2VSKB

Hendra virus attachment glycoprotein in complex with human cell surface receptor ephrinb2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
138
structure length
131
Chain Sequence
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Nipah and Hendra Virus Attachment to Their Cell-Surface Receptor Ephrin-B2
pubmed doi rcsb
source organism Hendra virus
molecule tags Hydrolase
molecule keywords HEMAGGLUTININ-NEURAMINIDASE
total genus 26
structure length 131
sequence length 138
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vskB00
1AANA 1AS7A 3DIVA 1A4CA 3FU7B 1KGYE 1ASOA 1ZV2A 2FQDA 5I5MA 2FQGA 3NJMA 4KO7A 3PLYA 3HEIB 3MBWB 4G70B 2W88A 3QJTB 1JZIA 1QHQA 3FT0A 4KOBA 1AG0A 3EH4B 3X1BA 1W8EA 1GW0A 4GXFA 5E9NA 2FQEA 1BYPA 4ZK8A 2LLNA 2PPCA 3WKPA 4DP4X 3AG4B 1JZGA 3SQRA 2XV3A 3IN2A 1V54B 2TSAA 4KOCA 1PZAA 4DPAX 1NINA 3CDZA 9PCYA 4KNSA 1JZJA 2YXVA 2XXGA 1KCBA 2I85A 1MG2C 1NWOA 5A7EA 3FSVA 3WIAA 4YL4A 6PAZA 2XX1A 2IDQA 4PAZA 2J57A 2XX0A 1AZBA 2PPDA 4G7SB 4BDVA 1W6LA 3OQRA 3ASOB 2UX6A 5FC9A 2CJ3A 2FTAA 5B7EA 1NDTA 4AKOA 3UACA 4DP7X 1ILSA 1J9TA 4A68A 3GDCA 2GI0A 3FSWA 1X9RA 1E30A 1ID2A 1GSKA 3ASNB 2WO2B 2IWEA 2BW4A 1ETJA 2PP7A 3UABA 2MRYA 4JKNA 5I6OA 1WS7A 1MG3C 3EHBB 1RKRA 3ZBMA 1J9SA 3AY2A 1M57B 2HX9A 3QJSB 2PPAA 5I28A 3QJQB 4QLWA 2CCWA 2FNWA 1WA0X 3DTUB 4A2DA 3TASA 1JXFA 2VW4A 3H56A 5I6MA 1KBWA 3CDZB 2YAEA 3FQ2A 3L45A 3NP4A 3FSAA 4FAAB 2FT7A 1AG6A 3JT2A 1QLEB 2J55A 5B1JC 2WSDA 4AX3A 2PP8A 2PCFA 1I53A 4AKPA 2Y69B 4NAJA 4P5SA 4QKTA 3SBPA 1HAUA 4E9XA 1BQ5A 1AIZA 1AACA 1L9SA 1ZIBA 2CAKA 4NERA 2W8CA 1VLXA 1CUOA 1ZDSA 3UAEA 1NPNA 1PNDA 2UXTA 2R7EB 3ZDWA 5I6NA 5I5JA 3ZX1A 3IEAA 2YAQA 1NPJA 1BQRA 1SJMA 4EF3A 4YSEA 1PY0A 1ET7A 2EIKB 1PZCA 1ILUA 4N8UA 1AQ8A 3DKHA 1PLBA 4YVUA 1OV8A 2DYSB 1ZDQA 3WI9A 3S8GB 1GS7A 1JZFA 4HCFA 1MZZA 1GR7A 1ZIAA 2PP9A 2BWDA 6PCYA 1JXDA 4L0PB 5PCYA 1CYXA 1KDIA 3EH5B 2HLEB 3FSZA 4KO6A 1SFDA 2RACA 3UAAA 1IC0A 4FA7B 1PZBA 1J9RA 2HXAA 3NJNA 3NSDA 5TK2A 4YSCA 3IE9A 1GS6X 2DWTA 1ASQA 1E5YA 1GYCA 1PNCA 3AG2B 2QPEB 5B3SB 4JHVA 3CVCA 1J9QA 4M3HA 1N68A 1OE1A 5D4JA 3NJFA 2YAHA 4YVNA 4DP6X 5ANHA 3NP3A 4YSTA 3N55A 2BHFA 3FS9A 3H4HA 1B3IA 1NIFA 3IN0A 2IDUA 4E9YA 1RCYA 1WS8A 2BW5A 2WO3B 3T6VA 2BWIA 5PAZA 1OCOB 1NWPA 2BZ7A 3S3DB 4E9QA 1NICA 2VM3A 4YSUA 2DYRB 3QJUB 2VSKB 1WA1X 2P80D 3PAVA 2JXMA 1L9QA 1XB8A 1JOIA 1A3ZA 4BK5C 4F2EA 2VW7A 2CUAA 2H5UA 1JVLA 2I7OA 5B7MA 4KO9A 2EILB 1N70A 3PXLA 4HHWA 4HIPA 4GYBA 3QJRB 1TU2A 1L9TA 2IDSA 1JZEA 2AFNA 2BP8B 2N0MA 2OJ1A 3NSFA 1PAZA 2IWFA 2AZAA 2H3XC 4E9WA 4NB7A 4RH4A 3T6ZA 3WKQA 4DP9X 1XB6A 2GB2A 3X1GA 2UXGA 4HAKA 1WA2X 2VM4A 1GS8A 4MFHA 3T6XA 3N2JA 4K9JA 4HCGA 1ET5A 1L9PA 4GP8B 4Q89A 3NSYA 1FFTB 1AZUA 1CURA 4BWTA 2AZUA 4WTQA 3NJLA 4HHGA 2BP0B 1OCRB 3T6WA 2XU9A 1AR1B 2ZONA 1MZYA 1A4AA 1L9RA 1AZNA 1GY2A 4HALA 3X1NA 3FPYA 2HX7A 4G72B 2QDVA 3X1EA 2JFCA 4TXVB 2B3IA 3CVDA 3WNIA 1XMEB 1M56B 1TEFA 4AI7A 3NJGA 5AZUA 2OCCB 3ABLB 2J5WA 1EZLA 3TA4D 1BXVA 2UX7A 1AAJA 3FQ1A 1A4BA 3OD3A 4KNTA 2OV0A 4W9ZA 2AVFA 4YSDA 2YQBA 3S8FB 1KV7A 1ASPA 1OE3A 3QJVB 2ZWNA 3UADA 4KO5A 2YAOA 4F7KA 3CVBA 1URIA 2VSMB 1CC3A 1JXGA 1ADWA 2FWLB 1ZPUA 3FU7A 3CZUB 1YLBB 3OM3B 3WG7B 1PF3A 2GIMA 5F7BA 2PCYA 2TSBA 4DP2X 3KW7A 2Q5BA 3FU9A 4CSPA 2H47C 1XB3A 2JKWA 1QNIA 7PAZA 4HZ1A 3X2QB 1KDJA 2GBAA 2GSMB 3FU8A 4GY4A 3PAUA 1AOZA 3OMAB 2XXFA 3TU6A 2GHZA 1OOWA 2MTAA 2XV2A 1OCZB 3MX0B 1TEGA 1V10A 1SNRA 4E9RA 3AZUA 4WKXA 2DWSA 1SFHA 1J5CA 4YSRA 4HCIA 1JZHA 4G71B 1PLCA 3GXUB 5AKRA 5IY5B 2PPEA 2YAPA 3NSCA 4BXVA 3AW5A 4A66A 1SHWA 4JHUA 4A2GA 3NJHA 2B08A 3SBQA 1OCCB 1L9OA 2BO0A 2IDTA 1BQKA 1E5ZA 3H4FA 3IBOA 4GP5B 3X1FA 3U25A 1AZCA 2R7EA 5B7FA 1HAWA 4YSSA 2X87A 4BDVB 1SF3A 2CALA 3S3BB 4M4RB 1HFUA 1FWXA 3KW8A 3OMIB 3TBBA 1NIAA 1IKOP 3FYIB 3QPKA 1IBZA 4E9TA 4G7RB 3PPSA 2HX8A 2YXWA 1UATA 3ABGA 2EINB 3G5WA 3PAZA 1PCSA 3AG1B 2VW6A 4UAHA 2XLLA 1NZRA 4W1TA 5D4HA 2X88A 1OF0A 2IDFA 1OE2A 1SF5A 3FPXA 4YSQA 4UF7C 2EIJB 1TKWA 2DV6A 3ABKB 3BVDB 4DPCX 4G7QB 8PAZA 4PCYA 5D4IA 1RZQA 2PLTA 3NJIA 2ZOOA 1AS6A 2J56A 4YSOA 4YSAA 1E67A 4A2EA 4UANA 1NIBA 5F7AA 3NT0A 1MDAA 1CYWA 3V9CA 3QQXA 2IAAC 4E9VA 1AS8A 1F56A 4N4YB 2YARA 3ABMB 3JTBA 1WAEA 5TK4A 4A67A 1PLAA 1SDDA 5I5IA 1DZ0A 1BXAA 2QDWA 3BQVA 2IH9A 2QT6A 2FQFA 1A8ZA 2FT8A 1KYAA 1X9UA 1BEXA 4BWUA 1JERA 5LDUA 5I6LA 1IUZA 2XV0A 3NJKA 3PCYA 2Y1AA 3NYKA 2BP0A 4CSZA 1BXUA 2I7SA 3T9WA 3FQYA 7PCYA 1AZRA 3V9EA 1KBVA 1JVOA 3T71A 2NRDA 1J5DA 2YAFA 4AZUA 5I26A 1PMYA 4BXSV 2DY2A 2QPDB 4YSPA 4DPBX 2YAMA 2ZXWB 3ERXA 5I6KA 2UXVA 2BP8A 3GYRA 2FJSA 3D12B 5B1JA 1E65A 4DP1X 2CBPA 1V55B 2XVBA 1DYZA 2BZCA 1R1CA 2XUWA 3HB3B 3TBCA 1KCWA 3RYMA 2IH8A 1T5KA 3EF4A 1FA4A 2HRHA 2GC7C 4F2FA 4DP5X 1A65A 2EIMB 4DP0X 2PPFA 4KNUA 4A2HA 1SDDB 3FYEB 3WNJA 2Q9OA 2HZHA 2FT6A 5B1KA 3OMNB 2IWKA 4GP4B 5AFAA 3AG3B 3EH3B 1NIEA 5I6PA 3UGEA 1IBYA 1SHXA 4P5RA 2UXFA 2HRGA 2XYBA 3CG8A 4DP8X 3C75A 3S3CB 5B1AB 2A3TA 2E86A 4X4KA 1NIDA 5EHFA 1RZPA 4Q8BA 1BYOA 1GY1A 4A2FA 4ENZA 3ZIYA 2P80A 2GC4C 2VMJA 1NTDA 1EHKB 3NJJA 1W6WA 2XWZA 5B1BB 2AANA 1M9WA 4AKQA 3SBRA 4BWWA 4E9SA 1ET8A 1BAWA 2VN3A
