2VSKB

Hendra virus attachment glycoprotein in complex with human cell surface receptor ephrinb2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
138
structure length
131
Chain Sequence
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMAGGLUTININ-NEURAMINIDASE
publication title Structural Basis of Nipah and Hendra Virus Attachment to Their Cell-Surface Receptor Ephrin-B2
pubmed doi rcsb
source organism Hendra virus
molecule tags Hydrolase
total genus 26
structure length 131
sequence length 138
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vskB00
1J9SA 1KDJA 2MRYA 2HZHA 3NJHA 3QPKA 4YVUA 3FPYA 1GW0A 1A8ZA 1AZBA 1JZJA 1A4BA 3JTBA 2BHFA 3T9WA 1J9QA 1OE3A 3EHBB 1UATA 2I85A 4NB7A 1BQRA 1NWOA 2XX1A 1MDAA 2PPEA 1CYXA 3WG7B 1ID2A 1MZZA 1NINA 2DYRB 2LLNA 4KO5A 1KBVA 4JKNA 1L9TA 8PAZA 4AX3A 1QHQA 2EIMB 1IUZA 3H4FA 4DP4X 1JZHA 2H3XC 1WA0X 2J57A 1CURA 2Y69B 2TSBA 3ASOB 1AG0A 4E9VA 2CUAA 2BW5A 5I6NA 3FQYA 2H5UA 2OCCB 4X4KA 5B1AB 4NAJA 2XUWA 3RYMA 4KOBA 2Y1AA 5TK2A 3T71A 3GXUB 1L9SA 1JXDA 2CALA 4BDVB 1N68A 2FJSA 1AQ8A 1A4CA 3OMAB 5I6LA 2XV0A 2IWEA 2UX6A 3CDZA 4WTQA 3ERXA 4EF3A 1M57B 1GSKA 3U25A 3HB3B 3QJTB 3NP4A 1GS6X 1JVLA 3PAVA 3KW8A 1ILUA 2FQEA 4HCGA 2PCYA 4HCIA 1AANA 2B08A 3BVDB 1AS8A 4JHUA 3C75A 4F2EA 3QJRB 2YAOA 4BWTA 1L9QA 2IDFA 5B1KA 3PXLA 1MG3C 1ZDSA 4KNSA 4AKPA 1E67A 2QDVA 2HRGA 3WNJA 2PLTA 3PPSA 3FSWA 1A3ZA 2BWIA 2PPAA 2UXVA 3WIAA 5B7EA 2DYSB 1JXGA 2AZAA 1HFUA 2XV2A 4E9RA 1GY2A 5I6PA 2FWLB 2VW7A 2BP0B 2CBPA 3H4HA 3QJVB 5D4JA 2YAQA 3NSFA 4MFHA 4NERA 4DP6X 3KW7A 2P80D 2EIKB 1ETJA 4HHWA 1NIBA 3UABA 4DPAX 1GS7A 1AZRA 2GC4C 4P5SA 4KNTA 4YSRA 2WSDA 1NZRA 1BQKA 3N2JA 1IBZA 4E9SA 1KV7A 2VMJA 1JZEA 3SBQA 1BAWA 1CYWA 4HALA 3EH5B 1OV8A 1W6WA 5E9NA 9PCYA 2ZXWB 1SDDB 2IH8A 3X1NA 3X1EA 4UANA 1E65A 1PNDA 1M9WA 3AY2A 1PAZA 3FU7B 1OE1A 1TEFA 1WS7A 4P5RA 2IDSA 4F7KA 1YLBB 3ABGA 2XU9A 3NSCA 4E9TA 3S3BB 1SDDA 1PZAA 3S8FB 1B3IA 2BZCA 2I7OA 1SFHA 3FU7A 2VSMB 4E9QA 3FSZA 2N0MA 4YSOA 2QT6A 1JXFA 1RZQA 4L0PB 2EIJB 1WA1X 2AVFA 1KDIA 3FT0A 1BXAA 1DZ0A 5AFAA 1PCSA 3IN0A 2X88A 2YXWA 4YL4A 3NJKA 2GB2A 4UAHA 3H56A 4YSSA 2FQFA 4YSQA 1ZDQA 2RACA 7PCYA 4M3HA 2JXMA 1NIAA 3GYRA 1M56B 3NSYA 1NTDA 1E5ZA 3EF4A 4FA7B 4Q8BA 2VN3A 5PAZA 1SHWA 2XVBA 2IDTA 1WAEA 3NJGA 5B7FA 3PAUA 1ET8A 4Q89A 3DKHA 3GDCA 4DP0X 3UAAA 3DIVA 2W8CA 1SFDA 5D4HA 4G7SB 2EILB 2CJ3A 2UXFA 1KCBA 2J5WA 2FTAA 2EINB 5F7AA 1JVOA 4JHVA 3UAEA 1PNCA 1R1CA 1FFTB 1GYCA 2P80A 3FQ1A 2B3IA 3V9CA 4BK5C 2AZUA 4TXVB 1KCWA 3WKQA 2UXTA 2FQGA 4A2GA 1L9RA 3DTUB 3QJUB 3IEAA 3X2QB 1BXVA 4BDVA 4BWUA 2GSMB 1MG2C 2Q5BA 2WO3B 2YAPA 3CG8A 4BXSV 4E9XA 4DP8X 1VLXA 2YARA 1AS6A 1ADWA 1KGYE 5I5IA 2YAEA 2GBAA 5TK4A 4E9YA 1L9PA 1AR1B 3QJSB 4QKTA 1ZIAA 3IE9A 1ET7A 4GP8B 4KNUA 2OJ1A 4M4RB 3ZIYA 5B1JA 2BP8B 1NWPA 3NYKA 3EH3B 1CUOA 3ASNB 2GIMA 3X1GA 1XMEB 5EHFA 1XB8A 7PAZA 2MTAA 2HXAA 2XWZA 2IDQA 4KOCA 5B7MA 1NIDA 2GC7C 5B1JC 3NJLA 3S3DB 2IAAC 4DP5X 2WO2B 1IKOP 1PLBA 1F56A 2XXGA 1A65A 1E30A 3CVBA 4WKXA 1IBYA 3NSDA 4YVNA 3AG3B 4DP2X 4ENZA 4W9ZA 3FYIB 1X9RA 2XV3A 4A2DA 4YSPA 4CSZA 5B1BB 1PZCA 2BP0A 4BXVA 5PCYA 2R7EB 2CCWA 5I28A 3NJNA 1AACA 4A67A 4GP5B 2HRHA 3OQRA 1JERA 3OM3B 2H47C 1ASOA 1T5KA 3S8GB 2IDUA 4DP1X 1RCYA 1J9RA 3ABLB 3T6WA 2FQDA 2UX7A 2E86A 2DWSA 2NRDA 3X1BA 4RH4A 5I5MA 2R7EA 3CVCA 3NT0A 1EHKB 3QQXA 3N55A 3PCYA 3OMNB 4A2FA 1ASQA 1NPJA 2VSKB 1TKWA 2DV6A 4PAZA 1URIA 2BWDA 2HX9A 3ZX1A 1OE2A 5A7EA 2PP9A 1QNIA 2I7SA 1KBWA 2HX8A 3MBWB 3JT2A 4HIPA 4ZK8A 3OD3A 1EZLA 1MZYA 1ZPUA 1A4AA 1ILSA 4G72B 2PPDA 1PLAA 1AAJA 2ZWNA 4YSEA 2HLEB 2PPFA 2ZOOA 3ABKB 3FQ2A 1GR7A 4BWWA 3WI9A 2BO0A 3NJFA 4N4YB 4HAKA 1N70A 1HAWA 5I6MA 1BYPA 1OCZB 4F2FA 2YAFA 2XLLA 1L9OA 1JOIA 4UF7C 1W8EA 3PLYA 4G71B 4AI7A 1E5YA 4GP4B 3SBRA 6PCYA 1AG6A 1X9UA 3AG4B 1PY0A 4N8UA 2FNWA 4GYBA 3V9EA 1HAUA 1TU2A 4HZ1A 2XYBA 1ASPA 4E9WA 2J55A 4W1TA 1V10A 2AFNA 3WNIA 2PP8A 3OMIB 2Q9OA 2XXFA 1AZCA 1OF0A 3TA4D 5F7BA 1V55B 2FT8A 1PLCA 3FSAA 3CDZB 3T6XA 1ET5A 2W88A 1KYAA 3ABMB 1SNRA 1SHXA 3QJQB 4A66A 1QLEB 1J9TA 1BQ5A 3CZUB 1AZNA 5AKRA 3ZDWA 3NJIA 2IH9A 2VW6A 4DPCX 3NP3A 4QLWA 4YSTA 5I6KA 3FU8A 3NJMA 1RZPA 2JKWA 3MX0B 3S3CB 3D12B 4HHGA 2DY2A 1AS7A 1NIEA 3G5WA 2PP7A 4KO6A 1AOZA 1OCCB 4YSAA 1NIFA 3FYEB 2XX0A 2VW4A 4G70B 3EH4B 1NPNA 4DPBX 1GY1A 1OOWA 1TEGA 2BP8A 1SF3A 1FA4A 5B3SB 4CSPA 2IWKA 2J56A 1OCOB 3FSVA 2YXVA 2YAMA 1BYOA 3TBBA 3BQVA 3FS9A 1GS8A 2PPCA 5AZUA 4DP7X 4YSCA 3IN2A 2QPEB 2FT6A 1W6LA 1FWXA 3HEIB 2X87A 1DYZA 1BEXA 4A68A 5I26A 2OV0A 5I5JA 1BXUA 4HCFA 2GHZA 1SJMA 2TSAA 3T6VA 1ZV2A 2AANA 1IC0A 4G7QB 5FC9A 3CVDA 1PMYA 3TBCA 3T6ZA 3FU9A 1WA2X 1XB6A 1I53A 2QDWA 2IWFA 1J5DA 1NICA 1CC3A 3UGEA 3WKPA 3AG2B 5D4IA 4A2EA 1PF3A 4AZUA 2PCFA 1OCRB 1AZUA 1PZBA 1JZIA 3L45A 5IY5B 3AG1B 2UXGA 4FAAB 2HX7A 4GXFA 3UADA 4AKOA 3SQRA 4K9JA 1JZGA 2BW4A 1ZIBA 1RKRA 3AZUA 1XB3A 2YQBA 3TASA 2VM4A 2ZONA 4G7RB 3PAZA 2QPDB 3NJJA 3FPXA 5LDUA 4DP9X 1WS8A 4GY4A 2A3TA 4YSDA 2JFCA 2VM3A 2DWTA 4YSUA 5ANHA 1NDTA 3AW5A 1SF5A 3SBPA 4AKQA 1AIZA 4KO9A 2BZ7A 6PAZA 3UACA 2GI0A 1V54B 4PCYA 1J5CA 3ZBMA 2FT7A 3X1FA 2YAHA 3IBOA 4A2HA 2CAKA 4KO7A 3TU6A 5I6OA 1JZFA
