2VSKB

Hendra virus attachment glycoprotein in complex with human cell surface receptor ephrinb2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
138
structure length
131
Chain Sequence
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HEMAGGLUTININ-NEURAMINIDASE
publication title Structural Basis of Nipah and Hendra Virus Attachment to Their Cell-Surface Receptor Ephrin-B2
pubmed doi rcsb
source organism Hendra virus
total genus 26
structure length 131
sequence length 138
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vskB00
1JERA 1ID2A 3JT2A 4F2EA 3CG8A 2BP0A 5I28A 1J5DA 4BXVA 3FYEB 4DP5X 5E9NA 1QLEB 1E30A 5I5IA 1KDJA 4YSAA 2FWLB 2IWKA 3BVDB 1XB8A 2MTAA 2H3XC 2PPCA 1GW0A 3FSAA 1BXAA 3G5WA 3S3CB 2YAMA 3T9WA 2ZONA 3DKHA 2JFCA 4YSPA 3IN0A 2E86A 4A68A 1OOWA 3PAVA 3S8FB 3NJIA 3WNJA 1BXUA 3UGEA 3N55A 3JTBA 4E9RA 2FQFA 2XV3A 6PCYA 2XVBA 1PCSA 2I85A 3NJJA 3NSFA 3RYMA 1L9PA 1AZCA 1PMYA 1JXDA 1PZCA 3QJTB 2XYBA 3N2JA 3NJKA 4BDVA 1CYXA 1OCRB 3QQXA 1IBZA 2BP0B 4G7RB 4KO5A 1PLAA 4DP4X 3S3BB 1V10A 3ASNB 4KO6A 4N8UA 1HAUA 1AOZA 2UXVA 2HX7A 2J56A 3ASOB 3QJUB 3X1NA 2IDTA 1HAWA 4AZUA 1A4BA 2B08A 3NYKA 2AFNA 2XXFA 1BAWA 3NSYA 1AQ8A 1ETJA 1KBVA 2XV2A 2YAQA 4DP0X 2CALA 1UATA 1AZRA 4MFHA 1JVLA 2W88A 1BEXA 3NJMA 4BWWA 2QT6A 1GS7A 1ASPA 2WSDA 5D4JA 3NJFA 5TK2A 4DP1X 5A7EA 1PZBA 1N68A 1KV7A 4FAAB 4BDVB 1NTDA 5EHFA 5AFAA 1CURA 3S8GB 4A2FA 3FS9A 1L9QA 1J9QA 1FWXA 2PLTA 2PPEA 1OE2A 3TBCA 4HCIA 1L9TA 1NICA 2YXVA 1EHKB 1TKWA 2VW4A 4GYBA 4RH4A 2YAEA 1MDAA 2BP8A 3KW7A 1ZIAA 3OD3A 1SHXA 1KCBA 2B3IA 4HAKA 4YSEA 1L9RA 1AS8A 4A2EA 1KYAA 4KNTA 2PCFA 5D4IA 4A2DA 2UXFA 4WTQA 3ABKB 4DP6X 1OCZB 3WG7B 1W6WA 2CBPA 2XLLA 5B7EA 1WA1X 5I6LA 4P5SA 1ZIBA 3ZDWA 1PLCA 2VN3A 1L9OA 5F7AA 2YARA 1W8EA 4K9JA 1TEGA 4KNUA 2BW5A 2OJ1A 4P5RA 4G7SB 2FQGA 5ANHA 2FQEA 3AY2A 5I5JA 1JZGA 3S3DB 1ET5A 3FPXA 2UXTA 1CUOA 1EZLA 4CSZA 5I6NA 5LDUA 1JZIA 2FNWA 4DP2X 8PAZA 3TU6A 1PF3A 3D12B 3FQ1A 1NZRA 3KW8A 1NINA 3ABLB 1IUZA 2BP8B 1AS7A 5AKRA 4NB7A 1OCCB 4UAHA 4DPBX 1AACA 2VM3A 1NWPA 2ZXWB 4BWTA 2XWZA 4UF7C 4GY4A 1KGYE 1FFTB 4X4KA 3EH4B 3DTUB 4JHUA 3SBRA 2CUAA 1GS8A 1ASOA 1JXGA 5I26A 2IAAC 2HRGA 3L45A 5B1BB 2GI0A 3IBOA 3IE9A 2EILB 1NIBA 3CVCA 1GSKA 4E9VA 3QJVB 2NRDA 4G72B 4HHGA 4N4YB 5B1JA 4Q89A 2BWIA 3FYIB 2H5UA 2HZHA 4E9YA 2UX7A 4ZK8A 2QDVA 4G71B 3TA4D 1QNIA 1J5CA 3WKPA 2HLEB 1SF5A 2CAKA 2YXWA 4Q8BA 2HXAA 3NJGA 1N70A 1GR7A 5I6KA 3TBBA 4HIPA 3ABMB 1CYWA 4GP5B 1BYPA 3GXUB 2BWDA 1A3ZA 4BWUA 2BZCA 2IDQA 1KDIA 3UAEA 2AANA 2YAFA 2GBAA 2PP7A 3HB3B 2J57A 4L0PB 4E9XA 3AG4B 2QPEB 3FSWA 4YSSA 1MZZA 1DZ0A 1NDTA 1NPNA 4YL4A 3UAAA 1NPJA 1GY1A 1ILSA 3NJNA 3ZBMA 2PP8A 3PAUA 1SDDA 2PCYA 4DPCX 4DPAX 2FTAA 2RACA 3T6ZA 4UANA 1T5KA 5I5MA 3EH3B 4M4RB 2YQBA 3ABGA 3X1GA 3NP3A 2P80A 1ADWA 4GP4B 2Y69B 3QPKA 1BQKA 4A66A 1GS6X 1X9UA 1NIFA 1SFHA 3FQYA 3X1BA 4HCGA 4HHWA 5I6PA 1X9RA 1E67A 1WA0X 4KOBA 1M57B 1OCOB 4M3HA 3MX0B 3SBQA 3NT0A 1IC0A 1E5YA 2UXGA 1OF0A 2XV0A 2IDFA 4YSOA 1NIAA 5B1AB 2DY2A 1ILUA 4AX3A 2IWFA 2I7OA 3CDZA 3QJQB 1DYZA 1TU2A 3FPYA 1PNCA 4AI7A 4QKTA 3UACA 1ZDQA 2IH8A 3AG1B 4PAZA 1WS7A 4DP9X 5IY5B 1SDDB 1FA4A 2CCWA 2VSKB 3T6XA 2QDWA 1AIZA 1NIEA 4GP8B 4YSUA 1ASQA 1JOIA 2FT7A 3WIAA 9PCYA 4YSCA 4YSQA 1IBYA 1BXVA 3ERXA 1PLBA 1AG0A 2X87A 1AS6A 2AZUA 3ZX1A 1OV8A 1MZYA 1SF3A 2EINB 3PPSA 2WO2B 4F7KA 3OMIB 2R7EA 2HX9A 3GYRA 1XB3A 2GHZA 3OQRA 5B1KA 5F7BA 5I6MA 3CVDA 1IKOP 4W1TA 3FQ2A 3T71A 2VW6A 3PCYA 1BQ5A 4NAJA 3FU7A 4KO7A 2EIJB 3UABA 3IN2A 4W9ZA 4HALA 1JXFA 2DYRB 1HFUA 2P80D 3CDZB 2AVFA 1AG6A 1MG3C 4DP7X 4TXVB 4FA7B 1M9WA 3PLYA 2PPDA 4YSDA 5TK4A 4A2GA 1SJMA 1L9SA 2YAOA 3AG2B 3OM3B 1NIDA 2EIKB 2Y1AA 1TEFA 2EIMB 3NSCA 4HZ1A 4DP8X 1BYOA 4NERA 1JVOA 1JZFA 3BQVA 2DV6A 3V9CA 1B3IA 2VSMB 2W8CA 5D4HA 1A8ZA 4JKNA 5B7FA 2H47C 1AZNA 3SBPA 3OMAB 1JZJA 2R7EB 2I7SA 1ET8A 2VM4A 5B3SB 1E5ZA 1J9SA 1XMEB 2ZWNA 3X1EA 3AG3B 1R1CA 1A4CA 2FT6A 1AANA 4KOCA 2GIMA 2UX6A 1KCWA 3FU7B 1PZAA 1ZPUA 3EF4A 2Q5BA 2TSAA 2OV0A 1J9RA 2HX8A 1VLXA 4A67A 1RZQA 4BK5C 4BXSV 2IH9A 4AKOA 7PAZA 2IWEA 1CC3A 1XB6A 4AKPA 2J5WA 3NJLA 3PAZA 4PCYA 3MBWB 3UADA 3OMNB 3TASA 4A2HA 2DYSB 1AAJA 2WO3B 3X2QB 1WA2X 2CJ3A 2X88A 1W6LA 3AZUA 2XX0A 3CZUB 1E65A 4KO9A 5I6OA 2AZAA 2BHFA 1ET7A 1PNDA 1RKRA 4KNSA 2XXGA 2HRHA 3V9EA 4YVNA 2YAPA 1SFDA 1JZHA 4JHVA 1A65A 1V54B 2OCCB 3FSVA 1RZPA 2XX1A 3IEAA 4AKQA 4E9WA 1GYCA 2TSBA 4E9SA 4YSRA 2GC7C 3H4FA 5PAZA 3NSDA 5B1JC 1QHQA 3ZIYA 3NJHA 2FQDA 4G7QB 4G70B 2N0MA 4GXFA 3WNIA 1PAZA 1KBWA 4ENZA 1ZV2A 1AR1B 3AW5A 3QJSB 2DWSA 4E9QA 2GC4C 2J55A 3HEIB 2GSMB 3FU9A 5AZUA 2BW4A 4YVUA 3T6WA 3T6VA 2PPAA 1BQRA 1URIA 2LLNA 2PP9A 2A3TA 2FJSA 1AZUA 2VMJA 4E9TA 3WKQA 2JXMA 2GB2A 5B7MA 4EF3A 1PY0A 1YLBB 5FC9A 1I53A 3EHBB 6PAZA 3CVBA 1JZEA 1WS8A 1ZDSA 3QJRB 4YSTA 2ZOOA 2XU9A 3DIVA 3EH5B 1A4AA 4CSPA 2DWTA 1F56A 2IDSA 4QLWA 1MG2C 2PPFA 3U25A 1RCYA 4HCFA 1SNRA 2FT8A 3GDCA 4WKXA 2MRYA 3PXLA 5PCYA 2YAHA 1GY2A 7PCYA 3C75A 3FU8A 1V55B 1WAEA 3H4HA 2BO0A 3SQRA 2JKWA 2Q9OA 3FSZA 3X1FA 1SHWA 1M56B 2VW7A 3FT0A 1NWOA 2IDUA 3H56A 1J9TA 2XUWA 3WI9A 2QPDB 1AZBA 1OE3A 4F2FA 1OE1A 3NP4A 2BZ7A
