1OALA

Active site copper and zinc ions modulate the quaternary structure of prokaryotic cu,zn superoxide dismutase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
151
Chain Sequence
QDLTVKMTDLQTGKPVGTIELSQNKYGVVFIPELADLTPGEHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active-Site Copper and Zinc Ions Modulate the Quaternary Structure of Prokaryotic Cu,Zn Superoxide Dismutase
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE
total genus 38
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1oalA00
3H2QA 1IBBA 2R27A 1CBJA 2Z7YA 1XTMA 3GQFA 1YAIA 3K91A 2WWOA 2WKOF 1CB4A 2GBTA 5CU9A 2SODB 1SXSA 1YAZA 1SXNA 3L9YA 2AEOA 1IBFA 3KH4A 2APSA 1SXBA 3LTVA 2AQPA 2AF2A 3T5WA 2JLPA 2XJKA 1ESOA 1KMGA 2AQQA 1E9PA 2WYZA 1IBDA 1AZVA 1B4TA 3KM1A 4A7TA 2C9UA 1SXAA 1E9QA 3MNDA 2VR7A 3QQDB 3ECVA 2Z7ZA 1N19A 4BD4A 1JK9B 1E9QB 2NNXA 3H2PA 2V0AA 4A7QA 1DO5A 3GZPA 2E46A 5KBLA 1B4LA 3CQPA 4OJAA 4A7GA 1N18A 1PZSA 4A7GF 1EJ8A 1JCVA 2AQNA 3HW7A 1BA9A 1PU0A 3QQDA 4BCYA 2Z7UA 1OEZW 2ZKYA 1SDYA 1OZTG 4A7VA 1SXZA 1SDAB 3ECUA 4BCZA 1COBA 1F18A 1XSOA 2VR8A 2AQRA 1JK9A 5KBMA 2E47A 1OZUA 3CE1A 3HOGA 1UXMA 2JCWA 5KBKA 4OH2A 4FF9A 1S4IA 3S0PA 2ZOWA 2AQTA 2ZKXA 2ZKWA 1PTZA 1Z9PA 1U3NA 2WZ0A 3GZQA 1UXLA 2GBVA 2WWNA 1E9PB 3L9EA 3RE0A 1FUNA 2WKOA 1F1GA 1DSWA 3GTVA 1BZOA 1SPDA 4L05A 4A7SA 1E9OB 1EQWA 1SRDA 1YSOA 1HL5A 3HFFA 3PU7A 2WYTA 3KBFA 4MCNA 1QUPA 1Q0EA 3ECWA 2GBUA 1RK7A 1IB5A 1TO5A 4A7UA 3GTTA 2LU5A 1F1DA 2WZ5A 3GZOA 4N3UA 1IBHA 2AQSA 1Z9NA 1OAJA 2WZ6A 4N3TA 2XJLA 3KM2A 3MKGA 3SODB 4MCMA 1HL4A 1SXCA 2Q2LA 3CQQA 1MFMA 3F7LA 1OALA 2VR6A 2K4WA 4U4IA 4B3EA 2Z7WA 1L3NA 1XTLA 1E9OA 3KBEA 3KH3A 1TO4A 1F1AA 1P1VA 2C9VA 2C9SA 1SOSA 3F7KA
chains in the Genus database with same CATH superfamily
1ETJA 2WBJC 4HIXL 1AZRA 1XH3A 3TT1H 5KUKA 3HG3A 1E6OH 3HUJA 4Y88A 1GC1H 4L5FH 1J10A 1S7QB 3VWJD 2A6KA 1C5BH 5FUZH 1ZTXE 3FRPA 4ZMWA 4G8FB 2XY1A 2WIIA 3POHA 2YO3A 1MLCA 4ONGH 4AYSA 3I6GB 4M7ZC 4IU3B 1NLDL 5DDHA 2ZUYA 2XN9D 4KK6C 5C7XH 1YJDC 2WYHA 1TFPA 3OAYK 5BVJA 5HHVL 3MCKA 1M71B 4XB3A 2Q7YA 3KS0J 3UBHA 3ZUCA 3OMZA 1KTDB 1OY3B 3U2JA 2XA3A 3KPTA 4IEFA 4O51A 2A9DA 3LMJL 5HGAA 4YQXL 3SDCB 4XTRD 5LJYH 4QHPA 2Y24A 3G5YB 3U0TB 4EI5A 4AK2A 4L4TB 4P4RA 2Y2WA 5KZCB 1KBPA 1WPCA 2ZAGA 3RILA 4NT6A 4GW4A 3ECQA 1WFJA 1UOLA 1UCBL 3OXSB 1AXTL 2Y2TA 4JO3L 3KGSA 2ODIA 1Q9KB 3DJSA 2KLRA 3IN0A 4ZXBD 5FXCH 1KPUB 3E9UA 2EIMB 4UZUA 4CU8A 3BH4A 4GMTH 3GWJA 4GIPD 4IYKA 4G3YL 4BH7A 2FB4L 3MRDB 4YGVB 3T1FB 4NEHB 3DHJA 3S4SG 4XO3A 1IGCL 3ARXA 2WNKA 3L1FA 4QXUH 4W9DC 3DARA 5F70A 3LXBA 5FB8A 1HX0A 4NKIL 5IK3B 4KZDH 1KIRB 5GS0H 4JQIA 1KELL 1LLAA 4R7VA 3IJEA 5DRXB 1EXHA 3U7AA 5EORH 4KTEL 4L3EA 3V0WL 3PCYA 1S7SA 1QRNA 3MV7E 1WLHA 2YGVA 3RL1A 1A7NH 1UXSA 4FI6A 4KDTA 1JIBA 3CSYA 3VRIB 4B9ZA 1DVTA 3WNKA 2GKIA 2VN3A 4J8RB 2E9WA 4UTBL 1IMHC 1J8RA 3JZYA 2XNAB 2R59A 2DYPA 4ZUUA 1QUNB 2PYED 3TBVA 1MG2C 1O7DC 3TONA 4OV6F 1XSIA 3NAAH 4DN3H 2X4QB 1MHPH 3KLDA 3N41B 2W65B 3MJ9H 1YEKH 1HINH 3U1QA 4JFYA 2P8MA 5D7JC 1XL4A 4Q0XH 2D4FA 2IDFA 1PFOA 4G6ML 2AV7B 4JZNA 1OAKH 2YUVA 3LEYL 3CFKA 1BZEA 1NEZG 2PMZA 4IIQB 2ICEC 1M6OB 2F53B 1KG0A 1VZGA 1KB5L 3P4LA 1JXGA 3JWOC 1BD2E 1OAQH 3QA3A 4I4WA 4K71B 1ZVSB 2V7HB 3L2LA 5CN1A 3GSOB 3OL2A 1L5GA 3FAWA 3QUKA 2YMTA 2L7UA 1MW3A 2WBXA 4GBXD 4R7NB 5I1HH 4H8UA 1A7RH 1N12A 5DJAA 4AY0A 4HLZG 2F6AA 5KOVC 2ATPA 3SGKA 3GSXB 4OJCA 5EPMB 1HHJA 2NXZB 4LVNB 1T1YA 2V6HA 4WO4D 2AJXH 4R83A 4G5ZL 1DBMH 4JJHA 2XZAL 5ICUA 1G1CA 3W82A 1D6EA 4OZIB 2XVKA 1GGBH 4OKVA 1Q0XH 3CSTA 4WWOA 1ULVA 2NY6C 2VGLM 1TFHA 4PRDB 5KANI 3RZCA 3G3LA 1F58H 3GLDA 3ESUF 5AG9A 3K6SB 5EEUA 3STZB 5EOTB 1QFOA 5I17A 3O11B 5EU6B 2OJ1A 4X6EB 4BKLA 4XPFH 3CLEH 1Z0NA 1KDIA 4GQ9L 4ATTA 3BRFA 3BISA 3RWGA 5BJTB 3PV7A 3QISA 3VJ6B 3B37A 1YYLH 1MLCB 3RRQA 4L8SC 4GAGL 4UV4H 5J12B 1AQDB 1QFWH 3CQFA 5CKAA 4NO3B 2FD6H 4OLVH 2NSXA 4FQIH 1BXXA 2NR6D 3OGOE 4XGZB 3PNRB 3NQKA 3K0YA 2I9TB 2FX7L 5LXGH 4BGDA 4HK3N 4QHKJ 3T3MF 3VXUB 1E28A 2BOCB 4BE5A 3SPHA 3MCLH 5JLZB 3WFHA 5EF1A 4O2CB 4MB3A 1S7XB 4NLHA 5E8NA 4XP6L 4X0KB 2H1PH 3VI4A 2YPVH 2F18A 4FFZA 4BFJA 3P9MA 4QRPA 1U93A 2Z8RA 1MREH 5ID1B 3HZVA 1I9RL 2ALAA 4GMSH 1KXTB 3WLBA 5B1KA 4W4NA 3MRPA 2NUTB 3AMKA 3PRZA 4J7RA 3H7BB 3P54A 4N5UA 2XZQL 3K0WA 4OZ4B 4JM4H 4OIAA 3WJMA 4P59L 4LU5H 1VGKB 2FJUB 2Y36L 2E9GA 3AS0A 2J6EA 4JFHD 1D3CA 4PP1D 3EYVA 2KZKA 4FLSA 4OCLC 5L88L 4WWNA 3CQQA 1FDLL 5LBSH 1SYSB 2EXYC 5GRJL 4NXSA 3EOTL 3KW7A 2OI9C 3DTUB 4AKOA 4IRJD 3FQXA 1ZWIA 3SSGA 1HE7A 4NQUA 5CLZA 3GI9H 2WTPA 5D1ZB 3C08H 1JRHH 5JMRA 4XP5L 4XVTH 1U91B 3ZKSD 4BSVB 3MQIA 3NJFA 1X5YA 2FL5A 2QHRL 4MDJA 4UQEA 3EBAA 1JHTB 2YBGA 3K6OA 5FYJH 1U8LA 4C47A 4TOYH 5DJCA 2CK0L 2WVTA 4MYWB 4DCQA 3HS9A 3S3PA 1PKOA 4NFCA 4P5MA 5EO1B 1CXFA 1M57B 3CMOL 4NKMA 1Q9KA 4UILH 3TBBA 3RI5K 1JPTL 2I60H 3ESNA 1KPUA 4K5NA 3AB0B 4Y0GA 1AOZA 5CZVL 3BC9A 2XVLA 4FZ8H 1LK3L 1I3RB 3IJYB 1UQSB 4ZSOB 2L4OA 2VQUA 3WIIL 5E1GA 3KPMB 2HVJA 1XXFC 1H3VA 4KRPC 1L7TL 2NSMA 4IBWA 2C7FA 3BPNC 2NTFB 4X50A 5IVZB 4V33A 1PQZA 3WGVB 1AKPA 1RURL 5TK2A 5KVEE 4GKSB 