1OALA

Active site copper and zinc ions modulate the quaternary structure of prokaryotic cu,zn superoxide dismutase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
151
Chain Sequence
b'QDLTVKMTDLQTGKPVGTIELSQNKYGVVFIPELADLTPGEHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
molecule tags Oxidoreductase
source organism Photobacterium leiognathi
publication title Active-Site Copper and Zinc Ions Modulate the Quaternary Structure of Prokaryotic Cu,Zn Superoxide Dismutase
pubmed doi rcsb
total genus 38
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1oalA00
1DSWA 1TO4A 1B4TA 3H2QA 1B4LA 3HW7A 1PTZA 3SODB 3QQDA 2XJLA 1SXSA 3KH3A 1SXCA 1U3NA 3H2PA 1TO5A 3GZOA 2C9VA 1N19A 1JK9B 1L3NA 1OZTG 4OH2A 3KM1A 2WZ6A 3K91A 4B3EA 1SXBA 4L05A 3MKGA 4BCYA 1F1GA 3ECUA 1XTMA 3L9EA 1HL5A 1IB5A 2V0AA 1E9PB 2AQRA 3GZPA 1SOSA 1OZUA 1MFMA 4A7GF 2AQTA 4FF9A 2E47A 1F1AA 2VR6A 1PZSA 2R27A 5KBMA 1F18A 1HL4A 2ZKXA 1XTLA 3L9YA 2AQPA 2GBUA 2GBTA 1E9QB 1Q0EA 1XSOA 1E9OA 1YSOA 2AEOA 1JK9A 1SRDA 2WWNA 3KBFA 3PU7A 1EJ8A 1SXNA 4A7SA 1N18A 2Z7UA 4A7QA 2WKOA 2AF2A 1SDYA 2WYZA 1SPDA 5KBKA 1YAIA 2WZ0A 5CU9A 1OAJA 2VR8A 2ZKWA 2AQQA 4MCNA 4A7UA 2C9SA 1SXZA 2LU5A 2WKOF 3GZQA 1FUNA 1Z9PA 3HOGA 2WYTA 1OALA 4MCMA 4N3TA 3MNDA 2Z7ZA 3GQFA 1OEZW 1CB4A 1Z9NA 3F7KA 1F1DA 1S4IA 2SODB 2Z7WA 4A7TA 3CQPA 3GTTA 1EQWA 2WWOA 1KMGA 1E9OB 2APSA 1E9QA 2WZ5A 2K4WA 3GTVA 1E9PA 4N3UA 1UXLA 2GBVA 3KBEA 4U4IA 4A7VA 1SXAA 2AQNA 2ZOWA 2NNXA 1IBDA 2Q2LA 3LTVA 2VR7A 3CQQA 3RE0A 1BZOA 4A7GA 1RK7A 3CE1A 4BD4A 2JCWA 1DO5A 3KM2A 1BA9A 1UXMA 1QUPA 1PU0A 2ZKYA 3HFFA 4OJAA 2AQSA 3QQDB 5KBLA 2JLPA 1COBA 1AZVA 2Z7YA 3ECVA 1YAZA 3S0PA 3T5WA 1JCVA 3KH4A 1IBFA 4BCZA 1IBBA 3F7LA 2E46A 3ECWA 2XJKA 1ESOA 1P1VA 1SDAB 2C9UA 1CBJA 1IBHA
chains in the Genus database with same CATH superfamily
3L9RB 5BO0D 5HDBF 2VABB 1ZGLB 5EDXA 2Q6WA 2OL3A 5HVFB 3CVDA 3DKHA 1XGYH 3CZUB 1CCZA 3LXCA 3TLRA 5IJKC 1WSST 2QSCH 3A24A 3CSYB 3DTXA 1X6LA 2E9WA 5JOFB 1TYJA 3CN1A 4NB7A 5LGHL 2XWDA 5B8CA 1X5HA 4MJIE 1XIWA 5KVFH 3LZQA 3MRHB 3CG8A 2G60L 3KYKL 2H0EA 3P1VA 3DNKA 4PVLA 3NCXA 2EACA 1V05A 1HQRB 2BY2A 2NZIA 4L18A 4BZ1L 4D0DA 1BBDL 5DJCB 1Y0LA 3NSYA 2KKQA 4PV9B 3O3DB 4PJXA 1OT4A 4S1QH 5HHMB 5BZZA 1L9QA 2H1PL 1I1AC 1K8IB 4HD5A 2WKLA 2XTJB 3FUNA 2WXKA 3O81A 3OLIA 5E6IA 2PCXA 5I74B 4LRNL 4N68A 2UY7B 4U1LA 5MEOB 4TNFA 3VB8A 5BQ7B 2WKOA 1CGXA 1NGWB 4JFOB 1NM4A 4R7XA 4LHUG 4NZUH 4ZQTA 1N6UA 5JHDD 2AQQA 3AU1B 3HG4A 5DD6B 1XF5A 1T1XB 5FW8A 4XBGB 1RUAH 5CD3A 3Q9PA 4HT1H 5FUOH 5SV4A 3GJFH 2PR4L 5KS9E 2DLFH 3LKNB 4GSQA 1RUMH 3QDME 4MWFA 2Q3XA 3PS6A 4GQPH 1XSKA 5C08D 3TBBA 2R69L 4OGZA 4RX4A 4TULL 8CGTA 1J11A 5G55A 3WLWD 3VWKB 1GTFA 1Q9LB 4CA4A 1YJDL 2IGFH 1KUMA 5E99H 5KG9B 3U30C 1GMEA 1SGKA 5KUKA 3K1DA 4JY5H 4L1SA 4LCUA 4MFHA 5C0AE 2A6DA 3D39E 1QR1A 2GBVA 2P5EE 1MVFA 1S7QA 4DJMA 2NPLX 2PPCA 1D5BB 1ZT1A 5IJCC 3KL5A 5D7LB 1KJ2H 2MNUA 2VXQH 4PJAE 4A68A 4M6NH 1F90L 3FU6A 3RWEA 3AREB 1HL8A 3FSAA 1KGCE 1QLRA 4KVNH 4MQTB 1BAFH 1ZHBB 2OMXA 3VO0A 4O5LL 4XVJL 2D0HA 3AACA 5IHBA 2NY1D 3C5JB 4R2GC 4F57L 4Z95H 4NERA 2FQGA 3OKOB 3FJTA 1LEIB 3U2SA 1JIBA 1J5DA 3T5WA 3DECA 4PG9B 4PWGA 4ZJ9A 3QQ4B 2C9RA 4JPIB 2YBRA 5CS7A 4C4UA 3ALPA 5CD5C 1H3XA 3T3PB 5B1AB 2D7TL 3LV3B 2QADB 2W94A 4JRFA 3D0VA 4FNPA 3ILQC 5K9KB 1XVSA 2ZX7A 2UX6A 4MMXB 3C6LA 1DSFH 2DY2A 2J55A 3V6OE 1U8OA 4UT7L 5LB1A 3ZDZF 1KTRL 3QFDA 4YK4B 5GISH 4OJFL 2VLRB 4FG6C 3LRSA 4HGWB 4HHWA 4UQ3B 5B22A 3WE6A 2NXZB 2W92A 4AQOA 1QLRB 4M1DH 4OJYA 3WTXA 2A77H 1DHKA 1SYSA 3WGVB 5DDHA 3GJEA 1PCXA 3V55A 1MHEA 1EO8L 3UJIH 4AITA 1P2CA 2OR9L 4PTUB 4DQOH 1CICC 5JYMA 3GSRB 1EAJA 2FBRA 3HG0A 4G6JL 2BNQB 3F04A 2OV0A 5DFVC 5B8CC 3US9A 3WKYA 4DEPB 1V3LA 1E65A 3WIFA 4FQXD 3VG9B 4IGBC 2BSSB 4MNQE 3BEWB 3R19A 1XMEB 1ZE3C 2D0FA 3GSUB 5I73C 4R96A 3B56A 1SVBA 4EBQL 1KWGA 1Y18A 3MUJA 3S3BB 3FRPA 1LO0H 2YAMA 2X89A 5IK3A 3U48A 5IFHH 2ZUXA 3GSVA 2HKHL 2LAGB 1L0XA 4QRUB 3MLPA 5KYUA 5AB9A 1Y07A 3CDGB 3K6SA 4OI9A 3TT3L 5D2LE 3ZLQC 1A6ZA 2UVFA 4EI5A 3UTTB 1DE4B 3ZOAA 2PXYD 2ZXCA 4G6MH 1Q4NX 4QYOA 3SPJA 4KH2A 1B2WL 4MCMA 1URZA 1KCVH 5BUAA 1G7PA 2XXGA 2ZYRA 1FGVH 1NFIA 3C8KA 2NW3A 2XTJD 3CXHK 2MCMA 3V5DA 3N2JA 4PGBA 4E5XB 5JW4R 1F4XL 2WXLA 1USZA 4ERSL 2Y6SD 5IHLB 4R84A 1PY0A 5HVWA 3HG1D 5KJRL 2NTFA 1FFRA 2JJTC 5DZNA 3U7YH 4J39A 3E3QC 2ARWA 4Y2OA 1MWAA 4NQED 3UP6A 4YXHL 4B9ZA 2MKLC 3CHXA 1KENH 4FFWD 4JFTA 5BNXD 1WUNT 4P4KB 1X5JA 4PJ7F 5GGSY 4OD2B 4AENB 5CMAA 4Z7OE 4FYTA 25C8H 4PRNA 3TO4B 4IU3A 1BA9A 2AK4A 3K72A 1U6AH 3RTQC 2HRGA 1KCUL 4R7DB 1N5AA 3P40A 4HX1A 1NMBL 1D9KD 1AZVA 4W6WB 3O8XB 3U4EA 3EF7A 4OIIH 4EUPH 2BP8A 4JFYA 4Z0XB 4EMZA 3QJTB 4RISH 3VD0A 3FB7A 2IGFL 4PRHA 1IM9B 4BQ6A 2YXVA 4XXCC 4YSCA 4JK0D 1NC2D 2CKBH 1E3FA 2E7BA 3CTTA 4FLQA 2A0LC 2Y36L 4YDIH 4FYSA 3AMLA 4JFOA 4DGVH 1EHNA 1FNGB 4YH6A 1KDIA 4UZSA 4PRDA 1GGIL 3H2PA 5E56A 1DJGA 2JVUA 5C0BB 3MACL 2OMWB 1QNIA 1OP5K 1SOKA 3DOIA 1I8IB 4AEHH 4UNVA 5I2IA 4PGEB 5T5NG 2VDKH 3SZKC 1E4HA 4J8QA 1U33A 4EN3B 4OZHA 2RAMA 1OSPL 3K6IA 3L9EA 5C2BH 2X4TA 3WS3A 5FGCE 3TWCL 4CW1A 2VW7A 35C8H 