1OALA

Active site copper and zinc ions modulate the quaternary structure of prokaryotic cu,zn superoxide dismutase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
151
Chain Sequence
QDLTVKMTDLQTGKPVGTIELSQNKYGVVFIPELADLTPGEHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Active-Site Copper and Zinc Ions Modulate the Quaternary Structure of Prokaryotic Cu,Zn Superoxide Dismutase
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Oxidoreductase
total genus 38
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1oalA00
2ZOWA 3QQDB 3KBEA 3L9EA 2AEOA 2VR8A 1N19A 4U4IA 1EJ8A 1Q0EA 1AZVA 1YAZA 3MNDA 1SXAA 2WZ5A 1B4LA 1SXZA 2WKOF 3ECUA 2AQTA 2E47A 1PU0A 2WYTA 2GBUA 2Z7ZA 1HL5A 3LTVA 2AQQA 2XJKA 1TO5A 2APSA 1COBA 1E9OA 1OEZW 1SDYA 4MCNA 1Z9NA 2Z7YA 4A7VA 3GTTA 3PU7A 1SPDA 1IB5A 3K91A 2JCWA 2JLPA 1E9PA 2Q2LA 4A7UA 2XJLA 4N3UA 2ZKYA 1SXCA 3GTVA 5CU9A 1JK9B 2AQRA 2AQNA 1F1DA 1OALA 1BA9A 2Z7UA 2ZKXA 4A7TA 4B3EA 1OZUA 2C9SA 1YAIA 3SODB 1P1VA 1S4IA 2GBTA 4FF9A 4BD4A 1SRDA 3KH3A 3KM1A 2WKOA 3H2PA 1SDAB 2VR6A 1QUPA 1F1AA 1MFMA 2C9UA 3KM2A 2WZ6A 4MCMA 2Z7WA 1IBDA 1TO4A 1FUNA 1N18A 4A7GF 1HL4A 2NNXA 3GZQA 1OAJA 2GBVA 2AQSA 1PZSA 3KH4A 1RK7A 2ZKWA 3CE1A 4N3TA 1E9OB 1OZTG 4A7SA 3L9YA 3T5WA 3CQPA 4OH2A 2V0AA 3HW7A 5KBKA 3GZPA 1SXBA 2WWNA 2R27A 2WWOA 1E9PB 1PTZA 2LU5A 3ECWA 3ECVA 3HOGA 3F7LA 1U3NA 2E46A 1E9QA 4BCYA 1XTMA 1CBJA 3CQQA 1IBHA 3HFFA 3GQFA 1IBBA 1L3NA 1EQWA 2WYZA 1DO5A 3S0PA 2C9VA 3F7KA 1CB4A 3RE0A 1Z9PA 4OJAA 1YSOA 1KMGA 1JCVA 2K4WA 1SOSA 2SODB 4A7GA 1XSOA 1E9QB 3MKGA 3QQDA 3H2QA 1SXNA 5KBMA 1ESOA 2AF2A 2VR7A 3GZOA 3KBFA 1F18A 5KBLA 1JK9A 1B4TA 1IBFA 2WZ0A 4A7QA 1UXLA 1F1GA 1BZOA 1XTLA 1SXSA 1DSWA 2AQPA 1UXMA 4L05A 4BCZA
chains in the Genus database with same CATH superfamily
3K2IA 1WSST 4XCFH 1Z5LB 2X4UB 4O02L 3NEXA 2KLRA 1KG0B 1NAMB 3P0GB 4MTMA 1GCYA 3IK2A 2Y7OA 1HSAA 4U31A 3DI2B 1IFHL 2NYYC 2IFGA 1EJOH 3H9ZA 3L6FB 5TQ2L 5BZWB 3OMNB 2OKMA 5KVFH 4PJFE 4S1QH 3ZT5A 5HD8C 2WSKA 4E9LA 1AS8A 1R6VA 5AOLA 3U7WH 5D2LA 5EOTB 4OJYA 1R33A 3W0WB 1JSYA 3IE9A 2WQAA 2AK4E 2WUCL 5IUCA 5DDHA 4O9HH 4XOEA 1U95B 1MW1A 5FK9B 3DJTA 5DHVA 5ELIA 1JFQH 2JB5L 1TEFA 4YXLL 1L7TL 5E24E 1A5FL 3E0GA 4X83A 4UU9A 2OP4L 1OCWL 4WW2C 4ALAH 3GXDA 4YZFF 5TQ0H 3X1NA 4JFFA 3VE0A 2B3IA 3GTNA 1Z0NA 3CPUA 3DTXB 4HPYL 4LSUH 1EXUA 4XZUB 4JFWA 4UT9H 3CDZA 3T6WA 3OZ9H 4X50A 4PJ9C 3P0YH 5E6IC 3VD4A 1UA7A 4GAYA 5FHBH 2X2IA 5TFSH 2FIKB 2GVYA 2AQ3A 4CJ1A 4KJWD 3SDXE 4FHBD 1UA3A 4JHBA 4ZUSA 2H45A 3E8UH 5IBLD 1VESA 5F7UA 4U0RC 1SEQL 3LMJL 4N0UA 3QWRA 3GZQA 1A66A 4TVPH 2GBVA 1W15A 5J3HD 3UC0L 3GPSA 3ZKMD 1QR1A 1HCVA 4O58L 4KNQA 2HX9A 1D7FA 1KTLB 2NZ9D 3ARFA 3OAZK 5DHYB 5T3ZL 1S9VA 1HILB 2OJEA 4P2YA 5T3ZE 4XX5A 5TPWL 3KPTA 3WFHA 3PHOA 1K8IB 2NY7L 1QSFD 4KOBA 1JZ3A 1CE6B 1OAKH 2EDNA 3T3ME 1LLAA 1ZDSA 2G5BB 3QORD 1LWJA 2CPCA 2R4RH 1NZRA 4P9HL 4XXWA 3TJHD 4P3DB 5AKSA 2ZUUA 3UYPA 2K70A 1NINA 4QRPA 1OKEA 1S5HA 1ZK5A 5A2BA 4P46A 4AGMA 4ODHL 5HHNB 5A2CA 1BYNA 1VB9A 2IPUG 2JFCA 4DVBA 1V10A 1RKRA 3QQDA 4F9LA 2F53B 3A6OA 4NNPL 4XAKD 4N8UA 1JGEB 3GDBA 3QUYB 2AQ1A 2E4TA 3GXIA 3MOBL 4DUXA 2YD5A 3QJQB 4IOIB 1AYOA 5F8RC 4E9XA 3WDJA 2IWGA 5FA4B 1ASPA 4GG8A 4JQIL 4MQ7A 1JHTA 5FKAB 4YFLF 5BV7B 2J5LB 4HXAL 4UNVA 1BQHA 1DE4A 4AIZA 4QF1B 3LIZL 3HTLX 4Y4HA 3MJ6A 2WK2A 2OR9L 5L4IA 3BFQG 1T83A 3CBKB 4QWWC 4H8WC 3ILEA 4ANKA 3IFPA 4LVNB 4FL4C 4FNRA 1PBYA 1CLYH 3KWXA 3QXAB 3U9PH 1BPVA 3ARQA 4PJHA 4GW4A 4HLEA 3LNGA 3NA9L 2R29L 4FLHA 4KROD 4QJ5B 3CZKA 5TD4A 3MLVL 1SN2A 1B4JH 3VWKD 4KZDH 3Q1SL 1WUZA 4FZ8H 4YHKL 3CN3A 2YEQA 2WLJA 4D0DB 3PDGA 2O6PA 3BMVA 3V0HA 5DA0B 5DDHB 2ATKA 1OZUA 2EUXA 1IT9L 4NP4L 4YHIB 3P4OA 4NM4H 1N4XL 4NKIL 4YBQD 3AXHA 5DK2B 5C0CB 1F11B 2ICWJ 5KSBA 2XX1A 5A43C 1WHPA 3R06B 3SBWC 3VACA 5E4EC 2ICEC 3CQFA 1DR9A 3S37X 1HN1A 1ML0A 3FTWA 4JFFB 4ODWB 1MUJA 1U8QA 4N2HA 2ZWYA 1EBPA 1GH7A 2X70B 4HWUA 3TF4A 2AXHA 2VKXA 3HI1A 3O6ML 1O75A 3PAYA 3KPMB 3TO4B 1E43A 2EP6A 6PAZA 3TA4D 5FM5O 4F57L 4JGNA 2DMBA 2GC4C 3BLKA 5IJKC 5H4YA 3L3KB 3VG0H 5CINL 2XN2A 2YXVA 3L2MA 4ZUSB 3UZVB 4C83A 3B34A 2QLYA 4I77L 1AQMA 1ZLWH 3VGFA 5SX5H 4Y2DC 5ESQB 3Q1SH 1IGCL 2FECI 2NMSA 4XVUD 2B3RA 2NY4B 1UM4H 2CLVB 3AXIA 3UYRH 3HBPA 4MMZA 4L3ED 5LAPA 1KFAH 3VI3A 3ARFB 4P4RA 5EORL 2A4ZA 2WLKA 2OJEB 4Z3HA 3SKJH 4AENB 2A9AA 1DVQA 3X13B 4KXDA 1D5XA 4FNUA 4ERSL 4F5CE 1KTRL 2PYEA 4NERA 3CGTA 2UYLB 3UTTA 2PMZA 5C0GA 2RR3A 4S0SD 3VXRD 3QG7H 2IEPA 4TL4A 4LARL 1TVHB 1WFOA 1DUYA 5EUKA 3GZOA 1CLOL 3EH3B 1FZOA 4PJBF 2A4EA 3U1PA 3VXSA 4LSSH 5DUPH 2ZG3A 4CVZA 5C9JA 3CFDB 4P46B 4F9PA 3V4PH 1OIOA 4BFGA 2XG5B 1IM3D 1FZJA 2BNQB 4HK0B 4NXKA 1FFNB 4PWIA 1S7QB 4FE9A 3R1GH 4DVBB 5D72H 1KCUH 3QQDB 3C6LA 4Y88A 5T5FA 4LCCA 4B5EA 3FHQA 2WGNB 4G42B 4GKZB 3UJIL 3EFOB 3MUZ1 1UQSA 4O2FB 3TYGH 5C0AE 4E41D 1N2RB 3QDJA 4FQJL 4GT7A 4NQEA 2Y0SA 3TP4A 3HHSB 3V0FA 4CW1A 4MDJA 3RL1A 2CJUL 2DMKA 3BPLB 4GG8B 3QZWB 3VFOA 4G70B 4MQSB 4FAAB 4UNTA 4HS3A 3B9KB 4Y5YB 3TWYA 4XP4L 1DE4B 4JO1L 4JBSA 4U1HB 4AIZB 3ULUH 3ARBD 3KJ4B 3MGAA 3N85H 5FXCH 4FEIA 4DQOL 4Y4HB 1J5DA 2Z92A 