2PNDA 1Z0MA 2WB7A 1BBDL 4G8GA 4D8OA 4B9GA 4M7LL 5GISL 4ZRGA 4E5XG 4Z3GA 5AVZB 4JQXA 4EBQL 2CMRH 3HI6L 1MPAH 3QORD 4KJWC 1JGUH 3T2LA 4PR5A 3OPUA 4A1RA 5DD0H 5EUOE 3JSSA 2R4RL 1NGWB 5SWSB 2XWXA 1E42A 2IAMA 3RTQB 3ZE1B 4KUCF 3CPLB 2GHZA 3QG7H 4P2CG 4X98B 5ALBL 2UY6A 3UO8B 3R0MA 2DB8A 5A2KH 3HUJF 1I7ZB 3BH8B 4XNZC 5IB5B 3NVQA 4GRMB 4X6FA 1HHHA 2FJFB 2WZAA 2XT1B 1G0XA 4L05A 4Y5YA 4KX7A 1NCNA 3NH7L 5KVGL 4N2NA 5FOBA 3US0A 3DDFA 5DJ6B 4IK6A 4QRPD 2K3HA 3MLTB 3BKML 4P23B 3NCFB 4YX2L 1D2PA 1G43A 5IQOA 1L9PA 4BQ8A 2WCPA 3ARRA 3ZN6A 4F7TA 2DDQL 2P5EE 3F5WB 1M2OA 3PHOB 1BD2D 2KDYA 4MAYC 4WV1A 1WCBB 4ZXBB 3FOMA 2R2BA 1UCBH 5EO0A 1BM7A 1BG9A 3QUYB 1VB9A 3BT2L 1MELA 5C07B 1MHEB 1PJWA 4RDQG 4LGPB 1AMYA 2OSWA 4B60A 2YBRA 5EDXA 4FQXA 1P7KB 3HBPA 1AD9B 2FB4H 4OCXH 3K46A 4NAJA 4BK8A 3QS3A 4KO7A 3PIQB 4MJ6B 4BHUA 2NXZD 1Q0YL 3D2TA 3V9EA 4D8PB 3TT3H 5L2KB 1CBJA 4P48A 4ODWB 1F4YH 5F2FA 1JZ8A 3TBWB 5KSVB 1T1ZA 4AIOA 2C1PA 2NYYC 1XF1A 5DK2A 2IWKA 5JOPD 2WLIA 2FYYA 1JZ4A 1NKRA 4HIIB 1FVDB 5FM4A 1P1ZA 2JCCF 1QFUL 4BSWB 4FKKA 4AQ1B 3Q2NA 4BZ1A 2EO7A 1OE1A 3QZWB 3TBYA 1IU1A 1BFTA 1UM5L 5CWSB 4ZMYA 1KN2H 1SFHA 4LIQE 4F1ZA 3RBGA 2MPAL 3N42F 4A7TA 1JDAA 3ZKQD 4LKCA 5ISZB 2JCCB 4XBEH 4BD4A 2XKNB 5E8OA 3H2PA 2HFEA 3Q8EA 2EE2A 3CQPA 3D39A 3VU1A 2N1TE 2WTOA 4NO0D 3B2XA 1CFQA 5ICYB 3IFPB 3FU3A 1OTTC 1LK2A 4U3XA 1ET5A 3QQDA 1BG1A 4O00A 4XNQA 3TYFA 3V9CA 4G6KL 5CGYD 4L8CB 1Z9LA 3O81A 3KYOA 1YEIH 3HG4A 4JRFA 4KI5C 3SYOA 4PGDA 2W95A 4AMKH 4ZMQA 3OKEA 2VXQH 5HI4C 3WIAA 1JF6A 2C3HA 4HSCX 4HUCA 3Q5YA 1GXEA 4IMLA 4JN1L 2XTJE 1KY6A 1EK3A 5LB1A 4P8QA 2VNCA 2I9LB 3M46A 4OLYL 2KL6A 4R26H 4ZJ9A 5J6HB 4R84A 1X5IA 2JELL 2J8UE 4U1SB 2EEDA 4QJ3B 2PTVA 3U2IA 3KS0H 5E8DH 2VQ1B 5K9JH 1N3NA 4O58H 2A3TA 3CK0L 3WKML 2VE6A 4KRPD 3DPBB 3ZTDC 4OFKA 4HIXH 4JE0A 5BRZD 1E6OL 2A77H 1J0YA 3PPSA 1GS6X 2BCMA 1FLRL 3WDJA 3BO8A 5FDWA 3DJRA 5ISZD 4FFVC 1J0KA 5C09B 3OB0K 3SBWC 3FTVA 3UZEC 1YNKL 4LPVA 4XXDA 4DGYH 4PGCA 4FQLL 8PAZA 4ZFQA 3MRJB 4R0LB 4OLXH 1A9BB 3MLXL 3TIDB 5JOEA 3HG5A 2Z92A 4P99A 3K2MC 5DHMC 2NXYD 3S9DB 3FXIC 2Q2EB 3VG9B 2NUPA 2AV1B 1N7MH 1HWHB 1JVKA 1GSKA 5JW4R 3QAZC 3VFVA 2FUTA 1GJUA 5FV1L 1EEYB 1R4XA 2XG5A 2OSXA 4N2LA 4U1MA 2C5DC 3BKCH 3IKKA 5D72L 1S9VA 3ZDZF 2H0PA 1XF4A 5HYJD 1W8NA 2PW1B 3O8XD 1OSZA 2J8HA 4X7DC 1NBCA 2GBTA 5F7WC 1FGVH 2WZPA 1ASPA 1IJ9A 1E4JA 3H7LA 4NO2A 5K39A 3RKDD 3VXSB 5AVRB 3IJSA 3BPCB 5GGTL 1G9NH 3MLWL 1EVUA 5I82A 3IDJA 4RZCA 4E0RA 2ZUQB 4JPSA 1A65A 2BVTA 3FRUA 3VTMA 1GA2A 1WSST 3AACA 4WY7L 5KS9B 3L3KB 5IHZA 1JZEA 2ZYHA 4P46A 1KTDA 2FWLB 4KXZH 2NY2B 2F7RA 4J1UB 2QADD 1ADQA 1NFDA 3KL3A 5JPNC 3F58H 5B39B 1SQ2N 4X7SL 4H8WL 3SD5A 3UADA 1O7SA 5KBDA 1PS3A 3M1BA 3NP3A 3B9EA 4MLIA 3F85A 3MRQB 1BQKA 2HCZX 3SKOA 1ZKAA 3V6ZA 1JV5B 1TR7A 3P4MB 4FABH 3GGWB 1I8MB 4MNHA 1CLOL 4HU2A 4U0RC 2FHBA 3CZGA 4WGKA 4JKLA 1SLVA 3CFUA 4FGMA 4FNTA 5DEGA 4QYAA 5GGTA 4F2FA 5M95B 4YXKH 1J1XH 3EFDL 3EJSA 3ISRA 1MW2A 2QHRH 3GJEA 1VHPA 1S2EA 3REVB 2DTML 3U4AA 3BSZL 4Y8AA 3ZLQC 4K3EH 4MYPA 2E6PA 3HKZA 1M7IA 2BHYA 3LEYH 3LIUA 1MEXH 2OMYB 4XNUL 3NFSL 1J0HA 3QCTL 5C3LD 3GLAA 4XOBA 1QI5A 4UMSA 3S34H 4ALAC 5J5EA 3QXTA 3V6OA 4NWTH 2O26U 1MHEA 4TM9A 2GJ6E 1E27B 2YPLB 3GSUA 4ZOEA 5I76B 1EDHA 4X4XA 2B4CC 3HFFA 3PU7A 3CDYA 3T0EC 3AREA 2F74A 3HHRB 1G9HA 2XXFA 2BIPA 2CDFB 4EDWL 1XGYL 5F21B 4DFHA 1OAZL 3N1FC 4JR9H 1HOEA 1PEZA 3I3DA 3JT2A 1TZ8A 4N86A 3MKGA 1IGIL 3TA4D 2GAZB 3JTTA 4PGBA 4XVUD 4G8EB 4P2RA 1UUNA 5DD1L 2O93L 3BH8A 2QQNH 3NIFE 1GGBL 5SWZA 2H6UA 4X4YB 5JMOC 4KVNH 2X4UA 1CBVL 3QEHA 4TL4A 4F7EA 4I0KA 5AW7B 3CPLA 4JMNA 3KPPA 3KDMA 2QSTA 3BH9B 1I7UA 1UACH 2JQAA 2X1QA 5SWSD 2WXQA 1EO8H 2DYPD 4FDWA 2YSSA 3F05A 5LVEA 1SNRA 2ZCKL 3UJJL 3K6IA 3UCQA 1T1WA 2IDCA 2D31A 2EO1A 1TKWA 4JFDD 4ONFL 4OQ1A 4TQPA 5DO2C 1BPVA 2J4WH 5DJDA 4X5LA 3T3PF 5GSRB 4IGBD 5TF0A 2IDUA 5DLMH 4JFZH 4OLVL 1LO3H 2DKSA 2D0GA 3ROLA 4JX0A 1THAA 2UZYA 5C0EA 1EFXD 3JT0A 1RIVH 3OX8A 1DQQB 3LKSA 4WKZB 2VM3A 2YJQA 1FO0A 3EYQD 5F1IB 2HRPL 5IVXB 5F96L 5ESQA 2OXGB 4MAUL 1N19A 1CDUA 3LRGA 3QUYD 4OCRL 5ICZA 5ESVB 1MFCH 1BEYH 3OKOA 4WKZA 1C5DB 2E86A 1AZCA 3QI9A 3VVVA 4EI5B 1RK1B 3QCVL 4IJTA 5HD8C 3G5ZB 3ELQA 1MUJA 2NY2C 5E4AA 4Z0BH 4G80B 1JPFA 4TULL 2MJWA 5IVXF 4ELKA 5FDYA 3ASNB 2GEEA 3HE7D 1G1OA 5HVFB 2EDNA 1W9XA 4RMVA 2CCVA 1SMAA 4Q6IA 12E8L 3OKKA 1H15A 2ORBH 1NCWH 2YS4A 4QRPE 1OW0A 3QWOB 4NENA 2HT3D 2JB6B 2KZ1B 1DEEA 3MRRA 4N8VB 3QC6X 3VQLA 4DUWA 2EDFA 5IR1A 4JK0D 4W81A 1FP5A 3GT6A 3GSVA 4OUOA 2Y5TB 3WJLC 3IU4H 4KROC 2BRRH 2X6UA 3WKQA 1I53A 5I0YA 2MNJB 4ZTPH 4HWEH 3D0AA 2X87A 4JFQB 2J88L 3OX8B 2DLHA 4Y7OC 5B1JC 4KJPC 5CZRA 5CFHA 3IFOB 5KVFH 3RIAF 4NO0A 1SN5A 2MMXA 4WFFD 5BO0D 3MA9H 2IAMC 3V4UH 3WY4A 3LN5B 2VSCA 4TF4A 3ZZ1A 4Y19D 3UAJC 3QJFA 2HJKB 3PP3K 1KXTA 3WLBB 1OE2A 5D7JA 4H8WC 3BCFA 3CFQA 1SJEA 2LTQB 3BAWA 3L4CA 4LLVA 5T1DH 2CBOA 3QO0B 3ARQA 2VLRD 2QLVB 4NC1E 1WV7T 3GXDA 3FFDB 1T2JA 3NIFB 4G8IB 1SBSH 3MYJB 1H8OA 3SO3B 4AMKL 3VWKA 5BV7B 25C8L 4YUEL 3RVVD 1CURA 1RZJL 3WS3B 3CWGA 5B22A 2DKMA 2OMVA 4JDVA 5DYOB 4ZFFB 4AH2B 5I16A 1RD6A 2E7BA 4TUJB 