3EZ8A 4UM9A 3VGHA 1I3UA 4PY8J 1NTDA 3NJHA 4C56D 2XFXB 3MV8A 3RGHA 3V4VL 4TYUA 4WIQA 3V5DB 2AK4E 4A2HA 3D6GA 3HLAA 3U4BL 3X14B 4AV5A 1JFQH 4XXDB 2EYTA 3PL6B 4IJ3B 4M8QB 5IROC 2XA3A 2G0LA 4AX3A 4YFLI 1AC0A 7FABL 2QZ5A 3ZTJH 1BFVH 4L4JA 1AO7B 4P5TB 4WDIA 4UV4H 3VWJA 1CT8B 3QUYD 2E9IA 4GAAA 1NIEA 4GQZA 5AKSA 4CC0A 3BGMA 3FTVA 1A4AA 1JFQL 3J7HA 4JJHA 3KHQA 4U6YB 3DTUB 1XX9C 1IM3D 2APWA 3JWNH 4MCNA 4O02B 3RWIB 2AK4B 3ULVC 1PYWB 4PRBB 2VXSL 3H7BB 4OQ1A 1IEAA 4ZPVA 4L5FL 3TBVB 1JHKH 3RGVD 5HPOA 1KCRH 5E8EB 1BQKA 3FQUA 2WD0A 3DTDA 4X6DB 3VGAB 1INQB 5E5MB 4V1DD 1WZKA 3QDGD 3NN8A 2FYYA 4LL1A 5IB1B 3OQ3B 2SODB 2PW1A 3BZ4B 1FPTL 4J3TA 5HHXL 3BD4A 5HHQA 4HJGB 2MCPH 1ROWA 4LLVA 5EEZA 3OB0K 3MV9E 1E9QA 3BVTA 4MQSB 3S7GA 5DHVB 2ZUWA 4APXB 2J2ZA 1UWEH 1UXLA 2GC7C 2GBAA 4W93A 4WFFD 1Z5HA 3ZZQA 1Q9OB 1E5AA 1FZJA 3AB0B 4GY4A 5FWQA 2MCG1 3LRSB 1ZGLP 4Y4KC 1IBDA 4HLZH 1TQBB 4MD5A 5DRWA 4OZ4B 1RK0B 3G6JF 4AIZA 1FBIL 4ZFOA 1A6ZB 4LQFL 5JQHC 2R29L 3N85L 2XY1A 3MRJB 2X40A 2JELH 3B43A 3SDCB 4KK8D 4I0PC 4KTEL 4LEXL 4IMLB 5DZPA 5AFAA 2KHAA 12E8L 1I1AD 3UERA 1XH1A 3VG0L 2QFRA 4FN0A 5AVQB 3RNQB 5FFGA 5C2UB 4W9LC 4CSPA 1NUGA 3EJSA 4G7SB 3TIEA 1T7VA 3HW7A 5FYJE 5TQ2H 3OSVA 2FIRT 3VXQA 1XB3A 1KXVA 2ARJB 1RIUH 4WK0B 3MUY1 3Q2NA 2F1AA 3L6FB 4ONGH 1UKQA 1FVDA 4CSZA 1U8LB 4GXVL 4XPBL 4Z1PA 3UEZA 5GRVK 4AEIL 1Q1JL 2C9XA 2WXMA 5K9JL 2ZCZA 3VX0A 1TETL 2VQUA 4YXKH 4A04A 2HWZL 1CI5A 2V5RA 5T5FL 2ZKHH 1K6QH 2HB0A 3A47A 3QFJE 2GJ6A 3I9IA 2VDNH 1CL7L 5EZJB 3BKCH 5JR1H 1NMAL 1G6RH 5ILTL 2ESVD 4UDTA 4XMUA 4MNGB 4JB9H 3ZR6A 5GS0L 4XXWC 4FMVA 1BEYL 3LXUX 4IU2A 1G6VK 3DV6A 3IAQA 5IP4A 4F8PA 4JHWL 1IGIH 4Y4KA 5IOKA 1KBWA 2UZPA 1FZJB 3KLLA 4OGYH 2F7IA 4L8CB 5LBSH 3TNNB 1J12A 1JGVH 3MRNA 5I75C 2QKIC 4M7LT 43CAB 4TNVK 4QHPA 1LEIA 2KZKA 1SPDA 3HMWL 1INDH 3KPPA 4FQLH 1N70A 3GB7A 4HJTA 3WTTA 2PR4H 1VGKA 5E95B 1Z3RA 4K3HA 4XCEA 4WWPA 4F1ZA 2H3KA 4CC4A 1FZMB 2FYYB 3FSOA 1NQBA 3GS7A 4AYSA 2BJML 2C9QA 4WTXA 5TE7L 2EKSA 2CO6B 3CSFA 3NFSH 4MAYD 3ULUL 4F2MA 3ROLB 1D5ZB 3AJ7A 4IW4C 3QZOA 1BD2A 4LCCA 3T8XB 3GHPA 3TN0A 5DYFA 2CA3A 5FLUA 3NP3A 4N24A 1KB5B 5I1EL 2WMPB 4KFMA 4GMSH 4BJLA 4A2MA 1JZGA 1S3RA 1XD1A 4XO8A 5AB1A 4AW4A 4CMMB 5L2KD 1S7TB 3SGJA 5FO8A 2Z93B 1TNNA 5C7XH 1U8JA 2R4RL 3EW3B 4F9PC 5GSVA 3ELAT 1QFWL 2VSKB 4Y89A 2VJXA 1CLYH 5AVYB 4HVBA 2CLRA 3OKNB 4NC0B 2QT6A 2QADD 3QUZA 4XX1E 3RWIA 4JQXA 3EH5B 3NEXA 4P2QB 3HLAB 3OR7B 4JM4L 4PGCB 1QSVA 3GSNB 1VFBA 1UA6H 3ILPB 1LK3H 5FUZH 5D1ZB 1LNUA 4DGUA 4YSTA 4LAJH 4V1DB 4KK6C 1JERA 4NRXB 3ZBMA 3V0VB 4G80A 5A2LH 1X5FA 5D96C 5CILH 5J1AB 4WNSA 3NMEA 4K94H 1SN2A 1EFXB 3X13A 1CBJA 3DX7A 3LVEA 1X5IA 2HX7A 1A7QH 2WTPA 3BN3B 4P2QE 3NBNA 4LKXA 4KDTA 4CNIB 4PV9A 2FHFA 4XMPH 1ZV5A 4JS7A 2ITFA 2F5AL 1NMBH 3P4NA 4IRZL 4HEMA 4H7VA 1HEZA 3UTQB 2FDBP 3KS0H 2OTWB 1MWAH 3M8OH 1I1AB 1DBMH 5I5JA 5FM5O 2OMZA 1XBDA 1YMMB 2HWZH 3TBWB 3IRCA 1KXVC 1YNLL 5H94B 4KHTL 1JPFA 2I85A 3D12B 3P3SA 3I50H 1I9IH 2GC4C 2TRHA 4ZUUB 3UTTD 5FO9B 3AC0A 2CBQA 2CJ3A 2UV3A 3MOAH 3HJ0A 5FO8B 1N7MH 4HOXA 2I24N 3P4OA 1ZIAA 4WNQA 1DUYA 5CCKH 2HT3C 4HUVA 4O2FA 3BSHA 1FZOA 4OCYL 5D4HA 4J3OF 3IMUA 2VDPB 5HPMB 3O3AB 3W11D 4ZS7L 1I7TB 2WLJA 3HNSH 2VN6A 4YDVA 1L7IH 4K7PX 2NX5D 3MOAL 4QRQA 5JW5B 1SUHA 3IWVA 1I4FB 1I1CA 2XICA 3CVHA 4HUXA 4RGOH 4HZLB 4S10A 1MWAB 3FFOA 3SOBH 5K5YA 3IXTB 1CYXA 4CDHA 1KPVA 4DP9X 3OWEA 4ZUVB 3AW5A 3BYYA 4JLRA 2BSBA 4NQVB 1BIIB 3Q6GL 5A2KH 1P1ZA 2XSKA 1BZ9A 4FZ8L 1VKXB 1CFVH 1JNLL 2CCWA 1TKWB 2QSCL 1ETJA 4W9HC 5EUKB 1G1OA 5JDSA 2F5AH 4PUBH 1GZPA 2BNRB 1NH6A 4GS7B 3VXSE 3RI5F 5CFHA 1W16A 3GTVA 3KPQB 1KT2B 3NZSA 4X6BB 3M1BB 1P6AB 4HCRH 4NO0D 1P5VA 1KXTA 4HJUA 4RGNC 3VFVA 2VLMD 5DO2C 3JWDH 4FZ8H 5KVGE 1TPXC 1FYHB 3LZFH 3NZ8A 1OO2A 2DKMA 1MELA 1ZKAA 3O45B 3FHAA 1DO5A 3JV4B 4LVNB 5DK2B 2HVKB 3DX2A 1A1NB 1G87A 3UDWA 2N0KA 4WI7A 3L1OH 1UZGA 1B0WA 3NGBB 4PLKC 1JTOA 3BDXA 4RGNE 1LYQA 3L1FA 5FK9B 3C87A 4J4PA 2VXUH 1FGVL 2VO5A 2WPGA 3DK0A 5L2KA 3QNZB 2WQUA 1E4WH 3LN9A 3W0WE 2ADIA 4LLQA 1I8LA 4ZMQA 3E6HB 4DGIL 3BDYH 4QXGH 5KYNA 4PJIF 3SOTA 5IFAH 2FZ3B 3PL6D 3VD4A 3D0VB 3UTSD 1XMWA 4U6HA 3CFQA 2FO4A 1LHZA 1R24B 3EYFA 4ZYKA 1OZTG 1E27B 3QR1A 2O6DA 1XF4B 2B4CH 4MAYA 2G4EA 1NGPL 1WBZB 2IPTL 5D2NB 3RGBA 4N2AA 5EZOH 4JDVB 1MJ8H 2EC9U 1MRFL 2FJFB 1PQZB 2Y07L 4AUJA 5ISZD 5IHWA 5D1QC 1E5ZA 3V7AE 2QL1A 4FG4A 2Q76A 1F6AB 4LVEA 2V9TA 3WNPA 3L54A 2E47A 3PHSA 4PW9A 1A7PL 3P3TA 1FL6B 1GAFL 1MRCH 4P59L 5J13C 1TVHB 1J1OH 1Z1WA 2Q3ZA 4PJCB 4Q0XH 3OKKB 2HJLB 4N2CA 4TOYL 2ICEC 1RKRA 3ZZ1A 5IB1A 2JJVA 2MJWA 3RX8A 1AMXA 2QVIA 4LSRH 1UD6A 1OSZB 3CN0A 4X6FB 1OF2A 2G0KA 1TZIB 2HLEB 4V11A 4AQ8A 1CLOL 1OHQA 2E9JA 1R34A 5F7DB 2BVPB 4L4VE 1QFWI 5D2LF 5BRZE 2YD8A 1EO7A 2MQGA 4YHZH 1OM3H 2A6JA 2XWCA 3EBHA 2XNAB 2BFGA 3ARFD 3VA6A 3HS9A 2R2CA 3L5JA 1BZEA 3P9LA 4LEBA 3WJLA 2FJGA 5KG9A 3HI1A 4L1DA 4OD1L 2HFGL 2V17L 3T4AB 4PJHF 2D31B 3MRFB 4UT7H 5B38A 3S36L 2FK9A 3O6KH 2J5LC 5HHPB 3TH4T 3STLB 4OCWH 4JPVL 3DGGB 2OMZB 2GT9A 4FABH 1WD9A 1YUKB 2YGNA 1I1AA 4I5BB 4Y2NA 1XGZA 3OZLA 4H26B 1MFBH 3NPSB 4OU3A 1KJ3L 3O3DA 4PR5A 5F97E 2BRRH 