chains in the Genus database with same CATH superfamily
1HSAB 3ZW3A 2L3BA 4FZ8H 3IDGA 1E4JA 1P6AB 3UTSA 1IGJB 4WDIA 2VDNB 3U2SA 3OKDB 4PJAF 5E95B 3F00A 4ZOEA 3QDME 2FQGA 3G6JE 4M9OA 1M6UA 2K3HA 1BD2B 4UT9H 1YEJH 5I1AB 5LWYH 4K5NA 1GYWA 1YC8A 1HL5A 1GZPB 3ZKSD 3J2PA 1G87A 1RFDL 1MH5B 3HW7A 4JRXB 1EPFA 4NNYB 3RWEA 3MRJA 4D9RE 2R1XB 1G6RB 4FFZA 5A3ID 4KDTC 3EG9B 4KMTL 5MENE 3DJRA 3C5ZB 3KVQA 5B8CB 3FZUC 2ITFA 4TNVK 1G7QA 2IQ9H 4DPAX 2QSVA 2OTWA 4D0CA 2YD4A 4WWKA 3QO1A 4HF5L 4JDTH 4OF6A 3GS7A 1N8ZA 3KYKL 3GUTA 1JD7A 4KRPD 4MGXA 1NBVL 2AJVL 2A6KB 5GGTL 1BZ8A 4R0LA 1HT6A 2WXKA 1CTNA 3GZOA 1WF5A 4FFVD 4ZUWB 3K71B 2ZX7A 5HI5C 1XCTA 3OZ9L 2XX0A 4WFFE 4LHUA 1AI1H 2C3GA 1NDTA 3RVXD 3RGVA 1P4IH 4BFIB 5KAQF 4FI8A 4Y16D 3LNFA 4XMVA 3S3SA 1M05B 3BJLA 3B9AA 3EXLA 1WZLA 3SYAA 3NRFA 5HI3D 3DVNB 3FN0H 1TJIL 1BP3B 3MHZA 3OAUL 2B0SL 2V2WA 5HJBA 5DJ6B 5J3HD 5KVGE 3BT2H 5JORB 3DUUB 1RMFL 3SIKA 5IGXH 3QUGA 4PJXF 4F57L 5EEWA 3ZSSA 4OFKA 4Y9EA 1FVEB 1U2YA 1BF8A 1QUPA 3U1QA 4O2CB 3PV6B 4L4VB 5LGJB 4KHTH 3OLIA 5KVDL 2C3WA 4TVUA 4LEBA 3SSGA 2DQGH 4MJ5A 1T0NB 2IOOA 2QZQA 1E3XA 5K39B 4FAAB 3K2UH 2FT7A 4ELKA 4F15B 5B1JC 3UAJC 2PCFA 1NFIB 3L4ZA 3V2AR 1UZ8A 1QSED 4P5SA 5AYQA 1KXVA 1D5RA 4HJJH 1P7HL 3KCPB 4OM0L 4EI6B 1LWRA 2G75B 5C0EA 1AXTL 3LN5B 1TETL 2XA3A 4BQCA 4IBLT 5ICZB 1GH7A 1T66C 2W8CA 3MV7D 1UB6B 1QBLL 3TH4T 1SOXA 4M5ZL 1NPNA 5KSVA 1BQUA 1ZS2A 2NUTB 3VDBA 4KK8C 1ZT7A 4IK6A 1Q1PA 1MHPL 4OT1H 5F1OB 3BKCH 3MRHB 1LP9E 3H7BA 3O3UN 1FZKA 4N0UE 5FFGA 1VGEH 4HZAA 1MRFL 1MJ7H 2BSEA 3NFPA 4JFFE 4HC1A 3FFDA 4K7FA 1B4JL 3IGFA 1JYNA 5E1AB 1A02N 3P4MB 2ICWA 4ZUVB 3D3VA 2HKFH 2VLJA 1L5GB 3T3ME 2FJHB 5IGXL 3L3GA 3OF6A 4JEGB 4PM1A 5BVJB 1QW8A 4PRIB 3FCSB 5BOZG 2KZWA 5DT1L 3QXDA 2ITCA 2ZUYA 3MRCB 5ISZA 2YD2A 1MFVA 1WAAE 4Y5YA 3A23A 4JGJA 5HDLA 5TDOA 1G9HA 3B9EA 4XE0A 3P54A 3M8OH 1A21A 2D3NA 1XT5A 2A4EA 3MREB 3CK0L 4APQA 3IETA 4GAGH 1YSOA 1FI8C 3HA0A 1UGKA 2WOBA 1TENA 4ZSOA 4A7GF 3IDMB 2AJ3B 5MHSE 4KJQC 1I85C 4Q58C 1U3JA 3D2TA 4P23B 4R3SB 1BQLL 2N7BA 2F7OA 1U8CB 3MCLH 1FC1A 1GYVA 3BKYL 4N9GA 1OPGL 2ZG2A 4ORGB 5GGSA 3QB7C 2P80D 3PAVA 3VDCA 2GY5A 2MCG1 5GGSY 2H3NB 3U0PB 5HD8C 1A3ZA 1MRCH 1QG3A 3KXFB 3MRMB 1XGUB 5KSUB 1B4JH 1RPKA 4AV0A 1KJ2L 1AMXA 1Y0LA 1UT2A 1OWRM 3IFLH 3IKCA 4OZ4B 5CZKA 1LK2A 3DA0A 2BVOA 1CT8B 4ZSOE 1E6OL 1P6WA 5CCKL 3TBWB 4Y0GA 4LE8A 4UDTB 2VXVH 3MCKB 5I30L 3DIDA 1A7OH 3V4PA 1HQRA 4NI6A 3VD5A 4OCRL 2GB2A 1GCFA 1MCWW 4MJ6B 3LKPB 2LFEA 2HJKB 4ENED 3CN4A 3NCYS 1DBBH 3OG6B 3QIWA 4U6XB 3EJZD 1K5NA 4Z9KB 4GW1B 2WLJA 3VGAB 3Q3GA 1RZJH 2HVJB 4UYQA 5KOMC 3VTMA 1IGYA 3ARED 5DRXA 2UUDK 5E5MA 2EECA 4CVWA 1WDAA 4A6YA 2Z6FA 1T04B 1AJ7L 5CEXA 3FTZA 1OAKH 2VL5B 3O3EA 4HW6A 3WY3A 3QUYA 4F9LC 4BZ1L 4ELDA 1UADC 3SOTA 1AZNA 1VB9A 2WB1A 2ZKHH 3IK2A 1SY6H 3GBEA 3MOQA 5E00B 4S1SH 1IC4L 3RL1A 5CCJA 5JZ7C 4FQQA 5KSBF 3ZE0F 4FL4C 5IW3A 1C5BH 4HGMA 2DI9A 4K5PA 5D7KE 5DI8B 1R34A 3EYQC 4D9QD 2H2SC 1TEFA 5I1KH 3BQUC 3JWOH 1MQ8A 2BWQA 5DZOA 1C9SA 3M17A 2WNXA 3CDGA 5HI5D 1QUNA 3OD3A 4PJXA 5FUCE 2FX8H 4Z3GA 4MXQC 5F7FA 5ADOL 1OZTG 5DR5H 4AXWA 4AYMC 2Y06L 4HEPG 4KKZA 5ESVB 1E6OH 4OIBA 1IBGL 3UADA 5IW1B 4M62H 4HA1A 2P8PA 3ZGHA 2C9XA 4GMSH 5E4AA 2NW3A 5FHAL 2VSMB 4K9EH 5IB1B 2PMZA 1YMHA 3ME0A 3H2WA 3WG7B 4NIKB 2JKNA 2R23A 3FONA 2OSLB 5F7BA 3SHSA 2Y7QB 5J3HC 3RPIA 2TSBA 3VQLA 2NY3D 2DWXA 2EXTA 3ML9A 2LT9A 4OKDA 1T1XA 1JI2A 3PFUA 3HMWL 3SD2A 5BRZE 1HI6A 2Y5TB 3QHFL 1CFTA 1V7NH 3EGSB 3QW9A 1SEBB 4LDEB 3WN6A 1AFVL 2DWDB 3VRJB 1OOWA 2NNXA 3C6SA 4OGYL 4RGNC 2CCVA 2XPGB 4E9RA 1GPOH 2XETA 4Z7NE 1MW1A 1SY6L 4D0CB 1JZHA 3EGDA 2WPGA 3DBSA 3RX8A 3QP3A 1YA5A 1GL4B 5DYOA 2XTJC 3ZO0A 4ADIA 1BQKA 2O5YL 2CU9A 2DM2A 3SO3C 4RAUA 4AGQA 1FUNA 1BXXA 1Q0YH 5EU4B 3IDYC 4OY9A 4YSSA 3QJHA 1NMCB 2BMKB 3D39E 4HWUA 4PB9L 5DJDB 1XGQA 1NIAA 3MRKB 5E5LA 4LDLB 5GHWL 3VFPA 1MIEL 1V7MH 1UATA 2JB5L 3ABGA 4NT6A 4GS7B 2ID5A 5FGRA 4Z77B 4JM2C 1SDAB 2FWSA 2O5XH 2Z35B 1U91A 3W11D 1CE1H 4QRRE 3STZA 2HT2C 1NMAH 4HCRA 1UA6H 2XWXA 3HLAB 4HJTA 1OF0A 3QJZA 2Z4TA 4MA7L 5I19H 3UROR 1OALA 1WCBA 2DV6A 3F83A 1NBZA 1T21B 3X12B 4CU8A 2OL3B 2VXVL 4JPVL 3TT1H 4KVNH 4RFEA 2IGTA 2XBZA 4I13B 3BH9A 2O6FA 4N20A 3QXUA 2XA8L 1T1YA 5J6HA 3NA9H 2ZAHA 3K8LA 5AB9A 1D9KB 5JPMC 2MPAL 3R0NA 5F96L 1DQLH 4KX7A 1O7SA 5F0JB 4OLXL 1MI5D 1SJVA 4YHML 1E90A 3HN8A 2MKWA 1JHLH 3PWUB 2OTUA 2VWEE 3QNZB 4EZKA 1G7PB 3WTVA 1S7VB 4A55A 4HUKB 3AWFA 4MBOA 3OLDA 5IREA 5D1XE 2D7NA 4ONHA 5D7JC 1T2JA 1UYWH 3AFLA 1T89A 5D1ZA 1JERA 5GZOD 3T0DA 3KM1A 1FL5B 4U0RB 5KJRH 1AO7A 3UDWA 4CC0A 1CFVL 1DBKL 5EF2A 3TBTA 4CSZA 1QKZL 3LRGA 3JYCA 5B4MD 2A77H 3DSNB 1G7LA 3IVKB 2IAMB 4F57H 2AP2A 1IFGA 4NO0B 4BD4A 4H1LB 1PMYA 3S97C 2WIIA 3L3HA 3MJ9L 3B7RL 2LU5A 2F6AA 3BZEB 3II1A 1U95A 2ZXWB 3SPGA 2HN7A 4R26H 3B5GA 1UD2A 2WD0A 1QMUA 2YJLA 5CILH 5B1JA 3S5ZA 2OXHA 3WDIA 1PYWA 3SE6A 3BPCB 5DFVC 4G2AA 3EF4A 2GTQA 2BERA 1BQHA 3RUGB 4L8DB 3GJEA 3UP1A 1E27B 2Z31C 3GDBA 3N5AA 1WYJA 4A2HA 3B83A 5LG6A 4G1MA 1TJHL 4A6YB 5GIRA 4U0QB 1LNUB 3TS8A 2YN5A 4TOYH 1F86A 5EN2A 1NCOA 3VTAA 1CF1A 