4A63A 2XZCH 1FJ1A 3QYCA 3QARA 3BLBA 1TPXC 5GGRA 1SOXA 3MRNB 1D2OA 4UOW1 4MNQD 2ICWJ 4DKFL 5C9JA 2O6CA 4DPAX 5I1DA 1FFOB 4L1BA 3LKQB 3N9GH 3WS6A 1NOFA 2WMPA 2IOOA 1B90A 3L4UA 3NA9H 4BEIA 1JGUL 4PSRA 3SGJA 4FQ2L 4EPSA 5HYIA 6TAAA 3P9WB 1URZA 4EKXA 1R75A 3T5WA 1INDH 3I6KA 4EE2A 1LE5B 4TQEL 3JTSB 4LLDA 3L13A 1E9QA 5AAPA 5F1SA 4PUBL 1RZ8A 4O02H 3ARBB 4R90L 1QLEL 2A5UA 4O2FB 2R2EB 1HOCA 5CEZE 1L9QA 2VXVH 4EZLA 1A3ZA 2XZZA 3B34A 3W0WD 1BVNT 4UDTA 4TVSa 4EI5C 3N1QC 3AM8C 1LTXA 2A6JA 5E6YA 1PZAA 2XX1A 5GZNC 4FL4B 4HK0B 4HQQH 4DVBA 3M1CA 3H42H 2FBRA 1E5BA 4I48B 3Q8AA 5F7FA 5B38G 5I6XC 3C9NB 1RUML 1OZUA 2QELA 4E5XA 5CMAB 3DVFA 1AGEA 4PJ7F 3ZT7A 4X6DB 1X6NA 3ZIYA 5TGBB 4CMMB 3EBHA 4KXDA 1CR9H 4JCLA 1DL7L 2ZKXA 1HU8A 3ARFB 2NXYC 5H2BA 3IU3B 3LNGA 4OD3H 2BIQA 3WJJC 3CX5K 1EFXA 3M7OA 5D7KE 5B3JE 1HVXA 6FABL 1WT5C 2WXOA 2F1AA 2OYPA 3QNYB 1CDJA 4ZS6D 2Z8WC 2WBJA 3N91A 3MBXH 4K9EH 3ECBB 5IY5B 5TTRA 3DUSA 2X4QA 1GL4B 3MLVH 4OLWH 4GH7B 1BEXA 3WUWA 4X7EC 1NGZA 1UA3A 2VERA 1F90H 2IDSA 5DMKB 3IS0X 2WUCL 3FPYA 3H9SD 1UT1A 1Y0LB 4IK7A 4MQXD 4PJDB 4OFYA 2J5LB 3CIQA 2YAHA 4HCIA 3RVUC 5K9OA 4TSCL 2XWTB 3WTTA 2FNBA 2LTQC 2VR3A 3C8KB 4K94H 3SKJL 3NJMA 1J5IA 4R5VA 3MRIB 1IC7L 1B2WL 2GITA 5JW5B 3PDOA 1ITBB 3RGVD 2VXSH 5JR1L 1DQDL 1HL9A 1SMOA 2Q8AH 4X4ME 5TFSH 4E9LA 1J0IA 3BYTA 5F89B 1MHHB 1VKXB 4X7TA 4HISA 5B8CA 4PBWD 3QIBD 2FJGA 1RZIA 3T0VA 3DMMA 4YVUA 3VG0L 3X13A 5DQJB 2R27A 4AQZA 3I74A 3U7WL 1RY7B 3S3JA 1ZEAH 1S7VA 4WI8A 5DZLA 5H37A 2BSCA 1BOYA 3SCMA 4BDVB 1CB4A 2H2PD 3CHXA 2E7MA 2PWFA 4N2EA 4HKBA 4XMPL 2DYSB 3ZHLA 1NANH 5CIPH 3DHUA 4QOKA 4LFHG 5KZCD 1ROCA 3EOAB 1RUQL 3MV9B 3V4VB 4HFWA 4FNPA 4PV1C 4N6RB 1YPZB 5LNDA 1HSBA 4GW1A 2C9QA 4XI5C 4LSTL 5I6KA 5F44A 1VADA 4R26L 4D3CH 5FYLE 3TA3B 2H6PA 5HHOE 2EP6A 2YIHA 4JRXA 1ZJBA 2JELH 2I27N 5B21A 4NZTH 3L4ZA 5TE6H 1OGAD 4NSKB 2D3LA 2ATKA 3MV8B 4AQ1C 3O9WC 3THMH 1PAZA 4EZKA 1YEJH 4G83A 4HIHB 1T0OA 5HDBB 4QAWA 3GBNL 4M93B 4WHYH 3P9LB 4F37F 3IMWA 1U2YA 5F7KC 1NICA 4JO4H 2C3VB 1TJMA 5EBLB 3S36X 3PXHA 2V2TB 4J3OH 2DQEL 2K70A 2NY1C 1KJ3H 3KVPA 4N0FB 5D1QA 3TO4D 4A2DA 2F7PA 1LO4H 4L8CA 4N4YB 4PQXA 4XMZA 5F1OB 3AZUA 1UWYA 3VU2A 4DNLA 2E47A 5KSUB 4ES9A 3NIDF 4XWGL 1UA6H 5ERWB 4KXBA 1DFBH 3HOGA 3MRBA 3QIBB 4PD4J 4PI0A 4N2KA 1IQDB 4WF7A 4PVNA 5KSBA 1H9DA 1D6VH 3DA0A 1KGWA 3MLXH 5LN4A 1U6AH 1P5UB 4FQQA 4RISH 3B7YA 5AB9A 3ULVE 3UABA 4JANA 1OW0C 2VMJA 4C56D 2DLEA 3DRQB 3C5JA 3FUJA 4Z7VE 3UG3A 3VXPB 4PRAA 1F8TH 4N8CL 3S5YA 4TLSA 3ZL4L 1TTFA 3DSNB 2B8OT 4H8QA 3GXPA 1P4IL 3U6RB 3MJ8A 3KYKH 3JQOB 5MI0B 2VMEA 3MBED 1JN6A 4WSKA 4A2EA 4UUJB 5EUKB 2EYRB 2UXFA 4IU2B 3CUPB 4PRBB 4WI6A 5A6MA 4R97C 1HCYA 4S0TD 4TUJA 3ZE0E 1EV2E 1J8SA 4K7PH 4M6NH 3HUJE 4U1NB 3P73A 3DK2A 4NKDA 3T8XA 1OLLA 1OAJA 1SHWA 4KJQC 2FLRT 5GGTH 3GIZH 5J1TC 2LU7A 5HDQL 4JVWA 1HL4A 4XXWC 5LUMA 1PLCA 2F54B 4YSEA 1VZHA 4OZFA 4Z76B 2YBRB 1QRNE 1UENA 5F9OH 3LN4A 2G9HA 2UXGA 2VXUH 1RAMA 2F8IA 1Q8MA 4FTVA 5HHXH 2OYMA 4GQZA 1W8OA 3LQAH 1IVLA 4HWUA 4Z3FA 1ORQA 4RA3A 2G2RB 4NP4L 1CT8A 4F58L 4U3CA 2W60B 5AOIA 1KB9J 3OZLA 3QXVA 1OKEA 2P8LB 2YOCA 4BZ2L 3JWDL 1S78D 5JXAL 1NEUA 4JAMB 1NTDA 4C56B 1OGSA 3NN8B 1KENH 2YAMA 3H6JA 5JIQA 2J25A 1RK0B 4U05A 4MA7H 3OPZL 3EO9H 4ZQKB 3LSOA 4DEPC 3EO1B 1AZZC 4JFFA 4NNYB 3H9SA 4XP4H 4GEIA 5E2WH 1UD6A 1ACXA 3V52H 4UIKH 4FFWC 4XX5A 4JFDA 2FO4A 5HI5C 3QK0A 4UINL 1TMCB 3S34L 4NAQA 4N8VA 3WEMA 2AK4E 3JV5A 1N18A 2A4ZA 3L2NA 4PBXA 1ZMYA 2W5PA 3C2AH 3WMQA 4ZTOL 1PU0A 3A0OA 4UV7L 3ZX1A 3Q9PA 3KPSB 4LDEB 3H3PH 4JKPL 1NZRA 4P2YA 1UWFA 2BK8A 4PJHB 1FSKC 2EAEA 4M7JH 3DYOA 1JHTA 2W92A 3EO0A 4TUOA 5TDOB 1Z7JA 4PHXA 3RL2B 2NTSP 1JERA 2CKBA 2H6PB 5F9AC 2FEDC 4XVJL 4PJ8D 2OXHB 1KGYE 3ABKB 4FF9A 3BPOC 2DI9A 4WWKD 2RQ8A 2EIZB 5CJQH 4WVRA 1QR1B 1A6AA 1KTJA 1LXMA 2DQIH 3QJVB 4PJFF 3TTSA 1K6QL 5IF0B 3H9SB 1P5UC 3NA9L 3D4ZA 1U3HC 4DW2H 1A7QL 3TV3H 1VAHA 4WI9A 3W0WA 5JW4Q 4MNGB 1I75A 4F7PB 2ZCZA 4Z7WE 4PJCA 4P57A 4P5MB 3KLSA 1H6UA 2YD4A 1BJ8A 4KO9A 5EO1A 4ZD3L 3ULUF 5ICXB 5JHDB 3EH2A 1MRDH 1NSNH 2GIXA 4WUUD 4X7TB 1ND0B 5GPRA 3JWOL 5MI0C 1N6QL 3VWKC 5JIDA 5I0DA 4KFZC 2KS0A 1ZA6A 5F1NB 4M5TA 4Q9RH 4HFUH 5PAZA 1BPLB 4K5PA 3D69A 3QUZB 4Z7UB 1KLFA 2WJ5A 1ZGLA 3MYZA 2HJFA 1RFDH 3FU0A 2P5WB 3AWGA 2NT1A 4NQXA 1NEZA 4GRWF 3W38A 3LXCA 2PKDA 3IDGB 2IBBA 3MX0B 3WFCL 2VABA 4G7VL 4HWZB 5JHAA 3VRJB 1SJVA 4HXBL 1AJ7H 1NGZB 3EJYD 3V4VL 3RWDB 1I8KA 3IDXH 4UOZA 4L4TD 2R4SH 1YRKA 2JTYA 3ZDXF 3F7QA 1BZ7B 1BM3H 4MCYB 1INEH 1W15A 5BO1H 1DVQA 3EGSB 3I75B 1V7ML 2BIIA 4KJYA 4MDRA 3PJNA 3CN1A 1XIWC 3AQXA 4BH8B 1QLRA 2HN7A 4TSBH 3PAVA 1A3LH 3M1OA 3RU8L 3A6CL 5I66A 3AAZA 1MIMH 4NM4L 3BKYH 4BZ1H 4GIAA 1R47A 3F00A 1FAKT 3F04A 3KEDA 3SKMB 2DV6A 4HOXA 1I8IB 2P52A 4C4BA 2WUCH 1TEYA 4NDMA 1VZIA 2GI7A 2ICWB 3I02A 4I48A 5E00A 3FNKA 3QORA 4KKBC 2NY0D 4Y4KC 1UATA 4I87A 5FV2A 3CXHJ 1CXEA 1OVZA 3OR6A 2ITEA 5GZOC 1GRWA 1URIA 1DZBA 2GW5A 1LILA 2UX7A 3DROA 1HH6A 4H1LH 3GMQA 3APMA 2IADB 3O3BB 3QIUB 3O2WL 3W0WE 5TFSL 1OSPL 3NSCA 4AW4A 4G6JL 1CLZL 3Q44A 3UJTL 4UT9L 4ZG1A 3OM3B 3U2SA 4I2XA 4NQSB 2EE9A 4XBMA 4GRLA 