3ALWA 3NDZE 5F3FA 1SDDA 3QB7C 2DQJL 3I74A 4U1LB 5F6HI 2RALA 3CZNA 2QKSA 4LKXB 1AIZA 1J5HA 4P5KB 4Z7WA 2TRYA 4NNXB 2OPCA 1E6OH 5HPMA 4HKZB 3V4PB 2NCEA 4XMWA 1UC6A 1OB1B 2YK1L 5EOQH 1W9XA 3X12A 3FL7A 5FYLL 3K4DA 3UYPB 2QSQA 1NIFA 2OTUB 5AALA 4NO3B 3C08L 4JFZL 3RJDA 3A6OA 3TBTB 2BDNL 2NY2B 5L8LB 3WBDA 2Q8BH 3IF1B 4XAKE 1I53A 3GXMA 3HNSL 4NIKB 3MX0B 2J7LA 1OARH 3WSQH 1W0YT 4K5NA 4FNRA 2F1BA 1SOSA 1UG9A 3KLHD 3WY2A 4F5CA 3SDDC 1YJDC 2E6PA 4DT2A 5GS0C 5HI3D 3LN4B 4JFEE 2GSGA 1NCGA 5BOJA 1Z7JA 4E9LA 2BIIA 2DQEL 2J1KA 1PEZA 3HZMB 3AS0A 3APMA 4MAUH 5CM1A 5JPNA 3L8QA 4IDJH 4MNQD 5ICZB 3GSNA 1B0GB 2CCVA 3SPCA 4ANVA 1ZMYA 4L3CB 5AKRA 4M93B 5EG6C 3TESA 1OP3H 2B15A 3ARGB 4G80B 3MBEB 5DJZB 2IDTA 1I8MA 3KPOA 3ZRSA 2R8SL 5D93B 4M62L 43CAA 5FA4B 1SOXA 5JA9A 3FQ4A 3AT0A 1D5MB 4PBDA 2NYYD 4XWOC 1T5WA 2UY6B 5KVGL 1F4YH 2OX5B 3ILDA 1BAFL 2YSSB 4FLRA 3RWDA 3UAJA 3IJHA 2WXRA 4N6QA 5HHPA 4CN1A 2H32B 4Z7VB 5JLZA 3NIFE 3HEIB 3GQFA 3FT4B 3OF6A 4R96B 1OAKH 1AZCA 3TO2A 5FB8A 2VMDA 4PV1C 3VWJD 2E56A 4GP5B 3VUAA 3IKCA 1F8TH 1FG9C 5LNEA 3DO3A 2DEXX 3NUKA 4P3CL 3RGVC 2O72A 3IDNA 4WKZB 2OR8A 4QLWA 3TCTA 4JHBA 3LEXB 1NC2B 1QX1A 1NOLA 4HLEA 5ECJE 3IFNH 3M7FB 1D9KA 3T0EA 4JRYE 1SHWA 4G6AC 3BZFB 4JFSA 3FOLA 3VDAA 4JPKH 4JL1A 1KTKE 4EIBA 3FQXB 3L3GA 4UQDA 1JUFA 3U7WL 2EDFA 1WT5A 4D3CL 3QXDA 2YIHA 1KGYE 3KLAB 4FQHA 4I48A 1O9WA 4R4BB 3K46A 4OQTL 5C6PB 1R0AH 2MIZA 2YAOA 1FAKT 5CBAA 1ASPA 3VXME 1CGTA 1DANU 3L4XA 1J05A 4DOHB 4DPRA 2V17H 1F4AA 2YA0A 3BSGA 4HSCX 2L7UA 2XJKA 3WHE0 4HOWA 5IF0A 1T1WB 1B4TA 1F56A 3BN9C 4P49A 1UT1A 2CHWA 1FIGL 5KVDH 5CJOL 1QSEA 1M05A 2K6ZA 5FECA 2VTFA 2UWEE 4EUPG 5E1HB 1F3DH 3BPLB 2DF3A 3I6KB 1EJ6A 4BXVA 2IDUA 3KJ6H 1IEBB 5F1SA 4HKBA 2AHIA 5HI4C 4QTFA 15C8L 1KYOK 3O11B 1HXYB 3BH9A 5TD4A 3HCVB 5IREA 5KOMC 4U1MB 1ZT7B 1JYNA 4GRLA 1EIBA 4M61B 7CGTA 5ID0A 2PCPB 5HYJA 1PJWA 3EH2A 2EQDA 2P52A 3F7YA 3IFLL 2VLRA 3PWLA 1XCQB 3IDNB 2FVNA 3BAJA 4HC1L 4WKZA 3NIDF 4DQAA 1B6DA 2R0KL 1AYOA 3P54A 1EHAA 5F7BA 5F0LB 5ILTH 5IMMA 3I2CL 2FCBA 1QFOA 2VNCA 5T1JA 1N67A 3FT2B 1M05B 5D1XC 4JHWH 4OBSA 1KTJA 3JBG7 5H2BB 2MEJB 1KGJA 3HZVB 4F9LC 1NWOA 3FCUB 4PJ9B 4BE6A 3O2WH 3QUHA 1B0IA 1IC5H 2X3CA 3V6FA 3UYRL 2MPAL 2GAZB 1J10A 2JIXA 3TZVC 4JKMA 4UT9A 3QR0A 3SDCD 3ZKMC 3BAKA 4YZWA 2BZ7A 2DQGL 2WBJD 1W6WA 3DSFH 2DQTH 3C09B 2KZWA 3E6FB 3KLSA 4GG8B 4GRMA 3PREA 4HAFA 2JI1A 3UEQA 3HS0B 3NP4A 4APXA 4HH9B 2YOAA 3DYMA 4OZFB 1BIIA 5K1NA 1LK2B 4KVCH 5HYJE 2N1TE 3I9GL 4FXTA 4FQXA 4ANXA 1M71B 2E86A 3OTTA 4XPFL 2DQGH 4AH2B 4NLAA 2WXGA 4JGNA 3PIQA 4N0CD 3P0GB 3FQUB 4X6DA 3CX2A 4HPHA 1WE5A 2FNBA 3AGWA 3K6NA 3EF4A 1G94A 4FJZA 3EJYC 1PZ3A 4LCWE 5FKPB 1RK7A 4A7GA 5KVFL 5DFTA 4MCYB 5KSVA 1MHHA 2PYED 4I3SL 4KO5A 2X3BA 1OGTA 3FUKA 4RCAA 5C08B 2GSGB 1FORL 1CZ8L 5F9WC 1KJ2B 1IEHA 5IFHL 4ONFL 1HAWA 3O2VH 1RZIA 2I32A 4OFYA 4WSJA 4NYLA 4ES8A 2AJSL 4LPUA 4GEJA 3RDTB 3NPSC 5DTFB 1YY9D 2K3TA 1XB8A 2ED8A 3MBEA 4WVRA 3C09C 5JNYB 1WF5A 2X6BA 1EZUA 3ROOB 4KH9A 4MA1B 2FO1A 2Z8RA 3ARDD 2Z35B 5E9DA 3WV0A 4NQXB 4KKNA 3WEAA 5KBNC 1FNSH 3Q8EA 4I2XB 1DQML 2OTWA 4WUUA 2W9EL 4NAQA 4KV5F 3ORJA 2BVEA 1P84K 3IJYA 1HZKA 5GZOD 4FQIH 3W1ZA 1AY1L 1BG1A 1RUML 2UXVA 3EYOB 3GGWA 1I7UA 4YDKH 1QBBA 2FL5A 3S5LB 3WFCL 1HL4A 2BMKB 2BRQA 1ZCRA 2O6FA 1ACYH 1EO5A 4DP5X 1I1YA 3LQZA 3P0YH 2OYPA 1ZVYA 1BF2A 2OZ4A 4BZ1H 3KPSD 1FSKC 5JNYA 5I19L 3KYMB 4G8EA 1TOXA 3HHMA 4N8CL 3RUGA 2VQ1B 4P46A 5AW0B 4ZSOA 2ZNXA 4YMPA 3UL4A 1TVDA 1OAJA 1O9ZA 5I0YA 1K8DB 3BXNA 5C08A 2LU4A 3C5ZA 1MEXH 2H3XC 5E2TL 2WLHA 1LP9F 4G72B 2FATL 2VIRA 1QFUL 4X7FC 2G75A 4QCIB 4XVUD 5ANMB 1BPLB 3FU5A 3PHOB 1PFOA 5CGYC 4I77L 1M1SA 1YQVL 2WCSA 1XH2A 3WLWC 5I16B 3R4RA 3NIGF 4IRZA 4HG4J 4AQZA 1SHXA 3FTUA 3OF6D 2FBOJ 3FAXA 5G2NA 4QRRD 1BLIA 1AXTH 3RVXD 4GAYA 2YMTA 2X7LA 3JV5A 4MZIA 1ZAGA 2ORBH 3FQTB 1ULVA 1SEBA 5KSUB 2HUHA 2GABA 4OT1L 2J1ZA 3QFDB 4UBDD 4IU2B 5CFAA 3GSUA 4M1DL 5B4MD 2YAEA 1IFGA 4MBRA 3MLXL 2BNRE 2QVMA 5M95B 3LEYH 3QIUA 3FZUC 3ZKXB 3GSVB 4XGZA 2Z0BA 1S8DB 1YY9C 2Y7MA 4KKCC 1IBYA 4NAMA 1SHSA 4HUWA 4MAYC 3VGDA 3BUYA 3GNML 2F54A 3MRGA 4LLQB 1IBHA 1PZBA 5F1OB 5F3HA 2VZTA 3DX8A 5GGSB 4J3SA 1QP1A 3LN5B 3K2MC 5ESAB 2B5IC 1RZFL 3ZIYA 3PDGA 4HK3N 1R24A 1JF1A 3HI5L 3IU4H 4XPGH 4YC2C 4JR9L 4MB1A 5E1AB 4ZYKB 3VFOA 4U1MA 4G8IB 4DK5A 4CJ1A 2AMUA 5EU6B 1VZGA 1L9MA 2VMFA 2K7QA 4AI7A 1FC1A 1QFHA 2DJUA 2LFGA 2PYFA 1J1XH 4AGNA 5F7UA 4IOSA 4H13C 1MLCA 3SCMB 5KZCB 3FUHA 4HP5A 4WJG3 3MRCA 4RZCB 4L3FA 3ULUH 5G5DA 3TFKD 1A2YA 1IC5L 3LVTA 1PLGL 4K7PL 3U2SB 4LLAA 3ZKMD 2WAQA 1XGYL 4L8BB 4PGZA 3TU6A 3F7RA 5C09B 2RIKA 2JSFA 3FN0L 5E6RB 3WXWH 4BQCA 1YEIH 4POYA 5J11B 3ETBJ 3NJMA 3PDOB 1E7UA 2R69H 1SEQL 5CJXA 3F5WA 1OPOA 5DHVA 1X6NA 2BNRD 5CCHE 2DQCH 2H6OA 1L0PA 2FSEA 4WW2C 4R9HA 3T2QA 4ZZKA 4KZEH 3C5JA 1LE5A 2NY2C 1BYNA 2IBBA 1OWWA 3LRKA 2VWEC 3QIBC 2R23A 1OTTC 3L48A 3CZFB 3QIUD 4P57B 4PRPB 5I9QB 2VLLA 4PJXB 4GG6E 4IOFD 1Q94B 1ETA1 1FZOB 4FTVD 2KPNA 4MCZB 4Q14A 5JTWA 4QRFA 3CHSA 6PCYA 4TS6A 4JE4B 4HAGA 5IV2A 1OIOA 2A4EA 3JV6B 5B4MC 3V0DA 2DQEH 2AABH 1AG6A 1I4FA 2W1NA 4OZFG 3HZKA 1RZKH 3KCPA 4EKXA 