2O5XL 3QR2A 1IARB 1TJXA 3QGVA 2UZPA 3JV4B 2C7UA 2CIIB 1IBYA 1I1AD 1GSMA 1OHZA 2UXFA 3SDDC 2AHIA 3QWOB 1IGFL 4JO4H 4V2BA 3WTSA 3LYRA 4KHTL 3B9KA 4GT7A 4PMFA 3VYNA 1GHFH 3FUEA 4NQDB 5KZCD 1Q0YL 2Q7AA 1R5VA 4AVIA 5GGUA 4H25B 5I75C 2P80A 2GC4C 4N0CC 4LKCB 5KVGL 4K8RD 4H44C 2JLPA 3CN0A 1FO0H 3D50A 1RMFH 2AANA 3DI3B 3SDDB 4J3OC 4FA6A 3WLWC 1N5YL 1E8YA 5F9AC 3RURA 4L5FE 3G7TA 2VN3A 3BO8B 4U05A 1G7JA 3KD4A 1MFBH 4ZTOH 6CGTA 3COOA 4R4BA 4WW1A 4R26L 1G5AA 4TTDD 4WUKH 5AVUB 2WQAA 1FC2D 1UH3A 2DS4A 3DVGA 4ETQA 4QTIL 1PS3A 5HGDA 4MCNA 3PLYA 1CLYL 3PRZA 5C0FB 4UB0L 1BJ1H 3PWLA 4TSBL 4PJHF 4LZKA 2DJUA 3HN3A 5AB2A 3D25A 2FQEA 4K2UL 3H9HB 4A2LA 4ZK8A 2YC1A 3WSQH 3PQYE 5KYWA 5E8EB 3G5ZB 3OJVC 1JPFB 5E2TL 2V7NA 5CGBA 2YGOA 1JYVA 5GJSL 1G4MA 4RGND 3BZ4B 3T0EA 3GLAA 4RFEB 1MDTA 5IJKA 2VLJD 1VRSA 1UOKA 1MEXL 2V9RA 4UNVA 5L2JB 1UD3A 4LLDA 4OGQC 5C0AE 1W0VA 1FL3A 1N7MH 1QBLH 2BNUA 2D73A 1EFXD 4PY7A 5FAAA 1MWAB 3ATDA 5IB3A 3AB0C 5EF1A 1UKSA 3UTZB 4WFED 1UA3A 2LR4A 4EN3B 2R0WH 3MA9L 5IT2L 1XCXA 1DANT 4OKVB 5CEZD 2F8OA 3LPOA 1ORSA 4FYRA 3W38A 1WVZA 2WLLA 4ELMA 4AGLA 3BVTA 4QHUA 4KZEH 1GAFH 3QRFM 1Z3RA 3ZE1F 1ZHNB 4OCYL 3RY4A 4URTB 5IJDC 2ZCKH 3ARUA 1COBA 4U1LA 5I6OA 1T0MB 3FFCB 3QEGH 3DXAA 4XMKL 5I2IB 1K4CB 2WWKO 2PO6B 3HE6B 1LXMA 3IWVA 5BRPA 4NWTL 3AU1B 3AROA 2DQMA 5EC2A 1V7ML 1IC4H 4JG1H 4ANUA 5G2NA 2A6DB 3L08A 2YQ3A 1RIHL 2B5IB 3VE0B 1JPTL 3SGDH 5LGHL 2P8LB 3NP4A 3UBFA 2HPTA 2E7LA 3L6FA 3JT2A 3SDXB 2FX7H 2J55A 4KQ3H 2XVGA 3VFSA 3P73A 3VTTA 2V5YA 4JFDA 2CLRA 5DMKB 4UQ3A 4XNUL 5T5NG 4JQVA 1PYWB 4PGEB 1ZT7B 4QHKJ 1E42A 3QT2A 4JM2B 1IQWL 3DV4B 4YX2H 1DEEA 1G7HB 1LDPH 4L1DA 1F42A 4WENB 3C8KA 1CD1B 3T4YA 4AGMA 5FA4A 4U1JA 5DO2C 5GZOA 3P69A 3GQFA 5MEQA 1Q9LB 3ZX1A 5JPNB 4XCNA 1HDMB 1NPJA 5E9DE 2QQLL 3RQ3A 3ARGB 4EF3A 2OZ4H 3LZLA 3PUCA 2IQ9L 1DQDH 3W57A 2C7UB 4LLMA 1TMQA 4LOFA 4NAQA 3IFLL 3FU5A 4MCYA 3HMWH 1WGVA 3DKHA 2AV7A 1QBMH 4I2XA 2FIRT 5E6UB 1CVSC 5C2BH 5MEPA 1HH6A 2RQEA 1EZUA 1XGZA 4KI5E 5AAWA 3CXFA 5BW7A 2NY0B 2PW2B 3H9SE 3QI9B 4KK5D 4LCCB 1BLIA 5DZLA 3M8OL 4N0UB 1F6FB 1EGJA 1I7TB 4I5BB 5I1EH 1SFDA 1KELH 3R8QA 1SYSA 4FE9A 4MB3A 2F7RA 5TK2A 2DRUA 4X5RA 1XL4A 5KUMA 5ECGA 3X3GH 1UWXH 2Q7YB 5FKPA 3ZTDC 3ATAA 3KJ6H 3QIBB 4JL1A 3ZTNL 3ASWA 4KXZI 2EQDA 2BVPB 1XR9B 3IFPB 1D5ZA 1H3UA 4M3KB 1F3DH 4YFLF 2R1YA 2B39A 3NFNB 4U3SB 2B7DT 4LPCA 4M48L 3B2XA 2G30A 1WPCA 3B2UD 1XX9C 3DMMD 3T6VA 3TJHC 1VCBC 3ARDC 4YBQC 3FB7B 4AL8H 3S3DB 3Q13A 1FSKB 4PJAE 4XE5B 4ZNEE 1KB5A 3K0WA 2VABB 3KYAA 1I7UA 5CEYA 2YBGA 3TL5A 4KXDA 3UPCA 3SDCB 4P9HH 1KYDA 4XP6H 1XBDA 4YHLH 4AQAA 2BNQD 3DPDA 3VI3E 5F21B 4K94H 5F9JA 3RVVC 5SWQB 5KBDA 3VFOA 3WHXA 4LEOA 4PJ8B 4WWPA 4D94A 3SCMD 1HS6A 1E2WA 4PWGA 2X40A 1CLZH 2CHNA 1TJGL 1HQRB 3P30H 4EDWH 5J11C 4XP5H 5EIVA 1NCAH 3DLQR 2R4RH 1K72A 5DDHB 3TOPA 4IU3A 1VPOL 3KH3A 5D7JD 5KYNA 3DOSA 4LAQL 2XT1B 1ORQA 2AQQA 3VMNA 3OKNB 4HAKA 4PJGF 1L6XA 1RZFH 3IXTB 3R06A 1CK0L 4R5XA 3QCVH 4ZQKB 1KBGL 5F9DC 4FRWA 3D09A 1CG9A 4Y19D 4FFYA 3NSYA 4DFHA 1Q38A 5LO7A 3GMMB 4I2XE 3HG5A 1TQSA 4KJWD 1GY2A 4IBTA 5F1SA 1CFNB 1HQ4B 4JN1L 1CI3M 1ONQB 2EDBA 2IBBA 2AI0L 4KUZL 3CTTA 4E41E 3O9WD 5C8JB 2BY2A 5J1AA 5C0BD 3LKSA 1E2ZA 1JYXA 3GSRA 3GLZA 1XMEB 3VX1A 4X98A 4GG8B 2EP6A 3UJJH 4YJZL 5LKNA 3OLGA 2X9YA 4AH2A 1MW2A 2UX7A 4NZUH 2QSCL 2B20A 4M43H 2ZF9A 2P8PB 3MOAL 4YHOH 4NC1E 5T5FH 3WFEH 4UUJA 1PY9A 1IEAA 1ZXQA 4JLRB 4XB3A 3CLEL 1N6UA 4ZX5A 1HKLH 4XNZB 1E6JH 2D7TH 1UENA 4ONGL 3ULVF 1YEKH 4R7NA 3VAEA 1NBYB 2C5DC 5BQ7A 3Q2VA 3LQZB 1JXGA 3HBPA 4PGBB 1Z6JT 2XTJE 3HJ0A 3DRTA 5KN5A 3DURA 2X9XA 4NYLB 3RIAK 1T0MA 3FFCA 4P2OD 1E5BA 4NEHB 2WINA 1FG9C 4AV5A 3I9GL 2DQEL 1KEMH 3TJEL 3CJJA 1L9NA 3JWNG 4RAVA 3VWKD 1CL7H 1HHJA 2CJUH 2GBAA 4JZJC 2GSMB 1WJ3A 2JJUA 4E9LA 3OMAB 4H40A 5E2JA 5TTRA 5GRZA 5EBLB 2FHCA 1OCZB 5DYOB 3TCLB 3ABZA 4EO5A 1LEIA 1SNRA 1U8MA 2AABH 2I9LB 5FECB 3ULUE 4ZFGL 1NOAA 1PFOA 2AK1H 3PDOB 3L4UA 1NM4A 1I1AC 4I0PB 5I0VA 3DX7A 4R2GB 1ZPLA 3PL6B 3N44F 2MWCA 4PR5B 3FKUS 1LP9F 3MAWA 4LARH 3U9UB 1AQKL 1SBSL 1A6VH 1RHHB 2R2HA 4WU5B 5D7IB 2RD0A 4LHUG 4RBPH 1OD7A 3CFBA 1YEIL 2APWA 4NJ9L 4AQEB 3Q43A 2GSGB 2QQKH 4J3TA 4C56B 5HI3C 5E08L 1GOHA 3O4LB 3FW6A 4JGUA 4LBAA 4XNMA 5DQJA 3ZDXE 5MERA 2G2RA 3GSUB 3VXOB 2NTSP 3BGFC 1I8UA 3PAZA 1XMWA 4XHJC 3L81A 1KCVL 3SQBB 1SMAA 4JHWL 3UBGA 4Y2DD 2R0ZL 2ZXCA 3P02A 4UAHA 1JZ6A 2W9DL 1C7SA 5E4EB 3ETBF 1PKQE 3EYOB 1NAMB 2A6IB 4WU7A 4AYID 5HXMA 3U2JA 2R2BB 4Q7DA 5I76B 4KKBD 1KIPB 4R7LA 3QIUA 2BNRE 5TFSL 2IBGA 3VW3H 1F58H 1AGCA 2KDGA 4F93B 4YZFF 2VC2L 4OIAA 4X7TA 3MBEA 4JN2B 2ZP9A 3MNMA 3SDAA 1MJ8H 5JQHC 1KPVB 4HJUA 1BJ8A 3G5XB 4IRZH 4X8XA 4FLSA 5CP7A 3PJNA 1WIPA 3W82A 3JTBA 5TK4A 4G6FD 5IG7B 3OQ3B 4LLUB 4A63A 2XKUA 1K85A 2IH9A 4V1DE 2E47A 4RFOH 2AK1L 4OZHE 4WEEA 5DGQA 3MRPB 1J5OH 4G5AA 3LQMA 2X38A 4JFXA 5EORL 4FNSA 4KFMA 4P3DA 5IHBA 3QUXD 3RI5F 4UIKH 1FLRH 2V7HA 5D70L 2TRYA 4MAUH 4WJ5A 3WS3A 1MNUL 2CGYA 2PXYC 3T71A 3OPZL 3MRLB 3BDYH 4CMHB 4KUCD 4LLVB 1B4TA 4D8PB 3O81A 3ULUH 3VXRD 3IGKA 1ONQA 4OCSL 1R0AH 2OMUB 5F3FA 2X42A 5CLYA 1U21A 3LKSB 4FQLH 4OLVL 1RU9H 