1OALA

Active site copper and zinc ions modulate the quaternary structure of prokaryotic cu,zn superoxide dismutase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
151
Chain Sequence
QDLTVKMTDLQTGKPVGTIELSQNKYGVVFIPELADLTPGEHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE
publication title Active-Site Copper and Zinc Ions Modulate the Quaternary Structure of Prokaryotic Cu,Zn Superoxide Dismutase
pubmed doi rcsb
source organism Photobacterium leiognathi
total genus 38
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1oalA00
1DSWA 3GQFA 1JCVA 1UXMA 3RE0A 4A7UA 1QUPA 4A7GA 1E9OA 1PTZA 3GZOA 4U4IA 1IBDA 2V0AA 2WYTA 1N19A 2C9UA 5KBLA 4A7SA 1KMGA 1F1AA 1OALA 3SODB 1FUNA 3L9EA 2SODB 3F7LA 2AF2A 1YAZA 2WKOA 2WWOA 2K4WA 1F1GA 3S0PA 1IBHA 1OZUA 1XSOA 2AQNA 4B3EA 3GZPA 2WZ0A 1IBBA 1XTLA 4BCYA 1MFMA 2ZKXA 2R27A 4MCMA 1SXSA 1EJ8A 1HL5A 3CQPA 1JK9A 1AZVA 5KBMA 1PZSA 1BA9A 3CQQA 1SPDA 1N18A 3H2PA 4A7TA 1CBJA 1SXNA 1B4TA 2AQRA 2E46A 2C9VA 3KBEA 3KM1A 2XJLA 1EQWA 2Z7UA 3KM2A 3T5WA 1SDAB 3KH4A 1SOSA 1P1VA 2LU5A 1TO5A 3HOGA 3MNDA 1HL4A 1COBA 1IB5A 3HFFA 1F18A 1SRDA 1SXZA 1S4IA 4A7VA 3ECVA 3HW7A 1E9QB 2Z7YA 1YAIA 1OZTG 2ZOWA 3QQDB 1Q0EA 1IBFA 3H2QA 4MCNA 2GBTA 3GZQA 1XTMA 2XJKA 1Z9PA 4A7GF 2WZ5A 5KBKA 4FF9A 2VR7A 1PU0A 2AQQA 2ZKWA 1UXLA 1E9PB 4BCZA 1SDYA 2WKOF 4A7QA 5CU9A 3ECWA 1OAJA 3K91A 3GTVA 2JCWA 1L3NA 2VR8A 2C9SA 2E47A 1E9OB 1DO5A 3CE1A 3L9YA 2AQSA 3ECUA 1CB4A 2GBUA 2APSA 2WYZA 2AQTA 3KBFA 2WWNA 1BZOA 2ZKYA 2AEOA 2NNXA 4N3TA 1E9QA 1RK7A 3LTVA 3QQDA 4OH2A 1TO4A 2Z7WA 4BD4A 1B4LA 1OEZW 4L05A 3F7KA 2JLPA 4OJAA 1SXCA 2Z7ZA 1F1DA 1JK9B 3KH3A 1SXAA 3GTTA 4N3UA 1ESOA 1U3NA 2Q2LA 2WZ6A 1E9PA 1SXBA 3PU7A 2VR6A 2AQPA 1YSOA 2GBVA 1Z9NA 3MKGA
chains in the Genus database with same CATH superfamily
1TTAA 3NGBC 3TONA 3WJLA 1P4UA 1JPSL 2NNAB 3FQXA 3TASA 2ITDA 3AZUA 2ZOLB 1E9OA 3C60B 3D2UB 2QGCA 1A5FH 3QG6A 2ARWA 2FGWH 3CFQA 1IBDA 3AXIA 3HB3C 3L9BA 3MUJA 1JBJA 5IB1B 2X2YA 3C6SB 5DVMA 3BN9D 3VA2C 3JTTB 4OGQC 3DJSA 3SKUD 2JVUA 3V8OA 5HDQH 2EE0A 2FYYA 4WLCA 3B7TA 3OLEA 2WXRA 4JHBA 1W0VB 1GGCH 2Y7OA 1F45A 3RTQA 3STLA 3BJLA 3GS7A 1EFXD 1IBBA 2CR0A 5EC1A 1T66D 5CSZB 5FM5O 4E9VA 3O8XA 4WNJA 1QSED 4X6EB 1OT4A 3WEBA 2VL5A 3RWFB 4EUPG 5INCA 2QFPA 3JV5A 4QRUB 4FNTA 1U8JB 4UIMB 4NZ8A 1RK0A 1TFPA 4DOHE 3C60C 3NQIA 4N4YB 5E1GA 2LR4A 3REWB 1FNHA 4C56B 1LNUB 1Z2KA 3PJSB 4JFZH 4F33B 2ICES 1NFDE 1PZ5A 2VDRL 4PG2C 4M29A 4S1RL 3U9UA 7PAZA 4HAFA 4WFHD 4PBDA 1K5WA 2AJZB 1XX9C 1FNSL 4UQAA 3Q6GL 4A37A 4F9PA 5C70A 4LCIL 1CYGA 2EDRA 2DQEH 3C5JA 3IWVA 4X6CF 3QEGL 5KG9A 4G1EA 3VTMA 5KSBA 5E2TL 3PAZA 5EEUA 3VNZA 4OLEA 3OC8A 1AHWB 1I85C 1NDGA 1ULVA 1ZS8A 2JKTM 4LLQB 1R3HA 4Y16C 4LCWB 4F1ZA 1IARB 1P5UC 1RZGB 4QI3A 4XCNB 5EZPA 3NDYE 3D2TA 1EXGA 1DDHB 1TOXA 3E8VA 3MRKB 4U31A 3ARBB 5D93B 5CEZE 3CVBA 3C8KA 4ATTA 3L13A 4H20H 2RB8A 3CVHH 4I9XA 4JCMA 1E43A 2K4AA 1MJ7H 1B4JL 1PYWA 1YEIH 2Q8BL 4OCRH 3OKDA 3SKMB 1G7HA 4O9HL 4KKAD 4HKJB 2IGTA 4JY6B 1EZSA 1T4KB 5C0FB 1UWXH 2YC1A 5IFHH 2FNBA 2YPVL 5AVSB 4G8GD 5AZUA 5BPPA 1ZK9A 4JN2A 3BKYH 3CFTA 4P48A 5IQNA 3TIEB 3F7KA 3HFML 5C7XL 4JFPA 3R7QA 3A23A 2VISA 1EEUA 5HDLA 1G0YR 1ROWA 2W81C 5D93C 2J88L 2E7LA 4WI7A 3GMRB 4E5XG 3ZE2B 1BFOA 2CIKB 2H32H 4OIAA 2JE8A 1AHMA 3MRLA 3TBYA 3L3OB 5D96C 3RWCA 3HS0A 1MQKH 2XRAH 2OYLA 1KT2A 3RVTC 2LLGA 5JW3H 4IMKC 1QFPA 1CFSA 1RUPL 3CUPA 2RFXA 3IMWA 4FXLA 1I1FB 1UWEH 5C0DB 1O75A 1ORQA 1AC6A 4GQQA 4FQJH 3QW9A 2TSBA 3DURA 3GSVA 5ILTH 4J5VA 3A4FA 3FB7B 3ZW3A 3GK8H 3I6LE 3BAEH 5FFOA 5SX5K 3FRPB 1XR9B 3P11H 3WIHL 3MA7B 4WHYG 2GTZA 4Q6YA 1S46A 3B83A 5GZND 5L0QB 4JFHE 4PJGA 3GXTA 4KGJA 4O02H 2I9LB 4OZFA 1VFMA 3TN0C 3T6QC 4HUVA 4TL4A 3EYFB 2DQCL 4QTHA 3R06A 4UQ9A 5DEGB 3L3OC 3WEOA 1NBZB 1T6WA 1PLGL 3A4EA 4K73A 4KFZC 4HJ1A 3NSCA 4JRWA 5BS0D 3DX9B 4A2EA 5FO9B 3P1VA 4L37A 1PW3A 5HY9A 4FFTA 4D0DB 3KLQA 1A6TB 3EGSB 4P46A 3NSXA 3HW7A 3QIWB 1HXKA 4R3SB 4R90L 1BIIA 2P52A 2PUQT 2R4RL 4XNZB 3U4BH 5E5LA 1T03H 4NN7B 5KVFE 4PJCE 3C6LD 4APQA 1DJXA 4NQSA 4JRYB 2ITFA 3ARDB 4M7LT 1TQSA 1MNUH 2X70A 5EBGA 4JO4L 3VD0A 4Z7WE 1KPUB 4FOMA 12E8H 4XWGH 1RMFL 4S1QH 2X2UA 5BVJB 1H3PH 2J2ZA 3CXHJ 3FU7A 1WITA 3EHBD 4IHOB 4NCC2 5EOCJ 4WHDA 4I77L 3MLTA 3SE3A 3WN5B 4PGCB 4KJPC 5C0IA 2EDQA 1ETZA 4Z7UA 3V5HB 4QHMB 2EDLA 1CFTA 5T1MB 4DNLA 1TPXC 3EGDB 3HC3L 4JUTA 4EIGB 3FQRB 1AYOA 4PUBH 2AQ3A 1J8RA 1M71B 1HL8A 2ATPB 3S96A 2FUTA 4LARL 4H8WL 4NN7C 2X4RA 3FB5B 4FZ8H 4G42B 1MDTA 5E5RB 3UG5A 6FABL 2B2XL 1NSNL 3SD5A 5JHDE 3HG1E 1N67A 3A6CL 4PJDA 3QWOB 5LVEA 3D39D 2XPGB 2YQ2A 5HHQA 4TSAH 1BQUA 3KBPA 2L7UA 2HG5B 1M3JA 4Y4KD 2WIIB 5I1LA 2Y3NA 5AAWC 3ZQXA 2QVTA 1P9MC 1LQBC 2FIKA 4KHTH 5HHMB 5TQ0H 1A21A 2J8UF 5DSCA 1V10A 2VRQA 3X1EA 1M6OA 1URZA 4UV4H 1YEFH 1QLEL 2FX9L 2E75C 2QQNH 5C97A 2XQYA 1PFOA 4DERA 4LSDA 4FHKA 5GS0C 1QI3A 2BPBA 2XTJD 1F4YH 1KIUA 1PLBA 1YJDC 4CGUB 4PGEB 3O9WD 3UFIA 4YHML 3A21A 4PRPE 2BSTA 2GC7C 1DN2A 1Q9OA 3FU8A 5LWYL 5HHPA 4YHPB 4R26H 4MRCA 3CDGB 1S7TB 4F2EA 3PGCB 3LN5B 5HDWA 5JO5B 4OF6A 2DQFA 2CDEB 2EEFA 5C0AB 1B2WH 2UZPA 4FD0A 2VM9A 4OD2A 