2YMXL

Crystal structure of inhibitory anti-ache fab408
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPASLSASVGATVTITCRTSENIDSYLAWYQQRQGKSPQLLVYAATNLADGVPSRFSGSGSGTQYSLKINSLQSEDVARYYCQHYSTTPWTFGGGTQLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB ANTIBODY HEAVY CHAIN
publication title Molecular Characterization of Monoclonal Antibodies that Inhibit Acetylcholinesterase by Targeting the Peripheral Site and Backdoor Region
pubmed doi rcsb
total genus 53
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2012-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ymxL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ymxL01
1JPFA 3MRQB 4ZFOB 2AK4B 4TULH 5CD3B 3CDGA 5FYLL 4U4BA 4Z7NE 2HFGH 1C1EH 4YK4B 3DMMB 3NOIA 2XFXB 1U2HA 1NL0H 4J2XA 5ADPL 2AABH 3HPJA 3UZEA 2QQKL 3RKDC 5HDQH 3CSGA 1MFBH 1TDQA 4K3JH 5ESAA 5E6ID 2QSVA 3T77B 3VMNA 1M1SA 1DLHA 2P5EB 4KHTH 5MENA 4L8DB 3WHXB 3N1QC 3N50A 2Z0BA 5JW4Q 4XGZA 4KY1H 5FGSA 2A6DB 2FIKB 4DN4H 4D94A 2BVYA 3V52H 4OZGE 5IW1B 3NA9L 4MA1B 4KI5E 4OV6F 4P9HH 1OVZA 4RBPK 3L3GB 5E2WH 3MFGB 1JIBA 4JG1H 5MI0B 5ALCL 4OFYA 1YMHA 1P53A 4R7NB 2FWOB 2AGJH 4ZUWB 4XVTH 4Z18A 2VR4A 3D2UA 4WJ5B 3EOBB 4HUUB 4Z7VB 3QHFH 5L0QC 4RQQB 1SBBA 3TNNB 1FZKB 1G9NH 4ETQB 5DRNA 4K94L 2OP4L 3GSXA 4IDJH 3RHWF 4XCNB 3RGVB 4JY6A 4CADB 2W0FB 4RBPH 2J8UB 3TO4A 1FZOA 4P2QD 3MV9B 4TSBL 3BX7C 4S1DC 4V1DD 3G6DL 3P4MA 2JCCE 2RBLA 2VN7A 4I2XB 4R4ND 4L29B 1MFAH 5K93A 3T3PF 1NJ9A 1NKRA 2Z8WC 4H1LA 5DD1H 5F7FA 1CD1A 3KLAA 4U2ZA 1YEHL 4LSSL 4GBXB 3VXOA 4OLUH 3S36X 1G0XA 4LDLB 4JPWL 4LIQE 1RU9L 4JZOA 2FECI 3VCLA 3DGGA 1X3DA 3QQ9D 5L2KA 2UWEE 1CL7I 5IROC 3PWJB 4WI3A 3WBDA 2EDNA 2EXWD 3DRTA 2C7UA 3I50L 3V6OC 4H26A 1DUZB 4HT1H 1KEGL 3C5ZD 4M6OL 5EZJB 4CL7A 4J3SA 4HZAA 2AJVL 4ODVH 4M9PA 4C83B 4U6TA 4OM1L 3PWUB 2UZIL 3QIUA 4HIJB 5J89A 2CK0L 1G7MA 1H3UA 2HMIC 1CT8B 4OBRA 2E3VA 3G08A 2W9EH 4FA8A 3MLTB 5GJSH 4OIIH 2VJXA 5GRWA 3MJGX 5ANMA 1EAPB 1FO0A 3MZGB 1R3JA 3MFFA 2QHRL 2BFVL 3HZYA 5DD0H 3NGBB 4FFYL 4GAFB 4F7MB 1Q1JL 3FQNB 4GRWE 4MNGE 3SE3A 2IFFL 4LCWD 3NCFB 2QTEA 2DJUA 3LMJL 4M7LH 3QUZB 3VFMA 2DLGA 4P48A 1OAUH 4YBQC 1QP1A 1TZGL 3EDDA 3WN5B 5DI8A 1XF2B 3N1PC 3PL6A 5E5UB 4BQBA 3ZT5A 1SMAA 3MUGB 1P7KA 5E8EA 2LABA 4JGMA 3U4BL 3V0WH 5F7DB 2F53E 3ALWA 5I8EA 5CBEA 3BP7B 2O5XH 3FTGB 2DAVA 2P49B 4KKNA 2Y07L 1G6RB 4LBEA 4G6FB 2XN9D 4PUBL 4PJ5D 1GC1H 2XZQH 3BN9D 1AIFA 1KIRB 4UNTA 3QUYB 4DEPB 4NKIL 1KXQE 1MH5B 3QB7C 3PHSA 4LEXH 4ZAKB 1JWMB 5IG7B 5LGKA 5LQBH 5K9OB 2VLJE 3OR6B 1QYGH 4JFDD 5DXWA 3V7AE 2YEZB 3GUTB 1N5YL 4Q9QH 5KSUA 3P9MB 1QPXA 3ULVE 2EYTA 4JDVA 2GJ6E 3FN0L 4S0SD 3GMOB 2C1PA 2ZOLB 3C8DA 2IAMD 3IGAB 3SCMB 1CGSL 4WTXA 3WO3B 2CXGA 1KJMA 4JQIL 3JV6B 2VXTL 1B6UA 2R56L 1G7QB 6CGTA 2EE3A 