3Q13A 4APXA 1PTZA 1WZLA 4IIQA 5DRZA 4MA8H 4CJ1A 5E2TL 5I0WA 1F2QA 1PZBA 2O5ZH 5DFVC 1S7WB 2P7TA 4QRSA 5JW4N 2FWSA 4OF3A 4UQ2A 3ZYOA 2NZ9C 5DJZB 5E4OA 4PJ9D 5EC2A 1OO2A 2B3RA 3LPWA 3OJDA 3MVSA 3WNPA 2XZCL 4OVUA 3L4YA 4RGND 3GIVA 5IFHH 4K2UL 2C7UB 2XQ0A 5ECGA 1ZHKA 3PGDB 4ACTA 1J9TA 2H0FA 1T66D 4JPIB 3RVTD 1AO7D 2WNWA 3FTGA 1HH9A 1R3HB 4X5XA 4ONGL 5KG9A 2B1OA 4PJGB 1FO0L 1HIML 5ILTL 4HD5A 4UF7C 3RIAK 1QNIA 3FDWA 2CIIA 4OAWB 4YHOL 4TQEH 2ZSVA 5DZAA 35C8L 4TNGA 3SGJC 2AJUH 4H20H 3Q5TA 3JV6A 4IRSC 1G9NC 1ZAGA 2CLRB 2VW7A 1A5FH 1MLBB 4IBTA 5F3HA 1RJZB 4NJ9L 5JDSB 1B88A 3F7KA 1DBML 2WPGA 1ECZA 1XO8A 4JFOA 4OR1A 4ZFGL 3D85D 1PYWB 4ODTL 5ELIA 3HAEG 2KQMA 4PFEA 2HMIC 5EZJB 3G6AB 1T5WA 1RCYA 4LCUB 2Y23A 1VACA 1V05A 4PP1C 5D7EA 4JFQA 3CD4A 5ANMA 5CEXB 1ICTA 1NDMA 4WLCA 1BQRA 1G6VK 4F9LA 4RMQA 3T3PE 1EHAA 1SY6H 3B43A 3BVTA 5CZXC 1F4WL 2WGXA 4MZ2A 3B9KC 4DP9X 1JAEA 2XI9A 3QH3B 4CDHA 3H4FA 4XMUA 5HGAB 5L7XL 4JO1L 3O8XA 4X6CA 2A6DB 4HJ0D 1HSAA 2VRQA 3U6XS 5LXGL 1IC1A 4JFPA 1EHLH 1W0WA 2ZP8A 3MBXL 1ACYH 4U1KA 2J8OA 2ZCLH 5HDQH 2FX9H 3GXMA 4K23L 3G5ZA 5FK9B 1YG9A 3U1SH 5DUML 3TEXA 4RX4A 1I31A 3EOTH 4HIJA 3PWJB 3U82B 1YJDH 5CM1A 3ENEA 4OJFL 1SOQA 5C0FB 3BVVA 3H9HA 3ULAB 1QZ1A 3CVDA 4RMRA 4WI3A 4ODVL 3DHPA 4RAVB 2V3DA 4LIQH 3H85A 4I7ZC 4KRMB 1JXKA 4X99B 2ZCHL 4F58H 5E5LA 5AW2B 1CLYH 2V9QA 5DZJA 4F9LC 1S4IA 2HFGH 3HNVH 4U1GC 2UUDH 3EO1A 3PAZA 1EAQA 2UZYB 4JFFB 4RLDA 4NPYB 2ZXDA 3LRSA 5KSAC 2EXTA 5EFIA 5I2IA 4F7KA 4Q6IC 4FHKA 3HNSL 1IQWH 3HN8A 4ANVA 2ARJA 2E7CA 1LD9B 2X9WA 4MA7L 4UTBA 2ZAIA 2YFNA 4HJJH 1AY1H 4PJIF 4M62L 3TNMB 4FFVD 4XZUA 3U1PA 1GAFH 2O5XL 2XDHA 4LB8A 4MFHA 3DO7A 2P5WD 2ICWI 2ZTBA 2X70B 4YXLH 1OB1B 5AVTB 4HG4J 5CEYB 1EAOA 2F58L 4ZO9A 3II2A 4OM1L 5AVYB 3FQTB 2ZP0T 2X4UB 2Y3AA 2DWTA 1CTNA 5HGBB 5DJYA 1P4UA 5TH2B 5M7QA 3GRWA 4FTVB 4J2XA 2F15A 4TUKL 4Q0XL 3MV9E 5FYJL 3ATDA 3EG9B 2YAOA 3IFNL 3IF1B 4QTHB 3D34A 2K78A 3ZDZB 1BMZA 5EIIB 2APTA 1H5BC 4PJ8B 1UADC 2ENQA 2PP8A 3K6FA 4Z18A 2AEQH 2E7DA 5L6YL 1N5YH 4NGHL 1OT1A 5FA4A 4WWKB 3SJVB 4QI3A 4IRSB 2WVSA 1TYEB 1IAMA 4QF1B 1V27A 2A38A 2EDYA 3DRTA 4FJYA 4TXVB 5BCAA 2B77A 4H0IA 5CZVH 1MWAL 3IKCA 4W4OA 2AP2A 1B3IA 4IOSA 2ARJB 3CUPA 1UH3A 3WTYA 1LO4L 2Z0BA 2BSTB 2BSRA 3LQZA 2XFGB 2QADB 1BJ1H 1TSRA 5AYUL 1N5AB 3IMRA 3MRGB 4NRXB 1W72A 4FG6C 4LSVH 4KMQA 3BFQG 3K2IA 1A4KB 1CD1B 4XXWA 4QWWD 1V54B 1VPOH 3D12B 1XBRA 1Y07A 1OIOA 4HLEA 2NZ9D 2BSED 2XXMB 4CBZA 1CDHA 3BUTA 3B9KB 4X6DE 4U3HA 3ABZA 1TETH 3J2PA 3CLEL 2X1WL 3QDJB 5DRNA 1ZLWK 4XH2A 1BECA 1JGLL 5TDOA 3M1BB 4NENB 3JUZA 2LHAA 2EYTA 3FTSA 4Q56A 1QI4A 5H35B 3DK0A 5EO9B 2FX8L 4JPVL 3S5LA 2AEPH 4FQIL 3FB7B 5CINH 4PY8I 5F7EL 3MV7B 2QSCL 1F02I 3KWTA 4EUPB 1FFPA 1ZPLA 5H37H 3MGOA 4BZ2A 4XC1H 5CHNB 1QLRB 2HN7B 2P44B 4P59H 5FGBC 4BIKA 4HX1B 3T4YB 3QZWG 1BW8A 2X9ZA 4HS6A 4KQ3L 3K7UA 3P3UA 1INEL 3AQYA 4X8GA 4ZXBC 3D0VA 2MIZA 1MNUH 3N04A 3CVBA 1FO0B 4P5TD 7PAZA 1KY7A 4KNUA 1CF8L 3LKSB 1YNTB 4QXVA 1AO7B 1QFUH 1X4ZA 3PY9A 4PCYA 1B0GA 4F27A 2G0KA 3BT2H 3ZR5A 4ZW5A 1R33A 3VXOB 2QVFB 1KBWA 3E6FA 3PL6D 1CGYA 4YR6A 4LL1A 4Q4EA 3W39B 2JJUA 4BBWA 4PJAE 4FN0A 1TT6A 2HJFB 5EHFA 4XNDA 1AIFB 5JXAH 4J6RL 1KLFB 3S3SA 3DBSA 5DI8A 5FW6A 1S7VB 1KLUB 3HS0C 3B9KD 3Q5OA 3D69B 3TZVA 3ZRCC 4Z5RB 4JM4L 1E8ZA 2DWEA 1UZ8A 1PKQB 4LU5L 2CUIA 4FERA 2R1WB 3QQNA 1FNGB 4FJ6A 4ALAL 5HPMB 1WQVT 5I1GH 4RGMC 1XCQA 5EU4A 2Q10A 2BM3A 1D5BB 4Z5RA 4MVBD 5CJBA 1FLTX 5J11B 5PCYA 2BP0A 3QDGA 2K4WA 4Z3IA 4LCCA 3RG1C 3O4LE 5EOCJ 2DBJA 5A2LH 1R19A 1K85A 43CAB 4YEFA 3DO3A 1H5BB 4OFYD 1CU4L 1SOSA 2YEZB 3STLB 5B1AB 1F2XK 4NQEE 1QHQA 2PW2B 1N4XL 3B9DA 4JPIA 4UTAH 2BIOA 4G11A 3UTSB 5E9NA 1T0NA 1JUFB 4TNWF 4Y1AA 5SWQB 4I2XE 4PGEA 1MWOA 3WUWB 2DICA 3AROA 2NLJA 4M5YL 1Z5YD 2CA4A 2DQHH 2FT8A 3CH1A 1K4DB 5IV2B 1JNNH 2P9RA 2HPOA 5CUSL 1CE6B 3QUMB 2ZX9A 4JM2B 2V17H 4MNGE 4F9PA 1ZHBB 1F4XL 1N26A 3VSVA 5IFHL 2VDML 3AWFA 4NRYB 1GS8A 2QFRA 3IE9A 2AFNA 1NGPH 1INQB 5T3XL 5I1EH 1HCFX 3SDXE 1KGIA 3X1NA 4AEHL 4JKMA 3GUTA 1ILUA 2R69A 2EIJB 2XYBA 4XX1G 2IQAA 3BKMH 1G7JA 2B0SH 2AI0L 4WGVB 1XCWA 3QFDB 1WT5A 1D5IL 1WAAE 2XKNA 3CK0H 2YQBA 5E8OB 4A6YA 4IBVA 1J1OH 3VD2A 4BFGA 3SE6A 3TH3T 5JXEC 4ZUVB 1WRFA 1Z9MA 4QHUA 4XC3H 3FO0L 3Q2WA 5DUPH 1HQRB 4ODTH 4PVMA 2XV0A 2NOYA 1JF1A 4C4KT 1EAPA 4N2AA 4QR7A 2AK4D 3FOLB 4QO1B 4LLUB 1QMUA 5DVPA 4PCSA 3I75A 4MJ2A 3ZMEA 1AJ7L 2CBMA 5MENB 1FC1A 1MJJA 2R69H 5HYEA 1J8KA 3DX8B 5D9SB 1DQTA 4I0PD 3V6OE 3VFSA 1P53A 5CBAB 1TCRB 4PU2A 4MCNA 3FB8B 1NCBL 1KCUL 1T3FB 1H5BA 3VM5A 2FR4B 4WWKA 1UJ3A 4M8UA 4HJTA 4N22A 5GGSB 5LCVL 5HDLA 2M8XA 3GTTA 2Y0SA 1O6VA 2AQ3A 4H26B 4TSBL 3UTTB 1TCRA 2IH3B 4Y5VC 1SF5A 5KAQG 4N3TA 2NW3A 4IBZA 1GS7A 2XJLA 2XRAH 2FIKB 2XBDA 2I07A 3G5WA 3GF8A 3L3GA 1FVCB 3TWYA 1U9KA 2DYRB 5EZLB 4L4VD 2PCXA 4E9XA 4ZW6A 1U8OB 3APFA 2BVOA 4LPYA 4ODVH 3FT0A 1NFAA 2P5EA 4PJ5E 4X8XA 5HHPB 3IDMB 4PGCB 2PXYC 3K2UL 4LMQE 4NUJB 1CMOA 1WAEA 3P2BA 3AG3B 3QEQE 3QPQD 1LWHA 1I3VA 5I15H 2J43A 2WTRA 3OSVA 4G6KH 2WLLA 4F8QA 3DOSB 3EJPA 3NIGE 4JRYA 2RR3A 3KL0A 4Z9KB 2AK4B 1IQWL 5CD3A 3EJJX 4NI6A 3INUH 5E8EB 4JN1H 