2XI9A 4ODVL 4Y2DC 4TTDC 4CJ0A 1OAXH 4Y4FC 4YSTA 3H9SA 5DMGC 2YOCA 3AITA 4KROB 1KBVA 4LBAA 1I3GL 1GOFA 1KB5H 3FKUS 3CPLA 1HAUA 5DK0A 3UPAA 1HH9A 4OIBA 1TCRA 1H0DA 3QAZC 2Y7QA 5DJXA 1I8AA 2F58L 1U8LA 1OT1A 3U4KA 1G9MC 5DFVC 2QT6A 4Z3JA 3UYOD 2XNAB 5AW4B 5C2UB 3T65A 1TJGL 1TZIB 2YXMA 3MRNA 1JZEA 4G6AD 3S3SA 2X4PA 3KLLA 3STZA 2ZYIA 2VSDA 3BUBA 3ARXA 1BWWA 3MCLL 2F18A 3AG2B 4NGHL 5FECB 4P59H 3ZKQD 4AEIH 2ILLA 3EZ8A 3VXOA 3RFZB 3ZKMD 4CC0A 4LOFA 5CS7A 1IBZA 1WCBB 4TUUA 5DS8B 4Z1PA 4LL4A 3O2VH 2Q6WB 4OLYL 2BHYA 2NW2A 2NZIA 4FQ1L 4UIKH 1DN0A 4L4JA 3CFEB 2HPTA 3TO4C 1S7VB 1U92B 3DVNA 4JGJA 3ZMEA 3K7UA 5HVHC 1PNDA 2EVHA 2GJJA 3VFTB 3FN0L 1EAPA 4LPYA 4XNQB 4A39A 1AGDA 2FEEL 3VE0A 3UTQA 3MV9D 3AQDA 4UWQB 3L3KB 3L2MA 1MFUA 5LBSL 2OMWB 1Q90A 2FQGA 2X1XR 1ZTMA 7TAAA 3W5NA 3IAPA 1ZANH 4U1GB 1KBGL 1S5IH 1UYWL 2F53D 4LSVL 4X6DB 5IM7A 1J8SA 2XBZA 3H1ZA 4ONFL 3RZCA 4JM2D 1Q8MA 2WBJA 3K2UL 1G0DA 3LV3A 5D71L 3GI8H 1S7QA 4HFWA 4HETA 4XNYH 3QUXD 3VMPA 3VGBA 4N68A 4DP5X 4FXGB 4HD9A 1PNCA 3DHMA 1JHLL 3E3QC 3D4ZA 2B4CH 1OP9A 3E80A 4KJQC 4QHLB 5F7LB 1RSYA 2EDTA 3BUQA 5JOEA 4BK5C 1J88A 3WSQL 4DHLA 4RMTA 2OL3L 3D05A 1A1OA 1GC1L 1BQHB 4PP1C 3MKGA 5BO0D 2RALA 4CVWA 3RTLA 1YRKA 3MNZA 1DQLL 3FO0H 3N04A 1AIFA 3MROB 2C7UB 4N25A 1DLFL 3GZOA 5HDRA 1K4CB 3BLPX 2JF1A 2AMUA 3PP3K 1OXYA 4CMMA 1HOCA 1MCOH 4JRXD 1MCKA 3ZTEA 3FO1B 1KEGL 5B8CC 4XN9A 2OMVA 1HK6A 4AQEB 2ZX9A 4XN7A 4B9ZA 1EPFA 5JW4R 4MJIB 1N6UA 4N8UA 4N9OB 4FTDA 3ALXA 3HB3D 1LWJA 3KE0A 1PSKL 4A2LA 2MIZA 4NZJA 3HG3A 3VW3L 3FSAA 1J1OH 4UUJB 1HXYB 1KIRB 4QRTB 1HNYA 5IESL 2OMNA 4GQRA 4UTAA 2X4NB 1ZT4B 3UBXG 2YGQA 2Q7NA 2VDNL 3M07A 2DQUL 3JV4A 4FJ6A 1JV5B 3AREA 3DTUB 2ADGB 2DDQL 3MGTA 5KBDA 4MXVE 3V6OE 3G6JB 2GI0A 1L0QA 2UWEF 3C60D 1VRSA 2CM5A 3F04A 3HUJB 3L4UA 2WP3O 1HHIA 2EUWA 4OQTA 1NFDA 2WZ5A 4PRHB 3S36L 2Q3XA 1QD0A 2BSSA 3VGEA 1MVYA 5PAZA 1UM5L 2P7TA 2W91A 1QBLL 1PD1A 4FYSA 3WTSA 5L6YH 2WLJA 4R4FH 3H9YA 5F89A 3UZQB 1MJUH 1FL3B 1KZQA 4W6YB 1VENA 1ZK5A 2O5NA 3FQXB 1UWYA 2ITDB 3QG6B 1E9OB 3CX5J 4WKZA 1NZRA 5EF1A 5H2BA 1UFGA 3CN2A 3LNEA 1RIVL 4B9FA 3RQ3A 4Y16D 1IGMH 2VDOH 3S88L 4GSQA 4C56D 2FYYB 1K8DB 2AJVL 3SYCA 5HPOA 1SFHA 3QUYC 2LOEA 4NERA 1OHZA 3RTQB 3DIDA 3STLB 2B8OT 3KJ6L 2J56A 5EC1B 1QACA 4K3DL 2JQMA 3O8XB 5HD8D 3SE8L 3FN9A 2VL5B 1EZLA 2V2XA 1U8HA 5D7LE 1PG7X 4OD3H 5INCB 5L4IA 1R33A 2R69L 2Q20A 1NOAA 3MV8E 1AG0A 4K5LA 1J9CT 4K15A 4U3SA 4HU8A 1RK0B 3KPNA 4L5FH 1V3MA 5FWRA 4J2QA 5I6KA 2V3DA 4LCWD 1UT1A 4A7UA 5KSAA 5IROA 1PZ5B 2VDLB 3ABLB 3K6IA 3U9UB 4PVBA 1E28A 5FYJE 5T1JA 3UGEA 3N44B 1F2XK 3QS2A 4B0MB 4IKIA 1NCGA 3C5JB 4KK6C 5AVXB 1HN1A 3KVDD 4PCYA 5C3LD 5KG9B 1B6UA 5E94A 4G1EB 5KSBB 4RFOH 3EF4A 2NSXA 2YXVA 4EEEA 4WFFD 3MO1A 1NDGB 1ZS8B 1I75A 2Z1KA 4I3GA 1R3HB 2RGSA 3FCUB 2FH6A 2IADA 3LRLA 5LXGH 1M7IA 3LZRA 4LEOA 1H3WM 2H26A 4D2NA 3BCDA 3B2VH 3CMOH 1GW0A 1N9PA 1ECZA 4XBEL 3C8KB 4P4KA 3F05A 3CU1A 2YOAA 2FTAA 1RFDL 3QWNA 3V4LA 3N0PB 1PD0A 1JFQH 2HP4A 4DP0X 1MIMH 2VTFA 4ECNA 2HLEB 1PYWB 3OKDB 5MEOA 4F9PC 1G7HB 4E9QA 5LHDA 3QEQD 1YEEL 4HKXA 5LUMA 5ACMA 1CLOL 5A2JH 1F4AA 1QUNA 3QARA 2YC1B 1B88A 1UH3A 3HG4A 4RBPK 1W72H 1QSVA 4JN2B 3GZQA 4JFPB 3GBNL 4TNGA 1NEZG 4MAUL 3AB0B 2VISB 4A7GF 1QW8A 5F8QC 4O2CA 1MHEA 1RHFA 3NJJA 5F7YC 4YMPA 1BFOB 4BZYA 4UZSA 3WO3B 4H8PA 4PJCA 5EO9A 1Q94A 1F90H 4P2OC 3MRLB 4HEPG 3TBYB 3ABMB 2FD6H 1TZAA 4C55A 3HS0B 4LDEB 5AW2B 4U6TA 5T8IA 5ABAA 1NCDH 4HA1A 4Z7WA 2J73A 1CFSB 3CUPB 1F3RB 1XB6A 2RFXB 4FI7A 4E9RA 5I1HH 5KS9E 4JB9H 1ORQB 5DUPL 2R0KL 3LKRA 5CM1A 2NZ9C 3DURB 2N1KA 3GSVB 4GRLC 1CL7H 2ZOUA 4KJPD 3TPUA 1EK3A 3AB0C 5FM5M 1RK7A 2AW2A 5K33A 2Z0BA 2GTZB 1RUKH 4PJGB 3Q1SL 4N22A 4HUVB 2HRPH 4OZFB 5MHSD 1QTYT 5ECJE 4DQOH 2Z34A 3RX7A 1R3KB 1XL6A 4FLQA 1NAML 4QTHB 3R06B 4JRYD 5JHDA 4O58H 3C9NA 3HG1A 1BZDA 4GP5B 2WW8A 2VKXA 4J3BA 5CEXA 2IGLA 3APDA 2GBVA 5DLML 3S98A 4ODHH 4AV4A 3WFHA 2H1PL 3DX8A 3CZGA 4BELD 2DZEA 4MCZA 4GQ9H 4L37B 4M8QA 5HY9B 3LPPA 2CGYA 4P46B 3KPQA 1V7MH 4KK8D 1BIIB 1OGSA 3HMWH 2MEJB 2MPVA 5IF0A 2DWSA 3AABA 1R4XA 4NQSB 4HIHA 4NQEE 1AOHA 1QEXA 4Z95L 5GGVH 1CVRA 2E9BA 2NYKA 5CCJA 5GS0D 2UZXA 1IGYA 2X70B 3EDJA 1JZGA 2IVFC 1NCIA 2NQCA 4XNAA 4RGMB 4UT9L 4PRPA 2ZKXA 1FGNH 2J2ZB 3FU7B 3QORC 1T04A 3MLTB 4ZMLA 1E6JH 5C0IB 5I0DA 1ETZB 4Z7UB 5DVPA 5AEAA 2CK0H 4AK1A 2AXWA 2AV7A 3NTCH 3DOSA 1DSFH 3F58L 1J9RA 1KJ2H 3IDJB 2BVOA 2X9YA 4TTDD 2E27H 2Y9RT 3GXFA 4Y4FD 5HHMD 5CBEA 3S96B 3MBXH 1QLFA 5DMGD 2VB5A 3NESA 1JDDA 2X4RB 3PWNA 3BT2H 5B38G 3IPFA 3Q05A 2ZXWB 4HMCA 1MN4A 4PJDB 1L3WA 4EN3A 4G70B 2H1XA 1AZCA 5HHQB 3HC2A 2BCMA 1T89C 4IDJL 4JFVA 1XCXA 4B3VA 3BPLB 3DMMA 5D1QC 5I1LB 5KJ7E 5E5UB 1Z9PA 3K71A 4MVBC 3HZYA 5JZ7C 4LVHC 1FO0H 2FIKB 1D6EA 2NRDA 4HDIA 2QSCH 3ZE1E 4UAOC 5DSCB 4FABL 4NN5B 1YC8A 1M6OB 3D4GA 4ZTOL 1AFVL 4JQXC 4MAYC 4UYPA 5L7XH 1KELL 1KIUB 2WAQA 3MZGB 2BSTB 5DU7A 4XGZA 1BAFL 5LCVL 4RA0C 2CO3A 1Q9OB 5HHPB 4JHVA 3EZJB 2VH5H 1EJ6A 3BPLC 3D9AH 1RPQA 2VMEA 4M62L 2K1MA 1RZKL 2DQFB 4JAMA 2HJFA 4WI3A 5JHBA 1VCAA 2ZWLT 3LTVA 4OD2B 4N1HB 1YN7A 3H9SB 3TJEL 1WHPA 2K8MA 3SDXE 3MLWH 1NIFA 1ZIBA 