chains in the Genus database with same CATH superfamily
3GI9H 3BP4A 5DJAA 3K80A 2GAZA 4RESB 3IDYC 2ZF9A 1DQQB 3PJLA 3QB7C 1YPZB 1FZOA 5C3LD 2NT0A 4PJ7B 2J88L 1SEQH 1LNUB 3FUMA 4XPAL 5B3NA 2DDQH 1CDIA 3VI3A 4QT5B 4AIXA 4AGNA 4C47A 2LE9A 4O2EA 5FO2A 1MRDH 5TDPA 1BD2B 3A4FA 4HUXB 1MDAA 5L7XL 1NINA 2A38A 2UUDH 1MFEL 3QAZB 3PF2A 3DMMC 3CHPA 1QRNE 3ARVA 2VL5A 3FQRB 3VG9C 4YHZL 4Z3GA 3V4VB 1YEKL 1ZHKA 3F5WA 1TJHL 1CS6A 5F7KC 4OCWH 5B1AB 1NEPA 3UP1A 1F6LL 3B2UD 2Y1AA 1ZLDA 1JWMA 1CFQB 2NNAA 2W65B 1YSOA 2FLMA 2SODB 4JQIL 3TIDB 4Y2DC 4RDQF 1A4CA 4GO6B 1S3KL 3DVGB 1CE6B 1S9WB 3CDZA 1SMOA 2FEEI 3HIZA 3LKNB 3MLTB 4U6VL 4BQ6A 1GSKA 2FYVA 3KBHE 2WJ5A 4ZS6D 3FQWB 3VXTA 2L7EA 1JVLA 1N0LA 4ZFQA 2VZVA 2ZP9A 4EUPG 1Q0XH 2FQEA 2V5SA 3CDYA 5DMGD 2VMCA 1RUQH 2PCYA 5CCJA 3ZHLA 1IVLA 2VZTA 2FDBP 1E4KA 4KX8A 4PREB 4Y8AA 3VYNA 1ECYA 1A3QA 1TQCB 4BWTA 2EDLA 1E7UA 3FT9A 3N85H 3I9GL 4MBOA 4KTEL 1QWUA 3PGFL 1D5RA 3WNJA 4F5CA 4L5FH 4V33A 4NO0B 5H94B 1PZ5B 4EDWH 2AJYL 4NQVA 3APMA 5CFAA 5I1HH 4K5LA 4JFTA 1HOEA 3DOHA 4LHUB 1DN0B 2WIMA 4PJAE 3BT0A 1XGZA 4LPVA 3S3PA 4XPGL 4ZZFA 1HEZA 2OP4L 3O8XB 1FDLH 2MEJB 1JNNH 2VNCA 1DVZA 4XO5A 5DHEA 3UERA 3UJIL 1X7QA 1OB1A 4YJZL 4ZG1A 1UM6H 4JPIA 3B2VH 2WXNA 4FQIH 4HHWA 3WLWD 1QFWL 3A3YB 1VFMA 2AJSH 2O5NA 1B0WA 5JZ7C 2V2XA 4HJGB 1FYTD 1R3KA 3QCTH 3ZGIA 2B1OA 4ZFOL 2XWXA 3PY9A 4P5SA 4EZMA 4HXAL 4JFDE 5TE6L 3GSOA 4YGVB 1S6NA 3G5VB 5FGCE 3RWDA 3GIVA 2B9AA 2NZ1A 3SBQA 5JXED 4IRJC 4QXTB 5JW4Q 4WUKL 5T1KB 1HEHC 1NMAL 4FYSA 4OB5H 3VWJD 2H8PB 3O6KH 1P7QA 4JLRB 2F54D 1ED3A 5GS1B 2NY1C 3K8KA 2H26A 3AY2A 3FU7B 4JPSA 3IPBA 3TN0D 2OMZA 3APFA 1IGTB 4N8VA 5ALCL 2Z8SA 4L4JA 1LO0L 5DD5H 1MFBH 2CLZB 2P8PA 1EUTA 3MJ8A 1BFOA 5FGRA 1OZTG 4I0CC 2ZZUT 3LEXA 3IFNL 4JGNA 1JFQL 1NH6A 1BREA 1OIOA 5IVZB 1B3IA 1I85C 2W80C 2R29H 3VVWA 4UMSA 2I7OA 3D0VB 4KZ0A 5MENE 5ALBH 2EDTA 4WIQA 2VSMB 5IQLA 2IDCA 4BSJA 5D7LE 4F2MB 4YHLL 3UTPE 4BUGA 2EYRB 3WELA 1WBXA 4XP6L 1KDIA 5K9QG 2OZ4H 4W6XB 5T3XD 4OV5B 2CJUL 3PDGA 5AFAA 1J8SA 5HYQA 2YXWA 2YUXA 4G8EA 5I1IL 1SOXA 2EDQA 1KXQE 2VDQH 2EXWD 1P1ZB 1CXFA 2ZOWA 1ZEAL 2WKGA 5H8DA 3KWXA 3QUML 5H2BA 4L0ZA 3BP6B 2OS7A 4V2CB 4OLUH 3KCPA 2C3GA 1U92A 1QFHA 4EIBA 4TNWK 1UVQB 2OMVB 4HT1L 5AW8B 5GGQH 1NCDH 5CWSA 3IGFA 5JQIB 4EXKA 4DGUA 4FNSA 1E5ZA 2WLKA 4MJ6B 5T5NG 4G6ML 3OLIA 5GGTL 1H9DA 4AENB 2VQUA 2FO4B 1ANUA 1QSEA 5KG9A 3S4SB 3J07A 4NQUA 4OZHE 5DQDL 3V52L 4EZJA 4I0KA 1E9QA 5M94B 3CFEA 1BQLH 1SFDA 2APBA 2OJZL 4NC1C 5D4HA 4Z77A 4G7SB 2NXYC 3NA4A 4AVHA 1DVFD 2WLHA 2C3VA 3KLQA 4ELMF 3VU1A 2A6IA 4W6WB 2J5WA 4TLTA 5I8CB 1GJIA 2BIQA 3DVNB 3VGDA 1UZ8B 1V05A 2CO4A 2HN7A 2YZ1A 3LKOA 4LE8A 3V9CA 4BFIB 5L2JA 5BS0D 2OXHB 1JGDA 3PIQB 5T1JA 1VFBB 3BO8B 4L3CA 3GM8A 1II4E 5E8DH 5IQ7H 2J8OA 1UB6B 1FCCA 1GJWA 3BQUD 1ZMYA 4MJIB 3WJLA 5D70H 3DTUB 1JWUA 1H6EA 5D2NC 2IANE 3IEAA 3X2QB 5HSFA 4BWUA 4UM8B 5I1DA 5SWQA 1XD0A 4H0HB 4BE6A 2B1HH 5ID1B 3BXNA 4AEIH 1EEYA 2F7QA 5H35A 3L7EB 5M7QA 2AS5M 5TK4A 4EKJA 3ARXA 3RWEB 1N6VA 2WCPA 2XY1A 4R5VA 4F57L 4HUUA 1DQVA 2Z1KA 4L1LA 3H3BC 4UTCA 1RL1A 5B1JA 5ITFB 4BCXA 3U46A 4BUQA 3ZK0A 2UY7B 3SPGA 2ZPKH 1INEL 1QLFB 2BIHA 3CN2A 2D3LA 3ILQC 3QUXA 4Y5XA 2DQHH 4EN2A 2ZG3A 1XH3B 2F7OA 4TUOB 4XBGB 3H54A 4F1SA 2XXGA 1C08B 1CF1A 3ZVVA 1RP8A 2LLLA 4NKIH 1DVXA 1UFUA 1YRKA 1NAMH 1OALA 4J2QA 1QQDA 3NACL 4XMZA 5EU7C 4F20A 2GSIB 2GFBA 1U8HA 2J1KA 4P57A 4XNAA 4NPYA 5CEZL 2Z0UA 3FBKA 2VR9A 1T5KA 3IBEA 3MQIA 4AY0A 2MKLC 5KSBA 4GMSH 4PGDB 1NANH 2EKSB 2GJ6E 2NT1A 3IB4A 4JM4L 2HFFA 4OZIA 4JM2C 1N3NA 2Y7OA 2EYSB 3Q01A 4ALAL 4UTAH 2C9AA 2BNQD 1FZMA 3K7UA 4HXBL 1IV8A 3OAYH 1K5NB 1NCJA 4QGYA 3T0ED 2VQ4A 5I2IA 2PP9A 3F7VA 1KBWA 5HTSA 2VGLM 1PSKH 1S7XB 1OGAA 1IZKA 1ETB1 1IBDA 2NPLX 4B9YA 2YPVL 3ARED 3GIZL 4X42A 2YPKA 4AXWA 3MUY1 3RWJB 2L3BA 2CUHA 3KPPB 2Q2LA 2IFFH 2DF3A 3G08B 2WSKA 3MOBL 3OKEA 2NW2B 3D39B 5ENWB 5G4NA 5FM5M 4LLMA 4PVLA 1NFAA 4QI3A 1MNUH 4F8NA 1Q0YL 1MRCL 3FQ2A 4OD1H 4F15B 1HQ4A 1HILB 3TV8A 2Y22A 3BVNB 1GGTA 2V2WA 2VZOA 1HAWA 4JFYA 4HSCX 4YHIA 4F2FA 3SKNA 1PZ2A 4WDIA 5FYJD 2DJUA 4NS0A 5T5FA 4F3FA 3VCLB 3DVFA 1E5YA 1JPSL 4GP4B 3UTTE 5C0FA 1KZQA 2XETA 5IB2B 1X6NA 4P4RB 4RNRB 2FNWA 1I7RA 4GYBA 5F2FA 2YWYA 4HZ1A 2XYBA 2Y2YA 3GJEB 2YOCA 4H5SB 3NFSL 1UM5H 2OTUA 3WNIA 1MCEA 3DGCR 5EU5A 5D7JD 1J7VR 5HVHB 1AZCA 4ALAC 3U0TA 3K72B 3R4DA 1I1CA 1SLVA 2QSQA 4JQVA 2ZUTA 1AY1H 1KWKA 5FGBC 3O11B 1Q9LA 2OYKA 1TJMA 1SNRA 2VR5A 4P2OC 3ZKND 1N0XL 4EDXB 1O5PA 1A21A 5AD0A 1ORSA 4UZUA 2VERA 1U8IB 3NJIA 2C4FU 2EE9A 3HPJA 5JLZB 5D9SB 5TDOA 5FO9A 2XT1B 2FGWL 3F12A 4MWFA 3AWGA 3GRBA 5HI4D 2RCSH 1O7DC 1G7LB 1F90H 3CSFA 3WUWG 4NKMB 2DY2A 5C07A 5D71L 2ZYIA 3LQZB 4GSXA 4M93C 5IQ9A 3CVHH 5E23A 4GW1A 4XP4H 1E2WA 3W0WE 1UFGA 1RU9L 5ES4B 1CTMA 4YSAA 1JNHA 2ENPA 4XNMA 4AGOA 2WN2A 1H3VA 2Z31C 4P46D 1H8OA 4BQ9A 4HS8H 5K1NA 1BZ8A 1SMDA 4QTHB 2XBTA 1NCUA 4ZMNA 3GMPB 3AWEA 2CD0A 2J6EH 4J6RH 3QAQA 3OZLA 5JMOC 4XCEA 3IDJA 2UWEF 2DW5A 3EYVA 3Q1SH 1OCOB 4FJYA 2HAZA 4OGXL 4AQEA 1F41A 5HYSB 4Y19D 3LIZA 1RULL 2A6KB 1F1GA 1R5WA 2ID5A 