 4WI7A 2YBRB 2B7DT 5DO2C 3LPGA 3VXNB 2YBRA 1Z1WA 1GKEA 1YQ2A 3VXNA 1XB3A 4HEME 4PMFA 4FFWD 4HFUH 4PWHA 3BZDA 1K2DB 1O9ZA 4Y0GA 1OAKL 2B9AA 3BN9D 1K2DA 4Q58C 4ZUVB 5IJKC 4K94C 2VQUA 5EO9B 4ZUVA 4OUUB 1U3NA 3LDBB 5EO9A 2YD9A 4OUUA 1INDL 4Z5RB 5T1JA 2B2XH 5LQBH 4Z5RA 3CLEH 4OZHE 1W6LA 5IW6B 5IW6A 4LCWE 3R8QA 1MHPL 3PV6B 1FZJB 4XP5L 4WI4A 3PV6A 1FZJA 4FQ1L 4JMNA 2V3FA 4AQAB 2V9RA 4X7TB 4AQAA 3H6AA 4H0GA 4X7TA 1J0IA 2HT3D 2X2IA 4GOSA 4LXFA 3AG3B 3REWB 2AI0L 2V3EA 3REWA 2YD2A 4ABQA 3OTTA 4OGYH 1YYLL 2YOAA 1CL7I 3HE7D 3S3PA 1J1OL 1MI5B 2H45A 1DHKA 1MI5A 3FUHA 1C8PA 5BMFL 1U30A 5TPWL 4N2AA 3CIAA 4LQFL 2E3VA 4MNGB 1FAIL 4MNGA 1Z0MA 4HJSA 5HHXH 4O2FB 2GSIB 3II2A 3QPXL 4O2FA 2B0SL 2EDQA 2GSIA 2FJGB 4IRZL 1CDGA 2FJGA 3TM6A 5ITFB 3VG9B 5ITFA 1DVQA 1IKOP 2VLRE 5K9JH 4GRMB 1J5DA 4GRMA 1DBMH 4QRPE 5DHMC 5IQ7L 4X6CB 3S4SG 5D93C 4X6CA 5IGXH 2J20A 1A8JH 5D1QE 8CGTA 2ENQA 3LIZH 4NJAH 2I32A 3QEHB 2J57A 5TFSL 4EKJA 1ZMYA 3QEHA 3BUTA 1TJGL 2AQQA 1USZA 3OM3B 3DJTA 4R2GD 4JFYB 5FGSA 5AAMC 4JFYA 2DQTL 3GT6A 3TFKD 3QSKB 3WJMB 1P7BA 3WJMA 1U8IB 1FE8L 4F2FA 5F89B 3RHWF 4E5XG 1U8IA 5F89A 3RNKB 3QZOA 1QVOB 2QT6A 2R69L 5I8EB 3RNKA 3FBKA 1QVOA 2MPVA 5I8EA 3ULVC 1WFMA 4U1GC 2WXPA 3B8YA 2DQHH 2IPKB 1L9OA 3CFMA 3K71B 2IPKA 1DZBA 1UM6L 3K71A 1IT9L 1N68A 3UIYA 3MQIA 4WY7H 4UANA 1IBDA 3I02B 1NC2B 3N41B 3I02A 1NC2A 4EI5C 2J5WA 1CURA 1FORL 1L6PA 5AW2B 4P59H 4TUKH 2GBVA 3V2AR 3L3HB 2EZ0C 3D2UD 4FRWA 2VMFA 4HJGB 3L3HA 3VYNA 1TZHB 4HJGA 5CJXC 1TETL 1RLBA 1TZHA 2F08A 2JCCB 3HUJB 4JKKA 5CSGA 2VJXA 2JCCA 4ZYKB 3HUJA 2Q3XA 4FCAA 5FCUL 1WFNA 4ZYKA 1ETB1 3Q9QA 4F8PA 1Q0YL 4RMUA 4XNZB 4AWJC 1TMQA 5HDBB 1RQ5A 4G6FD 4XCCH 5C0NC 4OKDA 5HJGA 4AGQA 4F80A 1IAII 5KWYC 3GMRB 2OSWA 2GHZA 3ASOB 3EBGA 1E0OB 