4QJ5B 1F6AA 4EIGB 3DGGA 5I6KA 4F1SA 4NQSA 1EZVX 5SV3A 4JDEA 3OWRA 4LDCA 4CU6A 1DQDL 1F58L 2I26N 3EYUH 4H20L 1P4BH 3W9EB 4XWGL 1JRHL 2NSQA 4K23L 1LNUA 2EDWA 1T5KA 4DTGL 4LRIC 2DEWX 2P49B 4DP5X 2ZF8A 5H4ZA 1IT9H 1JN6A 3TVMB 3REWB 1MJ7L 3QI9D 3BW9A 2HKHH 2LU3A 4LSVH 3TN0A 4OTXH 5GRUL 3QPXH 1BGXH 3ZU8A 1EEQA 2R1YB 4KX8A 3APDA 3KLAB 4JCWA 4FABH 1CFBA 4P5RA 3U79A 2YBRB 1NMBL 4X5XB 4PBDA 3QIBD 5C0AB 1C08A 4LBEA 3ZDYB 1AR2A 4KVPA 2XPZA 3J07A 4G42A 5E94B 1HZKA 4ZPVA 3VRIB 3MLWH 2OQJB 4UUJB 2UYLB 4NBXB 5DJXB 3NZ8B 1U8OA 2YGQA 4JJ5A 4WO4C 1YEEL 3LKOB 4XCFH 4I4WB 2UUDH 4EKJA 1BM3L 4YMPA 1UD5A 4QYOB 4Z7VA 3L5XL 1HEJC 1J88A 4KRMB 4QKXB 3U9PL 4RRPA 2P4AB 4IBWA 3FU7B 5DMIL 4WO0A 4KTDL 5E6IA 5GRJL 3EOAA 1PDKA 3R19A 2ZWZA 3FT0A 4W68A 4ES9A 3WFCH 2V33A 3GUTB 3VD1A 5E9NA 3ECVA 3BUPA 2PPCA 3QZWB 1FSKC 4XX1G 1E8XA 2BHZA 2PNDA 4Q74A 2WZPD 2GG1A 2VCOA 1PZAA 1NINA 2X1XR 4EZMA 4KRPB 3UEZA 3MRJB 1S7RA 4KH2A 3MDJA 1UOLA 4HX1A 4GJTB 1F41A 2LVCA 3B4NA 1EAOA 4WI5A 1U8QB 3NCJL 4P4RB 1XH3A 1KG0B 1OAXH 3GXDA 4YLQT 6PAZA 1Z9SB 3ZRCC 2F0CA 2HG5A 3RJQB 3FBKA 2GCYA 2R2HB 2WYHA 5D7IA 1YN7A 1UWGL 1BIHA 3CCHA 2W65B 4K5OA 1GZQB 1ZS8B 2ORBL 1OSZB 3MACH 4GKNA 1JZ8A 4W4OA 5FYKH 1T7VA 3EFFB 1E4XL 4Y4FA 1RQ5A 2Q8AL 4IKJA 4K3GA 4TPRL 1AKJA 3TVMD 5JHDB 3B9DA 3BSHA 1WH0A 3MRGA 4MHHG 3H54A 4ZFOB 1BM3H 4DVBA 4ZW7A 3X3FL 3VQ2C 3RWEB 1N5AA 3PGFH 5D96B 2CHWA 3X14A 4EBQH 1IM9A 3S3PA 5CF3A 2P26A 3L3GB 3C5ZA 1CFVH 1DBKH 4G9FB 4P5TD 4ELKB 3D39D 2A99A 1F4WH 1KC5L 3P0YH 5FYJH 2FLBT 5FKAA 1BECA 4F8NA 2EDQA 2APFA 1KB5H 1JXFA 2PWGA 4FFVC 4KROD 2FBOJ 3ZJAA 5J6SA 1RVFL 3RILA 4O4YH 1FCGA 5KVFE 3SQOH 3GIZH 1IGCL 3C8KB 8FABB 1TZGH 5C09E 1HWHB 3QPXL 4OZFH 5I5RA 1LGVA 2AJUL 2E6QA 5I6XB 1OCWL 2WP3O 4MNHB 1AACA 2F53E 1PX8A 2MOGA 2HH0L 1CUOA 1U8HA 3D3VD 4MXVF 4CJ1A 5IFJB 1U8NA 5CO1A 5DHVB 1UT1A 3WNNA 5TQ2L 5L0QC 4I2XB 1PKOA 4KKCD 5E1GA 1OAQL 1RLBA 1SJMA 2RMNA 3P30L 2F54D 4NQCD 1Z32X 3FT9A 4YXLH 3UC0L 1EDYA 1YYMH 4TVSa 5MEOA 3PL6D 2GUOA 2XOTA 4WI0B 2FGWL 1ZTMA 4JZJB 4Y4HD 5DRWB 2EXWC 1YY8B 3HOGA 2WBJA 3MRMA 5KSUA 1O9ZA 3QIWC 3NIDE 3SO5A 2WQUA 4M7ZC 4WU7B 4Y2DA 2WAHA 5ICUA 2FD6H 2C34A 3LZQA 4GXVL 3W9EA 1O6SA 2MFNA 3ARDD 4FZEL 4IHOA 3ATFA 1EEYB 1F1AA 3TCTA 4PJCA 3WGVB 2VMCA 4YSCA 1LO0H 4A7SA 4Q52A 3FB6B 5FOJA 5E6SB 5T1DL 2OMNA 2WBJD 5CLZA 4HPHA 2QPEB 5B3SB 1LEGA 1UXSA 1KNOA 1MI5A 2Z1KA 3BWUC 3OR7B 5EIIG 1EAPB 3U4BL 1MNUH 1OT4A 5BS0B 5HBBA 5DHYA 1JNHB 3AT0A 1JGVH 3KNBB 2WV3A 3MO1A 5GGSB 1PCXA 4Y5VB 4D2NA 1BAFH 3QUYD 2RJMA 3LN4B 3U30B 2OYPA 4D8OA 5AD0A 3KEHA 4KGJA 3QQ9C 5E00A 1ZLSH 3KR3H 4IGBA 4RGOL 4W9GC 3CDYA 3IXAA 4UTBH 4N0FA 4MRBA 4QHLB 4JE4B 3UZVA 5C2BL 2X6MA 2XHNA 2FL5B 3RIAF 3MLYL 4MZ3A 2IV8A 1KG0A 3GIZL 3GMNB 1MI5E 1D7DA 1YUHB 5TE7L 1TU2A 4APXB 4BV1A 5C6TL 1L9TA 5TDOB 2PTVA 2BSSA 2H0PA 1UHVA 5DC2A 4FP8L 5D1XD 4P46A 5J6GB 3MMEA 2IGFL 2XV6B 2RH0A 3GXIA 1C5CL 1UTDA 2BVOB 4NJ9H 3N41B 1FVDA 4X7SH 1VESA 4HUXB 4PLKC 5HYSG 4UOQA 2W60A 4LVOB 4X4XA 5L8LB 2GTWA 4AC4A 3B5HA 1ZJBA 3TVMA 1A9VA 4M61B 4G82A 4BWTA 3GBLA 3B8SA 4DUWA 2IANB 3FB7A 3SE9H 1L9RA 3SGEH 1C1EH 4JRFA 4HEME 2MCPL 3MBED 3WY1A 3VFTA 3VXQA 4S10A 2R29A 1X9LA 3U7YH 4PY8J 4DW2H 1RUML 4YAQA 5KG9B 1XH1A 3NIFF 4RFNB 2JKTM 3IJ8A 4UQCA 4XP9H 4ZMAT 2DDQL 3ABLB 1F8TH 3ARXA 3BUYA 3VFOB 1Z9PA 1RI8A 3LNHA 4JREB 4PRIE 5CJ8A 1FFPB 4XN7A 2ZX9A 5EWIH 2FB4H 1FORH 4S1RL 2WZPA 2XWTA 1PJ9A 1N6QL 4I48B 3CDGB 1DL7L 2L0DA 2ZOTA 4ES8A 1Z7JA 1U3NA 2ARJQ 2YAOA 3HPJB 3PHOA 3E3QC 1WICA 3QJXA 4KPHH 3LHAA 3T8MA 1EBAA 2BSDA 2XI9A 3MROB 4JMNA 5DFAA 1MUJB 3V4VB 4GI8A 4XP1L 3D85A 5FO7B 4G8GB 2J4WH 4NHUA 4AMKH 1DLFH 3AXIA 3HBZA 3MJ9H 5ALCH 1JPGA 4GT0A 5DVNA 1MRDH 3WJJA 4JHAL 4GY4A 1SQMA 4IMKC 5HDBB 1VCAA 4JFFD 3SY0A 4GIAA 2MTAA 1MHCB 4G80B 3RVWC 3VB8A 5CKAA 1BQLH 1TEGA 2WAQA 2YUXA 4GKZB 2F54E 4Y9BA 3FQUA 5F3HB 4NNPL 3PWNA 5DQDL 5EZOL 5M95B 4P4KA 2ZKHL 3QI9A 5J1AB 1SM3H 3GK8H 4WO4B 3EO9L 3UTPD 4JRXD 1PU0A 3KLQA 2QGEA 4C56A 4JE0A 1IGIH 1S7VA 3Q7JA 4JPQA 5B7FA 3QZOA 2Y7NA 1R3JA 3V6FA 4LK4A 3SYQA 4NWUH 4J5VA 3WXWL 2WUCL 4OZIA 4OF0A 5I1EL 5DTFB 5GSVB 1QPKA 3IFNH 3VFGH 3IFPA 2V3DA 3AT8A 2ED8A 1NUGA 3RLSA 2AXFB 2GAZB 1AXSA 4XO8A 2EIEA 5H2BB 4I18A 3V4UH 1X4YA 2R69H 4U1NB 2OMZB 3TURA 1PX4A 2GBUA 4PUBH 4PV1C 2WTRB 2VW6A 4NZ8A 2DH2A 3FQNB 4YDNA 4PYGA 3LXAA 1K8IB 1NZRA 1TTFA 1I9RH 4RDBA 3NCWA 1G7QB 2ETWA 3JWDL 2AF2A 4XNXH 1YMMA 3HZVA 1BEYH 1QR1A 3QWNA 3RHWK 4JK0D 2W94A 4JRYB 3RB5A 4G7QB 3FTUA 2JKIS 1DDTA 2EZ0D 3VRJA 5DSCA 2Q8AH 4H1LG 1MCJA 3WJJC 2CG9X 1ZK9A 3V6BR 4B5ZA 3D9AL 5EOTB 4N26A 1E67A 5EV7A 5DFWH 1QFOA 2WN3A 4QR7A 1T7WA 4MDIB 2FGZA 2VLKE 4ZFZA 4LIQE 3GGWA 1KJ3H 1VACB 4EZJA 5I75B 1JZ4A 1AGEB 1FNGA 1R19A 3GJEB 3V0WL 4KC3B 1E4KA 1DZ0A 1UVQA 5MI0B 4Z8FH 3T8XA 3TGXA 4JDZA 1NGYA 1KTLA 2WXLA 1ETZB 4E0RA 5DWUH 3F62A 3VXSD 2WQWA 4G3YL 5EUOA 4ZW8A 2A77L 1V8HA 3CK0H 1FLRL 3LY6A 5I9QC 2YD0A 3QNFA 1VIWA 4PV9A 4CL7A 3BFOA 1J0HA 4CMMB 3VXOA 1XF4A 1HXKA 1BFVH 3Q0HA 4K3HA 4NQVB 4NRXA 4UNUA 1UWEH 1HYSD 3JTSB 2NNAA 1EJOH 3VVWA 3ZTNH 3RI5K 1CFNA 3LH8A 4PU2A 1L7TH 3BUDA 4X4MA 4EVNB 2EDKA 3OKMA 1RUKL 1BMGA 