2LQRA 3BWAA 5FYJU 2G60L 1J0ZA 1EHNA 2XPGA 3SGDI 3PDOB 4AT6A 5JPNB 5D7LA 1F4YH 4KJWC 2FYYA 4C57C 3OXSB 4GH7B 3A6CH 2GTWA 1JE6A 1BPVA 1XF4A 4P2RA 3HUJF 4F8QA 5C92A 2KBGA 4NFDA 1YQVL 4GW4B 1T80A 1OSPH 1I8MA 3WDHA 3BH8B 1BHGA 5GS1C 3WS6A 3U79A 1XGQB 3ULUH 2LU4A 2ZUUA 3QPXH 4ZTPH 5ENWA 1DFBL 4LHUG 1U3HC 5DD5L 3HZVA 2FSEA 4JQVA 2RFXA 3B9KA 4UOJA 3T04D 5D8JL 2ADFL 5E8OA 2ADJB 1OCWL 2EDXA 2NY1D 1MQ8A 4WGVB 5CGYC 4BFIA 4OZFH 5C0AD 4GLRI 4XBPA 3SGKA 5SX4H 1F45A 3DVGB 3LEXB 4M8VA 4O2CB 5SWSE 5B38A 4LF3B 1FAKT 3INUL 2YBRB 4FQ1L 5EWIL 4CVUA 4IBLT 3PQYA 2ESVA 4GMSH 4HCRL 3BP5B 3UPRB 3UPCA 4OLYH 1U8OA 5DD6B 5D96C 3EJZC 2W38A 3LRGA 3MRQA 3TA3C 5HYIA 4ZFOA 2AK4A 2BOBB 1WGOA 2VWEC 3WFBH 3O6LH 5I1IL 4CBPA 5C0EB 5KVFH 3BKCL 1BQHA 5F1IA 3FQTB 5D2LB 4LLYB 3LV3B 3DMMA 2XFXA 4TVPH 2J6EL 15C8L 2A9NH 3ZTJG 1QLFA 2OR7A 4QRQB 1GGUA 1EERB 4UNUA 1HHHB 4C56B 3QPQD 1NUDA 5AEAA 2BVQB 3QISA 3X3GH 2NY6B 3DWTA 4L8DA 3RTQD 3WHXA 4YHOH 4AIXA 2OBGA 1NFDF 5D1QD 3MRBB 43C9B 2A6DA 2FIKA 3P11H 5SWZE 3T1WA 1MFNA 3U9UB 3MYZA 2BVUA 1IJ9A 5J13C 3LKRB 4XNQA 2X4RA 3L3GA 2YD2A 4QOKE 1VFUA 3BW9A 2OI9B 2HKHH 5E9DA 2MNUA 2X7LB 3PWPA 3GK8H 3GNMH 4R7NA 3MC0A 4PJIF 1RVFL 4WJ5A 4DGIL 4HUUA 1UACH 3GM0A 4YWGL 1DQDL 4RQQA 2NY0D 2PYEB 2NY2B 1FZKA 3IFNL 4HWEL 5EIQA 3FQRB 1IT9H 2V2XB 4PJDB 4ETQA 5DA4A 2DI8A 3IDXH 4HH8A 4PTTB 3D0VB 5L6YH 5DHXB 4JFZH 5KTEL 4XP4H 3P0YH 4XCNA 3RGVA 4CADA 2J8UA 1PKQB 3MV9A 3MJ6A 3KXFB 1XF1A 5T3ZD 4BQ6A 3TBVB 2DIBA 4BSVB 3P40A 4FQ2L 2PUQT 2I27N 4AQOA 2X6MA 1QPPA 3TH2T 1N0XH 4I2XA 1P5UA 1QFOA 5MENE 5FGBA 4NRXA 5K9QG 2E27H 4LARL 4F9PC 1KEMH 2F74A 4DKEH 3S36H 2X42A 1YEIH 5IM7A 5EZLB 3CH1A 5KG9A 1DL7L 2FO1A 5IKCB 4X0KB 2H3NB 4FZ8H 1MUJB 3ARGA 4EI5C 1JBJA 3O8XB 1NCCH 1WIPA 3MOAL 3PWJA 3MRCB 4RX4A 3VXTA 4OCYL 1DUZA 5F7UA 5C6PB 5EZJA 1CIDA 3P30H 3BKJH 2QQNL 4PRIB 5E08L 2ZCHL 3QDMD 3IU4H 4C83A 3RZWA 2DQIL 4RGNC 2ITCB 4R4BB 4XMLL 1X5HA 4Z77B 2NXYB 4DUXA 5KZCB 4WHCA 4JN1L 3F7QA 4FQXA 3LQAC 3DGCR 3VGEA 1CT8A 2BSTB 5FHAH 3MLTA 3UX9B 2VDRL 3UEZA 1X5FA 4X5LA 5D72H 4ODTL 4F7MA 3IRPX 4X6CB 5I75B 3E3QC 1DDHA 4X98B 1BBDL 1PVHA 3U30C 4PP1C 1YN6B 4OLVL 4YXKH 4GQ9L 5HI3C 1CYGA 1MFEH 3PWNA 1JHKL 3QG7H 3WN5A 5HSFA 1EBAA 1NCTA 3QEHB 3RVUD 5GS0H 3KLHD 1IARB 2YPLB 3OR7A 4G6MH 5L2KE 1FYTD 4MDJA 3K4ZA 3BP7A 1SJVA 2ICCA 3PHQA 5KSAD 5GRUH 1UH3A 3NIFF 3KYMB 3DECA 3LH2L 1Z9MA 1P6FA 1G6RA 2DTMH 3ARTA 3WUWG 4O9HH 3TFKD 3BEVB 1CVSC 4WIQA 4OF8A 3ZT6A 1E6OL 4XRCB 4MXQD 1KIRA 4G3YH 1JF6A 1D6EB 4JZJC 2D7MA 4W6XB 5IG7A 4RMSA 3OR6A 5DJCA 2JIXB 1N7ML 4UAOB 2P5WD 2YEZA 1MHEB 5BO1L 3MLUH 4TSAH 4ELKB 3NH7L 4KGLA 1HXMB 1YJDH 1XCTB 1EAJA 1CU4L 4HIIA 4Z7OF 3GMOA 2ZOLA 1XGTB 3IGAA 3SCMA 4UTAL 2CMRH 2LVCA 4RIRB 4JG0H 3JV6A 1G7QA 1MWAH 1SJXA 1SBSH 5T5FH 1Z9OA 