4G11A 3CPLB 5DK0B 4KZCA 4MS8C 4ZMTA 5DMIL 3L5WB 3EYSH 1HH9B 3RU8L 4AQ8A 5EBMA 1TCRB 2APWA 2EE9A 1H0DB 1MI5A 2Y7QB 5DJXB 3WNMA 1S8DA 2ZYSA 3QZWG 4GXVL 4PBXA 1GYVA 1DSWA 1U8LB 2JI1A 3E0GA 3GQFA 4HIJA 3HAEG 1U91A 5KVDE 4KJQD 4J3OC 4F8TA 5F7NC 1KIPA 3T65B 4N24A 4FE9A 3MRNB 4FQXC 2ZOOA 8FABA 4DPRA 1G1KA 3EJSA 3BP6A 4DTGL 2X4PB 3LKSA 4YN3A 3STZB 5I2IA 4JRFA 4XXWA 5ERWA 3PUCA 3JWOL 2DLHA 3BN3B 3GSOA 4N0UE 2AQNA 2VDPB 3VXOB 5DHEA 3ZO9A 4EDXA 5I8KH 2X3BA 4BQ9A 4BZ1H 2JJTC 3F65A 1ZLWK 1X5LA 2NW2B 1DN0B 3LMJH 2ADYA 3K8MA 5LGKA 3DVNB 4FA6A 1A6VL 1MRCL 2P49B 4XNXH 1NGWA 1Q0YL 5SV4A 4W9JC 1HC1A 2EXWD 1EAPB 3T2NH 2R56H 4YE4H 1AGDB 3BWUC 3DX6A 3UTQB 3VE0B 3D33A 5DCCA 5C92A 4XX1G 4O2EA 1QLRA 3QXTA 5IM7B 5AKSA 4EZJA 3MRBA 3P73A 3RZCB 2WBJB 4B7LA 3LV3B 4NNPL 1IE4A 1OZTG 2IPTL 1S7QB 4HFWB 2PETA 4JGMA 3AGWA 2E76C 3D12B 4WFED 4XAKD 1SVBA 2GJ6D 1G6VK 1J0IA 5DD5H 4JO3L 3EUUA 4ZMQA 3TEXA 1MCJA 3B4NA 1GIGL 2Y25A 3ARGA 1HCYA 3H3PL 4FNLH 1A25A 3V6OA 1WAPA 1HCFX 1A1OB 1HE7A 1KPRA 4MQ7A 5K5YA 1GJWA 2EIEA 3DHUA 3M46A 1D7CA 3MNZB 2NYYC 3CXFA 1I7TA 2ENYA 5AKTA 1AIFB 1ETJA 2VZOA 1BXVA 3GB7A 1A5FL 3PWPE 4LOUC 5G4MA 2Y6SD 4GNKB 3AXHA 4DEUA 4FCAA 2K7PA 1R5IA 2AQSA 3VAEA 3UBFA 4CMMB 1HOCB 3K81A 1WAEA 4V2CB 2X9WA 4BWUA 3ILEA 5AWNH 1AXTH 1ZT1A 2BNRE 3G08A 1GGCL 2OMVB 1YYLH 1S7SA 1SLUA 3SGJA 1EHXA 5F93C 2QHLA 3O6KH 1R3JA 1WFJA 4YDJA 1T21A 2WLZA 3WJJA 2Z7ZA 1J5HA 3RNKA 2UX7A 3ULVH 4LVNC 3EW3B 4ZRGA 4U49A 4ADJA 1FGVH 2WV3A 4FI8A 1X7QA 1NGXA 4PJ5E 4OM0H 3JV4B 5TDOA 5D7LA 3BIKA 3AREB 3SGKC 3MGTB 1OGPA 1UWFA 5BRZE 3MV8A 2GW5A 4WJ5A 1N19A 2Z31A 4QRRE 1HQ4A 3CZUB 3LH2H 4U2YA 4DOHB 3BUTA 5FWQA 5KJRH 3NYKA 5BVPH 2Q2EB 4DKFL 1ZTXL 4W9IC 2FJGA 5ITFA 4NAJA 2DQEL 5KJ4A 1HHIB 3D48R 3S0PA 3WU1A 3ZRSA 4LKCA 4NX0A 3PP4H 1AS6A 1NFDB 1ZHNA 4NCDA 2WCSA 2C3XA 4ICXA 3GC3A 3VWJA 5E6IA 2BSSB 2R2HA 2P7TB 3BEVA 5D72H 2DQDL 3U30B 4K2UH 5JLZA 5F89B 1JK9A 4X83A 4CSPA 1Z5LA 4KK6D 1AQKH 4YDLC 3AS2A 5FO7A 4NQCE 3QUMA 1XVSA 4L9DA 4WKZB 5DJZA 3IDMA 5H2BB 3CVHL 3IF1A 2QVFB 1S78C 2DY2A 2ZXCA 3KMDA 1YEIL 2JKJA 5FYLH 3GLAA 3O0RL 4GAJL 5IQ7H 4MJ4A 1FCGA 4K3HA 1KFAH 4Y5YA 1AMYA 3DGGA 3BZFA 4ONGH 2BJMH 3EFDH 3TPKA 4QJ3B 4G7YH 2QPDB 4N5UA 1FP5A 2WXMA 5GJTH 3U30C 5TQ2L 3V7MA 2V2XB 1U8HB 2DI9A 2VLMD 4JDTH 4L2YA 4OZFH 1P7HL 4LZKA 4U3SB 4WWKC 3NSJA 1HZKA 1MCSA 2KPNA 4D9QD 2FWSA 2RA1A 3PGDA 3KG5A 4PJ9C 3GDBA 4ZUUA 3LIZH 5JW3L 1MQKL 2HZHA 5KSAB 4DO6A 3OHXA 1G1YA 4HK3J 3L4YA 1QRKA 3QXWA 1E28B 1UGKA 4POZC 3TLRA 5L2KE 1UWEL 3QQXA 2ZUVA 1BPVA 4FQJL 5DZ9A 5ILTL 1MW0A 4YDIH 1UGNA 4P2OD 1QFUH 3VD1A 3BAEL 2BIPA 1WWCA 1M1SA 4HYTB 3L1GA 3P11L 4W9GC 5E94B 2KS0A 2Z7WA 3SCMC 3MO1B 4NNYA 1IGIH 3PFUA 2I27N 3QNZA 5KS9A 4XOBA 1PG7L 1NCAH 2IADB 4PB9H 1M7IB 4LEOB 2H26B 2NZ9D 4GRLD 5LN8A 5B7MA 4K3EH 2E8ZA 1E50A 3VFPA 5KSAC 2WCPA 2OXHB 4QRSA 1OANA 4P4KB 3KLDA 3TEZA 3FCBA 1P6AB 2AK1H 3J7HA 3TT3H 2VLRD 2WB7A 4XHQA 5MEOB 4AL8H 4NQDE 1OT2A 1L6PA 4HKXB 2O26U 5J0BA 2WYTA 4FERA 4M5TA 1QUNB 5IHZA 3U4BL 1T03L 3B8YA 3BGFB 1AKJA 4CL7A 1HH6A 5IT2H 1KN4H 3LQAC 4LRNH 3B1UA 2WANA 3LVTA 2EDJA 3U82B 1MNUL 3ABZA 3TM6A 3IVKA 4PHZA 4O2CB 4ZOAA 1MHEB 4XWGL 3OAZK 5EU7E 3II2A 4XP4H 4P4KC 3D87B 3FTGA 1H3PL 1BMZA 4PW9A 4HPHA 2A38A 4PJCB 5EO9B 1Q94B 4KRPC 2WYHA 4NQEA 3SPCA 3OWEA 1RUAH 4P2CG 5DMJB 5GRZA 5DHDA 5DO2C 1R19A 4BKLA 1DCLA 4JFOA 5GGTA 4YDZA 4Z7WB 5TPWH 1XF1A 3QH3A 5T3XD 3QZNA 3S34H 2WGXA 3LKRB 3QORD 4A6YA 3BGFC 2CKNA 4XO3A 4FZ8L 4IKLA 4K55A 2DLIA 1HHHA 3M88A 3TPUB 3NFNA 4ELMF 3AVEA 4X6FA 2C4XA 5I19H 2VN3A 3AG1B 2YBRA 4FGMA 5HVGB 5JOPE 5MI0C 5F21B 2XKNA 3U1QA 4U0RC 2Z6FA 5CJ8A 2NUPA 2FSEA 1WS7A 2EIJB 2XX0A 3VYOA 5JHDB 3C9NB 3T0WA 3LHPH 3B3BA 3HG1B 5CLXA 5CEXB 3T0EE 4HGKC 4UV4L 1YEFL 1RU9H 1PVHA 2QPSA 4K94C 3VQ2C 4Z8FH 1NIEA 2QQNL 3K6NA 5CJOH 5DO8A 3WFHB 3OKMA 4M7JH 1P6FA 3JQOB 3DX8B 3BWAA 3KL5A 4MVBD 4POUB 5JZ7D 4M8QB 2YSSA 5AOKA 3OB0K 3KPQB 3VGGA 2GSGA 3GJEA 2D2OA 5IF0B 2AS5M 3N42B 4R26L 4TSCH 4M03A 4HIHB 2NXYB 2P5WE 4MAYD 3SE6A 2UZXB 1IGYB 3V52H 1EBPA 4MJ2A 1B2WL 4DPCX 1YMME 1IC1A 1OAXL 1JZ6A 3Q2VA 4PRPB 3BX7C 3W82A 1ZWIA 1OGAE 5ALCH 1MFVA 1T04B 3X2QB 1DZ0A 1KB5L 4I2XE 4TLTA 4BZ2A 5HYJE 1JGVH 4UT7H 5ESVA 3EBGA 2AV7B 3QJQB 3DOSB 1CF1A 2BVOB 5CBEB 2TSAA 3EOYG 2OJ1A 1QLFB 1H3UA 1XD1A 1OWRM 2YAFA 3SDXA 1N26A 5F6IB 5L8KB 3PWNB 3HZVA 4HIQA 4WSJA 4PBWD 2YWZA 3L45A 4EN3B 4Z7AA 3ZE0F 4WO0A 3W37A 3H9HB 3ZTJG 3SN6N 1G87A 1NGZB 3DMMB 2PPFA 1E3FA 4P59L 3FH7A 2WMPA 4JM4H 3K71B 3UH8A 3HZYB 5TH2A 4ZUWA 4TVPE 4J3OD 1D6EB 4HDIB 5B1BB 1RPUA 4KVCH 1KDJA 2ZWNA 1SM3L 1OVZA 3QZMA 4HPOH 3HVDA 4RMQA 5LQBH 2PW2A 1NICA 5KBMA 3BD4A 2OMXA 1EWHA 4M5YH 4N0UA 4Q97A 4PJ7E 1ZHKA 2C9VA 3I2CH 2ADJA 2XJLA 3H2WA 4PEEA 1C8QA 1H6TA 3MX0B 2V5TA 3U0TA 3EFFA 4EN3C 4IRZL 4XBMA 4XGZB 2VWEE 1B3JA 5IVOA 3QFJE 1ZANL 4F8QA 2VXQH 3CNKA 3TEWA 3DX2A 5I75B 4JAMB 2BY0A 4MNQE 3EH4B 2HJFB 2IAMA 4HUWA 2WQUA 4HISA 4ODSH 3ZDYE 4P2RD 3MOQA 4HWUA 4KOBA 1YN7B 4ZMOA 4PJEE 3BOVA 1MIEL 3FTUA 4KKPA 3CFCH 1A6AB 2WVSA 4X99A 1ZLEA 2AEPH 2DMCA 1QNZH 5EBMB 3ZKXB 4AVKA 1G7QA 1KN2L 4W4NA 4BCZA 1MI5B 3OV6A 1UA6H 3H3KA 2HX8A 