4JREC 3MNVA 1HOEA 3VRLF 4FJ6A 5J8OA 1F45A 3FQYA 4LEXH 4U05A 2I5YH 3CCHA 4JQVA 3GLAA 4O58L 2D4DA 3U7WH 2DJMA 2J20A 5KYYA 3SQOH 3RKDC 1YCSA 4I8DA 1YEKH 4LVOC 3RIKA 3H6AA 1A3RL 4BSVA 1CXFA 1OAUH 1UT9A 1VZIA 2IAMA 2R1XB 2R59A 5EOCJ 1A65A 1IQWH 3N40F 3QDJB 1XGTB 2V9RA 4FI8A 1GVIA 2DPKA 4F7EA 4MA8L 2W9LA 2D9QB 2XN1A 3WGUB 1H5BC 5BQ7A 1G0YR 1U91A 1WWCA 5FPIA 4XXDA 1AGFA 1CXHA 4HKZA 3T4AC 1B2YA 1SEQH 1FE8H 1WC7A 2B20A 1EZVY 3VH8A 1CE6B 3BH8B 1B4LA 1FA4A 5CJBA 5EU3B 5AW7B 3PAVA 3C6SA 1XAUA 2ENYA 3P30H 4QRSB 1MCDA 2C9VA 3A6BH 3NJXA 4U3SB 4NQCB 2FUTA 1HQRA 3P77B 3HNTH 3Q3GA 5HGBA 3JT2A 5GRXG 2W5PA 3CLWA 1QAWA 3BUQA 5FO9A 32C2A 5E1GA 4PJ9D 5JOFA 4WHCA 3EO1A 4AGOA 3QHFL 4NDMB 3UROR 4ZBJA 5CR8A 1MCWM 3MRDA 2WQRA 1E6JH 4J4PD 4TVPH 4Q97A 2VDMH 4F2EA 4OM0H 5A16A 5J13B 1JDAA 4KTDL 1A14H 1A6UL 4N28A 1CUOA 5J5EA 4H44C 4F27A 3BFWA 4AKQA 3QXAB 3LZRA 1NOFA 3OLEA 1F3JB 1ZANL 3MREA 3T8VA 1DJIA 1T7ZA 5DQDH 5E8DH 2GB2A 3MODL 5ACMA 2C3XA 4B9FA 1WD8A 4JFWA 2DLGA 5C0CD 3WNOA 4KPHL 4KXZH 4Y16A 5TF0A 2G5BB 3B9KC 3B7RL 3RU8L 3GRWL 4JG5A 1ZPLA 3AT9A 3DHPA 5DD5L 2OMYA 4G5ZL 2QR0A 4EO5A 3HC2A 4HJIA 1T0NB 1GKOA 3GC3A 4GSDH 2DQUL 4HA1A 3HG3A 3STBA 4BA0A 4ELKA 5BZDB 4AG4L 4A66A 4Y2DC 2Y3NA 2EO7A 1TJGH 4BK4A 1HH9B 5F0MB 5GRWA 2IV9A 1AQDB 3NJFA 4QEGA 1DO6A 3HPJB 4PJEA 1JXJA 4PWIA 4BKTC 2XXCB 2G9KA 4J8RB 3TCXA 1T20B 1RFDH 1OAKL 3S35L 5DVNA 1WZMA 4HGMA 4Z7VE 5ESQB 4GW4A 2YAQA 5BRPA 3TBSB 5KVDE 2NX5B 1CG9A 3HMXA 3PJNA 4LU5H 3IDYB 3ZL1A 4GINA 2D7MA 3KEHA 1P0SE 2VXVL 4AGLA 4FTVB 4HUNB 3SDCC 2XV3A 3O4LE 4TLUA 5DT1H 2CO6A 1JF1B 3AQXA 5E1AA 5B1JA 3GSWA 3MLUH 1CGSL 1ECYA 5DEGA 1G7LA 2F19H 1JK8B 4RNRB 3DSFL 3HN5A 2XN9E 2XQBL 3UO1H 3OKLA 3KJ4B 2GTZA 5EU6A 5C0CE 1FVCA 5KAQF 5K93A 1J5OL 1JXDA 5JZ7C 5KSAD 2X4NA 1R5WA 2AXFB 5FOBB 1M1XA 2C4XA 4LLMA 4HKBB 2PWEA 1HIML 2C34A 4OV6F 1X9UA 2DBLH 4FNLL 4LCCC 3VGAC 4MJ5A 3ESPA 2EO9A 1LEKB 2FD6H 5CJ5A 1T2XA 4GRLD 4EQ2A 2VDOL 5JHBA 2FNWA 1DQTA 5DSCA 5C07A 3TN0D 1HHHB 1AGFB 2KC0A 1UM6L 1YEJH 4O9HH 3MCKB 3D2UD 2UZIH 5HHOB 2NOYA 4F7KA 5I6OA 2EICA 3QIWD 3SGDH 1E9QB 5JORB 2Y2YA 1N4XL 1U58A 2OJZH 3O6FB 4OF3A 5F9DC 4BSVB 2BFVL 4OZ4A 1TTGA 1P7KB 3QGVA 3UTSB 2NT1A 3EO0A 3AU0A 4PJ5A 1I3GH 4HIHB 2EIMB 2ZXEB 1WS7A 2QGEA 4KO6A 3I84A 4P5MA 5HHOE 1BEXA 1NEUA 1HU8A 4PJ8C 4WHTB 4E36A 1K8DA 3BXNB 2I69A 5E9AA 4IIZA 2F1EA 5HHME 3HOGA 3DDGA 3DXAD 2DQIH 4LSTL 3R0NA 1N2RB 5AB0A 5MEPB 3FW6A 5EU5B 3BAEL 2PKDA 2XPYA 2V5YA 4QT5B 5AOLA 4CGTA 1EAQA 5C7ZA 4L9LA 4R2GB 3E80A 4NCC2 3WD5H 2XN9B 3SE4C 1RK0A 5C86A 3L3IB 1RZGB 2W81C 4YGVB 2EH7H 1JZ4A 1UGNA 3C60D 1W6LA 2VR4A 3QUMB 4HJ1A 4HXBH 5FX3A 4F57H 3MROB 3TFBA 3WFDH 5E08H 1CDCA 5AQ0A 1W0VB 3RB7A 5IQ9B 4OGQC 2YOCA 1YUHB 1L7TH 3G5VA 4H1LG 4YUEL 4UDUB 4Z9KB 4N86A 4J3OD 1OCOB 1HHIA 4NCC1 4RRPA 4BD4A 1KSRA 4BFJA 2DIBA 3KM2A 2WLIB 1MFCH 2B39A 4HUXB 4FLSA 4LO9A 5FCUL 3ALXA 3AS2A 1GGCL 1A4JB 1ZHKA 5E2WH 3VXMD 5KANI 2G2PA 3MTRA 4XNQB 2RCSH 3BMVA 4FQLL 2YS4A 4BQ8A 1LTXA 4DP2X 1TZHB 3HA0A 5FYJL 3N43B 3CK0L 4RGMB 1U8IA 2K1MA 4ODXB 4WEBL 2P47B 2ITEA 3MLWL 3IFNL 2OSLA 4PJGA 4LASH 2Q6WB 1AXTL 3L3OA 4NQXA 1G4RA 1QUNA 3G04B 4HT1L 4E2OA 4HWUA 4JFFB 3NABH 2FRGP 2YEZA 3VFOB 4PP2B 2PETA 3K91A 3D39D 5ESAA 1HZLA 3FCSA 1XGUB 5I9QC 1N5YH 1BSIA 2BSCA 3DYOA 2CU9A 3NFNA 3RL2A 3GJFB 1ZANH 3DPBA 3TBYB 4PU2A 3MVSA 4CU8A 2XOTA 3UYPA 3MV9D 3QCTL 5F3BB 2AQRA 4D0BA 1WBYA 5DYOB 1L5GB 3S4SA 1RJZA 1CLYL 5AZ2L 5IBLC 5HI5C 3VI4A 5J9PA 3WTWA 1WTLA 4CMMA 3RWHB 2HA1A 2EEDA 4EN3A 3RGVA 4OTXH 1S78D 2XZCH 4WW1A 2ADFL 4DEWA 1SFHA 1G43A 4FL4B 3KWVA 3E2HC 3FXIC 1AOZA 1NIBA 2ZYIA 5D1QE 4PJHB 3SKMA 1E4KC 2EYRA 1TSRA 1U8MA 3L7EA 2Y2WA 3QORB 4NKDA 4G70B 1MPAL 2CGRH 3SZ6A 4AQAB 2IGTA 3QUGA 2BS71 4W9CC 4MS6A 3QO1B 3OXSB 3D39A 2WSPA 1PKOA 2W60A 2MMXA 3JWOC 4GRMB 4YHIA 3TZVD 4X9YA 2X38A 3KS0J 4JRYA 2WQXA 1OSPH 4HH8A 1XH3A 5C2BL 3SKJL 3FT2A 3GXNA 4OD2A 5CZVH 2DJSA 4RDQF 4HD9A 2EDHA 1NAKL 2OSXA 4G83A 1T89C 4J3OC 1TSHA 4LDEB 5IV2B 4YHML 1NAMB 2R0WH 4N6RA 3KBEA 3WS6A 1A4KA 1HOCB 4Y19D 3VXUA 4M61A 1VF5C 1OLLA 4QGTA 4URKA 1IJ9A 4NKQB 4Y19E 3T04D 5J3HD 1DVZA 3I3DA 1G7MB 4ZD3H 1JD7A 4U1JB 4UQ2B 1L7TL 4LSSH 2K6YA 4KX7A 5K9JH 2FTAA 1PY9A 4WTWA 2CQVA 4N5UA 2ZF9A 4RGMC 1N6QL 4M5YL 4Y5XB 4HWBA 4QKTA 3V10A 3AUWB 3MV9A 4P9HC 4XCNB 5SWQA 2PO6D 3A23A 3BCFA 3TCLB 5MERA 2F7QA 2PP8A 1U58B 2FX9L 5IESH 4WU7A 5FR3A 2XI9A 1XV8A 2H6PA 1TZ8A 2VLJE 3L3JB 3L7FB 2E27L 4HBCL 2CUMA 3ULAB 5AYUH 3WEBA 4DCQB 2HFFB 3II1A 4NAJA 3WJMB 4GJTB 5BVPH 2Q87A 4JAMB 5FYKU 4Y5VA 4BFFA 4Z7WF 1IEBA 4HUUA 1IVTA 1KLUB 3BGAA 4C4BA 1JF6A 1ZXQA 1XEUA 3U30B 2ZT9C 2J73A 1QTYT 4LZKA 2J4WH 1QRND 4G8FB 2X09A 2AITA 1GKEA 2CO7A 3JZ7A 4PJDA 4MXWL 4UTCA 4KUCD 5D7EA 1CJYA 2X4NB 3CC5B 3ECUA 3SJVE 3NQKA 4E9RA 1U8NA 1U8HA 3TEZA 5FYJU 1T03H 2BHFA 3LNEA 4Z7NE 5B3JF 3SD5A 4DTGL 3K1KC 4GXFA 1PMYA 2HRPL 3PXJA 4LOFA 4ODTH 3UPRA 3DUSA 1J8SA 2ZKXA 3CFBA 4LLYB 4EI5D 4JO1L 1AACA 4NRYB 3ZHNA 4XCYA 4PJ8B 5T1DL 4TRPL 3D07A 1E3ZA 5IIEA 3AZUA 3IDMA 5C71A 4KNTA 1TLMA 3VW3H 3TTSA 2EUZA 4BK5C 2JCCB 3RDJA 5GZND 2WQWA 3UZEC 4XT1C 2V3EA 5IJVA 5CU9A 2OW7A 3GSNH 1JPGA 3DI2B 