1OALA

Active site copper and zinc ions modulate the quaternary structure of prokaryotic cu,zn superoxide dismutase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
151
Chain Sequence
QDLTVKMTDLQTGKPVGTIELSQNKYGVVFIPELADLTPGEHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active-Site Copper and Zinc Ions Modulate the Quaternary Structure of Prokaryotic Cu,Zn Superoxide Dismutase
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE
total genus 38
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1oalA00
4BD4A 1PZSA 3KM2A 1E9OA 2WYZA 1KMGA 3S0PA 1JK9B 3MKGA 1FUNA 1CB4A 1SXBA 3CQQA 2WWOA 3RE0A 4BCYA 2C9SA 2GBUA 4FF9A 3L9YA 1YAIA 1SRDA 2VR6A 1N19A 2WYTA 1S4IA 1E9QA 2SODB 3ECWA 2WZ6A 1B4TA 1E9OB 4N3UA 2WZ5A 2E47A 2Z7YA 1F1GA 1YSOA 1Z9PA 2GBVA 1TO4A 1F1AA 3QQDB 1PTZA 1IBBA 3L9EA 3T5WA 1IBDA 1JK9A 1E9QB 3F7LA 1ESOA 1CBJA 5KBKA 4A7SA 1XTLA 3HW7A 3SODB 2AQPA 3MNDA 2V0AA 2Z7ZA 4N3TA 3GZPA 5CU9A 2AEOA 4U4IA 1EJ8A 2WKOA 4MCNA 2ZKWA 4A7UA 4OJAA 3ECUA 3GTVA 2AF2A 1DO5A 2C9UA 3CE1A 1HL5A 1OZUA 2WZ0A 3K91A 1N18A 2AQRA 1E9PA 4A7GA 4A7TA 1B4LA 1SXCA 4OH2A 1TO5A 4A7VA 1SXNA 1HL4A 2XJLA 1SXAA 2XJKA 1XSOA 1U3NA 3HFFA 1COBA 4BCZA 1OZTG 3H2PA 1F1DA 4B3EA 2WKOF 2E46A 1IB5A 2AQSA 2JLPA 1XTMA 1DSWA 2VR7A 2LU5A 5KBLA 2ZOWA 2C9VA 2Z7WA 1P1VA 1E9PB 2WWNA 1Q0EA 4A7GF 2VR8A 1BA9A 1SXZA 1SOSA 1L3NA 2Q2LA 1SDAB 1MFMA 1AZVA 2APSA 1UXMA 3KBFA 5KBMA 2JCWA 2K4WA 3H2QA 3HOGA 3GQFA 3LTVA 3KBEA 3GZOA 1QUPA 1SXSA 1IBHA 1OAJA 4MCMA 3PU7A 1BZOA 3GTTA 2ZKXA 1YAZA 1Z9NA 1JCVA 3KH4A 1F18A 2AQNA 2Z7UA 1SDYA 3KM1A 2R27A 1OALA 4A7QA 1EQWA 2ZKYA 1UXLA 3CQPA 1RK7A 3KH3A 2AQTA 2NNXA 2GBTA 3GZQA 1IBFA 3F7KA 2AQQA 3ECVA 1OEZW 4L05A 1SPDA 1PU0A 3QQDA
chains in the Genus database with same CATH superfamily
2GC4C 5I6MA 4BFIB 4MDIA 2WYZA 4JQXA 4O58H 4JGMA 4LOEA 1GS6X 5GS0L 1B4JL 1KXQA 4OCYH 3DYPA 2BSSB 3QUZD 4QYOB 4WW2B 5A2AA 4GQ9H 1LNUA 3APMA 1DJSA 3K46A 3QUYB 3SE3C 3V4VA 2XXMB 2FJFA 1YLBB 1MCIA 1YMMD 3W1ZA 2XN1A 3KJ4C 4X4ME 3TPUB 2HTKD 1NDMB 3FN0L 3B8SA 3I3DA 3LIZH 3IMRA 3VD2A 1ZTXH 1ACXA 5EIIB 1JD9A 2J56A 3TN0D 3MCYA 3G5XA 3N85H 2XQYG 1I3GL 4PRPA 4YFLF 2IG2L 5B7FA 4UDUB 3ILDA 2DI9A 4BFFA 5KSUB 1IFRA 3RFZC 1OCCB 4HEME 5DRWA 3FCGA 5TDPB 5F7HA 4A7UA 1OCZB 1G9EA 3OKNB 2HUEA 2K7QA 4UQBA 3DX9B 4N86A 5MI0C 4FXLA 2DQFB 1RP9A 5AG8A 4MDJB 1YYML 1HI6B 4PJEF 4PLJD 4YUEL 3FOLA 1NBVH 3CXFA 3LD8B 3MTRA 4OCSL 3EJZC 5K9KB 4U1LA 5TQ0H 2DLIA 5D71H 5FYLL 2Q6WB 1UWEL 3A23A 4FFVD 3C5JA 3MV7A 1QRNE 3QZWG 1DSWA 2ATPB 4N5ED 4ZUWB 4ATTA 3N0AA 5K69A 5JOFA 2ZPKL 2EILB 4KZDL 4FLQA 5C0AA 1KFAL 3N2JA 4UNVA 3C75A 3HIZA 4L3EA 1F11A 5ICUA 4DZBB 5TGBA 1GS7A 1W6WA 3MPCA 3STBA 1QATA 5GIRB 4B0MM 5IEHA 2B1AL 5JORB 3OJVC 5SX5H 1CDHA 4NLHA 4R8WH 4QXGL 3DTXA 1G7QB 2JFCA 1RJZA 3DJRA 5LNEA 2J7LA 1MG3C 4GXFA 4OVUA 4GIOA 3LQAH 4LEXL 1CQKA 3Q44A 4YIQB 4N2DA 1DVQA 2CNZA 3TCXA 2H8PA 3L9RB 4PJ6A 1NCCL 1RK7A 2F1BA 3PGCB 4PJAF 4NQXB 2VKXA 2GTZA 3G6DH 4WEEA 3OSKA 3WTXA 5E03A 3U4AA 5T5FA 1NJ9B 4OT1H 3VA6A 5F72S 3LN4A 5GS0C 4H1LB 3VMOA 3BWUF 4J6RH 2ZX8A 4P2OB 3A47A 5JHAA 4IBLT 3ZSTA 2HRLA 3IRZA 4YZFF 4N2MA 4A37A 3NIDF 1H6TA 4BSWA 1O6SA 2OR9L 1QUNB 1KN2L 2HVJA 4EZMA 2VRQA 2VLLA 3BE1H 2DAVA 1PL3A 4NFDA 2GBUA 3OLDA 2BOBA 2JJTC 3QUXB 2WYTA 4YHKH 4Z77A 1G7MA 4ZFFA 3L2LA 1CLYH 3FYIB 3VFUB 4FYSA 1IGYB 2EEBA 3AS3A 1OIOA 2RCSH 4AQ1A 2OI9C 3WU1A 3WN6A 2P8LA 2VDLH 4LCWB 4WHYH 5F7FA 3QEQB 5SX4I 4ABWA 5CJXA 1DBBH 1AYRA 5HYSG 2Q3XA 3RBSA 2IPTL 4NKQB 4JHUA 4UNIA 2WTOA 4A7SA 1ADQH 4LMQE 1SHSA 1UT9A 2DDQL 3RWIA 1D5BA 2YARA 3SKNB 2YAOA 3MYZA 3QIWC 3Q2LA 2XOTA 4S1RH 5C0EA 2VL4A 4N2AA 5AZUA 5MEQB 5C71A 5FM4A 5MHSE 4S2SA 1FWXA 4FG6D 5C92A 2ATKA 3DPDA 5KSAA 4C57C 5IFJB 2APTA 2BVOA 2DQDH 3B56A 2VXQH 2G2RA 1NFKA 3EOAA 1EDHA 5EBMB 5E51A 1IEAA 3OV6A 5EEVA 4X0NA 2DICA 4W9KC 4G8GB 3K71A 1LE9B 2GT9A 2XV0A 5DZVA 2O5NA 3WV0A 4NJAL 4XO8A 5DHXB 4JS7A 5HDQL 4PU2A 4U7SA 2H6UA 1CICC 4BGLA 1E4WL 1OTTD 4HAKA 2DH3A 5EOCL 3U0TB 4RX4A 5HDOA 4E42A 1T04B 1U2YA 3GEFA 4PD4J 3PYCA 2NY4C 1EEYA 4JM4L 1D7FA 3DX2A 3QUMA 2X28A 4WRLA 3D48R 2NY0B 4JN1L 3R8BB 3TWCH 5JHLL 1BJMA 4MGXA 4XBEL 3WS3B 3JVFC 4IEFA 4J1UB 1Q8MA 4NKMB 4RAUB 5EC2A 3T3PB 1GTFA 4JY6A 2D31B 1X5GA 2NTSP 4EDXA 3QFGA 3IGKA 5BMFH 1KLFA 5G4OA 1MJUH 1U21A 2EDHA 1OF2A 2YUVA 4OLEA 1XIWA 1HWGB 2BC4B 2XZAH 1X5KA 3D7PA 4LLQA 1NCGA 4A6YH 2AAVA 4QHPA 1J0KA 4XAWH 2Y3NA 3RIKA 1LDSA 3JTTA 3NCBB 4JLRB 2IGFL 4O9HL 1U8LB 4LBEB 2CK2A 4JDTH 5DSCB 1RUQH 2OSLA 3UJTL 3GSNL 3WIFB 5JOPD 5C6PB 1JMXA 1PSKL 1KJ2L 1U6AL 2K6WA 1PZ2A 3E6FB 4Q7DA 1U3HB 3FQWB 3PDOA 4N1CA 4QRTB 3IJ9A 2VDRH 3SYAA 3Q2WA 3L3GA 4X5WA 3SGKC 2K3TA 5IIEA 4S1QL 5K39B 1SMDA 4HKZA 4K3JH 4HV8B 3EFFB 4TNWF 2YIHA 3FONB 5DJAA 4H8WL 5BVJA 2F7RA 4N2HA 3SB3A 3H3KA 4DK5A 1CJYA 2LLGA 3A4AA 4KRPC 1C8PA 3D30A 3VXOA 1LTXA 5TDOB 5A7EA 1J5OH 5TQ2L 5AVWB 3SGJA 2MHAB 2GSIB 3U7WL 1MHCA 2QTVA 3RVTC 4MAYA 3MNZB 2WLZA 3UL4A 3REVB 3KLKA 2Q10A 5JW3L 4KAQH 1N6QH 2HRHA 1WCBA 5CCKH 1IAIH 2LVCA 3I6SA 1L9QA 3G04A 3MRQB 1QSED 1A6VH 3MRMA 4RRPA 2QPUA 3GO1H 1LP9A 3BO8A 3UTTE 3EDJA 4MQTB 4Z3JA 