2OJZH 3U6RA 2XVLA 3BISA 1L3NA 4HIJB 5J5EA 1U91B 2NOYA 2I69A 2YZ1A 4NKQB 5FR3A 1HINH 5A2BA 1JNLH 1S9XA 4FFYH 1KIPB 3EH1A 5E4EB 3O2WH 1R3IH 3ZHKA 1NM9A 1QI4A 2DAVA 3BVUA 8FABB 3DUUA 3HI5L 3BP6B 3LKSB 4PIRF 1OB1B 3WY2A 1MCOL 1KYOK 2B3RA 3WFEL 5I2IB 4OCSH 4FG4A 5ERWB 3FO2A 1P4LA 3GSOB 4EDXB 3ZDXE 3Q9QA 2WQWA 2NYYD 1N7MH 2ZXDA 5C0BD 3KJ4B 3PWPA 2Y72A 4B5ZA 1PCSA 4LOUD 1OGTA 2VLJD 4CKQA 3ZKXC 1JPTH 4OJAA 5MP6H 4ZW8A 2MSPA 1J1OL 1NGWB 5DJAA 4AYEC 5HGBA 4IU3A 4FP8H 2BNRA 3QDGE 2FO8A 2IQAA 5FPIA 4G80A 2WO2B 3DX6B 1BHGA 3MUGA 5FHAH 3VO0A 4Q6IA 2MNJB 4U05A 3B43A 4AENA 1QR1A 1EZUA 4O2EB 1QLRB 4BQ8A 5CIPA 2O6PA 1KCBA 1OAUH 3MRBB 3UJIL 3H7BA 3P73B 4P2AA 1SNRA 1F6AA 2M8XA 3JWNG 4FJYA 3NOIA 2BINA 1SYVA 1L9RA 3KJ4C 5FHBL 2BFVH 4NM4H 5CEZH 3P0VH 4R4BA 4HKBB 3IE9A 3ULUC 2W5PA 1SHMA 3BWSA 4PJ5A 4BJLA 2JKSA 4OD1H 4TUOA 5F1NA 4JQIH 3SZ6A 3RY4A 4EAEA 3ARGB 5BRZA 1CGSH 4YWGH 2UZIH 5HVFB 4QRRA 5D4HA 4Y1AE 2GEEA 3PHSA 2WO3B 3IB4A 5L6YL 1KPRB 4MQ7B 3SE9L 1MJUL 2KKQA 5GGQL 2J8OA 4YE0A 1I7TB 3KM2A 2FSDA 4KMTH 2ZQKA 3GB7B 3HPLA 4PQXA 4XI5C 4LPXA 1XZWA 2YD0A 4PYHA 1R5IB 2H0JA 4CMHB 5F7KC 1IGML 1LDSA 3AWGA 1J1XH 2NNRA 2VDOL 3RJQB 1JJUA 1ZT1B 4GKOA 1J18A 4BCXA 2J1ZA 3G08B 4NQCA 2JKWA 5D6DC 1S7SB 5I0ZA 3ARED 4YDJB 1R3JB 3TL5A 1TTUA 1YHPA 1S78D 2VQUA 1D3CA 1T21B 2Q0ZX 4TSBL 1O7VA 4YDVA 1HTYA 2YMTA 3PV7A 4L4VE 1VEMA 4X8JA 3FBKA 4OD3L 3IJ9A 1B9KA 3LZOA 3RNKB 4ZZKA 1IM3A 5FO8A 4XCCH 4KK9C 4OFQA 3INUH 2JKNA 4QO1A 1FHGA 1YYCA 2IPUG 4MX7A 1L7TL 3ZZQA 3ECWA 1XMEB 3DDFA 3OZ9H 1X7QB 1NGXB 5KSUA 2VMFA 5TDOB 5D7LB 3BIKB 4AG4H 2D8KA 5D7IE 2HB0A 1EHAA 1XCTA 3MV8B 4GW4A 1E6OH 1NGYA 2V9RA 4WJ5B 1A6WH 2Z31B 3W56A 1HQ4B 3UZEC 4WSGA 1NWPA 5A3ID 2FECL 4OU3A 2FJGB 4M3JA 4XO9A 3I50H 5ITFB 1Z1WA 4QRQA 2F19L 1G7PA 4JR9H 4LKCB 1FRGH 1ZHNB 1EVTC 3NZUA 3VWJB 4PS4H 1CXLA 5E6IB 2R2HB 4DP4X 5L2KA 1SHWA 3BEVB 5D5ME 2LU7A 1DFXA 3KHQA 4P99A 4L0YA 1J05A 2QQKH 5LXGL 1QX1A 2ZUWA 3LNIA 3WHXB 5JLZB 1G6RA 1JK9B 3B2VL 3VYPA 5I8EA 1XF3B 3CMOL 1Z5LB 1RJLA 3QXDA 3QP3A 1KYFA 5FO7B 5KVFH 3G6DH 2DRUA 4KHXH 2QPFA 3QUMB 4XBGA 4B97A 1I7UA 1T2JA 2P5EE 3IDMB 5DJZB 2BVTA 1JFQL 1LEGA 1M7DA 1MIML 3IF1B 2IXQA 4GS7C 4NXKA 4UNUA 5E1IA 1IBYA 4QDGA 4BINA 4NBXB 2EXYC 4HUUA 3SE4C 1C08A 1WA2X 1BOYA 3BKCH 4RSYA 4Y5YB 2XTSA 2J71A 5CKGA 3S5LG 4BK8A 4FLSA 5KSAD 1N0XH 3BZFB 3DGGB 3MPCA 3QZPA 4BRJA 5IROD 3IFLH 1W72L 3BVNA 4OTXH 1DQJA 2P3YA 2FJHA 3C6EA 2AK4E 3V9CA 1DQTA 4NQDA 3ETTA 5EOCH 3FSOA 4IBYA 3BRDA 2JELH 1XTLA 5IVXE 4JM2F 4BCYA 5CEYB 3KLHC 4YSOA 4BXSV 1H9VA 2BHUA 4MZRA 3BJ91 2PWGA 4QHPA 3PGDB 3ARUA 15C8L 4ZUUB 1YY8A 2FD6L 1G1OA 1CBJA 1CGVA 3BESR 3OHXB 5AG8A 1NCDL 2BCKA 2Y5TA 4UB0L 3I6LD 5T33L 5T5FH 5I1HL 4YL4A 4P4KD 2V8MA 2ZOKA 4R84A 4F27A 1YEHL 1JI2A 2CPCA 4GQZA 1CL7L 1KZYA 4L1HA 1MRFL 4KU1A 2A83A 1PEZA 2YQ3A 5DO2D 3NQKA 1Q0XH 1VFBA 4YBLB 5F6HI 3PWUA 4NNYB 3STBA 3OZKA 3QNZB 1RUKL 4L9LA 5KS9B 1OV8A 4EPSA 4PJHE 4LCVA 4WI2A 4DQOL 1PZAA 4XNMB 3WLBA 1FG2A 4PJFA 3TVMA 3VFPB 4QD2E 1PU0A 3LKOA 4QRSB 4O58L 3VXRD 3BQUA 2H0PA 4OI7A 2Y6TE 2WBXA 3OR6A 1EBAA 3FU5A 3GHBH 4ODHL 4KTDH 2H45A 3E6HA 4NBZB 1FJ1A 3U0PA 4GQ9L 1SZNA 2BSEA 4XPFH 3NJKA 4X8XA 3AUVA 2AJSH 4KVNH 1V7ML 1BSIA 3WO4B 5IHZB 3HMWL 4WI9A 2HKHH 4PRBA 3QPXL 3TZVA 3T0EA 2AQTA 1AKJB 1YPZE 1HH6B 3X3FH 5GGVL 2OCCB 1E5BA 3LXUX 1ZA3A 4JX0A 3SDAC 2ZP0T 3T1FA 3IVKB 2P24A 4K4KA 2ZCZA 4FLRA 1V8HA 1FGNL 3FTGB 2YXWA 1E6JL 4NQEB 2MOQA 2P5WA 2PCFA 4JFSA 4AJVA 4BKLB 1KENH 4JFOB 4PLOB 1RZIA 2QVMA 3PU7A 1KTBA 2O61A 1KJ2L 1YMMA 4LVEA 5DURD 2BW4A 2E27L 5JHDD 1SHSA 3MBXL 3KYKH 4A6YB 4X80L 1OGAA 2DQ6A 4HSQA 5G2NA 4D3CH 2NZ1A 4I2XA 4LAJH 2B59A 5HYJA 1HHHB 2DYPA 3NFNB 4X6FB 2V37A 3ATDA 5HVWA 2YBRB 4Y5XC 3GPEA 4MXQC 4AT6A 4X7FC 2NT1A 3PQYE 4F1SA 4OW6A 3SY0A 2NY2B 2XKNB 4PI0A 3ZYJA 1BW8A 2X41A 4WTQA 4A2GA 1SLVA 2NUPB 1FO0L 2VRAA 2FSEB 2QSCL 2IV9A 1L7IL 3FT0A 1AGBA 3EAKA 1HCZA 1U42A 5HYEA 3FS9A 3X11A 5HP5A 3UL4A 4PRPD 3OKMB 4R2GC 1WCQA 4XP5L 5DHYA 2K0RA 5L7XL 2QKIA 1SN0A 3BWAB 4G7QB 5D7SH 1U58A 1KEMH 3VI4F 5KAQF 4UOZA 4GJTB 1RK1A 1WBYA 2YSSB 3ZE1B 4F3FA 2GSGB 3T2LA 3GJEB 2VH5L 2I07A 1WT5A 1IUZA 3D9AL 5AVVB 3UIZA 2WQSA 5TE7H 3LD8B 1E5UI 4PJ7A 3RNQB 4XCEA 1IBFA 2YRBA 3FTXA 3R1GL 2H41A 4EN3D 1WUZA 1ZWIB 3I9GH 3QFJA 1P5VA 3MLWL 3UC0L 2PCPA 3FDWA 3UTZA 5ESVB 5I26A 1HYSC 1OP3H 4OCNC 3EYSL 4MNQA 3ULSA 3CLEH 3CHQA 4HS6A 1ORSA 4JKKA 2GC4C 4PJEA 3V9EA 2JKLA 1HJBC 3VXPA 1I9RH 4G6ML 2ZAHA 2LAGB 5C8JA 3SDXB 2OTWA 3HZVB 3NIFE 5A7BA 1EUUA 2D0GA 3P30H 4D94A 1BAWA 4HXAH 4XC3L 3SBQA 1JZ8A 4LIQH 4ZYKA 1KBPA 1DQQA 4ZUWB 3K0YA 5I8KL 3D0AA 4QGYA 1FFOA 4BZ1L 3L2LA 1GY2A 3KGTA 4JUSA 4DUWA 1HIMH 5CCKH 1WK0A 4KZEH 2PW2B 1C1EH 1KV3A 9CGTA 4XNXL 2OMXB 5IJKC 2EH8H 1ACCA 4N0UB 1ZHKB 3T2NL 2R56L 2ADJB 2JIXD 4AZ8A 4YE4L 1B9ZA 2CBPA 3WAKA 3U0TB 1ID5I 3EFFB 2L7JA 3NA9L 4KI5E 4JEGB 3GDCA 2VXVH 2O30A 4EOWH 1SY6H 3GEFA 4DT2A 1FNEA 2UUDH 4LMQI 4LVOC 2F74A 3KWWA 1U0QA 2IAMB 2YARA 3QDGA 4HUWB 1TSRA 1FUNA 3GI9H 4YSPA 4Y4HA 4CVUA 4OCXH 3ARVA 4LCYA 3JYBA 3W81A 5H37H 4D7PA 1NMCC 2LAAA 5DD5L 2F1EA 4X99B 1CFQA 4U6YA 5HJBA 1J1PH 1TLKA 2GUYA 5DD1H 