2UZIL 2GFBA 5I8CB 5K9OA 1V7NH 2RR3A 5F89B 3MSPA 4OI7A 2DS4A 4JPSA 2P49B 1CK0H 5HGHB 4K3JH 3OG6B 4LPCA 6CGTA 3QQNA 1A9EA 3QI9B 1BFTA 4X7TB 2GSIB 4MXQC 2DIAA 1SLWA 2Z4TA 4HLZG 2GI0A 2IPTH 5I19H 4XCCL 4IKKA 5CUSL 3KAAA 3MOQA 4CU7A 2V8LA 4ISVA 2Q1EA 5F0JB 1TVBB 3KWWB 4TVPL 1GCFA 2ED6A 5DD6A 1W8NA 4HJGA 3L3DB 4C4KT 4F91B 1ZT1B 1ED3A 3V8CA 4NQEE 1OCCB 1TQSA 2BZDA 1N8ZA 5EBLA 4ZI8A 1S7SB 4GAJL 4LU5L 3ZE1F 3TO4C 4HKXA 4HIQA 2H45A 5GJSH 3BAXA 1MAKA 3WEXB 4RBPH 5C3IA 3M8OL 5HYSB 4JQIL 3QT2A 4PV8B 3JWDC 2I60L 1OK0A 2YFNA 5DJDA 3ZKSD 5T1MB 5IW1A 1EHLL 4PJIA 3DUSB 2E6JA 1CGYA 4LMQI 3N50A 3G5ZA 3WDIA 1H3PH 3CAFA 4NENB 2OCJA 1EX0A 3WI9A 4FMKA 4R4NC 2AJYL 3B9KD 4WI4A 3HHRB 4NDMA 1U95A 5E00A 1XGUA 5IMLA 4PLOB 3GXIA 3IDJB 1QEWB 1LXMA 2GK2A 3IAGC 4GXUN 4FFTA 4H8HA 4XCFL 5B7MA 3SE6A 4AENA 1GGCH 4YNYA 4TVPE 4ZODA 3HS0C 3RI5K 3D0LA 2JH2A 1E90A 5GJTH 3ZUNC 4YBLC 3NK4A 4AL8C 3KD4A 4DO5A 3V9CA 5L4MA 2F53B 5KVMC 5I71C 4MMZC 3S3DB 4LARL 3SE3A 3M45A 3Q6FA 1MI5E 3MJ9L 4TQIA 1YECH 2QBWA 1MIML 4PJHE 4BV1A 4YSEA 5MEND 2M1KA 2V5TA 3GZPA 2YQ3A 3GI9H 3O3EA 3L3JA 5AW4B 3FUDA 4Y0GA 1HKLH 2BP0A 3RIFK 4RMRA 3B3BA 5BV7L 2EE9A 4XPTL 4XVUC 1MZYA 4GBXA 4BBWA 3WO4C 3MZTA 3QHFH 5J89A 1INEL 3MGAA 4F2FA 3TIDA 4R97B 1QG3A 5DTFA 4U1JA 4WO4A 2F2HA 4H26A 3RPKA 2EUXA 4OM0L 4PBVC 4YAQA 1KCBA 3QJZA 1GMIA 1URLA 3LB6C 2OTPA 4UI2A 2VDQH 3G9AB 4IRZH 2D31A 4XBMA 1P7QD 5C09E 3CH1A 4MCYA 3KWUA 1GL4B 3MLXH 4KKPA 3VXRE 4K8RL 2VB5A 2G60H 3KYKH 4HHAA 5EZLB 3FRPG 2DTSA 5A6LA 2HG5B 4PJ8D 4Y5VC 3BVDB 2X9YA 1VSCA 1F1DA 4YSDA 3REWB 2R2BA 3WL9A 1S5HA 4XI5D 1HE8A 3FO0L 4HCRL 2AERT 4OIIL 3SQBB 3SY6A 1CDBA 3GS4A 3GJEB 1IE4A 2WLMA 2X5PA 1IC7H 4DPCX 1TZIA 5GGQH 3TIDB 4DAGH 1MZZA 1SXAA 4XZUA 1U3HB 3HUJB 4OI8A 2J43A 2Y36H 2XWJA 1M9WA 4W4NA 5ANME 4H2AA 4U7KA 3SKJH 2OA9A 4OKVA 1UJTA 1WP6A 4W4OC 4GKSA 1BLNA 4HULB 1H8SA 5MHSD 4N90D 2IGLA 4HV8B 4NO0A 1H6FA 4O02H 4G8GA 1MHCA 1IM3B 2YKKA 2PTTB 5GS1B 4H8UA 5I23A 5GRVL 2WINA 1PLAA 4PJ9A 1FVEB 1ZWIA 5D1QD 4TKWA 3S0PA 3SPVB 4W6XB 1AHWA 4WQOA 4ZMXA 1IAKA 1AI1H 1MUJA 4M8UA 4O51A 5ICYA 1OGAD 4W4OA 2ZICA 3VJ6B 4E42A 2FSDA 4D0BB 3FO2B 4A38A 1AYRA 3S5YA 4U6XB 4X4MA 1OF0A 1HZHL 1MCOH 2WLZA 1WAAF 4G42B 1FNFA 5FYJD 3SKOA 3ZSSA 3MLUL 3QNXA 4B60A 2P80D 1R5WB 3EJYD 2VLKE 3C5ZC 3OKDB 1PD1A 4ZO8A 1QUNB 3G04A 4QRPB 4UUJA 4JKLA 1JNJA 5DK3A 3QORD 3TWYA 2F7OA 1I31A 1C9SA 5DJ6A 1MCHA 3N41F 4ZFZB 4NP9A 4JQXC 5IEKA 3BRDA 2ESVA 5IY5B 1FJ1A 1BWMA 1D7DA 4KJYA 1BJ1J 5I1DB 3V4PA 1U8OB 1AH1A 1IE5A 1V7NL 1UH4A 3RWJB 1CR9H 1BEYH 3INOA 4WFGD 2MNJB 1ORQB 4S0SD 3LDBC 3RYMA 1WBXA 1UM6H 4XMLH 1T1WA 4XP5L 4YBQC 2ZP9A 1J1PL 3U1SL 4JFPA 3BJLA 1Q0YL 4QKXB 4X4XB 3VNYA 1P1ZB 1VKXA 2F53D 1UM4L 2YZ1A 1F58L 1HINL 2BHZA 4PMFA 3WKNA 4AGPA 5ALBL 5AKTA 4RETB 3M1BA 4B96A 1YPZB 3ZE2F 2R0LL 3UIZA 2QV2A 4JDEB 2YR3A 2AXHA 3Q5YA 1A7RH 2DJ4A 3CVHB 1QSFE 3UXFA 5JW5A 3ARED 3EO9L 4AV0A 3SCMD 5GJSL 1PD6A 1NDGA 5KZCD 1WRFA 1MRFH 1JP5A 4QT5A 3NIGE 3BOVA 5TK4A 5AL0A 4K55A 1OWRM 3FK3A 4KDTC 1GTNA 5LN8A 1KPVB 2PO6B 1A14L 5CLTA 4CVUA 2AJVH 2OQJA 1FNHA 3IKKA 2HT4D 1T66D 3ZYIA 1BVNP 1PPIA 5KS9F 1YEFL 2PP9A 3FO1B 3MX0A 5D71L 5LXVA 3QS3A 1IEAB 4ZPVB 3BQUD 3F01A 1OXYA 1PYWA 3IF1A 3NIFF 4PRBA 4UNIA 1X5GA 4MA3B 4PRIB 3ILEA 1DDTA 2BC4B 2EIDA 1FJ1B 2RQ8A 2XBTA 1T1YB 3WTSA 2GYSA 1T5WB 2UY6A 2IWGA 4QTIL 3LIZH 4YL4A 2ZWNA 5HBBA 3BN9D 4GEIA 5DXWA 4CVXB 5GJTL 3CVBA 3L3KB 1KB5L 4Y4HD 5ADPL 2WSDA 5F7HA 2NZ9D 3VU2A 3T65A 1F8TL 1K5NA 1JZ3A 2IFGA 3PGFH 3WG7B 3WNMA 5DUBA 1KOAA 1NBYB 2E75C 5F93C 1QASA 3TV8A 4FQPA 4QHUA 3CZEA 2PO6C 3UC0L 1MJUH 3KVQA 2Q7AA 2EDTA 1K8IA 3EDFA 5BRZD 1VLXA 1AS8A 3DX7B 1JSYA 3S35H 4D94A 5FW6A 5IZ7A 1LE9B 2JFCA 1RK1B 3QUYA 4F80A 4GKNB 4JGJA 4NO5A 3R06A 4QI3A 5TDPB 2QPSA 4L1LA 4OZHB 1EHLH 3MOBL 3GMRA 4P9MH 2MOQA 3BGFB 3QRBA 4XC1L 2WBXA 4APQD 5GS1A 4GP8B 3MODH 4OCMC 5DA0B 3S4SG 2HTLD 2W95A 4H8WC 1ODUA 2OM5A 1BFOB 3DIFB 3GMLA 4PRDB 3G6JE 1S7UA 4IMKC 5AL8A 1J9QA 1P4BH 2X6VA 4L4TA 2ILLA 2Q8AH 4KJWD 1U8QB 5TGBA 4KXDA 4H0IA 1G1KA 4EOWL 5I82A 4LKCA 4LHUA 2GJ6D 3O8XA 5E5UB 5E70A 5EC2A 4U1IB 3HAEH 1JDDA 3H0TA 4KNSA 4HX1B 5I1EH 4YPJA 5BVPL 3FQ2A 1UJ3A 1BM3H 1MCFA 4EDWL 5IGXH 4U1KB 5HY9B 4BM7A 5MP6H 5L9DL 2YUXA 1TEGA 1WZLA 4NQCD 1G7QA 5A1AA 5IKCB 2WXNA 3DIVA 5T3XD 4K9JA 1G84A 1I8UA 2EKSB 1KIRA 3N1QC 4HMCA 3BCDA 4M5ZH 3O41B 3HC0B 1V3JA 5F8RC 3TVMB 3H85A 1AS7A 4Y1AA 3HG2A 1MLBA 4XRCA 1LO0L 1KB5A 2AEWA 1EBAA 4YHIB 3C60A 3T8XA 4RMQA 5C0EA 1FL3A 3H2WA 3SDXF 2EDQA 1T6WA 4GUPA 2B08A 4R6UA 5TDOA 3K2UL 3CBRA 3CQPA 4B53A 1MCQA 4Q6KA 4J5VA 2XZQL 3EJQA 1BXVA 3LPFA 4QYOB 3RPIA 3UTPE 2XTJE 1VGKB 3FHQA 1KZYA 3PWJB 3RL1B 1REIA 3EIFA 3DRQA 1RUQL 3CFDA 4JZJC 1EO8H 1OAQH 2N4IA 3BVNA 3D85B 3UJIL 4X6DF 5FYKL 1AZBA 3ARVA 1CD9B 1KEMH 1OD7A 2CXGA 2X4QA 3FRPB 1E2ZA 1FNEA 2DWSA 3EOBA 1TTFA 4HQQH 1UB5B 4JM2C 1U3HC 2C3VB 4O4YH 3HFFA 3TA4D 1HSBB 1NCBL 1DQLL 1XB6A 3OPUA 2HRHA 2BIHA 3WXVH 4DKFL 3RZCA 4Q9QL 3C5SB 4XPHH 1JPST 1GYWA 1OTUC 1MCCA 1SJVA 5AENA 1UXWA 2AJVL 4L23A 3ZO0A 3BIKA 5EPMA 3WNKA 3WIHA 1EEZA 2P5WD 3E9TA 3VYNA 4XHJC 4JFFA 1DJHA 3WFDL 2RD0A 2NX5E 5DMKA 5D71H 