3RGVD 3T0BA 1FL6B 3SCMA 1S5IL 4PJAA 3DSNA 2KLTA 4X6FB 1OB1B 4FTVD 2X10A 4E42B 2JI1A 4F3FB 1JDDA 4NQCB 1TFHA 2HVBA 5FUZL 5GS0H 4M5TA 1MCPL 1YG9A 2VC2B 5DJ0B 4ZPTA 4JMXA 1G7JB 2QLYA 4JKMA 5DD3H 2E7LC 4DP1X 1A0QH 3P3RA 4M4PA 1R1CA 1AXIB 1MREH 3BDBA 1YEWA 5A6MA 2GUYA 5CP7B 2X6UA 2R8SH 2NY1C 1A65A 5IEKA 4KNUA 2ITDB 3H8NA 2OMYA 2CIIA 4YHMH 3QO0B 5IVXA 3OR7A 3DV6B 2Y7OA 2KZKA 4XCCL 1D5IH 2FSEA 3L4CA 3ARBC 2BP3A 4N3UA 3ESUF 3DX2A 2NPLX 4HOMA 3UTSD 3QDHA 3BUTA 1U8OB 4GEIA 3V0EA 5EHFA 3P3SA 3KBFA 1S46A 2G5UA 1ZGLP 1W6WA 4WTWA 2C4FT 1ZA6B 5HY9A 2I69A 3SDDD 4OVUA 3L3OC 5F9OH 2ATKA 2NXZC 2HJLB 1U3HA 2VN5A 3MLXH 1BBJA 3EADA 5GGUB 4AJWA 4X83A 1AANA 4P2QB 4TNEA 1PDKB 5DD0L 4Y16A 1TVBB 3IAPA 1DQTA 2LTQC 5D7SH 2AKRB 4L1BA 1A5FH 5JW3H 4QRAA 4G6JH 4G7YL 1ZV2A 4GG6F 3IBEA 5I5MA 3FB5B 3Q1SH 4ELMB 2ZCKL 4G8FB 4L2YA 4U1SB 1LILA 5CINL 1OB0A 2Y1VA 3N1FC 4HEMA 4I0PD 3BLBA 4ISVB 4Z0BH 3DO7B 1FYTD 4IHBA 4XVSL 5LN4A 2OYMA 1N59B 2OMXB 4F58L 1Y6MR 2H9GA 1MRCL 2BH0A 3WKPA 5K69A 3SJVE 4HS8H 2D9CA 3FUNA 3POHA 4O2FB 5HVHC 5FO2A 1KB9J 2BNUB 5IUCA 4GQPH 3TIDB 1X5ZA 5CFAA 3V7MA 4PJFB 5JIIA 3B9KB 3MGOA 5A7EA 1MCEA 5ITBL 5CBAB 5KYXB 3UTZA 4Q9CA 4M5YL 3KLHD 1SMDA 3MJGX 4MX7B 2WHVA 4QGTA 3T1WA 1CT8A 3GXTA 2UZXB 5B7EA 2G9HA 5C0RH 5LG1A 4UINH 4NOFA 3TM6A 1DEEB 4LSRH 4TKWA 2CIKB 3L4VA 1D7FA 1H19A 1TPXB 1AYRA 1ILSA 3BZ5A 1G6VK 4LLUA 4X6CF 1EJ8A 4QTIH 3TEXA 1OLZA 2F08A 2VSDA 2NUTA 4IBQA 3HS0C 4UM8A 1MKFA 5IVXE 1E30A 5D7SL 4GXVH 1JS4A 3MRPA 5CJXA 1INQB 5JXAH 1LE5B 2XFXB 1VKXA 5FB8B 1IAIH 4PLJC 3MROA 3WXVH 3RA7H 3UO1H 1CLYH 3BJ91 1EUUA 3ULUC 3Q06A 5I18L 3QFJD 2HTLC 4UZSA 2BRRH 5JHBA 4JW3A 5KJRL 4Y1AB 2K78A 1G1OA 4A2DA 3O2VH 4E5XG 2J21A 5FR3A 4QCIB 3DMMA 3UP6A 1RZ7L 4UT6A 5C9KA 4KKCC 1LM8V 3QEUA 1CU4L 4FTDA 3L48A 1AG6A 1KIUA 4W9HC 4WI6A 1QLEB 1VEOA 4D3CH 4UT7H 3UMNA 3A4AA 4YS4A 3FTXA 4QKTA 1DJZA 1DJWA 3FU0A 2HG5B 3LN9A 1H9DA 2QEJA 3VXUE 1GHFL 2HTKD 3A3YB 3I6LD 2VDMH 4LRNL 3C6LA 4AEEA 15C8L 1GJUA 1KCRL 1MFEL 2WLKA 5HVWA 1RUPL 3MXVL 1GZQA 1BJMA 2FJFA 5EU5B 3L2MA 4AQZA 3T4AC 3Q2CA 5C0NC 4NS0A 2E6PA 3LNIA 2DJ4A 4OI7A 4MAYC 1P4LB 4KITB 3ETBJ 4FQHA 1A0QL 3BD4A 1INDL 2BS9A 4AOFA 2JIXA 3KWTA 3B2UC 2F53B 4U1LB 3EO1B 3S8GB 5M94B 2AJSL 3VM7A 4L3EE 1KFAH 2MSPA 4GSQA 1S7SA 3CSPA 4G42B 2VLLA 3PREA 3MNVB 2EEDA 5K93A 5SX5K 1CYXA 4M00A 5I8OL 1NFAA 1XZ0A 4AUUA 3QIUD 43C9A 3QH3A 3RY5A 4WTZG 3W0WD 5IFAH 3DJZA 3ARDB 4FS0A 4JO8A 5DDHA 4ZI8A 5FYJU 1NMCC 5FYKL 1BBJB 2EEAA 2OA9A 3AG2B 3L7EA 5H35A 1ZVSB 3VXME 5JW4N 3FTSA 2LHAA 4MJ6A 4NFBA 4FX5A 4TQ8A 4UV4L 2LAGB 5D72L 5DO2D 1H8LA 1OE1A 2PCPB 4CVZA 4M8QB 3V9FA 2OL3L 5DZ9A 4GS7C 1KB9K 3WS6C 1EIBA 4XPGH 3GTVA 2VABA 1NIFA 4FQ2L 5E8DH 5AAMA 1WS8A 2NX5E 3GMMA 4ICXA 4L05A 1EVUA 1N59A 3K4ZA 2DM3A 5A2AA 3QUYB 3BKCL 1OGAE 3QQDB 3UO8B 4GUPB 1RL1A 3JTTB 5E6ZA 4BH8A 2VSKB 3WDJA 4R3SA 3U46B 2BOBA 3FHEA 2EVGA 2AV7B 4MMZB 4XNYL 4TLUA 5DVLA 4RZKA 1U8CA 3GT6A 2D2CC 2HKFL 4H5SA 3PWJA 4UOJA 1OP5H 2B14A 3LIZH 1JDAA 4K3EH 3G6JF 1E9QB 4K5LA 5AOZA 3WTWA 1G9NH 4JFVA 4WW2F 1KYFA 1U8QA 3DI2B 1N70A 4K71B 1XGYL 4QTHB 4HIPA 3GI8H 4QHNA 2AQ3A 3FCBA 2QFPA 2BFVL 1KT2A 2IDSA 1FVDB 4ZW3A 3U2SB 2X4QB 1U8LA 3PE9A 3TTSA 2C7FA 5EB9A 1DN0B 2H3XC 3RVVD 2P5EA 3VI4B 3WKQA 4C56D 3QK0A 4HC1L 4O9HL 4DP9X 3IFNL 2DLGA 1DANU 3VFGL 4EI5A 3OHMB 3QUMB 1NBQA 4P2OA 3WNKA 3SKOB 4NCC1 4IU3B 2HFGH 1QFUL 1YY9C 4I0PC 2YUVA 5INCB 1ET5A 3AACA 1U4FA 1URZA 3BFQG 4Q89A 2ZYIA 2ZAIA 1FZOB 3P4LA 4QRUA 3LKPA 2ESVE 3NJLA 2DJSA 4QWWD 1MZYA 1G7LB 3OAUH 3GSRB 4BFOA 1ZSDB 4X5WA 3E9UA 3X1EA 3EKCA 1PY4A 4XPGL 3K71A 4QHLA 2OP4H 1P4IL 2Y07L 2Z8VC 4GBXC 2PYED 3C5SA 4PJ9A 3QEUB 3WU1A 5SWSE 4LF3A 3UBXA 4ALAC 2KYIA 3SJVD 4PJ8A 1OQOA 5B4MC 3FQ1A 4MB4A 1IT9L 1QI3A 3RWHA 1JHLL 3ULVE 4J3OF 1XCQB 3ZZSA 1E7VA 3RX7A 2NY5C 4W6YB 3MUGB 5IQMA 3RVTC 4PRBA 4JGMA 35C8H 3MRKA 4KPHL 4AGNA 3GSXA 3LMJL 3TBVA 4QO1B 4WKZB 4B97A 1ZE3H 3CVBA 1URIA 2BVEA 3EFOA 1OAZH 1ADWA 2G3ZA 4LCWA 5I1GH 4RAVB 3PWPA 3SJVA 1II4E 2WQRA 1E28A 5ENWB 3OZ9H 3UEQA 1WGOA 4ICWA 2Q6WA 4JM4L 3T6QC 3ZRSA 2ZUSA 4M5YH 3QFGA 1IAKB 5E7BA 1ZTXE 4GI6A 1WCBB 3OHXB 2QR0A 3VMOA 3H1ZA 2KH2B 5BXFA 4U7SA 5BZDA 4AM0B 2X0WA 4FZ8L 4HSQA 4LB8A 3WY2A 1KXQA 4X6EA 3KXFD 1CFTB 3EGSA 4G71B 4FNTA 5AKRA 3BSZH 4WEUD 1CZ8H 3HC2A 5ESQB 3GRBA 4BSWA 3KPOA 4XXWC 4TVPH 7TAAA 2PO6C 3V4LA 2OR8A 1T1ZA 5DTFA 3ARWA 3PWUA 4NPJA 4GP5B 3VGHA 1T0PB 3KAAA 4WW1B 4QRFA 1KNOB 2BIMA 3CVHL 4O02L 5TGBB 1R24B 3I6SA 3W5NA 2E9GA 1FH5H 4OJFL 4BFIA 5C70A 3HC0A 3JXAA 4P2OC 4AEHH 3GRWA 4MMXA 3QQ4A 3PABA 2WXFA 3O0LA 1J8HE 4PYHA 4X6BB 4C8XA 2VITB 2B59A 3LZPA 3ESPA 3HZVB 1QR1B 1U8JB 2R2BA 1BVKA 5IFHL 2QQQA 2B9BA 3MRBA 4O02B 5B8CA 3QUZC 1RJYA 2AERT 3VD0A 2K6YA 1EX0A 3NPZB 4N2MA 4YSQA 1K5WA 1GGIH 3SQBA 4X7TB 2YWZA 1OL0A 1OAQH 5AW5B 1I7ZA 5D4IA 1RZQA 4AQOA 1MHEA 5HYFA 5L2JA 4LRIA 4HJGB 4U49A 4WGVB 3O11A 4FA8A 2OI9B 2OM5A 4ZYKA 1IL1B 5FYLL 2XQYK 9CGTA 1ZJAA 2IAAC 4P3CH 3LPWA 3F7KA 4KHXL 4O58H 1W80A 1I1CA 3ZE0B 4HLZH 2QQNL 1KCLA 3PL6A 3T3MB 4YHIA 1IE4A 4BZ2H 5C08D 3DIFB 3G6JA 4KK6D 3AC0A 1O7DE 5AEAA 2VXTH 2ZNWA 4NXKA 5ICZA 3KYOB 1GMEA 2VUKA 