3GMRA 1X4YA 3GINA 2DQDL 3QJXA 4MJID 3OGCB 1NPUA 3GIZH 4NXSA 3OGCA 5CEYB 3QDMB 4J1UB 3JVGA 2VAJA 5CEYA 4J4PC 4J1UA 3OPZL 4M43L 3K4DA 1UEYA 1KF9B 3H3KA 3I74A 3OHXB 4FLQA 3L17A 3OHXA 4JPIB 4BUHA 4ZW3A 3L9BA 4JPIA 2FECI 4FLHA 1BIIB 2V4LA 4LHUD 3RX8A 1BIIA 1CGXA 2DLHA 4YN3A 2ATAA 4H88H 4IRJD 4U1IB 3DRQB 4U1IA 3DRQA 2C9UA 3P3SA 4W4OC 2VQ1B 3PDDA 3PUUA 5I0YA 2VQ1A 5G4OA 3AY4A 4DN3H 3ZKXB 4OJEH 2H0JA 3GSNB 4UM9D 5CEZL 3O3BB 3GSNA 2PWHA 2WVUA 3O3BA 3VU1A 1DBKH 5JDJA 2C34A 2ITEA 2XQBH 2YLHA 4A67A 2BIIA 2OR9L 3KEDA 4IGBB 4OW6A 4PJAE 3VNYA 3IFNH 4ALAL 1L9TA 4IGBA 4BZ2A 1N26A 2EUXA 3O2DA 3PDGA 1F8TH 1ZIBA 5JHBA 4I13B 3C60B 4KK9D 2EC9U 3UEQA 4C4BA 3C60A 1JHKL 1OGPA 5LNDA 3O4LB 4KRMB 3O4LA 4DH2A 2H0FA 3SYPA 3C8KB 5I0VA 1K85A 1TIUA 3C8KA 1MCCA 2E56A 5HYFA 4U4IA 1MCSA 3LZPA 2AVFA 1WA0X 3MCKB 2YUVA 4XNYH 3MCKA 2P8PB 4HF5H 5CILH 2P8PA 2DLEA 3EO1B 2IBBA 1S3KH 3EO1A 3QZWB 1E27B 3A6CL 1LQBC 3KYOB 1QRNE 3QZWA 1E27A 2YS4A 1G9NC 3IKKA 3E38A 3KYOA 3RU8H 3B2PA 2FLRT 4YSUA 1RK7A 2UX6A 1U8JB 4J8RB 3GRWL 1U8JA 3RX9A 4J8RA 1UYWH 3WUWB 3ZKQD 3WUWA 5IROC 5T8IA 1UB6B 3MLWH 1A6UL 4LLUB 1UB6A 2ZCHH 4LLUA 2B16A 2HXAA 3ARWA 4OGQC 2DI8A 4O5LH 1QUPA 3QZLA 1NIFA 3HB3D 3V4PH 1VZHA 4ZMYA 3WTSA 4JPWH 5DUBB 3AB0B 4H1LG 2ERJB 5DUBA 2X44D 5ILTH 3D30A 3QI9C 4XAWL 4WI2A 5INDB 1IC5L 1Q9WB 5INDA 1J5IA 2QVKA 1Q9WA 3B7RL 2KDGA 5CAYB 4KI5C 3H7LA 3WS6A 3JBG7 4KTDH 4JFFD 4OU3A 3S3BB 4UYQA 1VPOH 1BF2A 2Y07H 4AEEA 3ESVF 4XP6H 3VUAA 4P9HL 5IVXB 1QLEB 3EO9H 3VO0A 1MFUA 5AVZB 5IVXA 3LH2H 1KTRL 3Q8BA 3TIEB 4W81A 4IQHA 2DD8H 3D09A 3TIEA 3ARFD 1OOAA 1U8HB 5GS2D 3EUUA 1U8HA 1MFEL 2DYSB 1DL7L 3OBAA 3FSOA 2X9YA 3LZRA 4LSVL 5D1ZD 1JNJA 9PCYA 4PJ5D 4Z76B 4Z76A 3UACA 2X4OB 4ELMB 3QUXB 2X4OA 4ELMA 5B1AB 5AW0B 3QUXA 2VQTA 