2PR4L 4POYA 4XMTA 2Y07H 1XGTA 4FNLL 4UQ2A 1G7QB 3JVFC 4OGYH 4QXWA 4BHUA 1REIA 1V3JA 1LP9E 2BVQA 3PPEA 5C6PB 3U6RB 4U7MA 4X7CC 1E67A 2EIZA 3ULUD 1TNMA 4EI5C 4JPIA 1U8IA 1S9XB 4WGVB 3ELAT 3DUUB 4P2YA 3EJJX 3VMNA 5BW7A 2HLFD 3EH3B 2G3NA 1BJ1H 1COBA 1T1ZA 3R18A 4Y1AA 2P80A 1IGFL 2E4TA 3Q43A 3FO2B 3KGUA 5FYKL 2XIDA 1WHOA 5AWNL 1AXTL 1P4LB 1EZVY 3B7YA 1YYLL 4TYUA 2E6PA 3MRCA 4FXKA 2VXTH 3WXWH 3O6KL 3PWPB 5F0PB 1OGTB 4XI5D 4PJ8A 5JMRA 3VFSA 2CMRH 2P45B 4WI0A 2BP5M 4NQVA 4HPYH 5KBNC 1SJMA 1DQDH 5DJAB 2Y7SA 5HGBB 4IU3B 1F4XH 2BNRB 4LNVA 3ULVL 2D7TH 2V33A 4P5SA 3B2PA 3X14A 4G80B 3LVEA 3FHEA 3ARGD 3MUGB 5B1JA 4Q6IB 4N2BA 3QUMH 4AENB 1QR1B 3MJ9A 3UP6A 1FGVL 3BRFA 5CIPB 1KGUA 3RWDA 4L4VA 4LO9A 2X05A 3OKLA 4KXZH 4CN6A 3H7BB 5I17A 2IWGA 1F6AB 4DGIH 4KK9D 4TUKH 3LH2L 2A9CA 2BNQD 5KJRL 1SYVB 2EYSA 4QRBA 1KPVA 4X4ME 5BVPL 4U1KA 4Q9QH 4G7VH 4JPSA 3T6VA 1OSZA 4R4BB 3O45A 4PR5A 2LFEA 2XBTA 4PJ5B 1U3HA 3HA0A 3PP4L 4TUOB 5F1NB 5HHOD 2ZXGA 3JWDH 1U8KA 5D7IA 5H37G 1RZJH 5BRZB 1XF4A 3K4ZA 1KSRA 3W2DH 4QRRB 3FW6A 5D72L 1FE8H 4PJBB 1A1MA 4BE6A 3VRLF 4DESA 3RY6C 3V5KA 5LG6A 3VFUA 5EULV 3ENEA 2AQPA 3HPLB 3SY6A 1ZLDA 5I76A 1XB3A 5D5MA 3SPIA 3PDOA 5SWZE 3E1ZA 2W65A 1KGJA 2J72A 1XH3A 2CHZA 3D4YA 5IQ7L 1A4CA 2OQJA 1KFAL 4M9OA 4NQCB 3V79C 3C8DA 3LS4H 4WI8A 2COVD 4ONGL 4H8HA 2BJML 3EFDL 4GEIA 3UYPA 2P5EA 3ZUCA 4F9LA 3MV8D 2ZX5A 2ED9A 4IRJA 5GJTL 4MCYA 3TA3C 3U4EB 4YDVB 4OB5H 5ISZE 2EXYD 1MPAH 4X8JB 5KN5A 5B39A 3NN8A 2IAAC 3RPKA 1IM3B 5FO8B 4GI6A 3CU7A 3NBNA 2IO5A 4Z7NE 4ZFZA 3A67L 5L9DH 1KJVA 4QO1B 2WSDA 4MX7B 4N8CH 3LIZL 4JG1H 5FYJD 2AK4A 3W39A 5KSUB 4Z7OE 1WA1X 4JBSA 2X4UA 2JXMA 4AUUA 1XCTB 4HIXH 4GW4B 1NGYB 5IVXA 3MNDA 3HE7C 4MYPA 3HG5A 3QWRA 3KLHD 3E7JA 5G4OA 5HSFA 5EZJA 5BRPA 1SF5A 3NA4A 5GRVL 2VZUA 2O4EA 4LU5H 4YDIL 5J1AA 4QRQB 4BDVA 2DM7A 1QFUL 2XWDA 1G7PB 3KPMA 1A2YA 3K2MC 2Q86A 4AGPA 5DJCA 5CD3A 2AABH 2KHAA 2EZ0D 4YUEH 4KJYA 1IGIL 2Q9OA 4PM1A 1CDCA 5L2KB 4V11A 1NCAL 1J05B 1MXDA 2C7FA 3UTTA 4MA7H 5FDYA 1G6RB 1GKOA 4QRPE 5C0RH 5I8EB 4LLYA 5L8JB 3QXDB 2YPVA 1WP6A 1RIUH 4XBGB 3U46A 1DJWA 1RUMH 1I7UB 4R6UA 1XF2A 1LEGB 1M7DB 2CJUH 2IWKA 4H40A 2ICWA 3TT3L 5GGTH 4YR6A 3TH3T 2IBZY 4PJHA 4HUUB 3BCFA 1U36A 4N2EA 4AL8L 3RVWD 1J8KA 1BFSA 1WAAE 4PW4A 5AW5B 5E51A 3AY4A 4G9FE 1JZ3A 1JNJA 4QKXB 4NN6B 3BVNB 2FX7L 1KN4L 4LRNL 5IT2L 1DQJB 1IC7L 4I13B 2FJHB 3NABL 1R9FA 5IMOA 2EKSA 4NQDB 2YPLD 3FQ1A 5E8OA 2QSVA 4IBVA 4XP4L 1BG9A 3KYOA 4YSQA 4U3XA 1YPZA 3WL9A 5I23A 1Q1JH 4GUOA 3WIHA 3AT9A 2X89A 1RUAL 1YY8B 1TYRA 3VSUA 1M2VA 2OX5A 5HDBE 2PN5A 3RL1A 2Y5TB 2BCKB 1WYJA 4KKLC 5TPWL 1Z9NA 2WUCH 2HRLA 2X2IA 4DN4H 3WG7B 3B56A 2Y2TA 2E6QA 1J12A 3S34L 4W4OC 2ZOKB 4L4TE 4UQEA 5B3SB 4JFQA 3VGAB 1J10A 5DT1H 5GJSH 2A83B 4OZGE 1U2YA 3UBGA 2BY2A 5I19L 1E8ZA 4X42A 5DUMH 1VFBB 3PWUB 1UEMA 4K07A 3QDHA 4L9LB 3SBWC 2W07A 1XGPA 4WENB 3BE1H 1UQSA 5LJYH 1AOZA 1AKJD 4RX4D 3WLBB 1FG2B 2BSBA 4PJFB 3TVMB 5A7EA 3LKOB 3VX0A 3BQUB 4AMKL 3CAFA 3ZZSA 1QABA 1WC7A 4Z8FL 3PQYA 4GLRI 4HWNA 4MXQD 3UC2A 2VUYA 3DSFH 4P23A 5CJOL 4ZQKA 4KH2A 3G6JF 3SO5A 3E6HB 3OM3B 4N6QA 3K46A 2EEDA 5FO2A 1FJ1B 3U0PB 2V4LA 1U8PA 1MVFA 4NQED 1BREA 4XO5A 1IAIM 1T4WA 4ZXBA 3UAJC 4WEUD 3T0EB 2KLSA 3TZVB 4PRBB 4M1GH 2RQEA 2QEJA 1E5ZA 2Y36H 3KPSD 4J6RH 4YO0A 2WLNA 1DFBH 4R2GD 2AJXH 4NUPA 1ZA3B 2H6UA 4U1MA 5DLLA 3V52L 3T1FB 4CBPA 1EHLH 4TNWF 1YA5A 1I8LC 4GRWE 4KI1A 2FT8A 4R7XA 5I1GH 2QZ5A 1UT2A 5ALCL 1DBMH 5E8NA 3ZMNA 4R0LA 2EYRA 3IAQA 5C9JA 2NY2D 4UT7L 2A4EA 2P5WB 2PCFB 4BKSC 1KULA 4JLRB 2AEQH 1E5AA 1D5MA 1RZIB 2I85A 2LQRA 2NY5L 2YBGA 3D7PA 5I6PA 1A14L 4MBOA 1XSIA 1YMMB 2LHAA 1WBXA 2JFCA 2LW3A 1B0RA 1OGAB 1Z3GH 2WK2A 2B59B 3EFOA 4I2XB 3PHOA 2DYPB 1HYSD 1N0LA 3KXFB 4M93B 4AT6B 4HWBA 3GIZH 3SY0B 3QJFA 4APQB 2GEQA 4JM4L 5FUZL 1T1YA 1BF2A 3D34A 4H8QA 4BFIA 1TU2A 1ANUA 5EHFA 4KVCL 3K4AA 5CZRA 4L8DA 1UUSA 5JMOC 1AGBB 2FHBA 1Q72H 1D6VH 2DWEA 4XNBA 3X11B 5LQBL 3NJMA 5DHYB 1CDYA 2E0PA 1EAQA 3N44F 2QKIB 3N1PC 3X17A 4U6VH 3IS1X 1U58B 4B9JA 2I60H 1RK1B 1WBYB 4F3FB 4UOQA 4XMPH 1YNTA 5KSBF 1I1YA 3AG4B 4X50A 1IGCH 2QPEB 1ZXQA 5T1DH 5FA3A 4U4IA 2VXQL 4RWYH 5DVOA 3MU3A 3OSKA 3L08A 4FMVA 3BGAA 3N6YA 4PJ7B 1FIEA 4P9HC 4ODSL 4XCEB 1RLWA 3DDGA 1SMAA 5TJWK 1UM6L 2G60H 1V54B 3L7FA 4OKDA 1EO5A 3CFCL 3MLXH 1G43A 3QFJB 3MGAA 2BIOA 1P5VB 2FQDA 4OFVA 2PCPB 2FE0A 3UTZB 1J8HD 5CP3H 1X5YA 2AEPL 4MNQB 3ULSB 1KTDB 1QNZL 2C8NA 3CQFA 4HS6B 1ORSB 1O9VA 3CZKA 4LK4A 4DZBA 4ZD3H 1RP8A 1UA6L 3V4VH 3LNFA 1JYVA 1TQTA 1B3IA 4PJEB 4ZFFA 3FC8A 1QSZA 1D7DA 2AQRA 5C8JB 1HINL 2HYMA 3CXDH 4H8VA 3CDFA 4FFYL 2OTWB 3O2WL 1R3IL 4P5KA 4HXBL 3V5DA 2DLTA 4UTCA 1X5FA 4NZRH 4XXDA 4ABVA 4HMDA 4Z0XA 1AQHA 4OCSL 4GG8A 3X12A 4ZFOL 1LP9A 3D3VE 4G6FB 1HZLA 4ZO6A 2H1LM 5D70L 4ZYKB 1DQQB 4EI5D 4N0YH 4BFJA 4Q4EA 4ZW6A 1E8XA 1FFOB 2FIRT 3Q2WA 2NW3A 5LBSA 1J7VR 3VFNA 5FIEA 3PS6A 1CQYA 1JPTL 5CO1A 5MP6L 3D85D 3PL6A 4HLJA 5IMMA 4WI5A 1NAKH 4XN8A 1V3LA 1TQCB 2A99A 4QXUH 3IRPX 5EWIH 4FP8L 3ZDXB 4AZ8B 2IG2L 4XHJC 2A77H 1UZ6E 2FJFA 3FUDA 1C5CH 3GBLA 4KBPA 1A0QH 3GTVA 1ZLUH 4I18A 4AK2A 1KY7A 1IRAY 4ODTH 2VN6A 1B6DA 3JTSA 