5CEZE 3EO0A 3V6ZA 4DH2A 5EF3A 3BP4A 2WZ0A 5IEKB 4AW7A 1UOVA 3UZEA 1TQTA 5EO9A 3MRDA 3RWEB 4NNPH 2WQXA 2PTTA 3ETTA 2JJSA 4KMTL 1OANA 3ZK0A 3ZL1A 2F8XC 1BFOB 2N7BA 3O3UN 1TF4A 4TUOB 4U1HA 4WDIB 1IGML 2FATH 2L8AA 4XE5B 2NNFA 2D8KA 3ZMRA 1KIPB 3WN5A 1GCYA 2VC2L 3LS5H 4N0RA 1IEHA 3O4OB 1D5ZB 1TZIA 1G7PA 5K9KA 5IB2B 4JO2H 2J20A 4NWUH 5C9JA 3TVMA 5L2JA 5CEZH 2DWEB 3L4XA 3KR3H 4TNEA 1QZ1A 5D1XE 4L9LB 5CFHA 2EO9A 1QLEB 2B59A 1MJJB 1FJ1B 1QW9A 1JGIA 3L2NA 3ULVL 3T2LA 2EDEA 4I8DA 1F02I 2A9NL 4N0FA 2HFEB 4KJQC 1OLLA 4PGEB 3E6HB 4GQZA 4CSTA 4D0CB 4X80H 3LKSA 1S7XB 3O6FB 4OFPA 3NZ8A 4WWNA 2OTUA 1Q9OA 4KMQA 1P5VA 3GUTB 3U0TA 2WMPB 5C0BD 2QKSA 4MNQA 4NRYA 4OGYH 4PRHE 4TVPL 3CPLB 2JJTA 3EAKA 4XCYB 3Q9PA 4M02A 5BV7B 1GGYA 1UB6A 3FKUS 4IS6A 5FYLD 1CDGA 1FL3B 2DMCA 3BH4A 3BD4A 3M1BB 4DKEL 5CD3B 1JRHI 5JW4R 3VWJA 5E5MB 5EORL 2P28B 1KG0A 4Z0BL 1NGPH 5IHLB 3MREA 3WO3B 2R7EA 1Z9SA 1TPXB 4XB8A 1V54B 5C07E 1UH2A 5D9SB 2FWOB 1NAML 3MLVH 3L9YA 4P5RA 4JRXB 3P9WB 4CGTA 2AV1B 4WQOA 5AD0A 2FX7H 2JKTM 4AITA 3PGDB 3WD5L 5C0BA 2JQMA 3EW3B 4J8RA 5MENB 1Z9LA 5GGRY 3VI3B 1DJIA 4WKXA 1MIEL 4UOZA 5I2IA 2V37A 1RUML 3NJKA 1LDPL 4AIEA 4UNTA 2HJFA 3SZ6A 2VIRB 3PP3K 4GI8A 4I77L 5KAQG 4DGWC 1NEUA 3PJSB 1RFDH 4P2QA 3RUGF 4XN4A 3ZKMC 4HUUA 2V2WB 4R0LA 1K72A 4YZFE 5F9OH 3PHOA 3IJHB 2OW7A 3WS6A 3NN8B 3T0ED 3K7UA 2IAAC 5C0AB 2LE9A 5F1IB 3CHSA 1WFMA 5J9PA 2W9LA 3W81A 3O6ML 2D7PA 4L1BA 2X6UA 2KLTA 1E5AA 3KBPA 3F83A 5DZAA 1RK0A 4YWGL 3C5ZB 3CH1A 3RY6A 3VFOB 2YWZA 2NRDA 3FQNA 3MV11 2VR7A 3QIWA 5CF3A 4G7YH 2MKWA 4JY6B 1JTOA 5GRWA 4GSUA 3TJHC 4P5MA 5CINH 2HMIC 1VJSA 3TJEL 4B9CA 2NY1B 5DHVA 4EIUA 4P07A 4PJDA 1X9QA 8FABB 1VSCA 4RRPG 4Y5VC 3O8XD 4YVUA 2BZCA 3N9GL 2R29H 5HVHB 4AVIA 3KGUA 4FDWA 4MJID 4PIBA 4PRNB 3B5HA 3B4NA 2PWEA 1QLEL 4PJ5D 5IVXA 4Y1TA 4XNYL 4ZW5A 1KBGH 4XPBH 5KW9L 3D50A 1CFQB 1D2OA 1FN4A 5C09E 3DO3A 2WQRA 2VLLB 3FH5A 1CG9A 4H20L 3NIFF 3FHQA 3MZTA 2EIBA 2WSDA 4GB9A 4M1GH 1LO4H 1JGLL 1RPUA 3KH3A 1TITA 1HH9A 1N5YL 5IHZA 2XG4B 5CO1A 4UM8A 1XCQB 2YKLL 1OF2B 5B7MA 1A66A 4ZT1A 2QADB 1FPTL 3GB7A 4IMKC 1QLRA 3TESA 3CK0H 4KKAD 4PP2B 4RGNB 1CLZL 4F15C 1FAIL 3HAEB 3DPBA 4P2QD 4ZPVB 1U8CB 2FX8H 2MNUA 4PV9B 3WKML 2E8ZA 4F8TA 1SLUA 3QVAA 2BVQB 1BZ9B 2FZ3B 4OZGF 4YHIB 3CHPA 5DHMC 1CGWA 1RURL 5IV2B 1B88A 2C9SA 4QRPB 2AEPL 5I30H 2DV6A 4XMUA 1J0HA 3CUPA 4PJFA 2WLMA 1EWHA 1UZ8B 1HH6A 3REWA 3Q8CA 5IBLC 4UAHA 3B2XA 3B3IB 2YD5A 2H2PC 2GVYA 3NCJL 1H3PL 3LPPA 4LPTA 3VO0A 1NKOA 4J28A 1KBWA 1HOCB 4NS0A 5CBAB 4C83B 3GI9L 4CMMB 2HWZH 2BVEA 4EKJA 3QG7H 1YEDB 2ZCZA 4BUGA 2ATAA 1HNFA 2K8MA 4C55A 1KCLA 2FLMA 5GSRB 4X5LA 4JPKL 4AV4A 4NQEA 5BOPA 4IBTA 2X4QA 4B96A 2IF7A 1E3XA 1AQKL 2IV8A 5KJ4A 4YEFA 3MV01 4AYSA 3BZEB 1EFQA 4Y9EA 4HS3B 4Z7WE 1A1MA 1TVBB 5CS7A 3T0WA 3CH8A 3IETA 5G5DA 1HWHB 3CVHB 2FIKB 4HKJB 4HQQH 4XNQA 5IK3B 5T3XH 1UFUA 5DLMH 1I75A 1Y07A 3WTSA 1JZ5A 4MNQD 1WP6A 4Z7VB 3U9PL 3JXAA 4GBXD 3P2BA 3ESVF 1VKXA 3E7JA 1D9KA 1S9VB 3Q8AA 1A14H 3VYNA 3HFFA 3N1MC 1AMXA 1DLFH 4BHUA 2OX5B 4HH8A 5GRVK 1QRKA 4ZTPH 2BJMH 2W9EL 4J3UA 2ARJQ 1XGZA 3P4MB 3CX5K 3HUJF 3JV4B 5TF1H 1OB1B 1ADWA 3RJDA 3NZSA 3EBHA 4YK4C 5TD4A 3PWPD 5DFTA 3TVMD 1QACA 1H0DA 5F6IC 1Z66A 1QG3A 2HJLA 3LKPA 3WFZA 1UM5L 1OHQA 2CLZA 4DUWA 3MRBA 4BA8A 3AS0A 3WKYA 4FNUA 4P2RA 4XVTH 2Z31C 3LEVH 1TJHH 2EXYD 2NY3D 3Q0HA 4KK9C 4OB5L 1FV1A 4KGJA 3RVXC 1TQBB 5KBPA 4HKBA 3ZTJG 2CR0A 3ELQA 4FA6A 3JTSB 4LSVL 1KV3A 1KG0B 4GRWE 1QRND 4Z3HA 4ZMYA 5KSBF 5ERWB 4F57H 4CC4A 1QR1B 5B1KA 2BP3A 3L13A 5L6YL 4FNLH 3T3ME 1K4CA 3U30B 4PJHB 1BAFH 3OG4B 3ECBA 1HL9A 4N2BA 4FNRA 2ITCB 1YEJL 3EOBB 2WQ8A 2YPKB 3DOHA 1Q9OB 2WD0A 3ATEA 4PG9B 2TRHA 4NC1E 1U8KA 3MLWH 3S0PA 1FUNA 3ARYA 2PP9A 3RB7A 4ADGA 2A6DA 3P73A 4A6YB 3CGTA 4OBRA 2X1QA 2P8PB 3MJWA 4OT1L 2DM3A 2H41A 4MVBD 1KPUA 3FOMB 3EJTA 3DJTA 3OD3A 5GS1A 3WFDL 2ADJB 4Y2DA 5DRXA 1BD2A 3BPCA 4XHQA 2NY2C 1X4XA 5HHXH 1SJVA 4NRZB 1TKWA 3ULVE 4N90E 1OTUD 1ZHNB 3R19A 2MEJB 2YAFA 4WV1A 1WITA 4QI3A 1HDMB 1PD1A 3AT0A 4YHKL 4LCUB 2QT6A 2Y7LA 4L1LA 5C0BB 4QR7A 1EGJL 5JW5B 1N70A 1XGPB 2QVMA 4N8VB 2X4UB 3PV6A 1CYXA 2Z1KA 3GSVA 2OTWA 4X6CA 1KXVC 2J12B 2VDLL 1RU9H 4MCNA 4LCCB 4W9CC 3FB8B 4CNIB 1G7IB 4AYDC 1WC7A 2CUMA 4LKXB 3X12B 3Q9QA 2DQJH 2M26A 3TFKC 4LASH 3IDNA 3C60D 4FQ1H 5E4EB 1B4LA 3SDCA 3VMPA 3X13B 3F00A 3WJJA 2XWTB 2XI9A 4P46C 5CM1A 1LK2A 5C0GA 5MENE 2EIEA 5ETUB 1KCSH 2X4QB 3ZE1E 4FTVB 3VM7A 1NCAH 5BVPL 2WXLA 3DMMC 3SBRA 2Q7NA 3F7YA 3HZMA 1A21A 4PHZA 3FQUA 3IETB 2ZOLB 4P0DA 5T1LB 5DVOA 3APNA 1ZCRA 1NBQA 3CQFA 5B38B 3K4ZA 3Q6FB 4Z7NE 4NQSA 3WL9B 2ADFH 5KYWB 1T5KA 2KMWA 4MHHG 4Q6IA 3G9AB 3D34A 4HX1A 1LE5B 4U3XA 4LU5L 2DOCA 2PR4L 6TAAA 4FP8H 4UIKH 3V6OC 4ZG1A 4GW1A 1UD2A 3ARDD 3NRQA 3AUWB 4LPXA 5DHVB 4PJBF 1UH3A 4FFTA 3IMTA 4FQXB 4JM4H 3KDMB 4JFDE 3KH4A 3TNMB 4L0ZA 4ES9A 2B2XL 3NYKA 4J3TA 3QQ3B 1U8CA 1PZAA 4Y5VA 5HDBE 3UC0L 3ABMB 3EYSH 4LSSL 5I6LA 2F0CA 3OHXB 4TNWK 3KS0J 4FXKA 1N5AB 3SQRA 3O8XC 3SDAB 1NIFA 4W6XB 3U4BH 4PB9L 5DDHB 1OEZW 1TFPA 1UZ6F 2WWMD 3II2A 1MJUL 5BS0B 5I2IB 3F7QA 1J5CA 3S36H 5CSZB 3TYFB 3WHXA 4BELD 3DDFA 3QPXL 1IC5H 