4PJEB 5EU6D 5JNYA 1CUOA 3IWVA 1CGWA 2NDGA 4JFHE 4QRRA 4WI2A 2X40A 2O93L 4XPFH 3WXVH 3BDYL 4LLQB 3RIKA 4HV8B 5D1XE 4P9HC 5I1GL 2BZ7A 1SEBA 3JV5A 5DFVD 4XP5H 1B0GA 2ZF9A 2FVNA 3K72A 2QR0B 3TPUA 3FONB 1HKLH 2CBQA 4XP1L 4L5FL 1GGUA 2YBRA 4CGTA 4XNZB 4P4KA 3IDJB 4L5FE 1K4CA 1YLBB 2AABL 2Q86A 3MBXH 4L8SB 3EYUL 2EO1A 4GQZA 3SGJA 3UTZB 2DLGA 1WWCA 3OKLB 4FTDA 4K94L 2UZXA 3UTOA 3ZDYB 4Q2ZA 2P5PA 1TJHL 2I5YH 3EYQD 3FCGA 4BSWB 4B27A 3PWUA 4JRXA 3P11L 5SWSA 3VRIB 3VSVA 1OM3H 5CEZE 2ZWLT 4PRHB 1MHPH 5KSBB 3FMGH 4M7ZB 1PZSA 2P8MB 4PN6A 3TTSA 4ZMZA 4PPTA 2BSRA 5BRZD 1QSVA 1C5CL 1DQLH 1VACA 2Y1AA 1KJ3H 3MUY1 5K9JL 2FHBA 4H5SB 4FMFA 3S37H 3V0IA 4K2UL 3HI1B 4L9LB 3FU6A 2BX5A 3IDNA 4G3YL 5DJ2B 1OP3H 2R4SL 5I1AB 2J6EL 4XCYA 1I4FB 4KKAC 4M93C 5HHOA 3HRPA 4ZOAA 4HYTB 3GUFA 4OQ1A 2OMXB 3BVTA 2V2TA 2AABH 2EVFA 2ZCHH 4JVPA 3BHBA 1VGKB 1LMIA 3MU3A 4NPYA 3WIHA 4LCIL 3VI3B 3BDBA 5KVEL 5DK0A 1NMAL 1AQ8A 3KBFA 1VIWA 1Z5HA 5FUZH 5KVMC 3JWNH 4DKEH 4OUOA 1D5XB 3IJ8A 3LV3B 4DP2X 2PYEB 1KJ2B 2D8KA 1TXKA 3Q8BA 1E40A 1I3UA 1MFDL 4WU7A 3TEUA 1EXGA 2BNRA 1LEKB 3B1UA 3B2UC 4U4IA 5EUKB 2UWEB 2F18A 1FZOB 1PKQA 1NIBA 1QBBA 3IRZA 4K2UH 1PF3A 2WP3T 3FPYA 3PP3K 1LE5B 3UAJC 5CJQL 2FWOA 3DVIA 4QOKD 5LGYA 1WFJA 2DIBA 3UROR 3F7YB 4OZIB 2VDNB 2JCCF 4RZCA 5DR5L 3SJVA 4JM4L 3WEBA 4KOCA 3WNPA 2FH8A 3KR3L 4TVPD 4GSDH 2RCSL 3BCDA 3QDJB 2Z1KA 4D8OA 4RSVA 2VJ0A 5E8DL 2HX8A 2GJ6B 4UILL 1KPUA 5E99H 3SE6A 1IAII 3RL1B 4H1LB 1XGQA 4IEFA 1KZYA 1YEIH 4LCIH 5KVEH 1NMAH 5J4MA 1DQQA 5TDPB 4ZW5A 3FU9A 3APNA 2OMYA 3JBG7 2X6BA 4V33A 2BWDA 3BZ5A 4FKKA 4N85A 1J18A 2FO8A 3HNTL 2V9UA 4FXKB 5DJYA 4PJXF 3WFEL 4UBDD 2Q3AA 5HVWA 1B4RA 4AJYV 4JS7A 3TX4A 1HTYA 1MSPA 1KIPB 4L8DB 4AEIH 2PWHA 1VEOA 4BZYA 4ZFGL 3FO2B 3MROA 5CGTA 4B9ZA 2VL5A 4NNXB 1T4KB 4HF5H 1T4WA 1Y6MR 4RAUB 1K4CB 4K0OA 5C0DA 2Q86B 4DGYL 1I1FA 4HWEH 3EO0A 3GMPB 1CE1H 5GRUL 3DNKA 4E9YA 2X6MA 3C5ZD 1RERA 4J2QA 2O6EA 5KANI 3EO9L 2Z31A 2QMKA 2ZAIA 3LN5B 4YJZL 2WLIA 3OAUH 3U2JA 4JRXB 3HMXA 2GJZA 3SGEH 5EU4B 3DBXA 3DX9B 3FULA 1HXKA 4GP8B 4KI5F 4KRNA 3SPCA 4F8TA 5DVNA 1JXKA 4AL8L 4Z7NE 4XBPA 3WD5H 2EDQA 3W5MA 1ULVA 2BSRB 3L81A 2MKWA 1VACB 1O6SA 1L5GA 1MAJA 4K7PL 2WNWA 1VRSA 4ISVA 3INUH 1PL3A 4AJVA 2EYTA 3HNTH 5DWPA 3IDNB 1XCQA 4JFPB 3TBVA 4K5OA 2IC2A 2BOLA 4KMTL 1CD1B 1E0OB 2CNZA 5AWNH 5HPMB 5D1XC 4MJ2A 2GI0A 4ONGL 4XCYB 4H88H 5LBSH 3OHXC 4YEEA 1PEWA 2WLNA 5F6IB 1ZS8B 2OZ4A 4XTRD 1SUHA 2GSGA 2Z64C 1NBZB 3OR7A 4KVCH 4PJ5B 4L05A 1GYCA 3DIFB 4WNSA 5C08B 5C0BA 3RRQA 2AXFB 2BVUA 1AQKL 5E4IA 4YDKL 1NAMH 2VZTA 5DK0B 3L48A 1NM9A 4G7VL 4K94C 4JKKA 5DS2A 4YHMH 1EDHA 1TSHA 1E4WL 4K8RL 5F96L 2EEDA 1UWXH 4JPIA 2P3YA 1N59A 4P2OD 4WU7B 5DYOA 5E2UL 2AEPH 2M2DA 3DI3B 3ILQC 2VT0A 4PJGF 4TQIA 5FO7B 4HJTA 1NMBH 3T04D 3SDCA 4OZFA 2GBUA 1WQVT 5T1MA 1S9KC 5GSVA 3WOVA 1PKQB 2YD0A 5LXGL 4RGMC 3U1QA 3NJMA 5AVXB 4BUGA 5L9DH 5EZLB 3ZT6A 2VOTA 4J1UB 2DM4A 4GKSA 1XSKA 3TTYA 4U05A 1SJEB 1OP4A 3OKKB 3QUXA 5E95B 3SJVB 4HWZB 2EEAA 3L9RA 2CUIA 4E5XA 3FSZA 3K5SA 3ZE0E 5JDJA 5C09D 6FABL 3KWUA 1KPUB 1Q9OA 4I89A 1GGCH 3IAQA 1FN4B 4KUZH 1I1CA 2IH3B 1EEQA 2J8OA 2IPTL 1YEGH 1A6AA 2WOYA 1T2XA 1X5MA 3BUQA 5GRVK 2Q8BH 2W07A 2ZQKA 2ARJB 1P6AB 5KVGH 2DLEA 5D7JD 2YUXA 4Q74A 1QUPA 1SHSA 3FH7A 2PW2B 1CIUA 3P69A 5F96H 4KKRA 4CMHB 1MQ8A 4U6XB 4XOCA 5ERWA 2XV3A 4HHAB 1FUNA 2W38A 4JPQA 1WICA 2EUVA 5BZXA 3O2DA 5JDSA 4ZW8A 3DUSA 3NCCB 5HVHB 5ADOL 3QIBC 3K6NA 1OZTG 1ZGLA 4ODVH 2DJSA 2V0AA 2VIRB 5GS3A 5DTFA 5FF6B 2EC8A 3MROB 1GGBH 3Q5TA 4GRLA 3EF4A 2VDKL 2YJLA 5HHPB 4MS8C 4OGYH 1A25A 5SX4I 1AFVL 2ZXAA 2A83B 3GBNL 4FQIH 1T1ZB 4QRSB 1JGVH 1KTDB 1EHAA 3VXQB 2Z31B 3E9UA 3HFFA 4ABUA 4QLWA 1U58B 5MERA 1YHPA 3D7PA 1FFPA 1MQKL 1K6QH 2VN6A 3DBXB 3ME0A 5IQNA 5LUMA 3C6EA 3ULUD 5AAWC 3WFDL 3U7AA 4HMDA 3L3IB 5BMFL 3QQ4A 4JKPH 5EULV 3ES6A 1NIEA 4LBAA 4DKTA 2P48B 5F6HI 4ANUA 2FYVA 1O6SB 2IVFC 1L5GB 1TTBA 4WJ5A 3UEZA 5F2FA 4YHLL 4GI6A 1N8ZA 2MNJB 2AJYL 3GI9H 3HS8A 3HS0C 4K3JH 2EYTB 1N5YH 2VLKA 1GPOL 3TA3A 3L3JA 5I1JH 1RIUL 5ADOH 4U3SA 3CZFA 1DJZA 3C2AH 4LEXL 4M7KH 2ZOWA 1U8CA 2XC8A 5TF0A 5BV7H 2YQ3A 3BKML 4DO4A 1A6TB 3FFDA 3OR6B 2L8AA 1X5ZA 4KH9A 3RVUC 2E9BA 2JJUA 3SDYL 1AFVH 4LE8A 1OGAB 1AY1H 2O5NA 3X1FA 3VFNB 3GIZH 1QNZL 3MRBA 5I17B 4ZXBA 4EN2A 4IDJL 3FL7A 4KK5C 3UPRB 5JIQA 1R3HA 1A3LL 1MCKA 1RZ8A 1YPZB 4GSUA 4G83A 2RIKA 4DN4H 4N8PA 4JPIB 4PJBA 3WN6A 3GHBH 2CO3A 4D9LL 1H8SA 5E5MB 4NZUH 5C0NC 5B38A 2J8UE 2XACC 3W38A 4N0UE 5D7KD 2OQJA 5DQ9B 1CFTA 4M6OH 5LGKA 1A8ZA 2F0CA 4I85A 4NUPA 3SKOB 1HZHL 3SDDB 2UXGA 3RWDB 1UT1A 2V7NB 4NHUA 4JM2D 3IXAB 3U83A 1RH8A 1BYOA 1NCUA 1TQBC 3P40A 2ZKHL 5FYKH 3EHBB 1T03H 3FQYA 4GKSB 3SE3A 4LEXH 4PLOB 3BGFC 3P2DA 3QUXB 5IT2L 2PWDA 5GSRB 2ZAGA 4AV5A 3TU6A 4MS6A 3SZ6A 3L9RB 3FDWA 3NABH 2J2ZA 5MI0B 3ZR6A 1EAOA 1DL7L 3NZHH 4HIJA 2R2HA 3UG3A 1YEKL 3HNSL 3Q06A 4I3RL 3RPIB 5IHWA 3DURA 1ZE3C 4XO5A 3LKPB 4MAYA 3TONA 3TCXA 1FYTA 1IQWL 3SPJA 1A3LH 1BEXA 1JDAA 1P6WA 2AEIT 2F5AL 5ERWB 4D9LH 1SMOA 5IHZB 1J1XH 4K8RC 4B6ZA 1CTMA 2B1AL 1CLVA 4NO0D 4YE4L 4B41A 4WCYL 5B4MD 4AI7A 2C1OA 4YDMA 1OOWA 1HZHH 4OIIH 4WSGA 