5JIKA 3S96B 1HXYA 5BV7C 2ZG1A 3T0VA 4Q9QH 3MV8E 3CPLB 1X5YA 3DRTA 3JVFC 3GSQA 4UT6H 1QRKA 3GRGA 4XX1G 4XMXA 1RJLB 1WFMA 5JO5A 2O5YL 4EI5C 4L29B 2B2XH 4JFDB 1QA9A 3ATBA 4JDVA 5D7IB 1AD9B 2EKJA 3B7SA 4BINA 4KKRA 4AJYV 2QQKH 3U9PL 4FFZL 1BQLL 1SJEA 1S7VA 4K5OA 3D3VB 5C8JA 1S8DA 1IMHC 4BH7B 1WCBA 1ZSHA 2MTPA 2R0KH 3BLKA 3MUZ1 4Y9GA 5DZLA 3WO4B 1OAZL 4F15B 2D3NA 2VLME 3MRJA 4IEFB 5BQDA 4PJIE 3ZDXB 2WVTA 3B2UD 3FB5A 4LAQH 1KCSL 3IDIB 5DVMA 1BQLH 4G3YL 1T1YA 5K1JA 2BOCB 2Z7UA 2BINA 1CFQB 3L17A 4I2XE 5H37A 1KLGB 4WI5A 3SGEH 3BUDA 1ZHBA 2X3AA 3Q1EA 4JFFE 4DGWC 2HTKD 3T65B 5KSAB 3RWEB 4U1GC 3LPGA 4EXKA 3HRPA 3D3VE 2FH6A 3P3UA 1F97A 1MI5B 2ED7A 2H3NB 2VLRE 4YBLB 4OF6A 3Q06A 3MAWA 2XKNB 4QAWA 3HZYB 4NC1E 3OAYK 3U2IA 5BS0D 3FH8A 1MREH 1MW1A 4V2BA 5KOVC 5IOPB 5FS5A 4EQ3A 1MAML 1MVYA 4PRIE 2DBLL 3II3A 1QBLL 2Y4SA 3PDDA 1U2HA 2XXMB 1AAJA 2YD3A 4CJ0A 3QUYC 1JHLL 4ODVH 2RGSA 4BFIA 4FFVD 2IALA 5CUSH 3FQRB 3IAPA 2D7NA 2D73A 2GJJA 3OSKA 5SWSD 5I6NA 2ZCKL 4LB8A 4OCLC 3WSQL 1Q9WA 4H25A 5HXMA 5D5MA 4FTDA 2EE6A 2X6CA 4FQIL 4AK1A 4OAWB 4D9QE 5B39A 3G6DH 1UACH 3NCBB 1E8XA 4FCAA 1Z3GL 3FFDA 2B0SL 4DP1X 2O1AA 4AOFA 1RXLA 3O2WL 4LGPB 4X99A 3IJEB 2W91A 3S98A 5F7EH 1I3GL 3T1WA 2D3JA 2XYCA 2WYHA 4IHOA 1HT6A 3S34H 2UYLA 3BWAB 4Y2DA 1JZDC 3GMMA 3T9WA 3NSCA 1KFAH 2ESVB 4OT1H 4XN4A 1WHPA 3KXFA 4JM2D 3V4PL 1DEEA 3V9EA 1YQ2A 3DBSA 3KH3A 3GKZA 1CYGA 1LO5A 2YA1A 4RFEA 4N2OA 4L5FH 4NS0A 4NSKA 5EN3A 3CFUA 5HGAA 5A2IH 1OCWH 4Y16C 5SWQB 2WZ6A 1R47A 1A21A 3TBTA 4PCYA 1AGCA 3LKPB 4N0UB 4Z3FA 4OZGE 4JVWA 3IMVA 4EDWH 3LMJL 1CMOA 2EVFA 1O7DE 5J56B 1SYVB 3SE8L 1Y6KR 1IL1B 1S5IL 3DO4A 2XQYG 1L9TA 1BVZA 1UEMA 2VMCA 4AIXA 4FQ2L 2AQTA 5BW7C 4I0PA 5LVEA 4M5ZL 1D7CA 3NJLA 2XWTB 4L3ED 4TM9A 1EDQA 3RWCA 2X88A 3IU4L 2Y22A 1U8PB 5IQOA 4NZUL 4OIFA 4F7TB 4DO4A 4U0QB 4KK5C 2DL2A 3W3BA 5I75B 1HEHC 3TA3C 5D93C 3CMOH 3P4MB 1T20A 2R1YA 1NANI 2VN4A 1DYZA 3VSUA 5LBGA 2F7PA 4MD5B 4P4RA 3N55A 5DQJA 4GAGL 2O61A 2HFFA 4GSRA 4TTDC 4YSOA 4EOWH 4NJ9H 2VXVH 4GO8A 1FNSL 3GEWB 5F7KC 2YKLL 4PGBB 2NY5C 1IGJA 4PVNA 4TQHA 2JXMB 3QA3A 3PABA 4PY7A 4QRAA 4LFHG 4PJAB 2W80C 4BKLA 3GBMH 5IHZB 4OZFH 4TPRH 4XH2B 5B3NA 4KTGA 2WAHA 3T4AA 3JUZA 4M7ZB 1MN4A 3QDJD 1E2WA 5CWSA 1RUPL 3G5XA 3BT2H 4LL9A 2G75B 4L37B 4QCIA 2HMID 1ZIBA 4XTRD 2ZAIA 4HUMB 2IQAA 4DO6A 5I8CA 5EZPA 5I6LA 2JTYA 2P45B 3PG2A 1S9VB 3AMKA 5D1XD 3SO3C 3N44B 2HTLC 4HMDA 2W0FB 2ZUQC 4HPYH 2JCCE 4UINL 4W9KC 4X98B 4Z7VF 3LIZL 1WIUA 4K73A 1PZUB 4DWHA 4YXLH 2DI9A 5DDHB 4JREB 3U9UA 1SYVA 4JRWA 2LVCA 2GUOB 2CHXA 5JHDB 4R90L 4U7SA 1XSJA 2V3FA 3FCSB 4IM8A 1EHXA 3QXWA 2K4AA 1JRHI 5T1KA 4ZFGH 4UTAH 2XWBB 2A83A 4BDVA 4Y5YA 2XN9D 3L4TA 2MPVA 1BX2B 3L5WA 5DJAB 2DQDH 1AHKA 2OXGB 1M53A 5IFAL 3VFPA 5KJ4A 3FFCD 4I4WA 2EIZB 4KMTL 3LSOB 3DOSB 5F70A 3CU1A 4P4RB 5E1QA 4YHOL 4KRMB 1CE1L 2APVA 2F53A 3PV6B 5IQLA 4M1CC 1E6JL 5JDJA 1ZPUA 4Q58C 5I18H 1AANA 1HK6A 2TSBA 4DN3L 4PIRF 4XP4H 2VSMB 2QHRH 4GBXC 2ZYSA 3ARDC 3K4ZA 2F9BT 5H37G 1TJIL 3O0RL 1SHMA 3WIIH 2Z8SA 1BVLB 4I1PA 1C7SA 3UG3A 2ZKMX 4NC2B 2WIMA 2NY6D 3ES6B 1IC7L 1G6RB 3QPXL 5DMJB 1QYGH 3NT0A 5IVXA 5EOTB 2X4OA 5EIIB 3SCMC 5KYYB 3U6RA 1PD0A 2DRUA 4O9HL 3KGSA 4P5TC 4BFEA 2X2UA 3AXLA 4QNPF 5K39A 3N9GH 5CMAB 4MX7A 4F58H 1A8JH 2HPTA 1VFAB 2NY2D 3Q2CA 4L5FE 2KMWA 1X5KA 5EHFA 1DJWA 3OHXC 4YXKL 2WYZA 4NKIL 1RJYA 5AOIA 4JHAH 4OJFH 2CDFB 2CM6A 4XVSL 5DWUH 1IZJA 3DX6B 4U1HB 3I6LD 5BO1L 1XF5B 3TBCA 4AUUA 4PLKD 1E0OB 1A4JA 1ZHKB 5D4QA 2F74B 3P3RA 5D1QA 4Z7VA 5CF3A 4WV1A 4LBAA 2EYTB 3PL6A 2GIYA 4WFHE 5F88B 3P4LA 1DN2A 3OKEB 2OMVB 2ZWKA 4TTDD 1RURH 3RPBA 3ISRA 4JVUA 1OV8A 1KBBA 4M9PA 3PP3H 4ZX5A 1ERNA 3EBIA 1UYWL 1A3LH 3WS3B 4GUOA 4M6AA 1SJEB 3GMPA 3L81A 3ZX1A 3ZQWA 1KTBA 3NG5A 1HNYA 3RE0A 3ULUE 1BZOA 3AAZA 4G9FE 3V7MA 4O00A 4YDVB 1EERB 5GS0D 1N0LB 5FYKD 5DJ0B 3MGTA 3IPBA 1CICA 2L7QA 3ASNB 2J12B 3GPEA 1XGPA 3GSQB 4FQXC 5CEZL 1Q0XL 3OBAA 3FSZA 5J4MA 2IANB 3PJSB 1YEHL 1GGIH 4P5TA 1NLDH 1OGAA 5HDRA 5IW3A 1G9MC 2QVKA 2R0ZL 3P02A 2NDFA 3INUH 2VW4A 2WNKA 1OVZA 4WO4C 4DZBB 3VFNA 3FYIB 3GM0A 3RY4A 5FYJH 1UQSB 4NRYA 1RLBA 2Z91A 4YJZL 4WTZG 4X6EB 1II4E 4XMKL 5I1KL 1JD9A 3K8KA 4XO3A 4A6YB 4ABQA 5TDNA 1MEXL 2MCPL 2WGNB 2ZAGA 4NZTH 3PUUA 5E99L 3DUUA 4KPHH 1DL7H 3MR9B 1QRNE 2KL6A 4A39A 4ZFQA 1AHWB 3BSZA 4WUKL 2IDCA 2NNAA 5E8OA 3IXAB 1KXQA 4XI5C 3DA0A 4E9VA 4I0KA 1JMXA 2I26N 3MNZB 5E08L 4KHXH 3VFPB 4IDJL 1MVUA 1QA9B 2IIJA 3GJFK 3GK8H 3ZSTA 3X11A 2XQYA 3BRGC 3FTYA 4Z76B 2B3RA 3KPSE 1SDDB 4H8WH 3MJGX 5DK0B 3RAJL 1ID5I 3I3EA 4YHPB 2F8XC 4X6DE 1A6WH 1FYTB 4HS3A 2NY1C 1XT5A 4R2GD 4ZOCA 1IGJB 5INDB 2EJ1A 2ZXBA 2IPKB 5HDQH 1JV5A 1E2VA 2VXTH 1DBML 3ARDB 4LEOA 5L6YH 4Y5YB 3L4VA 4P2QA 3ZDZB 5MI0C 2VDKL 2D4FA 5SWZA 3S3CB 5B1BB 3K5SA 1L9RA 2EZ0D 1SMOA 3BX7C 3CZJA 5J3HC 2UWEA 3G6AB 3W39A 3RKPA 1OW0A 4HEME 4XCFH 2CBTA 3ARFC 4ONOA 2FUQA 2WUCL 3SDXE 3VDCA 2H32H 1SLVA 2XV6B 4J27A 4LSVL 4K5PA 5JIHA 3MCYA 1YEDB 4P3WA 4WNJA 1QI4A 2JKXA 2O5ZH 4X98A 2BFVH 5G4OA 1A6AB 5F9WB 3PQYD 3QZWB 4L4VB 3I6GA 5E0QA 2JXMA 2J57A 3UAEA 2XWEA 4KZCA 2V8MA 4R26L 4E5XA 5E2WL 3VXOB 1NAKH 3DRQB 4HS3B 