chains in the Genus database with same CATH superfamily
4EBQH 4AVJA 1T0NB 1YJDC 2BP0A 3V5DA 4JRXE 2EICA 5E6IB 3PWPB 3QXTA 4UILL 3U30C 2YZ1A 1DSFH 5ANMA 1RUMH 5FUCE 5CILH 1SN5A 3MROA 5T1MB 1TZHA 2IH3A 3BKYH 4AUUA 2CO4A 5KVGL 3UBXA 4YDNA 1LO2L 3BUYA 3VM5A 3ZT5A 2Z0UA 4QRRD 1E5CA 1MPAL 1C08A 1QP1A 4FG2A 3B5GA 1II4E 3S8FB 2NY0D 3QNYB 3QNZB 2M83A 3N55A 4FQCH 3CFNA 1AH1A 5HDBB 4U3SA 1CGXA 1NCGA 2XV3A 3QS2A 4PI2A 4XX5A 4Z7VB 3GI9H 2NCEA 1FVEA 5KBPA 5LG6A 3L2LA 4URTB 1O9ZA 2CRIA 5AG9A 2RFXB 1A25A 1D2PA 1ZHLB 3EAKA 4I8DA 4NM4L 1DQLH 4YDLC 1XAKA 3VGGA 4BCYA 1CYXA 3QIUB 1OCRB 5I6XB 5ECJE 4XGZA 4APXB 3HA0A 4NCC1 4PBXA 5KBLA 4L1BA 4PJIB 3VXME 3S3BB 2NUPA 2ID5A 3MX0A 4XVTH 1P1ZB 1K6QL 5IR1B 3LKOB 3W2DL 3V7AG 1OY3B 3X1NA 2DKSA 4PGBB 1U91A 2B08A 2E47A 3DBSA 3EO0A 4MXQC 5MP6H 4I0KA 4IRJD 2BFGA 2GK0B 2VE6B 3MV9D 4IU3B 1NC4B 4KMTH 3ARYA 2Y5QA 4H8WC 1G1KA 4TLSA 2WNWA 4LSDA 1IC7L 2VUYA 1BEXA 4LEBA 1WISA 1RZ8B 1AKPA 1DP0A 3ZE2E 1Q0YL 4YC2C 3DO7B 4MJ6A 2V9QA 1S9VB 3C2AH 1IAIL 4D9RE 1EEZB 1KTKE 1HILB 3EYSL 2PPEA 1LEKA 4Z7OB 4QMEA 3S4SA 4PJCE 1GTFA 1L9TA 4DGYH 4HJSA 1FCCA 3F58L 2GYSA 3ME0A 4N2EA 1Y1DA 3P30L 4H5SB 1BP3B 2VW4A 4QYAA 2F08A 4GKZA 1RZKC 4HKZA 2YUWA 4FL4C 4JDEB 5F96H 4TTDC 2B77A 1IU1A 2ARJQ 5LGHL 1NAMH 1VFUA 1PD0A 2C7UB 1S7VB 2QBWA 2QGDA 4QRFA 4CMMB 1G4RA 1T20B 2X4UA 3SPHA 1FSKB 4YUEH 1EGJA 2J88L 4OZFH 1RK0B 2OMZB 4U6VH 1AO7E 2XIBA 2D7TL 3J07A 5EPMA 4DEPB 2OMWB 1OCZB 4DP6X 1HZHL 1I85A 4I3SH 4MCZB 1M05A 4A37A 5KAQF 2AAAA 4AYGA 5HYQB 4TTGA 3O0RH 5ETUB 3DX4A 4NPYA 3WIHH 3O9WD 5J1SC 2DICA 3GS7A 1JK9B 1T22A 4K23H 2X4TB 3T0VA 2Y5EA 3LNFA 2AKRA 2V9RA 4F2MA 1K8IB 1OK0A 1M42A 3CLEL 3L9RB 1CFQB 4P5RA 5D7LA 1IKNC 3OWRA 4D9LL 3PRZA 2IAMA 2VL5B 3JV0A 5I5JA 1HESA 2DM4A 3LPPA 4JS7A 4KAQL 1SZNA 5EORH 4X80L 3ZE0E 1DDHB 1RUPL 2AABH 3STBA 1EZLA 4CSZA 1JNLH 1M6OB 4JFFB 4Z7VF 4AEFA 1JGVL 2XBZA 3MRCA 5AW0B 4HUKB 2K3TA 4ZOEA 1R5IB 3BDBA 1KPRB 2R0ZH 3DMMC 2MPAH 4HIQA 1I1FA 3TWCH 3SDAD 2NY7L 1OF2A 3D85D 5CGTA 3JXAA 4DPBX 1MI5A 2Y24A 3V0IA 1HS6A 3HE7C 3ARDB 1F8TH 2F7OA 2XG5A 4PJIF 1DHKA 2JB6A 4ICXA 5KJ7E 1OGAB 2PYFA 2TAAA 2FAUA 3MN8A 1MRFH 3DDFA 1DBBH 2Z92A 3BSZH 3DTUB 2IXQA 4YHKH 1KIUB 1XF4B 4TVPH 5FYLE 2BS9A 3P9LB 1Q9KA 2R2EB 4MQXC 2Q10A 1LXMA 3DVGA 1CGYA 1IEAB 4HFUL 4QYOB 3IBOA 4AQOA 4N2FA 1FYTA 3RX9A 4L8BA 1FL3A 5BZWA 4JMXA 4N87A 5CD3A 3C8KA 1S9XA 4RFEB 1JPST 1N5AA 2XNAA 4BZ1L 1A6VH 4DIXA 1UB5B 1ZLDA 2Y9RT 3B3IA 1FZMA 4M4RA 4TF4A 4POZC 3BP4A 3MLXH 4ODSH 1PKQB 3E8VA 3GXIA 2V33A 3QUMB 3D7PA 1T1ZB 1VRSA 4XI5C 3MLYL 3U7YH 4QWWD 4F33B 4LBEB 3NK3A 3V5HB 2HA1A 5E1AB 3CZKA 4JAMB 4JO2H 3IGLA 4XRCA 2XDHA 3X11B 4QXWA 4Z7OF 4N85A 2Y6SC 4NQCE 1D6VL 5T5FL 3TPUA 5K39B 3UAEA 1JWSB 3TYFA 3ZTNH 1I7RA 4BUGA 4D9QE 2Z31C 4JY5L 1HCYA 3VWJD 5BZDB 3CMOH 4BRVA 2VDKL 5JYMA 3ZE2F 1VKXA 4Q4EA 1YYML 1H5BC 3IFLL 3AQXA 3MFFA 4UTBL 5CEZL 1SDDA 2PCYA 2PR4L 3KJ6L 1ZE3C 3CPLA 2IPUG 5CKAA 2DH3A 5AG8A 3KLHC 1E6JL 2X2JA 2RACA 1NC2B 1YN6B 1I8IB 1VGEH 1HL4A 2CKBB 2VDRL 2W94A 4AH2A 3ELAT 1QPPA 1FAIL 4ODUA 4PFEA 1X6NA 5CZXD 3U0WL 3JVGC 3H7BA 3JYCA 3F5WB 3QWOB 4NT6A 4PJ8A 1YEDA 1VSCA 4XBGB 1FNGB 2AXGA 2E8YA 4IIZA 4JFPB 3COOA 2YMXL 4MLIA 1BBDH 5JNYA 1TCRA 3MRHB 4AJ0A 1BCIA 3CLWA 3JYBA 3IDJB 4X6BA 2A9DA 2NTSP 3CZEA 2BLFA 5L4IA 3ARFD 2ATKB 2F19H 4H88H 4KRLB 4UOJA 2VUKA 2W0KA 1P4LB 4PRAB 3O4LB 4P5TA 5BRZE 2C1PB 2WMPA 3H9HB 4I9WD 1RP9A 1V05A 3DPBB 5DD0H 3SKJH 1E4XI 5J1AB 1CN4A 4Y4FC 1UM5H 5LGYA 1YNLL 1A7PH 5DWPA 4OGXL 9PCYA 2CUMA 2IO5A 3TBTB 4EPSA 1BXVA 1S3RA 5C3TA 4PRBB 1PLBA 2W60B 3VSVA 2ZJSH 2KPNA 3BVUA 4KDTA 4YL9A 4N1HB 2OQJB 5C08B 2DQEL 2QV4A 3C60C 1G7MA 1MCIA 2LT9A 4HA1A 3WOVA 1SVCP 1D6EB 2ARJB 2B1AH 5E2WL 2J20A 1N2RB 4FP8H 1INQB 4RFNC 1TT6A 1RZFL 5IBUB 4QRBA 4ZW7A 2QZ5A 3F12A 4J3XA 3U2SA 2A4CA 4OZ4B 4IBSA 1F58L 4DP7X 3CCHB 1DUZB 4YSDA 3CU7A 2N56A 3KLQA 4A04A 4PY7B 2HLAB 4LPXA 1RJZA 3UC0H 1GZPA 1VHPA 1IGIH 3PP4H 3LVEA 1T6VN 1SOQA 1CXLA 1TENA 1BYOA 2WP3T 5DQ9B 4H0IA 1M4KA 4UM9B 1RIVH 2YPLE 1IL1A 4MVBD 3SCMC 5IMMA 5I0DA 1V3KA 4FFVC 4IOFC 1V7NH 5F9JB 1EX0A 2ZX5A 4Y2DB 1Q94A 4PG2C 5E56A 3IRCA 3U1SH 4AMKH 2QGCA 4U1SA 5JW4Q 3K1DA 5KSAA 5BV7B 1CE1H 4D0DB 2Y06L 4P2RD 2IPTH 5D7IB 3Q8FA 4GW5A 4BFGA 3SE8L 3SN6N 4NZFA 4D94A 1VB9A 4GQQA 3LN4B 3RUGA 1C5BL 4FHKA 4NQED 1KCRH 1KIPB 4X5XA 2WXMA 4ZUWB 5C0CD 3HZVA 4IDJH 3EH2A 4XXWC 4KVCL 1DL7H 4J28A 3X3FL 4URKA 4A67A 1L0PA 1I1AD 4LVEA 2NZ9D 2LU7A 3KWUA 5IEKB 4KI5E 3HC3L 4N26A 2AEOA 1U8PB 2P5EE 1E9QB 1YJDL 2DBJA 5IMOA 3MTXA 2OL3H 3O6KL 3AGVA 4U6XB 2ZG3A 4HK0B 3BKML 1DJYA 3H55A 4AYID 1O6TA 1UT9A 1AAJA 2DQGH 2YD6A 4I13B 1HHGA 3LRKA 3TYGH 5ADOL 2WO3B 2EYSB 1C12B 4Z77A 4AYSA 3QDJD 4N2BA 3RGVC 3ZUNC 1HWHB 2AZAA 2BNRB 3LEVL 4LOUD 3OKLB 4HH8A 2XG4A 4KFMA 3LRGA 3IEAA 3RBSA 4LQFH 3TEZA 5AYQA 4NO0D 2AEPH 4GXUM 3RL2A 4A7TA 1IGFH 3IMUA 2APXA 2W0FB 4KK6C 3V4VB 2XACC 4MZ3A 3CH1B 1ZVSA 1X9LA 2HVKA 1UT2A 3BC9A 3MBEC 4JFDE 3FZUC 3D4GA 2HVJA 1D5XA 3NG5A 1EAPA 3U46B 3ROLA 5D2LE 3QO1B 3ARTA 1U8MA 4K3JH 2YD4A 3LKQB 3SE9L 2ZZUT 3TH3T 1VEMA 3LSOB 4NZUL 5ID0A 2O93L 1OAUL 