3GM8A 1ZGLB 3PGFL 1CVRA 2W95A 3D5OF 4PG2A 2JKLA 1PJ9A 3X14B 3CVHA 1E6OH 4XE0A 3UG5A 4AQZA 2BVYA 2CLZA 2QVFB 5JTWA 1Z3GH 3MI6A 3VM5A 1W80A 1A6VH 3L5WA 4TLKA 1TJXA 1SOSA 5GS1C 3QPQC 3NSYA 4Z7VF 3GLDA 2QPEB 1J11A 3CFEB 5MENA 4PJHE 3RWFA 1OV8A 2WZ0A 2EE9A 1FFPB 1UXLA 3ME0B 2ROXA 2X42A 1R5IA 4KHXL 3ZDXF 1MCPH 4P0DA 2WAHA 3QQ4B 3FT4A 2Y6SC 2CLRA 1Q0XH 1FFOB 2DQTL 3UJJH 1BBDH 1M71A 1NGXB 4XXDA 2KYIA 4HSAC 1ZK9A 4ODTH 4LB8A 4WJ5B 4L0ZA 4CU7A 4MA8H 4CU6A 5LJYH 3QUYC 2VLKB 4AQ1C 4JHAL 4G82A 2CXKA 4XMPL 3IRCA 4ZMLA 1D5ZA 1MJUH 3JWNG 5FFGA 1LO4L 5E8PA 1AGEB 2NR6A 2ZP8A 1QNIA 4BKSC 4PIBA 4PVLA 5CEXA 1DBBH 5KTEH 1PKOA 2WBJA 4JPVL 4ZOBA 3NA4A 4BFIA 4LP8A 3BT2H 3LRGA 3I02A 4XNQB 2A74C 4OCXL 2FJGB 2C9QA 2V5YA 4PLKC 4ZXBB 3GTVA 2XCMC 2WO2B 4NN5B 1JZ8A 1WCBA 1JTPA 3BJ91 3ZHNA 2WY3B 2V8LA 2WYIA 4IK7A 2EDXA 1G7HA 2P8PA 3JSSA 1BAGA 3LVTA 4L37A 2OQJB 4BD4A 3WENA 4Y1TA 3AITA 4JFXB 4XMZA 5L2JA 1SDAB 2JCCA 4W9GC 3LKQA 1WFMA 4MXQC 5FOBB 1ERNA 2ZKMX 1NA8A 5I0ZA 2J25A 1CD8A 2DQIH 2FD6H 4JUTA 5C07A 3RDJA 3UERA 1SY6H 4FTVE 4X7TA 5A2IH 1R46A 1BV8A 2ZX7A 1AI1L 4WW1B 3RKPA 3UTTE 4ABQA 5EOCH 4OLEA 3FRPB 2DI9A 2J2ZB 3BW9A 3V4UL 2FJSA 4F33A 1E8XA 3VXSE 5A1AA 2R2HB 1P1ZA 3WFBL 4HCGA 1CGSH 3FT2A 2FH6A 3LKOB 5C0ND 1RHFA 1V7ML 1QFOA 3C5JA 4N9GA 3Q5YA 4NRZB 5T5FL 5DSCA 5C71A 1WP6A 1KPVA 1FYTB 5B1JA 1M53A 2A9CA 2ALAA 5I15H 3DYOA 3FQTB 3FO0H 4PJXA 1CICA 3W0WD 2Y5TB 4EZJA 4YHZH 1CU4L 5IZ7A 4NJAL 5T1LA 1IC5L 1H5BA 5DYFA 1YN6B 4L4JA 4NQEE 4XB3A 2CJ3A 5C0EA 2CUHA 4OV5A 4Q97A 3VFWA 2C1OB 5B21A 12E8H 2XXCB 1E7VA 4ZQTA 3ISYA 4OZ4A 2V17H 1FZKB 3ARFC 1P4IL 3GO1H 3WNIA 1KJ2H 5SWQA 2CLZB 1HOCA 1GMEA 2DWDA 1ADQA 1R5VB 4LZKA 2EZ0D 4YLBA 1X6NA 1NLBL 2Y72A 5FO9A 3WJMA 3IKCA 3V8CA 4MXWL 3UCRA 2OCCB 5L4MA 4G6AC 4HMCA 4XXWC 4K9JA 5MENB 1XGTA 1IU1A 1EZUA 2V37A 1AHMA 2X0UA 3VGAC 4CRPA 3V10A 4PS8A 4P46C 2VDNH 2GTWA 3FT4B 3U7YL 4KFZC 5LG6A 5DCCA 1Q38A 2IH9A 3GJFA 4NLAA 5C0JB 3NP4A 3OPZL 5G2NA 4K23H 4YPJA 4F9LC 1R0AH 1DCLA 4NJAH 1J1PL 1T1WB 2OSLA 2WXPA 3DSNA 4PRBA 3VI4B 1NGQH 5SWSE 4H1LH 4DGUA 2DQ6A 1S3RA 3BPLC 1IC1A 2EIBA 4WDIB 5E8PB 1I8MA 5I1EL 2Q6WA 5EDSA 1NEPA 1S7XA 1G7JA 1HNGA 4WUUA 3S3SA 4ZUWB 3VUAA 2CHNA 4Y4HC 2F9BT 4BFIB 4F3FB 5IOPB 4ZNCD 1QHOA 5IQ7L 1T83C 4XMXA 4AVIA 3MRFB 4HIHA 4UINL 3QJSB 4FNLL 2VLME 4N6QA 3O41B 1E5CA 1C9SA 4PJGA 3QQNA 5KAQG 1HEZB 2F53D 4IU2A 3O3UN 2WNKA 5CU5A 2Q8AL 3KWVA 5HHOE 3EJSA 2YPVL 3OJ2C 1L0PA 1P7QA 2P8PB 4FP8H 3AS0A 3ZL4H 3ULVF 2X4NA 3NIDB 3WIHL 2JCCB 4R0LB 4I8DA 4NUQA 4ZS6D 1KB5A 1OAXH 4BH7A 4NN6C 4XVSL 4OH2A 3OV6A 5EPMA 3T3MB 1NCTA 1JF1A 1H3WM 3W2DL 4WHYH 5C07B 4NIKB 4YSSA 1I7ZA 4B9JA 4M7ZC 5DD0L 2CKBA 1T66D 2BNRE 3MVSA 3BW9B 2G60H 3A22A 3REWB 3MMEB 1YYML 4DAGH 1OF0A 1P7KB 4Y8AA 2QQKH 2FX7L 2MQCA 3F58L 5F88B 3K71A 2CA4A 1XIWA 1OANA 3GXUB 3FB6B 2VQUA 1NPUA 1CYXA 5L8KB 1SVZA 5DZOA 4WHDA 4XOBA 5DSCB 2QMJA 4NWUH 4U6HB 4JE0A 1GIGH 4CN1A 2O6CA 3V0EA 4PJXB 4L29A 3JVFC 5EBLB 3HG2A 2ITDA 3FUHA 2FO4A 4WVRA 1N0XL 5BOZG 2JWYA 2PKDA 3NUKA 2FR4A 2PPAA 5L8JB 3FUFA 5FYKD 5C0CD 4NJ9H 3WUWB 4NBXB 5CLXA 4MMZC 1DQVA 2J21A 1F8TL 1N19A 3BIKB 3Q6GH 5D96C 4JFFD 5FO8B 5SWQB 1Z66A 3TEWA 3T65A 1DJIA 3PPEA 3KCWA 1YQVL 5FO9B 1TTCA 3IKCB 5CWSB 1LD9A 3E1ZA 5I76B 4I48A 3TO4D 2NNCA 1BZ7A 2WQSA 1NFKA 1YYMH 1KBWA 1HHGA 4FFVD 3D30A 4Z0BH 1HDMB 3RB7A 4F9PC 1NGYB 2GTWB 1BGXL 3SSGA 4JUSA 1AIZA 4DCQA 4WAFA 1MFUA 3K2KA 4RMWA 3MRIB 5JHAA 3OKMA 1FFQA 2NY4D 3VD1A 3C6LC 4LCCC 1WZ1L 3P30L 4WKZA 4AKOA 4AGOA 5HI5C 5EUOB 4B3EA 4XO8A 3HMXL 4FABL 3IJHA 3OJVC 4JQXC 4JL1A 5CGBA 3FUJA 2H0JA 1F8TH 1I8MB 3A24A 1UFUA 4AT6B 4PV8B 2Q6WB 1SOQA 4JO8A 4HIPA 1RFDH 3QCUH 2DQGL 5IR1A 1MCRA 1JCKA 4PU2A 1MHEB 1TOXA 2GSIA 4QXUH 2XQYA 1NKRA 2BNQD 3GS4A 4HIHB 4IM8A 1MRFH 2YAQA 3BWZA 4HEPA 3MNWB 4OB5H 1RMFH 3CIQA 3RTQA 1PLCA 5IEKB 1W91A 2D0GA 3N44F 2NX5A 4IU2B 1Q1PA 3VCLB 3G9VA 2EDTA 2WTPA 1PG7L 2OZ4L 3QJFB 3DHPA 2IAMA 1P7QB 5GZND 4DOHE 2EKSB 4P4KC 4GSQA 3CHXA 3H85A 1U92B 2ZE0A 2G75A 4N0CC 4N2NA 5C0BE 2OYKA 3SGJC 4AH2A 1J8RA 5DJ6A 4UUJB 2FJUB 5GRJH 3B9KD 3L3HB 4S2SA 2W91A 1ZV2A 4XC3H 2XZAL 4LLDA 4LRNH 5IBUB 5FLVA 1JPFB 2G4GA 3KJ6L 4LLUB 1JF1B 2DIEA 1U6AH 3V5HB 4DP0X 2CJTA 3V6OA 2BSSA 4Y16A 4FQPA 4MCZB 4JO3L 1LE9B 3P9MA 4NFBA 5KUKA 1TF4A 3CAFA 2GJJA 4PS4L 2XFXA 5F7KC 4JW3A 2ZNXA 4N28A 3K71B 1JWSA 8PAZA 1AGCB 1SXSA 3K1KC 2ZSWA 3C5XA 4PW4A 1J05B 1JS4A 3H56A 3DX6B 4ONOA 4L29B 3NJVA 5HHVH 3JV6B 5MEOA 1GS8A 3E8VA 2W88A 1ZHKB 4M03A 1VA9A 1IBGL 2QADB 4NUJA 1NCJA 3RQ3A 2QVMA 2JSFA 1MCHA 1SMDA 5FDWB 2IQ9H 4FLOA 4N4YB 4JFTA 3IMRA 3ECBA 4PRHD 3CZGA 2OSYA 3U25A 3GB7A 2VRQA 5FCUH 2X3BA 1UJ3A 3AG2B 1A7QL 1B2WH 4I9WD 1RUPL 4HAFA 3HNVL 2P47B 2K0RA 1WISA 4Z7VA 5J13C 2B16A 4ZTOH 4NRYB 4Q6KA 4GOSA 3FN0L 2QDWA 4DGWC 3DHMA 2FBOJ 2JCWA 3O2DL 4FOMA 3QO1A 2CRMA 5CCGE 5IWLA 1AR1B 1BZ7B 4PHXA 3R8BB 5DD5L 5D7IB 3RFZA 2VN5A 3JTTB 4HJSA 2VMJA 4M62L 1HHGB 3D33A 1JUFA 5L0QB 2Y06L 5EC1A 4GQ9L 1ETJA 1R9FA 2E27H 3T4YA 2AS5M 3B3BA 1L6ZA 1BQHG 3CHPA 4N2MA 2WD0A 4GY4A 1X5GA 1EMTL 2OMBA 3MLZH 4XPBL 3HN3A 3CH1A 4PTUA 3ZO0A 1JHLH 3IGLA 1Z9OA 1QI5A 4AGQA 5DXWA 2KDGA 