3LKRB 4A7QA 5AZUA 2XRAL 3IN2A 3LZQA 3ZL4H 1ZLSL 2DQJH 3QEQA 4I2XB 1CE1L 3O6LL 5I26A 2YBRA 5KS9E 2V5YA 2ZCKH 3FO9B 3ARGA 2FD6H 2I9LB 1ZS2A 4RWYH 4DEWA 2GHZA 3CDGA 1NUFA 2X09A 1UTDA 1SXNA 4WV1C 3T6VA 1S7WA 2MCPH 3EFOA 3MRPA 4JRYB 4CMMB 5FKAB 1DE4A 4WUUE 2AEPH 3BI9X 4WSGA 5DVNA 1WUZA 3QFJE 3KPMB 4G6KL 4AZUA 3ULUH 5DU7A 3RGVC 5CU5A 3I6LE 1KB5A 1HQRB 3APCA 3EYSH 3QI9A 1CIUA 5D96C 1JTOA 3CHOA 1WGOA 2G60H 3CD4A 3WTVA 5HVFB 5F1KC 5F3BB 1JGVL 3RX7A 1QR1A 2VM4A 1H9VA 3MLXL 3NJJA 1KCUL 4HV8A 3HVNA 5F7UA 1CICA 2NXZC 5C3TA 4XCFL 4LRIA 4ZXBB 3K81A 1X7TA 4HWBA 3EYUL 1KYOK 4N2EA 1FZKA 3FOLA 2BZ7A 2H1LM 2EXYD 3VD5A 2NY2C 1UXLA 3CLFH 1QW8A 4X6CA 3VW3H 4Y16B 3TBYB 2O5XL 5KEZA 2EICA 1QLEL 3MV9A 3K6FA 1LQBC 5FR3A 3QNFA 2NZ9D 4BBWA 1KLUB 1FBIH 3P40A 4U1IA 4WTZG 3S37L 1C5BH 1Y6MR 1I1AD 3P4MB 4WI9A 4OBSA 3CQQA 5CN1A 3QIBC 1CXHA 2HPOA 1UADC 1O6VA 4DTGL 3PWUB 1FL3A 2NTSP 1U58B 2BVPA 4LBEA 1A7BA 1LWJA 1AFVH 2I85A 5IVXE 3X3FH 1JWSB 4RWHA 1KBPA 1KPVB 5SWZE 1MZZA 1HDMB 3NAAH 5C0CA 1PJ9A 5E08H 1G43A 2GVYA 4KO5A 4L9LA 5IB1B 4JCWA 1MCIA 4RGNC 3AUWB 3IDXH 2XPGA 2H3XC 1YNKL 4G6FB 1B4JH 1N4XL 3SCMB 2VXQA 2ZXCA 4XC1L 5EFIB 3SEPA 2ENSA 3V7AE 4PGEA 2VDPB 4NO3B 4MGXA 1WRFA 1EXHA 1ZGLP 2Z7WA 1I9IH 3L5WB 5FDYA 2Z6FA 4WWKC 3RAJL 1FL6A 2CHDA 1XF3A 3OHMB 4N2MA 1ACYL 43C9A 4K3EL 2FR4B 3BZEA 1MFMA 4Y5VB 4DGVL 1WVZA 4M7KL 5E95B 4CSSA 2X9XA 4UDTB 1GS6X 3DO7A 1PX8A 1I4FA 1KN4L 2CKBL 5IJKA 4XI5D 3GQFA 4WWOA 3GT6A 4PBWD 5DD0L 4Y1TA 2K1MA 3DYPA 1BAFL 1C8PA 3FDWA 4N0YH 2WZPA 2Z4QB 3N1GC 1CK0L 5E6UB 2QDVA 4NC1E 4AQZA 4IMKC 3PPSA 5GJSH 1A3ZA 2Y5TB 2R9HD 2BVQA 2X4UA 3S36L 3G6JE 2MOGA 3IJHA 4TSBL 1J87A 5D2LE 1J5HA 4G9FE 4APQD 3B6SB 1MPAH 2J4WL 1NGZA 1JK8A 1GY2A 2A83B 3HB3C 1DVSA 4M6NL 4RMWA 3BD3A 4TYUA 4YFLI 5I6PA 4JFXB 4AGMA 3H4HA 2G9KA 3PS6A 1G5GA 1PS3A 4G7YL 3T2LA 5D72L 2G30A 4FMVA 1ETJA 4JM2B 5LGHH 1UOVA 4DPAX 3WMQA 2DEWX 3VDBA 4L2LA 2PR4L 1HIMH 1Z9MA 5JXAL 1G9NH 1ORQA 3DPBA 2NY6B 3DUUB 2HLFD 5IEHB 4R4FL 5FOBA 1I82A 2VJ0A 1UD5A 4E9SA 1HKFA 1EJ8A 5ESVB 2QADC 3MOQA 3TT1L 2E9WA 2XTLA 3K5RA 3L9RB 4E41B 4XO9A 1I8IB 2N7AA 1DBMH 5E6IC 5E5MA 1DLHB 3CH1A 3B2PA 3D08A 2IMMA 3QCVH 2CUIA 2P5WE 4GBXB 5E8PB 2QQLH 4K7FA 2HKAA 4LVOC 3IFOA 2WM0A 2EVGA 4X5PA 5LWYH 5HY9A 4H20H 3HUJF 1GOFA 1Z5LB 2W91A 3G9VA 4L3EE 1EDHA 3EOTH 5L2KA 5IHBA 5AVXB 2DD8L 4I9XA 5GRZA 5L4JA 4Y7OC 3QJHB 2XKUA 2ZF8A 4GAYB 3TS8A 2BXYA 2ATPB 1CFNA 1RLBA 3FZUC 3G5YA 2AW2A 4S10A 5D1ZI 4C4KO 5FFGA 2BWQA 4XOBA 4YNYB 5I8EB 4QXUH 1W91A 3E9UA 3BZFB 3CK0L 1D9KA 5AAMA 4FFYH 2XZZA 3CPUA 3O45B 4ONHA 3ARRA 1EVTC 2FQFA 5AAPA 1NL0L 4NI3A 5MP6H 2ZX8A 3HHSA 3JWOL 4M3HA 4ACTA 4DKFH 32C2A 4H0GA 1ZLWH 1D7DA 3BD5A 4D0BA 3Q8FA 1M56B 2Q76A 2XPYA 4MNQB 2IQ9H 3F83A 4NNXA 5IW6A 5PAZA 4URKA 2XA8L 2XVBA 4XO8A 3ZRCC 3VDCA 3MNVA 4HVBA 3D9AL 3O2WL 3BKYL 3R7QA 3O3DB 2KZWA 4QY8B 1SJHB 5B1CA 1VHPA 1XGYL 2OA9A 4ES9A 3PQYB 4EIGB 1RZFH 2X28A 2DQTL 2NY0C 4M6OL 2HVBA 4Z7WB 1X7SA 3MFFA 5DVKA 2JKSA 3ILPA 4Z7NB 3X13B 2CJ3A 5ECGA 4AV5A 4FNRA 3CFKA 4Z7UA 1GJUA 2FIRT 5HBBA 4PS7A 3HNSH 2KQMA 4M4PA 4JRWA 4EJ1C 3UAEA 4HMEA 1MCLA 1WWCA 3RDTD 4QRRD 2FH8A 3G04B 3GMLB 3EADA 4TVSa 2B20A 1OAZL 5ANMA 2DJ4A 3IF1B 5DFWH 5GS0D 1Z6JT 2VSDA 5D1XC 5AW3B 1WWWX 3BGAA 3MUZ1 1G7IB 5G5DA 3U36A 2AJYH 4BKTC 2DTSA 1DO5A 2Q5BA 1LE9A 3DX6B 1BGXL 1EFXA 4E5XG 4GI9A 2AP2A 5KUKA 3QZWG 4HU2A 5HYEA 4XPGH 1X5MA 3F04A 1INQB 4MNGB 4GQRA 2LR4A 2I5YL 1QFWI 2QLYA 3US0A 2W0FA 3SBWC 3JWOC 3V9FA 2QPUA 3BUQA 5A6LA 2HJFB 1XB8A 4J12A 7PAZA 4R90L 4J3BA 4FABH 1A9BB 2H2PD 5B7MA 4YHKH 4HBCH 3LS5L 5LN8A 4UIMB 4JM0A 1PEZA 5CLYA 1HH6A 3INUL 4HUVB 1NFDE 2EYTB 5JIQA 4FNLH 1E30A 3MRDB 4O2FA 4DKEL 4YVNA 3WCYA 4JL1A 3E6FA 3RL2B 3BPCA 4DF9A 4W9KC 3LZRA 1CXLA 3C12A 3WN5C 1MIMH 5IBLC 2CU9A 4Z78A 3TH4T 1EAQA 5ILTH 3OL2A 1E4XL 4OZFH 5IUCA 2V4LA 3D3VE 1JXJA 2LU7A 4ODVL 3TBVA 2CA4A 2H47C 3MO1A 1IGML 4B96A 1KJ2A 2DYPD 4WFHE 3WO4C 1M42A 2HTKC 3BE1L 1WAAF 4Y4FC 2I60H 1HOCA 1A3LH 2E7HA 5C0DB 2EVIA 3LEVL 4BYHA 1D6VL 3PJSB 2FRGP 1TVHA 4ELMA 2FBOJ 3DETD 1RMFL 4FDWA 3N44F 4PJXB 4FHBD 4LSVL 3O0RH 4MSWB 1J48A 4NO2B 3P4NB 2R4SH 3QFGA 5E03A 4XP6H 4LGPB 4MXVF 1ZHNB 3MR9A 3ATDA 2IH3A 1QNIA 4OTXL 5GGRY 3Q8AA 2IWGA 2WXMA 2Y36L 4JKMA 1YNTF 5CLTA 3O6FB 5I1CL 3APNA 5A2AA 1ZWIA 1EZLA 4UB0H 1PG7W 3PV6A 1IQWL 1P4UA 3MRIB 5KVGE 1EAJA 1XXFC 1U41A 3ARFB 4IRSB 3DBXA 1SXBA 2HLEB 1I7ZB 1MCOH 1WCQA 5C7XL 1F02I 5E5UB 1JRHL 4TM9A 5D55A 5CJ5A 4NDMB 1N70A 5I6MA 3PWVB 4HG4K 3ZTDC 4HPHA 4MDJA 4N6QA 4NZUH 4ZQKA 2BOBA 3H9SD 3HC4H 5FA4A 4BA8A 2XNAA 2P8MA 2X4PB 3MBED 1KSRA 5BZDA 2FX7L 3AXLB 2P48B 5BRZD 3SDAB 4WI0A 1UZ6E 3NN8A 4UT7H 3B43A 3ATFA 7CGTA 1A64A 5CHNA 4XO3A 4DO6A 3VRJA 4KK6D 5HJDA 5DHMC 1S7RB 1S9VB 1JV2B 3MV01 3WY2A 5I18H 1ZS8B 3FMGL 4YDIH 5FUCC 3WHE1 4LSRH 1NMCC 1PFCA 4W68A 4XZUA 3KPSA 2E27L 3WIIH 3RTQA 5GSRA 1OF0A 3NMEA 5ITBH 4HC1L 4BZ2A 4I5BB 1N5AB 1WFIA 3FTYA 2DRUA 2ITFA 3WY3A 4Y4HA 5CBEB 4PRNB 3H7BA 3HE7C 3I02A 1QLEB 2JB5L 2Q10A 4V1DD 4ZX4A 4WU5B 3DTDA 1U8OA 4U3HA 5AKRA 4BZYA 4S1RL 4IMLB 1C7TA 4M29A 4X5WB 4YHOH 1F2QA 4R2GB 5LAXB 1INEH 4XVTH 2P9RA 3T3PF 2DN7A 3EW3B 