4OZFH 5I1JL 1A6VH 3MXWH 3ATFA 5JPMC 3MBEB 5I15H 1N3NB 2NTSP 2EINB 3MBEA 1NFDE 4YDVB 4G6JH 1N3NA 3U6XA 4YDVA 2HJLB 5GRUH 3WIHL 2VKWA 1IKNA 2HJLA 3TCXA 5C86A 1G7MB 1G7MA 2ZXCA 5E2UL 1ETJA 1D3CA 2H1PL 4A7GF 1CGVA 2J1WA 5L2KE 2EH8H 2G9HB 5ABDE 2RFXB 2G9HA 1FFRA 2RFXA 1PLGL 3FTGB 1UH3A 3MAWA 4JHUA 4WTZA 5LGHL 3FTGA 3O6FB 2W94A 2WUBL 3O6FA 1BF8A 4H7VA 3F62A 3LIZA 1X5KA 2CAKA 2YPVL 3EG9B 4H4NA 3LQAL 3V9FA 3LS5L 3T04D 3EG9A 3NABL 3O4OC 3C12A 1CE1H 3WAKA 4HKXB 4WAFA 4HKXA 4E41D 3DGGB 4RGMB 4EEEA 1IGMH 1QTPA 3DGGA 1BZDA 1RJCA 5GSRB 2J12B 1T03L 3QP3A 5GSRA 3V0WL 4BD4A 4ZOBA 2EC8A 4ONGL 2W38A 1JZ4A 3A67H 4HXAH 2JIXB 5FFGA 4JG0L 4HLZH 2JIXA 2W07B 3ZE2B 2ZYSA 2W07A 4APQC 2TSBA 2F5AH 4I2XB 1I7UB 4ZFZB 4I2XA 4LOUC 1I7UA 4ZFZA 3WEMA 3TASA 4PLNC 4OCMC 3DGDA 1AR1C 5A3ID 4OAWA 2NY2B 2NY1C 3MA9H 5HHPB 5BVPL 1BVOA 5HHPA 5LWYH 4M7KH 4N2IA 2H2SD 3RZCB 1BMWA 4G8AC 3RZCA 1AGDB 3HC3L 1BREA 1AGDA 1A7OH 1HINL 2CCWA 2CUIA 2ZXAA 5C0BD 4I4WB 2CLVB 4M1DH 3FCTA 4A68A 4I4WA 2CLVA 4MJIE 2C26A 4FERA 3G5ZB 4KRLB 4TULL 1EBPA 3G5ZA 5BVJB 5AYQA 5BVJA 1JI1A 4DGVH 4ESKA 5JXED 4UB0H 2WUCL 3KL3A 5T33L 3UAJD 4Y4KC 3CLFL 3BSGA 3DSFH 2P5EB 2Y5QA 4FL4C 2VDRH 1H8NA 2P5EA 5GGSB 3X14A 5DVPA 5GGSA 4HT1L 4I77L 1D6VL 2FYVA 2WBWB 4PMEA 2IADB 2IADA 5E94B 2I85A 2XQYK 3N1QC 4YK4B 4JHZA 3MGAA 5E94A 5CN2A 1X4ZA 5C70A 6TAAA 4BSJA 4WTQA 4HDIB 4L3AA 3NVQA 3B34A 4HDIA 4XNDA 5IFHH 3WYRA 5AVRB 2VN4A 3LNDA 4U4BA 3D48R 3K2MC 3VD5A 3GSQB 3GSQA 3L48A 2WLHA 1JTTA 5MEOB 2OM5A 4J6IA 4NX0A 5MEOA 2GEQA 1YDPB 3FULA 3HPLB 4W9EC 4HJJH 1YDPA 3HPLA 1AQMA 4HWEH 1HHKB 4XPHH 4RFOL 1HHKA 2LU5A 2VR9A 3LRHA 1W0VB 1FO0H 5DZLA 1W0VA 1FVDB 3IS1X 1FVDA 4LCYB 5F9AC 3GI8H 4LCYA 3EHBC 2PO6B 3VB8A 1PFCA 2PO6A 5HGBB 4MXVF 3D85D 4EN3C 2JI1A 5HGBA 