4MCMA 3H8NA 1NM4A 3C5SB 2BMKA 3IJHB 5AB0A 4B7IA 3UAAA 2PYED 4R8WH 1KEMH 4HU8A 3I75A 5MEQA 1K4DB 4G9FA 4PJDB 2DI8A 1SNRA 4P07A 3VA6A 4HA1A 1TU2B 5JXAH 1WZAA 3RB5A 3GSWA 3CSGA 3HW7A 5IW1A 3BKJH 1K5NA 3FN0H 3WE1A 4WJG3 2Y7SA 1LO2L 4H0LC 2GSIB 4XP9L 4GKOA 2D3JA 3MRRA 1YEFL 3BQUA 1THAA 2XSKA 2XG4A 5HVHC 3UPAA 2NSXA 1YCSA 3I6GA 3QDJD 5DRWA 4H2AA 4PBXA 2IAMB 4OCRL 2GJ6D 1T04B 4Z78A 4HUXA 3AU0A 3VWJB 3HRZA 2HLAB 4AH2B 3US1A 2GIXA 1N10A 4S2SB 3SPIA 1WYJA 3EG9B 4KO7A 5D8JL 4LLDB 2Z31C 1JE6A 3LNFA 4GSXA 3FB7A 2HN7B 2WB1A 4X6BA 3SYPA 3AW5A 2BSSB 1MI5A 5HYQA 2XYBA 2OK0H 4PJBE 4ZQKB 1FCCA 1ND0B 4LCWA 2O4EA 2VMCA 1FPTH 3SE4A 5CSGA 1KN4H 1UOKA 4XB8A 5GGSB 4G6JH 4JG5A 1HHHA 1NKOA 1ZY9A 2IADA 4JG0H 1PZAA 2PCYA 4Y19B 3V9FA 3WUZA 1RJYB 1V3KA 1B0RB 2WVTA 1JWSB 1YNKL 2IOOA 3G08B 4XP9H 5HVFB 3BEWB 1D3CA 5F7NC 4NDMB 4PRAB 3UX9B 3VXPA 2YGQA 3TBTB 3ATBA 4XWGH 4KZCA 4D3CH 3VXUE 1XL6A 4AEEA 1WEJL 4P23B 3G5YA 3B7TA 3ECBB 4NRXA 4ANXA 3GB7B 2WB7A 3M07A 4ORGA 4HUUA 5D8JH 3RAJH 1MCJA 1N6VA 4YSEA 1CGXA 3O9WA 1LL1A 1XAUA 3MRHB 4HKXA 4UI2A 2A9BA 4WFFD 1KCSH 1YEJL 4NHCH 5J9PA 2ADJA 1BJMA 3MGOA 5TE6L 1E4XL 3F7QA 4EI6B 2WJ5A 4DHLA 3S3BB 4WIQA 3TV3H 4YGVA 35C8L 3RFZB 3MX0A 2R9HD 3SDCC 3M17B 1FNLA 4RGOH 2ZUXA 3WNOA 2DD8L 3PABA 3VA2C 3FF7A 3CVHL 5F72S 1FRGL 3I50H 2W0LA 3V4VB 2DQUH 4I1RA 3T4YB 4PB9L 3DOSA 4Z77A 3H7BB 4ZFFB 2HTLC 3O2WH 4JJ5A 1OAJA 3QUXC 4PJ5D 1BVLB 2NY1C 5C08D 3IU4L 3U0WH 4Q14A 1I1YA 1IEHA 2HAZA 1XBRA 1VFUA 4GYBA 1BD2B 4WWPA 2ATAA 1PD0A 1ZCRA 2E59A 1BDYA 1NCHA 5KYUA 2VQ4A 4IJ3B 4EKJA 2APTA 3U9WA 2G3ZA 4EKXA 4K15A 3HBZA 1QBML 1OAYH 2CM5A 4WI6A 4R96B 4WEUD 4NC1E 1OF2B 5K9KA 1LO0L 2XA8L 3MGTA 4LO9A 1E27A 4A39A 4DKDC 2OULB 2P42B 2APFA 3HC4H 4OD1H 2WXKA 5I1IL 4XMKL 3BQUB 2F74B 4A2DA 3TLRA 5JLZA 1VADB 1KOAA 4WHYG 1L9MA 4UMSA 5JO5A 1L0YA 5ESVA 2ILLA 4LEEA 3IDYC 3PFUA 2W9EH 4OF0A 4N86A 3DXAA 4GRLC 4GG6B 3IDGB 5C6TH 3EZJB 4DGVH 3SOBL 3Q3GB 3S9DB 5HYJA 3BVNB 2QHRL 1CXEA 3EBGA 3NESA 5AAMA 4Z7OB 1KGCD 3FB7B 1A7PL 3RZCA 5I30H 1FGNL 4TSCL 3GMLA 4FCHA 3CVIH 4XX1G 3GSQA 4QY8A 2J6WA 1CZ8L 4HOMA 1IGML 1PPIA 5CSZB 1HWWA 1HHHB 5LBVA 4L4VA 4G59C 4OJCA 3CLWA 1SQ2N 4UM8A 8FABB 1AD9A 4ATWA 3Q2CA 4F58H 1LP9F 1QI4A 3NK4A 1OE3A 2GAZA 3TA3C 3ZPDA 4OF6A 4GW1B 1HH9A 4GUPB 5I1LA 2ZICA 5DD6B 2WXIA 3ATAA 5AG9A 4HGKC 3O11A 1T0OA 5BRPA 1KY7A 4MZ2A 3L1OH 5TK4A 5B22A 3QXVA 2DYSB 3E6HA 1P84K 5I0DA 1S4IA 2FNBA 4Z3FA 3O0LA 1G9EA 5IQOA 3ETTA 4ORGB 1FORL 4G8FA 1MF2L 1NCBL 4ZXBC 2VM9A 5ANHA 1FGNH 5IFAL 4TSCH 2Q0ZX 3TT3L 2EILB 5I5IA 2ADJB 4N1CA 4XNXH 3U79A 1FHNA 1XHHA 1J0KA 2G3XA 2Q9OA 3D0AA 1T1YB 4HIQA 4YGVB 2VDPB 1UCTA 3PV7A 1CDJA 3ESUF 2JIXB 3ETBF 3BQVA 4RDQF 4QHUA 4G7SB 3GZPA 2P80A 3GSVB 4LCUA 3VRJB 2JJSA 3DOSB 4Z77B 3LX9A 1ADQL 3SE3C 2YARA 1W2KT 1OGAD 3FUMA 2BOCA 4KI5E 2BERA 4FQCL 4I18A 5LAXA 1I8UA 5B39A 5IGXL 1JGUL 4ZUVA 1Y07A 5DT1L 5JQ6L 2C9VA 3AQXA 3UZQB 1W8NA 1TYJA 3K81A 2DBJA 1N0LA 4G5ZH 3OM3B 4A2HA 4PJIE 1SN5A 1H3VA 3CSYB 4AQEB 3VFSA 3PQYA 4PS3A 4MAYC 1A1MA 3LD8B 1O6VA 2AVFA 2CU9A 1F86A 2EC9U 2YOAA 1MDAA 3A0OA 3LKRA 3QJUB 3SDDD 3TH2T 5K9KB 4R7DA 4AG4L 1NANH 1W72B 1KBGL 2ZYRA 3EHBD 3GDCA 2YAHA 3MR9B 1WAEA 3I6LD 4U0QB 5I9QC 4Z95L 5EEUA 2MJWA 5K69A 4YAQA 1DO6A 2X4PA 4G8EB 2OMTA 1EJ8A 4XNBA 3MHZA 2Y9RT 5JO5B 3V52H 2LU7A 4PG2C 2YZ1A 2CRYA 4UTCA 4UDTB 4WUUE 4JGMA 1H6TA 2WZPD 4LDCA 1FVEB 5J11B 2HTKC 1JYXA 2K78A 5HHQA 1RSYA 3DRQA 1U93A 3C2SA 2J8UB 1XGYL 1IKOP 2B77A 4PJGE 3WKMH 4ZNEA 2DB8A 2QQNL 3MLTA 2E7LA 2VRAA 5HI4C 1ACCA 1ZHBA 3UXFA 2EVHA 3PHSA 2MOQA 4Y4FB 2FCBA 4FDWA 4ONFH 4LMQE 3MLWH 1KB5L 1KBPA 4PMFA 3VRLF 1UATA 4G7YL 5IB2B 1EEUA 2X7LA 4TUUA 4NC1C 4V11A 4YLQT 4UM8B 2W9DL 2PYFA 4IOFD 1KIRB 1AD9B 1H3UA 3KHQA 1HJBC 1MFAL 2RH0A 2Z4QA 4FG4A 2RFXA 1YUHB 1Z9MA 5ILTL 4JK0D 5BVJA 1BVKA 2B8OT 5CS7A 1HH9B 1ACYH 4IQHA 3ZHDA 3QRFM 1BW8A 2CKBL 5LGHH 2R0LH 4POZD 2A5UA 2ESVB 2FB4L 5LHDA 1GSKA 1F4WL 2NR6C 2YPKB 3HUJF 3DPBA 5KVDL 3QJXA 2M1KA 1CK0H 2WBJC 2NNXA 4RFEB 2V9RA 5HJ3B 3MCKB 4E68A 1M56B 4QRUB 2ZT9C 3L9BA 3QRGL 2H9GA 3O6LL 1I1RA 4ANVA 4PJAF 2O1AA 4YXKL 3RJDA 3FXIC 3GNML 5DGQA 2NW2A 3UC2A 1SF5A 3NIGB 4LDEB 2V2XA 1A0QL 4XNUH 5TJWK 3SYOA 5ID1A 1FQ9C 1HWHB 1U41A 4U6TA 4XBEL 1QLRA 3TBYA 3M6DA 1S8DA 1F4XH 2LU5A 4XVTL 4HK3J 4E5XG 1YUKB 2XN9E 4YHNB 2EDKA 1FE8L 5ECGA 4KVPA 3NN8A 3DJ9A 2O61A 1YY8B 1U8MA 2GJPA 3QJOA 1ZVNA 3AAZA 5LQBH 2HJLA 1DJGA 4BCYA 5J06A 5EEVA 2IANE 2XOTA 1XH0A 4PD4K 3S34L 5JHDA 1P4LA 3DMMD 3S0PA 4G6FB 4UQEA 5JXEA 3S36X 4X42A 5EEWA 3LKSB 3S3DB 2Z91B 4QHMA 1G84A 1A6ZA 4PCTA 4UQ2A 4I1NB 1L9TA 3ZYOA 2A99A 2J3SA 3GUTA 1FF5A 2FB4H 3EBHA 3QQ9C 5LAXB 3DV4B 1SXNA 4ZUVB 2V4LA 3IVKA 5DEJA 1WFNA 4NFCA 4IBQA 1ACXA 3F85A 2VE6A 2N0MA 1MREL 1ZPUA 1QPKA 3Q1EA 3WHE1 3TC9A 4HPHA 1RV6X 3NCMA 4K7FB 2VRKA 3GNMH 1KY6A 2VC2B 1CFSA 3PRZA 2YBGA 1E50A 4JZNA 2OL3A 3PQYB 4X99B 1A1MB 3LKRB 1CXIA 5CZKA 5DU7A 2AJ3A 2IPUK 1EK3A 2OMVB 4FYQA 1CICC 3ROOA 3S88L 3AGWA 3GI8L 1H5BC 3EGDA 3ARGB 4Y5VB 1DFBH 1PZ2A 5DEGB 5AYTA 3HVNA 2ZOKA 3QDGD 2CO1A 4JJOA 4BZ2H 4OKVA 4W81A 4W9JC 2YMOA 3ESPA 5AKRA 2CRZA 1WIPA 3QUHA 5K9OB 2NY2B 4BEIA 