1RHFA 4L0YA 5IB3B 3SDDB 3W0WB 5MEND 4N2MA 2E0PA 4X9FA 3U0PA 3PWUA 4IQHA 1UT2A 5EN2B 2Y7QB 3ZTNH 1U8PA 4AK1A 1BYPA 1J12A 3NRPA 1ONQB 2AQQA 2FLMA 1MHCB 2C1OA 5CHNA 3MRLA 4W9GC 1FFPB 4LRIA 3ZTJG 3AS2A 1DYZA 4MJ5B 3CMOH 4WO4C 3BVNA 2J8UB 5DJ0B 3BP5B 3UTTD 4C56E 4G9FD 3ULVD 1WAPA 2AQNA 3ZDZE 3SE8H 1QHOA 3VMPA 4AE0A 4P46C 4PGDB 1SDYA 5T3XE 1QNZL 1RZFH 2PTTA 4N8UA 3ZE2E 4B9YA 1UYWL 4M9OA 4ELKB 2GJPA 3ARYA 4H25A 1E3FA 3L5WB 5L6YH 4YHIB 1C16A 1JPEA 1KLGA 3SBQA 2PYFA 2FIRT 4F5CE 5DZ9A 1FV1B 1Z5HA 2LE9A 4LCWE 4XZ4A 4MJIA 1RIHH 3V7AE 4KKZA 4YHOH 4LAJH 4HAGA 1FAIL 3NUKA 2V2WB 3K71A 4GG6E 3L4XA 4AL8C 1C8PA 5GISH 1QSEB 4NZUH 5LNGA 2WINB 5EU6E 3ZW3A 4H0GA 3WTUA 4RCAA 1W6WA 3UJIL 1CGXA 5KTEL 2R0KL 1YN7B 3QDGB 4MZ3A 3OZKA 1BQSA 4GRWH 4ZDHB 1F6AB 3BDBA 1M7DB 3T08A 1P5VA 4HOMA 4ZBJA 2OZNA 3SE3A 3IDMA 3U83A 4OBRA 4WAFA 2VC2H 3I9IA 2UYLA 2BWDA 2OSLA 1XDTT 2BSSB 3C8DA 5ALCH 3ZKXC 1HL8A 3ZYJA 1NMBH 2NMSA 4Z76A 3NYKA 4KROD 1AQMA 2JTDA 5DT1H 2GFBB 1HH9B 1R3HA 1MWAA 4X5XB 3SJVA 3T77B 1TJHL 3Q06A 4D9RD 3U9UA 2VMFA 5A6IA 2D7PA 4D0BA 1Z9SB 3G9AB 5C1MB 2DMHA 5E4EC 3QUMH 2XUWA 4AM0B 1EUTA 1OE3A 4UQBA 2ZXBA 4AQAB 5FWRA 2WP3T 5KN5B 4XX1E 3FB8A 1A4BA 3GB7B 1WITA 1AHWC 4PP2B 2SEBB 4K23H 3U6RA 8CGTA 1BOGA 3CDFA 4OQTH 1YAIA 4JRXD 1U8NB 4MQXC 5F9WC 1JZGA 3DIFB 4MA3B 1A9EB 2PR4H 3BXNB 3PP4L 3SYCA 4FABL 1M7DA 1Z6JT 1I9JL 3B6SB 2FJFA 1NC2D 2Z0UA 3HE6D 5CP7B 2UVEA 5L4JA 2N4IA 2X2UA 4NC2B 2X4TA 3IGFA 2PYEA 4HT1H 1EWHA 3TO4B 1M7XA 4RSVA 3RBSA 1AZVA 1XCXA 3LNIA 4G9DA 2YC1A 4HXAL 3MRHB 5GZOA 1FYTA 2NY4C 3EH1A 1V55B 4KROB 3ZTCC 2TSBA 1NFDF 1MSPA 2DWXA 4NBZB 5JPMB 3RPIA 4ZMVA 2NY6B 5DRWA 2OV0A 3WXVH 3U6XA 3U79A 3V6OC 1NDGB 2VITA 3G6JB 4RIRB 3Q1SL 4DQAA 2IFFH 3LRKA 3OLEA 4D7PA 4YHYB 3LHAA 2AQRA 3V9FA 1RZJH 4CMHC 5MHSE 1OSYA 4EN3C 1P84K 4KKPA 5FUCE 1J0ZA 1SMDA 1CE6A 1NFDE 2F1EA 4XVSL 3MBEA 1T4KB 3DRTB 1HHKB 4K3EL 2EDLA 4L8SB 4RNRA 2NY1D 3BP6B 4PRHD 1D5ZA 1Q9WA 1T6VN 3B3IA 4CRPA 1KIPA 4U1HB 2XLLA 5CUSH 3UP6A 4GEJA 3ZVVA 4QRRA 3US1A 4HPOL 2C9PA 5FYKE 3BP4B 2IEPA 3L9RB 3H53A 2EDXA 2PTUA 4OLYH 3LEVH 3DGGB 5K9KA 3SB3A 5INDA 2EVIA 1KXHA 1NCHA 2WYTA 3HR5B 1U8LB 3MLYL 1QSFA 3MV01 5IESL 1G7MB 3QUZA 2IBGA 3BDYL 3CFNA 1X5XA 1NCDH 2WXFA 1J5DA 1TO5A 4WU7A 2ENYA 2EH8L 4LHQB 5A2AA 2O6PA 2C3GA 3QFJA 4XVOA 5E8PA 2KZWA 4PY8J 2X53A 2HRGA 3EF4A 1MCKA 2P8PB 1OALA 3MJ6A 3N9GL 3LXUX 2O5YL 2VIRB 1UURA 1LJMA 4JUSA 3SGKC 4YSAA 4Y9CA 1OOAA 4ZDHA 4JCWA 5DFAA 5DQ9B 2BNQE 3W9EB 1UWGH 1A8JH 2VISB 5I1JH 4JGUA 1JZ7A 2YJLA 1FZMA 1KIPB 1WD8A 1XR9B 1ZT1A 2Q76B 2R7EA 1UD4A 3LZLA 4KUZL 4TULH 4IKKA 4EO5A 1JGDA 1RI8A 4HJSA 3E8UL 1T20B 2DQFB 1AI1H 4LOVA 1XGUA 1QW9A 1KJVA 2V8MA 3PWJA 4PM1A 4POZC 2YAEA 5EIIG 2VE6B 4MS6A 4ZT1A 2R69L 1UD3A 4A2FA 5D72H 4GQQA 2CPUA 4H25B 4V2BA 2I9LA 3MLVL 1JF5A 3H42L 4IOFD 4WFFE 3GMLB 3LRLA 4RDBA 3QG6B 4MRCA 1MNUL 4GRLD 2C9RA 1FL6A 2COQA 2WO2B 1KXQA 5E7FA 1IKFH 5F7DA 3V55A 4OGYL 5D93C 2IG2H 4AYGA 1GGTA 3QCVH 1I8LA 2GPZA 3QI9B 1QRKA 4EN2A 3QJUB 3T0AA 5FPIA 1WCQA 3U46B 1AR2A 3FCGA 1NIAA 1WGOA 4A6YB 5IBLC 2XWBA 3R0NA 4DK5A 4XNYL 3SKOB 5E8EA 4FXKC 1JHLL 5EN2A 1LK2B 2OSYA 4WFHE 4HPYL 1NFDB 1XEDA 3D39D 5BV7L 4XO8A 2C4FT 5I1KL 1QBML 5DS8B 5IFAL 4CMHB 3VG0H 5IIEB 2B2XL 2AKRB 4LDLB 5CCHE 3HLKA 4JHAH 4N28A 1XZWA 2J2ZB 2KQNA 5DJDB 2ZXCA 2VDNL 3OB8A 4GLRI 4HDIA 1XGZA 3L9EA 5JORA 4UIKL 3QZMA 1O7DE 1A6TA 1S46A 4HALA 4ZX4A 4QYOA 5DJXA 5HTSA 4ODWA 1CYWA 4RESB 4KI1A 3UROR 4KZEH 4UTAL 2B1HH 2DMBA 4W9FC 3VYPA 4DP6X 1BWWA 2CZNA 1OARH 4C59B 3FBQA 3EJZC 3CCHB 3QDMA 1CFSA 1CYXA 1JZIA 1ORSB 5E2VL 2H8PA 5JO5A 1DN0A 4J3XA 3GZOA 5DQDL 1DCLA 4KITB 4OI7A 4Z7UA 4XNBA 3CSFA 4M93C 1U8KB 4WJKB 2EUVA 5CILH 1HQ4B 2Q3ZA 2F2HA 5B4MC 3VCLB 3EH5B 4IGBA 4M9PA 4HCRA 3V0EA 3TLRA 3V5HA 1QYGL 4FMFA 5IQ7H 4R0LA 1QLEH 1DVYA 2JIXB 3A4FA 4UQDA 2W9LA 4APXB 5M94B 3QDME 3TA3C 3QFGA 4LVEA 3K8LA 2ADGA 5DD1H 5HI3D 3OKDB 3WUZA 4F7TB 4WCYH 3TNNA 2EXWD 4FNQA 1A2YA 3PV6B 4FJZA 4JY6B 1ZT4B 4I3RH 1CD8A 4N9OB 3VXPA 1QX1A 4L3CA 5I30H 1A14H 5C7XL 4TLUA 1EDQA 3L4TA 4LAQH 4YSUA 2X7LA 1U58A 2CUAA 1C5CL 1OQOA 1EUUA 2CE6A 2R83A 4XC3L 1QWNA 3MFFA 5BZZA 2QR0B 4UNVA 5I6NA 3FT3A 5I8OL 3DIVA 2BC4A 3OV6A 4OD3L 1HFUA 4HWBH 5E00B 4PRHA 4U6VH 3L5WA 3UMTA 2R0WL 1INQA 1JWUA 3LH9A 4ESKA 3BPNB 4AJWA 5TF1L 2OAAA 5BMFH 1GTFA 3V0VA 5IVOA 1MCIA 1RIVL 4D9QD 3SDAD 4GRWE 2HKFH 1Y18A 2WVUA 1MUJB 2K6ZA 1GW6A 3UYRL 2VR5A 3I2CH 4AW7A 3KPRD 5T1KD 4BINA 1MCRA 1BZDA 3RZCC 4LRIC 4W68A 2W80C 3EJRA 2Y07L 4DO6A 4OB5L 4B7LA 3MLUH 4B9PA 4LDOB 5E4IA 1X6LA 5F7NC 4KHXL 5J6GA 1TZOA 5EZPA 1BF5A 4DTGH 2WLMA 1R17A 2OYKA 2DLFL 1I9RH 2JCWA 3L3JB 3EH4B 4XPAH 5AALA 3RAJH 1EFQA 2HVJB 3LPOA 4HUWB 2P26A 3EUUA 3JWDH 3UTSA 4LDCA 2WTRB 4L1SA 4XTRC 3F2LA 1RQ5A 4PJEA 4OD2B 3WN5B 5IQLA 1X3DA 5B8CB 4P2OD 2C3XA 1ZLUK 2FAUA 2WAQA 2J6EH 4LLQA 3TEYA 3IU4L 3RVTC 4KTDL 1F90L 4P23C 5J0BA 1JHKL 4Z3HA 4MJID 3VQ1C 3MNVA 4NQDE 2WQVA 2BMKA 4TVPH 1QFPA 1R6VA 2P5PA 1WIOA 3QAQA 4GG8B 3MNVB 3NSJA 4K94L 3SKJH 4G8GE 5FA4B 3C8KA 3PL6A 3CV5A 4MCMA 4PN6A 2OX5A 4Y1SA 4LKXB 1RHHB 2Q2LA 4D3CL 3QJHA 3LY6A 2VXSL 4DKAA 4DZ8B 5JR1H 1SOKA 