1PEZA 1INDH 3TT3H 1L7IL 3SDCC 5JPNA 1GGYA 3Q2CA 2R1XA 3VG9C 3EZ8A 5IB5B 1T0NB 3OXSA 4PJXF 3L7FB 1GHFL 5E00B 1IFHH 5BS0E 2R2HB 1IQWL 2AI0H 2HFTA 4GW4A 3UTSE 1NLBL 5DHVB 2JCCB 2D03H 2VDKH 4KDVA 1R3LB 1XGQA 2MHAB 1HZHH 1CLOH 5E24E 3FKUS 4RAVB 5GQBA 3MJ9A 1TETH 1YEEL 5E6IB 2R39A 5ESVA 2P42B 5DUPH 1OTUD 3LY6A 3GKZA 4XMKL 3KR3H 1OGAD 1NGQL 1AD9A 1OAKL 4EDXB 1UXSB 5A3IC 5DF0A 3H7BB 3HE6D 2XNAA 4NQTA 3DVGA 3LEXA 3MLYH 1BQLH 2HVKB 3PABB 1RUQH 4LEOB 2BDNL 4O4YH 4XAWL 5LBSH 2YBRA 4J3OC 1DQMH 4Z7UF 4ELMF 2FR4A 4UU9A 3BH9B 1FAIL 3BP5A 1WBYA 4E0RA 3JUZA 3VWJA 4R8WL 3VWKD 4Y2DA 3VGHA 3QH3B 2BOBA 2UVFA 4MHHI 5D7LE 5MEPB 4P46C 2LAAA 1YNKL 3T65A 4YR6B 3FQTA 3LV3A 2P44B 2ZZUT 3MRIB 2BHUA 5FO8B 5IQ7H 4P2RE 1YQ2A 2Z31A 4LDOB 3W9DB 1K8IA 4NN5B 4O58H 5ETUA 4R7DA 4QRQA 3U7WL 4HIHB 4G6JL 4OZHA 3VFTB 1HHHA 1F3RB 3BIKA 5H35A 2BVQA 2VZ1A 3QHZH 4MB3A 1T7ZA 4V1DB 3TP4A 1P6AB 1FLRL 1XIWC 2VIRA 4XPHH 2XZAL 4OFKA 4JVWA 2Q86B 1BJ1H 5FYJD 4OQTH 4LMQI 2A6JA 3ZE0F 5AD0A 4YBHA 3GKWL 3EOAB 5F96H 3DO3A 2YA2A 4FOMA 4KJYB 3BPOB 4K07A 5CJXC 1QVOB 3MJ7B 3CSYA 2JJTC 3P9LB 3NIGF 1UA6L 4NQCD 3OPZH 2X7LA 4I0CC 4NWTH 3PQYE 3VDAA 5HHVH 5DFVC 1BD2E 3C5ZB 2OL3H 1S3KH 2QKIA 4CVZA 1DQTA 5JW5B 1D9KA 5F6HI 1Y6KR 2OZ4H 2XQBH 2V2XA 4MDIB 4OJFL 4PTTA 3D0VA 5DURD 1N5AB 4BUHA 2X1PA 4PJ7E 3HI1A 5JQHC 4HGKC 2IQAB 4LNRB 1O7VA 3ZYOA 5SX4I 1KTLA 2X4TB 1PKQA 1M7DA 2PYFB 3QQ3A 4YC2B 5GGSY 1KFAH 5FYKD 4XVJL 4YXHL 1BWMA 1J1OL 3TBVA 4BFGA 3NCJH 4BSVA 3OKDB 4MXVF 3C6LD 4YHLL 2GITB 4ZO6A 2MPAL 3E1F1 3W9EB 1FCCA 3I6KB 3WHE1 2H1PL 3H0TA 4XPAL 3MRJB 1ED3A 3BD5A 1T04A 3LEVL 4IOFC 1I9IL 3D85D 3HG1A 3TN0C 5IKCA 2J12B 3SGEH 2E7LA 3I2CL 1C7TA 1DQJB 4JDZA 4H20L 2QJDA 5C71A 5C7XH 1ERNA 2L7UA 4K8RC 3ZSTA 4PGJA 1CN4A 1BZ9B 5E9DE 3PWPE 4CGTA 3VI4F 2HKFL 4U3XA 1IAIL 1MWAA 1JWUB 1NAKL 4PRIA 4F7EB 2YUVA 2ITCA 2B1AH 4R4BA 2H8PB 3IJSA 2J1KA 4Z77A 4JFOB 1A7NH 2XN9B 4UT6H 1JNLH 1CFBA 1X6LA 4LSPL 4YH6A 2EDHA 1JF1B 1J18A 5JHLH 5CP3H 4KJQD 2YPVL 2PO6C 3I3EA 1AC0A 3AMKA 5DR5L 3STZA 5J12C 5I1CH 1AGFA 1UM4L 5SWSB 3TNMB 3MRGB 4GAGH 4JFDB 4XX1G 3O6FD 5I1KH 1HHIB 4X6CA 1GVIA 2J2ZA 4RFEB 3LZFL 4K71C 1JGLH 2AQ2A 4ZYKB 3UTTB 4X98A 5F7LB 2FDBP 2FCBA 1FLTX 2KZWA 4C58B 5I9QB 3C5SA 1Y0LB 2ZUXA 5EOCH 4LAQL 1MPAL 2B4CL 4GJTB 4U1SA 4JY5H 1F90L 1MJ8L 2YPLA 5IR1B 5DJ2B 1F4AA 4Z0XB 3ZO0A 4PG2C 2X4PB 3TPKA 5F71A 5CCKH 4K23L 2IWGA 4MNHB 4MCYB 1TQCB 1LEIA 3G9AB 3KYMA 1UB6B 1RHFA 1T7YA 3D69B 3KAAA 3P4NA 2J7LA 4V2BA 1WUNT 1A3LH 3PF2A 2YD7A 5I8KL 1RFDH 1YY8B 3WD5L 1KCUL 3IDYB 2BNRD 1OARL 2A73B 2CRIA 3O4LD 3WXWL 1T2JA 5ICXB 4LMQE 4FP8H 3QFDB 1ADQL 2P24B 4APQD 4C54A 5I19L 2HP4A 1MHEA 4J1UA 4TUJB 1E28A 4FMFA 5GISL 4O2EB 5KSBA 1HN1A 1HXMA 1KC5L 1XCTA 3N9GL 4NOBA 1XGTA 2FATH 4G9DB 2UYLB 3VGAC 1BBJB 4WY7L 