4MJHA 2I26N 3BDXA 2PCPA 4NXSA 4TSAH 1HSBA 1T3FB 4LF3A 1QUNA 4P2QB 1J9TA 1F13A 1TZGL 1C8QA 4KI5C 4PREB 2H5UA 1U93B 3KS0J 1R3KA 4K3DL 2AV7B 1NQBA 3EOAB 4QKTA 1FYTD 2LAGB 3D50A 3QVAA 5IMKA 3UDWA 2NX5E 2CK0H 2KI6A 4ODBD 4LESA 3DTDA 5GJSL 5I6XC 4I13B 5JHBA 1F00I 3GSRA 3RI5F 2ITFA 4YH6A 4F7MB 1KYOK 3S8FB 3Q6FB 5TDOB 1QABA 1C5BL 4ZW7A 3GI8H 3BXNA 4PP1D 3H0TA 4A6YB 5A2FA 2Z4QB 2I85A 2RFXB 2X6AA 5BXFB 1C16B 3O3BB 1BG1A 1BVKB 3V6OE 3F84A 4J6RL 3MRMA 3S36L 4P2RB 5F7EL 4LSRH 1QSEA 5F1KC 1EZSA 3D0VA 2FSDA 3O4LA 5B38G 2YSSA 3DPBB 3W11D 5MEND 1J1OH 4XCEA 4PI2A 5HHXL 3MOQA 3A23A 1A6UH 2DKSA 3HZMA 2BZDA 1MHCA 1W0WA 2AK1L 1NCAH 2E7HA 4N2IA 4YDJB 5DZPA 3NJHA 2H9GB 3EOBB 2AK4D 4HIIB 3QAZB 2CGRL 5IKCB 4K3DH 2NW2B 3OC5A 1CBJA 1OTTD 3AVEA 5DJ0A 3DSFL 4M9PA 1J8HA 5FW8A 3VFGH 1MVUB 1BQLL 2FEDC 2A77L 1QLRB 2WKGA 5ICYA 5GJSH 3FRPG 3EOTL 1E8WA 2MH4A 4PJCB 5L7XL 2X2JA 3NN8B 3MV8B 2HFFB 3D3VB 1ZLUK 3BFOA 3K6SB 4BGDA 4HD5A 2N59A 2RBLA 2MHAA 4JCMA 4BQBA 2Q7YA 1JZFA 1I8IA 4D0CA 4GUOA 4PVNA 5JHDB 5KW9L 3TIDA 4NQTA 4IMLB 1N6QL 2GITA 1L7IH 3KNBB 3QQXA 2ZX5A 1XCXA 4MQXC 4Z7VE 2YMXH 1A6ZB 1V27A 4HBCL 1DYZA 1ZT7A 1UB5A 4RMBA 4JY4B 3AADB 3F6LA 4WJKB 1MAMH 2ZX6A 4ZW3A 3ZDXE 2A73A 4U33A 1KBVA 4XVJL 2QPUA 1J8KA 1G9HA 2AK1H 3W1ZA 4OJFH 4UANA 3IMTA 2F54B 1HHIB 4DKFL 5IFHH 1XIWC 1S7UA 1MIEH 2GG1A 3N1MC 2HH0L 2E47A 3IMWA 4OTXL 5J6GA 1LQSR 3ROLB 1XVSA 5L2KE 3WAKA 4RNRB 4LU5H 3QNXA 1AKJA 1D7DA 5TDNA 2XTLA 1G6RB 5BZZA 5IM7A 2E4FA 3GMQA 2WLYA 5MEPA 1FL5A 2J20A 4OZGB 5E1AA 1FC2D 1ZJBA 1G9MH 3MXWH 4LGPB 3I2CH 1PZUB 3K0WA 3L16A 4H20L 2B1HL 4FD0A 4WWKA 2BJMH 5DMKA 5BZDA 3TWCL 2R56H 4N24A 4R90L 4N90D 5GGVL 3HFMH 1KXQE 4L8BA 4QHNA 5EOQH 1WD8A 3TN0A 1GSMA 2M83A 4EE2A 4W68A 3Q48A 4LF3B 1QUNB 3H6JA 3VXMB 3EADA 5DD3L 5ITBH 5CN1A 2DWYA 4GMSL 1JNHA 2A1WH 2C7FA 2EIZA 3FQRA 4BM7A 1LK2A 5C6PB 1HYSD 2XKNA 2ICWB 2RALA 1FLRH 5DZLA 3SQOL 4D9QD 4XMTA 1YJDL 3V4VH 4B9IA 4RBPH 2Y7LA 4U1SA 4CBZA 3BD5A 4ZJ9A 4PTTB 5KSAA 2QQLH 1A14H 2AV1B 4MA7L 3V7MA 3GSRB 4B9KC 5CFHA 4MCYB 3KH4A 4HKJA 1LP9A 2AAAA 1D6VL 2CD0A 2Y1YA 3OKNA 4HWBH 4PRNA 2C26A 1TYEB 3WNMA 1E4JA 1SM3H 3BXNB 4NI3A 2L0DA 1JDDA 1PX8A 3NJFA 1QLFA 4HUVA 1NBVL 1UB6B 4Y4KA 4K3GA 1FV1A 4B9PA 1MI5E 3DECA 2B1HH 3N9GH 3BSZL 3KBPA 3MRMB 4JREB 3VYNA 3F7LA 4R5XA 5AOJA 4LCWE 1M6OB 3RDTB 1NFAA 3JV4B 3MPCA 4NZJA 3LHAA 1AP2A 4PGCA 4OIFA 1U8HA 1NWPA 4F8LA 3FFCA 1KPRA 5DD3H 5DUMH 2Y07H 4KQ4H 4QYOB 1ZLSH 2Y2TA 3X3FL 1N26A 5JORB 1L9SA 2ZP0T 4P04A 5GISL 2VR7A 1J8HB 2WINA 4UOW1 3RTQC 4GI9A 1B4TA 5HDRA 4LHUA 2VISA 4LNRA 2WYHA 3BWSA 4ZMQA 4S1DD 4MA7H 2IAMC 3U2SB 4ELME 1RUAL 1T20A 3K4DA 3QEQA 1D6VH 3L3DA 2MHAB 2P5EA 3G6JE 4I0PB 1URZA 1I8IB 2P5WB 5D7LA 4D0CB 1DJWA 3TIDB 2A6IA 4PRDA 2O6DA 2WLLB 3FCTB 3MODL 4M6ML 3RVVC 1E3ZA 3HMWL 1IC0A 3U6RA 1ZT7B 4TQEH 1HXYA 3C87A 4LPTA 4Y16C 1LK3H 1PX3A 5KN5A 4V1DB 1OTUD 1A8JH 4DPCX 3IETA 4YR6B 4ZK8A 1I9RL 1S9YB 2A73B 2NZ1A 1U42A 2P8LA 1AOZA 3MDJA 1PYWA 1HJCA 4KK6D 4XXCA 1SDYA 3CDGB 1OAQL 5BCAA 2FEDD 1VEMA 4O5LL 3EDFA 1G7QA 1DLHB 1TR7A 5E08H 1IKFL 2QGEA 43C9A 4X5QA 5C0FB 4YSTA 2CHZA 2ZPKL 2VDML 2KLSA 4MJIA 5EA0L 2R2BA 5TDNB 1KFGA 4G6KH 5MEPB 2MSPA 4FG0A 4JFOB 5E1AB 5FGRA 5I8EA 1TZIB 2I07A 4IRJB 3S97C 1CQYA 4NO3A 2YUZA 2NW3A 1TEGA 1UJ3C 3MODH 3AABA 3P73A 2OTWB 3TN0B 3EFDH 1F6AA 4JFZL 3WO3B 1Y7VA 4PR5A 1W8OA 1R3IL 2X4SA 4QRQA 3OXSB 5A16A 3IJSA 2UV3A 2VDPH 2WO4A 5IWLC 2VQTA 3DYMA 4OVUA 5T3XL 5AENA 2FYYB 2JNZA 3FQRB 2B2XL 1LK2B 2HWZH 3RFZC 2NY3B 5T3XE 3ULVL 1OAQH 2XKNB 1DBML 3LZLA 4MNQB 4WY7H 3ULVE 1GZHC 2WBXA 3SYCA 3CC5A 3APFA 2DKUA 3CZLA 2HVJA 1JPGA 2X53A 3G3LA 4MDIB 2VAAB 4U1SB 3MV9B 3HC0B 2QADD 1U8LA 2H2SD 4DO6A 1F2XK 2G9HA 3DXAE 1QAWA 4EUPB 2BNUA 2R1XA 3QWQB 2EACA 3S4SB 1PJWA 3MV01 3OKNB 1KN2H 1RVFL 5C92A 32C2A 3F7KA 1NEZA 5AVYB 2HA1A 3PNRB 4HUVB 1QLFB 4DP4X 3HUJA 4Y4KB 5BS0A 3D9AL 3K2UL 1FV1B 3KPRA 4JRWA 2IMNA 5ENWB 2O5ZH 2FJHB 4X5WA 3MRJB 5D5MF 1AR1D 1KLFA 2VM4A 1XEUA 4I2XE 4OR1A 3NG5A 1EHLH 4L4VE 4PJAA 3QCTL 5KBLA 1NGWB 4HU2A 1OLLA 3BEVA 1QBLH 3AJ7A 3X12B 1U8HB 3HE7C 1W72H 2GCYA 2F1EA 4OUUB 3F00A 4DUVA 1J5IA 1RULH 3OJMB 4BE6A 3KPSA 2C5DC 3O8XA 2H3XC 3A6CH 3LPOA 1DBMH 1AG6A 4ODUB 4GH7B 4JANA 3EJYD 4XNAA 3D85B 1FNSL 5CEZD 2YD8A 1GR7A 1WZLA 2VISB 4WU5A 1GYWA 3CCHB 1YJDC 3QI9B 3T0XA 3WL9B 5FX3A 3EOYG 1HU8A 1T20B 2GTQA 5F3BB 3HRZC 1OAZL 1P84J 4RA0C 4J3OH 2H8PA 2J88H 4E42B 4LSPH 3IXTB 1YG9A 1U4FA 3RNQA 4HJJL 5DC9B 1NC2D 4I87A 2YD9A 5DMJB 3PJSA 3ILPA 3BO8B 4AW4A 4EBQH 1B90A 2XJLA 3S96A 4HQQL 1ZA6A 2IFFH 1OCRB 5L88L 4MA1C 2X88A 5F7LB 3GEFA 2CCLA 4WSKA 1G7QB 2PO6A 4H4NA 3OKOB 4BH8B 1P1VA 4ZT1A 3F5WB 4PG9A 1HI6A 3IDMA 4UQ3B 3VWJD 3QCVL 1FSKC 1ROCA 5JHLA 4MBRA 1FNEB 2WVVA 4HVBA 5I8EB 3B1TA 5EMYA 3NK3A 2HRHA 2VSDA 5E2VH 3WEMA 4BSVA 3ZL1A 3I9AA 4HK3N 3OAYH 4FMKA 4OV6F 1KGUA 3SOTA 1OAZH 3QNFA 3NJKA 2ZOLA 5CJOH 3PXLA 3SE9L 3T2NL 1CYGA 3DUUB 3O9WC 3K4AA 1F6AB 4Y19D 3GYRA 3PXHA 4WGVB 3VX0A 1IAIH 3D2UA 4QRQB 1RU9L 3F01A 2Q10A 1D6EB 4RIRB 3RFRA 1ZT4B 4FLQA 4YQXH 4YLCA 3CQQA 2R0WL 2WXLA 1YO4A 4BWUA 3RGVA 1N3NA 2XWBB 5C3IA 3MXVL 2HVJB 4KU1A 3RWIA 5EV7A 