3ULVF 1EBAA 3CFDA 3IN2A 1TNNA 15C8H 4BGLA 5T1DL 3B3IB 3RIKA 2H26B 2CXGA 4NS0A 4QXGH 5D5ME 2GK2A 1DJXA 3MJ7A 4PG9B 1XT5A 3V52L 4KAQH 3MV8D 4AJ0A 3O2VH 4FFZL 2EDMA 4FULA 3VI4F 4J3OF 3ALPA 4HIEA 4XWOD 4AKPA 4GRLB 3RDTC 5EZOH 3K2KA 2APBA 4CN6A 1AH1A 1TNMA 5DMYA 4WNSA 2IJ0C 4OLZH 5D4HA 1DBJH 5DRZB 3RFZA 2XETA 2A9ML 3K72B 2PXYB 3O4LB 4LHUG 1UA6L 1JYXA 4ZTOH 2GSMB 2P4AB 4ZOCA 3WXWH 4A6YH 3GKWL 5KVDE 1WEJL 1W72H 2EACA 3K5SA 4KK5D 3UPRB 5EU7E 1FSKB 4YEEA 3W57A 4QHUB 1FYTB 2G9KA 2G30A 4HBCL 1MPAL 4O2EB 4JRYD 2N59A 3VXUA 3D30A 3U4KA 2JNZA 2OR9H 2NX5E 4YSTA 1P4BL 5CJQL 4MXVE 4HH8A 5G5DA 1G9EA 2NNCA 2ITFA 2KZBA 2O5YH 5EU6A 2H6OA 4R90H 4MA3A 4YSRA 3D39E 3HNTH 3RWGB 3DURA 5BJTA 1FNAA 3N1MC 4MQ7B 4K15A 4UZGA 2EECA 4Y7MA 5D7IE 4U6TA 2OMXB 4NM8H 4EN3D 4F5CA 2D73A 4JRWA 2ED7A 5C0AB 3D0LB 3HMXL 3JVGA 5H37G 2VLJA 4P46B 2DZEA 3LAFA 3N0AA 1YQVL 1BQHB 1KFAL 1BOGB 2NW2B 5EF3A 4FNUA 4AXWA 1F8TL 4N8CH 3ZUNC 2EVFA 3MO1A 5T1MA 5ADOH 1P4IH 5F88A 3WTWA 1OD9A 1DE4A 1YHPA 3EZ8A 1F3DJ 3A6CH 4KKAC 4N6RA 3UTQB 4HPHA 4OM0H 4K3GA 1AKJD 4Y9GA 5FYJU 3EHBC 1MWAB 4GI8A 2QGCA 3BEWA 5IVXE 4PRPB 1BGXL 3EFFA 1PW3A 3QCUH 4FQCL 4DKDC 1Q0EA 4MXQD 3WU1A 4PLOB 4B50A 1MAKA 3VD9A 2HT2D 5FUOH 1XQ4A 3C5ZC 4BFEA 4XNAA 2VIRA 3D3VD 4LCCB 5AKTA 2B08A 5BZWA 3CDGB 3OSKA 4UT7L 4QKXB 1IGYA 1JP5A 4L9DA 5LWYL 3PWNB 4Y4KB 1M05A 3WIHA 2BVQA 3GJFK 4DP5X 3NESA 4P2QB 1SXCA 4HT1L 2PF6A 4YC2B 3PDOB 2MPVA 4Q74A 1ED3A 1HEJC 2ICCA 3FMGH 2HMID 2NX5A 4JY5L 3OQ3B 3UTPE 4MB4A 4OZFG 1A3LL 3RVXD 4LLQB 2Q3XA 3NMEA 1TO4A 5F7LB 5E9AA 4YS4A 1MIML 2FBOJ 1TZGH 4IRJB 1MCOL 1X5GA 2AZUA 5T5FA 1RUAL 2PR9A 4WDIA 3PFQA 1MF2H 1IQDA 4Z8FH 1TIUA 2MPAH 2Q8BL 1OTSC 4FQHA 5D1ZI 2X6AA 4XCFH 5E99H 4F1SA 2IWGA 2BIHA 3VXOA 4HC1L 5CFAA 1D9KD 2DM2A 2QGEA 3ULVL 1KENL 3NFNA 1AKJA 1HHIA 5E2TH 3S96B 1CE1L 5DTFB 1EXUA 1K3IA 2CKBB 3Q05A 4OZHF 3MRRB 2QL1A 2P5ED 4RWYL 5H2BB 3ARDB 4ZX5A 4XPBH 1ADWA 1UOVA 2FLBT 1FGNH 1IAIH 3KXFD 4XVSH 3LTVA 4QY8B 5D7KD 4E41B 3L4WA 2B1HL 3QIUC 4FZ8L 1S9KC 1WWCA 4YDKL 3SDCD 5H35A 4K55A 1MKFA 2EEAA 4TYUA 5C08E 5EU7C 4OZHB 1PAMA 1W0WB 2NNRA 4ABVA 3SN6N 3ZYIA 4OCSL 3KYOB 3SQOH 3BZEB 4LSTH 1MCQA 3LIZL 3T04D 3ASWA 5JZ7D 2QBWA 1EHXA 3FQYA 3QIBC 1MRDL 4WU5B 4PJHF 1MFEL 1FNSL 3F12A 4X6BA 3WGUB 4AQOA 5ACLA 1NWOA 5K1NA 2HPTA 2XPYA 2WZPD 4CSSA 1KN4H 4R4FH 2JK5A 1QKZL 1U8CB 2WB1A 4XOAA 3TCTA 1U58B 1ZT4A 2IV9A 3EDKA 3VX0A 3G5VB 2IWFA 2ZKHL 2Y1YA 2YA1A 3INOA 3VFWB 4DOHE 2A77L 4ZNEA 2Z31B 1FLRH 1JK8B 4X8JB 1SDDB 2OQJB 1U4EA 1T5WB 3SZ6A 2R0ZH 1I85A 2DH3A 1M7UA 3AABA 3ZE0B 1WWBX 4NCDA 1M71A 1BMGA 4OZIA 3IXTA 3LQZB 3GSRA 1PY9A 2AW2A 5SX4H 3AXHA 4LAQL 1QLFB 3I6SA 4LEOB 1NCCH 5KSVA 2DQDH 5AL0A 5CCKH 2VMCA 3QXUA 2N7BA 4XBPA 3GB7A 1FVDA 1DQLL 2YAFA 1CGUA 1EEQA 3PF2A 5C6WH 2DDQH 5BO1L 1A5FL 4JO1H 2DEWX 3K4ZA 1DJHA 3ZTEA 4V1DA 5HJ3B 3EYFB 3QA3B 5FYJE 1KIUA 5TF1H 3TASA 3EFFB 5HHMB 3BIKB 3EOBB 4Z7UF 3OJVC 3DWTA 4KKQA 5E94B 4RGNE 5EC2B 3T65A 3G6DH 1R1CA 4DKEL 1G6RA 2GSIA 5J8OA 3LS5H 3QO0A 1AXSA 3HZKA 5DHEA 4AKQA 4L3AA 5AZ2L 4GUPB 1IKFL 4KH2A 1UGNA 1EAPB 1VDGA 2LFEA 3GS4A 3KH3A 3QUYA 1F1AA 1IARB 2IG2L 4G8IA 4M4RA 1KYFA 2HJLA 1FNHA 3VXMA 3B2PA 3ZKND 1ODAA 1L9RA 3DVGA 5BVPL 5AW9B 3IXAB 1FDLH 4RRPG 1BM3L 3TF4A 4ZUVA 4AYDC 4DEPB 1KSRA 3LRSB 2EUXA 4FQQB 5GS2D 4P2OB 1D7BA 2J2ZA 4NZRH 3UTTE 3GXUB 5CU9A 3W81A 3BN3B 4XN1A 4JZJC 3APDA 1ADQL 3IEAA 2B4CL 1PLGL 1RULH 2IBZY 3D05A 2RAMA 1M3IA 2KUTA 5GS3A 4LE8A 1MCLA 2EKJA 4GP8B 1TDQA 4PWGA 3HZMA 4JG9A 3ZSSA 1ZGLM 2JB6A 3I02B 1G9MH 1X9UA 4JFED 5SWSA 4KMTL 1JK9B 1J48A 2NNXA 5BRZA 4F8PA 5IJKA 1B4RA 1IBYA 3NJVA 3QBTB 3RY6C 3GEFA 1W0YT 2Z3FA 1IZJA 4WQOA 1BA9A 5KS9A 1FHGA 1CI3M 4L3EE 5JHLH 3FO1A 4WO4A 2JLLA 3U4EA 3RDTD 3UXFA 5IJKC 1R5VA 4LARH 2VLLA 2A6DA 1COBA 4LP4A 4M5ZH 1CLZH 3UJTH 3S8FB 4PJ8C 5I24A 2BOBB 5KJ7E 1IO4C 4UTCA 4CUCA 2DQCL 1HIMH 4UQ9A 4XB7A 5C2BL 5ILTH 4YHZH 3CU7A 3LX9A 1CFTA 3ULVC 4BJLA 1HXKA 3O3UN 3SDDA 1IM3A 1BZ7A 4OIIL 1GYVA 1HHGA 3ZMRA 2J1ZA 4PWFA 5JQ6H 4ONOA 2NDFA 5CU5A 1HE8A 3KXFA 3MBWB 4OLZL 2OMWA 5GGSY 2CUMA 5E08H 2EDEA 2PO6D 1RZ7L 1FBIH 3UBXI 4ZQKA 3KHOA 2WWMC 2DPKA 3MYJA 4FYRA 4MX7A 1A0QL 1HILB 3N3EA 1G1YA 3WNOA 2QKIB 2NUPB 4WCYL 4ISVB 4R5TA 3MRFA 3ES6B 3CHOA 3SPJA 2XA8H 4GG8A 3DJZA 4ANWA 1NINA 3LZQA 3S36L 4F8TA 1VKXA 1A7PL 2GJJA 3HA0A 3CDZB 2NRDA 4NNPL 1MIEH 2DW5A 1A7QH 1RK7A 1SUHA 4I0PC 1FO0H 1J9SA 1G7MA 3TV3L 4AEEA 3A4DA 1ZA6B 2FWOB 5JIPA 3L1EA 2CKBL 4ZMNA 3TWCL 5C0GA 1E4HA 3P4OB 5MP6H 3TXAA 4I9XA 4LL4A 4TRPH 3QR1A 3OKYA 4U3SB 2NNAB 3KPPB 2WXMA 3HE6A 4GRWB 3VI4E 3GK8H 1QRND 1AIFA 2HX7A 1ND0A 1G7LB 1ZK5A 2OJEA 3PS6A 3DKHA 3QZBA 4XXDB 3WEXB 1IE4A 5E1IA 3NEEA 2WINA 4JFUA 1UCTA 2UXTA 3GTNA 3ZGIA 4B5ZA 4JDTH 1KUMA 1IM3B 2L0DA 3FU7A 5T1MB 3TN0D 3T4YA 2W94A 5BQDA 3TPKA 4KK9C 5DMIH 2CLZB 4O9HL 4OZGB 1J8HB 1DTUA 2OXHA 1T83C 5DS1A 2VR9A 1KJ2H 3KHQA 4OGAD 2OMBA 1G9NL 1UUSA 4DTGL 2VDPH 1UD5A 1YNLL 4G1MB 3T0DA 3FT4A 2W8CA 1H6EA 4XPAL 2APSA 3RAJL 3V7AG 2OCCB 4HIQA 1Y1DA 1K2DB 4LP8A 5FW7A 1X5LA 5JTWA 4IMLB 2A99A 1NKGA 2ZT9C 2QSCH 4MJ5A 3RPIB 3ECVA 4F8NA 1LVEA 2ZF9A 4M56A 5IHUH 2GUYA 2CO6B 