3P3UA 5LDUA 3ELQA 4ZDHA 4N9GB 4ORGA 5I6LA 3KL3A 4IGBD 5DJ6A 4MD5A 1TNMA 3HLKA 4C56E 3MI6A 3FQYA 3LRSA 4XN9A 4XVOA 3UPRA 1KTDA 4TQEL 2XYCA 1RUKH 5T1KB 1EXHA 2GJRA 5IMLA 4ZPTB 1T4WA 3TBTB 2XIDA 4YQXL 4H8UA 1SYVB 1ROCA 5JIDA 3O6MH 5JZ7D 2E9IA 3PJSB 3ET9F 2AJZB 2W38A 2KZBA 4Z7OF 5I16B 2PWHA 1U8LB 2V5RA 4ESKA 3A4DA 2VB5A 3CU1A 1H3PH 1DLHA 1OLLA 1X4XA 2CLRB 4WO4D 4GKLA 1GCYA 5DJYB 5ID0A 2A0LD 2SEBB 3HB3B 1I1RA 4L37B 4LVNC 2FATH 3O45A 3GMLB 4ZFQA 3DV6A 3BWZA 1FA4A 1NCDL 3WFEL 2F61A 2Y3AA 3V0WH 2WXGA 2NYYD 2CO7B 1R3LB 1CLOH 2Q9OA 4BSJA 4LASH 3SJVB 2JJVA 1NBVH 1S5HB 2AJVH 3QUXC 1UQSB 3ULVD 4I3GA 4WEBL 4E0RB 3LIZL 2HFEA 4QHKI 2K70A 3SDXF 1D5XA 4OZHF 2NXZD 5E94A 1EVTC 3REWA 1YUKB 4DOHE 1OARH 1MIEH 4N0YL 5EC1A 2XYBA 4WW2C 3C2AL 3S3CB 2HCZX 2OQJA 2XRAL 1NANH 5J57B 4XN8A 3W0WA 3LRHA 3QZWG 1A4JA 1V5JA 2EADA 5BVJA 4ZMPA 4ODUA 3TA3B 4F2ME 1CXEA 1FAIH 2XN0A 5MENA 3JQOB 5HPOA 1T2QL 2ERJC 1MCSA 3NGBC 5A2JH 3WEOA 1U36A 3KXFA 4MDJB 4M1DH 1KTJA 3AXHA 3K2UL 4BKSC 4XVJL 3FT1A 1AVAA 5FM5M 3FT2B 4UWQB 3UTQB 1BAWA 1M4KA 5DD3L 3MR9B 3LEYL 1IGML 1Z66A 4E36A 5I9QB 4X4ME 4YK4C 3BWAA 3DROA 5E8NB 3NCEB 2O72A 1I3GH 3EUUA 1QQDA 5IBUG 2BINA 3NK3A 3PYCA 5EEUA 2X28A 1ECYA 2ROYA 3WNMA 1P2CB 4GXFA 4LCYA 3ZTCC 2Y5QA 2DMKA 3WD5H 1H3WM 3KPLA 2GKIA 3P3YA 3VXUA 2XV3A 3BOVA 4LLAA 3SBWA 5DC9B 3LZNA 1KN4H 2GYSA 4Z7AA 4HF5H 5DSCB 3CXDL 2DQCH 3O4OB 1UM6H 1I7ZB 3FTWA 1QAWA 4I77H 1X7QA 2ADIA 4WVRA 4Z8FL 1HEZA 1M2OA 4IIQA 3EGXA 4WWNA 4AMKL 1G0DA 1ZT1B 4UQ3B 2O6DA 1MFDL 4G7SB 1M6OA 3OAZK 4WUUD 2ZUQB 4I4WA 1JPSL 4UM8B 3C60D 3WYRA 1AKJB 4AC2A 4ZOCA 2PR4L 1JUFB 3TO4C 5IP4A 5T3ZL 2EIZB 4YHNB 2Y1ZA 2CZNA 5ID1B 5D7HA 2CHXA 4A68A 3T65A 4ATTA 4F27A 3E6FB 1W0WA 1AP2A 3TN0C 1FFOA 2IVFC 5DZJA 1J05B 2GJ6A 2JKRM 3O41B 3RJOA 3ENEA 1DQQA 1EA9C 1B6DA 3IMVA 4FFZL 2R23B 3CQQA 2Y2TA 4PV8B 5F71A 1G7MB 4MAUL 1M57B 1YPZE 2WQSA 4QHUB 4UILL 1QI4A 3O2DH 4E41B 3DTUB 1W15A 1XQ4A 4JFUA 4S2SB 1FIGH 3PF2A 4I0KA 2O61A 4TSCL 3QWRD 1TYEB 1XF3A 4W93A 4WWKC 3GEFA 1JHTB 4L5FL 1NPUA 4AKPA 2F19L 1S7WA 4C4UA 2CDGB 1QWNA 2VR7A 4Z7WE 5EEVA 2GCYB 5HHPA 2OZNA 5IM7B 4U4IA 1X7TA 1CD9B 3P73B 5MEOB 2UXTA 2R7EB 4PRHE 3FUDA 3NABH 4MD5B 2X4PA 3TXAA 5AKVA 2F1AA 5D7KD 3O3BB 1ZHBB 4XVUD 1M71B 3UBHA 3F65A 3APNA 4NIYE 5F2FA 4FQXB 4MXWH 5JW4Q 4X6BA 1AQ8A 2UWEF 2Z8RA 3FT4B 1QLRB 3I02B 1BIIA 4EXPX 2UWEE 4AW4A 1OV8A 5SX4I 2Q3ZA 3VFMA 3RRQA 2ESVD 3C6SB 3BIKA 1MZZA 2NZ9C 3QISA 5FF6A 5JLZB 5JOFB 3LEXB 1P84J 4I87A 3LV3B 2BNQA 2D7QA 2L4OA 2OXHB 1RIUH 3DX3A 3I6GB 5T1DH 2VKXA 3ZDZB 4KJWC 4L9DA 1A2YB 1MHHB 1QOKA 4KO6A 4LVEA 4UQ2B 3GIVA 1PVHA 1A6VL 1I1FA 2H2PC 4EIUA 5I0YA 2BSRB 5E99H 2PYEE 2C9SA 4Q0XL 4XMZA 1DVZA 4X6DE 5MP6H 1K2DB 4XPHL 4JHVA 4TS6A 1RHHA 2ZP0T 5C0AD 2BMKA 2FYVA 2VXUH 1KGIA 1D7CA 2B1OA 2ZUUA 1N7ML 5IMMA 1A7QL 1U8NB 3IN0A 1TO4A 3EBHA 2VDPB 4N2HA 3U7AA 2VRQA 3FQWB 3NIFE 4APQD 3TWYA 2DQCL 2EDNA 3CSYA 4HLJA 2W91A 1R5IB 5KANI 5LQBL 2K1MA 2AMGA 5GJSH 2OW6A 3BAIA 1KCUL 5GGRA 1DUYA 2XIBA 4IRJC 5TFSH 2KERA 1GTFA 1NFDF 3C87A 4RMBA 5EN3A 4DKEH 3TWCL 4WK4B 4RA3A 5ADPL 3I6KB 1NC4A 1QLFB 3Q1EA 3MGOB 2WIIB 3L3HB 3FDWA 3PNRB 4KO9A 2EDLA 4AQ8A 4HHWA 1J1XL 2H6OA 3WMQA 2EVFA 2CLZA 1KYUA 2FBJH 4XC3L 1KMGA 2NY7H 4TVPE 1PAZA 2BHUA 4CDHA 5ILTH 2X1WL 3ZGIA 2Q1EA 3NPSB 2ZWLT 1GS8A 4BH7B 2XG5B 3LEVH 3N2JA 3HI6L 4K9JA 1AQKH 1SBSH 1OM3L 3EDEA 4DGWC 2IPKB 2QHRH 2HYMA 3LPPA 2VO5A 3GI9L 1R47A 4K4KA 1CURA 5E8EA 5D1XC 5FM5O 5DVPA 2QGCA 3D05A 4C4KO 4ECNA 3VFRB 3H55A 3K5RA 3CN1A 4PBWD 2CR0A 1OY3B 3ARGD 4HJ0D 3ZMEA 1OCRB 4XN4A 3KR3L 5EBGA 5LCVH 3PU7A 3T6WA 3AITA 4JFFA 4R96B 1TCMA 4A6YL 1ZANH 3CH8A 3C9NB 4B9IA 4B9ZA 1WAPA 1UZGA 3VWKA 3JV5A 3DDFA 5LGKA 1HHKB 1UM5L 2NR6C 3DYMA 5D2NE 4BUHA 5B3JE 2JQMA 3RZCD 1QLEH 2B3IA 1HILA 5DO8A 2FZ3A 4AI7A 1UWYA 3NJGA 1VHPA 3HUJF 2A0LC 3APFA 1NFIA 2L8AA 4JDEB 3GSNL 2I32A 3S7GA 1EXGA 2PXYD 2V9UA 1TSRA 1L4IA 2OV0A 4NX0A 1TU2B 4APXA 2FR4B 2R4RL 4X98B 25C8H 4BK8A 3WCYA 4BFRA 4WI7A 4FFWC 2HUEA 4L3ED 4JFWA 4KO5A 2PKDA 3QUML 4U1GC 2Y7SA 3IU3B 1CC3A 1CLCA 2D7TL 2BOCB 4P2RB 4Q9RL 1DLFL 5HGAB 4IBSA 3UTTD 3F2LA 5TH2A 1FBIL 1MPAL 2CKBL 1FVEA 4WTXA 4BINA 1FZKB 3NIDF 3O6LL 3WLBB 5BXFB 3ZQWA 4WUUA 1KACB 5FYKU 5F9WB 1A6AB 2LVEA 3GNML 3RIKA 3PAUA 1NOLA 3ARBA 3Q9QA 3WO4B 2FJHA 3N44B 4WV1C 3MX0B 3L6FB 1V10A 1QEWA 4JRXE 1KXHA 4K73A 3RX9A 4OQTL 3VGEA 4ANVA 1A6WH 2DWSA 2AQPA 2BNQB 4Y2OB 2CKBB 4NSKA 5D9SA 1G9EA 4AUYA 3MRCA 2NY2B 3F84A 4K7PY 3OVUB 4YPGA 2VXUL 2VQ1B 4B6ZA 4JANA 3NSCA 4ZFZB 4BXVA 3QEQE 1QLEL 3MZGB 4NN5B 4FQXD 1E5ZA 3K4AA 3K6SB 1HOCB 3ZQ9A 3U25A 3VXPA 2R83A 3PDOA 5MEQB 3OXRA 4YDLC 3S3BB 3WKMH 1MWAL 3IYLW 4YK4B 2LAAA 3KW8A 3X13B 5F96H 3N42B 3BWSA 1K3ZA 1PG7H 3LKRB 3D52A 3Q5YA 4XXDA 4XI5D 1JFQL 4YHPB 5FS5A 3DJTA 2AK4D 3BKML 4K8RL 5SWSD 3SCMC 4R7DA 3VG9B 1E28B 4IS6B 3BC9A 1VENA 4HXBL 4LL1A 4NHUB 4RBPK 4LSVL 1HCFX 5AWNL 5EH1A 4FLQA 4W1TA 3GO1H 3GLEA 3U0WH 3FPXA 4F7TA 1PBYA 3S88H 1WBXA 1EMTH 2B4CH 1CGYA 3OPUA 5DZAA 1I1FB 1QWUA 4KTGA 1JF5A 1SLWA 4O2CA 3F7RA 4IBZA 4LSRL 2ROXA 5CEZE 4APQB 1ES0A 2AXWA 5F7AA 1KIPA 4PJXE 3L17A 3AGWA 4NM8H 1A3LL 4PIBA 2CH8A 