3CZUB 3I9IA 4FXGA 4P23D 1U8LB 3FU5A 4FQQB 4GQPH 5FYKU 1G1OA 3JTSB 3Q8AA 1S2EA 2BSDA 4TYUA 4WLCA 2V3FA 1N5AA 3BH8A 1V8HA 2OJZL 3FZUD 3WE6A 4MX7A 2XQYG 32C2B 3C9NB 4X8JA 1NEZB 4HEPG 5F89B 1M7XA 1F58H 4WHTA 3WIFB 4M3JA 1U3JA 7CGTA 1NPJA 1DDTA 2VC2H 3ZMEA 1CFQB 5AEAA 1PAZA 4CNIA 4NQSA 4JN2B 4X5WB 5DS1A 5MP6L 4RFNB 1WDAA 4HMEA 3FT3B 2HFEB 3EYOB 1ZLWK 4ENEC 2WLMA 4JX0A 1RU9H 4HIEA 2DICA 4U3XA 4PSPA 3T2OA 3HCVA 4QRTB 1UWEL 4HUNB 1E4KA 4QTIH 3T0DA 1QPPA 1Y6KR 5T1KA 3VXUB 3WO4C 1DEEA 3E7JA 3ULVC 3D25B 4QNPE 3POHA 4U49A 3TNNB 4YDLC 4Z8FH 3KLAA 3A21A 3VD2A 5CLTA 1BD2D 5IJCC 4A7UA 3OKEA 2VZ1A 25C8H 1GGIL 3N43B 1BX2B 1DQJB 4J3TA 3W82A 3D8MA 3SHSA 2D9CA 5AAMC 3DTUB 1MEXH 2Y7NA 3RZCC 2RQEA 4KY2A 3V6FA 1OP5H 3FN9A 3PJSB 1ZKAA 1PEZA 4AV0A 4XNDA 5MP6H 5BVPL 4WUKL 3ETSA 2Y2WA 4XODA 2PTTA 5KYWA 3KAAA 3BQUD 5EWIH 2XI9A 3N6YA 3QFJA 2IV9A 3TJPA 5H4ZA 1KXVA 4A6YH 3IF1B 2EDRA 5GGRA 4LOEA 4PD4J 1UWEH 3KCPA 1TQTA 2D0HA 1U8OA 4X4XA 4UZUA 6PCYA 2ORBL 1UOVA 2Y4SA 3OF6D 1IGFH 3H53A 4U6YA 4L23A 2R2EB 3T5WA 5I82A 5BOJA 5B7FA 3D05A 3ET9F 1OPGH 4I3SH 4FFZA 5I8CA 2DQCH 5TF1L 3D4GA 5F7WC 4D0BB 1SLUA 1NCIA 1A3QA 1RZKH 1O7DE 1ONQA 4RGNB 3BPCA 4JFQA 2W5PA 1AGDA 1R24A 2OL3L 3M86A 1X5KA 1VHPA 3S5LA 3P9WB 4YEFA 4GINA 3MRNB 3TZVA 4BRVA 4UTAH 3MRDA 1CDBA 1FGVL 1BXUA 3QGVA 3QFDA 4R26L 5F7DA 1XBDA 1XZ0A 4QHKI 1QRNB 4OD3L 3TIEB 2DL9A 4EI5A 3RGVB 2XTJE 1BLNA 4ZOCA 2Y22A 1MH5A 1MRDL 2YIHA 4BFBD 3LPGA 4Q6IB 2MTPA 4IBUA 3MNZB 5MHSE 2JJSC 2ORBH 3B6SB 4X8XA 3ABGA 3AY2A 3BPOB 4TULH 5KUMA 1W6WA 1X9RA 4WI0A 3D4ZA 1JF5A 1Y18B 3WE6B 4NQDA 3S48A 4A2LA 4HAKA 4I18C 2DTML 3NACL 3FU3A 2KERA 3OQRA 3T8MA 4HUKB 3G5XA 3M1OA 5AYUL 3BX7C 1WS7A 2WZ5A 5SWZB 2FATL 5SX4H 1S7TB 1XCWA 1ZXQA 2O5XH 4UQCA 1NCWL 2Z34A 3STLB 2AJXL 1JD7A 4Y5XA 1G6RH 2X2UA 2GUOB 2BW5A 2X1WL 2MPAH 2PXYA 2JIXD 3NJNA 1G0YR 4P5TB 4QT5B 1KYOJ 3QUZB 4NUGH 2G3NA 4G7QB 4HH8A 5DMYA 5T5NF 3HCVB 4M9OA 2Q2LA 1G7IA 1I3RB 1EGJH 1A1NB 1WPCA 4N2DA 5T1KB 5E1GA 5GRYA 1A7NL 4X4YB 4MJ6B 1RP8A 2BRQA 1QSEE 4FQ1H 4JPWL 3PWNA 3ZTDC 1MRDH 1QVOB 2X4OA 3O4LE 5EC2A 1NGPL 2A0LD 2C3WA 2OR7A 4X4KA 2YRPA 3HG1E 3KPQA 1BFSA 4FRWA 5FYJH 1QFWH 4AZ8A 1ZOXA 3TCLA 4K07A 4X6FA 5FECB 2H32A 1IAIM 2BM3A 2YFNA 3NTCH 3UEQA 3DV6B 4NQCA 4DPBX 2E7LC 2LW3A 5HI3C 4TVUA 1HVXA 1LDPH 5HY9B 1NL0H 4QI3A 4EN3A 3LRLA 4OCWH 4RMSA 5TE7L 5KYWB 4U1IA 3LQMA 5IHUL 1WC7A 5E1IA 4JY5H 1UWYA 3FCUB 3FTGB 2N7BA 1O5PA 1CLZL 4R4NC 4DIXA 5E23A 2WMPA 3GSNB 5DUBA 1C5DA 1CFMA 2QELA 5CBEA 3ECVA 2VXVL 4WO4B 4Z9KB 4ZSOA 2B0SH 4RQQA 4ZPTA 2PWFA 2IQAB 2H1PL 3POCA 2XWTA 5D1QB 4PJIB 4AGLA 4J3OD 1I75A 3CMOL 2E86A 3DJSA 5CZRA 3TOPA 4J4PA 2XLLA 1ONQB 3BPCB 1FH5L 4W9EC 1S7SA 5EZJA 4Y4FD 1I31A 4HXBH 3S5LB 3SDAD 1ZIBA 2BSED 3T4AB 3QYNA 3TZVB 1U8IB 1BZOA 4XGZB 5JR1L 1IAMA 1KLGB 3QUMB 3K4ZA 4KPHL 4LLVA 2CDGA 4NENB 2XPGA 1HT6A 3FJTA 3CUPB 2DWEA 3FHEA 5JXEC 1BLNB 1I8AA 2ESVD 1LVEA 1MH5B 2IH8A 3RPBA 5IQLA 1YQ2A 1G7MA 1O7VA 1UKSA 4JO4H 3TVMB 4WI0B 1DQKA 5CJ8A 5FHAL 4R2GC 2Z7ZA 1D5MA 2J4WH 4M1CC 4MAUL 4ZUUA 4UYPA 5JPNA 3LXCA 2ARWA 5D5MA 1N12A 2CBPA 2N1KA 1DANU 4H8HA 1WF5A 2PF6A 1PQZB 3FOMA 3OXRA 4JHWL 4LSDA 5F3HB 1O7DC 1ETB1 4M1GH 5M7QA 3O81A 3QHFL 3TBSB 1CT8A 4Y5XB 4JCWA 4BHUI 5HDBF 1LP9E 2PXYB 3GK8L 2WAQA 3FUDA 5HHMB 4MA3A 4G6FD 3C60B 3UG4A 2AVGA 3HS9A 4KC3B 4Y0GA 1G1KA 4YBLB 5IB4B 4U1LA 3QSKB 4J3XA 1QTSA 5GGQH 2F6AA 5IHLB 5F9JA 2IXQA 3HIZA 2D2CC 4DTGL 3QIWB 4JZJA 4MDRA 4E0RA 2ZUSA 2X0VA 5EEXA 5F1SA 2XTJC 5EC2B 3JT2A 3HR5A 5G5DB 1GA2A 3G5ZB 3SY0A 3T09A 4P59L 3KPQB 2J1ZA 4HG4K 4JFDE 2AW2A 1ZJAA 3FFCE 4JO2H 4XO4A 3WXWH 2FGZA 2VUKA 4IHOB 4DW2H 4G8IB 2AC0A 2P26A 3TEYA 2JI3A 1UVQA 3D07A 5DJCA 1PD6A 2H32B 5CD3A 3WFZA 3DX4A 2DJUA 4F92B 3SPVB 2Y2YA 2R27A 3UDWC 3KPLB 1QSFA 4I5BA 2JJVA 4U1JA 2WN2A 1U0QA 3S3PA 3ARGD 4EUPH 1M05B 4D8PA 2MWCA 4U1IB 3QEQE 1UXSA 1WC7B 3QORA 2P5EE 3IFOA 3LYRA 4JDTL 5DJZB 1DDHA 1SYSA 1N64H 1F90H 1CB4A 4M6AA 4KDTA 1XZWA 5LNDA 2NY2D 5DUBB 4PJ7B 4NOFA 3FU7B 2BSTB 5DS8B 2R69A 1QASA 2VDLL 1T1XA 4I4WB 1RJLA 2QVTA 4M8UA 4P2QD 4LASL 3GMMA 2HJFB 4EZLA 3RP1A 2AJUH 1IC4H 1SBSH 5CP3H 3V9CA 5TGBA 3L08A 2VZVA 2NXYC 3KLSA 2O30A 2ITCA 3MSPA 5FEBA 3ZE2F 2Y36H 2JKSA 4KNSA 4NQVA 4UT7H 3LIUA 1E2ZA 3I6KA 1Z9LA 3JXAA 5E4AA 3C6SA 5AOZA 4CILA 4LEOA 1PLBA 3FK3A 4KTEL 4UQ9A 4X9HA 3KYMB 4MJIE 1A4JA 3VNYA 3D4CA 3FCSB 1UCBL 4WV1A 2F19L 4FTVD 2ODIA 4GXFA 5A3IC 1B4LA 5B39G 2EDDA 5AOKA 3T0EB 3L17A 5EO1B 5IJVA 2JKNA 5LNGA 4P2RD 2XPGB 4BFRA 1N70A 5J5EA 3W3BA 2DWEB 3CZNA 2XX0A 1ZVSA 4XP6L 2G2NA 1BQSA 3FB5B 4Q9RH 1QFWM 1Z9NA 1I9EA 1EA9C 1IGJA 4FULA 4Q89A 4U1GB 5DQDH 3SEPA 3VWKA 3ATFA 4M5ZL 1G7MB 1IJ9A 2ZD0A 4POUB 4JFSA 5KANG 4B9FA 1RJZB 3CK0H 5E6SB 1F3JA 3WMSA 2F7IA 4F7KA 1BA9A 1DJXA 4AKQA 4FFWD 3BSHA 1EUUA 1KTJA 3ABMB 4UIMA 1IBYA 4KKQA 3OXRB 1ZEAH 5I75C 5C8JB 3GGWA 1U8KA 4EDXB 3MV8D 3D3VD 1T5WA 1G87A 3HPLB 2Y7MA 3ULUF 1A1OA 4N6RB 3EO1A 4Q6YA 4M7LH 4J23A 4AMKL 1UH4A 1RZIB 3AGVA 4O51A 4GAGL 4U4BA 5AOIA 4OU3A 1E7UA 3HUJE 4X0KA 3VAEA 5BS0E 5E5UB 2IXQB 3KPRE 2HMIC 1SGKA 4E0RB 4WWKC 4YOKA 3F7RA 1FCGA 4KRPB 4PJAE 1J0HA 1EJFA 1AHWB 4N2KA 1M42A 