1BZDA 2BSSB 2JELL 1QWNA 1T2XA 2QQKL 2AKRA 4QRUB 4U1SB 5BZZA 1LP9B 2EQDA 1G4RA 3NIDF 1NIFA 4NYLB 5EWIL 4YPJA 3K1DA 2FJGB 5C1MB 3QDHA 3QQ3B 1F86A 5F3HA 3D8MA 3NCBB 1A1MB 4A7SA 3V4PA 3WEXA 2YGVA 3TT3L 3L3JA 4ERSL 2GPZA 3L9BA 5KOVC 1P9MA 2EXTA 1MEXL 3VM5A 3SDCA 4OFDA 5D6CA 3F58L 3UC0L 5K69A 3REWA 3QZBA 1A1NA 1YPZF 1Z5YD 3GMNA 4KUCF 2Y6SD 3H8NA 1I9JH 2BFVH 3RB7A 3WL9A 4K4KA 2V37A 3VFSB 4IBYA 3GXMA 4PS4H 4O2CA 2M26A 3IXTA 1T0MB 4ODBD 3VFWA 1NA8A 1AE6H 4LSUL 2M1KA 3D0LA 4L1TA 4MAUL 4V2BA 2CE6A 4CUCA 5BXFA 1LO4L 2MCG1 1E7VA 5F44A 1X5IA 4HS6B 4OGYH 3VAEA 1UXSB 1I53A 4DZBA 3QC5X 1J5DA 1RUPH 1T4WA 2HFGH 1AP2B 1JZ4A 1NMBH 1SMAA 2PCFA 3BFQG 2QVKA 4LCCA 3BWSA 3ZHDA 2PO6B 2QQQA 1MCWW 3PXHA 2IALA 4YHPA 4LDEB 1JMXA 2CR6A 4HU8A 4AKOA 5E9AA 3F65A 4K9JA 4JVPA 2R0LH 5DHVH 3MJ9A 5DJ6A 3P77B 1XB3A 2O1AA 1R4XA 3QQ9C 2VKWA 4G82A 1P5VB 2AXGA 5FDWB 1IEHA 1DQLL 3HMXH 2UZXA 5C0AE 1VA9A 3OV6A 1RIHL 4AYEC 2OKMA 4X99A 4MA3A 4YMPA 4NHUB 3GJFB 3MA7A 1NKOA 2VLKB 3QIUB 4LASL 4QNPF 3WS3A 4N2OA 3M8OL 3IBOA 4R0LA 5LDSA 4WNSA 3BAWA 3DX1A 1QEWA 1JZFA 2P42B 4WO4A 4ZNCD 4OIIH 3JV0A 5DK0B 4L8SA 3IGAA 1U95B 1N8ZA 2VDLB 3W9DA 4ZPTB 4BH8B 3NZUA 5GZOA 3O4LD 4KZEL 5KVGH 3I50L 2XQ0A 1D2PA 4Q6IC 1DDHB 5JW5A 3UIYA 2ICES 1OSYA 2A73B 2LLNA 4M1CD 2OSWA 3VI4E 1L9TA 1NCBL 3H4FA 5T1MB 3CBJB 4E42A 3KLHD 1RSYA 3KD4A 4XBPB 4EXPX 2Y69B 4CMHB 1MCNA 1MLBA 3BJ91 2R0WH 1AKJD 3IPFA 3OF6D 4PJDA 2L7JA 1HSAB 4H1LG 3L4VA 4P2QA 4AEHH 3RYMA 3PP4H 3U2IA 2R69L 1VACB 3QBTB 3EKCA 1THCA 5AKTA 3EHBC 4RBPK 3MNMA 4UM9A 1KCSH 4OGAC 4XWOD 4NRZB 1EZVX 1H3UA 1KTDA 4M1GL 3RFZA 3BRGC 3NGBB 4PRBA 4G5ZH 4IGBD 3TLRA 4JO1L 5FYKH 3UO8B 2D7PA 5CILH 1D5MA 1DBBL 2VABA 3NP4A 3NSXA 5ETUB 3RVUC 3DX7A 2H7WA 1HH9A 4M7LT 1QTSA 3N1FC 1DBAH 1MJ8L 2WWMC 4HUWB 3VYPA 1HHJB 2YO3A 1CO1A 2GEEA 1YECL 3MUGB 2DI8A 5CJQL 1UWGH 2K3HA 2VITA 3L4ZA 5CUSH 1U3HC 3WN5B 3L1OH 4ZTOL 2Y23A 1NGXA 1CQYA 4NENA 3L4YA 4HEME 4AW7A 3QRLA 1HFUA 4IHBA 4NRYB 1R3IL 3GSQA 2WXKA 4X4ZA 4JO3L 5IHLB 4ZFGL 3OSVA 2FWLB 3Q06A 1JBJA 4D0CB 2X42A 3S5YA 5EB9A 1W0WB 4PLKC 3LQAH 5C8JB 5C6PB 1MVUB 3MNZB 2WK2A 1UB5B 3DIFA 3VXPA 2X3CA 4GAJH 3G6DH 2MIZA 4DW2H 1GS7A 1DVYA 5EZJB 1A6ZA 2XI9A 3DWTA 1EAPA 3SJVE 4MVBC 1MXGA 2ZKHH 4KNTA 4YSRA 5DMKB 2Z3FA 5JA8B 4Q9RL 2VRAA 4P48A 3GSNA 3EH5B 2BVOB 4BZ1A 1FGVL 1SDDB 3NCYS 5FA3A 2G9HA 4P5MA 1HZLA 3RPKA 3PWNB 1PAZA 1FFOA 4CRPA 3QUKB 4GLRI 4G5AA 3BC9A 2UYLA 3BH9B 3VSUA 5E4AA 2NSQA 3WFEH 4GLRH 2J1XA 1AO7E 3ZDYB 4HFUH 3SGKC 3U7YH 1YNLH 4JG9A 1IRAY 2J71A 1F00I 1FYHB 2HUEA 4FKEA 2GJPA 1K4DA 2YPLB 3ARDD 5LBSL 2KBGA 3MRFB 5FCSH 4I3RL 4OGZA 4KV5F 1T04B 2FE0A 2G2RA 3W11D 3OX8B 2BIOA 4L0PB 2HT2C 3HI5H 4GKLA 4D8PA 4N0RA 1ACCA 2J21A 5HHOE 1LD9A 4NUGH 2P8LB 2VE6A 3WIHL 1XGRA 2O4EA 4U33A 1TTFA 5C0ND 3T4AC 4FS0A 5KVDE 3IMBA 5DLLA 4LLVA 3ZE0B 3QORC 4YIQA 1TJGH 5TQ0H 4AQ1B 2B59B 2AJ3B 2HKFL 4GRLC 3RY6C 4EI5D 4YSQA 2GABA 1CGUA 4LVHB 1AYRA 4RGOH 2Q6WA 3MUHL 5DFTA 4YS4A 2J20A 3CZKA 4DO4A 1IO4C 1BBJB 5DS1A 5DLMH 3SKJL 4GQQA 2VH5L 4ZI8A 3OXSB 1N6QH 3ZDXB 1UD8A 4FQQB 1BPVA 2JI2A 5EUOE 4FTVD 1HL9A 1HJCA 1OB0A 3DK2A 1O6TA 1LYQA 3JV6B 1MH5A 5IB3A 3CFIC 1WCBA 1JFHA 3HZYA 3MA9L 2D73A 1DN2A 5I1EL 4GKZB 5GS2H 2HVJA 3KXFB 1MI5A 1LO2H 4LSTH 4PRPE 3MBXH 5D93B 2D7QA 1CGVA 1FFTB 2PXYA 1BZEA 4N1CA 1BAFH 2VDQB 2OW6A 3ECVA 3HN8A 4IDJH 3C9NA 2CLVA 2OK0H 4A2GA 3QR2A 2N7SA 3RPBA 1YYLL 2PWHA 4L48A 4UOJA 3SN6N 3QDJE 1M71A 4L4TA 1WZ1H 4KKAD 1Q0EA 5K33A 3DX8B 3B56A 2P5ED 1ZA6B 3HUJA 3KDMA 4DP8X 4FFWC 4AIZB 5SWSB 1HE8A 3D48R 4KXDA 4LLUB 2F58L 2YAEA 3ARWA 3B9KD 4M6NH 1Z32X 2R1YA 1S9KC 4X7SH 6FABL 1MCKA 4DN4L 2CRYA 5D7IE 1SOKA 3NEEA 4LEOA 1FFRA 4MX7A 2J8HA 4K71C 5J3HD 2GBUA 3N0PB 4U1HB 4G1EA 4AJVA 3B8SA 4JB9L 3S3DB 1PX3A 4FG2A 2PF6A 3IDNB 4ZMZA 4XN5A 1F56A 1P4LA 3W39A 4YE4H 1FLRL 5LJYH 5EZIH 4ENZA 1FZJB 4LCYA 3VXRD 4WFGD 5C92A 3EAKA 3FCTB 2HT4D 1NEZG 3MZTA 5D8JL 2NCEA 3TWCH 3NG5A 3GHEH 1SBBA 2EACA 2YJQA 3QXDA 4KI5F 4U6XB 1YC8A 1DQTA 1I1AA 4P5TA 3LN9A 1MWAL 3BX7C 1N7ML 2N01B 4M61B 1DR9A 1OM3L 3ZDZE 4J3SA 4A55A 3UL4A 4QYOB 4UQDA 4OFIA 4WF7A 1RZ7L 3MRMA 1I1YA 5ISZE 4PV8A 2FATH 2QGEA 3M86A 5IZ7A 5MEQA 5IT2H 1FAIH 2V5MA 2JE8A 5EU3A 3UZVA 3CHSA 5EO9B 5D1QC 2XWTA 4S0SD 1AXSA 1NM9A 4XTRD 2WINA 3E6HA 1TKWA 1HYRC 3DRQB 1BCIA 2AQ2A 2LT9A 4OUUB 4QOKA 4Y1AE 5IM7B 1BLIA 4Y4KB 3Q1EA 2NY3B 5IESH 4LCVA 2BXZA 2AF2A 4I0PD 4HH9B 4P2CG 1VRSA 2QBWA 5DJYB 2V7HB 3QDGD 3QEHA 4PWIA 2DMGA 3TZVC 3HS0A 3RNKB 2ADFH 2DWEA 3WLBA 3GHPA 1NLBH 1MHHB 2MCAA 2MPAL 2NR6C 4UQ3B 1NAMB 1NC4A 3A24A 1AAJA 4I1NB 1CXKA 2D7NA 2HRLA 3CFCL 4YHYC 1SY6L 2O61B 35C8L 2OXGB 4RISL 2VLLA 2JMRA 4K5OA 5GZNA 4PRHE 4WJ5A 2CH8A 3R0MA 2J5LC 3BW9B 2D7MA 4LPCA 4H8WL 1CQKA 4NQCD 5F7HA 2Q7YB 5KYUA 3KLKA 3IMUA 3V0EA 1ITBB 1PD0A 2K8MA 3VXMB 2CBQA 3D18A 3IJEB 3QZNA 4G8GD 4KGLA 4HIJB 5F71A 1I8KA 3PGDB 3ARSA 2W92A 3O2VL 3SBRA 4ONFL 2BX5A 4X7TA 1Q1PA 1LEGA 1AVAA 3QRGL 2Z9TA 3H42H 4FLRA 5DEJA 2WXQA 3D34A 2YA0A 1BWMA 1WQVT 3MV11 2A6JA 4JFDB 4TRPL 2XACC 1OAZH 2J55A 5KVDH 5EU6E 1M3JA 1V10A 5K93A 4JRXE 4HSAC 3GO1L 4ZO7A 1W72A 1AHKA 4HWZA 4FP8L 4F91B 3FQXB 3HMWH 