1JDCA 4PHXA 5ANME 3LEVL 1HZHH 4YXKH 2ENJA 2HLEB 1CYXA 5C2BL 2XOTA 2BZCA 3FSVA 2P24B 3H3PL 4I1RA 1ZV9A 2P24A 2NY6B 1D9KB 2VUKA 3AAZB 5BCAA 4XBPB 1D9KA 5D5MF 3AAZA 1QWHA 4XBPA 3M7OA 5B8CB 1D5RA 5CINL 2OX5B 5B8CA 4XNUL 3MLPA 2OX5A 3TPUB 2ICWI 3TPUA 5JHLL 2WTOA 3V6BR 2VN5A 3CZJA 2ZUQC 5C9JB 5KTEL 1F56A 2Y2YA 5C9JA 4Z7UE 4U7MA 4U6TA 5F7FA 5EC1B 1INEH 1XHHA 2G5BB 2APTA 2Y9RT 1JGIA 1AR2A 5JOEA 1YNTF 1YMMB 5DXWA 1GGIH 1G7IB 5A40E 4JFFE 3MV7D 1SEBB 1YMMA 4JG1H 4PP1D 1G7IA 4M7LH 3AVEA 3L1FA 1SEBA 4LP5A 4FNPA 1EJFA 3BKMH 3OLDA 1FHGA 1RUPH 3MPCA 1OP9A 2XG5B 2P47B 4EOWL 2XG5A 3HRPA 1QBLL 1RIHH 25C8H 4XTRD 4H20H 4PRDB 4PRDA 4NZRH 3NCYS 1AD9B 3ATBA 4ACTA 4PJ5E 1AD9A 1ZVYA 1R33A 2HT2C 4XNQB 4QXGH 4OY9A 4XNQA 1MW3A 2AXWA 3WO3B 2BINA 3H4HA 2P80D 1KJ3L 4TTGA 1KXQA 3BPOB 4CAGA 3FPXA 5EDXA 4HPOH 3WEOA 1GIGH 2EIZB 4OIIL 2EIZA 4V1DD 3MVSA 4YHKL 2WWMC 1M7IB 4OZFB 3HAEG 1M7IA 4OZFA 2UYLB 2NY3B 3QORC 3DMMD 4KJPC 4UV7H 1BVZA 4D0DB 2UYLA 3AQXA 3LPOA 3W39B 4RFNC 4D0DA 2YAOA 4WK0B 3W39A 4U6VL 2EE9A 1LHZA 2AQSA 4N68A 1IVLA 5CLXA 5EUOE 2YA0A 2WQVA 3G6JB 3G6JA 2WIMA 1UWEL 4RNRB 4LLVB 4RNRA 2PWGA 4LLVA 1BAGA 3IMUA 4MAYB 4QOKE 3G6AB 5C08B 3FTVA 4MAYA 5C08A 3G6AA 4LEEA 1Q72H 2ZG3A 4M93C 4WUUD 4ACPA 1ZOXA 1B6DA 3N1GC 4L23A 4Z7OE 1BJ1H 1XF3B 1QI4A 3HG4A 2AANA 3HBQA 1F6AB 1XF3A 2YXFA 4XCEB 4KKCC 1F6AA 4WWOA 4XCEA 4I89A 3UTSB 3LJ3A 1KIRB 3FHEA 4L4TE 4QF1B 1UQSB 2LLNA 3UTSA 1KIRA 4QF1A 1UQSA 3HC2A 4JO1H 1U3HB 3U9PH 1U3HA 3ESOA 1PIGA 4HCFA 2MCMA 2YD5A 4H2AA 3EJJX 3K0YA 4C59B 3DRTB 4MB5A 3DRTA 2X0WA 3QWQB 3RB7A 2VR5A 2VZVA 3FUMA 1J1PH 3CMOL 3WOVA 4BWWA 2LABA 3OGOE 1U8OB 1XD1A 3B2VL 1TYJA 1NFIB 1U8OA 3NPSB 1CCZA 1FDLL 1NFIA 2AV7B 4IIQC 1FBIH 2AV7A 2WKLA 2AQRA 5FDWB 1XDTT 1SF3A 3V8OA 3ZDYE 