4HGKC 4XMPH 4CC1A 1E4WH 3PGDA 2CHDA 3P73B 4WLCA 4HMCA 3QXUA 2A3TA 3K2IA 2P44B 4OKVA 4OJEH 4NJAL 4F7MB 4I48A 1XO8A 4Z76B 1E2ZA 2JXMA 5D7KE 2GB2A 1BFOB 4JFQA 4WIQA 3EO9L 4R7XA 2PYEE 5FHAH 5KYYB 5B38G 4FNPA 4YDIH 1A14H 5DQJB 4H8WL 3ULUH 1F6AB 2W38A 2WJ7A 4QPEA 1WO2A 4UV7L 1M71B 5HHXH 4P46C 5DJYA 1JGEA 2XVGA 4UT6H 4OLVH 2ADIA 1FH2A 3J2PA 2OSLA 2RJMA 3WTWA 2ADFH 4TSCL 1F3JB 4JQXC 4XZ4A 5LGJB 4MDIB 1MFAL 2QQKH 1GY2A 1Q72H 2F6AA 1J0JA 2Z34A 1A1NB 3OKOA 3T6QC 3Q5YA 3ILPB 3EJQA 3QXDB 4KZDL 1IVTA 1J9CT 3O6MH 3ESPA 2X10A 1BIIA 5EMYA 1RZKL 2LLGA 1X5YA 4TUKH 2A6IB 5L2KB 2Y5TB 1IGTA 1NUGA 1UXMA 2QPDB 1JNNH 1YYLL 3HI6L 2BCKB 3PWLA 4JZNB 4X83A 4XT1C 5FYJU 3VXSD 3MRIA 2Z8VC 1XBRA 4HK3N 4Y9BA 2Z93B 3C5ZB 3DV6B 4L4TB 5IHHA 4MD4A 1CDBA 4WENB 3DOSA 4ZTOL 3HS9A 3FHQA 2FRGP 2Q8BL 4NO5A 4ZQKA 1NCCL 3GEFA 2CR0A 2FDBP 3ES6B 2AJXL 1YECH 3LXBA 4C8XA 2FNBA 4HWBL 3N1PC 3H9SB 3QZNA 1Y1UA 1CICD 3QHFL 5BVJB 4B3EA 4N9OB 5FX3A 3N85L 1BXXA 5JR1L 1EZUA 4U1MB 3LZOA 3GMQA 3ZKMD 3LEXB 3DKHA 1MCSA 2AGJL 2YWZA 4X5WB 4X5PA 4KJYB 4G6AC 4XOBA 1NEZG 2IQ9H 4OSUL 4CN1A 1JDAA 4K5MA 1ZANL 1P5UB 4QGTA 1E9OB 1IEBB 4IBWA 4NYLB 3UYRL 5DO2C 5I1LA 4EZLA 4EXKA 3IJYA 2X4RB 3FHEA 2JNZA 4HS3A 3BD5A 4PI0A 4X9YA 2IH1B 5DJCA 2DMKA 3ULVF 4HJTA 3W0WB 3VG0H 4LLMB 4F20A 1UGNA 4PJ5B 2ZCHL 4IKJA 3BRGC 1SEBA 4P59H 3MRBB 3UX9B 2XWBA 4PVBA 4ZD3H 4NEHB 3QI9B 5F70A 3WMPA 2QKSA 1FL5B 3KXFB 4WEEA 1WPCA 5E94A 2YC1B 3KBFA 1X5JA 1BPVA 1L9NA 4FDWA 1W8OA 1MFBH 5IHZB 3RGBA 2WJ5A 1PLGL 2X05A 4JFYB 2J8UE 4AQAA 2NTFA 5CCKH 1L9MA 2BIIA 1CLYL 1G6RB 2UYLB 1RZGA 2UWEA 2J2ZB 1BAWA 2OSYA 4B7LA 4P4RA 4XBEL 3UFIA 4RNRB 5LBSL 3X12A 1G7JB 3GO1H 3OKMA 4P3WA 3WELA 5CN3A 3FN0H 1J11A 2FUQA 3E3QE 3NJMA 2QT6A 3EXLA 2C4FT 5A7EA 1J0YA 1N68A 3EOAA 4JBSA 5E8OA 1U3HB 3HMWL 3LS4L 1CURA 3S8GB 3Q9QA 1NBCA 1ZHBA 3SYCA 1RZ7H 1QTPA 5F1NA 3ILQD 4PVMA 2VDOL 3UDWC 5GIRB 4JQVC 2X0WA 4LPTA 4TSAL 4WEBH 4EI5A 4J8QA 4PJDA 1F1GA 5IFHH 1XCWA 4ZTPH 3O3AA 3QUMH 2BP8A 1HH6A 4LAQL 3LPWA 3FUEA 5FR3A 4PD4J 2L04A 1X7QB 1R75A 2G0KA 2A74B 3AADB 4EN3B 2CDGA 5IMKA 2X4OB 3RWCA 1A4JB 1N8ZB 4OI8A 2NZIA 3OXSA 4JKMA 1W6WA 4M1DL 3RILA 4P2OB 1WAAF 4L29A 4MNGB 5GZOC 1OAQH 5J3HC 3ZDWA 1PLCA 2LHAA 4G80A 2H45A 3HCVB 2GFBA 4N3TA 2ORBH 3TJEH 4Q58C 3TVMA 4BK5A 3RTQA 2FQEA 2CLRA 3FCUB 5IVNA 1MWAL 4LMQE 4NUQA 2CKBH 3G6DH 1LE9A 1X3DA 4CU6A 5ICYB 5F44A 3TU6A 1PF3A 4WI0B 1S5HB 3TN0B 1GYWA 2E9GA 1M3JA 5BUPA 1ZCRA 1AQDA 2XZAL 1GHFL 5KANG 1QHPA 3GZPA 2XA8L 4L2YA 4HUVB 3MJ9L 4LK4A 4UOW1 3ZZLA 1A6WL 5C86A 2F0CA 2XN9A 4YHLL 5SV3A 1VEPA 4FFYL 4ZZKA 1FFTB 4JMNA 3EH4B 4JO3H 4RZCB 5ACZA 1JTOA 5JHMA 1M2OA 2V2XB 4P49A 3FOLB 4NZDA 4M03A 1MFEL 3FFDB 4WW1B 5TPWH 1GYUA 3MR9A 2NT1A 1CK0H 2EILB 4MHHG 4WCYL 4GINA 5EOQH 1CFVH 1LEGA 4HWNA 4QRPE 4M6AA 3ZL4L 3VXRE 5IJVA 4FFZL 1HU8A 3F7KA 1JGUL 3GT6A 3M8OH 4LLDA 5D6DC 4QIRA 5ACMA 3STLA 3IMBA 3FYIB 3ILEA 5FO7A 1NGYB 1A7BA 2VDNB 4IRSB 3QR1A 5CEZD 3HFML 1ZHNB 5HPOA 4WKZA 3TBWA 1SOXA 4N8VB 3FO2A 2CAKA 3CFDA 3QUKB 4FHJA 4U49A 5GGVY 4PJ9A 4F58L 4X98B 2ZWKA 3BT2H 4MLSA 2FB4H 2H4EA 2OR9H 1RFDL 2XYCA 1MIEH 4OLWL 5D1XC 4PV9B 5AZEH 4RMWA 4J23A 5ANME 1DANU 5AW8B 5TQ2L 5KJ4A 3NEEA 4XC1L 4XHJC 3AS3A 3C6LC 1COBA 2GUYA 4ANUA 5D70L 1JF6A 4GAGH 1WBYA 3DETC 4YS4A 2XRAH 5F7FA 1NBQA 3PWVA 1NOLA 1H8LA 2DQHH 2ZUVA 4LCCA 4QTIH 1NDTA 3MLSL 1EEYB 4ZO7A 1H3WM 5FM5O 1GY1A 1SLVA 1RPUA 3WUWB 5LBVA 4P3DB 3GSOB 3TFKD 2G9HA 2HG0A 2HG5B 1CXKA 1Z0NA 2DIAA 4OCYH 4OZHA 5IVXA 4WZ9A 2ATAA 2VLJA 3K0YA 1MJ7H 5IOPA 4G8GA 4YAQB 2FO4A 3CHXA 2JK5A 1KJMB 1ZVYA 4MXWL 1NBYA 2WYTA 3FT3A 3S5LA 3BZ4B 2Y4SA 4GB9A 2W95A 3KPPA 4GT7A 4GW1B 1NIFA 3AACA 4Y1AA 4DSYA 1VFBB 3H2PA 4HCGA 5IVOA 3BGMA 1HEHC 2FYVA 5BV7H 4N5EC 2VGLM 4JDTL 2Z8WC 3P11H 4AM0B 4KHXH 4YQXL 4OCWH 2B5IC 3PQYE 1SHMA 1YC8A 3C9NA 4LIQL 2IDFA 2UVEA 1S78C 3CD4A 3PHOB 2R8SL 3FCTA 4EQ2A 1G1YA 4OF5A 2FX8L 3RP1A 2YKKA 4FQHA 4NNYB 2X70B 2VDPB 1E4KC 1XGTA 5I18L 3UZQA 3T2QA 2XPZA 4HIEA 2ZUYA 3ARBA 3BAEH 4FNSA 4IOSD 4PPTA 3RI5K 4A2LA 1F4XH 1HEZB 1PQZA 3L4XA 1T4KB 4FZEL 1TJHL 4XMLH 2DJUA 4BUQA 1GGIL 1DN0B 1M2VB 4K2UH 3PGCB 4OFYD 4QR7A 4TUOB 2AJVL 3VQLA 5FW6A 2WO2B 3PIQA 2ZXAA 4M6NL 5CIPA 5A6LA 3SDDB 5AAPA 1SJVA 3QHZL 3MJ8A 1DBKH 4M8RA 4QRRE 2W91A 3Q6FB 4WI8A 2GTWA 2OMUB 3FU7A 3FXIC 2E9IA 2APFA 2JIXB 4IGBD 4AMXA 1CJYA 4OZIA 1KSRA 3DUUB 2EXSA 3VYOA 2P80D 2L0DA 4MA3B 3V4VH 1TU2B 5BS0D 1FLRL 1U8KB 5I1HH 3ULVH 5AOKA 1I1CA 3BWAA 5DJXA 4XX1E 1M9WA 2PPDA 2Z8SA 3MODH 1MREH 2HFEA 2O6EA 5IROA 3MPCA 3UTSB 1KJ3L 2HFFB 1Q9LB 4HG4K 1T03H 4AQ1C 1SOKA 2XWJA 4KVNH 3SE6A 4YFLF 1OALA 5FDYA 1UZGA 3V5KB 1BECA 1JVOA 4MNHB 1U8LB 1U6AH 4G8FA 3MCG1 5EO1A 1B3IA 2JI1A 1ADQH 4W9HC 4F2ME 3BQUC 3VXUD 1IM3A 5GZNA 1AZNA 3CDYA 2WTPA 3VMPA 4XNZB 1AFVL 3S48A 2FVNA 4G5AA 3TC9A 1CU4H 3AREC 4I4WA 4JO8A 1AANA 1GOFA 3FBKA 3DTXB 3OB0H 6TAAA 3SOBL 3LNEA 4IQHA 5HDQL 3VFOA 1QRND 3MV9E 4N8CH 2B4CC 2CNZA 1S7SB 3V79C 2WXQA 3MYZA 3VD5A 1LYQA 2FJGB 3IDYB 4OIIH 5EA0H 2OZ4H 3FBQA 5TF1H 2EDBA 3H3KA 4LP8A 5SWZB 1P7QA 2IQAB 5HY9A 3T4YB 1OTTC 3BPOB 1RZIB 5LNDA 4F92B 4WI5A 4OFYA 4YDKH 3MXWL 4G6FB 4K5NA 5CJ8A 