3ULUE 3QDAA 4MWFB 2VR5A 3VXPB 2X4OB 3EYUL 4X9FA 4YHYB 1WIOA 2V7NA 1EEQA 2HFFB 3ZDZF 2GFBB 1I1FB 5EU7E 4EVNB 1PX4A 1FGNH 3ZDXF 4OZIF 3RVVD 3MLPA 4Z78A 2VZSA 3SQOL 5IB5A 2VLRE 3ARUA 5E99L 2IG2H 3TM6A 2MMXA 2QR0A 4HHAB 3L7FA 5E00A 4CVWA 1CZ8H 5JIHA 4BELD 5TQ2H 5DHVA 5EN2B 3T4AA 3TWCL 1A14H 4HJ0D 5GRVK 3RVTD 5F3BB 2ZG2A 3EAKA 2MTPA 3NFPB 2OL3A 5E6IA 3HC3L 3DNKA 4Z5RA 3AB0C 2OZ4A 3MLZL 3RTQB 2Q7YB 4N5EC 4KTEH 4AM0A 3HC0B 4X7FC 4PLNC 4NQDB 4S11A 2V9TA 5FHBL 4TVPE 1X5LA 3OJ2C 4LCIL 1TZIA 1UXSA 4FFVD 3V9FA 1ACZA 2YK1L 3WO4C 4YHZH 2OXHA 2XKNA 5C1MB 3TT1H 3LKOB 3PABA 5EBWB 3CLEH 3O2DH 1NGWB 4OD1L 2ADIB 5JR1H 3R06B 5CAYB 5I17B 5F44A 2HLAB 2XT1B 2HT4C 2HTKD 2W9LA 1F8TL 1YNLL 5DMIL 5E56A 1A9EB 1LO4H 3BI9X 4ZDHB 5MEPA 5T5NG 1YMMA 1FORH 3AM8A 3HE7B 2HJFA 3HAEB 4TUKL 3C8KA 5CD5C 2KKQA 3PV6B 1P4BL 4ZSOA 1BLNB 3UYRH 4TOYL 4UQ3A 1A0QH 1IEHA 2YA1A 1PG7X 1QQDA 3FHQA 1J0JA 2VXQH 4EBQH 4HIHA 3VXQB 2NLJB 4UIKH 3VFTA 1R5IB 5F6HJ 4P2QA 4YBLB 1FFPB 5CEZL 4K3DH 4V1DA 5KS9E 2O5YL 3DI2B 4BH8B 2VDLL 1U8KB 4XC1L 4PJAE 1KENL 5TE7L 3ZKND 5CP3A 5D7SH 2Q86A 4Q2ZA 3FQXB 4M7JL 3E6FA 3ARVA 2VQUA 2HN7A 2WP3T 1D6VL 3NCYS 5H2BB 2F5AH 3EOAA 2GSIB 3VFUB 5D7IA 2DYPD 4KJYA 5GS2H 1YEKH 1QVOA 3MJ7A 3RGHA 4Y4FC 3C08L 1ZWIB 9CGTA 1LO0L 3QIWC 4TNWF 4W4NA 3M07A 3F58H 4HULB 4KVCH 3DBXB 2Z9TA 4J4PD 2VO5A 3T3ME 1L0YA 3TBYB 1N6QL 5JW5A 3RDTD 4JQXA 3GSOB 4MDIA 1VPOH 1E4XL 3ARQA 1OOAA 3S8WA 2VAAA 4DAGL 2VZTA 4G9FD 1LHZA 4L5FH 5F97E 2A0LC 1OAYH 4LNRA 2X4TA 3V4VL 5JUEL 2PYFA 3SDDD 2K7PA 2EH7L 3X14A 3BYTA 4OZHE 1LNUA 1MI5D 1RUPH 3OKDA 2GITA 4OBSA 3W9EA 1RULH 4LCWA 4L9LC 5IHUL 3I6KA 1V7MH 5JMRA 1VENA 1CDYA 1KN2L 2WUBH 1V8HA 5DLMH 1DQJA 4AH2B 3UJTH 3A67H 3WUZA 2O61B 4AZ8A 4F8TA 3CFKA 2G75B 5C70A 5EBMA 2DQFA 5I8OL 2J5LB 4L3CA 1FYTB 3ARWA 3VI3E 4F58H 3KS0H 3U83A 4F57L 2P8MB 5KANG 1JWUA 1FFRA 1VGEL 4XNXL 3CVHH 4F2MB 4JFOA 4OCNC 4LCUA 5JXED 3FFDA 2XN9A 3C87A 4PJ5A 3HRPA 1JF1A 4OCRL 4JHWH 4PJ8C 4WEUD 4YQXL 4YGAB 3F7VB 3EHBC 1WC7B 3MLXH 3MRGA 4GAJL 3SJVD 1FE8L 4HZLB 3V6ZB 1Z2KA 1ND0B 1ZEAL 3WFDH 1HHIA 4ZYKA 4RFEA 3OAZH 2M8XA 3QQ4B 3BXNA 3O11A 4U1JA 5EUKA 2IAMA 4L4TD 2RCSH 3BIBX 2ZKHH 4NN7B 5F7YC 1Y0LA 4GXUN 1AR1D 1HKLH 1N59B 2CQVA 3EOTH 4ZD3H 1MFCL 3HG1E 4CAGA 4GG8B 1B90A 4XPFL 4PRNA 2F9BT 5DJ2A 4P5TD 2ERJC 4Z0XA 4PP2A 3TV3L 5BOPA 4QRSA 4MNHA 3O2DA 3D69A 1CF8L 5K59E 5HVWA 5ICYA 3BSZH 4L8BB 4NKMB 3RJDA 3UROR 2OSLB 3SE4C 2DOCA 4MVBD 4JANA 4I8DA 1X5ZA 3JTSB 5JZ7C 3BZFA 5C6WH 2AKRA 5F8QC 2ED9A 2A73A 1M05B 1IM3A 5CJOL 5ICXA 3VFVB 4QEGA 3SGEI 3QFDA 2P24A 4BYHA 4YIQB 4YZFF 1KBGL 1EEYB 4TUJA 1B88A 2NXZD 5I15H 4RGMC 1T6VN 5HYQA 1YY9D 5GJTH 4LLDB 1A6VL 2UYLA 4UT9H 5C0AA 1BBJA 3HE6B 3S3JA 3PGCA 2FJHB 4O5LL 4PY8I 1W72H 2F54D 5JA9A 1QHOA 4NC1E 3TVMA 3VW3L 