4Y8DC 4QRTA 1M7IA 4KC3B 3TXAA 1HYSD 4ZMZA 4LCVA 4NKDB 4ZW7A 5D1ZI 3QXTA 4KX8A 4YL9A 3ZE1B 2D7PA 3K71A 4NQQA 1MW2A 3CE1A 2AXWA 1D2OA 3QEGH 1MKFA 2PLTA 2V37A 4MVBD 3QJVB 2BSRA 2GW5A 2ZUQB 4OJAA 2PWFA 3NH7L 1GS7A 1FG2A 1ZTXH 1VGEH 3EG9A 1IKNC 2AQ2A 3QIBD 5E94A 1S78C 1JCVA 4JO5A 1K2DB 4PLJC 1IL1A 1BFVL 3ARQA 5D1ZC 1NFKA 3U4AA 1IZKA 1DSWA 3V5KB 4GNKB 2YMOA 5CSZA 3U2JA 4HU2A 3WLBB 5GZNA 2BNQA 5JXAH 1UUNA 2GJ6B 5L4IA 2NNAB 4JFXA 3VXUD 1QSFA 1IAIL 3H9SE 4S1RH 4J23A 1Z5LB 2Y1VA 2JIXD 1LD9B 5F9OH 3CDZB 5ABDE 1RZIB 1UA7A 2AP2A 4IJTA 4HGWA 4R0LA 2X6AA 4OGYL 1JZ7A 2CK0L 2P1YA 3O4LB 4MA3A 3I3BA 4XNZC 3B7TA 1UCTA 3M17B 4JCLA 1PZSA 3TA3B 5TQ0H 3LOWA 4XP9H 2RBLA 1C12A 4NPYB 5E2UH 4YX2L 1NICA 1QLFB 4P48A 2ZUVA 4OB5H 3EDJA 4ODTL 2VDLL 4I3RL 4YS4A 1KPRB 1QRNA 3GMRB 1Z0MA 4MHHI 4O2CA 4H0HB 1SRDA 3QWOB 1A66A 4MCZA 4Z7UB 5IQ7L 1MF2L 4A7SA 1KF9B 4IIQB 5DC4B 2A77L 1T04B 3H9ZA 3SYOA 3KPRB 4RISL 4EI6A 2DH3A 4A67A 4NI3A 3SBQA 2FH8A 4HJ0D 4QHUB 1X5XA 5E2JA 4H0GA 4PJEB 3OKEA 3WEOA 3QYNA 1IVLA 3G5YB 1Q9OA 3QJQB 4LPTA 3B3IA 1NMAH 5BOPA 3S37L 1BF5A 1RSYA 4LRIC 1QACA 4QHLA 2WC7A 2SEBA 4FHKA 1R9FA 3N40P 1K4CB 2NY6C 1FYTD 1S7QB 3ARTA 1OL0A 4A7TA 3NN8B 4UT6L 1QLEL 3CZGA 4PJ5E 2WXFA 4OVUA 4XNYH 2FBJH 3OAYH 3OR6B 2AABL 4JFHE 2WNXA 1O6SB 1EGJH 4ZMYA 4X50A 1AZRA 4PCKA 5KVEL 2AJZB 1RLWA 2NQDA 2IANE 4PREB 1FP5A 3NYKA 2M8XA 3A22A 3FC8A 3EOAA 2ATPA 4XN9A 3VFMB 2F19L 5DU7A 4R5VA 3NIDE 2R7EB 1AI1L 4JDZB 1U36A 4R5TA 1WFOA 4XC1H 4FERA 2NW2A 3MRLA 3VXSA 4DN4L 3E1ZA 1I3RA 1IFHH 1B6UA 5GPRA 3L9RA 4FQJL 4MNGE 2EABA 4JFXB 1N0XH 1U2CA 5EPMB 4CKQA 5C92A 5LG6A 3IJ9A 3LN5A 4KDWA 4RFOL 1AZZC 2QV4A 2GPZA 3MA7A 3DX8B 2C9UA 5LBSL 3VQMA 3SJVA 4C83A 3SBWC 2K9UA 3CH8A 4LSUH 1EAOA 4JKKA 3KPRA 5T3ZE 4Z3IA 3EJZD 1KCRL 5E4OA 4X8XA 3H7LA 1YEEL 4J3OH 4NQCA 1SF3A 2Z31A 5T8IA 4EVNA 1YEJL 2VDQL 2VL5B 1JZHA 2AJUL 1FPTH 3VD3A 1RL1A 1IQDB 3PV7A 1JDCA 4MJ2A 5D7IA 3HE6A 5F7MC 3NRQA 4OLYH 4ZDHA 2HG0A 3P2DA 3TCLA 1BLNB 1FCGA 1TETH 1MI5D 2C26A 1JPSL 1UJ3C 3SGKA 2ATKB 3VGBA 1Q90A 3QXDB 1RULH 5KSUA 3T6XA 3AVEA 2K78A 2ADFH 1J0JA 4K94C 3L5HA 4G7YL 2UZXA 2Y5EA 4DVRL 4F15C 1Q0EA 2XT1B 3IFOA 1UFGA 2VDPL 1EH9A 1P84J 1S9XA 2Z92A 1ACZA 4KFZC 1KV3A 2JK5A 3LEVH 5EN2B 1EGJA 1EJ8A 3UBXI 3EH3B 4P23B 4RAVB 1CO1A 2XZAL 3O41A 4KXZI 2BHUA 2P4AB 4NP4L 4UQ9A 3OB0H 4BFRA 2X10A 2ADJB 4XXWA 1HDMA 2DYPB 2LTQC 2Z93A 4XVTH 3MRGB 3WIHH 2W9EH 3AUVA 4JNXA 1KB3A 3DVFA 3QRGL 3RNKA 3FBQA 4HIXL 5D70L 3DPDA 4YBHA 4D9RE 3EG9B 4ZOEA 1LWHA 4ZTEA 1P4UA 5C9JA 1Q94A 2AI0H 4LOUC 2CO2A 4QHMB 5BV7B 4X9BA 2VLLB 3OMZA 4GI9A 4D8PB 3BZEB 2WVVB 2P24B 3VW3L 3SDDD 1PLBA 4AGQA 1KG0A 3NESA 4LAQL 1BQHB 5FHBL 1WIPA 2H0JA 1BVKA 1BHGA 1KULA 1KZQA 3HN8A 1AIFA 3T3ME 2YD7A 3KPRD 4L4TB 3ARFA 3CSTA 5F8QC 3QIBA 1MRCL 3SJVD 4Y16B 1RUPH 2FL5B 1Q1PA 4J6IA 3U4KA 3K6SB 2NQCA 4ZOAA 4LCYA 5BMFH 5JPMA 2VDOH 2AAAA 4M7LH 1GYAA 4Z0BL 3QZMA 1UA3A 3Q6FB 5IM7B 4FA7B 1A5FH 4GO9A 2G9HB 5JW4N 2CJUL 3ZL4L 4J3BA 1JWUB 1CFNA 4ZMLA 2GKIA 4PB9L 3V0JA 2Z7YA 3QFJB 3C75A 4Z3HA 1JGIA 3GJFA 4ELME 2BP3A 5CXPA 3T0DA 3KH4A 5IMOB 5FFOA 3SQOL 3VWKD 5JHDE 4MJ4A 3TBWA 2FT7A 1GW0A 1PZ2A 3DX9B 3DO7A 4F3FA 4DZBA 1LWRA 3CMGA 4HWZB 2H1LM 1EGJL 3JYBA 4ZW6A 5HYIA 2QFPA 1CYWA 4X6CB 2ISDA 5GGRY 3UYRH 1HL9A 4S1DC 2WTRB 3EYUL 1Z32X 1L9OA 3SN6N 3ZVVA 3OKMA 3GSNL 3K8MA 2XVKA 3UG5A 1RK1A 3QUYB 5C0JA 2YZ8A 1LLAA 4F37K 2DOCA 4P5KA 2QLVB 1T2QH 2BY1A 2VL4A 5FKAB 5AZEH 1HHKA 2XWXA 3FN0H 3WXWL 4E0RB 5BRZB 1N8ZB 4PD4K 1K5NB 3KLQA 3C6SB 1GZQB 2LE9A 4KK9D 1CLOH 4Y1SA 1RIVH 1LK2A 1TQUA 4X7EC 1JNNH 3T3MB 1ORSA 1UOKA 4M3KB 2APBA 3OKOA 4DUWA 1G1YA 4LIQL 3PPSA 1NBCA 4U1GB 1K4DA 4XMLL 2VZ3A 1A9EB 3QI9A 3QUXD 4HIPA 5I73B 3DVNA 3O2VL 2CALA 2ZKWA 3AT8A 3VG9C 5BJTA 2QDWA 4NENA 1VESA 1KB5H 5ADPH 4OZGB 1MWOA 5GGVY 1MCRA 1TQWA 5DHVH 4BWWA 5C0RH 1N12A 5E5MA 3IDUA 4X80H 2D7TH 2ICWI 3BEVA 3H42H 3TN0B 5I71B 5AVZB 3FOMA 1DBJL 3CMOL 4MX7B 5DWPA 2QJDA 3ATAA 1TNMA 4BA8A 2NXZC 4XBPA 4ACTA 3EYUH 3VM5A 4NQTA 4BIKA 2WZ5A 1XCXA 4B0MM 2ADGA 4H1LH 3KPNA 3Q48A 4L2LA 1HWWA 4IYKA 1K72A 1RURL 1CLVA 2XV2A 4LE8A 4XAKD 3WELA 5J06A 3EBGA 5HVGB 3RUGB 2FWOB 1W72A 2I9LA 4HKJB 5E51A 4AYEC 4A6YL 3FN3A 4MQ7B 4MTMA 2EAEA 1ZTXL 5IJBC 3BE1L 5E4EC 2C7UB 2BOCA 1HHKB 2O6EA 3V7AG 3ARBB 1X4XA 5I0DA 3D51A 5KBLA 5EU6D 2CJUH 4HIIB 3ZL4H 4BFOA 2VRAA 4PS4H 2P5EA 1XR8B 4PJ7B 2F58H 5BS0B 2W65B 4OLUL 2XFGB 2AXGB 3GHBH 4FXKA 4X6EA 1QW9A 4GPVA 1WCBB 3O6ML 2VC2B 43C9B 4B41A 2JQZA 1E67A 4JPQA 1PTZA 1WAAA 4TVSa 3QQDA 5LKNA 1NLDL 1DLFH 1KGUA 2IOMA 1C12B 3EOTH 3QNYA 4NPYA 2F58L 3QSKB 1BYPA 4TUOB 1H15B 3ERXA 3V0IA 4X7SL 2J8UA 1VA9A 2XWBA 5I1DA 1KIPA 3QZBA 4WO4D 3V95A 2X4SB 1EXUA 3WN6A 5DEGB 3H9HA 2ETWA 1JE6A 3HI6L 4FEIA 4NP4H 5FF6A 1RH8A 1M7DA 2Z4QA 4IBZA 2ED9A 2XVGA 1U92B 3IS1X 2N0MA 2NNCA 3RILA 4EIGB 3FN9A 1U8HB 5DZJA 3BKMH 4WK2B 5FUOL 2QQLH 5ICYB 4HIXH 5IBUG 3CFKA 2VR6A 4RGOL 4WO0A 2KZ1B 2R27A 4XPTH 5TH2B 1ILUA 2WJ7A 4S2SB 5JIIA 2AQPA 1WGVA 4KTYA 3BW9A 3V4VB 4FHJA 1I8KA 1WPCA 1DVQA 3VVVA 3CH1B 2G2RB 2G9HA 2MRYA 1JYXA 4UIMB 3REVA 3OL2A 5I6XB 5GGTH 3FSVA 2BNRA 1M2OA 5LWYH 1AY1H 5EOCH 2G3ZA 4Z6AT 