4OQTA 3SDDA 1WAAA 2BMKA 4PJEE 2E47A 1OT1A 4LNRA 2OX5A 4TULH 4HLJA 4P3CH 2PNDA 1QPXA 2VZ3A 3F00A 3H85A 3P0YL 3VMNA 5I1JH 5LGJA 2AAAA 5HHME 1X44A 4EKXA 5I6KA 2F5AL 1KT2A 4XCNB 3EDJA 3IDIB 2JKWA 1RUMH 2ZYRA 3FTGA 3GHBH 3VWKC 1IC7H 5IJCC 1JK9A 1MFDL 1EGJL 3ROOA 2NYYD 2OJEB 1YNTA 2ATKB 3SDXE 1MW3A 1S7SB 1G7HA 2Z93A 3CSGA 3MDJA 3OKMA 4H8WC 2GIXA 4UDUA 1IC1A 3Q6GL 4JFEA 4OLZL 4DKEH 5IHWA 5IQMA 1RUAH 1LK3H 5J13B 5JHLA 4OI7A 4G70B 3EH4B 1QSZA 4ATWA 3KYOB 3FH8A 1E4XI 5GGSA 43CAA 4DK3A 1B6DA 3NA9L 5A16B 4XBEH 1YEDA 1YEIH 3D33A 4H8UA 3AU1B 2ESVA 2DM7A 4IBZA 3O2DH 1Q72L 3ETBF 5IREA 3CFBB 1IGMH 3KGTA 3X3GH 2FECI 1KEML 1CFMA 1SEBB 2X7LA 2YXVA 1UJ3C 3FSVA 4PJCE 4O9HH 3TBBA 1AHWC 2AEQL 3WSQL 5DRNB 2QFPA 3OR6B 4JJ5B 4IKNA 1ROWA 1WFTA 4ZQTA 1JF5A 5DUJA 4FQCL 4OZHB 5T3ZL 2BC4B 4R7XA 3O41B 1XF5B 1EEZB 2TAAA 1M7XA 1AGBB 5AOLA 3TJHC 3VQLA 1XCTA 2IGTA 4I48B 4WSKA 1LDPL 3MROB 1QR4A 1KCRL 4LP4A 3CVHB 3EOBA 3QUGA 4KKRA 1I1FA 4MCZB 2DH2A 3W82A 4HWUA 1OF2B 3QRFM 1G9HA 4KTDL 3DYOA 2OTWA 1F4XL 4AWJC 3H3PL 5JMRA 4N87A 2F54E 2IAMD 3KWWA 3EFFB 4MAYD 1JRHI 1VSCA 4FAAB 2GT9B 2KS0A 4OFYD 3EFDL 2IANB 2ZUYA 4ZPVA 2C9SA 3MUJA 4QJ4B 1EFQA 4K0OA 1IQDA 5C0EA 3VFRA 3ZMNA 2ZNWA 2AQSA 1WS8A 2Y5EA 4X6BA 2PWFA 2CCLA 4IOFD 5AZEL 1OQXA 3UZQA 1NDTA 3U9UA 3AW5A 4C8XA 5KYWA 4HPOH 5IQNA 1DBKH 2D03H 1SHMA 5TDNB 2NSXA 2VR4A 2AQTA 5ICZA 1UWEL 2XQBL 3VG0H 3ZBMA 5IG7A 4JUSA 3QZMA 4K3DH 2AI0L 4DVBB 2NTFA 5CD5C 5T3XE 4UINL 3SZKC 3P11L 3QJFA 3CMGA 3BAKA 1AQ8A 1IM3B 2G5RA 1KDJA 3N9GH 2A99A 2J8UA 5JQ6H 1MAML 5E1GA 3I9AA 1PFOA 2AQ1A 1AZBA 1QBML 4DVRL 4PJGE 1J9QA 4PG2C 5BUGA 4OKVB 3AUVA 3HS8A 2VZ1A 2ARJB 2X5PA 1BZ7B 1FFPA 5ECJE 2CXKA 1OD7A 1G4MA 1EJ6A 2JB5H 5EOCJ 3MV7B 3HC3H 4PLJC 1YPZA 2Y2WA 4DP4X 4P9HC 4PJ7A 5GGVY 1CURA 1LNUA 3K0YA 3X12B 4OJCA 3ARBD 4PRID 2GJ6B 4LGSB 3M6DA 1HCVA 5DFVD 1KY6A 5EEVA 1BEYL 4RQQB 2A7BA 5T1LB 3VRIB 4HUXA 1U8CB 2LW3A 4RZCB 4KITB 3SZ6A 3QIWD 2JJVA 5CBAB 2Z65C 2WLJA 3HAEH 5FWQA 3QUHA 1NFKA 2GBTA 5HGAB 2WHVA 2DBLL 3FQRA 3V4VA 2K9FB 4XOCA 2IXQA 4YH6A 1PU0A 4ZZKA 1ACZA 2X12A 3PAVA 2Y25A 3KW8A 3SKOB 3DDFA 5CGTA 3I9IA 4HCIA 4B5ZA 1CFQA 4HOMA 1AANA 2DZEA 5TPWL 3BLPX 5EEZA 4DFIA 3QPQD 3A6CH 4F2EA 2V7NB 3TIDA 4KK8C 1KJVB 1A0QL 5CJOL 4F7CB 3DVGA 1T6VN 1CE6A 4KROD 1S9WA 3MRLB 1MG3C 1QZ1A 3PXLA 4NRXB 3U9WA 5KUMA 3LKNA 4GRWE 1WISA 1T20B 3MCG1 3AM8A 4FNQA 4K3JH 3EBAA 2DH3A 5EPMB 5BO1H 4MS8C 1BF8A 1IGIL 4HMCA 4H2CA 4N3TA 2MHAB 2DJMA 2UXVA 4JFQA 3WIAA 5B7EA 3VH8B 3E9TA 4E68A 2XIIA 5D4QA 3WENA 1AJ7L 2X89D 5AALA 4D9LH 4PREA 2AJVH 3QJOA 4UWQB 5FO7B 4Z95H 2OTPA 2E59A 2AABH 4LNVA 4NOFA 4PJBE 5E4EB 4AUJA 2OMYB 3T3MF 5D4JA 4Z0BH 2VLJE 3MSPA 3UTTB 1KB9K 1QBLL 3LNGA 1PZ5A 5H94A 1LO4H 4KHXH 3VRLF 4DP6X 2P80D 5JA9A 1RJLB 4HIQA 3CHXA 4HK0B 4LDCA 3VXSE 2QZQA 4LHUA 1DN0A 5BVPL 1FE8H 3NH7L 3DBSA 1NZRA 1YAZA 2JTDA 3O8XA 1IIIA 3Q5TA 5BRZA 2GJZB 2HT3C 4P05A 5EEUA 5A2IH 1VEOA 2CPCA 1N19A 1CYWA 3HFML 4RAUB 5E9NA 1P2CB 4P4KB 2B9BA 3QS2A 3GZKA 5DEZA 5E2VL 4DKTA 5KVFH 3QUYB 3GKWH 4HJGA 4NGHL 2H0FA 2W9DL 1E65A 2P47B 2V3FA 3AXHA 3KEDA 4IYKA 1DQLH 2YMXL 3BLBA 2E75C 3HR6A 3KNBB 4YGVA 1X5LA 4J3OC 4KRPD 1E5AA 1QNZH 3G5VA 4YHYB 3AQDA 4JFSA 2IDSA 2CMRL 1P4IH 2HTLD 4KMQA 4QXTA 5KW9H 5T1KA 3W57A 3KYMB 2BNQE 3FCSB 3M1BB 4NIKB 1H0DB 3UMNA 4WI8A 1PZAA 1BWWA 3TFBA 5BCAA 4JLRA 1PIGA 5GS1A 1SFHA 3Q05A 3FU7A 3VFOB 3C08L 5D7KD 1F58L 2HYMA 2CLZA 4RX4A 1NAKH 2DICA 1M7UA 4Z9KB 1BXAA 5ADPL 1AMXA 4MJHA 4QRAA 1BQHA 1REIA 2NY5L 2A9AA 1QFPA 2X88A 3ORJA 4S11A 5IVZA 5E51A 3VFVB 3D0VA 1R6VA 3OZKA 1YY8B 2QQNL 1N6UA 2VOTA 1XXDC 2QZ5A 4F2MA 3KZ8A 2EYRA 5D1QE 4QF1B 5GRJL 5I17B 2L7UA 4OV5A 3PHQB 4HCRH 1Y0LB 1M7IB 3BDYH 3DTXB 4QRPD 4CJ0A 1GAFH 5I74C 2ZAGA 3BSZH 1JGLL 1ZD6A 4WI4A 2X2YA 3NJGA 3KG5A 3GSWB 2W9EH 3BP6A 4LPXA 5KS9B 3OLGA 4CDGC 4U1MB 2OMVA 4Y89A 5T3XH 4YFEA 4YR6B 5DZVA 1H3PH 3AY4A 4XZ4A 4NQDD 1DJGA 4GEJA 2QV4A 4MJ6A 1EXUB 4X9YA 2DMBA 5FLUA 4AENA 3PYCA 3R8QA 4JPKL 3DROB 3S4SA 2RIKA 3OAUH 3ESNA 3REVB 4LZKA 5DZJA 3QP3A 5D1ZB 3W2DH 4KJPD 4ODXB 2NNFA 3FK3A 3OJDB 3TX4A 4ZO6A 3GB7B 3LPGA 4FQJL 3NRPA 4HQQH 5J12C 5I8CA 4NI6A 3BUIA 3E1ZA 1OCWH 3CG8A 2ZXEB 3RIKA 1UZ8A 4R97B 4XX1G 1AS6A 2NY5C 4KPHL 4ZUTB 2JQAA 4BFIA 3WD5H 3P2TA 3WJLC 5GISL 2OXHA 4E9YA 2FBJH 2WWNA 3GI8H 1VFBA 1Y18B 3BO8A 3MNWB 1YMME 4HDIB 4ODWB 4RRPM 3IE9A 5BNXD 5JPMB 2WXGA 1UB6A 4Q4IA 4I88A 4MJIA 3GEFA 4IS6B 4LL9A 4U2ZA 2YRLA 3SOBH 5FIEA 3MLYH 2GBVA 4UUJB 1U9KA 3PG2A 1EEUA 1BBDL 4UM8A 2FL5B 5ID1A 1ZVYA 1EPFA 1A3RH 2DLFH 5B1JC 1OW0A 2K6WA 1A02N 4K15A 3RWEA 5JTWA 5HYIA 3C6LB 4JDEB 3F7QA 5BUAA 3KPRB 4WKXA 5B4MC 5ITFA 3QUXC 4Y5XC 2NY4C 2J72A 3MMEB 4NAMA 4TUKH 4TQPA 3DX9B 4A2DA 2UY7A 5T33L 4OQ1A 1QLFA 4IQHA 4Q4EA 1E6JL 5CR8A 3GBMH 3HE6C 4ZAKB 2KDGA 3GSVB 3I75B 1XH3A 4OCSL 4GP5B 4TUOA 4XBGA 4PQXA 3HFFA 3MODH 4JJOA 1C08A 4WGVB 3T4YB 3D2UB 1RAMA 5C09D 4GG8B 3WMPA 5AW5B 4A7UA 2Y5QA 5T5FL 1Z0MA 2A6DA 2AXHA 4ZMXA 2KQNA 3WTWA 2OULB 2GSIA 3CVCA 3R1GL 1FNFA 4EAEA 3MJ6A 1YDPB 4LQ1A 3FT3B 3EJRA 3OMNB 4LL4A 5CINL 2HJLB 1A7PL 5J5EA 2Y3AA 1CXEA 1SM3L 3QC6X 5CSZB 2BDNH 2VR6A 4U7MA 2LABA 4RMBA 4PGDA 