1FNEB 3GRWL 4PJGF 4U1SA 5E7FA 2OL3A 3E8UH 2F74B 3KWWB 1P53A 3QDGB 3WKNA 1NC2A 4LSTH 4Y4HB 2X7LA 2BFVL 4NM4L 3U7AA 3P0VL 4LCYB 3ZGIA 2HTKC 1BZOA 4ABQA 4EZKA 1FBIH 1XFPA 2R39A 4UNTA 4ZMWA 1ZGLP 1MF2H 1T0MA 4LT7A 1CFQB 4U6YB 4OD1L 1OEZW 4JQIL 1HHKA 4KTGA 2APFA 4R7NA 3P4NA 4MASA 1IBGH 1CGSL 1XGTB 2UZIL 4YWGL 4UQ2B 4XNUH 5G55A 4X4MA 3IPEA 1AZNA 2EIZB 1MCPH 3GNMH 4JPIB 4PMFA 1U8IB 5AQ0A 2VZSA 4KMTL 1AXSA 4ZI8A 3TJPA 4LHQB 2JCCE 5CZKA 3U7WL 3I74A 4Y1AB 1T1ZB 3HJ0A 3Q5TA 1J1XL 4YPGA 4AZUA 3VFVA 2X9XA 2ZJSH 2WNGA 4HT1H 5CF3A 1LWHA 3MRCB 1QBMH 1YNLH 4FXKB 1FVEA 4KJWD 4Z7UF 4DFIA 4PJ8B 3VFSB 1P4IH 1JYNA 4WI0B 1KF9B 1LGVA 5SWZA 4NQVB 3RWHA 4DO4A 3EO0A 2DTSA 1T80A 4ACPA 4HJJH 4X5QA 2WXPA 1MQ8A 3ZKSD 1UCBH 3DYOA 3S37L 4XCCL 1GKEA 4ZX5A 3INUL 4PJ5D 1OE2A 3O6FA 3X14B 4JZJC 5DEFA 1A65A 5BRZD 3U6XS 3WD5H 3NJIA 5DD3H 4QRRD 3OZ9L 4OJYA 3TA3D 4JVUA 4C57C 3RVXC 4I0PA 1AQDA 2C1PA 3QEUA 4L4VB 3RWDB 3OKLB 4AG4L 5IW6A 4HMEA 3W57A 2CUAA 1UD4A 5I17B 1E6OL 1A6WL 3QBTB 1NANH 3ARPA 2JQAA 1DVQA 2EYSB 1KPVB 2H6OA 4U1KB 4FL4C 4H1LH 1OSZB 3O45B 3HC4H 3I50L 4PR5B 2ESVE 3TCLB 3F83A 4R83A 1U3HB 2RAMA 1FRGL 1JTTA 4LB8A 1JG9A 3IXTA 3JVGC 4PS4L 3LNGA 1U8KB 1NKOA 2PF6A 5D7IB 1XF4B 3T6WA 1KCLA 1W2KT 2QHRH 3WTTA 5EU5A 2QQKL 4PWFA 3UAAA 4TF4A 5B1JC 2R51A 1A1MB 1RCYA 4KO7A 5CGTA 3TBCA 3K3QA 3ML8A 3V5KB 3IMSA 3VFUB 1AANA 4KHXL 2K7QA 4J3OF 2NY6C 2J8HA 5I76B 2WD0A 3H54A 4EMZA 4P5RA 4HOMA 3PDOB 3CSFA 2VABA 2W65B 4TRPL 1XH3B 2R69A 1DSYA 4P9MH 3QJUB 5IQ9A 3P3TA 1NBQA 4QRPA 4PLNC 3SYPA 2OQJB 3BKCL 3EDFA 3FUHA 2GY5A 1U3HC 4ZNEE 4HJEA 1N0XL 1PPIA 1ZTXE 3UYPB 2P5EB 5JW4N 4ZO7A 4OTXL 5HHVL 1KLUA 4IRJB 1ZDQA 3MRRA 2XQBH 4MCYB 2WSPA 2VQTA 4GMSH 5KN5B 5B39B 3NN8B 4FQCH 5EOCL 1WAAA 1BJ8A 2JELL 4AQAA 1E5YA 3RUGF 3DXAE 1QSFE 3PCYA 1KJVB 4ZFZB 1RZFH 4G9FA 5I0WA 1OSPH 2HMIC 1RZQA 3DHPA 2AQ2A 1X9LA 1KNOA 2A6IA 3BWUF 4BUQA 5L2KD 3QZOA 1U3NA 2AK4B 3DJ9A 3INOA 3W39B 3ZDZB 4CADA 2V2WA 4HEME 5JPMA 2X4UB 1ACYL 2JXMB 5IVXB 5T5FL 5M94B 1H3TA 5EZJB 3P77A 2X2HA 4C58B 3WYRA 4Y1SA 1MEXH 5J1AB 4BDVB 3KPMB 1A2YB 2CWRA 2Q86B 1EIBA 1F1AA 5DJCB 2AITA 5CD3B 3ETBJ 2ZP9A 1OD9A 1Q0XL 4H1LG 4KKLD 1TTFA 2BS9A 1F3DJ 4KJYB 1L9TA 3OVUB 3AG3B 5F7UA 2OP4H 3N91A 4FA8A 4DK3A 1CLZH 3UTTB 4L4TA 2QQLH 4WHTA 5F9WC 2NX5E 4LLYB 2PCYA 5GZOA 1RULL 4OZGA 4MCMA 1I9EA 3U46B 3SGEI 3FCTA 3C09B 3MLRH 4NQDD 1XF2B 1ET7A 3GHBL 4ZODA 1LD9A 2ICWB 4YR6B 4L1DA 1D5XA 4MXWL 4PJHB 3IT8D 4OIIH 3BD5A 3VG9C 1SDAB 1JRHH 1CLYL 1HWWA 2XZQH 1PGRB 5I71B 2DN7A 5C1MB 3KGRA 2AJSL 4KVNL 5DWUH 5D4IA 3UOAB 2NR6A 1AYRA 5GGVY 1BQKA 3SO3C 4UU9A 3X3FL 4FCHA 4DGUA 4WK4B 5IMOB 2EKSB 5E8OB 2MTPA 5M95B 4ZBJA 5DQDH 3C09C 2GHWB 4IGBA 3KYOB 3UAJD 5ICUA 1YPZB 7PCYA 3WL9B 3WTWA 2B3IA 3HEIB 1M2VB 4CW1A 3F7QA 3HMXH 5CJQH 1KENL 3RL1B 1MCRA 3K6FA 1XMWA 1T7WA 3HHRB 3DRQA 3TVMD 3AY4C 3BQUD 1NAMA 3KYKL 2E47A 4KDVA 2CJTA 4D3CL 5C0GA 4JFQB 4TNVF 3ZJAA 5JOPD 1F8TH 5JPNA 1GYWA 2YN5A 5BRQA 2OR9H 5INDA 5E2VH 5MEQA 1IAIH 2BSED 5CILL 5IV2A 3GJFH 3QK0A 2W07B 1XGPB 5EO1A 4AYGA 1UQSB 1A8JH 3TZVD 4OF5A 3HZ3A 4OY9A 1CBVH 2J43A 4BUHA 4NSKA 3B9EA 2OK0L 2CXKA 2PPAA 2CDGA 1WC7B 2ARJQ 3PQYB 4PD4K 3HI6H 3KH3A 1F11A 4P23B 4ZQKB 1BM3H 4HH9A 5EF3A 1VFOA 1U8PB 3V6ZA 5D7SL 5ALBH 1KEML 1GJIA 1QZ1A 3K5RA 4BGLA 5LLIC 3TV3L 5EOTA 4ZXBB 3QUZC 5ICYA 3RHWF 2OMTA 1NFDF 5CUSH 5EUOF 3C75A 1JVKA 2LE9A 3LEVL 5F0LB 5DZPA 1CTOA 1XH1A 2JSFA 4YO0B 4OJDH 1AJ7L 2DQIL 2MQGA 1HWHB 5K9QI 1RERA 1MHHA 1OGAD 2OJEA 2W0LA 4U1MB 1UA7A 2YKLL 5TE7L 4KY2A 4ETYA 1EGJH 4FEMA 5HYJD 2ZWYA 2DYPD 2PWFA 4M56A 3OF6D 4F58L 2Z1PA 3AQXA 1UOLA 3I9GL 3LZFH 5E8NB 4OVUA 5C9JB 4R0LB 2EYRB 2QPUA 2DYSB 4AKOA 5CBAA 2K3TA 2N7AA 3P2TA 3L6FA 3RGBA 3U25A 2M2DA 4LEBA 1D5MB 2IDCA 5DHXB 5IW1A 1NL0H 4FQ2H 1T3FA 1LK2A 1WBXB 1INDH 2ZOTA 3TV8A 1DVFC 3QQ4A 1B0RB 1I9RL 1KGCE 5I1DA 5HGAA 3EFOB 1Z9MA 3PHOB 2BFGA 2H0EA 4DGWC 3SPVA 1QLEB 3DC0A 2EO7A 1N0LB 4FKEA 2OMUA 1IJ9A 4TVPD 3ARWA 4NO0D 5ETUA 4B9GA 3QJFB 4JPQA 1I1RA 2PWEA 3D8MA 5LGHH 4LLVA 4YLBA 4HG4K 5GXBB 3FQ4A 1T1YB 4LIQL 4UF7C 3IMRA 2EUVA 4BFIB 1TU2B 2C9PA 3NIFB 5LCVA 5CGMA 6TAAA 3OAYK 4NT6A 4FNQA 4L8DB 3AU0A 4I1RA 5CCKL 4OJCA 2Z65C 2DWEB 1ZLSH 3HR5A 8CGTA 4KZEL 2PPEA 4A2HA 4B53A 3LZNA 1C1EL 1O7DC 2AGJH 3MACH 3D3VA 4KO6A 3OWRA 5D1ZA 2EH8L 3QFJD 4EIUA 2DKMA 1LO4L 3FZUC 2MPAH 4EZMA 4MNQD 1YNTB 5AVZB 1X4XA 1KJ3L 2VXVL 1I1YB 4EOWL 4J3OG 4RQQA 4AQ1A 5FA3B 1SY6L 3OLDA 5IBUG 3NZHH 4XVOA 3LYRA 3VU1A 2HUEA 1BM7A 4YS4A 4GOSA 5AZ2L 3NJVA 3GSXA 3GI9L 3HLAA 1Z0MA 3OMZA 4E9TA 2MQ0A 4GAGL 4XHJD 2BIIA 1A7PL 4K8RC 3L7FB 1SMOA 5ADPH 4JPVH 1J1PL 4G6FD 3EH2A 2Y07L 4JKWA 1SQMA 4QF1A 4OGYL 4DZBB 5FM8A 5F9OH 5I73B 4X7EC 1XIWA 3G04A 1P7BA 2GUOA 3GTTA 3RI5F 4ZFFB 1UJ3A 1CD8A 3HBGA 4EUPA 4BUGA 3L81A 1UH2A 4P5KB 3V5DB 4XXDB 4DUXA 4Z0XB 4ZOEA 4GG8B 3X12B 1R1CA 1LP9B 4GKZA 4KI5C 3VXUE 2WQVA 2GCYA 4PJCF 1EEYA 1JPSH 2AF2A 2HRGA 3LN4A 2J44A 3WXWL 1YAZA 1MXGA 1U8NA 2JCCA 3IEAA 3VFNB 3QDGD 4Z7WF 4Y4HD 4UILH 3PL6B 1TDQA 4HPYL 5IMMB 1DQDL 2CJSA 1F4XL 1OW0A 2R1YA 3MOBH 5ICXA 4GSDL 3V0DA 2QLVB 2FJFB 1RZ8A 3NCBB 5A6IA 3FXIC 5I74C 5I8OL 3WIIH 2BZDA 