5CJXA 1PY9A 1PGRB 2K8QA 3GMLA 4GRLA 2C3WA 5HVGB 4AK1A 5A3IC 5IREA 1O6SA 5ID1A 4KV5F 3AZUA 3QQ9C 1ZTXE 3CZUB 2VT0A 4YHMH 3L5WB 5EZJA 4RAUB 5IKCB 5JOPD 1RUKL 2BHFA 3P0VL 5C0EA 4KK9C 4MNQA 3OVUB 4AENB 1WUNT 3ETBF 1KT2A 3C09B 3IDIB 3NH7L 3DSFL 5EIIG 4M7ZB 4JVPA 4IBLT 3W39A 1KJ2L 1KTLA 2GC7C 1SXBA 2AJZA 1FZOB 1QHQA 1XMWA 1PEWA 4PJHA 5K9KB 3D69A 2NXYC 2YPKB 3EGXB 3RNQB 3ZMRA 5E08H 1E43A 5AW2B 2WSPA 5JZ7C 5AOIA 1HIMH 2BM3A 1ZA6A 2E5EA 3OWEA 5KVFE 4B53A 2EUXA 4OJDH 3RZCB 2ICCA 2VLRA 2ZICA 4TQPA 3QQ4A 3T2NH 4XO3A 3GSXB 3PL6B 3VXUA 3EJTA 3EIFA 1URLA 2UZYA 1MFCH 5E2TL 4F7TB 4EAEA 2WWNA 2XKSA 5H2BA 1CFNB 4UDTA 2AQRA 2R27A 1DEEA 5I1JH 3GJEA 4TTDD 3OGCB 3V0WH 1TZIA 2VQ1A 2YUVA 3ZGHA 1ZLUH 1QRNA 5EOCJ 4WDIA 2D0FA 4F57L 5JQHC 3O45B 4TSBL 3BYTA 1JP5A 4UZSA 2Q7NA 4ODBD 1OGTA 3NACH 1XCTA 5DUBB 2P47B 4OCRL 2NNAA 1XR9B 4HYTB 3SYAA 2FEEL 5D71L 4RWYH 3VDCA 1D9KB 2X12A 1CGUA 5D7JB 1G6RH 3PXLA 4Y8AA 2R69H 2O6CA 1LVEA 2MQ3A 4QOKB 2VAAA 2YN5A 3MV8D 1CGSH 2DLIA 4KZCA 3VD4A 3AXHA 1TTAA 2NDGA 2JKWA 3L1EA 4MAYB 4JE4B 12E8L 3IKKA 4NQSA 3P1VA 1OZUA 4AITA 3CTTA 3WE1A 3HPLB 1YMHB 5TDPB 2H6OA 1J0ZA 4JO5A 3RVWC 3CHOA 1KXHA 1HXKA 1ZWIB 1GCYA 2C9AA 2CBMA 3F84A 4KHTH 4AYMC 1FJ1B 2WXPA 1JPTH 5KSBA 2D3NA 5IJKA 4ADGA 4F2EA 1TSHA 4KKAC 1C5CH 1UJ3B 4AQEA 3QP3A 1KEMH 1U8NA 5H4ZA 3NZ8A 1EVTC 3AQYA 2DDQH 5LXGL 3DMMD 4IKKA 5E9NA 5HGDA 5HHOB 1PYWB 4G6KH 1HKLH 3KBEA 4AGMA 4QTFA 3U36B 3FRPB 2H3XC 3I3DA 1Z5LA 4IU2A 1GW0A 3D9AL 3ZQXA 4E41A 3N3EA 1YPZA 4QT5A 3DXAA 2DLGA 3BSHA 5B8CC 3N9GH 4MQXD 1BLIA 3IN0A 1SXSA 4JPIB 1ORQB 4HWEL 5C0AB 1RVFL 3IJSA 4R96B 4Z95H 4DZBA 5LXVA 4PJ7B 1CGWA 2CJUH 4PCKA 1AY1H 3QT2A 4YJZL 2I07A 6PCYA 3UYPA 3OKDB 2EDQA 2H32A 3CFJA 3NJJA 1CLOL 4HF5H 1OTUC 3ARZA 5C07D 3IDNA 5J89A 4PREB 4CADA 2G2RB 4Z0XB 3Q05A 2DMBA 3EBAA 4L1DA 3ARPA 1MOEA 4K5OA 4POZD 4UDUB 4TQEL 1Z9LA 4XI5D 4UT9A 1V10A 3CN2A 5LN4A 1FBIL 4HV8B 3WS6C 1J1PH 2BJMH 4UB0L 2UXVA 2Y6SD 4JG1L 4XP6L 3DURA 1J8HA 2IDTA 1HNGA 2Z31D 2VR6A 2EVJA 4OT1L 4NENA 4KXZI 2VDML 4L3EB 4JN1H 5DMIL 5KVEH 1KBVA 4XPFH 4Z1PA 3Q43A 3SE3A 4HMEA 4B0MM 3FW6A 4IS6A 4I9WE 1Q9WA 4JZOB 1GYAA 3G6JA 3I02A 4W9FC 3PNRB 3UPRB 1ASPA 3KLHD 5EUOA 2WSDA 3QS3A 5HYJB 4FQXA 4H20L 4WWKB 5TDNA 2V37A 4G3YL 2E8ZA 5F0LB 1V3LA 4WK2B 1KN2L 3IE4A 1NFAA 3I3EA 1QSEB 5EU3A 5M94B 4RDBA 1U93B 4CVXB 1WRFA 2VDNH 3UJJL 3JBG7 1AR1C 2B39A 4J1UA 4OVVA 4KROC 2YEZB 3GI8L 1U30A 4LSRH 4DJMA 5KYXA 1T5WA 4XP4L 2IGFH 4RMTA 3TBYB 2NY1B 1U0QA 3MOBL 4L9LA 5IGXH 2E7HA 3BDYH 2B1HL 2O1AA 1BM7A 3BH9B 4O2CA 3SPVA 1X5IA 1ECZA 1EXHA 2IANB 4MAUH 2JH2A 4PEEA 4XB7A 2QVTA 1E50A 5C9JB 3PS6A 4HIJB 4HDIA 4YX2L 1VPOL 3MRJA 1LE5A 4U3HA 1XZ0B 2BC4B 2CBPA 3B7SA 2JTYA 4NSKA 5GSRB 4J3UA 4A6YL 1U3NA 4QGYA 3L48A 1KIQA 2XTJC 4EE2A 3GNMH 5K9QG 1G7HA 4HBCH 3OAYK 3NZSA 2YARA 2YSSB 5J6HA 5LAXB 1X9QA 4V33A 5I30H 1B4RA 3X14B 1FO0A 2V7HA 2VO5A 4R0LB 3LHAA 5JW5B 1PJWA 2GUOA 4P2RE 1CUOA 2ZUXA 3QUZB 1DQTA 3C60D 5MENB 4HUUB 4MD0B 1N59B 5F9AC 3QEGH 2UY7B 4UQ3B 3KS0H 2XV6B 4NQEE 5C0CE 3QO0B 4LSVL 5I1CL 3JTTB 4PGDB 4NN6C 2WQXA 3CSYB 3GEWB 3BZFA 2HN7A 3FT4B 3MNWA 1QFWM 1IGCL 3BKCL 3KL3A 4S2SB 1VZGA 1NGPL 2DQJH 2I32A 3ARBC 4BIKA 3NCYS 4KX7A 1KTDA 3LQZA 1YEGL 3FO9A 2YMTA 4XCFL 1XAUA 4ZFGL 2SEBA 3P9WB 3FF8A 3V0EA 5JLZA 4OD3H 4S1RH 3E6HA 3P3SA 2VDPH 3WE6A 1JMXA 4B9CA 1YSOA 4FFVD 4IOFD 1P9MC 1IQWL 4WW2B 1QSFD 2KZKA 3G04A 3QDJE 2W81C 1Z9PA 5FCSH 3FTYA 2X3CA 4X7SH 3MOAH 1Q38A 1MWAA 4HEMA 4TUJB 5I74C 2EDYA 2GSIA 3EYVB 3ZDXE 5DI8A 5JXEC 3QUYC 3RFZA 5C3LD 4U6HB 4IIQB 3NJGA 4X6CA 4GG6B 4EIZC 5JHDA 4NRXB 4ODWB 3NZHH 1ZSDB 1TVHB 1NUDA 3QUXA 1INEH 2BZCA 3O2WL 4W93A 3HB3B 1PZUB 2F54A 1CR9L 1B0RA 1TEYA 2BMKA 4MA8L 1G7LB 3J27A 4FQIH 4YPGB 4MKTA 1XSOA 5C0DA 4HT1H 2ENYA 3UCQA 2VR4A 1MCDA 3P0GB 2QPEB 2ZXEB 3O81A 1GTNA 3WJJA 2FX7H 1NMBL 1WFUA 3T0EB 2YOAA 3NJNA 4QHMB 1DVFA 2A99A 4WFGD 4N28A 1A0QL 2VR9A 1TQCC 2ISDA 4U2YA 4LLYB 1YVLA 3RGVD 1JPSL 2F5BH 1ESOA 2B0SH 5B3NA 5E2VH 2J21A 4ZAKC 4UANA 4B9KC 3MJGX 3EYOB 5IB1B 4FXKB 4N2NA 4XWGH 4DFIA 3EJSA 1A3LH 2B4CL 2IGLA 4HETA 5F21B 4OZFG 1MHPL 4K07A 3LIUA 1GS6X 1OAJA 1YNTB 5E2UL 5CZVL 4DO6A 5I0VA 5J5EA 4TPRH 3TBSB 5C3IA 1VERA 4KK6D 1XGPB 3MBED 4LSUH 2VERN 3FZUD 4IKIA 4RMBA 1QBLL 4Y4KC 2W80C 1R3LA 4Y19A 3FQRB 3OHXC 2CHWA 2IV8A 4K73A 5F89B 5KVGE 5BQ7B 3U79A 4AX3A 3IWVA 5D5MB 3MUUA 3JQOB 2KI6A 4G6ML 3D09A 3VTAA 2IH8A 4ZFFA 5HDLA 5DLLA 1O0VA 3S34L 3T2OA 1WTLA 1TQVA 4CKQA 5HVHB 3BP7B 2J1YA 3VXSE 1IIKA 3SGJC 4Q6IC 3PUUA 4LF3A 2ZPKL 4GIAA 2Y1VA 4HHAA 1SHSA 5CBAA 3S3SA 3MKGA 4KXCA 2O72A 4DKAA 1N0XL 2Y23A 3D06A 4H1LA 2CMRL 2P8LB 3B34A 3DX2A 3PPSA 3JV6A 1XR8A 3PNWB 1U8OB 4R2GC 1GAFH 4BE5A 2WXGA 4P46D 5F7BA 3CJJA 4X6DE 2Q86B 3IDGB 1KUMA 4HQQL 5I8CB 1V5JA 2V5TA 3PCYA 3F3HA 3WIIH 2RD0A 3MXVH 3NIGB 4M61B 2A4EA 3C5SB 1B6UA 4OH2A 4Z7QB 1GOGA 4NKMA 1TYEB 4P07A 3EJYC 2Q76A 4ORGA 3R1GL 3FQTB 3IT8D 15C8H 1JFQH 5KBDA 1C1EH 4C47A 1S7XB 2BNQB 3VACA 4DZ8B 2JLLA 1AQKL 3P0YH 4JPVL 4KC3B 4Z7WA 4GG6F 1CLZH 2G3NA 4ONFH 2PMZA 1FFOB 2XT1B 1HQ4B 4PLKC 4HZ1A 3MJ6A 1N7MH 3ARVA 4XOCA 4DOHB 4AXWA 3OPZL 4G9FD 5KSVB 1YC7A 1ACYH 