1C1EL 2F54D 3GXTA 2VUOA 2C3XA 4A2MA 2WQ8A 5I26A 5I74C 3U4EB 4YS4A 3KPSE 4A67A 3F7PC 4L3EA 1AGFB 3P77A 1MJ8L 2VLRB 1QO3A 2NY3C 1Q90A 1O7SA 1P4UA 4LPYA 5JZ7D 5FYLH 4OJAA 3MREA 2XHNA 5EBMA 3VFTA 3IGFA 4KV5F 3ZTNH 3FRUA 1MCOH 3MJ9A 4Y1AA 3RJOA 1MJJA 1UZ8A 5KSAC 1L9OA 4CVUA 3VXRA 1UXSB 3WY2A 5JOPE 3IFOB 5F1NB 2GK0A 3VH8B 1SYSB 2NY0B 1BEYL 1UD6A 4GAGH 3BE1H 4DKAA 2NY5L 5JIPA 2WQRA 1ITCA 1EHKB 1WFUA 3OL2A 2YKLL 3TJEL 1IM3A 2VLMD 4Y4KC 2I60L 2C4FU 3P3SA 4R97B 2QSQA 4A55A 4IIQB 3GS7A 1X6LA 1CGUA 3VXMD 1JNLH 4K71B 4JM2F 1B6DA 3HZKB 3H3KA 5FYJD 2AMUA 3M8OL 5CCJA 4YXHH 4G80B 4E41A 4ZRGA 4X5XA 1WWAX 1T21A 5B8CB 3DRTA 2YEZA 5H8DA 3U0PB 5T1DH 1S7VA 4P05A 5C0IB 1BIHA 2CH8A 5DRXA 3I6KB 3L7EB 3ARBA 3FO9B 4WV1B 1TJIH 2OMZB 3X11A 1I9IH 4FA7B 4AYSA 5EU6A 2X6CA 3ZN6A 3OPUA 5EZPA 2H26A 2MQ0A 2OMWA 1L0XA 2Z8SA 1H6EA 1WITA 3FTZA 3I85A 4XN9A 1XCTA 2VXQH 1GZPB 3L3GB 4L48A 4Y9BA 3RDTD 1P5UB 4GRMB 1INQB 5CIPH 5IB5A 5TE4H 4UB0L 4JFUA 4X7SL 2IDUA 1ET7A 2AGJH 2ERJC 2Z93B 3DPDA 5K1VA 3BAEH 5JA8B 2WGXA 1IGYA 3BGMB 1RL1A 2CK2A 3STZA 2KT6A 4OCYH 4KBPA 4XH2B 2ZCLL 3KYOA 1WTGT 4F91B 1MLCA 4XXCC 4UIMB 5I1CH 3VXNB 3WY4A 2MCG1 1DVSA 3BZEA 2FNWA 3VXTA 3MRCA 4M48L 1BIIA 1ET5A 3ZU8A 4L2LA 1IBZA 4CSSA 1HE8A 1KLUB 1GZQA 5JHLH 1S3KL 1T5WB 3LKNB 2H4EA 3LEVL 5BRZA 2EQDA 1J5HA 1JMXA 4I0PD 4LOUC 2ICCA 2P5WD 2VERA 1HIMH 5A2LH 1EFQA 4KQ3L 2XWXA 5ALCH 4F7EA 5IVNA 1LMKA 1XSIA 3SY6A 4ZFZB 3MRGA 1T0NB 1BZ9A 5JW3L 3FAXA 3WFCH 3ZE1B 4M5YL 4KZEL 3CHRA 5HGAB 4V1DD 5EZIL 3COOA 3NH7H 3EXLA 2CIKA 4HIXH 3U30C 2D7MA 2YAMA 3OGCA 1AJ7L 4FC3E 3HC3L 3H55A 3DUHA 3NIFE 1G9NH 1KMGA 3BUPA 1P5VB 3HI5H 4U3CA 4KHTH 4TF4A 5HYIA 1EDQA 5AL0A 4YHOL 2L7JA 4WI7A 4OFQA 3Q7JA 3TESA 4YDVA 4GAJL 2PP7A 2YXFA 2X9YA 5DMIL 4ELMB 1CXLA 3WEXB 3FOLA 2EH8L 2PCFA 3RNKA 3VTMA 4ZS7H 3SD2A 2R1WA 5EBMB 3VFTB 2IMMA 1WBXB 4HUCA 3ESOA 4Y1AB 1UZ8B 2MMXA 2BVOA 4IRJD 3PP4H 4TUOB 1YRKA 3LEVH 1U21A 4XAWL 4NGHL 4UT9A 5HP5A 3HPJB 1YY9D 4FZEL 5DK3A 3A3YB 4C55A 1IZJA 2D7OA 2O26U 5JOFA 1AE6H 4MNGA 2OV0A 1SJHB 3WS6A 1M7DB 3FO1A 2XBTA 4QOKA 1R3LA 3TN0D 3RUGF 2YK1L 2YAFA 4KZEH 3SBRA 3RVTC 1X5IA 2OAAA 2CALA 1MFEH 3LEYL 3RVWD 3RKDC 5A2AA 3QXDA 2R23B 2NY3D 2EVGA 4WEMB 4MNQD 5JW4Q 3DRTB 3D39E 2EDHA 5GHWL 1NMCB 3NCFB 1S7VB 2R39A 5DRXB 4ZAKB 1E9PA 1W0VB 3H42L 3MV9D 5IB1B 2VJ8A 3AS2A 3G6DL 4QHPA 5DF0A 3O8XC 5INDB 1XGZA 3OHMB 4N5ED 2ZP9A 4YNYB 3DETC 4R4FH 1M2VB 1QA9A 3GSOB 1F6LL 2D7QA 2YC1B 3WHXA 2Y69B 3B2DC 4LKXA 1DANT 3E6FB 4O2CA 1CIDA 4Y4KD 4Z7QB 2EDLA 2H26B 3NCYP 4M6NH 4YMPA 5LVEA 4RFOL 2FJFB 2NUPB 1S78C 4UAOC 3X1EA 4APQB 2RA1A 1T6VN 1PX4A 2JKJA 3KM2A 4U1KA 1G5AA 3EJPA 3VD7A 4QHLA 3PL6A 5C3LD 2NY5C 3ARPA 3Q9PA 4FLSA 1DTUA 3B3IA 2HT2C 4Z76B 1RI8A 4TLTA 4ONHB 2LVEA 3TH4T 3GSUA 5AZEH 1E9OB 3C5ZA 4KXZI 2F7RA 2AKRA 1U8PB 5IK3B 2D9QB 5DJ8B 3MFFA 3D85D 5CP7B 2FEEI 1ROWA 3SPHA 3GSNH 2P52A 4H26B 1MVFA 4APXA 3VXTB 3BZEB 2PO6C 3QI9D 1W6LA 2WUBL 5C0RH 2FGWH 3HOGA 3MA7B 4IRZH 2YD2A 2FQEA 4OFPA 2QT6A 4NQDE 1IGTA 2FQDA 3RIAK 4FFZH 3EJCA 3VGGA 4HJUA 2HLFC 7FABH 1EHXA 4MMXB 4XCCL 4JG1L 1G0DA 1ZSHA 2XKSA 4EQ2A 1IQDA 2D4DA 3CMGA 1U36A 4CVXB 4S0TD 5CZVH 4ANWA 4LVEA 2BK8A 3CXDH 5KYXA 3VFPA 4WNQA 2J44A 2CMRL 1DN0A 1LO5A 3KYNA 3QG6A 1QR4A 1ZA3A 3VSUA 2G0KA 1GKEA 3ARRA 5J1AB 3QUMH 3GBEA 4PWJA 4YWGL 1A2YB 4XPAH 1NUGA 3JWOH 1MCLA 4DPRA 1D5IH 5GGUA 2PCFB 3RNKB 3RWJB 3G04A 4EOWL 3ASOB 3ZL2A 4Y2OB 4FXGC 2X4RA 2GSMB 3D51A 4P2OA 2Q20A 4G6MH 5DJDB 5E9NA 3BPOC 1HX0A 2DLFL 2APVA 4BA8A 1RLWA 3MC0A 1OB0A 4XN4A 5PAZA 1COBA 4EDWL 4YHPB 3BZ4B 4M43L 4A68A 3FO1B 1NSNH 4QOKB 1SPDA 3VJ6A 3PGCA 3HLKA 4WKXA 1M6UA 2CNYA 1MIML 2EXWC 4NQCE 4LHUG 3QJZA 2EYRA 1MN4A 4ODXB 1YC7A 4YGAB 1WFTA 4PRPB 1UEMA 4RDQG 5JUEH 3FSWA 3UGUA 2CMRH 1JGLL 3F2LA 3A6BL 3LB6C 5C09A 4J3VA 5FGBA 4WK4B 2CM6A 5CBAA 4OLWL 3LSOA 4P48A 4B53A 4S1SL 1S9XB 3BAWA 4RSYA 1E5UI 3K0YA 5FYLD 3RX7A 2GBTA 2R0KH 4IRSB 1E4KC 4AEHH 5I1DB 2QSTA 4HETA 5D7JA 2DQJL 2Y7QB 3N3EA 4H8UA 3Q13A 4ZSOE 4BJLA 2NNAA 3V7AG 4C56E 3G5VB 3EUDA 2DMGA 3GRGA 4LKXB 1BFOB 4Z3GA 4P9ML 4OCMC 5ID0A 2D4FA 1VZGA 1TENA 3TPKA 4DGIH 3V4PA 3EDKA 4LSTH 2H32H 3BH9A 4YDIH 2WIIB 3B83A 3MOAL 4LBEA 2EXYD 4U1KB 3L95A 2VDOL 3RVXD 4QHLB 2BC4A 2F68X 3OG6B 3PL6B 4XB7A 4PCYA 2DQDL 4AYGA 5JA9A 5HYSB 3MCLL 2JLLA 5T33H 1KCWA 3B3IB 3FT0A 1U2YA 4WF7A 1BJ1J 4JY6B 3WLBB 9CGTA 3VXUD 3GSUB 3NFSH 3DOHA 1RAMA 3GQFA 2WYZA 3B7UX 2HT4C 4CA4A 1MW3A 1KXVC 2HX7A 2PPCA 3JWDH 5F7BA 4ZI8A 1SUJA 4QCIB 3TT1H 2R1YB 5DFWH 1JPTL 3B9AA 2ZIDA 1ZTXH 4FNPA 3NPSB 1NBCA 5AVVB 1Y0LA 4Q9QH 4IYKA 5F0JB 3MV7B 1DSFL 2QSCH 3AUVA 5D5ME 5A40E 1KV7A 3M1BA 4XBMA 1IQDB 1Q72H 5ISZB 3P4NB 1F3DH 4CGUB 2GTZA 1JPSH 4MD4B 3ZR5A 1DJHA 2UXVA 3TNMB 1TVBA 3FTVA 3K5RA 4F2MB 5HGHA 4PS7A 1DN0B 1LO5B 3WY3A 2DQDH 3KYNB 1EJ6A 4FA8A 3TZVC 3KPPA 4DEPC 5B3NA 5BQ7A 2HG0A 3V6BR 1OW0A 4X9FA 4G5AA 3RWHA 2CSPA 1NEZG 4MVBD 4NKOB 1PLGH 4OZHA 1RK1B 2N01B 3PGDB 4NT6A 3UFIA 3VQMA 2A9NH 1VFBB 1KENL 3GFUA 1U3HA 5DC2A 4BXVA 5DEFA 5C3TA 4TSBH 4EI5C 3CLEL 5SV4A 5FUOL 1NFDB 4H7VA 4XHJD 1IE4A 1JDCA 3V5DB 1I3VA 4QRAA 2ENJA 5ANME 3IMSA 1JPTH 2YGNA 4CAGA 2YXMA 