1OW0A 4MQSB 2X4OA 1BVLB 2V2WB 2HFFA 3O9WD 2Z4QB 1I1FA 2QSCH 1ACYL 3HZMA 4EVNA 3LQMA 1I3GL 4DCQB 4I9WD 4W4OC 2ATKB 1A8JH 1A5FH 1DVFD 1OAXL 3HLAB 4IRJB 4NKDA 5AWNL 4P99A 5I1LA 4KJPC 2XTJB 2AEPH 5D1ZC 4TTDD 2FX8L 2X4UB 4OCSH 3VD4A 3FO1B 3V6FB 2PW1B 4UV7L 4R2GD 1VB9A 4PS4H 1DEEA 5IBTL 25C8L 2VISA 5FV2A 4YFDB 5IMKB 1C5DA 4FFZL 5JO5A 1YNTA 2Z91A 3SO5A 2BHZA 4XP9H 1ZHLB 3ARYA 5E4IA 1ZHNB 5KN5B 2DWEB 4LPVA 3RTQA 3QWQB 4HWBA 4BK4A 2WLYA 4G8EB 1TPXC 3TEUA 4Q0XH 4QXGL 3GJFK 3KGRA 2MCPH 5D1QA 3RY4A 4WUUD 3AS0A 5BV7C 3IAPA 4LCCA 5KSBE 1ZLSH 1A6AB 5FKAB 5C09D 1QFUL 3LKOA 4YNYB 4NYLB 1NGWA 4FABH 3MRFB 2ADIA 3T08A 3UPAA 3T0EB 5L2JB 3TJEH 5I17A 2A6IA 3F7YB 5C0NC 4K2UH 4LCYB 3QNXB 1UGNA 3JWDL 4WFHD 2VDOH 1F3DH 5JHDD 1JGUL 4ZDHA 4NC0B 4M1GH 3RZCD 4XXDB 4FZEL 3MCLH 4XWGL 2ZUYA 5D71L 3PV6A 3GJFH 1UKTA 5JLZA 4NUJA 1BLNA 4XAKD 1ZGLB 4Z0BL 1B0WA 2IH3B 5L9DL 5GXBB 2NLJA 4YUEL 1R5IA 4DGYL 4AMKH 3CVHA 1FFPA 4KI5C 4WFGE 4WU5B 2V6HA 2PTVA 3C6LB 3B83A 1ZLWK 1U8KA 3UYOD 4DVBB 5A2LH 4KV5F 2VXUH 3FQXA 5HD8C 4G8GE 2AV7B 1TJGH 3S98A 5HPMA 2W0LA 2BP3A 2R2BB 2GSIA 1UJ3B 3VFUA 3I02B 5C0FB 1U6AH 4CN6A 4JRYA 2WZPD 1CK0H 4J8RB 1ZWIA 3ARZA 2XWJB 1WWBX 3C9NB 1W0VB 1B6DA 4ZXBD 2DQJH 5HHMB 2Z35B 2IBZX 4M7KL 5F9AC 1HHJB 1B4RA 2W0PA 4JY4A 3TBYA 2ATPA 3QDMA 2EZ0D 3GSOA 4X8JA 1YMME 2R0KL 4JHAH 1D5XB 1A4JA 1C8PA 4HK3N 4ZSOE 3U6RB 1DQLL 1S7VB 4Y5YA 2YZ1A 1D5MB 1AHWC 5D2NB 5FYJH 3NFNB 2I9LB 3CD4A 4JFFB 4HX1A 4M62L 5J8OA 5E6YA 5E8NB 4KTDL 4P2QE 3O6FB 4FTVD 3MODL 1N3NB 3UBXG 4XMPH 1NBZA 4RFNB 4OV5B 4KK5C 1S7SA 1MF2L 4M4PA 5BRZD 3EFFB 4ODXB 3MOBH 5CWSB 3SGJC 4U2YA 1H0DB 4RWYH 1YEFH 3V4PL 4AH2A 2NY4D 1KCVH 5E2VH 1QA9B 4R26L 1A6WL 4I18C 4HG4K 4HBQA 4KTYA 5DJYB 3HB3D 1FYTA 3ARFC 4NT6B 2BXYA 3VH8G 5KSAA 2J8OA 4XXCC 1X5GA 4HMCA 1B0GB 3R8BB 4YE4H 5D93C 4PJGF 4S1SL 5FYKH 5F89A 4DUVA 3OG6B 4F2MA 1NFIA 3RWFA 1KYOK 3IAGC 4H0HB 3ZDYE 2FH8A 5HPOA 2F8XC 2YRLA 4PIRF 3MNWA 4G5ZL 5FDYA 1Z0MA 2H32H 2J88H 3F7VA 2AEIT 3MXWH 2MJWA 3DX6A 5T1DH 3ZHLA 2ZOKB 1XGUA 1P1ZB 3EYVB 2P5WA 4ODBD 4HZLA 3T1FA 1WF5A 2OMBA 1ND0A 1FVEA 2OJZH 2RGSA 3RVXC 5JQ6L 2HJKB 3BE1L 3QQ4A 4LSVH 3GMPA 1M7IA 5TFSH 4Z9KB 5FDWA 4WI2A 1AE6H 4L3AA 2FGZA 4LCWE 4RDQF 3TIDB 5ACLA 4EKXA 3CC5A 2DL9A 5INDB 1HSBA 1IGIL 5IW6B 4BSWB 3PP3K 4OD3L 1F13A 1FC1A 5F6IC 5FUZH 2B2XL 1NUFA 1P4IH 4PJIB 2IPKB 5H37G 2BXZA 1I9EA 1S7RB 1U93B 4KUZL 3BRDA 4PY8J 2JF1A 4U7KA 1YC8A 5L88L 1NEZG 3S34H 1OAZH 4XBEH 4Y1AB 5C0CD 3CIQA 5I1EH 4O2FA 4Y5VC 4PJHF 4IRSC 1IZKA 2V5SA 5F3HA 2XQYG 4L8BA 5FYLH 2OSLA 1OTSD 3B8SA 3IDUA 4S0TD 2XACC 2I26N 1I1RA 3DI3B 2WLZA 4A6YH 1UC6A 4PJ5E 5JOPD 3ULVC 1TXKA 4JPIB 2EEAA 5K9KB 5ADPH 4KFZC 4YGVA 2QQKH 4QHNA 3DVIA 1CDCA 1EEYA 4KRNA 1U8IB 1OGAA 4KKCC 2HT2D 3HR5B 3TYGL 1AKJA 3IB4A 3HE6A 