3NCMA 2WUBH 3D3VD 1CLOL 4ZTOH 2XG4A 2XPZA 4FQIH 4CMMA 1ZLVH 3P4LA 2F53A 1N0XH 2X88A 3K2UL 1OQOA 4QTIH 3QC6X 3ZDZE 1E4KC 2FB4H 1PQZB 4AMKL 3GBNH 5C0NC 4XNDA 2BK8A 2VR3A 2GJ6A 2ZXBA 4ZPVA 1MAJA 3VCLB 4MJIE 3GSQB 1URIA 5JR1H 4PJHF 5EU4A 1QX1A 2EABA 1FGNH 2P5EB 3QZNA 5AAPA 3L1EA 4OQTA 5IMMB 3EGXA 3LZLA 3RWCB 3SE4C 4AT6B 3UBXB 4G6FD 2ZOKB 5E70A 3N40F 5DWUH 4ERSL 3QYMA 3GXNA 4ZOEA 3VI3E 3CFEA 1JYNA 4U1GB 5JPNA 1Q0YH 1MCPL 3IFPB 1R0AH 3K8LA 2YZ8A 3QIBA 4IW4C 1UKTA 1Z5HA 4PR5B 2E27H 4LHJB 3FT3A 3ZZLA 3N04A 2P24B 4PG2C 1I3UA 5C0JA 1XQ4A 2MRYA 4K4KA 4NPKA 3JVGA 3V4VL 1MFBH 2WVVB 5CBEA 1FRGH 3QRGL 2I9TB 4DN4L 1Q38A 5DUMH 1P84J 3ZE0E 2UX7A 2X9WA 5E6IB 4HXBL 2ITFA 2E0PA 3RTQB 4G43A 5KG9A 1L0QA 1DLHB 1AZUA 4PI0A 2C3VB 2FLRT 2H3KA 2P9RA 2VZSA 5GRJH 3V0EA 3VD0A 1U4EA 3O11A 4FQHA 4RLDA 3N1PC 1HZHL 3BZ5A 2GCYA 3F65A 2NXZD 3K4AA 4QTFA 5KZCD 3OR6B 4G9DA 2MNWA 5I19L 5BUGA 1XGTA 1Q94B 1RZFL 2VLKE 3WEXB 2Y36H 4HUMB 2A9DA 2ZP9A 5I0VA 1CLYL 1ZD6A 4JFDD 4YX2H 4G6JL 5IV2A 2W0PA 1C08A 1F5WA 4XZ4A 2CD0A 2OZ4H 3BIKA 3NA9H 1ETB1 4MD5B 4I48B 5KOVC 2ZZUT 3D69A 5D1QC 1AIFA 2XWBA 3MDJA 4YDJB 1ZE3C 3SGJC 4FFYA 5LN4A 4LGSB 4F7PA 2AKRA 2DQIH 3U0PA 1QLFB 3FO1A 1DR9A 5IW1A 2VDKB 2NR6A 4MQSB 3IF1A 5I15H 2AJ3A 2GY7B 3O45B 2D03L 1U3JA 4P4RA 3JWNE 4BH8B 1I9JH 1CL7L 1T6WA 1XR9A 2A77L 3HC0B 4V11A 3WMSA 1NFDA 2SODB 3UERA 2BRQA 1C1EL 3V6OE 2EE3A 4HYTB 5FA4B 1NGPL 5BRZD 2ODHA 3SDAA 1ORQA 2VDQH 4KVCL 2HVJB 1YUHB 3UFIA 2WSPA 3T1FA 3AB0C 3RI5K 5CZVL 1FVCB 4WVRA 1FYHB 1ZOXA 3PDOB 5AAWA 5J7CC 3AWGA 3VFUA 4OZIA 3MV7B 5ANMA 5AW3B 3T3PE 4HWNA 3EDFA 2FGZA 3IAQA 2V0AA 4J3OG 3KPOA 2DZEA 3L3OA 1LE9A 2EACA 3GMNB 3OF6A 3MA7A 3HRPA 5BZWB 4QGTA 1CFVH 4JRWA 5KVEL 4MB5A 1CDJA 2GIXA 2QPFA 4TL5A 2HH0H 1DO5A 3ISWA 4N9GA 2BSEA 3QJOA 3KLQA 4BSVA 5TDOA 1OPGL 3HUJA 1ZLWK 3O81A 3IFOB 3CV5A 4P3DA 4NI3A 3QAZC 5DJ2A 2VXQA 1EDQA 3HZMB 1G94A 3IU3A 3NGBB 4KGLA 5ESAB 3ARXA 3REVA 1YY8A 3SKNA 3Q48A 4YSPA 2CLRB 1NFDE 2CRYA 3R7RA 4F3FA 1MNUH 3C9NB 5GJSH 5HDWA 2YXMA 2H2PD 4D3CH 2CBOA 3N42B 5I75C 3F8UB 1PKOA 1FYTA 1FNGB 2ZWLT 2ADGB 3MUHL 5BXFA 5DQDH 4O5LH 5ID1B 1TNMA 2BZ7A 2JMRA 1W0WA 2PW1A 3D85D 1RUQL 4A7GF 3O4LA 4AM0B 2JKIS 3V0VA 3WSQL 2DW5A 2QELA 2JCWA 2NW2A 3IKKA 3V5DB 2RALA 1HK6A 2PWDA 4IRJA 5IF0A 1U93A 3SDDB 1PKQB 2VAJA 3DXAB 4PBVC 1LO0L 4MQ7A 4ZUVA 2CKBH 2I9TA 1HIMH 1T1ZB 4ZXBC 2C3HA 2OYKA 3O6LL 1KGYE 1EEYB 3RVVC 4LSUL 3T3PF 4MMYA 2I9LA 2YBRA 3C2AL 4HUXB 2HJKA 5IG7B 5DRNA 1EXUA 2QBWA 4Q0XL 2Z7UA 2ENYA 2R4RH 5EC2B 2X4NB 3VXMA 4OF3A 2V8LA 4FQJH 4N68A 3UZVB 1TYRA 3WLWC 4JQIH 4A68A 2VLRB 2VXTL 5LB1A 3HG0A 4NN6B 3WFEH 5JLZB 1RUKH 3QDGE 3CFDB 3VDCA 4NZFA 3T0DA 2XXCB 3KVQA 3ZN6A 1SHWA 3TNMA 1A6VL 4A2MA 1TUPA 1TEFA 4H20H 3E38A 2O93L 5E1IA 3RGVB 4IBSA 4NGHH 3ESPA 4FLSA 3O6FA 1N7MH 1ZVHA 4FF9A 4MAYB 3OG6B 4X99B 3KPPB 3AM8C 5EUOA 2J5LC 4S0HA 1PGRB 3PWUB 4H0LC 4PJBE 4WWKA 1B4TA 1ZEAH 4NNPL 5T3ZE 4XOEA 3ILQD 1JHLH 3OXSB 4QGYA 4B9IA 1S5IH 5GGQH 3MV7E 3K2KA 4TUKL 4Y16A 1HSAB 1IJNA 2Q86B 4PVBA 3LAFA 4BUQA 1BCIA 2K70A 5D1ZI 1RURH 4OV5B 3UEZA 4LSPL 3AAZA 5E2WH 3CSTA 4R7NB 2AAAA 5JZ7D 4IKIA 2PETA 1RD6A 1GZPB 1OP3K 3N1QC 1B4RA 3WIHL 3AREC 4NWUL 1F13A 3UGXA 4HW6A 1H6FA 2P80D 1OL0A 3WFBL 2RAMA 2DM7A 5CBEB 3F58H 1GYCA 1PG7H 4N0CD 4L1HA 3ROOA 1UATA 1RZJH 4Y1AB 2X1PA 1BLNA 4MX7A 3GMQA 3THML 3DVGA 5DMJB 5E6IA 2CCVA 2ZOKA 3V7AE 4LLDA 3H56A 3WS3A 2X1OA 4H0IA 2EKSA 4BH7B 1UKSA 5DD6B 3LQZA 1OAXL 5JO5A 3VFPA 2V33A 1FZMB 5MP6L 1WBXB 3CWGA 2PPAA 1MF2L 1S9YA 1JUFB 2ZCKH 3WLBB 3FUNA 1FF5A 4KJWC 5T3XL 4UILL 3I74A 1KWGA 1NOFA 1MI5B 1JXGA 3LZFL 1NGQH 1ZT1B 2Y1AA 3PJNA 4MB4A 5DK2B 4K8RC 1GIGH 3JT0A 4FXKB 4UQ2A 3D39D 3LHAA 1IE5A 1BQSA 2IGLA 1AKJA 1NAMA 1INDH 3BIKB 2JKXA 4KZ0A 5CHNA 5GSVA 4UF7C 3U9UB 3UGUA 3FBKA 3PPSA 4NUGH 3U7YL 1BM7A 3QJFA 1WBYA 4PVNA 5IVZA 1PNCA 1QWNA 1KEML 2DEYX 3KPTA 4KO9A 4QHNB 4WI5A 5FYKU 3K2MC 1GGUA 3MGOA 4KO7A 1UM5H 1IGJA 1U3HD 2YEZA 3NFPB 4G9DB 4Y5YA 1B4JH 2ZKYA 3WHE1 1AZBA 3CJJA 4GKSB 2ZONA 3HCVB 4HFUH 2UWEE 4PY7A 5DQ9B 1DVUA 4K07A 3EH1A 3KNBB 1XR9B 1KZYA 1J5IA 4Y4HD 2FCBA 4BHUI 2XWCA 3X2QB 3GK8L 5DXWA 4ORGA 4RSYA 1I8KB 4BE6A 2ZTBA 4BDVB 5F9OL 1W72L 4U1JA 5AUMA 4FXGA 3PAVA 4QHUB 1UWGL 4XNMA 2RJMA 3MFFB 3EYVB 3L95B 1EVTC 4FKKA 5E9DA 2HKFH 2GJPA 3NK4A 5F7UA 1MXDA 3G6JE 3W39B 3V7AG 4C4KT 3N85L 1YEJH 2BMKB 1CLVA 2WCSA 4XBGB 3SE8H 1GSKA 4PLJC 4HIEB 5BV7H 5HYSA 3DGGA 4FEIA 4FTVD 5AVUB 1P1ZA 1T66C 5GS2H 5KBDA 3MUGA 1LP9E 4HF5L 4X9IA 4CBZA 4W4OA 4Y4FC 4UDTA 1UD8A 2C9AA 5E08H 1GYWA 5JNYA 1OT1A 4QHLB 1P7HL 3SKUD 3SODB 4H25A 4X9BA 1WF5A 4GRWF 4OCSH 1GVIA 3QZBA 2DWXA 3ARDB 4RGMC 4RH4A 5FCSH 3SGEH 3QDJA 4NM8H 3VQMA 1H8OA 2J43A 3QIBD 5ABZA 3WKNA 1RV6X 1CT8B 5ISZE 2XA3A 5F9WB 1JSYA 5B7EA 4WCYH 3BWSA 1JXKA 4JDEB 4FTVE 1P7QA 4PJGF 1KB9J 3V0IA 4W9HC 2EE2A 4B3EA 3TA3D 3BXNB 2TSBA 2N3JA 5F1IA 4N5UA 3TEWA 1N5YH 1EPFA 4Z7NB 5BRZB 3P77B 2ICCA 3MV9D 4G8EA 3PL6B 4HS3A 3FQ4A 4V2CB 2DIBA 3PDGA 4HPYH 3NBNA 2FYYB 1FPTH 1NCHA 1GPOH 2FX8L 1U8JA 2DLHA 1TFHA 2XC8A 1IL1B 1NCCH 3PQYD 5JO5B 2BCKA 1C12A 2YR3A 4XN5A 3JTBA 2UX6A 3F62A 4X8GA 3SCMB 2B3RA 