5IP4A 5FDWA 5DJZB 4GRLA 1DJZA 1JHLH 1SQ2N 5DJZA 5C0BE 4DIXA 1W6WA 5C0RH 3N2JA 3V4VH 4NWUL 3ERXA 2V7HB 4FQIH 3MRGB 1ZGLP 2V7HA 1F0LA 3IT8D 3MRGA 4ALAC 1LQSR 5C0CD 5I2IB 3VXME 5I2IA 4YNYB 1A9EB 2FX7H 4X9FA 1A9EA 2HG5B 1E5UI 4FE9A 4YNYA 2HG5A 2Z8SA 3C6SB 4ZZKA 3UBXI 2HPOA 4MWFB 2Q2LA 3C6SA 4MWFA 5L4FA 3S98A 1KWGA 5DU7A 2X6MA 3VXUE 4TLUA 3NSFA 4K8RD 3PFUA 2IGFL 3RA7H 3GFUA 3ASNB 2BHYA 2K70A 2K8QA 1A7RL 4M7ZB 3QA3B 3SPIA 3PGFL 1A3LH 3QA3A 4MFHA 5I1EL 2BY1A 1JN6B 2GPZA 5KYNA 5EIVA 1JN6A 4NN5C 1J9CT 5GGTH 4AEHH 2ZKXA 3CHXA 3QCUL 4GEJA 2EDOA 1QBBA 4YBHA 4WENB 4OI7A 1RZJH 3X1EA 1DBAH 4ZX6A 5DEGB 5JIQA 1EO7A 1BVNT 4NNPH 5DEGA 1RZGB 4BFNA 3ZL4H 5KVGE 4DQOL 1DLFH 1BQLH 1RZGA 1U8QB 2YKKA 3JT2A 4Q52A 3LN5B 1U8QA 4HS6B 2ZAIA 3LN5A 2LE9A 3BIBX 4HS6A 4QHLB 1KGCD 4ZX5A 1YEDB 2YAQA 1AIFB 4QHLA 1YEDA 1AIFA 2ZOWA 5EFIA 4LVOB 4XBEH 1KTKE 1NICA 4YZFE 2QEJA 2QSVA 4I88A 4YHLL 1KFGA 4KGLA 4KTEH 3QHFH 3T8VA 3ZVVA 4YDKH 4MD5B 2JJTC 1HOEA 2ZX9A 5EZIL 4MD5A 3FFCD 4Y4HC 2OL3B 4DGWC 1NGPH 4X5PA 2OL3A 4BCZA 4FNSA 2EEBA 3JWNG 4IBUA 4M8QB 4MBOA 5C97A 2CR6A 2LT9A 2Z0UA 1UTDA 4M8QA 5ICYB 4E2OA 3QW9A 1TPXB 2FUTA 5ICYA 3PGCA 3ZY7A 5JA9A 4Z1PA 1DEEB 4U0RC 2VTFA 4GS7B 1J8RA 1DEEA 1ML0A 3AFLA 2A74B 2X6BA 2A74A 3CHRA 3SHSA 1NBCA 3VNZA 1CFMA 3VX1A 1IEBB 3DUSB 1C5DB 1PEZA 1IEBA 1AZVA 4ZFFB 3DUSA 1C5DA 4ZFFA 2ODHA 3T0BA 5EBWB 2JF1A 4U0QB 5EBWA 1KXTB 1C5CH 5CBAB 1ADQL 5CFAA 1KXTA 5EHFA 2JFCA 5CBAA 1RZIB 3MV7E 1YPZB 1A1OB 2N56A 2XV6B 1RZIA 4QRAA 4S1SL 5IB1B 1YPZA 1A1OA 3EW3B 1ZGLB 3GSWB 5IB1A 4J2XA 3WEXB 1ZGLA 5C6WH 3GSWA 1FP5A 3BKJL 3WEXA 3X13B 5I1GH 3MBXL 1AD0B 3X13A 2GJZB 3B2XA 3VXOB 1AD0A 2AQ1A 1H6TA 2GJZA 3VXOA 5L9DH 4ZO9A 4PWEA 1EA9C 4KQ3L 4QRQB 3CVIL 4FD0A 1RH8A 4QRQA 1KPUB 1KPUA 1G5AA 4L4JA 