2NUTB 4LNVA 4OGYH 5H35B 4LARH 1PU0A 5LGKA 4LHJB 2J6EH 1R46A 4XP9L 3WS3A 3LZFL 4PJFA 4DQOH 3QNXA 4UINH 3Q06A 3MRGB 1BZQK 4GSXA 2FO8A 1CBJA 4GRMA 4D0BA 3H42H 4AEIH 4I5BB 3AG3B 3F7PC 4Z3JA 2Z35B 1R3HB 2WUCL 4M6ML 4RMUA 1KXQA 1OANA 3MKKA 2BDNH 5E8EB 4OGZA 1WGOA 5KYUB 4G6AD 5F71A 1K5NA 3DX0A 1NC4A 1G9NH 3FU0A 1U8CB 2F9BT 3SGKA 3VRJB 1R33A 3HRPA 1N5YH 3O11A 5DO2D 3WN5A 3MNMA 4IJ3B 2Y07L 1MFNA 3HRZC 3HR5A 3NAAH 1WBXB 5EO0B 4GAAA 3MNDA 4L8SA 3V6FB 4RGMB 4TL4A 4U1JB 4A2HA 4G2AA 1AIFA 2NY6C 3IU4H 2WKOA 2YPVL 3FB6A 1SY6A 3BO8A 2A6KB 3NK4A 4P2AA 5E1GA 1FH5L 1E7VA 2K4WA 3TNNA 1ZHKA 5DZ9A 5IESH 5L2JB 3GRWH 4FLSA 1AGCA 3M88A 1BVKB 2NNRA 4P5MB 3U48A 1QKZH 2NT0A 4JM2C 2JCCA 4WU5A 1OM9A 3HUJA 1OAXH 4RMRA 5D1ZC 5E8PB 4TNEA 2NSQA 2HUEA 4UT7H 5GGSA 3RGHA 1KXVA 1WWAX 2X89D 1V54B 4KUZL 5C09A 4E9WA 2MCG1 3BGFB 4XN2A 3UAFA 3KLAB 4HW6A 4HJ1A 4NKDA 2FJUB 5BCAA 1R0AL 4LESA 4ZMTA 1ND0B 3AWEA 5E7FA 1JYVA 1TVBA 3L3GB 1T6WA 3HG2A 4PJEA 4G7VL 2XKNB 4DUVA 2OXGB 3GXMA 2GJRA 3I6LD 3HHSA 1BV8A 4E41B 5EIVA 1GZQB 3ZZQA 2ADGB 5CEXA 1QR1A 3SBWA 3OXRA 1G7QA 3ESUF 4X9BA 3TXAA 4LGSB 3VFPA 2XIDA 5KG9B 4PJCB 3F8UB 3WN6A 2OW7A 4N9GB 2NX5A 3MFGB 1AZUA 5I1IH 1G7PA 1M6OA 5GJSH 4OZHE 3AGWA 5GXBB 1A3RH 1CD9B 3HZKA 1ZV9A 3HOGA 1K2DB 3K72B 4N0UA 2X9ZA 4R7LA 4JPWL 3CLFH 3FH5A 2E7CA 4OZGA 1DR9A 2F7IA 4FG0A 1X4XA 4JZJA 3QIWA 4A7QA 2GY7B 4F3FB 4FJ6A 3QFJD 5AW9B 3B7TA 4QXUH 1ID5I 2A6JB 3DX6A 4HJEA 5C8JB 3CSBA 4LHUB 5KN5A 3JWNE 2K6YA 3UGUA 2WNGA 4M8VA 7PCYA 5GZOD 3FU8A 5J3HD 1I7ZB 4OLUH 3MLRH 4YK4C 4L37B 2W92A 2QSVA 4LKXB 1C9SA 1KULA 1U2CA 1K72A 2NQDA 1CI3M 4TULH 1TQBC 1TTFA 3RB5A 2Y1ZA 5CEZE 3UTPD 3KPLB 3IETA 3IPEA 5F7WC 4NKIL 2ZUTA 1CBVL 5GRWA 4BH7B 4LASH 5T3ZH 4AY0A 5HGAB 5E03A 2DIBA 1RIHL 3MO1B 5IVZB 1H3GA 2K6WA 1AHWC 2PO6B 5KBNC 2NY2C 2IWKA 4GAJL 3U4EA 2DMCA 3UTQA 2OI9B 1W2KT 3VI4E 1GIGL 4LDLB 1X5MA 3FSAA 2WBJB 5FEBA 3G5WA 5D93B 4WHYG 2CKNA 1BFTA 4Y4HA 5JDSB 4YSPA 1OSYA 4LLAA 4W6WB 3MRQA 3SJVB 2DQMA 2EVIA 3KYMA 5LG1A 4Q0XL 5TE6L 3QPXH 3FQNB 2E76C 4OZIE 1UH4A 3UGEA 5B38A 1KGWA 1EJ6A 3V0VB 1KB5B 1S7WA 3LRMA 5SX5K 3ZTJH 1L4IA 3HS0C 3RWEA 3GDBA 1O9VA 1J05B 5BOPA 3AU1B 2HJLB 4MYWB 2J25A 5F1IB 4NZTL 3TX4A 1XIWB 5ESAA 4OCLC 5HI3C 5FPIA 4FMVA 5KAQG 1IBZA 4G6JL 1GA2A 5CD5D 4KO5A 2CR3A 2FE0A 5BMFL 3V8CA 3HG1B 4WU7B 4XOEA 4ZUVB 2ZAIA 5D1XD 4Q14A 1XD1A 4ZO8A 4XNUL 3NFSL 4JHWH 2Y2WA 4NQCB 1VCAA 4U1IA 4XHJD 3FNKA 3C6LD 4KZEL 2J56A 3DETD 2AV7B 3LKRB 1QLRB 3OAZH 3SE4C 4DKFL 4C83B 3ELQA 5FO9A 2AFNA 2BOLA 2PTTA 4F7EB 3CUPA 3L3HA 1CZ8H 1M53A 2QLVB 1U21A 2Y2TA 5D7SH 1DJSA 2VLKD 2DYPD 4MFHA 4AQ8A 2CIKB 2QV2A 5DUPH 5T1LB 1XH1A 3O6FB 4IK7A 5J1AA 3V0AC 4J4PA 4ZDHB 3UBFA 1T21B 2X6MA 4GO9A 3RPKA 1CFSA 3D2UD 4NGHH 1MCRA 5EO9A 3U0PA 3FFCD 2IBGA 2EYRA 1SGKA 3P54A 1FC1A 1KV7A 4O4YL 4V2BA 1NGXB 4XN9A 5EWIH 1JNJA 4WNQA 1MCPH 3IFNL 2CLVB 4PRHB 1CF8L 4GJTB 3IGUA 3TBCA 4U0RC 4HLZG 1TJIH 3KVPA 3L9BA 1L3WA 1EJFA 5IB3B 5EF2A 4N5ED 3LEYL 5C08A 5KW9L 1SMAA 2IC2A 3BHBA 1GPOH 2R1YA 3FU6A 4UTAL 3GBMH 3KW7A 5BO1H 1S78D 1ZIAA 4LXFA 5E1QA 1SHXA 5SV4A 1FVDB 4MCMA 2FD6L 3HPJA 2B3IA 2VXQL 4HAKA 1AXTL 1UVQA 2E27H 5BS0E 4J39A 5SWSB 4D8OA 5FK9A 5DMGC 4AV5A 3QSKB 1ZA3B 4NO2B 5K9OA 3VFWA 3PWJB 3UP1A 2Q3AA 1QLFA 2IBZX 3FRUA 3QFGA 4WFED 5ALCH 5EZIL 5ITFB 2GSGB 4UUJA 4CGTA 3F6JA 4QY8B 3NABH 1CDIA 2X7LA 3WFCL 3PREA 1F6LL 1XFPA 2VN3A 1R5WA 3BPNC 1LQSR 1UD5A 2BSCA 5DJ6A 5DVPA 1N9PA 2BW5A 3D34A 3JTSA 1AYOA 1LP9E 2NW2A 3AY2A 1OZTG 3ZHFA 2W9EL 2FBJH 2BSDA 3N44F 4D0DA 3FPXA 3DV4A 2RCSL 3ARRA 1NM4A 3LIZH 4U1KB 4EBQL 1IIIA 5SX4H 4NRYA 1G7IA 5FF6B 3QORA 4Y4HC 3VI4F 2WINA 1G1CA 1UXSA 1DSFL 4HOXA 1QRNE 5CILL 4DW2H 4G59C 3VTTA 3RZWA 1FNFA 3BKYL 1A1OA 4CDGC 2HT2C 1JF1B 1AACA 1XGQB 4XCEA 2Q7YB 3U0TA 5IIEA 5ABAA 5H37A 3FK3A 4P4KC 1MF2H 2YD1A 5DK3A 4KJWC 2UZXA 2W07A 1AGDA 2LGNA 3GSWB 5E6IC 3IJEB 4FQCL 3ILDA 5CP3A 2DKUA 1BD2D 3KPSB 2H2SC 4LCUA 3DX9B 1BOGB 3L3IB 5CJBA 4ZMLA 3ULSB 3GBNH 5HBBA 2V3EA 5JMOC 3GI9L 3BQUD 2EUZA 4DH2A 2XQBH 4X6EA 4YHIA 1MW2A 3UGXA 3PYCA 5HHMD 2IPKA 4GI9A 4N0CC 1DQLL 1GZHA 4MMXA 5JOPE 1HHKB 3D0VA 4N5UA 3W3BA 4QRUA 3UEZA 3ARED 2JJTA 3N40P 4JFZH 4LEOA 3UBHA 3WKPA 3OR7B 3LOWA 2HLEB 2BVQA 4U7MA 1OIOA 1I7TB 1OHQA 3NIFE 3UAJC 3PABB 4XVTL 4LVOB 1A4KA 3U6XS 5CLYA 3FT9A 4JDVA 4S1DC 1DQVA 3DPDA 3H54A 3SYOA 3EO1B 2E0PA 3L4UA 4R7NA 2F58H 3QO1A 4X7CC 3PHAA 5A2BA 1EERB 4A7GF 3QIUC 5I6XC 5GRUH 5MP6L 1HQRA 4L0PB 4IMLA 1OTTD 4KKZA 4KMTL 2WTOA 3HC0A 3KBHE 4F8QA 4LKCB 3ULUC 3T65A 4YL4A 1NPJA 2BHYA 4PJBE 1Z3GH 2APVA 5A3ID 2YBRA 4F7MA 2J43A 2K8MA 1EDYA 1T66C 3D5OF 5DLMH 3WKYA 4AGLA 4ELDA 5A7BA 3HG3A 4OF0A 3IDXH 4YBLB 4KK9D 4NDMA 5HHNA 3C2AL 5EBLA 1FI8C 4UQEA 3VFNB 4W81A 3NP3A 5J56B 1JD9A 4OY9A 4XNYH 2A4ZA 2V8LA 4PRDB 4DGYL 1B4JH 4OJCA 3QDHA 2GKIA 1UOWA 2FYYB 4EOWH 1IAIM 1NQBA 2D7PA 3U9UB 5FW8A 2ARWA 3Q2NA 5F96L 4QO1B 2GPZA 2NXYD 5AB1A 1ACXA 5I71B 1NAML 1TZGH 1W9XA 5JZ7D 4JFVA 1LO4H 1OW0A 4WUUA 4YUEL 3CDZA 3MV8E 4PWKA 1PNCA 5D1QD 4L0YA 4U6VL 4HUWB 1NMAH 4F1SA 4QKTA 3MRPB 4JO4H 4O00A 2BVTA 4PLNC 4IRZA 4I3SL 3GKWL 1EZVY 4PD4K 4FZ8H 3QR0A 3O0RL 3T77A 1B88A 