1F4WL 3OAZK 1NBYB 4FFYL 2O5YL 1XXFC 3B43A 2C26A 3IS0X 3U79A 4JANA 4Z7UE 5CWSB 4JPQA 4PP2A 1JNHB 1KGXA 3FO9B 4RDQF 2YD0A 3VXTB 4FKHA 3UBXG 3IMVA 4KQ0A 1UT1A 5DK2A 1GGCL 2J21A 3I6LD 1WD9A 2G3MA 1UJ3B 4PRDA 4YXKH 2VN6A 4F24A 2FX9L 1T6BX 1D3CA 4ZMOA 1VZIA 3O2VL 1KY6A 4JE0A 1X7SA 2X4TA 3CN3A 3TBSB 1XSIA 1VF5C 5EU6D 1CC3A 4ALAL 4PRHD 3B7RL 5CR8A 3UPRA 1QSEA 3D0VA 1CG9B 3KM2A 4MNHA 3ESUF 3LDBB 3RZCA 3NJNA 3QI9D 3CVCA 2FD6H 3IDXL 2BIQA 4LIQL 4XMLL 1NLDL 1CYWA 4DFIA 5M94B 1I7RA 4KO5A 5FHAL 2EEAA 1U2HA 3BP7B 4JG1L 4K7FA 2BVPB 1EO8H 1BOGB 1S7SB 2WN2A 2WP3O 3S36X 2XKUA 1DUYA 1LK3L 3LJ3A 4ONGH 2VQUA 4K8RD 3HAEG 3G5YA 3WY3A 1G87A 3FN3A 3CSYA 1SYSA 3EHBB 2BNQE 4ODSL 1DLFL 5CJOL 1JRHH 3I6LE 4OLYH 2W9EH 5HI3D 2C1OB 2EUVA 2RD0A 2ZUXA 4ZTOL 3N06B 1JGEA 2MJWA 2YD6A 3DIDA 4MB1A 5DO2D 1YEKH 5LBSA 3X11A 2AK4B 5LXGH 2JCCF 4JREB 4NZUL 2D73A 4J3BA 4F1SA 2X7LB 4RMBA 3GMMA 4FFZH 4WW1B 3AM8A 3K8MA 4J7RA 1RIUH 4M3KB 2H6PB 4PCYA 5DD6A 2Y25A 5LO7A 3ZL4H 1DP0A 3QZWA 4I3SH 3LEVL 1HXMA 2Z9TA 1JP5A 2VXUH 3F6IA 5E5UB 5FYKH 3UAEA 5C6TL 3PY9A 3OR7A 4F92B 3DGGB 5AVRB 1I3RA 3MQIA 3P9MB 2Z8RA 3AZUA 3DK2A 5DJ0A 5DJ6B 3FT0A 5EOCH 2BXYA 1DVXA 1RAMA 5C8JB 3HR5A 1YQVH 5KJ7E 1UT2A 1BP3B 1NIDA 4TOYH 4B9KC 4F57L 4MS8C 3KXFA 2NZIA 4PJ5B 3TWCL 4JN1H 5JHLH 1SVCP 2C1PB 1ZTXL 1BLNB 1J0ZA 4MX7B 3V0JA 2KS0A 5KSAD 2E27L 4N26A 2Z65C 5FYJD 1K9TA 3NSCA 4HMCA 1DVZA 2CO2A 5EBLA 5BZZA 2DKSA 1II4E 3FH8A 2PWGA 4GUCA 1V3JA 4AQOA 4DGIH 4P3WA 3QJFB 2IG2H 4HJUA 5IVZB 4WUUA 3G6JF 4GSDL 1ES0A 5E24E 4XP4L 1O7SA 3L08A 1FSKC 4UV4L 5DI8A 2B8OT 3FUMA 3GQFA 3NH7L 1ZPUA 2Y2TA 1UXWA 2QVKA 3GB7B 3QQNA 4JMXA 1I9RH 5C08A 1QFWL 4AZUA 4MKTA 4WW2F 3BMWA 1TZOA 1ZT1A 4HK3J 4QOKB 3RGVA 1TVHA 1HHIB 4XGZA 1FIGH 3TA4D 1TQSA 4LPUA 2VH5L 1A4JA 3B5GA 1I8KA 1I1AC 2APWA 3DJ9A 4JNXA 1GTNA 3FUIA 3UJJL 4GT7A 3REWB 4NXKA 1I8UA 1DQQA 3TJHD 4NQUA 4XB3A 5FCUL 4KUCF 1REIA 5E9DB 1HVXA 5JDJA 3TZVB 3VSQA 2DEXX 1WLHA 4AENA 1DN0B 4ZRGA 1PS3A 4DW2H 2BCKB 4AMXA 5JPMB 4J3OH 4HIEA 4U1KA 4WHTA 3ZTNH 4HZLB 1TJIL 1VFBA 2RH0A 1CFTB 3V9EA 3FTYA 1F56A 1MI5D 2NSMA 3L5WB 1E5YA 4R4BB 3KWWA 5E1QA 5MERA 2B1AH 3HCVA 2OXHB 1KJVB 3TBVA 4ZNEA 1U8NB 4MNGA 4Q58C 4I0PC 3HS9A 3KWVA 2ICEB 4DHLA 3GSNA 1K3ZA 4EQ2A 5MEND 1XGQA 3TEYA 5I15L 3ZE2E 4EOWH 5CEZL 1MWOA 4JLRA 4M8QA 2KDGA 4Z0XA 3QJUB 3ZQWA 4YXLH 4EBQH 3BD5A 4G5ZL 1FG9C 2HN7A 4KNTA 3S3CB 1QSFA 2HLAB 4PJ9A 5DUJA 3SEPA 3UTTD 1C1EH 7FABH 1DBKL 1JUFA 2DWSA 4DFHA 3D0AA 4GBXC 3DHMA 4LRIA 1L6ZA 4MWFA 4IGBA 3QCTL 3OKDA 4KMTH 3T0EB 2ZAGA 3MUGB 3V0GA 2WVTA 3VU2A 5IVXE 3ZTJH 4WJKB 1N4XL 2R56H 4CKVX 4JGJA 3ARFC 4IK7A 1KN2H 1IGMH 2FATL 2OMBA 1FO0H 4K23L 4UQ2B 5C0RL 4Y4KC 2FQEA 2O4EA 1TEYA 2NXYD 4E42B 4Z7WB 5CGMA 4JL1A 1WDAA 3DROB 5D7JA 3L4ZA 2VLRD 4XI5C 3UC2A 4B27A 4ZMTA 2HFFA 1RK1B 2A6JB 4R0LC 1KZQA 4XBPB 3VRLE 1DZBA 4U2ZA 2OMZA 4V33A 1IKNA 4HHAB 3TIDB 4NSKA 3T09A 5JA9A 4PB9H 1ACCA 2IMNA 4MA1B 5D7HA 1PLBA 3EOTH 1Z7JA 3LPOA 4TLSA 1WAAA 4WGKA 4L3ED 3G5ZB 3QUZC 2BFVH 1U8OB 4GKSA 4X80L 5EC1B 3WXWL 1Z5LA 5I73B 5EO9B 2W80C 3OLEA 3MLPA 4HWUA 3EO9H 1HQRA 4KTGA 3S97C 4S1RL 4DKAA 2QDWA 4ELMA 2UXTA 1YNLL 3QUYD 3ARVA 4KTYA 2YPVH 5AL0A 2C1PA 2XQBL 3HB3B 3QIUA 5L0QC 4HLJA 4JO3L 4GS7B 1KIPA 3WN5B 2GTQA 4AYID 4XH2B 4HFWB 3GMPA 3QUXA 5FGRA 1C16B 4UZGA 5C9JB 1QQDB 2EVFA 2E3VA 3BDYH 5LBVA 4AQ1B 4MMZB 2A2QT 3QORA 1BPVA 1E4WH 4L05A 1XF4A 2XPGB 1OOAA 4L8SB 5LAPA 4LF3B 4WI0A 5F70A 3B37A 5I16A 1Q0YL 1ZLDA 4KKCC 5LAXA 4NI6A 4C56A 1RUMH 1J8HA 2GJJA 1Q1JH 4NZ8A 5MEPB 2MHAA 3SE4A 4QRSB 2G4GA 3UX9B 2CA4A 1V7NH 4XCFL 1T21A 2YSSA 3I9PA 5GGUB 4EJ1C 3DIFB 4X5PA 2QPSA 5CEXA 1ED3A 3RUGA 3LSOB 1KLGB 1M4KA 4W9JC 4QXWA 2GUOB 4PYHA 3U2JA 1QI4A 3AU1B 4H4NA 4TUJB 5DYFA 4A6YL 4ABQA 4B7LA 4BXSV 1ACYL 3NCYS 2HZHA 4IKNA 4M6ML 3C6LB 3SGKA 3D4ZA 4GYBA 5HP5A 1S9XA 5IEKA 2YS4A 4XXDA 2YFNA 1ZEAL 3N40P 3LXUX 1JZ3A 3D1MC 1XD1A 3DIVA 1NGZB 1BFVL 3QS2A 4TN9A 4BH8A 4PUBL 1NICA 1PLAA 1XF5A 3T4YA 4ENED 4JRXA 3GSXB 3GJFH 2GSIA 3C09C 2ZOTA 3O2DA 3PWVA 3O2WL 4TV3A 4PRBA 1F90H 2V5RA 4U1SB 4S1QH 5L9DH 3FQTB 5F88A 5F9DC 5IBUG 4GW5A 4MJIB 4TTDD 4ANWA 1A7RL 3HBQA 4TS6A 4Z5RB 1E50A 1U2CA 4NIYE 1T7WA 1IV8A 3SYPA 4HJIA 5BNXD 4JFYB 2HLAA 4ELDA 2UYLA 2AJUL 3GIVA 4J2XA 4M7LL 1S7TA 2VO8A 4TVPD 3W0WA 1UGKA 1IVLA 1Z3GL 3THMH 1BJ8A 2UVEA 3E2HB 2BC4A 5FF6A 4I0PD 1N6QL 1A4KA 3UYRL 3G9VA 1TZHB 5CKGA 2DQIL 5LNDA 2F1EA 4IGBC 2VLKA 4P2OD 3E6HA 3A6CH 4JJHA 5DD3L 2YLKA 2WBJC 1A9VA 3CMGA 1R9FA 4G80A 3LZRA 4F37K 2BHFA 1IAIM 3BZFB 4PHXA 1JGLH 4LCYA 1MHPL 1NGXA 4TMPA 2PR9A 3QZPA 3EJSA 1A0QL 3L5HA 5IB2A 5JMRA 1YUKB 1SNRA 1HHHA 1CLZH 4KVCH 2XVKA 5HHNA 2B59B 1FFOB 2DWDA 5FYJU 4OZGA 1R24B 3FONA 2ISDA 4PJCF 3KWWB 3F7VB 3OJ2C 2VC2H 1SJMA 3H9SD 1RZ8B 4E41A 1KEMH 4WHDA 1T7YA 4ZO9A 4AZ8B 3W0WE 3D25A 4P8QA 3G5WA 1XGQB 3DXAA 4ZUVB 2C1OA 3STZB 5KEZA 3NP4A 1NIAA 1OSPH 1MWAH 4M8QB 2EJ1A 4H26A 4OLZL 3V0DA 3MCKB 2VN7A 3GI9H 3CFEB 4K7PL 1VFAA 4NDMB 3QJHB 1G9NH 3L3IA 1WUNT 2VMDA 3PDDA 1R46A 1QLFA 2IPKA 2R83A 2V2XB 3FO1B 4KUZL 4GQQA 3NIFB 5I18L 4G9FA 4K94H 1KNOA 3HLAA 3MRNA 1MHEA 4MS8D 2NSXA 1AHWA 3CFDA 1VPOH 1HQ4B 2NZ9D 