5EUOB 4M7ZB 1CFQB 3AVEA 4PRDA 1XF5B 4TQPA 3D51A 3M7FB 4HHAA 3ULUL 2P8MA 5AOKA 4PJDB 1U6AH 3J27A 2L7EA 3POCA 5DD1L 1FNGB 4BZ2A 4KI1A 1UACL 2OR9H 4AG4L 3QJFA 4MA1B 2NZ1A 4LOUD 3RVUD 2AEWA 2JE8A 5HJ3B 1SXSA 1FYHB 4G9DA 4UU9A 1AE6H 3WAKA 4NQDE 5CEXB 1JWMA 3N43B 3T9WA 4UTAL 1HVXA 3BQUA 4HUCA 2XWDA 3RTQA 4QEGA 5CWSA 3INUH 1AHWB 2NZIA 5F3BB 3MKGA 5I26A 4IDJH 3RL1B 3IKCB 4C55A 3JVFC 4XPHH 3SOBH 1OT2A 4IDJL 4X8GA 4BCYA 5IMOA 4D9RD 5D2LA 1QLRA 3I02A 1S2EA 5LWYL 2QHRL 5JYLA 1QSVA 2EDTA 2VR9A 5BMFH 1S78C 4PJ9B 1R75A 3MV9B 1S8DA 1XGRB 2UXVA 2NX5D 4RETB 4PW9A 1P1ZB 4Z3IA 5I71B 2VYRE 4GO6B 1E65A 2F54B 4YPJA 2WCSA 3CMGA 4IOIA 2BZCA 1CXHA 4QMEA 4OAWB 1KCWA 4MDIA 1OF2B 1U58A 2IOIA 5A2BA 3MODL 3ETTA 4KROC 1HL8A 2VDQB 5C0BB 3IJEB 3O2WH 2H7WA 1XIWD 5EOCJ 3VI3B 5JHDD 5ICXB 4IM8A 1F4AA 2Y36L 5L6YL 1YYML 4CVUA 3QARA 4R83A 4B9JA 1W9XA 2B15A 4EIBA 4XOCA 4Y4HA 5K9OA 3ROOA 3TYGH 2EDMA 4J3BA 3RFZB 3H9SD 4DGYL 3VD3A 5E0QA 2BIQA 4N9OB 2NXZB 2QPSA 1SHXA 3JWDC 5D7IF 1OP4A 3UAFA 4PHXA 4PCTA 1AGBA 3ARFC 3FBQA 2WBJB 3S0PA 4HWEH 3IU4H 1L6PA 5EEYA 1EO5A 1E4KC 2HLFD 2WWNA 2Z3FA 3D69B 4G1EA 5D55A 5DC4B 1KTRL 4XAKE 3TA3D 3L13A 2H2SD 1FL6A 1NGWA 4YXKH 1XR8B 2V17L 3UJIL 3V0IA 1VFUA 3NJJA 3VH8G 5HGGS 1LMIA 3GSQB 4JFOB 5IVXF 3U4BH 5C7XL 4FXGC 1PJWA 3DO4A 4MBRA 1P0SE 1JNJA 4BWWA 3SBRA 4D0DB 1IGMH 2Q7NA 4NKOA 2NY1D 3HFMH 2R1WB 1ZLUK 5DYFA 1HINL 1X7SA 5GS0L 3SY6A 1ASOA 4NYLA 3TNMB 5GISL 3M6DA 1MCOH 2QPFA 3HZMA 3MNWB 2X89A 4ALAH 3UTOA 3ZKNC 1X5FA 4QHMA 1JZ5A 3OC8A 5JMRA 2R59A 2TAAA 3IDJB 4Z95L 3UYPB 2XNAA 5FK9A 3W81A 2FECI 3CBJB 3DUSB 1LO5B 2VDOB 4X4YA 2Y24A 2Q87A 4QLRA 1Y6KR 1SPDA 4FADA 1IGYB 3OL2A 4HBCL 5DCCA 5DRXB 5BV7L 3IFOB 5EORH 3AY4A 4KOCA 2CSPA 1YEKL 1OIOA 3MLUH 4PREB 4N2BA 4PJEB 4F7TB 4R96A 3MUUA 1N8OE 3UZVB 1TPXC 4KNSA 2AK4E 2A6JA 25C8L 1Y18B 1JL8A 3GZQA 3OV6A 4N5UA 5C0DB 2D4DA 1MFDH 4YFLI 4E5XB 2ED9A 4Z7IA 4YL4A 1CDYA 5J06A 2CWRA 3PWVB 5BRQA 4R90H 4HISA 5I0ZA 2BPBA 1YPZF 1TCRA 1W6LA 2VIRB 3OG4B 5BV7B 2CDFB 1JK9A 4M8VA 4Z7NF 2QTVA 1USQA 4Z6AT 1PZUB 1U92B 3NZHL 2DBLL 4U0RC 4Q97A 3QIUC 2V2WB 1G7PA 4HIJA 3DJSA 1YECH 3FXIC 1J9TA 1NUNB 2YA1A 4WWOA 1ED3A 1CFSA 2CRMA 5FIEA 3KGSA 3L8QA 1IB5A 1JWUA 4LGRB 4PP1D 1NKRA 5GGVY 3WBDA 3GS4A 3E9TA 4FLOA 3G6DL 5IB2B 3ZUNC 4ZMYA 3QXVA 4HIXH 4MA8L 2EKJA 1JXKA 1HOEA 2XZCL 4CNIA 1YMHB 1HJBC 2OMWA 1PLGH 4JUSA 3EHBB 1T21A 1T7YA 2OP4L 3H9SB 2RCSH 4AQ1A 1T2QH 3MCYA 1SXZA 4JFZL 2R69L 4DEPB 1JFQH 1MRFH 3VFNA 4CN4A 5EO1A 3PV7A 2JJSA 3U0TA 4JHBA 1MWAH 3MV9A 2VSCA 4Y5XC 1DDHA 5IK3B 1OSYA 1G6RH 1I3RB 4N8VA 4POZD 2I9TA 1A8JH 1I53A 1LDPL 2VERN 1ZLWH 1CR9H 2NMSA 1BDYA 1AXTH 4J4PA 3CH1B 4JANB 3SPHA 3RL2A 2XZQL 2Z4QA 3MVSA 3T08A 3DC0A 4OJCA 1JNHA 4R9HA 5AW3B 1J18A 5DS1A 5EU7C 2XA8H 2YGNA 4HIHA 2ARJA 4G43B 4PJ9D 1A6WL 1PIFA 3GHBL 1CVRA 4RGMB 3T65B 3FT4A 3IEAA 3I9AA 1A6TA 4I3SH 2ICWB 4JPVH 3TT1L 3ZMNA 3E3QE 3CBKB 3HG3A 3CD4A 5DRZB 1TJGH 3QZMA 5EOQL 2V9TA 2V5TA 4OLEA 5D2NB 2EIKB 1WHPA 2QADC 2HT3D 2Q3XA 2D9QB 3FO0L 3HRPA 1T03L 4PV8A 3DTXA 1WFOA 3VU1A 5E2UL 1FE8H 1PIGA 1P4BL 4E41A 4PRNB 4KTEH 4YBHA 3QJOA 4B5EA 4X9FA 5L7XL 4FEIA 5GHWH 1U3ZA 1KWKA 4W70A 3X3GL 3VA6A 2ZYSA 4NHCL 3T77A 4IOSA 3LZRA 5HPMB 4LSUH 4ZXBB 2XQBH 3VGFA 4FNPA 3KGUA 4NO3B 2QGBA 4KQ4H 2KLSA 4M5SA 4PMEA 4AT6B 1T1YB 5KEZA 2ZXAA 3KPRB 2CDGA 3U9UA 4X0KA 3MJ6A 4R4BB 4Y5YC 5DFVD 2AS5M 43C9B 3CVCA 5CR1A 3UTSB 3VXNB 5IM7A 1EEYA 2YAHA 3RG1C 3SDAD 3T1FA 5IESL 2HWZL 3N55A 1AHWC 4PJ5B 1BFOB 1B3IA 5D1ZC 5AVZB 3IDXL 3QZPA 3FUIA 2WO3B 2JKXA 1NLBL 3DX9B 1DQLL 3UBXG 3VUAA 2MPAH 3QJUB 2CM6A 2JKJA 3K2KA 1T6VN 4QTHA 1Q0EA 5K9JL 3HIZA 5F97E 3HJEA 2DQUH 1ITBB 3P4OA 1JWMB 3AB0B 1CDHA 2WKOF 4OB5H 1MCIA 4WEBH 2VW7A 3CFKB 4LNRB 4NO0A 1LEKB 2HKHL 5D5MF 3TBWA 5CD3B 1KXQE 4QIRA 3LD8B 3RNKA 4DKTA 2EDHA 4R0LB 2VR5A 3MLZL 1QABA 1P5VA 4K8RC 1TEYA 2DMGA 4ZMWA 4Y4FC 1ZT1A 2H8PA 2ZKXA 3NCMA 4ONFH 4LPYA 2F74B 2N0MA 4NQSB 2Z9TA 4GRWH 3EOAB 3OSKA 3GMNA 4HIJB 4KXBA 4MSWB 3EOYG 5DA0B 4UQBA 3D0LA 2FYYA 3IJYB 2VM4A 1AIFB 5F9OL 3PL6C 5I1LA 2PCPA 5FO9A 4AMXA 4TULH 5JO5B 3HHRB 1R0AL 4H2AA 3HNSH 4PS4L 4IRZA 4UT7L 3FCTB 4ZTEA 3SKJH 1FJ1A 1AGFB 3TVMC 2BP0B 4J3VA 3LZOA 4HFWB 1NSNH 1DO5A 3WN5A 1BVZA 1NSNL 3C5ZC 4PJBA 4GUPA 3FFCE 4NAMA 1MFCH 2PTUA 1GGBH 3VCLA 7FABL 1T80A 1G1CA 2NDFA 3GXFA 4G72B 4XVTL 1S9WB 1WWAX 4G6KH 1BQHG 3A22A 4R7VA 2H3NA 3U0PA 2IPUG 4WNSA 3MJ9A 1ULVA 3FO9B 3HE7A 2XWRA 3PJLA 5ICYA 3GFUA 2HVKB 3BE1L 2ZOLA 1UFGA 4ODWB 1DQKA 4RVBA 1P7KA 3GHEH 3Q6FB 4LCWB 1XIWA 1ZGLA 4QAMB 4BE6A 1RZIA 4YSDA 2OLDA 2YQBA 4FZEH 3QE5A 5CCKH 3BZDA 3K3QA 3CN3A 4K9EL 1OQXA 4HD5A 2DYPB 2YD1A 2R1WA 2HT4C 5FA4B 3O2DA 4N2OA 3FU7A 5C0RL 4PVMA 1YLBB 3QIWD 3TNNA 3FMGL 4MYWB 2VNCA 2CJTA 2NX5A 1CICA 1N0LB 1ZTXL 3A24A 3GSXB 1MFNA 1GGIL 3DYOA 3FU9A 1G84A 2NTFB 3MX0A 5E6ID 4QHMB 3ARFD 3BVNA 3X2QB 4AGPA 1FHGA 5HI4D 1AD9A 4LLQB 4Z7UB 3FU8A 5DLML 5F6IB 1U8IA 3D3VB 3KG5A 3BP7A 3O0RH 5J12C 3UTTA 1LE9B 3QPQD 5F7KC 3VE0A 1BFVL 2WWMD 2APVA 4L1HA 1JK8A 2APSA 1O6TA 4HSCX 4NRYB 1HHKA 3G9AB 1QRND 7FABH 2UY7A 5CIPB 5F1IA 5HPMA 2QSCH 4L29B 4JBSA 5FEBA 1MQKL 2YS4A 4UQ2A 5BZWA 3FT3B 