2EKSA 2AAVA 3T2QA 2WUCL 1MOEA 4O4YL 3BN3B 4PD4J 2J2ZB 3V79C 3FFCD 2EYSA 4ZK8A 1ZLUK 5H4ZA 5HHQB 2X4TB 1OEZW 1K5NA 3TNMB 4RLDA 2PYFB 4OZFB 3LZFL 2ZOOA 1S7XA 3D4CA 1QP1A 3G6JB 4H0IA 3ZTNH 4RZKA 2JQMA 4OM0H 1UXMA 2BO0A 3VI3B 5KBMA 5D6DA 4X7CC 3RWJA 3L9YA 2EC9T 2KH2B 3KPPA 1CFSB 4JG1H 3QYNA 2R0KL 2NW2A 3D39A 5ENWA 2JIXB 4RMRA 4XNZC 3D25B 1YO4A 1CJYA 3GUTB 4Y88A 5FM8A 1K9TA 4PJFE 2CDGB 2P24A 2ZX6A 1HILA 3BVNA 4N8UA 4QRSB 2BK8A 1BFVH 1XSKA 2WAHA 5JHDB 3WFDL 4JDVB 1J1OL 2E0PA 4LQFL 2WW8A 4X5XB 3EUUA 3FN0L 4M62L 4N25A 3LIZL 4K7PX 4EQ3A 4N6RB 4P4RA 5KTEL 5DT1H 2WYHA 1WGVA 3CDZB 3T6XA 1UT9A 1OTUD 3BKMH 2NQ3A 2B1AL 4KKBC 1QBAA 1FVEB 3GJEA 4H5SA 5FYJH 1MW0A 3C5SB 4M6AA 1DSFL 4JQVC 4IIQA 5EBLB 2RJMA 3K72A 4L3EB 4PWFA 4KZDH 5DHDA 5T3ZE 1QWHA 3GEWB 1J86A 3DXAD 4M3JA 2P26A 3O11A 1RZPA 3OHXB 2CA3A 2BHZA 3MX0B 4EDXA 2C1OA 3QK0A 4KRLB 4KQ0A 4NQVB 2AV7B 4QYAA 3ZE1E 1VPOH 1YJDC 4JFFD 1KB5L 4N2AA 1U8IA 2XN9B 4TSCL 5D9SA 2VLRD 5F6HI 1J0ZA 3QPXH 1MN4A 1G7LA 1YEWA 3D87B 1X7QB 2RFXB 2AERT 4NKMA 4NQED 5LQBH 3V5HB 2A1WH 3LQZA 5E4OA 1B2WH 1AR1C 3W81A 4HWBL 1BW8A 4AH2B 3BQVA 3MZGB 4N1HB 1QSFE 1OM3H 4QJ3B 4LCIL 2DQEL 3JYCA 4RMUA 3KS0J 5E9DD 3V0IA 3GIVB 4QTHA 1KEGL 2BP3A 5G4OA 3GMPA 3OPZH 2IIJA 4KK5C 4RSVA 4DAGL 2BNRB 4H1LH 4X6FB 2E6JA 4F93B 2L4OA 4UV7H 5HYSA 2A6KA 3LKRA 2B5IC 2CPUA 4B53A 2WVSA 1DQMH 1JHLL 1GIGL 5KANG 3KYKH 3U9PL 1PMYA 3ARGC 3UBXB 5DYFA 4I2XA 2LHAA 2YUVA 5B3JF 2ITEA 3VU2A 1T5XB 4IRZA 3LEXB 4X8GA 5D4IA 4A2EA 1VZIA 4WHCA 1BOGB 1RVFL 2I9LA 1I8UA 4F5CE 4P23B 4JN2A 2OMWB 1BVZA 4LAJH 4L29B 1PKQB 5DO2C 2VXQL 4FZ8L 3IKCB 3S9DB 4R5XA 4N90D 5IF0B 3S5LG 4CMMA 5FKAA 3QI9C 4R26H 5E2TH 5H37A 5JW4M 4JY5H 3FAWA 3KPMA 2YD4A 4PJIE 1MWOA 4AQOA 3KGSA 2VM3A 5DUBB 1FP5A 1ZT7B 5F0PB 2EZ0D 1UD4A 3WS6A 1EDQA 2H9GB 3MJ7B 4CAGA 3ULVD 1OTTC 1CICC 5F3BA 1NBYB 2BSED 2ICWJ 1R34A 5DI8B 3S98A 1IM9D 2DQDH 4P3DA 4LRIC 1FLTX 4JO4H 5A1AA 5AVZB 4AYDC 3B9KA 4NLAA 4ZXBA 1A4JB 3FPYA 1CZ8L 1KTCA 1D2OA 1RIUH 4MLIA 4TSAH 5CM1A 3NK3A 1LEIB 1A14L 2Y6TE 2D8KA 3GO1H 2YEZB 4QTIH 1L7IL 2WGXA 3TBYA 5F7EH 5E6SB 4UYQA 2PMZA 3SO3C 5E5RB 3BKCL 4YX2L 1KLUA 5KVEL 4KRMB 3SHSA 5F8RC 1FHNA 1KBVA 3P4MA 3BPLB 5A43C 4XMKL 5DHVB 1QRND 3SGJA 4WTWA 5TQ2H 5JIIA 4EN3D 3MLZL 2AHIA 1OAYH 2HN7B 2JJTA 2OMUA 1QOKA 4QEGA 3PWUA 3VXRA 4GSUA 3DOIA 1FG2B 1HN1A 1U58A 4PJ8D 4PY8J 4UYPA 5I6NA 2ERJC 3FQYA 5AVSB 4X4KA 5F7YC 1AGCA 2DWXA 2XUWA 1CDGA 1KPVA 1XIWD 3EO9H 3KJ6L 4KOBA 4TQEH 1HDMA 4MZRA 1MFDH 3ISWA 2RQEA 5IB1A 4PSPA 2OLDA 1A47A 1J18A 3EJZD 3H2PA 4NSKB 5SWQB 1EEYB 3RA7H 3ILDA 3RDJA 3SCMA 5IQOA 5EOCH 1JYXA 4WEBL 4WY7H 4IM8A 1U6AL 2ZCLH 3K91A 4K9EH 3U46B 3EYOB 3OG6B 4WKZB 3L5WA 4XPHH 3TEXA 3WKNA 4O02H 1S7UA 2A77H 3ZDYF 5ADOL 2OI9C 2VZUA 1TSRA 2FR4A 4Y5VA 5IJKC 4QHLB 3EG9B 3FSWA 2MMXA 2PPAA 1DUYB 4JHAL 3RLSA 4MD4B 3FONB 5F1NB 5ICXB 5EEWA 2DYSB 1EANA 3F64A 5AL8A 1PD1A 1AHMA 1BD2D 3QWQB 3T2NL 3THMH 1BVLB 2RR3A 4A38A 5FYKU 2GFBB 5FO8B 3CDFA 3B9VA 2ZSVB 4NERA 4NZTH 3CXDH 3RVTC 2Y5TA 1EMTL 4BEIA 5E7BA 1SLXA 2WWKT 3QW9A 2K7QA 4XVUC 5DS8B 4CNIB 3OLEA 5AWNL 1JG9A 3B6SA 4KZCA 1FNEB 3U7WL 2H6UA 4HJTA 2IBBA 4JFXA 4MRBA 4OLYL 25C8H 2QSCL 3UIZA 5F6IB 2X53A 1BPLB 2X6VA 3ZDXF 4JFOB 1TETH 5SV3A 5I2IB 5HDBE 3MLRL 5L6YH 1BIIB 1X4XA 2GJRA 3K6DA 3F7VB 3SE8H 4X80L 3L4TA 5F9AC 4CC1A 1OGAB 1SGKA 4XNBA 5D7SL 3GBEA 5IFAL 5ESVA 4QHMA 4AXWB 4KMTL 1EZUA 4J3TA 2FWOB 1QFUL 3OJVC 3R4RA 4PRAB 3WYRA 3U0WL 4WNQB 4E41A 4KY1H 3IDUA 1I8IA 5MEND 1WEJL 4XCYB 3MHZA 1DLHA 2H1XA 2M8XA 4NP4H 5CLXA 5KSAB 3O9WB 2XKSA 1XR8B 2WB7A 3UTPD 2WV3A 3C8HA 4GBXA 1HQ4B 4JREB 5I66B 5E8PA 5J4MA 3AACA 2BS8A 4IBQA 2WZ5A 3K0WA 1THAA 1MAJA 2IGFL 3NEOA 2WQXA 2VN4A 3MYZA 2XTJD 2A9NL 5J9PA 2Q3AA 3K1KC 4G11A 5GJTH 1R46A 1OO2A 5IW3A 1ZKAA 1W2KT 2QHRL 2R1WB 1NGQH 4KK9C 5KSBE 3QJHA 4GAYA 5JNYB 1D9KC 2ATPA 1I7RB 2IOOA 3Q44A 5AAMC 3V6OA 4JR9H 3C5ZD 2CKNA 2I26N 3FRUB 4YNYA 2FX8H 5I8EA 4KQ3L 4ANXA 2X4QB 2AMGA 2V33A 3H9SE 2PWDA 1K2DA 3TPUB 3UX9B 1FH2A 4DQAA 3D85D 1SYVB 4EIZC 4Z3JA 2H3NB 4DGIH 4JHBA 3GDCA 4UTBA 3K3QA 2R2CA 3ML9A 3EZ8A 3HRZB 4MNQA 1DCLA 3WEMA 1EAOA 3FB7B 3VD2A 3K2IA 2BSRB 4IBUA 1L9NA 1DJHA 4PJ9B 4BFOA 4QY8A 1SJHA 2B14A 2WBKA 3NESA 1EK3A 1D5IL 3HPJB 3PQYA 3V0DA 2RHEA 1NEUA 4D3CH 2KPNA 5FM5O 1VKXA 3A6BH 5A2KH 2C9PA 1C1EL 4MMZA 4MTMA 4GUCA 1KJ2L 3X13A 5C0GB 2DTMH 5C07B 2B2XH 1IGIH 1ZJAA 3VGGA 4U6TA 4V1DE 5LGKA 2X6CA 3OMZA 5FLVA 1VLXA 4R83A 2V17H 2YEQA 5C0AB 2DI7A 3GMLA 1FC1A 2WXLA 1KGJA 3FB6B 3IF1A 5HI5C 4H25B 5JIKA 1AR1B 3N04A 4J5VA 5AOIA 1X5FA 2WBJD 1YQ2A 1G7IA 4OFYA 4OAWB 1NWPA 2P3YA 1F6AB 1JDAA 1LTXA 1I3GL 4XCEB 3IDJB 4GW5A 4W4OA 3DX6A 3EYVB 3UBGA 4HPYH 1G1OA 3SGDH 1FSKB 4KKLC 1R5WB 3GMQB 5E2JA 2ORBH 4Z23A 1M1XA 2COVD 3L5IA 4JPVH 5GS0H 2CRIA 1INQA 4MNGA 3UAFA 7FABL 2B5IB 1IBYA 4R3SB 1DANU 3FN3A 2YBRB 3AB0C 2CJSA 3L9EA 2EIDA 2XV3A 2Z92B 1HKLH 2HJFA 4PJAF 3QUZB 4A6YH 4M43H 3QDAA 1A9BA 4NGHH 4B97A 2CK2A 1MQ8A 5DVOA 3NJNA 4X4XA 4HUVA 2K7PA 2EYTA 1IJNA 1YEGH 4G42B 4GS7B 3MRDA 3HNTH 4RGMC 1R0AH 1BECA 4WW2C 1DSWA 2EIZB 3IJ7A 1RCYA 4LOVA 4ODHH 3ZL2A 4MJ2A 3RL2A 3LB6D 4JG5A 2F53B 1A1OB 3QI9B 