2R15A 4OM1H 5KBKA 3QA3B 3X1EA 4JKPL 4BKLB 3F58H 2CA4A 1EEQA 2HLAA 5CLZA 3I50L 1TG8A 4GQ9H 3D39B 4O4YL 1DQDL 2VC2L 3HS0A 1R3JB 2ITCA 3BPLC 5E2VH 3IMTA 3LRLA 2EH8L 2YEQA 1HAUA 4JN2A 5DK0A 1X4YA 3HUJA 2CIKA 1L9SA 5I0XA 2GITB 2CHDA 1ACXA 3SKMB 4AXWA 4KJWC 2AJSH 5D4JA 3BZFA 1FFOB 3OAUH 5FM5M 3RLSA 4YX2H 4JDTL 3M86A 3BZEA 1KMGA 2R56L 3FUEA 2AQNA 4L9DA 1DVFD 2LLNA 2Y7SA 3MLWH 3IDGA 3OG4B 5IG7B 2QPDB 3ZE2E 4P5TD 4BFBD 4PJBB 3EAKA 1FF5A 5JIMA 1CBVL 2E7MA 4DESA 1BBJB 1I9RL 1NCAH 3LH2H 3TONA 4FQJH 4XP4L 1CICD 3K0YA 2ZOTA 5FA3B 2FLRT 3FT3B 4CU6A 5TH2A 4MDIB 3GSRA 2BW4A 4F37F 5DD3H 3VFNB 2ZCLL 3HC4L 3UP1A 3MNWA 4UQBA 2VLJD 5FO7A 5L9DH 1GHFL 1QLEB 2ERJB 2KH2B 5DURB 5DJZA 1DBBL 5EA0H 3KYMA 4G8EB 1E5YA 2BX5A 3IB4A 2FHBA 5CCKL 1RZ8A 3ARXA 3N6YA 1HCYA 1G9MH 3ENEA 4UIMA 2I9TB 3ILQD 3Q5OA 5E8NA 3MGTB 3DIFA 2ZCLH 4PIBA 2R9HC 4YIQB 4E41E 1C5DB 5GZOC 3LEYL 4FQ2H 1AQMA 2R0LH 4NQSB 4MYPA 2ZXDA 4FNTA 4ZTPH 3CVHH 2DM3A 1FNGA 4HS6A 2KBGA 1XTMA 2D9CA 2F0CA 3ZKND 2PXYB 4LRIA 3DWTA 4AYMC 3FT1A 4HCRA 4AKPA 3EH4B 3W9EA 5I5RA 1B0RB 3RFZC 2WHVA 2IAMB 2R1XA 3B7YA 3QC5X 5IQ9A 2H26B 3NIFB 1RQ5A 3IJEA 1JBJA 3F7QA 3JWOL 3NABL 3RZWA 4A6YA 4AMKL 2R56H 4CSSA 3KPNB 2NYZA 4FZEL 5DGQA 1P53A 4HZAA 1UEYA 4MJ6A 3BDBA 4Z7WE 2Y1YA 3RFRA 3PNWA 3NACH 4LSUL 4TUOA 2I9LB 4HKJA 4UT9H 4QUOA 3FQWB 2IDSA 3TC9A 5FKPA 5B3JE 3VA2C 4CVXA 3BD3A 4J3XA 1F3DJ 1DEEB 4AEFA 3UADA 1NJ9B 1J87A 2WGXA 1TMCB 1A7PH 2XXFA 4M4RB 3UPAA 1LP9B 2CM5A 4PREA 2PR9A 3LDBB 2A4ZA 3QDMD 5AOMA 4OZFA 1VFAA 5DJ2B 1LO2H 5AW1B 2YAPA 4HFUL 2D8KA 5DC2A 1FH2A 1OALA 4NHCL 5ICXA 4EI0A 1XF3A 5T1LD 2BVQA 2UUDH 4F8QA 1ZA6A 4HGKC 4G5AA 2ZTBA 1FZMA 2VXUL 2JTDA 2XQ0A 4NUQA 2VRQA 1CXKA 5GGRB 1EAPA 4S1QL 1YEFH 1KJVA 1TVBA 1N59A 3KWWA 5AW2B 3G9VA 2HFEA 3S3PA 4NIYE 4Q56A 1D6VH 3EGXA 5I0VA 4XN8A 3W0WB 1YEGH 3ZRCC 1JPGB 3CFMA 3STLA 2VQ4A 3IN2A 3C2AH 2COVD 3Q8BA 1PAZA 1GR7A 4Y4KB 3DV6B 2XN0A 2XN9A 1FBIH 3WKPA 4L8SA 1CBVH 1FZKB 1VADB 3PWPB 4E9TA 4GKZA 1A2YB 4PJEF 1A0QH 4V2CB 4ZAKA 3R1GL 4M6OL 3WS6C 1T3FB 2OR7A 1RJYB 4JFDD 2JKTM 4JFQA 2XIIA 3NIGB 4DCQA 1XR9A 3G7TA 1MCBA 3E3QE 3ZTNH 5CN2A 4UQAA 5GS1C 3UABA 3E6HA 2AJYH 2C3WA 3MV8D 4NGHH 1BPVA 2VRKA 4I0PD 4NJAL 3RUGF 2QPFA 3MLVL 1AO7D 2WTOA 4L1HA 4WFHD 2EXSA 4CILA 1AZNA 1AO7E 4JO1H 1OOWA 4G5ZH 4JHZA 3ARUA 4UBDC 4FAAB 1JK9B 5DEFB 1PJ9A 4C54A 1FDLL 3KPSA 1ZGLA 5FECB 3ATEA 1OE1A 3MCLH 5DHYA 1RHFA 5LWYL 1K6QL 3LH8A 2XA8H 4N6RB 4ZW8A 1A64A 1F6AA 2I7SA 3BP7B 4M4PA 3F6JA 4FKEA 3H56A 4IMLA 4PWHA 1GGYA 2CGYA 3SDCA 2VYRE 1DQDH 4M62H 1PGRB 4XPAL 5I66B 3AY4C 2A74B 3X1FA 4KVCL 3PWJA 3RL1A 4CVWA 2A1WH 2P8MB 4I1RA 4NWTL 2WIIA 3P0VH 1E27A 3D05A 5D7IE 3SPGA 3CPLA 1BQHA 3ARRA 3LPPA 4N5EC 3GNMH 1J8HA 2H1PH 3LB6D 3WFHA 3SQBA 5C0EB 2V5MA 1JXKA 2QSTA 4IKJA 2A1WL 4NWTH 1HXMA 3ZW3A 2PNDA 4ZUSA 4UM9D 4YDZA 3SKNB 1UXWB 5SWSB 3GBNL 2VWEE 3REVB 4Y4FB 4B3VA 5IB5B 5LBSA 5I8OH 4KI5C 3SE9L 4HHAB 5I17A 1GRWA 5A3IC 3VXRD 1EZVX 2EDJA 3UBXB 3PJLA 1CXIA 3FT4A 4NGHL 4K3DL 4XXCA 5I30L 4G3YH 2G3XA 1OT2A 4PW4A 4NZDA 3WY1A 4AL8H 4PJ5D 1X7QB 1WFJA 3LKNA 2P5WA 4I85A 2XHNA 5CLXA 3G3LA 1CGUA 5HDWA 5EEVA 4OW6A 2HN7B 2WWOA 4X42A 5E0FA 1TITA 5F7EL 3MRPB 4N3UA 1HDMB 2DYPA 4QYAA 2OW6A 3MU3A 2LFEA 5ABAA 1XHHA 3KJ4C 2R1WA 4X9FA 2P46B 4G43A 2HH0H 1AD0A 2WO2B 4OZIE 5HYSG 2HCZX 1UD2A 4AQ8C 4EKJA 3HBQA 3PCYA 2O5YH 3PWUA 1OSEA 3W37A 4TNWF 1YG9A 2AGJL 2ADYA 4ODWA 1E4XH 4R4ND 4U1NA 3I75A 3IXTA 4GS7C 5AVVB 3IJYB 4H20H 2AXGA 3CXHJ 3OZ9L 3P4MA 3MNMA 3PQYB 4L4VD 1XR8A 4Z7NF 3LKSA 4UU9A 4U3HA 4YNYB 5DHDA 1FFPA 4BSJA 1KN4L 5GRJL 5AUMB 4J3VA 1WBZA 1IQDA 1YEGL 8PAZA 4Z7QB 3VD1A 3K4AA 4QLRA 4EVNB 4MNQB 1PDKA 1NUNB 4ELMB 2KT6A 4EAEA 1I8AA 2QDVA 4GKNA 1Q9KA 3CFCH 1SXBA 3Q1SL 4JJ5A 2ADIB 3HMWH 4PJGB 3FU3A 2H9GB 3G5ZB 2EUVA 1NCDH 1XAKA 3MCLL 1OB1A 4ZX4A 3QIWA 3WNIA 2JJWA 4LCWA 1DCLA 3GXDA 1WYJA 4UINH 4G6KH 3ARYA 3B9KB 3HB3C 4W9DC 5E00B 2HT2C 3QI9C 2ZQKA 4ODSL 4FL4C 3FCBA 2IAMC 2OZ4L 3KCPB 1A3QA 1H8NA 2GVYA 1OGAB 1PF3A 1EZSA 3VB9A 3BT0A 4NJAH 1IC4L 1RHHA 1UASA 4YLQT 2E7CA 3U1QA 1FGNH 1KXQE 1IGFH 4NNXA 4YE4H 4CDGC 3VFGL 1QZNA 2VZVA 5I1HL 1M2VA 2RHEA 3DVNB 3GO1L 5MENB 1NFIB 1DVFB 2NW3B 4BRVA 2DN7A 3VD2A 5DVKA 4IGBD 2GJZB 4NX0A 2X2JA 3QP3A 2DMKA 4POZD 5EO9A 1JGEB 1ICTA 1QVOA 3ZE0E 5B38B 4TQPA 5DFVD 2GAZA 5ISZB 1BJ8A 2FLMA 5IVZA 1MNNA 3BDYL 3H8NA 5K59E 3HNVL 1LVEA 1T5XB 4LPWA 4WGKA 3CDGA 2EXTA 1S9YA 3FQRA 3MNDA 2A38A 2JCCF 4GMTH 2ICWA 1UCBH 2AVGA 2I5YL 2GFBB 4A63A 5HYJD 5AW6B 5F44A 2FEEI 2VLJB 2DW5A 2R51A 4KZ0A 3MJWA 2BVQB 1OW0C 4KI1A 1S7RB 2K4WA 3T4YB 5JHMA 3FFCB 2BOBB 5EU7C 4YSSA 4FNQA 4FG6D 2FR4B 4AEEA 4TUKH 4J2QA 3TA3A 3UTZB 3P9LB 5G5DB 4ALAH 2WK2A 1YZZA 5ANHA 3RVXC 1LO3H 1V8HA 3AADB 4M1CD 1GC1L 3NTCL 4KNUA 3MO1A 1QQDA 5IB2B 3F6IA 5DD3L 5D4IA 2ATAA 3GHEH 1RFDL 3B8SA 4JKWA 2GHZA 1AGEB 4HSAC 4IS6A 4NQCE 4XWGL 4B9PA 2AEPH 3DJSA 5CGYD 3ZYZA 5FGCB 5HHOA 3DX9A 3DO7B 3G5YA 1JZFA 1KLGA 2X4OB 5EIIA 1TF4A 4LSRL 1YNTF 1KCKA 3VVWA 1N3NA 3B1UA 3I6KA 1TYEB 2R0ZH 1AFVH 2DMBA 4L4TE 4PJCA 2OJZL 1C8QA 3UAAA 4CN4A 2W8CA 1ZVSA 3FUIA 3WAKA 1WVZA 5EIIG 4I3GA 5I6PA 5BS0E 1JV2B 4D7BA 4ZZFA 1OP9A