4O02H 1A3QA 3DRQA 1JAEA 1YEFL 3H42L 1OCCB 2HJLA 1JZ3A 2BO0A 4I1PA 5BVPH 5CINH 2N0KA 1M3JA 3PABB 5A2LH 3FUHA 3U7WL 4L9LA 1FQ9C 4JL2A 2B59B 5HHOD 3G6JB 1CTOA 4AMWA 3KYNA 1A14H 2P43B 4TSCH 4FMVA 3MRFB 4NHCH 3NCXA 4PTTA 4PJ5A 1EHAA 5CLTA 3STZB 2FJGB 3UCRA 1NCWH 2YXWA 4DKAA 2EE0A 3F8UB 3V6FB 3QEQB 4ZAKC 2EUVA 3ZK0A 5FCUL 1BWMA 3P0VL 2W0LA 2K8MA 4M4RA 1Q9KB 2XZZA 3TFKC 3ZE2B 4AVHA 4LESA 4PJ8C 1SJEA 2ZCZA 1B2YA 3U4EB 1GMIA 1AXSB 1DJSA 2YPLB 5T1KA 2X88A 4K15A 1MHEB 4BZYA 2ZCHL 2FO4B 3I9GH 4NJAL 4L1SA 1NA8A 2BXZA 4JM4H 4Y19A 5ANMA 1FBIH 2C4XA 2VMDA 5LAXA 1K4CA 1KTBA 3HE6A 3K2MC 4MA3A 4V1DD 1E4XI 2HAZA 1BMWA 3ZYIA 3GHBH 4WI2A 2J56A 4YSOA 5EO1B 3PIQB 3M1BB 1IAOA 4FTVA 4GAFB 2PR4H 1WWWX 1T0OA 3LCYA 5HHNB 2KZ1B 1G9NL 3HBQA 2RQ8A 4N22A 1CYWA 2OK0H 1E43A 1QTYT 4TF4A 3TWCH 5ADPH 3TT3L 2KHAA 3CFNA 2V2XB 5LNEA 1F3JA 2GSIB 1YEFH 2BNRB 3VXTA 4AYBA 3BQVA 5LBSA 3ROLB 3SODB 3EO9H 2MHAA 4HSAC 5L2KD 1VACA 3OSVA 4MAYA 3O8XA 3OC5A 1JV2B 1C12A 2IALB 4S0TD 1IE5A 2VDLL 3VYPA 4PGCB 3GXPA 4H8WH 4ZS6D 4CDGC 2HFFA 5IFAL 4OM1H 1HDMA 3SYCA 3O3EB 3WGUB 4IRSC 3P9LA 3BUIA 2X4RA 4PY8I 1HYRC 1S8DB 5DRZA 3VWKB 2A38A 4JY6A 1DJXA 2QPDB 4TUOA 3IAQA 1EJOL 4F2MB 2X4NA 3RIFF 1T20A 2K9FB 8CGTA 1G9MC 1BA9A 1FLTX 5GSRA 1HWGB 4U3CA 4RGNE 4MJ2A 4CW1B 5FYLH 1Z9LA 1VGEL 5HYJD 4Z7UF 2E8YA 3S35L 1F45A 2P52A 4GRLA 3IMBA 1TQTA 3SE4A 3S48A 5CIPH 4PGZA 3RYMA 5IQNA 1FO0L 3VYOA 4KK6C 3FOLA 3NACH 3UIZA 2HRHA 3CZFA 5MI0C 5JUEH 1BD2A 3W1ZA 3E38A 1BZEA 2HLFC 5EUKA 3ZE1E 2WMPA 4L3CB 4ODSH 1PZ5B 2PXYA 2DIJA 1WK0A 2ZX8A 4FNLL 3WIHA 5J1TC 2RAMA 3ZE0E 3CVHA 2OSLA 3PFQA 5E8OB 4F7PB 1YDPB 4GP4B 5B1CA 2YZ1A 1H5BA 3C5JB 1NIEA 4S0SD 3QUHA 5CJ5A 4RIRB 4ZFFB 2NLJB 3VD4A 1QO3B 2HRGA 2JWYA 5T1LD 4WI0A 5A43C 5C0BE 3G08A 3G6AA 3DBXB 2HFEB 1IC7L 3S5YA 1MVUB 1KSRA 1MWOA 4JFED 3Q8BA 3QORC 4WJG3 4AH2B 2ZCLH 2HVKA 1VAHA 2MQCA 2PYFA 3F7LA 1RPQA 4UQEA 2COVD 2VQ1A 2EYSA 3RBSA 1QPPA 3FT3A 3ZT6A 2BY3A 4TVPL 5D72H 3KBPA 3VO0A 3EYUL 5DRNB 1HINH 3L7FA 1AS7A 3DIVA 1LTXA 4RAHA 5KN5B 2WUCH 4MA1C 3UYRH 5LLIC 5IVNA 2YPVH 1PPIA 1OSPH 5E4EC 5KBLA 1CIDA 4P46B 2P44B 4FFZH 1CICD 3D34A 1JV5A 1CD8A 1PZ3A 1T83C 3MLZH 1CF8H 2E74C 4P57A 3FRPG 5K59E 3IXTA 3R06B 2E0PA 3VXSB 5I0WA 1MAMH 5M7QA 4LLWA 4NENA 3BWAB 2F18A 1U93A 4JG5A 5EBWB 2LLNA 4G8FA 3CDCA 2NY4D 1FAKT 1X7QB 2ADIB 2JTYA 3FCTA 4KH9A 2DTML 4W9DC 5D71H 3EYOA 1MCCA 1DJHA 2C9QA 1DFBL 3V5KA 3LPFA 4CSSA 4N0FB 5I24A 1FZJA 2OSYA 4I18C 35C8L 4H5SB 5IJKC 4EQ3A 2NR6D 4JVPA 4YXHL 3VXRB 4RA0C 2C9UA 1MG2C 4G1EB 1S9WA 5EU6B 2IQAB 4FTVB 5F6HJ 3UTSE 1LO2H 1KFGA 2IDQA 3PAYA 5ID1A 2CD0A 4EI6A 5FX3A 2YOCA 3G5XA 4RFNC 5E2WL 4H8WC 4PWHA 4G6MH 4X6DA 1TITA 4XH2B 3MMEB 2XN9B 3UACA 2J44A 4R84A 1P5UA 2R2CA 4XXCC 1XTLA 2ENQA 1DVFC 4XMWA 3S5LA 3F7VA 1TTRA 1VSCA 3PP4H 2XFGB 2K4AA 1BREA 4LCCC 4PWFA 1NFDB 3FOMA 4QD2E 3LSOA 1TQBB 5F7UA 3HPLA 4HIEB 1NEZG 5I2IA 2G3XA 3FQRB 3BE1H 4U6TA 1ETJA 1M7IA 4NPYA 4POZC 4TLSA 4QRUB 2VDKB 4TSBH 3SKJL 1A9EA 3PV6A 5LGJA 2J8UE 3N3EA 2Y07H 4X4YB 3CN2A 2DQFA 3QJSB 5I28A 1AE6L 4N6QA 3IKKA 4KFZC 2VLLB 4CC4C 2V7NB 1GGCL 2IC2A 2ZXQA 3PXJA 2EXWD 4YXLL 5IB5A 4HIIA 2R9HD 2AEPH 1OW0C 2BZDA 2WLNA 3H3BC 1U4EA 5IQOA 2E76C 3BPLB 3GGWB 2VLJE 1MFUA 4IOFD 5H37G 4P2QE 2WSDA 3KDPB 2E7BA 5IUSA 1J1OH 5IBTL 2UY7B 5CIPA 1UXLA 2YD5A 3DX6A 5F1IB 1G7IA 4OGAC 5CR8A 5IV2A 4UQDA 4XCNB 4PFEA 4HXAH 4MCMA 3UGUA 3D08A 1QRNA 3RGVB 1WT5A 2CAKA 3BVUA 1JHTA 1EJ6A 3QCUH 1JN6B 2CA4A 1DQIA 4Z3HA 2XN1A 5IMKA 1ZXKA 5C9JA 3ILPA 5EBMA 1DBAL 4KXZH 4N2GA 4X9BA 5HHMB 2WLLB 3AXLB 4U1MB 4OFDA 4G6AC 5D1XA 3OHXC 5A2FA 1Y07A 4CKQA 1ID5I 1T66D 4U1NA 1J7VR 1JPGB 2HT2D 4YDMA 3HI1B 4YVUA 3O3BA 4WHYG 4ODHL 2NY4B 2WTRA 3WI9A 5A1AA 5J56B 4ZUUA 2P5PA 3FF7A 3I6KA 4JX0A 4MQXD 1GR7A 2WJ5A 1ZIAA 2N59A 4R5VA 5KBPA 2F5AL 2PYFB 3ALXA 1BZ7B 4GMSL 1MVFA 5PCYA 5D1ZD 5I73B 4ONGH 3B9KD 3S37X 3EW3B 4KQ0A 2DLHA 3FSZA 4HAFA 1T0NA 4FI6A 3LKOA 2QV2A 3V5HA 2QPUA 1J9RA 1CIUA 5DR5L 2MH4A 3SDDA 3IE9A 3A6CH 5ITFB 5I1DB 3LV3A 5DD0H 1PNCA 2I9TB 1IAOB 2JQZA 1KLFA 2QKIB 2MMXA 4GBXD 2XICA 4WLCA 2K4WA 4ZUTB 5BVPL 4U2YA 1HXMA 3CFEA 1SEQL 5CBEA 4HBQA 2V4LA 5CN2A 4LSPH 4BSVB 5E8OA 4ZAKD 5DVKA 2GITA 3WEAA 4AK2A 4C4KT 4HIHB 2BVYA 4NQCE 4S1QH 2BW5A 2ZKMX 2OMZA 3NJVA 4MCZB 2BWIA 4NQEA 3AS3A 3CSGA 4A04A 4YSUA 4OZGE 2DYRB 5KSBE 3WEXB 1M2VB 3RJDA 1JBJA 4YOKA 5B3NA 2Y7MA 1WA1X 1D5IL 1YMMB 4QXGH 1BD2D 1KY6A 3QORD 3T0EB 2ALAA 5T3XE 2FZ3B 4JJ5B 1CO1A 4PD4K 4TVPD 3T3PE 4ODSL 1N9PA 4Q6IA 5EU6A 3FCSA 5IBTH 3KPPB 2Z91A 1A7OL 1OO2A 4X6FA 1Q72H 1XF2A 5I1HL 3CMOH 5D1QC 4YLCA 2ICWI 3C5ZD 4ANXA 2W65A 4MB5A 1YJDH 4JKWA 4U1SA 5HYEA 2W07A 2AC0A 1DE4A 1DO6A 4CBPA 1KJVA 4HPYH 5JXEC 1JGDA 1WA2X 1OCWH 3WFBH 3D85D 5HGAA 4B9KC 3Q5TA 1NFDA 3FOMB 3M1OA 3MCKA 5ENWA 1XR9A 3HG1D 2X4OA 4CC4A 4GXUN 3WKNA 4GRLC 2BC4A 1ZV9A 3V0VB 2VAAB 5L4JA 1A1OA 3VM5A 4X7FC 1MFCL 3FQWA 3QBTB 3BKYH 4NKMA 3FRPA 1G94A 1HILB 4PCSA 1O7DC 1E3FA 4EAEA 2VLKD 2X1PA 4HALA 4UZUA 2HVJA 5BZDB 5JPMA 1QATA 2JJTC 3IMSA 2ED7A 3I3BA 3OKMB 5I23A 3IE4A 2RCSL 2HTLD 4X8CA 1WSST 2NY6C 4YWGL 2BNQE 2AITA 3CVDA 4JY5L 4RQQB 1H5BC 3X11B 1KENL 1EZLA