1IGFH 2JWYA 1F8TH 3MRNB 4YZFE 5I5MA 2WZ6A 1QYGL 1TR7A 4AQAB 1EXGA 1L6PA 5IIEB 1MHPH 3RWGA 3WNOA 4RMTA 2AJUL 1MKFA 1S5HA 2IPUK 4LLAA 1CD1B 1Z9OA 2ZOTA 4HV8B 3M17B 5ADPH 1RZ8A 2NY5H 3GK8L 2OMTB 5EC2B 4ZW8A 1OAUL 4DEPC 4BZ2L 3IJSA 2VL4A 4PUBL 3TP4A 3T0WA 4PIBA 4X6CB 5SX5K 4NXKA 4MSWA 4NO2A 3P4NA 3OC8A 3MV9B 2Y7QB 4ZX5A 2BIPA 3TO4B 2ZWNA 3DO4A 1ZHNA 5T1DL 2X1QA 2JB6A 4LLDB 3IYLW 2HSIA 1ND0B 5A7BA 4XNUL 5IMLB 4N0UB 3O6FA 4KTYA 5IJBC 1FL3B 3MRIA 4P59L 2F74B 3ARFA 4IRSA 2XG5B 2WQ8A 4AK2A 3GGWB 2YD5A 1IT9L 3WKML 2CGRH 4L9LB 1U8JB 3UCRA 1MREH 3FSOA 5F9WC 4A2MA 4CW1B 1XQ4A 1JZ2A 5DD3L 1V3LA 3G9AB 4NDMA 4OFQA 1YAIA 3UYRH 1E43A 1OAQL 1IARB 5IBTL 3AJ7A 3SJVB 1MFCL 3GXPA 3O4LE 3PWVA 4FI6A 1Y6NR 2BP5M 4XNYH 5JYLA 1F97A 1EHLH 4MA1B 1PY9A 2ED6A 2X4PA 2AFNA 3SDAA 3AXLA 3SYCA 2GTWB 2H3KA 4FQ2H 1CXIA 1GC1L 2ZJSL 3GNMH 1CDUA 4M7LH 4OZHF 4QWWD 2KI6A 4ORZC 1S7RA 1ET5A 1S9VA 1JV2A 1GYWA 1ZS8A 5IFHH 4KPHH 3RTQC 3UYPB 1T4KB 5AOMA 5GGUB 3FXIC 2QPSA 4HS3A 3BAEH 3LKSA 4Y4HC 4H8VA 5CSBA 4FLQA 4LP5A 2PCPB 1N5AA 1DLFL 5DD1H 1E50A 3FCGA 5CBEA 4IJTA 2ZUQC 4PRNA 3CFDB 4M02A 3UPRB 2TRYA 4QXGH 1E3FA 4UT9A 2X4UB 4WU5A 3DMMD 4XXDB 1SRDA 2LU4A 1XZWA 3A5VA 3FYEB 4HIIB 4IMLA 4JDZB 2ROYA 3MXVL 4X5WA 5EORL 1OQOA 1CLOL 1XWVA 1HYSC 5C0CE 1OOWA 1EHAA 3S35H 3MJ9L 5AVYB 3OZ9H 2VXUL 1Z3GH 3C60B 1ROCA 2BSSA 1WWAX 1UJTA 1VAHA 2XWJA 2G3MA 3P4OB 4QRUA 4Y2DD 3TV3H 4U1SA 2J56A 4N5EC 2XHNA 4NYLA 1R3LB 3ENEA 4OLVH 1AQKH 2AK4D 1GS8A 4RDBA 2FJGA 4XWGH 5C2BL 1Z9SA 3T65B 4HW6A 5B39B 3QQ3A 4UOW1 4XP5L 3QO0B 2JJWA 1A1MA 2E7LA 1B6UA 4XX1E 1GC1C 1P9MC 4S1QL 4WWNA 3TA3B 3SDCC 4F9PC 3QG6B 2F68X 3QHFH 5AW0B 3MLUL 3UAJA 3ULUF 2H2SD 5AL0A 1JP5A 4LCWD 4YDMA 4KXCA 5INDB 4H26B 2AANA 1IGJB 4G7QB 5C6TH 4O4YH 4WUUD 3UCQA 5AB2A 3NEXA 1XBDA 2V8MA 4IBVA 3CLWA 3E38A 3QFJD 1UASA 3KS0H 3VFSA 3Q2VA 1PZBA 5J1AB 3F6JA 3GXIA 1U0QA 3O4OB 4OVUA 4AIOA 1MELA 4UU9A 5HXMA 1Q4NX 5KVEE 4FJ6A 1OPGH 2I24N 5J57B 3MRCB 1X5AA 1ZIBA 4HS6A 4LCCC 4Q6KA 5TGBB 1UQSB 5JZ7D 3D06A 3FPXA 1TQVA 4GY4A 3MLWL 2N56A 3HI6H 1KBGH 2YLHA 2ZOKA 1JE6A 1P6AB 3A67H 1SF5A 2PO6A 3AROA 3ZTJG 2LV4A 1RZGB 1CFTA 5D7IB 1M9SA 2VDRB 1MJUH 4IRJD 4TVUA 4LMQE 32C2B 4KFZC 4KKNA 1B4RA 3VXOB 1P5VA 3OB8A 4NNXB 1WZAA 5IW6B 4EOWH 3WKYA 2NY1D 3OB0K 4FFTA 1FO0H 5TH2B 4LAQH 3CDCA 2FSEB 4NHUA 4R0LC 5A2FA 4KKQA 3GJFA 4LQFH 2WXHA 4W9GC 2ZCHH 3QIUA 4WO4C 5EOQL 1KENH 1HHHB 3QHZL 1K6QL 2MOQA 1J8HD 4FQXA 4MHHG 4L8SC 3FUFA 5SWZD 4JRYD 1A6UH 5GZOC 3MRJB 3L3IB 5DK0A 3POHA 4BCYA 3VYOA 3ARYA 1UWYA 3CQFA 4KAQL 1U95A 1TQBB 1NCNA 1FIGH 4ZPTA 4FTVE 1IBGL 1G7JB 2VDOL 4QDGA 3VGFA 3ZQWA 5ANMB 4AC4A 3IETB 5ISZB 2XPZA 1QRKA 1FQ9C 1BA9A 1DDHA 2X1OA 2XA3A 3OG4B 5MEOA 1QFWM 3T71A 2OCFD 4HZAA 2XCMC 3IMRA 3LHPH 4U31A 1L9SA 2A73A 4HIXL 5EC1B 1JXDA 2CALA 3FT2A 3OGCB 5T1MA 1LE9B 4WHTA 4XBPA 4YC2B 3GSNL 1XAKA 5GGVH 5C0BE 4HJ1A 4PY8I 1HSAA 3TF4A 1SXCA 1V3JA 4BZ1L 3FUHA 3QG7L 1RPQA 1VACA 3O3BB 2Z7UA 2DWYA 4K23L 3RNQA 9CGTA 3RFZC 4A1RA 3SQOL 1M6UA 1HCYA 4NRZA 5BV7H 2JLPA 1N26A 2NXYD 4PRHB 3CFUA 4NFCA 1X4YA 4CVZB 5ETUA 4Z8FL 3IJYA 3RZCB 4OIAA 2B0SH 5DZLA 1XCWA 3DVIA 4K5MA 2E9IA 4G9FD 5HYJE 4HUWA 4BFRA 1LM8V 1HHJA 3ZGHA 3E0GA 1HZHL 1KACB 2YLKA 4OCMC 4Z7UE 3TVMC 2VW7A 3MUGA 4ZMWA 1ZANL 1F13A 4LU5H 5I76A 1P84J 2YD0A 4XH2B 4CILA 1DP0A 3T6QC 3HAEB 4RFOL 3EUDA 3N0AA 1KB3A 1AZRA 1GL4B 4Z7OE 3L4XA 4NRYA 1GHFL 3HCVB 2EEXA 4YLCA 2YK1L 3LS4H 4GMTL 1A6VL 4D0CA 3IPEA 4ELMB 1W0WA 1KV7A 4P99A 3IU4L 1JZEA 4PJ5E 5C8JA 5JHAA 3MNZA 5F7DB 1UB5A 5IHZB 3FUKA 5DVPA 1T83A 2XN0A 3UGUA 3SODB 5KS9F 4PJEB 3F6LA 1VEMA 2YSTA 3FC8A 4OF0A 3JVFC 4W9DC 5EZJA 1KN2H 3SPVB 3ILQD 4J2XA 4YDLB 4XXWA 5CLZA 5DMKA 2CIIB 4PTUB 2P5WD 1BV8A 3B7YA 3EJQA 3LMJL 4UCFA 1T2QH 3QQ4B 4Z7VE 3CN1A 3CNKA 4X8CA 4N9GB 5A2BA 3CFNA 4MA7H 4TN9A 1ZWIB 3ABGA 5HHVH 3FRPB 4Q9QH 1P5UA 2BVOA 4XMWA 4I3SL 1KTLB 1SDDA 1FNSL 4YHNB 1I9RH 2B4CH 1G0DA 3LXBA 4P07A 3DBXB 4TQ8A 5FW8A 1PBYA 3PWNA 3JV5A 3BDXA 2A9ML 3I74A 3QUKA 15C8H 4WK0B 3P4LA 1JXFA 1RZQA 1Q9KB 3BH9A 1CZ8H 3V8OA 2X2UA 2EIJB 3QDGE 4KKCC 4R96B 3IN0A 1GGIH 1ODUA 5F9WB 5FA4B 2RAMA 1HNGA 2YPLA 4WI6A 3U4BH 1AGFB 3CXHJ 1HL4A 2WOYA 4UAHA 4TVPL 3ULSA 4M5YH 3ECUA 1T04A 4JAMA 3GC3A 4NN7C 1OP5K 1CU4L 7PCYA 4I77L 1YN6B 3OX8A 3TFKC 3EJYD 4XMKH 3TH2T 4JFFA 2YD9A 4NQCE 4PJCB 3MLZH 3RP1A 3VXUE 3AVEA 2P8LA 4K7PL 1NGPL 2I9TB 2BZDA 3ZR6A 3KWUA 4LMQI 4HUCA 1WK0A 4G8GE 1Z9NA 3RKPA 4AQ1A 2AJ3A 3EBGA 3S2CA 3U6XS 4ES8A 3UAAA 3DIVA 1FYTB 4YBHA 2C4FT 5IVXF 1MNNA 3D4YA 2F19L 1BBJA 4I7ZC 5AZ2H 3H7BB 3SKMB 3BD4A 3BEVB 4X83A 4G80B 2NLJB 4JN1L 4P9MH 5DJXB 2EINB 4KH9A 1YEEH 1N67A 3CX5J 2ZUQB 4FQQA 2AK1L 4LSQH 3ZR5A 4I18A 2FIKA 4E2OA 1P6WA 2F15A 1TZOA 3VWJB 1KCWA 3JV6A 5I16A 2F54B 3ZJAA 4PBVC 2R29A 4WI5A 1MQKL 4YDNA 3TN0B 4GKZA 3WOVA 3WMSA 3KXFA 2PXYC 3B3BA 5SX5H 3LQMA 5CEZD 2AKRB 4TUJB 3CFMA 2OZ4A 2X1PA 4JO2H 3KGUA 1U3YA 2ZX7A 1J0KA 1KGYE 4NQTA 1DO6A 4FNUA 3V0VB 3B37A 3T2NH 2YN5A 5F3HB 1ZIAA 2EAEA 3VGBA 2MOVA 3EJTA 2HH0H 3V4PB 4LSDA 2YSSB 3WEXB 1F3JB 4FFZH 4QHKI 5E99L 3WTXA 1ZA6A 3VGAB 4AIZA 5SWSA 4EI6B 3R06B 2OBGA 4P2OD 5DGRA 4LLUA 1L5GB 3U7WH 