4POUB 4JJOA 3JT2A 4HPHA 5DWPA 5FV1L 3RAJL 3WJJC 1HXYA 1HC1A 1XTLA 5DTFB 1PKQE 1T1WB 2G5UA 1V3MA 4Z0XB 3MRRB 3LHPL 3CLWA 3NG5A 2WAHA 5KG9B 4P4KC 4PRIE 1KC5H 2JB6B 4YE4L 4BFRA 3JUYA 2BWDA 3CE1A 1JYXA 3RIFF 3INOA 1NMAH 2EEFA 3U36A 2JI2A 4F2FA 5IJVB 1AXSA 3QDHA 4P2AA 3WCYA 4NAQA 2CIKB 3PV7A 5T1MB 4MWFB 1PEZA 4LVHC 1J11A 2XU9A 3VNZA 4D8PA 2WBWB 3HG1D 5GGSB 3FAWA 3H2PA 5IROA 1CXKA 3BD3A 3T2NL 4A2FA 4GAJH 5AAMC 4UDUA 4Y4FD 1JPGB 3GRGA 1YRKA 3GJFA 2K6ZA 1C7TA 1LWJA 3H6AA 2OQJA 4JRYA 5A1AA 1NC2D 4X7FC 5C0ND 4YDJA 3M1CA 3O9WC 3W9EA 4R2GD 1GZHC 4IBZA 4JQVA 4CSZA 3GM8A 3IDGA 4FHJA 5TK4A 2QVTA 2G3ZA 2VZTA 4JL2A 2EP6A 3T4AB 5E8EB 3UACA 3ZHFA 5FO7A 3E1F1 1AS8A 3C8DA 2JJWA 3LQAC 4G8FB 3MJ8B 4IMLB 4RAVB 3HBGA 3K6IA 3QNXA 1Q72H 4YHZH 1XH0A 3H55A 4JZJC 2APVA 4XN1A 1ZHLA 3NRPA 3GSRB 4IIQC 4AYBA 1BGXH 1IAOB 3V0AC 3H9ZA 3VFMB 3H9SE 4YC2C 4JBSA 4R26H 4EZKA 2VISA 2O6FA 4PH8A 3T77B 3KPRD 4MRCA 4RA0C 1TQVA 4MJ6B 4HCIA 4R90H 1N0LA 3EJZD 4P49A 1JK9B 2WTRA 4MXWH 5IOKA 3ARSA 1GGCH 4FAAB 2KKQA 1IGCL 1WFIA 3WG7B 2F7QA 3NIDE 2B1HH 2EXWC 3FCTA 4HXAL 1NMBL 1TYJA 4U0RB 1G0XA 4ZQTA 5IFHH 2AEQL 1ASOA 1WH0A 3IM1A 4PRPB 3VFGL 3KLAA 1T03H 1EGJH 5D4IA 1PZDA 5KVEE 2OR8A 4URKA 3D85A 3QK0A 3MLZL 3W5NA 3KZ8A 1HSBB 2QQKH 3HS0A 1HCYA 2Z92A 5I6XC 1IJ9A 1OAUH 1S8DB 3CZNA 3KPPA 3EH3B 5K59F 1ZWIA 4MQXD 1VADA 2G5BA 1ZV5A 1DVSA 1D9KC 4MDJA 4J8QA 3B9KB 3L95A 3Q3GB 3FTXA 4FEMA 4V1DB 3FFDB 5B4MC 3TCLA 1ULVA 4NKDA 1RLBA 1MKFA 4XMKH 4WTQA 3L3IB 3LZOA 4U1LB 2FLBT 2WTPA 4QOKD 1RJYB 1UASA 1KGCD 4WI9A 3D3VA 5LXGL 1EBPA 1XMWA 3U82B 2AVGA 5IUSA 1EFXB 3OHMB 3FU5A 4WV1B 5IGXH 2C3XA 2DMBA 3D8MA 3NPSB 4UOW0 4E9TA 5GRUH 3NEOA 5H4ZA 3NCJH 3SDDD 4FI8A 5SWZB 3TZVD 4DOHE 2C5DC 3ARQA 2PWFA 3MRPA 4XNQB 1P7KB 3HTLX 2XNAB 4G6KH 5HPMB 2ED6A 3QSKB 5HXMA 1CK0L 5JXED 4AVKA 4K5PA 1UWYA 4Z18A 5D1QD 3FB5B 1PFOA 3ZDXB 4RMWA 1NWOA 1W91A 2MCPL 1W72A 2HT2D 5FKAA 4Y5YC 4TL4A 1E27A 2FVNA 3MACL 1KGCE 1H8SA 2H8PB 4JVWA 1P7QB 3BKML 2WLJA 1LK2B 1ZLEA 1T5XA 4G3YH 2LHAA 2VLJE 2BSSA 4XP4H 5EUKB 5KS9F 4OZFB 1F18A 1YEIH 4ZUUB 5GZNA 4HF5H 4LQ1A 3PIQA 4U6HA 2VQ1A 3O9WD 4WTWA 1JPSL 3P73B 1FV1B 2WUBL 5HGBA 5JHDE 3ZMNA 3MUUA 1VFAB 5GRYA 3TIEA 3SDXB 2NX5A 1DL7H 2YEZB 1DEDA 1IGJB 4R4ND 5AZEH 5DEGB 1Y18A 5L2KE 3FF8A 1FORL 4K0OA 3UJJH 1HEJC 3SDXF 5BCAA 4N6RB 3HA0A 4PJHA 1TKWB 5AENA 5IB5A 1NC4B 2OMXB 2W59A 3QG6A 5D5MB 3UCQA 3H3BC 1GAFL 4HDIB 1DSFL 5KBNC 1OAZL 3ROOB 1AZCA 5G5DB 4L1TA 2VJ8A 5CP7B 2OZNA 3W11D 4FN0A 3UAJC 1JI2A 1ZLVK 4FNLL 3BGFC 4FNPA 3MV7D 4HIPA 3DETD 1D7BA 1FZMA 2OP4H 2YUZA 3IPEA 4L9DA 2CALA 1L7TL 2W60B 4NFBA 2BX5A 1ORSA 2V7NA 3MLTB 3DA0A 3QNYB 5INDA 4NRZA 4JGUA 4QDGA 4HGWB 4RX4D 1OLZA 1HQ4A 2GYSA 2XFGB 3ARGD 1AHWC 2VMEA 3LKOB 2K78A 4DKFH 4NPJA 3MMEA 3MV8B 5DFVC 5K9JL 2RFXB 4EQ3A 1T2JA 4B97A 1FAKT 3X1BA 3NDZE 5D6DC 1MRCH 4DPCX 1U8QA 4YPGA 2B5IB 4FCHA 1ZA6B 1O7DE 3VXME 4OGXL 1ZMYA 5LG6A 4ZNCD 1U8PA 1NPJA 1SDDB 2FX9H 3MGOB 3QE5A 3UAAA 3ZOAA 4LIQE 4G42A 3VGAC 2IQ9H 1I82A 3E8UL 3ZR6A 2IALA 4UTBL 3Q2VA 4PCSA 4IU2B 3S37L 2F7PA 4AUJA 5GRZA 4GP4B 2RQ8A 4XMLH 1RU9L 4FMKA 1R3KB 1MCWM 4X50A 3ZIYA 1J1OL 1BIHA 2AQ3A 1DANU 3RI5F 1GZQA 2H9GB 4L4JA 2G30A 3ZHLA 3FT9A 2HT4C 3U4EA 1B3IA 1S9WA 2IDUA 3TH3T 3EYOB 3GBLA 1MJ7H 2ZX9A 1DE4A 1JS4A 1QSEE 4N2OA 3ARRA 1EA9C 4WEBL 4GXUM 4KH9A 4NKOB 3FU7B 2PXYC 4UM9B 1ZXQA 3FT4A 5D6CA 4Y9BA 1NANI 4YDVB 1NCAL 1Z6JT 4KRNA 4CC1A 2M1KA 3A6OA 1I8AA 2DRUA 4KHTH 1FGVL 5DS8B 5CD5D 4KU1A 4JDZB 1JNHA 3VWKB 1BPLB 5BOZG 4I5BA 3NZHH 1C5DA 2XIBA 3CDGA 1BLIA 3B9AA 1C9SA 3CSBA 4AKQA 4JVUA 3A6BL 2BNQA 1ONQA 4UOJA 5EU7E 3RE0A 5I8OL 4IRZH 4MNQB 4DTGH 1SOXA 2HXAA 2OSLB 4IRZA 4KDTA 4XZUA 3GIZL 1ROWA 5FFGA 5INCA 5L88H 4OZIF 1EDYA 1T7XA 3CIQA 4GUQA 4WEUD 4OUUB 1U95B 2P45B 3IPFA 4FRWA 1BZQK 1VZHA 2WXGA 2LTQB 3HNVL 4XP1L 1CFVL 5C07A 5AOKA 2JE8A 5AAMA 5FYKE 3BKCL 3V6ZB 1UZGA 2EDDA 1BQKA 4IYKA 4DNLA 4TSAL 3GDBA 1J5DA 2YD1A 3GUFA 1P9MA 1YDPA 3I9IA 3ZXAC 5J06A 1UTDA 3LYRA 1J7VR 5C0JB 2FWOA 1YNTA 4X6DB 5ANHA 4CSSA 3D85B 3OZ9H 3M8OH 2QR0A 4GG8A 1U91B 4OZHE 4YFLI 1EX0A 3BVNA 3IGUA 3Q7JA 2NY3B 4FZEL 1JF1B 1QI5A 3FT2B 3QPXH 4JM2D 4R9HA 4DGUA 1EHLH 2H1PH 4MSWB 4NNYA 3EGSA 5H35A 3JYCA 4GKZB 2HPOA 2OMVB 2JJVA 1FG2B 3SGDI 2ZUSA 4A7GA 3IVKB 1A3LL 1G0YR 1O7DC 1OAQH 4OFDA 3GBNL 3MRMB 4KJYA 3RZCD 2XJKA 3LH2H 3EADA 1KTDB 1EERB 1CZ8H 2NX5D 4PJ8B 4BKLA 2AQSA 1BBJA 4RFOL 5JQ6H 2ZXWB 3EO0B 5JHLA 1K4DA 5I74C 3VFTB 4IOSD 4KKZA 3SJVD 3KYNB 2IFFH 4Y8DC 2IWKA 1V10A 3F6LA 1HCFX 1P0SE 3NN8A 4ZMQA 4LOFA 3JZYA 3SGEI 1JF6A 2E6QA 4YSSA 2L7QA 5C08E 2FT6A 3B2PA 2KZWA 3D39B 4WK2B 3HUJB 1TJIH 1DQJA 3L7EB 4KK5C 4KWUA 4MJ5A 5DFAA 4TF4A 4Y19D 2CNYA 2Y5TA 1VEOA 3W38A 5D5ME 4AEIL 1SEQL 1I9IL 5HHVH 4JQIL 4PREB 3UYRH 1G7PB 5IM7B 3HZVB 4QKXB 2HT4D 3CDCA 3FQRA 4WO0A 5GGVY 5I5JA 1OGAA 4XCCH 4EOWL 1VDGA 5EB9A 4LVNC 1RIHL 2JJUA 3L3JA 5IMKA 3TBWA 3VFWA 3CSFA 5DUBA 2OK0H 3NSYA 1INQB 1YMMA 4TULH 3QRGH 3VE0A 4AWJC 2F54E 1CFTA 4UTAL 5J6GA 2F53D 4R97B 3CVIH 5J1AA 3O45A 3WEXA 3S4SB 2JVUA 2XIDA 3DK0A 2Y22A 2HFEA 15C8L 1DQMH 1A0QH 3QFJE 3QUZA 4N2LA 1U8NA 4MNGB 4HJEA 3PFUA 4YO0B 3TU6A 