4NC0B 3QPKA 1LO0L 5KS9F 1AXTH 1ET7A 2DQFB 3GPEA 2Z7ZA 4MQ7B 2DQFA 3VVWA 4MQ7A 5DRNB 3LQAC 1HSBB 1H3TA 4R90L 4S1QH 2DBLL 5DRNA 3TZVB 1HSBA 4N9OB 4GH7B 1S9VB 3T1FB 3TZVA 3BSZL 1S9VA 2Z8WC 3B9KB 1MREL 3H54A 4P07A 3T1FA 5I6KA 3CQFA 1G9NH 3B9KA 4AMKH 4OCRH 1F58H 1BJ1J 4NBXB 3ARSA 5JMOC 2FVNA 4V1DE 3MRHB 3O41B 3MRHA 3O41A 2YR3A 2LHAA 2CLZB 1Q38A 2CLZA 4PJIE 4XXWC 5HD8C 3EJTA 4EKXA 3O45B 4UQCA 5DZPA 3O45A 4U1KB 2OP4H 2YQGA 4U1KA 3CFTA 4YX2L 3T6WA 1Y1DA 3HMWL 2VRKA 5LGYA 3NFSL 4LDEB 4NN6C 1NMBH 1RK1B 2HJKB 3ZDXF 4PN6A 5DVMA 1RK1A 2HJKA 2DL2A 4WUUE 4HIXL 1I1FB 5G2NA 1I1FA 1FYHB 3THML 1J9QA 4O02H 4ZODA 1QMUA 1XB8A 2A0LD 1D5IH 4OSUL 3HS0B 3VD7A 4JQIL 1FH2A 3HS0A 3HG3A 4JQVC 1VZGA 1ED3B 4YHPB 1ED3A 4YHPA 2I5YH 1ILSA 5KVDH 1QZNA 1B90A 2YPLB 1CTNA 1HXKA 2EDYA 1WITA 2YPLA 4DO5A 1OARL 2YZ8A 4FFVD 5HGDB 2Z8RA 5HGDA 5JW3L 3ELQA 2DN7A 1GHFH 5D8JL 5F6HI 5ADPH 1E4WL 3L5IA 1CFSB 3VQLA 1CFSA 3DOIA 1CDJA 2F53D 4ODSH 3BYTA 5D1QC 1TQUA 3BXNB 2CO7B 3L5XH 3ARDD 3BXNA 2CO7A 2QTEA 3ETSA 3KVPA 4NQED 5DUPL 1Y6NR 3I9AA 3EYFB 4JVWA 3GZQA 5LXGH 3EYFA 3ZO0A 5EG6C 4XB3A 3AMLA 2IFFH 2WINB 4JK0D 5C0CE 5DMGC 2WINA 3V8CA 2ZKYA 1QFWL 3JWDL 4OTXL 2WLNA 1N67A 3KLHC 5KSAD 1XZWA 2I27N 3D7PA 1ZLWH 1RK0B 4YDLB 4XBGB 1K4DB 1RK0A 1XBDA 4XBGA 2F1EA 1K4DA 1JGLL 1FNHA 4KZDH 1ITBB 1BD2D 1KC5L 2DBJA 3V5DB 3ZQ9A 4HG4J 3V5DA 4KQ0A 1T7VA 2A9ML 1YEJH 4TRPL 2LOEA 4F33B 3CFNA 1BG1A 1KY7A 3LKQB 4F33A 2F5BH 2IH8A 3LKQA 2CK0H 3LPFA 5D55A 5EEZA 1HJBC 3VW3L 4JFDD 1EZLA 1LEGB 4ODTL 1LEGA 4G6AC 1OE3A 2EXWD 5AAMA 4A55A 1KMGA 1H8LA 1UOWA 3F7QA 5FYKH 4ADIA 1JPST 1MJ7L 4IKNA 4XNXH 1CDBA 3FQUB 3UTQB 5D2LF 2BOCB 5A16B 1SOQA 3FQUA 3UTQA 3UERA 3GSOB 2ZP9A 1LMIA 3MCLL 4X8GA 5IW1B 5A16A 3N43B 3GSOA 3V0HA 3L4ZA 5IW1A 1EPFA 