2CCWA 3WIHL 3N50A 4N68A 3ZE1E 4K23L 1LP9F 4Y5YA 1I3VA 3LX9A 1E5BA 3US1A 4NPKA 1FSKC 2JJSA 2X87A 2K9FB 2HVBA 3BWSA 3GSUB 5EORL 3GSVB 1A6TA 4X6FA 4DEPC 2AABL 3S37X 4YO0B 3OQRA 5TJWK 4M9OA 5A1AA 1TIUA 3GSNA 3VFUA 2KQNA 1BBJB 4M48H 2DBLH 2NNCA 1IJNA 3FO1A 4M1CC 4XO4A 1ITBB 1W72A 2MSPA 2MPAL 3ET9F 1A7OH 4RIRA 3TWCL 4L1SA 1T5XB 2OR7A 1XGZA 3GHPA 1XXFC 4HCRH 4M9PA 1F8TL 4QAWA 4U1NB 2Q1EA 3NFPB 3QRBA 3V55A 3TO2B 5EF0A 1MRFL 1P7KA 1DBBL 3BSZL 1PSKH 4YHKL 3ROOB 3UZEC 4TVPL 4ETQA 5C07E 3RVWD 3HI1A 4Z7UA 2M26A 2H9GB 4KXAA 4HEPA 1KYFA 1QVOA 4KKAD 5ISZB 1I8LC 1TOXA 3V7AE 5IW6A 1MFUA 3TNMA 4FJZA 3MRDA 1E2WA 3ARDC 1QYGH 1MHHB 3HJEA 5L88H 1A6VL 1T89A 2I7SA 3L17A 4B96A 3BZEA 5IBUG 4ODSL 3MLXL 4ZFOL 4OLZH 4FEMA 1BM3H 3PPEA 2FT6A 2AMGA 3C5XA 4CC0A 4ZQTA 3L2MA 3U7YL 2UX6A 5D1QA 2WCSA 1KNOA 1A9BB 1FQ9C 3WNNA 4MBOA 3VD1A 1HXYB 2EVHA 4Y0GA 5EU6B 1J9RA 2WZAA 2X6AA 2YA2A 3R0MA 1J1OH 4JO2L 5CU9A 4L8CA 1UZ6E 4LDCA 1YEIH 3LKSA 4HU2A 4CUCA 4HJ0D 3SDCB 3ZTNL 2ZD0A 4QXTA 2R0KH 1NPUA 1OTUD 3H0TA 3NUKA 4PCYA 4PGCA 3CMOL 2AF2A 2VN5A 1W0WA 2RGSA 3EDDA 4BSJA 2GBVA 1FZJB 3A67H 5EU5B 5F7YC 4HKJB 1UZ8B 3AAZB 3IFPB 4RRPA 1KBBA 4GUPA 2OMBA 5J12B 1X4YA 5ICZB 2HPTA 3WJLC 5F7MC 4HUXB 1VGEL 5HI5C 2DQCH 4ADIA 1KEGH 1RKRA 1U58B 5AB9A 3JUYA 3D3VB 4X5RA 4B41A 1W0VA 1PEZA 2KL6A 3L13A 5DDHB 5EULV 2RA1A 1KGXA 3CFEB 2C9UA 4JKKA 4R3SA 1RAMA 4JFOB 1T7WA 5EIQA 4XPHH 1BBDL 5GISH 4PH8A 5GHWH 4QHUB 5J06A 4L4VD 3T8XA 3P4OB 4NQXA 2GABA 2Z7WA 2PTVA 4JRYB 2F19L 2EQDA 4H88L 2B9AA 2XXMB 3ZE1F 1BG1A 1KB5H 4P5KA 4YVUA 4F9LC 3O41A 2V0AA 3TZVA 2WLNA 4PGEA 3HE6D 4NQDD 2J72A 3QDGA 2YPVA 5I2IB 5MEPA 4HIXH 5DD0L 3SKJL 4MJ2A 4F8OA 3L4WA 4XXDB 2DQDH 1SQ2N 1UM5L 3RJDA 1A7PL 4JPKH 5GRYA 3ZJAA 5MHSD 2YUZA 1AR1D 5B7MA 1G5GA 1SPDA 4MRCA 4FFTA 3DYMA 4KROD 2ZJSL 1R3JB 4J3VA 4KK5C 3KYKH 3PXHA 1JUFA 2FLMA 2DOCA 2PWGA 4PTUB 4X99A 3BXNA 2AQ1A 4JFXB 3VRIA 4WTZA 3SSGA 3L3JB 5F7NC 1ETZA 4H0GA 2IDSA 2H3NA 2B1AL 2A0LC 1SXCA 1CDGA 4FP8L 2F15A 2VL4A 4U05A 2WK2A 2XWXA 3FFDA 2F7PA 1YN7B 2XQ0A 3HG5A 4MMZB 1KPUA 5CSZB 3FT2B 1YUHA 1HH9A 2XTJD 4G9DA 3FH7A 3X17A 4GSUA 5LCVH 4DGIH 5AVVB 4ENEC 5AW1B 3OKNA 1QSFE 3FT0A 5EIIA 5FOJA 3CHRA 3UC0L 2CLZB 4GBXB 1IGIL 4HGMA 1J9TA 3PP4L 3HW7A 1GVIA 2WZ0A 3ARGA 3E6FB 4Y88A 5BZZA 2NYZA 5LKNA 3D39A 1EH9A 3KEHA 1KN4H 3Q44A 2IWGA 1RIVL 2AK4D 2IMNA 3K80A 2OMTA 2GAZA 1V7NL 3T04D 3MLVL 4R4BA 4ZS7H 3OR6B 2ZAHA 2XOTA 1KDJA 3HHMA 3U1SL 4AMKL 3EZJB 2VWEC 1CE1L 2CDFA 1ORSB 4DVBB 1SLXA 2IPTL 3VCLA 5BW7A 1DTUA 5D7HA 1R17A 1WD8A 2EEAA 2W0LA 2G75B 3RURA 1BDYA 3T9WA 3QJOA 1KCRL 1SBSH 3CE1A 4IDJL 4S0HA 5FB8A 1DL7L 1JPGA 2R39A 2Y7OA 4LIQE 3PAVA 5JIHA 3HE6A 3IB4A 4ONGH 2H0JA 2P7TA 4V1DB 3HR6A 2V2WB 4N2OA 4Y2DC 4MA7H 4WFGE 4E9RA 4DFHA 5BV7C 3KPRD 2XVBA 4FTVD 4L05A 5DD3H 4F8NA 5A43C 4HFWA 2MCPH 1JYWA 3TJHD 4U7SA 4TNVK 4DEUA 2XYBA 1HYRC 3NJKA 2Y1YA 2DQGL 1ZV5A 5LN8A 5EOTA 1TLKA 4RX4D 5JXED 2BP0B 4NFCA 3TYGL 4FXGA 3QUYD 4ZMYA 1XD0A 5FFGA 3V5DB 3WLBA 3RKDC 1NLBH 5ANMB 2OP4H 3MROB 1TZHB 2IH3B 4L2LA 1RK1A 2QVMA 1KGJA 5E00A 2PWEA 1I3RA 3M6DA 5DK0A 4K3DH 3UBXB 5F0JB 3BUYB 3MMEA 4LQFL 5KUKA 1NBZA 1C08B 1WV7T 2G2NA 4HC1H 2XXFA 3SZ6A 2AEPL 3S37H 3BWZA 3O3EA 3FTSA 4W4NA 1IGFL 2NQ3A 3U2JA 2J6WA 1F18A 5ICXA 3RJQB 4U3SB 5K1NA 4EKJA 4K3JL 1FVEB 3U4AA 2X4NA 5CR8A 3STZA 1SYVA 4K7PY 4LEXH 1SBBA 4RGNB 4ZAKD 3NCEB 5I8OH 4XMPL 5DHYA 1E4WL 4PRID 3POCA 2DJ4A 1DLFH 3QK0A 5D4QA 5EEYA 4XGZB 1A6ZA 4PR5A 5T5NF 3AQDA 1ZVHA 3ULVC 3AT0A 3IJ9A 3W57A 4F37K 4A2MA 1AD9A 2NUPB 3IS0X 4XAWH 1MCCA 1FORH 1HN1A 1MDAA 5FHAL 1HHHA 4PRNA 5L0QB 3P2BA 5E5RB 5DC4B 4YDIL 2K7QA 1A14L 4Y4KD 1QWNA 3ULUL 2BY2A 1U91B 3BVXA 3HNSH 3EO0B 3L5HA 3RIFK 5HHXL 3FAXA 1OEZW 2ESVA 1PW3A 4I1RA 2EEBA 4OLVL 4UT6L 1UJTA 3EJPA 3I74A 2ADFL 4P2QA 3VO0A 3L5XH 2QQKL 1Q72L 3ULAB 1ECYA 2CXKA 2EVGA 4W9KC 1U8IA 2DIEA 4U31A 3O6ML 3MUZ1 4G9FE 5EEZA 4GKSA 5F7AA 3NCBB 3R7RA 4MJ6B 1TEGA 4TUKL 5E9DD 3O3UN 2ED8A 4LMQI 4P9MH 1JNNL 5CXPA 1LEKB 3S4SB 4R2GD 1J5HA 4DGUA 4ELMA 3ME0B 4PIBA 4HUMB 3ISRA 4BRJA 4GKZB 1AZZC 4HKZB 2OSWA 4XOAA 5I0ZA 4CILA 4N0UE 1XHHA 1YECL 3EJYD 5D9SA 4JFED 2X4UB 3FQ4A 3QJHA 3GQFA 1JDDA 4PJAA 3AROA 4GY4A 3D05A 4MZRA 2B15A 5EPMB 3C5ZC 2AXFA 1CFTA 1M05B 2OULB 3W0WD 3B9KA 2IQ9L 4PLKD 4U2ZA 5I26A 3U9PH 3TCTA 3FMGH 2GJPA 3OF6D 1BYNA 3EDKA 2HSIA 1LMIA 1T22B 4HD5A 3B2DC 3MACH 2AKRB 2RMNA 4F2MB 5BJTA 5A2AA 4ATTA 4FA8A 3TT1H 4HXBH 5D7LB 4WTXA 4NQQA 5A16A 2IAMB 3RHWK 3UOAB 5EUKA 1JZ6A 2G0LA 3Q2VA 4Y5VA 5IQNA 3VG0L 5E4AA 2F2HA 4G71B 4NQUA 5JPMA 1QNIA 2ENPA 4OQ1A 4OM1H 4P59L 4ZD3L 3MRCB 1P5UC 4Y16A 5DHMC 3VXOA 1EZSA 3Q48A 4AUJA 5SWQA 1S46A 2LAAA 1I1FB 4HIPA 4XCNA 4W70A 3T4AA 1OF2B 1MI5B 1MFBL 3FH8A 2XG5B 4ATWA 2JB6B 4YE0A 2PYFB 4JUSA 3S3JA 5CCKL 4M00A 2Z92B 3I6LE 2IXQB 2JE8A 1Q9KB 1YO4A 4PS8A 3DVGB 1TTBA 3MNVA 3QI9C 2CCLA 1XXDC 1FYTB 2YGPA 3GO1L 4L8BB 2C1OA 5GPRA 3FN0L 1MLBA 1FL3B 4O2EA 5BZWB 5CD3B 3C8KB 1S9XB 1N5AB 2XNAB 4N8VG 1JYNA 3ISYA 3D4ZA 2WUBH 4JM2D 2ITFA 1T5KA 2FGWH 3CFMA 3B3IB 3FUNA 1FZMB 4M4RB 1V3MA 1RZ7L 2XXCB 4L3AA 1QFWI 3BP4B 5DJDA 1A6AA 2Y7QA 3BN9C 4H8QA 4WEBL 3OJ2C 4XNDA 