1VCAA 2EVGA 1NFDB 2QL1A 4OGAC 5EU4B 3HI6H 1FFTB 1P5VB 1RZ7H 1YN7B 2CK0L 1I8IB 2Z93A 2G0KA 3BZDA 2J4WH 3IJEB 4NO2A 5D1XC 4JFPB 2Y69B 1HZHH 3DI3B 4P57A 1BZ8A 3R06A 4X9HA 3QDJE 3MRQA 5AWNH 3LRGA 1YVLA 4OCXH 2VE6B 4TQPA 5HI4D 1UQSA 3CHQA 3LIZA 4HIHB 4QRUB 3SPVA 1OSPL 3ARFA 2P24A 3IDJA 3PHOB 4JFZL 3NA9L 3JWNC 3NESA 4LF3A 2DIEA 4WI0B 4PYGA 4ETQA 3MNVB 3BQUC 3I3BA 3RP1A 4PP1C 1DSYA 5ECGA 5FIEA 3CFJB 1U4FA 1JXJA 3G08B 1XGYL 1L7IL 1GL4B 2YUWA 5E4IA 4MD0B 3NEEA 4ELKA 1TZIB 3QDJD 2ZCKL 2D03H 2NYYC 3NJVA 4HJGA 3VGGA 2MQCA 5F9JA 2VDMH 3O11B 4FQHB 3GRWH 1I9JL 4I1NB 5I1KH 5MEOB 1JNJA 3P11L 4Z23A 1E27B 2XFXB 3CLEL 4Z7UA 4UUJB 3KPOB 1AJ7L 1OE1A 1T4WA 1GIGL 4BFBD 1KBPA 4OF0A 4G9FE 3PHQA 1AO7A 1S9XB 3QQ4B 1SN0A 5D2LE 3S2AA 3U1SH 1Z5LB 1SVBA 2AXJA 4UB0L 1NSNL 3BPOB 4IRJB 1D6VL 3L5XH 1QBBA 3RVTD 5CGBA 2CJ3A 2DIJA 4X6DA 2ZCHH 1GY2A 2GAZA 4ZUTB 4RGOH 3RVWC 5FPIA 2DQGL 1P4IL 2C4XA 3GGWB 3MRCA 3Q05A 3C5ZA 1HX0A 5KVGL 3FQTA 3MKKA 2BNRE 1PY4A 1GYAA 4Q8BA 3FQ1A 4YR6A 3SO3B 5EF1A 2DEWX 1E5UI 1XT5A 1B0RA 4G6ML 1X5XA 5EFIA 5E6UB 3VWJB 2Z4QA 1YEFL 2PLTA 4R5TA 3O4LB 3I85A 3EUUA 4M7KH 2A83B 4OF7A 2GEQA 4PS4L 4IOFC 5F3BB 2NYZA 1XF4B 3TONA 2DM2A 1DYZA 5DVLA 2LFEA 2FHBA 4A2GA 4QT5A 5HDBF 1AQDA 2VLKB 1KV7A 1J0YA 3DNKA 3F2LA 3UMNA 1PZUB 1J8HB 2HFTA 2XZQL 1NPNA 2D3JA 3A22A 3HJ0A 5I5RA 1DVFC 1OV8A 4I9WE 3MRKB 3TH2T 2YSSB 1NA8A 3OJMB 1BF5A 4IRSD 5E9AA 1FVCA 1ZVYA 4J5VA 1NCOA 4FQQB 4EKXA 4TTDC 4EI5C 1K5WA 4WFFE 4UQ3A 4A2HA 4HJ0C 3MVSA 1AG6A 2QV2A 2FWUA 3PP3H 4IOIB 2VW6A 3IS1X 2D4DA 4JM2C 2UXFA 4M9OA 2XPGA 1QSFE 4OVVA 5C0CA 4WO4D 2G0LA 3SY0B 5HBBA 4R90L 1HHGA 4NQDB 1XX9C 1QFUH 3MODL 4M4RB 1C5DB 2MCAA 2QSQA 3HFML 4D2NA 4HUVA 1CGUA 1ZLSL 2R4RL 1N3NA 1QFOA 2X3AA 4GAYB 5KYYA 3IBOA 2ZX7A 4WU5A 1XCTB 25C8H 2B1HL 4QIRA 2YGNA 4NM8L 4U6YA 2IH3A 4FD0A 1GJIA 1DBMH 2FEJA 4YL4A 2A6DB 1KWKA 4GP8B 3US0A 3IVKA 4ZO6A 3CZFB 2NTFB 3LN5B 2BMKA 3UO1H 3ATAA 5KZCB 2F7OA 5AW6B 4N22A 4NGHL 1XZ0A 3DDGA 1UD6A 3OKLA 1AE6L 2R51A 4LCWD 5E94B 43CAB 5EC1A 1EVUA 4E9XA 3WKQA 1OW0C 4XMWA 2QMJA 1V55B 2AJYH 1T5WA 5E2JA 5EZOH 5I26A 4YDIH 5E6SB 3F6JA 1A6AA 1KBVA 4PVMA 7CGTA 5AEAA 4E9QA 1M3JA 1XD0A 2QSCL 4HA1A 2PCFA 3F01A 4NP4H 2WKOF 1TVBA 3MRBB 3WOVA 1I4FB 2ZE0A 4KZEL 1CD9B 2XWJB 4U1SA 1XH3A 5A2BA 4TNVF 4DN3L 2HTLD 4WI8A 1JGVH 2XWRA 2JELH 1P1VA 1FG2A 3MNMA 4J6IA 2BVYA 4HMDA 1WIPA 1DQDL 1ZIAA 2YD3A 3CPUA 4Q9QL 3UROR 1AZVA 4GRLC 4LVEA 5E2TH 4BKLB 1JF5A 1H3TA 1PG7L 1JPFB 2CJSA 3DX6B 4WENB 2GT9B 5ACLA 3ISYA 5F7EL 4NQXA 4ZOCA 2PN5A 3R18A 1CO1A 2MCPH 1IGTA 3J8F7 4XXWA 2FO4B 2A4ZA 4IK6A 5GHWH 1KGIA 3KYOB 1BFTA 4P2OA 3KPRA 2J6EA 5AUMB 5T1LA 1OM3L 4KV5E 3IFLL 5LWYH 5FHAH 3F7KA 4GUOA 4XCEB 2L7UA 3HAEH 1FVDB 3RAJH 1EO8L 1ICTA 3KLSA 5I8KL 5LVEA 2X70B 4PJAA 2KZBA 5F7WC 2ZWNA 2G60H 3SJVB 4B9FA 3KYMA 4Q6IC 3LHPH 3SCMA 1ZTXE 1L9RA 1AS7A 4OIFA 5CIPH 4WSGA 4WFFD 5SWQB 1BD2B 3BPCB 1P5UA 4KRLB 2W65B 3QDGB 2R23B 3S9DB 2YPKA 3MLSH 1XXDC 2HLFC 1PX3A 3QZLA 2KUTA 4FFZL 1BX2B 4N24A 5FKPA 5L6YH 2VLJA 5IESL 4PW9A 1UWEH 3PV6B 2YZ1A 3VXPB 1A25A 1YHPA 3MHZA 2OSWA 3UPRB 3QJTB 3D0VB 1BYNA 3C60C 1YG9A 2WBXA 4KBPA 3UTTB 3TX4A 3VG9C 4YL9A 4KZDH 5KSAB 5IFJA 4I4WB 1MUJB 4YDKH 1BF2A 4YBHA 2NOYA 1TTUA 2F54D 1R3HA 1OB1A 5DK0A 4U4IA 4AC2A 4QRAA 4FYTA 3MX0A 4ELME 4QY8B 1WFUA 2V5SA 4LCUA 1DDHB 4AM0Q 1UURA 2H6OA 1HXYB 3AUVA 4AYFA 4DZBA 2A99A 1G7LB 5DJYA 3TO4B 2F74B 4WU5B 4UBDC 4IHOB 2X4UA 4E5XG 1MHHA 4FLOA 1N6VA 4WJ5B 1KULA 4QKTA 4GINA 1NINA 2XN9B 5I1DB 5C0FA 3COOA 3JWOL 1U8JB 3N41F 3OC5A 5LGJB 3RWDA 3K2IA 3VH8A 1UXSA 4EUPG 1YY9C 3ZDYF 3IDGB 4HEPA 4DAGL 4E9RA 4G6AD 4EI6B 3CVBA 5ISZD 1V5JA 1FIGL 2Q2LA 1MRCL 5GGSA 4PB0H 4WUUD 3UTPE 3F7VA 3BXNA 5E00B 2K4WA 3H2QA 5KUMA 4LLWB 5CLTA 1IGCH 4O2FA 3MCG1 4K2UL 4HIJA 4EIZC 3ULUL 1UJ3A 3HB3D 2IQ9L 4PFEA 3IT8D 3JZ7A 4HGKC 1MFNA 3MRPB 2EH7L 3MV9E 4LNVA 1L5GB 1E8XA 4DGVL 1KSRA 3NFNA 4CMHC 5EIQA 4ONHB 4YQXH 1NMCB 3BQVA 4KKBD 3MLZH 1OALA 4ZX3A 1ZANH 2HUHA 3NZUA 1ZSDA 1MCHA 2D2CC 4YLQT 2EINB 3Q5OA 3TNNA 3VTAA 1XAKA 4GFXA 5HGAB 3LD8C 4M93C 5C86A 4GT0A 4PLNC 3MBED 1BOGA 1S7SA 2A9CA 3CMOL 4KKPA 2Z31A 3MAWA 1HDMA 1T5XB 2CKNA 4KJQD 2UXGA 3AXIA 5KN5A 1L9OA 1OE3A 2QHLA 2R4SH 5DQJA 5AYUL 2Y7OA 4XXCA 1G5AA 5KYYB 3FT1A 4D9LH 1MFDH 3CFCH 4YAQB 3A0OA 2HRGA 4JKNA 1NL0L 3MLYL 2AK4A 5EEZA 2R9HD 2X09A 1NFIB 1XR8A 3CU1A 4U1NB 2BHUA 1KLUA 2CO7B 3AG2B 3FFDA 5EUOF 4ATWA 2FSEB 5GS0H 1EGJA 3SDCC 3OAZH 1QHOA 1YSOA 1OSEA 1CT8A 5J11C 5JIMA 1Y18B 4TUUA 2GSGB 3BKJH 3GINA 4UUJA 1MW1A 1RJYA 3NK3A 4TQEH 4D8PB 2E6PA 3H9HB 2R0KH 5EH1A 4K23H 4Y1SA 1MW2A 1ROCA 5ECJE 3RPKA 1LWHA 2LOEA 5I9QB 5J13C 3CN0A 3GLAA 4O2CB 4WTZG 3P77A 1T20B 1WIUA 2EDWA 3FB6A 3VUAA 5D70H 1S8DA 1UACL 5I0WA 3BAJA 1NLDH 3FUJA 3TC9A 1HL5A 4JG1H 3OAUH 1KF9B 2ZNWA 4PRID 4NCDA 1SJEB 4N0UB 1AD9B 4NYLB 2P7TB 1R4XA 4LDOB 3HRZA 2XBDA 2DWEA 2E46A 2Y24A 2YLHA 2JLPA 5CN2A 3BP6B 3FW6A 3IMUA 2C9VA 4O9HH 1URLA 5SV3A 1W9XA 4Y4HB 1B6DA 2PYEB 1SXZA 1OP5K 3IYLW 3II3A 4Q14A 1IC4L 1XF1A 1KJ2H 3U1QA 2ZXGA 3WIHA 5J9PB 1BFOA 1S7XA 2IANA 2X4OA 5IB3A 2A9AA 5CGYC 5KJRL 1O5PA 4HGMA 3CZEA 4UINL 4I13B 5IBUB 