5K39B 1WE5A 3SE9L 4K3HA 4UV4L 1QFOA 2O5YH 5IJVB 4FQLH 5CJ8A 3REWB 2LU3A 2X10A 2WXOA 1G6VK 1A1NB 2CR3A 3G6JF 4K55A 4PJGB 4X4MA 3S88L 2XFGB 3GMNB 3HLAB 1OKEA 5D2LF 2FWUA 1J0YA 5EF3A 3B2XA 3FT1A 5KYNA 1DQKA 2WSPA 3IMSA 3LDBB 3FCUB 3ZRSA 2R7EB 3WUZA 3D3VD 3RX5A 1ZJBA 3IDNA 4IBSA 1WC7B 4YEFA 4I13B 2IMNA 4WFHD 1OP3H 4OI8A 5TJWK 4LEXL 1ETZB 5K1JA 3WXWL 1AXIB 1X3DA 2FQDA 1F3DJ 3FCTA 1I1AC 1EX0A 1CD0A 1UA7A 3K8MA 4P5TC 1JZ7A 3DHJA 2Z31D 2ROXA 2IALB 1DVFB 1GMEA 3K2MC 1UKSA 3NSJA 4U6XA 2RH0A 2C9QA 4XP1H 2WTOA 2VDNH 1QUPA 5MERB 2ZYHA 4A2FA 5DJ6B 5CSGA 1A9VA 4JFZL 1URIA 4M61A 2R0ZH 5BS0B 4QYOA 1W72L 3SDYH 1SJEB 1M05B 1A7NH 2A9NH 3CFTA 5DC2A 4DN3L 3ALPA 3BQUB 5C6WH 3BPOC 2LGNA 1WAPA 5EO9A 1HWWA 3P30L 5J89A 4R0LB 5JIMA 4U0RB 5F0MB 3HBQA 2R4RL 3PL6D 4IBTA 3U30C 1QEWB 4OUUA 5IM7A 4Y4KA 3HS0C 4HH9A 5DJYA 3PWPD 1QX1A 2V7HA 4FGMA 1G7QB 2ZTBA 1FJ1B 4HAKA 3RNKA 2UWEB 3TJEH 1FNAA 3T1WA 1VCBC 1MHHA 2YWZA 1R3JB 3T8XB 5GZNC 1WZMA 1NAMA 3RGVD 3V4UH 1CF8H 2O61A 2XLLA 2OXGA 3EGSB 3P3TA 5JHLL 4GT0A 4NNPL 3BW9A 1IAIL 3AG4B 4W9IC 4G6AC 3ULAB 5GSVB 5KANI 1DL7L 5TE7H 4LF3B 1SVBA 3FKUS 2CSPA 3BZ4B 2IPTH 2NXZD 1T1WB 2DLTA 3K6SB 2W81C 4YDJB 1NBVL 3J2PA 3VXMA 1CGSL 3K2KA 1C7SA 4EMZA 3OAZH 4GUPB 5F8QC 4C83B 1W8OA 1X6LA 4JY6B 3PGDA 3TA4D 1V8HA 3K8LA 1CTOA 4XPBL 1ZK9A 2NY2D 3GJFK 5SX4I 3OC5A 2GW5A 1UUNA 3ABMB 3L3DB 4M7JL 3OVUB 1MJJB 2HKHH 4IBLT 4EPSA 4JFDA 4KH2A 1ADQH 2PN5A 3EO0B 2W1NA 5B3JE 1WF5A 3CZUB 3SDDC 3LRGA 1S8DB 3QIBD 5GGRB 4A2LA 4R7VA 2VXTL 2BNQB 1HT6A 2EUVA 3FQXA 5DCCA 2CK0L 2Y06H 2OL3L 2OR9H 3CZSA 1R5VB 1F4WL 4PB9L 3T0EB 2D9CA 1NCAL 4NM4L 1DBJL 5F7MC 5LGYA 3P3UA 3B5TA 4FMKA 5AVTB 1NIEA 4AMKH 3VD4A 1GW6A 2IGLA 4ZTPL 4XPFH 1NGXB 4RGND 4NENB 3AREB 4KO6A 3WEOA 4FERA 4GXUM 2VIRB 5TE4L 4D7BA 4U1KB 1C16B 1PTZA 5I23A 3S3SA 1T03H 4XCNA 4PY7A 3IDIA 5JW3L 3PGCB 4LVNB 5FYJU 2OJEA 5D7LA 1CLZL 4ZNEA 2N4IA 2ATKA 1SF3A 3RVWC 1S7SA 3A47A 3BGFC 1UD3A 4WWKD 5FF6B 4NO5B 4R8WL 1MFNA 3A4DA 4PJDE 3Q9QA 4P2QE 4OF7A 2EH8H 5D7EA 5LO7A 5HYFA 2CGZA 3APDA 3KYOA 2Y7SA 1XD1A 3FQUB 2X4SB 1V3KA 3S7GA 4EZKA 2FT6A 4FXLA 1FWXA 2FEDD 5ICUA 2X87A 5A16A 1OXYA 1TPXC 3AU1A 4Q74A 2FLBT 2XZAH 3GRWH 3B83A 4FG0A 4GAGL 2JI3A 3U4KA 5DDHB 4FLOA 2G9HB 4FZEH 3EOAB 5E2UH 5JW4R 5HHXL 3TYGH 1BIHA 1CBJA 2VC2B 4LARL 1FFOB 1D5ZB 1QABA 5CP7A 3BUYA 2UYLB 4ZMPA 3OR6A 3GLAA 3PFUA 5D7JB 3L5HA 1R3HB 2UUDK 4OZHA 3WKPA 3O41A 2Q87A 1GZHA 1XF5A 1EEZA 2EH7H 1NCWH 2ICEB 3HB3D 1CFVL 2DOCA 4X5QA 1AGBA 2UXGA 2HFEB 1MFAL 4I48A 1KGCD 5AW6B 1J1XH 2UVEA 3CVHA 5DUPL 4YUEL 3UJJL 1FNLA 4Y7MA 4AM0Q 2JKTM 4YSUA 2FJFB 2E56A 2X6BA 5DK3A 5DC0A 1F18A 4YIQB 2NUPB 4LPWA 5E6RB 1FN4B 3EFFA 1URZA 5FV2A 3V4VL 3C6EA 2GI0A 2IANA 4LVEA 4PMEA 5D7KE 2QADD 2BSCA 2J6EA 3CC1A 4H1LB 3WHE0 5AG8A 1ONQB 2R56H 4LPYA 2XVKA 3FQTB 4FL4C 4DOHE 1JUFB 1H8NA 5E6ID 1LHZA 1KMGA 3DYMA 2WMPB 3QPKA 4OT1L 4GKNB 4Y2NA 4P46B 5C08E 2Q7AA 3W9EB 2DQUL 1LJMA 3RJOA 4B3EA 2XBDA 5TDNA 3LSOB 1JI2A 4DVBA 4JK0D 1VENA 1LILA 1TITA 1NWOA 3FF7A 3HZYB 4Y19B 1CR9H 1IM3A 5DZOA 2GSGB 3NDYE 3A0OA 5A3IC 2BPBA 1J11A 1TXKA 2X70B 1BQSA 1EBPA 2ZXBA 2X05A 1BJ1J 2FCBA 3FZUD 2DEXX 4OKVA 1UKTA 3K2UH 3STLA 4E9VA 1B4LA 3S34L 2ARJA 4OF5A 1OWWA 1T1ZB 3C9NB 3I6GB 4GEIA 4NAJA 1GCFA 1OGTB 1SBSH 1NCCH 3CZEA 4NQDE 3HVDA 4LKCB 1ZVHA 4MXWH 3OPUA 4KQ4H 1N68A 2F5BL 2WTRB 3HUJB 2JSFA 2EKJA 1DHKA 1VADB 2NW3B 3X12A 3ERXA 1TZGH 3STZB 2GJ6A 3HJEA 4GXVH 5FUOH 3DDGA 5T1LA 1CDBA 3QAZC 4F58L 2K45A 4XR8C 5DR5L 4JANB 1NKGA 3VRIA 1E90A 4QIRA 2FZ3B 2QGDA 2WUBH 1UD2A 2IFGA 4RZCA 4QUOA 1JL8A 3GD1C 1KYUA 3BVDB 1AS8A 2YKLL 4JHUA 5CBAA 3ZL1A 1UYWH 3HBZA 2YAOA 4UOZA 2NY0D 5T5NF 1J1PH 4KNSA 4NJ9L 4OSUH 4YXKH 3F05A 2Z91B 1MIEH 2DL9A 2VAAB 3RY5A 5EIQA 3J7HA 3SKOA 4ZMVA 1JD9A 1YEHL 4XP5H 2DM4A 2EEAA 1VJSA 4C57C 1ZRUA 1C5CH 4NBYB 4OLXH 4PJHE 4S0TD 4AL8L 1RZIB 3AM8C 2V7NA 4LCYB 3VD0A 3U1SL 1KGWA 1ZTMA 3EJJX 4L37B 1Q1JH 1GXEA 4F7CA 3P0VH 3MRLA 4RIRB 1MI5E 5D1XD 1T20A 3B9DA 4YDZA 1I1AB 3DUSB 3CZJA 2MHAA 1A22B 2MSPA 3JUZA 4B9GA 4KC3B 4C56D 2GC4C 1UWXH 3CGTA 5DVMA 3RL1B 4ONGL 1I1YB 4PV8B 3MXWL 2YQ2A 2OMYA 2FB4L 3C5JB 4JJHA 1MY7A 2P7TB 4TVPE 5AYUH 3F7LA 4ZUSB 3UTTA 5DXWA 5TF1H 4F9LA 9PCYA 3DK0A 1RJLA 2AJXH 4O02B 5CEYA 3BUDA 2DM3A 3CMOH 3O8XC 2JKLA 5C09E 4HK0A 3DX4A 4QRFA 4HMDA 2DI9A 2L0DA 3IMTA 1OE1A 3TXAA 5HYSG 1RI8A 4Z1PA 4OM1H 1B0IA 2GJZA 1QTPA 2GQHA 2Y07H 3QEHB 1RURH 1ODAA 1AZZC 1TFHA 1P6FA 1AO7D 3QDME 2ZNXA 4HEPA 1GZQB 4RAUA 3BKJL 3NSCA 1P2CA 3LYRA 4P4KA 2DQCL 1JGUH 3QUYA 2APTA 4XN1A 5EA0L 4BKSC 5IBLD 2V3DA 3KNBA 4JGJA 4ELDA 2WYTA 5DJDA 5IMKB 2Q7NA 4QHNA 1SN5A 1S7VB 2ED7A 3FFCE 3M7FB 1DZ0A 4HJJH 1USQA 4KVNL 5GS1C 2JH2A 5HHOD 4AL8C 3X11A 5H37G 4Y4FD 5KYUB 3FCSA 3M1BA 1H0DA 4YL4A 3O3EB 1TJIH 4G3YH 1SQ2N 4N1EA 3VFOA 5I8KH 4S0HA 4X7TB 2ODHA 1U21A 3W0WA 2AV1A 5CCKL 3CFJB 3NSYA 4APQB 2VN3A 2XOTA 3LN4B 4X9GA 4B27A 3BRFA 5GRXG 5BZWB 1ZE3H 5J8OA 4QD2E 3VFVA 4FCAA 4HKXA 1YY8A 1J10A 4XE0A 5EIIG 4X50A 5AB9A 2YGNA 1MCBA 4P2YA 3HG3A 4GQ9L 4QOKE 4QF1A 2BMKB 3VACA 1SXSA 3PHQA 1N5YH 1Y0LA 1T66C 1M7IA 4NCC1 4W6YB 2YC1B 4ETQB 3DTXA 4G8IB 5DEFB 2XJKA 1QACA 4PRPD