2YD1A 3KPPB 3CCHB 5EOCJ 4XBGA 2Q3AA 1P84J 5I73B 3NA9H 5DUBA 1BVLA 2V2WA 4YAQB 3KJ6H 3ULSB 4RWHA 2Z4QA 1P7QD 2HYMA 1NFKA 4UDUB 3VGBA 3HLAA 3UJJL 3LRSA 2D7PA 3VWKA 2A1WL 1CDUA 3K0WA 4ZPTB 1CFSB 2PF6A 3EYSL 3LN5B 4JFYB 5IVXB 2OJEA 5IW3A 2X4UA 3FO1A 5FA3B 1FNAA 1FNSL 1ITCA 2FJFB 4X4YB 4HS8L 4U6XB 3DXAD 5DYOA 5IMKA 5FA4B 4K94H 3WJLA 5DK0B 1ZHLA 2OP4H 5MP6L 1LDSA 1ZHNA 3C60D 2GY5A 3NIDE 3RUGB 4PB0L 5KN5A 1T66C 4G8EA 4HFWB 3QXTA 1CDGA 2JK5B 4RNRB 2B5IB 3D48R 2EIBA 2V7HB 4QHUB 3G6DH 4I0PC 1A6AA 1FFNB 5FKAA 2WIIB 4YNYA 5C0AE 1Y6MR 2DYPB 3MRFA 5DVNA 5C9JA 3QZWG 3AS1A 3MA7A 1U92A 1YEHH 4LSSH 5L2JA 4NQCA 3TZVC 3RRQA 4JN2B 4P57B 3QNXA 4M93C 4OAWA 2PTTB 4Y4HD 2FX9L 1CBVH 2XTLA 5IFAL 4RDQG 2DMKA 3ILQC 3RDTB 3I50H 1KEGH 2AJZB 1HDMB 3KDMB 3SO3B 1XR9B 5GGQL 1S5HB 2AJVH 1K5NB 5F8RC 4POZD 2IH3A 4G8IB 4OM1H 2UZIH 2KDGA 1INQA 3SDDB 3X12B 3NCEB 2YC1A 1MI5B 3MV01 3P4LA 4Y16D 5GSVB 5JORB 2QHRH 2BFVH 2ICEB 2H32A 4FFYH 2R9HC 4EN3D 1Q1JH 1MRDH 3D85A 2IFFH 2IJ0C 1UJ3A 3LQAH 3SKOB 3JV5A 2I07B 2BNQA 4J8RA 3VDCA 4OM0L 3ES6B 4LLWA 2XWJA 1TZGH 5EC2B 1W0VA 4GW5A 5I6XC 2J8HA 1DSFL 1U3ZA 1HHJA 4PJXB 3U4BH 3KPRB 3L6FA 3HUJA 3UXFA 5DT1H 3PWVA 5HGAB 1D5XA 5E7FA 2Y07H 1LP9B 1EUTA 4K9EL 4DFIA 4ZFOL 4U6YB 2UZXB 3P3YA 3U2SB 4GSDL 1RSFA 3NFNA 4PUBH 2I9LA 3QXDB 1F6AB 3C6SA 3IETB 5HI4D 2X44D 1NMCC 1DQQB 3SJVB 3V95A 5E8NA 3UTZA 3MA9L 2D7QA 4N8VG 1WAAE 3O6FA 4CJ0A 5IHZA 1N3NA 3S96B 4L4TB 4X6BA 3WCYA 1OLZA 1N5YH 1FFQA 3IKCB 5HDBF 1VKXB 3EFFA 3FN0H 2Y7QB 4JRXA 4MQ7B 5CWSA 3JBG7 5EUOB 1H0DA 1EGJL 1G9ML 2VL5B 1OQOA 4X4MA 3RKDD 5DRZB 5EFIA 3VFPB 4JQIH 1J88A 2VXTH 3QP3A 2R15A 2R56H 4HJJH 4JRYE 1NAMB 4WDIA 3JVGC 2G60H 4WW1B 4WHTB 4NT6A 3DYPA 5IWLC 2NY3C 2GK0B 3MO1B 4ONFL 1OP5H 5GGRY 1ZGLP 1R0AL 3OWEA 3DX9B 5IFJB 2CO6B 1HOCB 4PY7A 4DGVL 2GKIA 4UUJA 3TO4C 3C2AL 4UNVA 1YQVH 4GAYB 5F93C 2BNRA 3CVIL 2LTQC 2DD8L 3OKNA 3S35L 3O4LA 4U1HA 3O4OC 1CGVA 4HIXL 5FCSH 3TF7C 2ZOKA 5A1AA 1P1ZA 4APQA 3JWOC 4QXUL 1NFDA 2NXZB 1DFBH 2AEQL 4H8WL 3BUYA 5DD5H 1A64A 4NJAL 3CX5J 2H2PC 4KMLB 2HJKA 1X5KA 1XH3B 1XR8A 4H5SA 5D8JH 3WFEL 1W0WB 2ADFH 3KLSA 5DZOA 1L0XA 3OJDB 1OCWH 3WLBB 2F54B 1E6JL 3D18A 4MAYC 2VYRE 2DQHL 1CGTA 4CMHB 4BSWA 1U91A 4PLOB 4Y19E 5D6CB 3QJFA 2A38A 3LSOB 4NOFA 4PJIA 2IPKA 3INUH 3F7PC 4FQ1H 1DVFB 5EWIH 1U93A 1JN6B 5F88B 4HCRH 2P8LB 5DEGB 3MLVL 2AERT 4L4VD 5I1JL 2XY1A 5GSRB 1SEBB 1CGYA 2GTZB 5FKPA 4HAFA 1LE5B 3ARDC 4MA3B 3UZQA 4MQXC 4O51A 4RMTA 5I1IH 1Q9WB 4ONGL 4R2GB 2J4WL 5EDXA 3BKCH 4NZTL 1N8ZB 4YDKH 2BC4B 2IFGA 4X9GA 5IB1B 1JPSL 3QULA 2J6EH 15C8H 3OKOB 4NNPL 5ACZB 2E9BA 3O3BB 2NYYC 3KVQA 3SE3C 5C08D 2V5TA 4CNIB 1U8IA 4WUUB 3HR5A 3CDCA 2P5WE 4G6AC 5EBLB 2X70B 2WWMC 4DKDC 1MCBA 4IS6A 4Y89A 2C9AA 3CCHA 3KPPA 3S4SB 1R3KA 3ZSSA 3OKEA 5EIVA 5KSVB 