1D7CA 1WUNT 3VVWA 5KSBB 3HC3H 4KKAD 4ORZC 3SYQA 1CDCA 1WZAA 2IQAB 3FFCD 3QQXA 3NJNA 2AJSH 2LAAA 5CXPA 2XN9A 1LP9F 3ZT6A 1ZIAA 2P46B 1FQ9C 4OJFH 4MQTB 4KZ0A 2OK0H 3LH8A 3A6BH 5IB2B 1ZANL 2C3VA 1UM4L 1H3XA 1JPSH 5I71B 3ME0A 4HOWA 3RY5A 3K72A 2BO0A 2NR6C 1J1XL 3EFDH 4LLDB 3VXUD 5IQMA 4LO9A 1K3ZA 1AHMA 1Z3GL 5K9QG 1U8JA 5DVNA 2DM4A 3ROOA 5ABDE 3HNSH 5EEXA 2QQQA 1FUNA 3H9YA 2WKOA 4AH2A 4D0CB 1K8IA 1I1AA 4NYLB 4N20A 3CHSA 1EHKB 4MCYA 3BWAA 4FHJA 1A47A 1NIEA 3ALWA 2QJDA 4PG2A 5EPMA 4RRPM 3X11A 1T0MA 5CJXA 1X9LA 4PWEA 2O5XH 3PWPB 3RGBA 1TTBA 3QP3A 2VDMH 4FQXB 4G8GD 4IIZA 2B16A 3KCPB 2PO6A 3DX9A 4XHQA 1EMTL 1LEGB 1BD2B 3WY2A 1Q1JH 1FL5B 1MFBL 3PIQA 3WLWD 1PX8A 2Y7OA 1XF4B 3NCCB 2F5BH 1Z9OA 5L8JB 2OFQA 4JR9L 3FN0H 2FR4A 2A9MH 2WHVA 5DJYB 3SQOL 5GGUA 2ZOKA 1RVFL 3EDDA 5D7IA 5MEOB 4MAYA 2W65A 2V3EA 4YDVB 1R5IB 1ZV2A 4IU2A 4PRBA 3T2PA 4LCYB 4E36A 4LLVB 1PKQA 3T0EE 2XN0A 2UV3A 3WELA 1EO8L 5TQ0H 3PWLB 2BS8A 4UNTA 4BK5C 1LYQA 5C0CE 3HC4L 3KR3L 1KEGH 1QEWB 1NFKA 1I7ZA 5D71L 3UC2A 5FR3A 1J9QA 3TFKD 2DYPB 2N7AA 1S7TA 2WCSA 3QR0A 4XNXH 4ZUUB 3G5XB 4Y5YB 5C09A 1U95B 4OZGE 2D7TL 1FFNA 2FWUA 5D2NE 3ULUL 3DJTA 2RTTA 3DSFL 3VNYA 3IVKB 2Q6WA 2BZ7A 3V95A 2ZXEB 3AGVA 3AXLA 3QRGH 2CG9X 3NCJH 4X80L 3JVGC 2WC7A 1LNUB 1IBFA 5K9QI 5IKCB 3GSVB 5TDNA 2D0HA 3D06A 2RA1A 2VW4A 3QFJE 3CHPA 3L6FB 2JKJA 3FCBA 5F6HI 2Q3AA 3EYQC 1GW0A 4UOQA 2UZIL 5J1SC 1RUMH 1TEGA 2CLVA 3JWNC 5H4ZA 2EKSB 5CIPB 3R7RA 3UGEA 3G08B 1G7QA 5E2UL 5EUOA 1EO7A 3D25A 4ZO8A 3R06B 3N55A 4WY7H 1OEZW 2X4SB 3QH3A 3D09A 4FQCH 1PLAA 2Z8VC 3VXSA 3OKOB 5FGCB 3T4AA 5DO2D 3RA7L 4GW1B 5A3ID 1EHLL 4XC1L 3D25B 1UQSA 5DGQA 4Y16B 2DWSA 5K69A 4ALAH 4NHCH 4ZOAA 3LNFA 2Z1PA 5AAMC 1KXVC 3Q3GB 1KCUH 3HHSA 3LKPB 3O6ML 3RUGA 4HWEL 2V2XA 4ZTPL 3G6AA 3QZWA 2VC2B 4J4PD 4IU3A 3HVNA 3IGAB 2XY2A 4JHWL 2VLKD 1JZFA 2DWDA 2WZ0A 4M7ZB 1NUFA 2XU9A 5K93A 5BOJA 4PLNC 4U1LB 2JF1A 2MOGA 4JFFD 4XVUC 1U8HA 1KJMB 4HIIA 3FPXA 4YDVA 2DQJL 3QSKB 2UUDK 4MWFA 4P2RD 2CGRL 4L8DA 4RGOH 4OD1H 4L48A 5DHVA 5AVSB 2Q8BH 3BSZH 5DMGC 5D1QD 5T3ZL 5DVLA 2BNUB 1G7IA 4I3SH 4LVOC 5C70A 3KWXA 4WU7B 1CS6A 1NIDA 4BFBD 4D0DB 3UTSE 1WZMA 2YZ1A 1JNNL 4KXZI 5I16B 5DWPA 2YD0A 2DRUA 1GCYA 1NEPA 3OJDB 4MJ6A 1RP9A 2FZ3A 3B7RL 3DX8A 3EG9A 1M4KA 3NCEB 4IKJA 1P9MC 1VGKA 3FQWB 3WEAA 3RWJB 1TTGA 4OJYA 4XMLL 1J8HD 1N67A 4WTQA 4NPKA 3H0TB 1OAZH 3MJ8B 5E0QA 3I3EA 1Z2KA 2H32B 1BVLB 1MFAL 5J6HA 1IX2A 1FZOB 1SJHA 4S1DC 3LIZH 3A6OA 5IW3A 5EA0H 4OV5B 5IHHA 3P3RA 1QO3A 3CZEA 3V7MA 4IRSD 2XTJD 1E27A 2YPLA 4Y19E 1MFEH 1P7QD 4G6AD 4G9FB 5TE6L 4E5XB 5IEHA 3O6FA 2AXFA 4HKJA 2X5PA 3C9NA 3N0PB 4KC3B 5ACZB 2WO3B 3QIUA 3TPUB 1U8MB 4K4KA 2XWJB 4OSUH 2CHZA 4JM2F 4NQCD 3UBFA 1PFCA 3S35X 4N0CD 3M88A 4UCFA 3VGHA 5GRVK 3AY2A 4LHUB 3W2DL 4EDXA 4JE4B 3CMGA 4EAEA 4W6WB 5LXVA 3DPDA 1JXJA 3DXAA 1BZ8A 2IADA 3O3BA 2AQPA 3D4YA 1GGCH 2NY5H 4FZEL 3QJRB 3V6ZB 5CSBA 4KQ4H 2KYIA 5FYKH 5D1XB 1RZGB 5EZIL 4N24A 1VSCA 2VH5H 1VFBA 3N42B 3WN5C 2AS5M 1NMBL 4N2IA 5GJSH 5FKAA 3JTSA 1H3PH 3WTSA 3Q2VA 1KV7A 1KPRB 5HXMA 2DQDL 1EERB 1YEFL 3QEGH 4RISL 1R3JB 3GK8L 3FCUB 3TBYB 4YNYA 3UACA 1A3RH 5B3NA 2NSQA 4JFPB 3D2UD 3IRCA 4GW5A 4WJ5A 3RKPA 3ARSA 5F71A 1LQBC 3UL4A 2J7LA 2MSPA 3IKCB 3PWPD 2J56A 1E4WL 3IJSB 4I9WD 1NCJA 5ALCL 2QHLA 3L9BA 2GI0A 3L16A 5I0VA 2J1XA 3WSQL 12E8H 1X7SA 2I69A 1CGSL 2UWEE 1UB6B 5C07E 1WIUA 4PJ8A 5DQJA 4KVPA 3H6AA 3RJQB 3T9WA 2A74B 1OGPA 1XZ0B 1OF0A 4AEFA 1L6ZA 1R3IH 5I6OA 1RUKL 4OFPA 5BUGA 3QB7C 2HB0A 4KK6D 2XIDA 4AIXA 3VWKB 5FM5M 5KS9E 5C09D 5DSCB 2MOQA 5DYFA 2BERA 1KLUA 2FHFA 3TZVB 5L2JA 5LLIC 1EEZA 1W0VA 2VAAA 2XPGA 4JPKL 3B2UD 3DYPA 5IM7A 3C6LB 2BSEA 2OR8A 4JFFE 2IANE 4G7YH 2CKNA 5KANG 3FU7B 3BH9A 1F6AA 3SODB 3UMNA 4EEEA 3GO1H 3F64A 5GJTH 3FHAA 5EU3A 4OVVA 2WOBA 4BFKA 5A6LA 5KYWB 1F4AA 1JZHA 2VUYA 2P48B 4QRFA 3MR9A 1CI5A 1JPSL 2WBJB 3DETC 1C9SA 4GKNB 2P47B 2WXNA 1FVEB 3UO1L 4OBSA 4JO2H 4WUUA 1FL3A 5IJDC 2YFOA 5HYSB 1A3QA 4TUOB 1BF8A 2GCYA 2X42A 2EO9A 3HE7A 1PNDA 4FQXD 1A6ZB 4G8GB 4DP2X 3IJEB 5DRXA 4EIZC 1WWWX 4EKJA 2VRAA 4NUGL 2L7EA 4HW6A 1CIDA 1RIHL 4QAMB 1SGKA 2CR6A 2VTFA 2YXVA 4DVBB 1M3JA 5HJDA 1FCGA 4JM2D 3BPLB 4NN5C 2WD0A 2ZUSA 3E6HA 1JPFB 1C7TA 2X4OA 1BQLL 1ZVYA 3P11H 4X5WB 2AXWA 4I5BB 2K7PA 1MW0A 4PIBA 4GFTB 4TQ8A 5L2KD 2AEIT 4L4TA 4P4RB 3C6LD 1INDL 4GAYA 4N9GA 5E6IA 5LO7A 1AXIB 1NKOA 3FHEA 1XR8A 1XCTA 2X0VA 4X9YA 1CFQB 1NUGA 1W6LA 2K9UA 1RZJC 3CN2A 4HV8B 3T6WA 1AAJA 3OTTA 1LP9B 4B9FA 3BW9B 1CL7I 2X2IA 3P1VA 4UYPA 4HUNB 3P3SA 2FCBA 4AJVA 3UAEA 4YJZL 3SKMA 4LNVA 3ZXAC 5KBNC 1F3DH 3NSFA 1F56A 1XD1A 4LSPL 1YYLL 1QR4A 3RWCA 3TBSB 2YSSB 3SE4C 4D2NA 1KZQA 3F7VA 4XMTA 4DAGL 1KT2A 1ZTXL 1NCGA 1AGCA 3HC0A 1W8EA 2RACA 2CALA 2G2RA 1M1SA 5DJAB 3VFUB 2LABA 2IV8A 1WBYA 2F54A 1PG7X 1T1YB 1PZ3A 1KB5B 4L37A 1DVXA 2IFGA 5T8IA 3A4AA 4ELMB 4D8PA 5KVEH 3K3QA 4MMYA 3SKUD 3FSWA 1ORSA 1M53A 2QPFA 4G7VH 4QLWA 1MCFA 2BZCA 2H32H 4QEGA 4UB0H 5C07A 2NUTA 4GSRA 5GGSA 4RDQF 5DT1L 3U48A 1ERNA 3LOWA 2IANB 3ETBF 1QO3B 4DESA 2GFBA 3DMMD 3TU6A 5IROC 2EYRA 2NYYD 2P5WA 3L1OL 1MDTA 1OCWL 1YDPA 3KLKA 2P8MB 4ES8A 3QGVA 4WFED 3LXAA 