3H3BC 3QUML 4I18B 4WAFA 3H9ZA 3SEPA 3BFQG 3JTSB 4RGNE 2VC2L 3GSUA 4N1EA 4PU2A 4U1SB 4R5XA 2OL3B 1X5KA 1IILE 2VJ0A 1QASA 1NC2B 2XXFA 5A2FA 4Q9QL 2X7LB 4KKBC 4XN2A 3ARRA 1OOWA 3QJZA 4YH6A 4XE0A 3WCYA 5F3FA 3P3YA 1T0MB 4Y1AD 4ALAH 4HKZA 3PL6C 1HHKB 4HCIA 4R7NB 2VM3A 3IMVA 3P4NB 4MA1C 3W2DL 3DI3B 4HCRH 3PNWA 1FE8L 4PMEA 2YEVB 1Z66A 3K6OA 3Q6GH 4XPGH 4YEEA 5DI8A 2ESVA 2R7EA 3QIUC 3QEGH 3OSVA 5B1AB 5GHWH 5KYNA 3N42F 4JDZA 1AXSB 3L5IA 1JAEA 1CT8A 4DGVH 2OS7A 1EXUA 4PVLA 4QCIA 3SDCC 2CUIA 2WNKA 4JHZA 4E5XA 4HJUA 4YPGB 2KZBA 3VFVB 3LPGA 3NRQA 1UZGA 4K71C 4GBXA 1W8OA 3LS4L 4L4VD 1FVEB 2UYLA 2NY6D 2YGVA 4OFYA 1TVDA 4MB4A 3AM8C 5SWZB 4OB5L 3L9RA 2EILB 3BPOB 3RWHB 1MPAL 3EO0B 4OUOA 2ADFH 5T3ZH 3C5ZA 3NDZE 2HFEA 3S5YA 4BE5A 2KT6A 3KYAA 5B1KA 4Q2ZA 4ZNEA 2K6WA 1U3HD 4I8DA 3T3ME 3O6FB 5L9DL 2XWJA 4WUKH 3HCVA 4HJTA 4J1UA 1IEBA 2B9AA 2G2PA 2UX6A 4I0PB 1AQDB 2C1PB 2PPCA 3QEUB 2E4FA 5IW6B 1P2CA 4HIXL 5BZWA 1WDAA 1QSFA 3DXAA 3GIVA 1N3NA 2HMID 3F7VA 2LLLA 3NCJL 5CJXA 3A6OA 3CHOA 3GLZA 1TYEB 5FCSH 5FUOH 4NKMA 4O00A 3GMQA 4Z7OB 2AABL 3CVHA 4KNUA 3IXTB 4HEMA 1OP4A 4MNHA 4YUEL 4DCQA 2CM6A 5CU5A 4ZAKC 1OP5H 1RUPH 4B9PA 4B6ZA 4AWJC 4Z9KB 4H26A 2Y7LA 3O6FC 4B3EA 4LNRA 5EU5B 2JKIS 4GI9A 3QUHA 5DZLA 2F8VA 3F62A 5E9DE 2P5ED 4P5TA 3RYMA 5C0RL 2R2EA 3ATFA 4HJSA 3X1BA 4LQ1A 2WTRA 2AMGA 2CJUL 1PZSA 2ZNXA 3N1GC 4AJYV 5GGTL 4QOKE 3V6FA 1KYOJ 2A4ZA 3QDME 1NOFA 2ED7A 2VABB 1BBDH 4GXUN 1OLZA 3SOBL 5IQ9B 5F3BA 2NX5A 4QRPB 5JR1L 3BSZL 1E4XH 2DQCH 2OSWA 4FFWD 3IU4H 4Z76A 2AK4D 2MCMA 2ORBH 2ODHA 1NLDL 5DFAA 1KYDA 1O0VA 3DK0A 3T4AA 1M53A 1ZSDA 1KLUB 4AUJA 3MRRB 3RGVA 2P46B 3QWRD 3ZN6A 1LILA 2IOIA 3K1DA 5AAMA 3WFCL 3HHMA 4J12A 1QOKA 4MDIA 3ASNB 3FOLA 4AQAB 1TEGA 1ROCA 4Q52A 4I89A 1OTTC 3KW8A 2Q7YA 5DVKA 2FT6A 2K6ZA 2R4RH 4KDWA 4NXSA 3WEXA 1KNOB 3VDBA 2A6IB 1Q1JL 5SWSE 5J4MA 2OXGA 3KS0J 4CADB 2D7MA 1NPJA 2BY3A 2V2WB 1VADA 4M7LH 5LXVA 2R4SH 2WUCL 5AB0A 2D7NA 3IJ8A 4XODA 2YPKA 4DGYH 1RMFH 5JHMA 3ILDA 2ALAA 1UOKA 4C47A 3P77B 2WBKA 2W38A 4R8WH 3ILQC 2VN4A 3WTVA 4P07A 5JIHA 3F7PC 2FO1A 2C3GA 3GBDA 5KANG 3CLFL 5GJSL 4I85A 3K2KA 3O11A 5HDBB 3ULUF 1ZGLM 4KZDL 2R1WB 5DUML 1JFHA 3RGHA 3KBFA 1R34A 2XPZA 2CO1A 4NM8L 2BH0A 2NNCA 2CA4A 4WW1A 2WJ7A 4L4TB 1NH6A 4WHTB 4HSAC 3UTSD 3DETC 4QYOA 2B2XH 3TF4A 1UHVA 1IFHL 1XSJA 1ZPUA 4MNGA 1T83C 3FCTB 4KX7A 5JPMC 3CZEA 2XYBA 4CU6A 5D9SA 1LD9B 3DSFL 1D5XB 1GGTA 1WVZA 2ZUXA 3IM1A 1OB0A 2B7DT 1G9ML 1ZT7A 2X89D 1IKNA 3QULA 1M57B 5FDWA 3UEZA 4N86A 3I75A 5I5MA 2R83A 1NMBH 3NT0A 4L8BA 3N43B 3ZIMA 5I9QB 3ZYOA 4M1GL 4N1CA 2Y36L 4J6RL 1QLEH 4UU9B 3ARZA 5B3NA 4MXVF 1DFBL 2AJXL 4HWBH 2CNYA 3CSTA 5C0AE 1QW9A 1Q4NX 5CKAA 5J6GA 1EHLL 1FC2D 5I1GL 4IGBB 1OZUA 1N10A 1I3VA 1DBML 3T0VA 4CW1B 2AEQL 4AGLA 4YHYC 4OGAD 1IM9A 3DRQB 3WEMA 4GRWB 4ZNCD 1CFVH 5HI3C 1NAMB 5GGUA 3S8GB 1TT6A 1ASQA 2W0FA 3CPUA 5C0GB 2D3NA 1GZQA 3PQYD 4YLQT 5JPNB 1I3GH 1MJ8H 1DANT 2H9GA 5INDB 1AR1B 2VDQH 3GTNA 5I1KL 5MEQB 5I15H 4YAQA 5IV2B 2X6UA 3MDJA 5K9JL 5EO1B 2WN3A 2F58H 2GB2A 3G3LA 1DVFD 4KGLA 1HT6A 3MV11 1X4YA 4FS0A 4RAVA 4UCFA 2GBTA 3QFGA 4NSKB 3HRPA 2QSQA 5E8PA 5GS3A 2HFTA 3K8LA 2CDGB 4AITA 1D6VL 1QFWI 2Z8VC 1F11B 5C0EA 4HH9B 2UXTA 4NGHH 1BLIA 3WKML 5JPNC 5F7AA 3V6ZB 4U6VL 1ETA1 4XBPA 1KOAA 2DMGA 4ABWA 5EOTB 5ICYB 1SOXA 1LXMA 1AR1C 3GMLA 2OMTB 2ZXAA 1KB5A 4XMPL 3X3GL 5JIKA 3L3HA 2H8PA 4GSXA 1NUNB 1IGCL 3ZTDC 2C5DC 1L9NA 1FL6A 2EDKA 1MHHB 1F5WA 2OJEB 3RVVC 2XUWA 4HFUH 4W9KC 2HN7A 1H5BA 3D30A 2DB8A 5E2WL 3FZUD 2G60L 4HLEA 4PFEA 1N8ZA 3MLXL 4YSSA 4DZ8A 5ID0A 1C9SA 5CBAB 1CD9B 4N0CC 1KBGH 3DPBA 3L6FB 5J12C 1LMIA 2YD3A 5E0FA 1EA9C 5IW1B 4LOEA 1T3FB 1LK2B 3DLQR 3NCXA 3V4VL 3W3BA 3PY9A 2W9DL 2VGLM 1KXTA 2AJ3A 1BZ8A 2RD0A 1BBJA 1FCCA 3OD3A 3QQ4B 4K8RD 4XX1E 5I1DB 5I6XC 3VH8G 5HGAB 4HP5A 4IRSC 1BD2E 3CXDL 2DI7A 3V2AR 2FWLB 3SPVB 2QELA 4UQDA 5JA9A 5DZAA 4F2ME 2OMUB 1IU1A 2OL3H 5ETUB 3FO9A 1BZ7A 3UBXA 1QFOA 3GXNA 4LLVB 1TZGH 4N0YL 1DQLH 1RL1A 4IRZA 4ANXA 3Q9PA 5IWLC 1J5DA 4NT6B 1S7WA 4RVBA 4XE5B 3NK3A 2KMWA 2HPOA 4N28A 5IB1A 3C6SA 4C4KT 3HR5B 1KIQA 5CGBA 3UGXA 3MLVH 1NAKL 1QBAA 4J4PC 3VXUA 1MFMA 3D3VB 4QXUL 4KI5D 3BZDA 4XMVA 5D1ZB 5EWIL 2WQAA 4I7ZC 1KEGH 3VXNA 1BZEA 5D6CA 4MSWA 4MD4A 4NUQA 4AEFA 2A77L 1JMZA 1C5CL 3SPHA 1A0QL 3H2PA 1P84K 4E41A 4XH2A 3QHFH 4JDEA 4RQQB 4AQ1B 3T5WA 3P3RA 2WWKO 4ODTL 3VW3H 5KS9F 1X7SA 1NPUA 2DWXA 5DK2A 3S7GA 1U4EA 3I85A 3GSXB 3HLAB 1CR9L 3DOIA 2ZUUA 4LSTL 2B15A 1UOVA 1CIDA 3BYTA 1D7BA 4OLXL 1ED3A 3Q13A 1FBIL 4JVPA 3UAEA 4S11A 5E9AA 2XIBA 4MQXC 1MF2L 5CSGA 5GS2H 2W94A 1SVCP 1RZKC 1U2HA 1U2CA 3H2QA 4WEMB 2A74C 1IBGL 1HCVA 1KTCA 1VLXA 2DDQH 3FF7A 2DL2A 2FB4H 5T1LA 4QF1B 1QG3A 1NIAA 4XNUL 1J5IA 1XIWB 3NUKA 3G04B 2ICEC 2GUOB 1UJ3B 3NCEB 1MCPL 4EUPB 4I1PA 2AZAA 3GNML 1AVAA 3PL6D 2FX8L 3S36H 2ZYRA 3M1BA 2W60A 4HGMA 1PAMA 2DTMH 4IIQA 1UM5H 5I66A 3H7LA 1HZHH 3BN9C 1T7ZA 2VXSH 4HBQA 2RR3A 3VXSE 4AMWA 4GKZB 1G7MA 3FUMA 3QIUD 2GCYB 2PCXA 3ZSSA 1W15A 4UNIA 1EEYB 4PRIE 1QBML 3LN4B 3FQNA 3B5TA 3GSWA 1U8NB 2JCCB 3ECBA 1P4IL 1RIVH 1QWNA 4OCYL 1NC2D 1A3QA 5L88H 5EBWA 2CRZA 3IJEA 2CDFA 1P7QA 