3PL6C 3DSFL 4LQFL 3AREA 3DX8A 1UM6L 1T0PB 2GK2A 2VMFA 4JGUA 3ULSA 4MJIB 1QSEE 1NCAH 2SEBB 2HMID 2APFA 4UDUA 1MVFA 5FUCE 1EXUB 3ARPA 5JHDB 5DA0B 4P5KB 4LRIA 4LVOB 2KH2B 3RZCB 1P7HL 1N0LA 4ZPTA 3C2SA 3B8YA 1CFSA 4JFYA 3UYPA 3LN5A 4KUCF 5C0BA 1RVFH 1WWAX 1Z3GL 1L9NA 4DGIH 4M5ZL 2FJFA 4X4YA 4EXKA 4YWGH 4QRTA 1DQDH 1HQRB 1MAKA 4JAMB 5DZLA 2D31B 3F8UB 4M00A 3SDXF 4G7YL 5FA4A 5CJ8A 3EO1A 1EO5A 2UY6A 1JHLL 4HD9A 1CTOA 1XF5B 4Z7WF 1G6RL 4GKSB 3RUGA 5IK3A 1IAIM 1ZA6B 5KTEH 4JGJA 5E2TL 1IE5A 1CXIA 3IDGA 3QIBD 3K4AA 3K8KA 5LAXA 3WFCL 2GYSA 4GXVL 4X5WB 2JK5A 3MRPB 3MR9B 4JREC 4MMXC 1CFQB 2V7HA 4QHUA 3QT2A 5I18L 4FQ2H 2CD0A 4N68A 3T3PE 1FFNA 5E2UL 4KU1A 1IAOB 5K9JL 4EUPB 4PJFB 4PG9A 2EE2A 2DYPA 5J1AB 3N1FC 4LARH 1YC7A 2B39A 2AS5M 4X6FA 1U36A 3L5XL 4P9HC 1DL7H 1RZFL 4P57A 4DW2L 5T1LB 4ZXBB 2PTTA 3QUXD 4J4PA 1EFXD 1WWWX 1IGCL 3MOAH 4QXTB 4WO4B 1YDPB 4F7CB 5E1AB 3WS6C 4OCYH 2AJZA 1HDMA 3KDMA 1IM9D 4LSTH 2QQNH 1XR9A 2ZUQC 4G9FA 1S5HA 2ZCHH 1M6OB 4PRPD 2DQIH 1QFHA 4XMLH 5EZIL 1G9NC 4JRWA 2IBGA 2W9DL 4JQVC 3VJ6A 3B9KC 4JN1H 3SDDA 3L3DB 4M7LT 4G8FA 3W0WB 2NQCA 5DEFA 1J0IA 1MI5A 4IMLB 1I4FB 4ZFFB 3LS5H 4Z8FL 1FN4B 3SGKC 2VDRH 2EO9A 4PRAA 1T03L 3MJ9L 2GSGA 3OJVC 4LDEB 4PYGA 1AO7E 3WV0A 5BRZB 1IC7L 1MQKL 3GI9L 5FYJE 3TBSB 43CAA 1TIUA 3EJYD 1BBDH 3SKOA 2NY4B 4I3SL 4OLVH 5F1NB 2AJ3B 1F3DJ 3EO0A 4LSUL 4GQ9H 3BD3A 4POYA 5EC2A 3UO1H 5JW4N 2AW2A 2BRRL 4NQCE 1U3HD 4ZQKB 2IBBA 4YK4C 4PJXA 3DMMC 4GW1B 2NW3B 2AAVA 2Y5TA 3GMMB 2CLVB 5IHBA 2WANA 1S9WA 5CGYD 2NX5D 5JXEA 2Q6WA 5T1MB 3ZL4L 4HCRA 5FOBA 5C86A 4IDLA 2P43B 1H15A 12E8L 2HVJB 4FQCL 4NQEE 3U2SA 1A2YB 1BZ7B 2BMKB 5AYQA 1E6OH 3RQ3A 4NJ9L 3IETA 4EUPH 4QRPD 1DQQA 3SJVA 4XWOD 5FYKE 4NBZB 1F5WA 3EJZD 2PKDA 3S96A 4OIBA 1N7MH 4O00A 4L4TA 4XC3H 2XA8L 4N5UA 5BO1H 1ZXQA 1YEDA 4K3GA 2J6EA 1LEKB 4EOWL 3SDAC 1VKXA 3NH7H 4OUOA 1X44A 1CU4H 4MQ7A 4Z7VF 4UTAH 2B20A 5EUOA 4ELMA 3BRGC 3LCYA 3L3HB 3VFPA 1SJEB 2LU7A 4LNVA 1KTDA 1HCVA 1NAMA 5J11B 2BNQE 3K80A 3MJ8A 4HUMB 4P5TA 4WW1A 1A7PL 1HHKB 1L7IH 4E41B 2APVA 2DLTA 2OCFD 5HTSA 2GK0A 2J8UF 1FYHB 2G9HB 4D0DB 3DX9A 3P73A 4WI7A 5IOPB 4Y0GA 3HUJE 4LVNC 1GHFH 2M2DA 4LP4A 1IQWH 3D39D 4GAYA 1I8KB 1K3ZA 1NLBH 1GGIL 1YECL 5SX5K 4HK0B 3H9ZA 4MS8D 4CN4A 4LOUC 3CFJA 2RIKA 3DO7A 1X5IA 2MQ0A 1GC1C 5CZKA 5FGBC 4M6NL 1ODAA 1YEEH 2ZG3A 5C8JB 2Y9RT 4RSVA 1RK0A 5HJ3B 4GS7B 3DV6B 1W8NA 1WT5A 3JV4A 5FYLE 4XMKH 4X4XB 3W2DL 4BM7A 1TCRB 3O45B 3O3UN 2YN3A 1S78C 4UDTB 3U36B 3ARGC 4XCCL 2F54A 1JZ4A 5JW4R 1OAKH 1A3RL 3O41A 4CKVX 5B38G 1FSKB 2D0FA 2GI7A 1HK6A 3O9WA 1J8HA 4JRXE 3QEQE 3EJJX 5L7XL 3LSOA 4Z7QF 3SY0A 2BDNH 1U8MB 2AJXL 1JN6A 4HGWB 3BUTA 4M3KB 1FAIH 4HXAL 2VZUA 5GSRA 4R8WH 4EIGB 2GTZA 3VRLF 1B2WL 4NNYB 1H3VA 3SKNB 4FQXC 3E6HB 3ZYZA 1BQHG 5DC0A 