4KKPA 2WQVA 3QFJE 3WDHA 4EO5A 5IFHL 1D9KA 4ZTPL 4XRCB 3QUML 4L23A 4ANKA 3GS4A 4XH2A 4JANA 4AIZA 3TPUB 4WNJA 3OF6A 5GGVH 4WI2A 3TYFB 1U3HC 1I7RB 3CC1A 5TDOA 2SODB 3WUWG 3ETSA 4Q2ZA 2OJZH 2F53D 2WC7A 5AVQB 4DK5A 2F7RA 5BO0D 1ZLWH 4F1ZA 1VKXB 5TDPA 2OBGA 4EZKA 1A9VA 4NUJA 4OQTH 1M7XA 3MFFB 3KLLA 4LE8A 2DI8A 1QEWA 1SDDB 5IY5B 2QZQA 3CPLB 1OAQL 2JJUA 4EZJA 3UTPE 3W5NA 2YRBA 4MSWA 4J3OH 4TVPD 3GZOA 4KRMB 4AH2B 2MNJB 1ML0A 5GGSY 2A74C 4ODUB 2ORBL 2GJZA 1Z1WA 2MFNA 2NW3B 3H7BB 1TJGH 3TJEL 4EN3C 4NT6B 4ZUUA 4PJ8B 1SF3A 1YEDB 3ZRFC 4NNPH 2AXGB 3EUDA 2R7EA 5F97E 1OB1A 2CKBL 2N1TE 3G6DL 1F42A 1TETH 4P2OC 4R4NC 3RNKA 1GGCH 1BGXH 5JNYB 1UUNA 1TCRB 3DBXA 3WMQA 4JKPH 2CK0H 1UG9A 4X6BB 2DYRB 5I1GH 1HFUA 4PJ7A 1HCZA 3REWB 1TXKA 2AP2A 3SKMA 1JPFA 4GT0A 4ZPTA 1AHKA 4P5TB 3W37A 4JO3L 2WMPB 3TIEA 3NEOA 4H25A 5I23A 1QBBA 3TN0C 5E5UB 5TPWL 2X9WA 5AB2A 5DRWA 1CK0L 5EOQL 4Z7NB 4PMFA 3N43B 1CFVL 4EDWH 5IB5A 3IYLW 5J7CC 4RDQF 4AEEA 2BRQA 1J18A 1A8ZA 5D1XE 3M8OL 2IF7A 4MA1B 2C4FU 2NY2D 2QHRH 4ABVA 4A1RA 2OTUA 2CPCA 5CFHA 1SJEB 2AEWA 1G7MB 4MTMA 1CTMA 3NCJH 2DQ6A 3BT2L 2FB4L 2OR9L 4N2LA 1MIEL 1ZPUA 5AZEL 3EJCA 4X4ZA 2AEQH 4HPYH 3HG0A 2E4TA 3F12B 3U2SB 2XA3A 2VLKE 2IH9A 4AKOA 1RLBA 2WAHA 4GAGL 2O61A 4WY7H 4M7JH 1D5IH 4IRSC 5MI0B 5I66A 4AKPA 2XRAL 1RJZB 2ITDA 2J5WA 1GZPB 2DQHL 3FFCE 4MXVE 4QTIL 5HI3D 3QG7H 4M7LH 5D72H 3I6KA 4PW4A 3E8UH 1IL1B 5IMMB 2AQTA 1F13A 2TRYA 4OCYL 4LBAA 1MJ7L 2JLPA 1Q94B 4DETA 1OT4A 1P5VA 2WY3B 1OD9A 4U1SB 2EUWA 5KSAB 1PNDA 1DQDH 2WANA 4B3VA 2VZUA 2EIEA 1LWJA 4HVBA 2IOOA 4GW5B 4LCWA 4EUPB 2EXTA 1SFDA 2VRKA 1EFXD 3RUGB 2DQFA 2P5WD 5BV7L 4X5XB 3ZKSD 1MW1A 3HZVB 4Y2LA 4A7SA 3P11L 2OTPA 3ALXA 4KHXL 4EJ1C 4Y9GA 4OCWL 1FHGA 2EC8A 4G7QB 2D4DA 1N8OE 4WFEE 3QJSB 5IMOB 1VJSA 4IMKA 4PRPD 2C8NA 4RISH 2ZSVA 3W1ZA 2CUHA 5AYUH 1S8DA 2J7LA 3SDYH 4K8RH 4JNXA 4WRLA 1BQRA 4I3RH 2V2TA 3BAEL 1HHGB 1JTTA 2PP9A 4A63A 4Z77B 1F4XL 2FJSA 2MOVA 3CC5A 2VMJA 1TF4A 4PJXF 3B7YA 3DI3B 2GJ6D 1DFBH 4K2UL 2XG4B 3CWGA 5E6UB 4R90H 1WS8A 1ZDSA 1HSBA 3N43F 2M2DA 3EJJX 3C08H 1Z3RA 2XU9A 3TO4A 5DMGD 3RL2B 4OLYH 1DFXA 2ENQA 1DBKL 3ZKXB 3RDJA 1ZVSB 1W80A 2HVKB 3GDCA 4AL8H 2HVJB 1D5XB 4H2AA 3UYOD 1EAPB 1YY8A 3ROLB 2VR5A 4NIKB 1YEJL 3V4VL 3V6OA 1U8MB 5I1HL 1I9IH 4MJIA 4LPWA 1BD2E 4OFPA 3ULVL 2WXIA 4PJGA 2BNUA 3DWTA 3MODL 5C70A 5ID0B 1MREL 4MQ7A 3PGDB 1N6QH 3SDDC 1T03L 3QJZA 1NWOA 5HHME 43C9A 4KVNL 3K3QA 4WI9A 4P2RB 2Y7MA 4OKVB 1CTNA 4I48B 1NUNB 5AOJA 1U6AL 3REVA 1LM8V 2JXMB 4TLUA 4ZX6A 1QI4A 4WJ5A 1ADQL 3W9DB 4AW7A 5DUJA 4ODTH 1E30A 2JTDA 2HT2D 1UWYA 4HS6A 5HVFB 1YMMA 5DJYB 1CU4L 1UM6H 1JGEB 2QQNH 2ADIB 4PRPA 3ATDA 1S7RA 2OSLB 2ZONA 1OQXA 4P4KD 5DEZA 1ZS8A 1VDGA 4Z5RA 2NYYC 4N8CL 5E6ID 1BREA 3PWPD 3OKOB 2P45B 4PWHA 2VKWA 3ALPA 2H2SD 1IEHA 3RUGF 3JTBA 4XNZC 3ZPDA 2CBTA 5A2FA 1F00I 4OIIL 3TBVA 5EA0L 2OZ4L 5TF1L 1BIIB 2J12B 1PMYA 1JXDA 2E3VA 5HJ3A 1IGTB 4N0CD 2CM6A 1LMKA 4YDKL 3PWLB 3MRIB 3S7GA 3MBXH 3LN5A 3MV7A 4MD4B 5KS9E 4YZFE 1EAOA 1PLAA 2NQCA 4JJHA 4YHML 3DOSB 5FDWA 2ZOKA 4NO5B 4ZQKB 3UAJD 3ASNB 4BSVA 3IDYC 4NBZB 1PZ2A 3TEUA 1G6VK 4S1DD 5GRZA 2AJUH 4CBPA 2OK0H 3BPOC 3LKPB 1T80A 3GMQB 3ZXAC 2YKLH 2QSTA 3BEVA 2BSEA 5E23A 1EGJH 2QQLH 4X5LA 3OX8A 5IWLC 2GCYA 2MTPA 2J1WA 1AZRA 3VFTA 5E08L 1IVLA 5HI4C 1BAFH 5I1LB 3S88H 1HIML 5F9OH 3IJYB 1T66D 3MUJA 4C56A 4HS3B 4XCYA 1GS7A 5DJCB 3C09C 3QZBA 4NLAA 1A66A 1PZBA 3T2NL 2QADD 4XWOC 3APFA 3NOIA 4M7ZC 1GGYA 1E8WA 3ZHLA 4KY1H 1MFCL 2Q3ZA 3GXNA 5D2NA 1SEBB 1VADA 4UIKH 2XWBB 4Z23A 3VSUA 3PWNA 1NICA 2Z4QA 5E94B 1TKWA 4F9PC 5I1JL 1E27A 1FCGA 3V0WL 2ZUWA 3VYNA 3RZCC 4I2XE 3G9VA 4D2NA 4AQAB 3LRSA 1TFPA 2NTFB 1DQKA 3PL6C 4JY6A 2KBGA 4QEGA 4A2EA 2YGOA 3EZ8A 5BRPA 1JI1A 1UOLA 1RZGB 2UWEB 3NACL 3PJNA 4P4RB 3ZOAA 5DFWH 5IF0A 4A2DA 4YGAB 5GGTL 4RWYL 2VOTA 3SB3A 4NC1C 1YNKH 1WFJA 1T3FA 1SUHA 3X12B 2RB8A 3DROA 1G6RL 3OKMB 4JFHD 3UH8A 2LU3A 2A7BA 2R69L 3SPGA 2ALAA 3RVXC 2VMDA 1QUNA 4AT6A 5I6LA 4E68A 1CGSL 1ZIBA 5CHNA 4EVNA 1RPKA 4JRXA 3OKEA 4XXCA 3EOAB 3VYPA 3ZHNA 4BUHA 4LRIC 3C6SA 5E8OB 1ODUA 1ZHBB 3OJVC 1G9NC 3BFQG 4ZFZA 5F1NB 2RHEA 4TL5A 2F61A 2PF6A 1OGSA 2CM5A 4APQD 2WZPA 4KHTL 1CICB 1ZT4A 3M86A 1JPTL 5D7JC 2ZE0A 3HBPA 4EI5B 1C5CL 1B3JA 1MELA 5D8JH 1KEML 4BFEA 4NCDA 4PJDB 5C0NC 4M1CD 2DDQL 3LNHA 3TS8A 3BAJA 3O3AB 1NINA 3ABLB 2BP8B 1HH6B 1ZVNA 5INCA 3N41F 3THMH 1P1VA 3ZT7A 4B5EA 4DT2A 4MAYC 4G6KL 1HKLL 3ZTJG 1OCCB 3KPQA 1SEQL 2CDGB 5IMKB 4UOQA 2EKJA 2MMXA 3RWCB 3N9GL 4NN7B 5KVFH 3OXSB 4JFFD 4F7CA 1UJ3C 2HRGA 3FQXA 1YQ2A 3TA3A 4Z95L 5B1BB 4L29B 3VFVA 2CJUL 2AAVA 1AY1L 3BCDA 5FKAA 1CLVA 3WTUA 2WBKA 1QW9A 4D3CH 3VXMA 3QJVB 4G80B 5I16A 5HGBA 2GFBB 2E4FA 1UB6A 3ARDD 4PTTA 1A3QA 1WH0A 1CLCA 4HF5L 3TVMB 1OGAD 4BFRA 4Q89A 1I82A 3H9ZA 3RTQB 4YZFF 3T1FA 5IBTH 2CLRB 2LLLA 3KGSA 3BSGA 3POHA 1DBML 1LE9B 1Z9MA 4HPOH 4FQQA 1MHCA 4LLQA 1AQDB 4XMUA 5E4IA 4HAGA 3AXLA 2CUIA 1J1PL 2BJML 4F5CE 2XJKA 3QHTC 5AQ0A 5ESQA 3MHZA 1LILA 1A3ZA 1NANI 2OXGA 1F11A 5K59E 2XN9B 4L4VE 2NY5H 5DJ8A 3L54A 4Y5XA 5ACZB 4Z78A 1N10A 4LLWA 4JN1L 2ZYHA 4E9XA 4N2GA 1SQMA 4XPFL 1A7NH 5KVEL 2GTZA 4HJUA 1ZT1A 