5C3LD 1OK8A 1UUSA 2XTJE 3U1PA 3FH7A 3PIQB 2DD8H 4MNQE 5CU5A 4NIKB 3T65A 1ZV9A 3SBPA 2Q8AH 3GSOB 4NRXA 4Y0GA 2P5EE 1U30A 3QIWB 5J1TC 3GLDA 1PY0A 5I1GH 5K39A 1MCLA 4DF9A 4GXVH 4QWWC 3HJEA 3AFLA 2DN7A 3CZGA 1A4AA 2N7AA 4WUKL 4R8WL 1Q1JL 3RTLA 4ZZKA 3H9SB 2AQQA 4G72B 4Z3IA 3P2DA 1KTKE 3A4EA 3FFCB 1IGTB 4JFFE 1N3NB 1MY7A 3LKSB 3RLSA 3QUKB 4Y9FA 1TEGA 2I69A 3ARPA 4FQLH 3MJ9A 1JZ4A 1OP3H 4GKLA 2V4LA 2VDKH 3DBXB 3QDMB 5HGHA 5HYQA 4XPHH 1KIRB 1D6EB 3W2DL 2BSTB 3BT0A 2VXVL 3ME0B 2CK0H 3VGFA 3CLFH 5IQNA 1KPVB 3ULSA 1SYVB 3B7UX 43CAA 1OXYA 3IWVA 1KBBA 2PWHA 3VYPA 4CAGA 3O2WH 2UY7A 4LLMA 1BM3H 2BH0A 3MV9B 3LS5L 4BM7A 3M1OA 5DFVD 3FU6A 3WE6B 4JRYE 2BS71 4OZFH 4C4KO 4LOUD 4DQAA 5I23A 1SJHA 5DJ2B 2F74A 4NJ9L 4QRPA 4ZSOE 1NLBL 4YBLC 3RVUD 4JFXB 3KPNB 1T21B 2CM5A 2I25N 4AIZB 1RMFL 1T22B 3HC3L 1H9DA 2K3HA 4S10A 1SGKA 3ULVH 1HEZA 2ARJA 4AX3A 2ZJSL 1LQBC 3N5AA 2G9HA 3QISA 1HNYA 1L3WA 1MUJA 1ADQL 1TO5A 4PJ9C 4Z7OE 3C6LA 2AP2A 2NY5L 2YD8A 3GSUB 2NW2B 4G7SB 4HLZH 3BEWA 4QXVA 4Z7IA 3WUWG 3TN0A 1XF5B 4FZ8L 3APDA 4P4KA 3D07A 1CR9L 2BS9A 1T20A 3T6QC 1BXUA 4G5ZH 5EU6B 4HJ0D 3VXQB 3TURA 5ALCL 1X7QB 1BA9A 4PRBB 7FABL 1AGDB 2YPLA 3EF7A 3Q1SL 3N43B 3BUPA 5L8KB 4UB0H 4EZJA 1ILUA 2IADA 2W1NA 2DYPD 3NUKA 4Z5RA 3HHSA 3U9WA 5CD3A 4IM8A 5ITFA 5D93B 5EZPA 4DEPC 1YPZE 4IRZL 3UZVA 1A9EB 4LHUA 4KXDA 5IKCB 4P5TC 3MREB 1OP5H 5C0RH 2BP5M 3UP1A 1SBSH 1AOZA 1XF3B 1SF5A 5D72L 3CDZA 3VSUA 3RKDC 1B0GB 5IMOA 1ZDSA 2ESVA 4XP1H 4L18A 3FHEA 3RWJA 4I7ZC 5BZDB 1NC4D 4ELMB 3PNRB 1EQWA 1TJGL 3ZKSD 1JHTA 5BS0E 5ICZB 4EAEA 2J6WA 1A9BB 4X6DE 1GZQB 4K71C 3V8OA 4APXB 2H7WA 4CBPA 5B3JE 1CTNA 2XX0A 4PS4H 3ZT5A 2R1WA 1GGIL 2C9QA 2BNRD 3GHBH 3UTZB 3S35X 2AJVL 4FG4A 5I18H 4I88A 2XZAL 3OZ9L 5E2VH 2N7SA 2DL9A 4LXFA 4GBXA 1I7UB 4GO9A 4KI1A 3OKOB 1OGAB 3AQYA 3LNIA 4ODUA 4O51A 4ZMXA 1YNLH 2HA1A 3NFSL 4EIGB 5JXEC 1ZKAA 2X6CA 3LZQA 3DJSA 8PAZA 4OD2A 5FW8A 1LEIA 1JVKA 5J1AB 2W9DL 4WWKD 4PGBB 2H3NB 1Z2KA 3NVQA 1FC2D 1X9UA 3WKPA 4N2NA 1T80A 4GG8B 1E8WA 2WWKT 2IFFL 3PXHA 4A39A 4O02H 3P3UA 4E2OA 3O6FC 1NMAL 5CINL 4F8NA 2BNUA 2Z91B 3PABB 1LD9A 3ENEA 1Z0NA 2Z7ZA 1J5OL 1TTFA 3ESMA 5TQ2H 3N9GH 2R29L 3BFQG 4BRVA 1S7UB 5T33L 3HKFA 4XNYH 1SYVA 1I9IH 4QUOA 3X3GL 4L8DA 3GYRA 4UOQA 1H3WM 1CD1B 3DRQB 3SPVB 4U3CA 5ICYB 4YDLB 1YDPB 2CHXA 4HAGA 2NCMA 1AD0B 1XEDA 1A4KB 1JI1A 1NGZA 2IPUK 4LLMB 5J56B 2Y9RT 3HI1B 5D55A 3KVDD 1U91A 4BBWA 3QUML 4MBOA 4ZODA 3QIUB 5TPWH 3CXHK 4N8VA 4MMYB 3G08A 4BFNA 2Q87A 4MSWA 3NRFA 1D5BB 4M6MH 4NNYB 5H35B 2Y72A 4ZYKB 5EZOL 2DLTA 5DD5L 3RTQD 1CDBA 3EJQA 2ZUQB 4NZRH 4TRPH 3EJJX 1KTDA 2ATKB 1O9VA 4PUBH 4UM9A 3GIVB 1F6AB 2LFGA 3UMTA 3VB8A 3CHXA 2E9JA 4RFNB 3PRZA 1IBHA 2R29A 2JKLA 4PCKA 2Y2YA 4BFIA 1ETJA 3AXHA 1QD0A 4PRHB 3IRCA 3UTSB 3LKPB 3D39A 4F33A 5I1CL 4JHZA 4JFDB 3QPKA 3CFKB 1X4YA 2AQNA 1GC1H 1QPKA 3OAYH 2R27A 2EC9T 1XEUA 3F7YB 3F12B 2IH1A 1G7QA 2NXZC 3QG7L 4JFOB 5BUAA 2A9NH 4ZPTA 2ZF8A 2P5PA 2X38A 3VFVA 2J3SA 4NKMA 3HE7A 5IVNA 2Q76A 1DQLH 4HHGA 4YIQA 1XGRA 4Y2DC 1D5XB 2UZIH 3SYOA 4RQQB 4B3VA 3AY4C 4JPIA 4EDXB 4GJTB 1H8NA 3ARZA 1YQ2A 3VFSA 3RFZA 3KPSB 1R3LB 2X3BA 1XF3A 2CGRH 1MWAB 4XNXH 1IQWH 3ETBJ 4XO3A 1I7TA 1N64L 2EEXA 4DKEH 4H1LA 5IW3A 3UIYA 1JGDB 4JQIA 3AS2A 1H3GA 4Z7OB 3DUUB 5DZOA 1NUGA 4ZMWA 1WHOA 4FFWC 4BSWB 2DKMA 1K5NA 3PWJB 2WQAA 3DVFA 1AGBA 5HYQB 2E9WA 4CNIA 3QT2A 1W80A 1JFHA 1UB5A 4N1EA 1UGNA 4XWGH 3ME0A 3SD2A 2EE0A 2NXYC 4ICWA 2EQDA 3KYNA 5DGRA 3BAYA 3LN9A 2GIYA 2Y07H 3VH8G 4E41D 3UYPB 2PYEA 4HIXL 3GKWH 4DESA 2F5AL 3KCWA 1KIQA 3FU8A 2E59A 2NNRA 2Y6TE 4K7PH 4LEOA 4D0BA 3K3QA 5DHVH 4G1MB 2VZVA 1XV8A 2CSPA 5T5NF 2QQQA 1W6LA 4LSVH 4NQVA 3QDMD 4NN5B 3J27A 3QWOB 4FKEA 2DMHA 1PCSA 1T22A 2LU3A 1EJFA 1GHFH 2EDLA 3DETC 5SWZE 4DOHB 3FB8A 4XTRD 4ZZFA 4G8GD 3M86A 2H6PA 2LU5A 1JZFA 3EF4A 2CJUL 5DC0A 2H26A 4QXTA 2QSTA 2VTFA 5J6HB 4OU3A 1RI8A 5EIVA 2Z8SA 3NSXA 3EYUL 3P9MA 5B1JC 4JR9L 4PWJA 3EUDA 3ISRA 3BLKA 3SGDH 3ECBB 4K7PY 3GJFB 1R75A 4F7EA 4R7XA 2LAAA 4U3SB 4U49A 4WIQA 2QGDA 2ICWJ 4QWWD 2JI1A 2L7JA 4J3OC 2CLVA 1G7JA 3I2CH 4OCWH 4UU9A 4EN3C 3OKKA 3QJZA 3TBSA 2Y7SA 3B83A 1XH3B 2VQ4A 3HRZC 4KVNH 5E8NA 5EZLA 4A6YA 4XNUL 4KJPD 2YRPA 5CN1A 4NQCA 2E4TA 3DX0A 3V6FB 4XBGA 1ET8A 4GW1B 1E6OH 4XPBL 5KW9H 2ZX5A 5E8EA 2YMXH 5DI8B 4I2XA 4JRXE 3STLA 3TV3L 4W4OC 4Y4FA 3QUGA 2J5WA 5DJ8A 2NUPB 2IBZX 4RDQG 1E42A 4AI7A 5BUPA 4HHWA 3B6SA 3GJEA 4U6XA 3OHXA 1RSYA 3TYGL 1R5IA 4YK4B 1AE6H 2O6EA 4M48H 3W57A 4LLVA 5KVFL 5BW7C 4PS3A 1X7TA 3AG4B 1IC0A 3VXRE 3T6ZA 3BSZH 1N0LB 3B9KA 1ETZB 4J3VA 4KROD 5FO8A 5IREA 2JB5H 1U58A 1ZS2A 3QDJB 2BP0B 4NHCH 4X6CF 1RHFA 3KJ4B 1FE8H 1WS7A 2AMUA 3QA3A 2AEPH 3OR7B 4ZNEE 5I30L 1G6VK 1QBMH 1KJ3L 1MFDL 1RZKL 3CFCL 3EO1B 5B1CA 1NL0H 3MLYH 4I9XA 4DKFL 4Z6AT 4OFQA 3ARGC 2NUTA 1CS6A 3BUBA 1SYSB 3PWLB 1UCTA 1M05B 4ODXB 3UG4A 5AQ0A 4WGWB 3FQXB 3O41A 1Z1WA 3EFOB 3DUUA 12E8L 5D7SH 1YJDC 4P48A 4E36A 4FXTA 3QWRA 5B38A 2X4RB 1XMEB 3D5OF 5LG1A 1UA6L 4ZX4A 1OGAD 1MOEA 3MSPA 4UI2A 1G1OA 4A7VA 5BQ7A 1JYWA 2UVFA 1F3RB 2ZOOA 5AVQB 1A7NH 1KCVH 4NWTL 1NCDL 3A5VA 2D7TL 5KVFE 1T3FB 4N85A 4RZCB 3QXWA 1J1OH 1YJDH 