4AGPA 4RGND 2OMNA 4AVKA 4HG4J 3MYJA 2X3CA 2XXMB 2FBJL 3F65A 3NZ8A 1QFPA 4JM2A 1GGYA 3VJ6B 5HDQH 3GM0A 3GS0A 1SJMA 1FP5A 2Y1VA 3MRKB 4F7TB 1QSFE 1UOLA 2VQ1A 1PZDA 5I19L 5GIRB 3V79C 4OT1H 3KGUA 4TRPH 2Z35B 4ABWA 3O3EA 1JK8B 3J2PA 4KVNL 4IBTA 1F1AA 4Y5XC 1TIUA 2F58H 3WTWA 1PZ5A 1QRND 2PXYC 3MLSL 3ZMRA 1XQ4A 4PJEF 5CBAB 3RGVD 1JF6A 4XNMA 2ZCKL 1OVZA 3V0VB 2TRYA 2HVKA 1V7NL 4GXVL 1ACZA 4ZD3L 1AR2A 3SYAA 2R69L 1P7BA 2XZQH 4MD0B 1AO7B 2WCPA 2LOEA 1TG8A 3NT0A 4NKMA 1NDTA 5D7JB 2NNAB 3DVGB 3S35X 3ZRCC 3LRSB 3LNIA 4XAKE 1T0PB 3OKYA 5IV2B 3RWCA 2P7TB 1W16A 2HFGH 4NO0A 4OD2A 1HINL 4XI5C 1JNNL 3ECWA 5SWZD 1G7LA 1ID2A 3BISA 3NAAH 3ZDYF 2N1TE 2J8HA 1M9WA 4X98A 4OF8A 4LBEB 3CLFL 3NFPB 3WBDA 4NFDA 4AM0A 2BC4B 4P5TD 1YMME 1TZAA 1WUNT 4ZMNA 3QUZD 3DO7B 1GJIA 3QHZH 1AZRA 3LHPH 2R51A 2IWFA 2XXGA 3BAXA 1A3ZA 3GEWB 4EN3C 5T1KD 1ZV9A 1OTSC 3OB0K 4Z7WB 3PP3H 1IIIA 4Y7MA 5B1CA 4PP2A 5D71L 1HHJA 3GT6A 4KJPC 2WWKO 1BFTA 3FT9A 2EECA 4LLMB 4ZPVA 5FV1L 5IBTH 1XF2B 3UO1L 1NAKL 4YL4A 5ALBL 1Q1JH 2E74C 3NCBB 2AXJA 3WCYA 1MCQA 4XN8A 1IEAB 1JWMB 3OX8A 5DRNA 5L6YL 3X3GL 3QPXH 1PNCA 4HZLA 3CFMA 2AQTA 2E7MA 3MLXL 3MO1A 5E2TH 4J4PC 1IAOA 5D70H 4PVMA 3FQXB 1HQRB 2GTZB 3EYFA 3W39B 2YD4A 1FAIH 5CMAA 5E2WL 3HHMA 1GMIA 4MB4A 2XRAL 1U8JA 5BQ7B 1MZZA 3QQ3B 5DO2C 2L3BA 4AXWA 1UXWA 4UCFA 2ENSA 3HZYA 1D7BA 4OZHB 3L5XH 4CMMA 2UWEF 1NGZA 1P69B 4WO4D 3HG1B 1EEZB 1RXLA 1U3HB 3QJHA 3VD0A 5D71H 5DVKA 1GC1H 4R4BA 4XHQA 5D1QD 2I7OA 2VDRB 4OZIF 4LGSB 1ZANH 5I18H 3QC5X 4KXAA 1HESA 3T6ZA 4MRBA 4LHQB 4TMPA 2EIDA 3KDMA 4GUCA 2G0LA 5BOPA 15C8H 3MYJB 4LL1A 2KPNA 2X10A 4L3EE 4Z7UB 2R8SH 4XT1C 2Q3XA 1QZ1A 3ZKND 2YPLB 3JYCA 3X3GH 5L8LB 5AQ0A 5JPNC 4Q0XH 3TZVD 2ADFL 3IGAB 1V54B 3MBWA 5LBSA 4WGKA 3MJ9L 1E42A 5EN2B 2EEFA 3BP7B 1VGEL 4I9XA 3WIIL 3RWEB 2YGPA 2FT7A 2H3NA 3CFCL 5E56A 5AZ2L 3GZKA 2X4UA 3O4OB 3VXRE 4FQ2H 2V7HA 1NAMA 3LS4L 4YSQA 1IC7L 1EO8H 1J86A 3VB8A 3E2HB 3WU1A 2WWOA 1SQMA 4QXVA 1G94A 3QEHB 1FDLL 5BZWA 5CLYA 3G6AA 3B2VH 3TVMD 2GEEA 4XRCB 3W9EB 5EOTA 3I9PA 4JZJC 4KJWC 3PWPA 3W0WA 3P3YA 2BVQB 4E41E 4LQFH 5IBLC 4OLUH 1U95A 4OD2B 5H94B 2IDFA 3S35H 4RH4A 2Q1EA 2X1OA 3TL5A 2UZIL 4LPVA 4XN5A 1Q9LB 1ZT1B 5J3HC 3ZKMC 2XNAB 5DMGD 1A47A 3SGKA 5LKNA 1RIHL 2NZ9C 4K9EH 3ZIMA 1JIBA 4OM0L 1VFMA 3EYSL 5KOVC 3SKNA 4HDIA 2J12B 5HHMD 2WQWA 3DTXA 3MRLB 4XC1L 2NTSP 3C60D 5EU6E 1VLXA 3AT0A 4XZUA 3DGDA 4Y7OC 3ZOAA 5AUMA 3FUKA 1EBAA 1E3XA 4TOYH 2N4IA 3QORC 4YSUA 3EYVB 3TJHC 4L1HA 4WFEE 3QIWD 5E9DB 1HHJB 2VLJB 4KDTC 1FDLH 3S5LG 4UQBA 2E6PA 1OB1B 1SN0A 2FIRT 3IWUA 4TQ8A 4UV4L 5DD1L 3I9GH 4XOAA 4WQOA 3SE8H 4R97C 4GP4B 1S5IH 3NOIA 3A4EA 3IDXH 2WXNA 4EAEA 1TO5A 1BFVL 1M9SA 4QXWA 1KTLA 4KX8A 4XPHH 2QVKA 5DHYA 4JM0A 4XCNB 1HILA 1ID5I 2I25N 1IM9B 2UZIH 4DSYA 1K8IA 1JVLA 1IAOB 1EUTA 4LIQH 3NEEA 1CE6A 5I5RA 4OIBA 2OXGA 5CMAB 4D9RD 4POYA 2G5BA 1F45A 4XCFL 4YVUA 2COQA 5BRZE 3SN6N 1WZMA 1U8JB 4P3DA 1NUFA 3O6FB 4WV1C 3QA3B 4HKBA 3UTPD 2K6YA 1X7SA 3GRWH 1EJOL 3HZYB 3DROA 1ODUA 1NGZB 1I7UB 2XVGA 3BAJA 3DX0A 4OIAA 5KVFL 1FO0B 1QW8A 4S1QL 3KE0A 5KVFE 3U7WL 3FFOA 3L3OB 3VG9C 1A7OH 2F53A 2X09A 3LZFH 4KROC 1KB3A 1WG3A 1JRHH 3HLAA 4BFEA 2VSCA 3ARDB 4IBYA 1UGNA 4KK9D 4O9HL 4UV4H 3VWKC 1T7VA 1Q0YH 2DAVA 4IOIA 3EH2A 3KDMB 4Q58C 4OI9A 5FA4A 1NCCH 3PIQB 1DFXA 5FKAA 1J9SA 1BYPA 5EF3A 2XBDA 1X9UA 4ALAL 3LN4B 3A4FA 3H9SB 4QF1A 4QXGH 1KNOB 5TQ0L 1OSZB 4YBQC 3VFRB 4LSUL 5FAAA 3T0ED 4UT9L 3KWTA 3OZ9L 3P0YL 2V7HB 3IGUA 1WFIA 2XZCH 3QXAA 5FHBL 4GRWB 5TFSL 4BINA 1L3WA 3E8UL 2EDYA 2W9LA 2IO5A 3GF8A 4N26A 4X6EA 3G6AB 3ZSSA 1XR8B 3AG4B 3NFNB 1D9KD 4BQ8A 1I9JH 1XV8A 4D0DA 4TVPL 5D6CA 4TVPE 3PWPB 3ZHKA 2HB0A 5IB3B 4KJYA 2YAEA 4YHIA 3SCMB 1M4KA 5KYYB 4XVUC 3BIBX 5EF0A 5DK2A 5C0CA 1QFUH 1F11A 1UACH 3RU8L 3TBWA 2X1XR 4HKZB 4RISL 3R06A 1G7PB 4JKWA 4GMTH 1OAKL 2ZUVA 1VF5C 2KZWA 3QP3A 4HD9A 2R4RL 3SKNB 4HDIB 2K8QA 4ODWA 2JELL 2X70A 1M7IB 4HWNA 5AUMB 2WXJA 3TO4A 3KPMA 4ES8A 2D7TH 5K9QI 4EXPX 3WDHA 1IEBA 3QEGH 3L3KA 1U8NB 5FWRA 1OEZW 2PP8A 2NOYA 4P49A 2XKUA 4EPSA 3UZVA 4FJ6A 4KRPD 2Y5QA 5ESQA 2BINA 1KACB 4FQHB 1EERB 1KCKA 2CLVA 3MCG1 2IBZX 3DO4A 1RIVH 4PGDB 3Q2VA 4PGBB 4BKTC 1TETH 1CFNA 4OM1L 5IF0B 2VLRD 4KITB 1YZZA 4PRIE 4PY7A 4AENA 1GY1A 3X13A 4BYHA 5HDBE 3ZTJH 3HE6B 3BZFB 4TQPA 3WJJC 3RU8H 1SLWA 1YECL 4RISH 2RQ8A 2UYLA 2NT0A 2OXGB 5KS9F 1M1XA 4DP8X 1YPZF 1TVHA 1I1AB 5CHNB 1CLYL 4QAWA 4X6DF 3ARBC 3U9PL 2NY0D 2JELH 4HKBB 1FL3B 2UVFA 2H41A 3QJRB 1E5YA 1FNGB 3CFDA 4UDUB 2A4CA 1F56A 2XG5A 1JFHA 1V55B 2BNQA 5E4OA 1UURA 3DROB 3SIKA 4HK0A 1B4JL 1GHFH 2WC7A 1FFNA 4KZDL 1S7QA 3QZPA 4FZ8L 2PWEA 4BHUA 3G5WA 2FX8H 4G42A 7TAAA 4GKZA 1JAEA 3EFOA 5DFVC 1G4RA 2YRLA 3HLAB 4O2FA 1N2RA 2XVBA 4AUJA 1BG9A 5GZNA 1IL1B 2HMID 5L2KD 1UA6H 3HHSA 3SGDH 1T7XA 3GJFK 3BRGC 4NM4L 3ARUA 3MLRH 3QZWA 3GMNB 1IUZA 3S3CB 4OM1H 3B9KA 3QDMB 1WD9A 4Y5YA 3EYQC 3IRPX 4U1HA 3TBBA 3S8GB 1YECH 4PJEA 5ABZA 1UENA 1YYCA 4GS7C 4JPKH 4Q56A 4OI7A 1WTLA 2E9WA 4NIYE 3Q9QA 2KL6A 2QKSA 1N68A 2XVLA 1H3TA 1ZRUA 4H8VA 4HV8A 4LLQA 3TEZA 2GQHA 2VSKB 3VG0L 5INCB 2AJSL 4U6VL 3UJTL 2P46B 2QR0A 3FONA 3PF2A 4UMGA 3VFMB