3T3PB 3MR9B 4FNRA 1QQDA 3IFOA 4NQDE 1LEGB 1ILSA 4APQA 5DJ0A 2Y3AA 1B4LA 2CA4A 2LV4A 2UWEF 2Y3NA 2ZUUA 3JV4A 3PWUA 5IJVB 5CJQH 4D0CA 5MHSE 2BIOA 4LLDB 4YR6A 1EAQA 5HI5D 3STLB 1UCTA 3CQPA 1U95A 5FO7B 3P4NA 1S7TA 1BQSA 1O5PA 4WKZB 5DJ2A 3TBWB 2MQ0A 2WZ6A 3FO2B 1MCNA 3CFDB 5FGBC 5LVEA 4PJ9B 3EYFA 2VDNL 1AO7A 2BY1A 1RSYA 5I6PA 4M3KB 2ZKMX 2W1NA 3GBLA 5JIQA 4ANXA 2VABA 4LSRL 1ES0A 1YEEH 3WHE1 1NC2D 4WWKC 5I8EB 5T1JA 2IGFL 2QPFA 5IGXL 3BDYL 1WBYB 4AGNA 4BKSC 2XTJE 3L3OA 3PWVB 1DJXA 4MAUL 1M9SA 1UD3A 3KD4A 4LCCB 4NPJA 4R7VA 1GC1H 5EEWA 3HAEG 3KJ4B 4NWTH 4AUYA 2PW1A 4WO4A 1FA4A 2E7MA 1BZ9A 4I85A 5DK2A 3BP6A 1MQKH 4OZHB 5IVXB 3GNML 2VLJB 3ABZA 5IOPB 3WIAA 2NY1C 2AK4E 3BAYA 4FCHA 4G8GB 4HBCL 2FO4B 4BZ2A 2JK5B 3MC0A 4O02A 5I30L 4FMFA 1NBYB 3FT3B 4KK5D 3S5LB 4QLRA 3KPPB 4JJOA 3O4LD 5CCGE 1JHKH 2E6JA 3ZKNC 4QD2E 4Y1AB 3IGKA 2XETA 3G5XA 4JW3A 3BGMB 3RVVC 3ZZSA 1E40A 4GIOA 5I6MA 2APTA 3RVUC 2ERJB 2O5YH 3WY3A 3QEGL 3A4DA 4HWUA 5JDSA 4EUPH 3SDXE 2A0LD 3A4EA 3C9NB 2GW5A 3O2VH 1PD1A 3NCYP 3FCTB 3V0VA 5EZOH 4LB8A 2DQJL 4R0LC 4U3XA 2MNUA 4N25A 4FQHB 4ENED 1I9JH 5HYSG 3GMMA 3KPRE 4FTVE 3MUHL 1XGTB 5DQDH 1J05A 3QUZC 3QH3A 4H40A 4HIEB 3RBGA 3UZQB 2W59A 1NIDA 4CC4C 2Y1AA 1LDPH 2BFVH 1UHVA 4OD3L 3CZJA 3A6CH 4S1RL 5TE4H 5IV2A 1U4EA 4HOWA 1PQZB 2VDPL 1ZGLP 1QBMH 1JGLH 3RWGA 3I9PA 2LR4A 1OGPA 1NFDE 2J71A 4K3HA 4E0RB 3C5JA 4FNLH 3T3PF 4X7SL 3MOAL 4XP1H 3G5ZA 1E6OH 1FVCA 3PIQB 1O7VA 3RY5A 5CIPB 2BHUA 1E5ZA 3CVIH 3ZVVA 2ZWNA 4YOKA 4ELME 2YEVB 1DCLA 3MJ8B 1NGZA 2GTWB 4UM9D 3FU7B 2TSAA 1OP3H 2OV0A 1BJ8A 4OZIB 4WW2C 1WT5A 3NZHL 1AOHA 3L4YA 4Y2DD 4OW6A 1INEL 3BWAB 5DJXB 4JN2A 4XMZA 1A21A 2HFEB 4FQIL 3O8XA 1XB6A 3FU5A 1WICA 5B39G 3VFMA 2EVFA 4HT1L 2XWJB 1VACA 3TCLA 2FX7L 4IIQC 4PRIE 1FUNA 3KVQA 2DYSB 2B2XH 5E95B 1ICTA 2X3BA 3EW3B 3QG6A 4G8FB 3BMVA 3H1ZA 3OC5A 5EO1B 3B2MA 3GXPA 3RKDD 2XVKA 2F5BL 2B0SL 4ELKA 4OCNC 1IM3B 9CGTA 5FYKH 3HB3C 2PXYA 4XWGL 1A3LL 3I3BA 3DOIA 3SQBA 1B4TA 4F93B 1QLEL 2C3HA 2F5AH 4YVNA 3N0AA 4I4WB 5CWSA 5IVXF 3T0EC 4AIOA 2TSBA 4QHPA 3QVAA 4TPRL 3VFOB 5BRZA 3NSDA 4XODA 3Q7JA 5CNHA 5B1JC 4XPTH 5F7UA 4XB3A 4LSUL 1ETB1 2FQDA 2BNRD 2XZQH 2R29A 4LOFA 3BW9A 4FXKC 3WGVB 1I3UA 2IJ0C 2NLJA 1P7QB 5HY9B 4AMWA 4FKEA 5DA4A 2WVUA 2YFOA 3EBHA 1EIBA 1J8KA 5E9DE 4GRLB 3GMLB 1R9FA 1FIEA 3EBIA 3NTCH 1JXJA 1PY4A 3VE0A 4KTGA 5EDSA 3ULVD 2P43B 3LZLA 5ID1B 5BVPH 2FO1A 2RAMA 2DS4A 5EZJB 5FF6A 3OKKA 5AW4B 4EF3A 5C0EB 4ECNA 4MNQB 2VM9A 2Y36H 2X6BA 1KC5H 3AWGA 4KGLA 1KT2B 3CVBA 5B3JE 5KJRH 5DRXA 1JZEA 1PZ5A 1J8SA 1GAFL 4JFEE 4LO9A 4QF1A 4YN3A 3B3BA 5E7BA 1ZT7A 3W39B 1F5WA 1KTLB 2XFXA 4CSPA 5HVHC 2AJZB 2PWHA 4PJHB 2FHBA 3WIIL 3MXVL 2O6PA 1KF9B 3KYOA 3D69B 4LP5A 1KXTA 2YD3A 3BJLA 4OFQA 2XHNA 2MQCA 4WVRA 1CDJA 5F1KC 3K2MC 1KIRA 4RA3A 1ZA6B 2YPLA 3VTMA 4AIEA 15C8L 1JFQL 2DI9A 1MAMH 3N1MC 2VLRB 1C1EL 3QQ4B 2ATPA 3FT1A 4W9LC 4U4BA 4NP4H 3P0YL 3FSZA 4NAMA 5BQDA 3VXUB 1BJMA 1CLZL 1KENH 3ALWA 4ONFL 4H8VA 1IGYA 2UZYB 2XUWA 3O3BA 4O5LH 1N7ML 3GD1C 1JRHH 1OE1A 5H2BB 4UDTB 5EV7A 1DEEB 1ACYL 4OGYL 3GJEB 4LARL 2ZSWA 4UMGA 5I19H 2J6EL 1W15A 2GBTA 5B1CA 1TZIB 2VQ1B 3IBEA 1QRNB 3UTTD 4WDIB 4DQOL 4L8DA 2M1KA 4UINL 1NEPA 3AUVA 2GEQA 2LU5A 4FHBD 4LHUG 4W6YB 2P5EA 5C92A 3I2CH 1OGTB 2MTAA 3H42L 4FLRA 1XCTB 4X9GA 5KOMC 4AEIL 5TFSH 2NNAB 5IW3A 2JVUA 4KRPB 3RDTA 3WY1A 2BSSA 5DWUH 2BDNL 3C5ZD 1KLUA 4QJ5B 5IFAL 2VITA 1G9NL 5HD8C 2VAAB 2I69A 4M43L 2GG1A 1YRKA 2VZ1A 4PCSA 1N5YL 3QIBA 1CGVA 4XN4A 3L3DA 3H9SD 5DT1H 3CSFA 4LP4A 3NAAL 1PAMA 4NQSB 1J86A 4X4ME 1XTMA 4WQOA 3JWNG 5CJOH 4N2DA 4HJIA 3BN3B 1PZDA 3MNZA 3TGXA 1MVUA 1P4IH 5IEHA 4OIBA 3RU8H 4R6UA 3AVEA 3IU4L 5KSBB 5AW3B 2D7MA 1LWHA 1HE7A 2DJMA 4AQEB 1U8NB 1AZVA 3NZ8B 4G8IA 2HWZH 2WLIA 4N0FA 4ZW6A 3NIFB 5IESL 4BFBD 3GRWL 5HGDB 4IJ3C 2LTQB 1QKZL 4JFDA 4J6IA 3B2VH 1ZAGA 4N8UA 1J1XH 1W0YT 1OAXL 4ZX5A 3T2LA 1T7YA 1O9WA 4KXDA 1AKJA 1Z5LB 4IU2B 4UT7L 3ASOB 2XQYG 4Y2OA 5D2LA 3QRGH 1YPZB 3O0LA 3DXAB 4RGMC 1DSWA 5I82A 5K33A 2C9RA 4PJ5D 1D5BA 5FGCB 2F53E 3AM8C 3L9YA 4ZS6C 3QI9D 3IJSB 4DZBB 3KXFD 4KMQA 4DKEH 1K4CA 2I07B 2BSTA 3UYPB 4U1HA 1EZVX 1WFOA 2H32B 3CFJB 4LSQH 5EEUA 2O6DA 4KI1A 2PYEA 4PJHF 3IDNB 5TK2A 4TVPE 1RD6A 3M45A 3BGFC 4CADB 1NTDA 3UTTA 4HPHA 4YGVA 5T1KD 4G82A 1P53A 1BVZA 2EE9A 3BN9D 1OE2A 3DX7A 3ZDYB 1KJVA 4X7TA 4BFJA 4KGJA 5G5DA 5I1IL 4CBZA 5GJSL 5ITBL 1CL7I 4FCAA 2VZTA 1EHKB 1A3RL 2H0EA 3FB8A 4RH4A 1RK7A 2DM3A 3CLFL 2CO6A 3DURB 1J8HB 3UJIH 1U3HD 3SGEH 4NENB 4QNPF 2R2HA 4QXUL 3A3YB 2AK1H 5C6PB 1Q9WB 3GKZA 2D3LA 3G6JB 3I02B 1VENA 4OLUL 1S4IA 1AMYA 5AKTA 5EUOB 3N1GC 4M1GH 4FQXB 3MLRL 5TDNB 3V4PA 3VI3F 4K9JA 3V6BR 2B16A 3RE0A 1MHHA 1Z32X 3B8YA 1JD7A 3VA2C 4EN3D 3S8WA 2DIJA 2N59A 1JVKA 3E9TA 4TULL 5EU3B 1NCWH 5EF1A 4GQZA 4WGWB 2IEPA 4P2OD 4R4ND 2Z7ZA 4ZSOA 2MOGA 4LASL 4LDOB 4G8EA 5T3ZL 4J1UB 5EEVA 4UU9A 3OAYH 3RWJA 3MV11 3NRQA 1T5WB 5KYXB 5KSBF 4L9LB 5CZKA 35C8H 4NB7A 4I87A 3DJSA 4O2CB 5CN2A 3SPVB 3DK2A 4ODVH 5F1OB 2C9SA 4K7FA 5CU5A 1QACA 5TE7H 4LPYA 1FZKA 1BFVH 1BF2A 4OQTA 5GGTA 5J9PA 2X6VA 1SRDA 4HD9A 1DQQA 4HDIB 1QWHA 3HLAA 3MRJB 1PX8A 1LE5B 2IAA