3QQ9C 2MCG1 5F8RC 4Y16D 4RMQA 1DFBL 1EAJA 1MCNA 3GS4A 4UM9D 1SEBA 5AB0A 2WXFA 1A14L 2DJUA 4DO4A 1NUDA 3V4UL 4JFDA 3IXTA 5HYFA 2X4TB 1BMGA 1K8IB 2BIOA 3MJGX 4HEPG 3LTVA 4FQCH 1AR1C 4L4VA 4YHYB 1HAUA 1THAA 3LRMA 5I1HH 1WA2X 2WANA 4CU6A 4HOZA 1LMKA 3GHEH 4FQIL 3LRHA 4NO3A 2KQMA 3X14A 2OR7A 4ONFH 4AQ8A 4BGDA 3WEOA 3GMRA 1OAYH 3VFOA 1S3KL 3NABH 5IHUH 3TIEB 3VMNA 5ES4B 3G6AA 3T1WA 5EZIL 4N2EA 4RGNE 4KKRA 3VTMA 5H94B 1JPFA 2F53B 1RKRA 2XTJC 3NJXA 4DKDC 2ADYA 3CHRA 3D08A 5GGSY 3KPSA 4G6KL 1T0OA 3G5YB 3S3JA 4KK5D 4WO4B 1UYWH 5L88L 2UZXA 5B1BB 5T5FH 4QYAA 1WA0X 4CW1B 1XIWD 2CDFA 4GXVL 1LILA 1F4YH 1JGUH 4PJ9D 3WEMA 4JFVA 4O2EB 4QRFA 2JNZA 1Y1DA 4XCEA 1CXFA 2ZXEB 3FB7A 4R2GC 3CZFA 1FL3A 3M1BA 1OCRB 3QCUH 4XX5A 4NUJA 1CURA 1QAWA 1NPUA 4JKLA 2ED7A 3KYMB 3QR2A 4OI8A 4LP8A 3WNIA 5IHHA 4DN4H 4FQLL 4QXUL 3STLB 2JQAA 5DJ6A 1AD0A 3A4DA 1QLRB 1J48A 2ZXCA 3H9YA 3L9EA 4MDIB 4TQHA 4PV8A 1JGDA 3SOTA 4K3EH 5EZJB 4JDVA 3IFOA 1BX2A 3NIGE 5FKPB 3ZKMD 2XWJA 1VHPA 5D7KD 1JPTL 2BNRA 4MAUL 1GKEA 3PWJA 4M8RA 4NQVB 1M57B 3GSWB 4AL8L 5SWSD 1K2DA 4OJAA 1RZFH 4AQEA 2YWYA 2AK1L 4YXHH 1MCCA 3D33A 3DYMA 1INEL 3D06A 4N8CH 4PWEA 2HPTA 3VXSA 1FNSL 5TE7L 4OD3L 5F7YC 1X6LA 2HLFD 3QA3B 4G6JH 5FV2A 5JW4Q 2PCPB 4R7NA 3HBPA 5EF2A 1WTLA 1Q9KA 1EJ6A 2OXGB 5HVGB 1IVTA 5TFSH 4PI2A 2P1YA 3G5VB 4B41A 5C08D 1EK3A 4AEIH 2YK1L 3FO2A 1UC6A 1VZGA 1P69B 1MFAL 3ARGA 3KYOA 3DHPA 2AS5M 3VAEA 1UOWA 2QJDA 1MCBA 1RH8A 2IH1B 2K0RA 2CLRA 1VEMA 4F2MA 3KBFA 1F3JA 2F2HA 2XXFA 5SX4H 3F3HA 5FYLE 2Q76B 4UV7L 4XN8A 3VXMB 2IDFA 3KE0A 4XN9A 4U31A 4WHCA 3U0PB 5L8LB 1MCQA 4BWUA 2JKSA 2ZKXA 2WB1A 2VL5A 1C7SA 5K9JH 5I1IL 5HDBB 2B20A 5HGDA 5ACMA 2XWZA 2PTVA 2XZCH 2FRGP 1RZ7L 1XL6A 3IB4A 4ES8A 1HKLL 1X5HA 1H0DB 4LU5H 3UBXI 2OR9H 2XV3A 4YHIA 4JHBA 2NNXA 2APXA 4LLVB 4M62H 4N28A 4M7ZB 4BA0A 3PUUA 4X8JB 2ZG3A 5JIQA 3E8UH 4ZS6D 2EVHA 4YSDA 2Y5EA 2HJFB 4P5TA 4J3WA 3LSOA 4G70B 1ETZA 3LIUA 4UTAA 4AH2B 3D3VE 3MBEA 2HT2C 3EYSL 5GZOC 1UACH 2HH0L 2CPCA 4P2QB 1TG8A 2V6HA 1P53A 3D52A 4OLVL 4QOKE 3TLRA 5JLZA 4HSQA 1B6UA 2KH2B 4UQ9A 1E5CA 4HD9A 1SQMA 4QAMB 1I8LC 1S7VB 2GBAA 5I76A 1J8HE 4D94A 4IGBD 1JAEA 1KELL 1QASA 3GPSA 1KIQB 4GQRA 4Q2ZB 2UZPA 4PY8I 1O0VA 5JYMA 4D3CL 3D25B 1ZVSA 4KRPB 1NBCA 2W0KA 2VWEC 1IIIA 4ORGB 3WELA 1QPXA 4L4TA 2J8HA 3RUGE 5BO0D 4QHKI 3CTTA 1YY8B 1U8MB 1R19A 1DBJL 5I1KL 3JVGC 5I5MA 5C9KA 3RWFA 1KLGA 3BVWA 3CLEH 2W9DH 2ERJB 4R7VA 5EULV 5H37G 2AQPA 2FT7A 1FGVH 5B3NA 2ADGA 3LOWA 5C0DB 5I28A 3HG1B 4A2EA 3L5JA 1RZIB 3NZHL 2R0WH 5JR1L 2H0PA 2XN0A 1NSNH 2RB8A 2BPBA 3O9WA 3P0VH 3TGXA 4YE0A 4JKPL 2DI7A 2A38A 4KY2A 3TBBA 1R5WB 2CHZA 5FF6B 4DTGL 5DO2C 1MI5A 1IM9B 2V7HA 2ADIB 2XX1A 5CJ8A 5AYQA 4GRMA 2WO4A 3SDDA 4CVWA 4AQZA 1QI3A 4JFHE 1MCPH 3CX5J 4LMQI 4KKAC 5D2LB 1M71A 1RSFA 4PRIA 3CDFA 5HI4C 2UWEB 4JAMB 3X3GH 5I5IA 3QRFM 2ENPA 5E8DL 1WT5A 2GY5A 4GW5B 4MJIA 2EH8H 3N1GC 4XH2A 3D2TA 4A66A 4H0GA 3S5LA 4M7KL 1L3NA 1QRNA 5E99L 1E2WA 4JFYA 3MJ9L 5D7IB 2WO2B 4W9ZA 4TLTA 2PKDA 4YGVA 1SUJA 5FO9B 3LMJH 3M7FB 3VFTA 5DEFA 3MRJB 3TA3B 1TTBA 4OZGB 3PGFH 3GMOB 2OMWA 2YAQA 1VLXA 4XHJC 2VMJA 2GC7C 1A1NB 3OX8B 4KXBA 3RWHA 2NSQA 2UUDK 4HIIB 1EAPA 3CZLA 4JE4B 4MCYB 3TF7C 5GRJL 3FTGB 3UJTH 5CSGA 1WFOA 1X5MA 4OIIL 1WV7T 1JCVA 2X4OB 1I8LA 1ECZA 1NUNB 2WZPD 4PJXA 3NJHA 1PSKH 1I8IA 3CUPB 4ANVA 2VDRL 3FRPB 2HMID 3H0TB 2FQFA 4ALAC 4Y89A 5E2WL 3T65B 5LLIC 3Q6FA 1OTSC 1O6TA 1OGTB 2LAGB 3OXSA 2CRMA 5EA0L 3LKRA 5JIKA 2RMNA 4FADA 3Q5YA 4POYA 2BOBB 2GB2A 3NIDB 5B39G 4L8CB 4XTRC 2LLNA 5ITFB 4EXKA 1BVOA 2AFNA 1J87A 3WIIL 2YGVA 3F58L 1JZDC 2VAAA 4BEIA 2QKIB 2X4PA 2GK0B 2IAMC 4MMXC 3DXAE 4R6UA 5F0JB 1YNTB 5HHVL 6PCYA 5CCKL 5BZDA 2CHNA 2JIXA 1J1XH 3M07A 4KFMA 5F96L 4IJ3C 4PG9A 1PF3A 4KY1H 2WLYA 1AFVH 2A9ML 1RIHH 4O2EA 4V1DE 3MOAL 4HZAA 1KYUA 3MLUH 4ZXBB 4TSCH 4ELKB 3WIFA 4C8XA 1YYCA 2CIIA 3TT1L 1BAGA 2BDNH 4NDMA 1N64H 4TVUA 2PUQT 1JDCA 2PO6C 1ZGLA 3WHXB 5I71C 2VJ0A 2A1WH 1YYLL 4JRLA 2FGWH 4ZDHA 3IMWA 3DGDA 3T6VA 1P4LA 4GY4A 2FQGA 1A1OA 2DQ6A 3PHQB 2X44D 2WKOA 3QQ4A 4JRYD 3WXVL 1OY3B 1TJMA 4NN6C 2B16A 4MJ2A 4OM1L 1PYWA 3TN0B 1BAWA 2PYED 2R2BB 5AWNL 5AOLA 9CGTA 1J05B 2MTPA 3IK2A 5DTFA 4Z1PA 3QI9A 2RGSA 3Q1EA 3PJLA 2QVFB 3BFWA 5IMMA 5DVPA 4QNPE 1CE6B 2UXVA 3ARBD 4MAYC 5KVEH 2CH8A 4JO5A 4EBQL 4P5KA 3NEXA 5GGTH 3VRLF 2CHDA 4P23D 5JPNB 1F3DH 1OPGH 2NZ1A 2WCGA 3MRFB 4AK2A 2WHVA 4XB7A 4JKMA 5KVDL 1RZIA 5DLLA 3K72B 5DD1H 1KTBA 1S7UA 5KSVB 4EF3A 1V27A 1SOSA 2BCMA 1CXHA 3KEHA 1MPAL 3S6CA 4FOMA 3CXDL 1WEJL 1N12A 4JO4L 4WTXA 4Y5VB 2FAUA 3ZDZB 4HCFA 4QMEA 1RULH 4X7TA 1JV5B 1LQSR 3KXFB 4PJ5A 2D7QA 5GGRA 3SE8L 3P11H 3ESNA 5DDHA 5BS0A 1J0IA 4XODA 4APQA 1C5CH 4HUCA 4PTTB 5ADPH 3ML9A 1ITBB 1RZQA 1OOWA 2D3LA 1XSKA 3U1SL 2VC2B 3ZYOA 1KYAA 2I32A 4PJ7B 1IT9L 1KPUB 1W72B 2VE6A 3FOMA 2NQDA 3DYOA 4DERA 1UH4A 1G7HA 4O51B 3FTVA 1KEGL 2P5WD 3TA3A 5DJAB 4DP2X 2DQGH 1P4IH 1SPDA 4PIRF 2XRAH 3QEQA 5C08B 3VXTA 5BS0D 1YEEH 3RA7L 1CDUA 3H7LA 4B5EA 1CGYA 3BOVA 4I3RL 4HWEL 2YXFA 3JTTB 5T33H 1HAWA 1HFUA 2BXZA 2O5XH 3O4OC 5ICXA 3LKQB 5F89A 5DJCB 2R2HA 1MFCL 4QRBA 1YEFH 2CZNA 2OCCB 4MD0A 1A7PH