3GRBA 1UCBL 4GKLA 4GY4A 4TLSA 4PRDA 2R1YB 5ICXB 4DFHA 2EXTA 3I9IA 5DJDA 4DKAA 1RZ8B 4JRLA 1U3YA 4LRIC 25C8H 2NY1B 3WD5L 5DD3L 3OZLA 2F7IA 4K3DH 2RIKA 3HN5A 1BQ5A 1WZKA 3Q8FA 2CKBH 1T22A 1H15A 3GSUB 4RLDA 3M1CA 1YECH 3B9DA 3BAJA 4GFTB 1DBKL 5FYKE 5T1KA 3TF7C 3ZQWA 4I88A 2ZXQA 1CS6A 1MLBA 1IJNA 3HC4L 4KXDA 1QWUA 1EVUA 4DEPB 1H8LA 4FQLH 4HKZB 1MHCA 4PG9A 3H53A 3ZOAA 4IBZA 1S7XA 1A7RH 3D52A 4LPTA 3PNWB 2QHRL 1HSAA 3CZSA 4APXA 4OF7A 1X5XA 4RCAA 5AOIA 3U2IA 3EXJA 1PKQE 2WZAA 3KD4A 3SJVE 3ZE1F 5DI8B 1ZCRA 3ULVE 2ESVB 2R7EB 3D0VA 1CXKA 3LQMA 4BEIA 1NEZA 5EEWA 3GHEH 4BWTA 2AJUL 3SKJH 4V1DE 4JDZB 4X7SH 2IDFA 1TNNA 1CT8B 1VJSA 1EXUB 4QCIB 4E5XB 3QNXA 3V4PL 1K6QH 4EN2A 3CFJA 3O6FD 4BFFA 4HJGA 5E9DA 4FULA 4P9ML 4KKAC 1KGIA 3FPYA 4RFNC 4M7ZB 3DX1A 4GBXB 1IIKA 5ISZD 4QUOA 1DJHA 3UX9B 2UYLB 2IDTA 3OJ2C 2XQYK 3NP3A 3SQOH 4QOKA 2XQBL 5FB8A 3QDMA 3L9RB 3B7SA 2PPDA 4GMSL 4FDWA 3C5ZB 2HFEB 3QJOA 2BHFA 1CLOH 2Z64C 4Q2ZB 3TH2T 1P0SE 4MA3A 3F2LA 1RZFL 3SDXF 1OSPL 2XWJB 3FU6A 2DJMA 2WWMD 5IQOA 4FXTA 4FF9A 5HYSG 3HCVB 3DGCR 3B6SB 4QNPE 2RCSL 4KUCD 4KDTA 4J1UB 1IEBB 1ML0A 3ARDA 3GPSA 5DZVA 1GS7A 4L29A 3RBSA 1G7LA 3MNWA 1P2CB 5BZWB 4GBXC 3K5SA 4WI6A 3DXAB 1QSFB 3GIVB 1N3NB 3F7VB 5BVJA 4P05A 5J13C 1GJUA 1OY3B 5SWSA 3WN5A 4CSSA 1E27A 1X4ZA 3CDZA 4NKMB 1XGQA 3N85H 3SGDI 3Q0HA 3AMLA 3GMQB 3CVHB 4MNHB 1BVKA 1PZ3A 5D2LE 2KZWA 5DD0H 3G5XA 4QRPD 4DCQB 2YGNA 3FQWA 2YAEA 2F9BT 4PJ6A 4W68A 3VRIA 4H26B 1F02I 4LNRB 5F6HJ 1CLZL 5KANI 5DUPH 2QQLL 2R0KH 4P5TB 2BVUA 3ILQD 2GYSA 3IBEA 1FIGH 3S3CB 2R2EB 5EU3A 2WTRB 1EHNA 1W72A 3TCXA 3MLRL 1FNGA 4LEXH 5EIIG 3T77A 4ANKA 3LKNA 3V6FB 4G9FD 4ZPTA 5K1VA 3SDDC 4OIIL 1BVNP 4GRWH 5CJXC 5TE4L 2NX5B 2E7MA 4WTXA 5E4AA 1CDIA 1JRHL 2XZQL 5F3BB 1J11A 3DETD 3VXME 4TQPA 4Z76B 3T4AB 2FDBP 3L4ZA 4PTTA 1ZSDB 2XYCA 2EIMB 3RGVB 4A7SA 3IDYB 4HALA 2F54E 3X1FA 2Y1AA 3EF7A 3ZUNC 5B38A 2X09A 3NCWA 4LSRL 4MDIB 3FOLB 5F8RC 2A3TA 1WUNT 2EC9T 5DQDL 3ARSA 2Q7YB 4NYLA 2PXYA 3WEXB 1SJHA 4YDMA 1F58H 2YSTA 1DQIA 1F41A 4N2DA 2YA1A 2R27A 2OXGB 4ENEC 3HMXL 5CJQL 1ZVSA 2W0KA 1VADB 3DRTA 4MQTB 4F92B 3SBRA 5GZOD 1GY1A 1RUQL 2YPKB 3I3BA 5LDUA 3TU6A 1S5HA 4R4ND 2PTTA 1Z32X 2XA8H 5DK3A 1QRNE 4LL1A 3VDAA 5KVGH 1F8TL 4ADGA 3RGVC 2YO3A 3H55A 3HOGA 3O11B 2OR9L 3QJTB 1QKZH 1QMUA 1Z5YD 1IAIL 4HBCH 3LN9A 1SRDA 4QHUA 1OCOB 5CINL 4K7PY 4WW1B 3KVPA 2J55A 5IKCA 2BRQA 2GSMB 4QYOB 1KC5H 1L0XA 5D7JA 1GTNA 1V27A 1PJ9A 2OI9B 3FUFA 4MNGB 5EOQL 2JJSA 3O4LD 4PBVC 4YSUA 5D9SB 2F0CA 2YXFA 3HI6L 1WIOA 5CCGE 4JM0A 1SLWA 1BM3L 4IGBD 2NNFA 4N2IA 2ZWZA 3P4MA 2N59A 1ZT7B 5ALBL 4PB0H 3LIUA 3O9WC 3QULB 4TNVK 5FDWB 4U7SA 3I75B 3U1SH 1OAYL 1OARH 4L8BB 2VLKD 5CUSL 3GMOA 4ZTOH 3QZWA 2QADB 1SFDA 5F7DA 2MCG1 2CJ3A 3HAEA 1I7ZA 1AZZC 1KJ2A 1LLAA 2VR9A 5FGSA 3HNVH 1JZ2A 1KELH 5D1XE 1EGJL 1G1CA 5J6GB 1MFDH 4JG5A 4WK0B 5IFJA 1W16A 4R97C 2RJMA 1AR1D 4LLAA 1MJJA 5C6TH 4FYTA 5EO0A 4XN5A 5AKRA 4YJZL 3IJHA 3CJJA 3S2CA 3RVVD 1BF5A 4MYWB 3ZBMA 4QYAA 1NL0L 4FQ2L 2YAPA 1XH2A 4ZW3A 5GGUB 4BM7A 4FXGA 1FO0A 4U2ZA 2W0FB 3BAKA 1GZQB 2MNUA 5BV7H 3RHWK 2YRZA 3FT9A 1UADC 4N0CD 2H9GB 4YHZH 5I5IA 1KDIA 5DXWA 4G6AC 4YAQB 4UT6A 4PIBA 4RGOL 2YD7A 4B96A 2CPUA 3MBWA 3BEWA 2WSKA 3QHTC 4PAZA 4AVIA 5LGHL 4IBLT 2ATKA 3RL2A 5TF1H 1BD2A 4RAVB 4IRSD 1H8NA 4J3XA 1T7YA 2RH0A 3F6IA 2AFNA 1G9NH 5E8PB 5F7HA 1A7NH 4F2MA 3AMKA 3QIBA 4N8PA 4HSCX 1ZLSL 2C4FT 1BOGA 5C0EB 1Y6MR 2AGJL 1S6NA 5GRYA 1ZA6A 2GJRA 4Z0BH 3JWOH 2EKJA 4XBPB 1FSKB 2CG9X 1H6UA 4ZMVA 2MPAL 3GMLB 5C09E 1KB5B 3ML9A 3L3HB 2H8PB 2J4WH 3VU2A 1HKFA 2Z7UA 5GIRA 3VGDA 1T1XA 4LSQH 2P1YA 3NZHL 4J4PD 1YUKB 1FL6B 1MRCH 4NOFA 1Q0YH 4TPRL 5BZDA 3P9WB 2L0DA 4ZTEA 1OCRB 1IAKA 2HN7B 2VSCA 1H5BB 4XB8A 2KLRA 2P48B 4XB7A 4QWWC 3DNKA 3RWIA 1JD9A 3VSVA 3NP4A 4DP6X 3U4AA 2G0KA 1N8ZB 2OZ4H 4AI7A 4DZ8B 5ID0B 5ADPL 4JPVL 3NG5A 3DPBB 3IGFA 1WA0X 3L4XA 1SOQA 2NSQA 3IPBA 5F9OL 2IPTH 5FGBA 1BDYA 1FLTX 4NHUA 1KXTB 2AJ3B 3DTDA 1BBJB 3FONA 4BZ1A 5FEBA 1U41A 2B0SH 4MQXD 3OJMB 5I1JH 1GSKA 2D7QA 1E4JA 1OSYA 3Q5YA 1GIGH 3V7AG 3MRJA 1CICA 1OPOA 3JWNE 4WV1C 5D1ZD 4XPAL 2Z8SA 2XY1A 1HI6A 3ASOB 3FO9B 1BZ7B 3UBXB 1SBSH 2J12B 3CE1A 3UJJL 4WWID 1A4AA 1FL3A 2CRYA 1HQRA 2PNDA 2FWUA 4AH2A 2BXYA 5EB9A 3UP1A 3Q06A 2DKUA 2ROXA 4Y8AA 1KCWA 1S7WB 1FYTD 5TD4A 5LNEA 4UILL 1KIQB 4Q4IA 2LLNA 3IRCA 3VXUB 3VXSA 3KZ8A 1K8DA 5AZEH 3IMBA 3RI5K 2H2PD 3MOBL 3VXNB 5D6CB 4MSWB 4MD4B 4Y9EA 4PRIA 4ZOCA 2B5IB 2WZPA 4BSJA 1BV8A 1IQDA 3WIIL 5AVTB 4MBRA 2AEIT 3UIYA 4E41B 4XH2B 4JDEB 5DQ9A 2VR6A 1XIWD 4UBDD 1X5HA 4MMXC 4ACTA 4RZKA 5DK2B 4G7RB 1FWXA 1YEJH 1VESA 1WWWX 1ED3B 2H47C 5BMFH 3OC5A 3QNFA 2DLGA 3CSGA 4RDQF 4ALAL 1YCSA 1RIHL 4RGNB 1WWAX 1ERNA 5IHHA 3FJTA 2IWEA 4HCRL 5T1LB 3L4VA 3NMEA 4N2NA 1JWMB 2ZKHH 2B5IC 4PW3A 1IC4H 4NFDA 5E5MA 1M05A 2B39A 2B4CC 3QR0A 4XPGL 4DKFH 4YC2B 3RWEA 1ZTXH 4WHYH 2BNUA 4OIFA 1W9XA 5K59E 2X0WA 2ZCKL 5GHWL 2OR8A 5EH1A 3V0JA 5IY5B 4DGVL 3M1BB 2W60B 5CHNA 4IIQB 5I66B 3C2SA 2CA3A 2DQDH 1PKQA 3MFGB 3SJVA 3F6LA 4XVSL 4PS3A 1G7MB 1U8MA 1S9YA 1VERA 1HL4A 5GGRA 4V1DA 2PO6A 3FQNB 4LL9A 1JUFA 2X28A 2BX5A 3GSWB 4X98A 3ECBB 4GSRA <