4JHWL 1IIKA 1UZGA 4OCWL 2NX5B 2IC2A 3EFFB 4N0UE 2NX5A 4GNKB 3EFFA 5F72S 4XN9A 2C3XA 1BSIA 4Z0BL 2CO4A 2OZ4H 3TWYA 3KPSB 1UZ6E 4OZGF 3KPSA 3ZJAA 3PHAA 4LPTA 1LE9B 3B56A 1W0WA 4A7UA 1LE9A 1ZHLB 2H4EA 1KGCE 3U0TB 2EJ1A 2DJSA 1ZHLA 4F5CE 1AHWC 3U0TA 1WZLA 4ZFGL 4JG5A 3HG1D 1E4XH 2HUEA 5DUML 1CICC 4EDWL 4I18C 1KBVA 3SGEI 3X3GH 2EICA 2W59A 3RIAF 1CLZH 1G7JB 4HCRL 1G7JA 3APFA 2ICES 3NYKA 1PIFA 2P5WD 3FFCE 1U8MB 3H0TB 4UQIM 1U8MA 3H0TA 3ZTCC 1E2WA 2YAMA 3D9AL 2EEFA 2H1XA 4OD2B 4OD2A 4YDZA 1WCBB 1P84J 1UZ8B 1WCBA 2E6JA 3B8SA 4LSQL 5GRXG 1UZ8A 1R19A 3ZKSD 1IAIL 5CJOH 4X8XA 5K1VA 4HJUA 4HQQL 1DN0B 3SCMC 3DHMA 4FG0A 4GMTH 1DN0A 1T2XA 2D03H 1M6OB 3EFDH 1DUZB 4R7LA 1M6OA 3AABA 4OF7A 4Q9QH 1DUZA 2ZXDA 1LO3L 1XSJA 2LW3A 4J4PA 1E5ZA 1MCOH 1AS8A 4DK3A 2CJTA 3NIFE 4KVCH 1W72L 4MXVE 3KYMB 2QHLA 3N44B 3KYMA 4MGXA 1MCKA 5IR1A 3GBLA 5KSUB 1Z3GL 5KSUA 2ZCLL 1AHMA 3ZE1F 1UOLA 5GGRY 3BCFA 4R6UA 4PJFB 3SPCA 4PJFA 5D5ME 4ZNEE 1OAKH 2BFVL 4E9TA 5J4MA 4N2MA 5D7JD 3CBRA 5BO1L 5EU6D 1INDH 2VERN 2ZYIA 4Y4FD 3MACH 4KHXL 1DQLH 4KMQA 1UKSA 2WXFA 3DXAD 1IB5A 4ODWB 4QXWA 4KITB 5KSBF 4DKEL 4ODWA 1TO5A 4NQDE 1KTLB 4XP5H 4XMPH 4BFJA 3DNKA 1KTLA 1I3VA 4FQ1H 1QFUL 3L2LA 3GNML 1T5KA 4OIFA 4WTXA 1DQDL 3VCLB 3ISYA 3VCLA 2ID5A 4XMLL 2LV4A 2AI0H 4UT7L 4X6BB 1IFGA 4X6BA 4ZTPL 4OGZA 3NIGF 5KVGL 1RERA 4LVHC 3PJLA 4CNIB 3LIUA 3STLB 1U6AL 1SJMA 3ZDZF 4CNIA 3STLA 1NM4A 5BMFH 5GZNC 1XH3B 2R59A 3QIBC 4P3DB 1AYRA 3BQUD 4LQFH 1XH3A 5C0JB 4P3DA 4FS0A 1GOHA 5C0JA 3UFIA 1OW0C 4OLUL 2EKJA 4PJXB 4C56B 4PJXA 5IROA 2NT0A 4C56A 3QPXH 2XIDA 2B0SH 3VAEA 3HE7C 4DGIL 4H8QA 1RZKC 4TS6A 2CBTA 4BQCA 4NQVB 3SODB 3EJCA 4NQVA 1ZAGA 5I6PA 5HI4C 2E9WA 2QHRL 1E5BA 3H53A 3QR0A 4L29B 3RUGF 1B0IA 2XWXA 4L29A 1YC8A 1ODAA 4F8OA 3QI9B