3P3YA 3PAUA 4CJ0A 1N9PA 2BP5M 4QRSB 3DO7B 5JIMA 4FD0A 2PWDA 2X2JA 4JEGB 4JPQA 3V5KA 1WD9A 2C9VA 3N40F 1AZBA 4M1CC 4GS7B 2E7HA 4TSCH 3GRWH 3O4OB 4PJIA 1HL5A 4UM9B 2AKRA 4ZUSB 2FGWH 2FK9A 5KVDH 2V7NA 1SQMA 4H7VA 5ISZE 1SLUA 1U3HA 5EBWB 4HUXA 1PVHA 3K71B 4X6FB 2QVIA 4B5EA 1F6LL 1JWMB 4OCYL 2FQDA 2IFFL 3CFCL 4L0ZA 1LEKA 3RWEA 4YE4L 5D1QB 4FEMA 2NY6D 4G8AC 1OAYH 5JUEH 4HKZB 4LF3B 4IKLA 1S7SB 5I9QB 1QR1A 2BNRD 5EMYA 3DXAE 5EBLA 5FK9A 3KPRE 3MJ9A 2Z31C 4MAZA 1XF2A 1IJNA 3RYMA 5FB8B 1QBLL 3FB6A 2QSVA 2LFGA 3BRGC 4FG6D 4FP8H 2R29H 3NZUA 4PS8A 3HPJB 3BRDA 3BEVA 3AU0A 4HS8L 5EWIL 2ZPKL 3WBDA 1M2VA 3GHEH 4HPYH 1RUQH 4TV3A 4YAQA 2F9BT 1TQTA 3O41A 5KBLA 2V8LA 3RZWA 3SBRA 3QHTC 4S1QH 4GSDH 1DJYA 3IWUA 1K5WA 5DLLA 4WI4A 2ISDA 1DJIA 2WXPA 5JIKA 3MRLB 2GJ6B 4X6CF 4U31A 2VXTH 4YHML 1DQQA 5I0XA 2E9JA 4J3OC 1YEJL 1DBKL 4Y5VA 5ESQB 3DDGA 5SX5K 1ES0A 3DECA 3GUFA 3SO3C 5I73B 1NGYA 3QQ4B 3T2NH 2YGQA 3TJEL 4AENA 5HYJE 1ZVSA 2V7HA 2VWEC 3CVCA 4J27A 5IGXH 2C4XA 3O3EB 4ZQTA 4OFVA 1GH7A 4MD4B 3ABGA 3VRJA 1RJZA 5TPWL 2EXYD 1G5GA 3QDMD 4BSVA 3WFEH 4OF7A 1KTLB 5CWSA 4JFOB 4N1EA 4XWGH 2OMTA 1EDYA 3LYRA 3SDXF 3C5SB 3GSQB 4ZD3H 5HHPA 1ZGLB 4YSOA 3ZZSA 1CICA 2UY7A 3II3A 3PABA 1AC0A 4AQEA 1PG7H 5CGTA 1FFQA 1IGYB 2R8SL 2ZP9A 4DPRA 4HH9B 2EIBA 3SY6A 1YN6A 3D87B 3E8UH 1BLNA 3TEWA 1ZIBA 3X14B 2WQAA 2OL3H 4GG6B 1UB5A 3IGUA 4GYBA 4Y2NA 3UG5A 4FXTA 4OTXL 2J1WA 2Y72A 4DQOL 3B1UA 3I2CL 4YBHA 1GHFH 2VDNB 3L7EA 1M56B 3BAXA 1AHWB 4X4MA 2UZIH 3BVXA 2QQLL 3P0VL 5E7BA 2AK1H 3H7BA 5FGCE 3PNWA 2YPLD 3IU3A 4LNRB 5AUMA 2F74B 1TJHH 4Z7VA 1FFRA 1AFVL 2E7LC 4Z7NE 5JA8B 3WMPA 1AGFA 3WOVA 3M7FB 3QXWA 4WHTB 1CPUA 4OCXL 4ANUA 2VXUL 4PRNA 2Y1ZA 5DJ6A 4IBSA 3U4BH 2ZYSA 3KPSA 1MN4A 3IPBA 4XPTH 3X12A 4PVLA 2PLTA 2XXGA 4JN2A 5F88B 5IB1A 1MCWM 2M26A 3G6JE 3JBG7 3T6QC 2VM4A 4CDGC 1QFWM 5JQIB 4NQVB 3QQDB 3S4SB 4IEFB 4FQ1H 4MGXA 4O51B 2V4LA 4CAGA 1WFTA 3JYCA 5IJBC 3AT8A 2G2NA 4Z6AT 1PKQE 3M6DA 1ET8A 5MEQB 3BMWA 4K8RC 3LEXB 3KPSE 3BX7C 4NDMB 5K1JA 3GMMB 1TJIH 1IGFL 2RGSA 1NBZB 2WBJD 3JZ7A 4FC3E 3O9WA 3DXAD 4OQTA 2BNRE 3PHQB 2XWZA 4I3SL 4TTGA 2AXJA 4XRCB 1YEEL 1V8HA 2AJYH 3L2MA 3AAZB 3KDPB 3CLFL 4OT1L 3ML9A 4YHNB 1VGEL 4CN4A 1PNCA 1JHKH 2ZXQA 4M1GL 1P1ZB 1L9SA 5L2KA 3EH3B 5FO9A 2VN7A 2EEXA 5I5JA 1DANT 3Q43A 3MUGA 4L29B 1YPZA 2F58H 3AG1B 2BVUA 2BW5A 4LEXL 3CLWA 4W9LC 5GGRB 4CSPA 4K5LA 4O4YH 1NMAH 3ELAT 3H2WA 4FYSA 3LS4H 4JB9H 3SCMC 5I8EA 3VH8A 2Q7NA 3BAYA 5E6ID 3BFOA 2FYVA 1WC7A 2VABB 4E9YA 4A7SA 4CNIB 3GSOA 4FKHA 3MX0A 3UAAA 1FRGL 1G4MA 1NEZB 3KLHD 3FT9A 2LLGA 5HI5D 1QUPA 4APQD 3PHOA 1A9BA 1NL0H 5FM8A 3VMOA 3ERXA 1O0VA 4EOWH 5C8JB 2G75A 3CFKB 1AGFB 1PZCA 2CRIA 5I30L 1QHPA 3UEQA 4I85A 1WCBA 3CAFA 5FIEA 2NQ3A 3C09C 1P2CA 1EO5A 3S7GA 2BSDA 2WXKA 2O6EA 1OGTB 3PHAA 5AWNH 3UZEA 5H4YA 4CW1A 5CD5C 4NQTA 3FQRB 4WI0B 1OF2A 2VDKH 5F9JB 2X4RB 3KBEA 2MFNA 4JANB 1FNFA 1IBGL 3GKWH 2P1YA 1NCAL 1O5PA 2WXLA 4HH9A 3RVWC 2HZHA 3I9PA 4X9BA 1NGWA 4K3DL 2UWEA 1XFPA 1T5KA 2OZ4L 1JL8A 1T89A 3SDXA 3RTQA 3MKKA 2EDJA 4PJFA 4JFEB 43C9B 5F6HJ 2YMOA 4PTTB 3SE4A 2VLRB 4U1SA 2GVYA 4QRUA 4XR8C 4K3HA 4QHKI 5IWLA 5I74C 2FX8H 4IMKC 4FG2A 4QXWA 1C5DA 2OM5A 3NZSA 4JHBA 2YD6A 4MMXB 1HYSD 2WYZA 2VR7A 5GGQL 1MVFA 2EYTB 3Q6FA 3QDHA 2OBGA 1OCWH 2JKIS 3QHZH 1KACB 2VDRH 3HLAB 3RNKA 4C83B 3WAJA 1ZSHA 3PREA 1R3IL 4A7GF 3PWUB 4RAUA 3VGEA 4E9WA 4U7SA 3GI8L 3CVHH 4H2AA 4MZIA 3BWUF 3D51A 5D2NC 1NDMB 4Z77B 1FG2A 3LDBC 1EZLA 3QZLA 3WIHL 3GMMA 4LIQL 4LLYA 4N0UE 4HULB 5GS1C 1I7RB 2A6IA 3HPJA 3VTAA 2HFGL 3GS0A 1A7OL 4HJUA 5KVDL 1F5WA 4XNYH 3FB5A 5IWLC 1PY0A 1CGTA 5EF0A 1XF2B 1MDAA 1S7QA 3ARBD 3QWRD 1DLFL 3G04A 1MRCH 4LSUL 1A1MA 3O2WH 4TL5A 2HX8A 1WDAA 5GRUH 4JDEA 3QUGA 3RE0A 1ZWIB 2Z4QA 1CE1H 4G8FA 1MCHA 2AXGA 4QCIA 4UT7H 1OAYL 1SVBA 3ISYA 5JUEL 4M8QB 1FVCA 3VO0A 1O9ZA 2ZSVB 5A16A 4O5LH 4CC1A 1GSMA 2WBWB 2CIIB 3MC0A 1A64A 2X40A 4JHAL 3ARGB 4HMCA 3AFLA 3GPSA 3BYYA 1XB3A 2AANA 4AV0A 4A2MA 4DVRL 2YPVA 1D5XB 4FFZH 4JY5H 3PJSA 3IMUA 1E4XH 5HGDA 3UP1A 3ZE1F 5DXWA 1FORH 3C87A 4KTGA 1HXMA 3OKMB 2ICES 4YFLI 5DHDA 2CDFA 3CCHA 4ZYKA 2JB5H 1C8QA 3FU8A 3VRLF 2QT6A 4S1QL 5I1CH 3E80A 2BHFA 4BUGA 1ASQA 5DFVD 4BE6A 4X5RA 3B2VH 3ARDD 3APCA 4LPTA 1UEYA 1JZDC 5E1AA 2IBZX 4AM0Q 5TE7L 1S7WA 1OPGH 1T2QH 1WHOA 4F37K 3L7FA 5A2CA 3TZVC 5IB4B 4Z78B 4N8PA 1UH4A 3NCXA 4XCEB 4CNIA 5DJ2A 2B20A 5KVGE 3IDIA 5I8CA 5IB5A 3VFGH 2ICEB 5ITBL 5E9DA 2OR9L 1DP0A 2CO4A 4UI2A 3ABLB 5DEFA 2WBKA 4GXFA 5JDJA 1UJTA 2R0ZL 5DA0B 5C0JA 4FG4A 4UBDD 3DC0A 7TAAA 5CGYC 4OCMC 4PGZA 4U6HA 3WHXB 4AEHH 1T66C 1CK0H 1QABA 2K3TA 4ZNCD 1BIIA 3R4DA 4DUVA 4N0FA 3E1ZA 4NC0B 1OP5H 4X4KA 3D2UA 1WEJH 1N0XH 4GO6B 5F3BA 4HUKB 2BDNH 4XMKL 2CJSA 3ARPA 4C8XA 1DQLH 5J1AB 1I7RA 4HDIB 1TETL 3T0ED 1J1OL 1LDPH 1WH0A 2A2QT 1G0DA 3QRBA 4J4PA 3L3KA 3IBOA 3KD4A 4MSWB 4PRDA 4WTZA 4HZLB 4OGQC 2UX6A 4BKLB 2RD0A 2UZXA 1B0WA 3GMLA 3OAYH 4CU6A 1NGYB 3MUHL 2J21A 3QQ4A 4KX8A 3MV8A 1NPNA 3STBA 3WDIA 1BFVL 1ES0B 1I3GH 1LO0H 2XN9B 3G6DL 4G80A 5C0BE 1PQZB 1YMMD 5LGHH 4DKEH 4L0PB 2Q5BA 1VA9A 1WZ1H 2WYIA 4IGBC 4TN9A 4UTAA 4JHUA 1YEWA 1JGVL 4LVOB 1XGTB