1T20B 1BM3L 1WK0A 1Q9WA 1XT5A 1YNKH 4D2NA 2Z93A 4XHJC 3DXAB 3LDBC 3LEYH 4TNVF 1N8ZA 3U0WL 2DTSA 5DUML 2NZ9C 5IB1A 4NKOB 4L8SB 5FIEA 1JV5B 2BNRE 3C60B 3K4DA 1QRNE 3FRPA 2FEEL 2QLVB 3U7WH 3O4LE 4G6JH 3G6JB 1ZHKA 4CNIA 3G5YA 4WUUA 5D4QA 1SEQH 4Y8AA 3NMEA 5EBLA 4XB7A 4IOIB 1NFDE 3ZYIA 2H41A 5EU7C 2P47B 4YHIB 3WMSA 4X6DB 4LSQL 1FLRH 1KPUB 5ILTL 3WN5C 3BZ4B 2XZAH 1PZUB 2VDPH 4RGND 5C09A 1LE9B 1RY7B 1KYOJ 3CLFL 3RWCB 3VRJA 5CJBA 3MRKB 4RAUB 3FZUC 2VNCA 5DGQA 1AGDB 3CXDL 4NRZB 1U58B 1EXUA 2B0SL 3VFSA 4YFEA 5JHDA 5DDHB 4Y4HB 3CSPA 1UA6H 3RZCA 4K7FB 4KK8D 4YDLC 1ZLVK 3EBAA 1NGPL 2ZUWA 1SY6H 1UZ8A 4JAMA 3WE6B 2D31A 3QCTL 4OJFH 2MKLC 4PP1D 4JPKL 5MHSD 7FABL 4BSJA 1KJVB 4ZFZB 3WIHA 1WWCA 4ZO9A 3C5JA 2XICA 4P3DB 3KPNB 4GKSA 1K9TA 2DICA 1EEZB 4ZPVB 5IEHA 4LQ1A 5FUOL 5KAQG 3V5DA 4X5WA 5F70A 1QNZL 4Y16B 1F6FB 5C07D 3QO0B 4KHXH 1J1OH 2XZZA 3DUSA 1BMGA 2Y23A 4QT5B 3QG6B 4YHLH 3SOBL 2MPAH 4EUPA 4PJFA 5I2IA 3MGAA 1ZLVH 2H1PH 5J1AA 4XPAH 2EKJA 2GJZA 3G5ZB 3L3JA 1TQBC 1WZLA 4RCAA 3LEVH 4UT7L 2O5ZH 2R23B 4YJZL 2CDEA 4KRPC 2BCKB 1MCFA 3I2CH 4DKAA 1C5CL 4ZXBA 4H20H 2QBWA 4WWKD 1A21A 3BIAX 1VFOA 4IIQB 4J6RL 4ETYA 1FC2D 4ODHL 4F7CA 5E1AA 4QRUB 4YX2L 2NW2B 5DRXB 1NGXB 2E6QA 1U2CA 2HKFH 5DWUH 1IAIH 5C0BE 3WDIA 4I13B 1J86A 1M6OA 2VB5A 2EDRA 2WUCL 4BUGA 1KB5L 1EH9A 4G80B 2XYCA 4FQQB 1IBGL 2OMNA 1FBIL 2GY7B 1I4FA 1T0MB 5DR5H 4ZFFA 4XCEB 1EUUA 1FN4A 1LK2B 1UM4H 4FTVA 4OFIA 1TVHB 3QNYB 4P23C 5CP7B 4PV9A 4F9LA 5EO0B 4FXGB 5BRZA 5C0DB 5I16B 3GMRB 2CJUL 3LZFH 2L0DA 4LK4A 3TBSA 4QCIB 3TIEB 3IXAB 2VLKB 1F97A 2IMNA 5GRYA 5D2LF 3VWJC 1DN0A 3DIFB 4Y2DC 4OZIA 3IYLW 4JCLA 5D7JD 3ALPA 5CZXC 4LAQH 1MPAH 2CLRB 4Z95L 4ERSH 1A6TA 2B4CH 3B9DA 3HN3A 3MREB 1F90H 1MCNA 1MJ8H 2YZ8A 1YPZF 4GW1A 2Z31C 4PV8B 5HI5D 1FDLL 3EDJA 1RIHL 1MIEL 5JTWA 3NIFE 1PAMA 4K23H 3GSRA 3SKJL 1QR4A 4I48A 5A3ID 1MNUH 5T1MA 4UV4L 4JFEB 1QG3A 2Q8AL 2X05A 3L9RB 1VERA 5HYJA 4G9FE 2NY6C 1BZ7A 2BMKA 1HH6B 5LXGL 1DCLA 4N9OB 5I8KH 1RJYB 1GPOL 3WD5H 1KCUH 1OARH 5JDJA 2WP3O 1J0YA 1ADQH 3NN8A 4ONOA 1FL3B 4XNUL 5I19H 5L0QB 1UZ6F 2ZNWA 4N1HB 1VEMA 3EIFA 1EBPA 2OI9C 3Q0HA 1KC5H 1UH2A 3HFML 3N9GH 1PX3A 4WY7H 4GKZB 2A6KB 3L3HA 4Y4KD 4HDIA 4PJDF 1SJEA 1FL6A 4D8PB 3PGDB 5EU4A 3EYUH 4JFXB 2BX5A 4D9LL 3ZE1E 1HHKA 3GSQA 1D9KC 2QV2A 3ABZA 4JO1L 3ECBB 5C0CA 4L4VB 2CKBB 4KUCD 4PJCF 5GS0C 3FRUB 2G9HA 1XIWD 2LVEA 3SQOH 1UQSB 5E99H 2W60A 3S5LB 2OR8A 3RPIA 2ORBL 2DM3A 2R1YB 5IOPA 1FFOA 4PYHA 4ZOEA 2H26A 3I75B 1I8KA 4BQCA 5TH2B 3TWCH 3I6LE 4N0FA 1FNHA 3LQZB 1KPVB 4NQSB 4ZUTA 2X9XA 5C08B 3HC3H 5C8JA 3AAZB 5DFVD 2BSRB 1B0RB 3DV6A 3MLZH 3BRFA 1TCRA 4PTUB 2K1MA 5AZEL 4UDTA 3VA2C 2E7LC 3U36A 2IAND 5FHBH 1MELA 4LCIH 2EH8L 5JIKA 1YJDC 3D3VE 2YK1H 3QO1A 1B3JA 1P7QA 1ZSDB 3BO8B 5GZNC 2N7AA 4Z7UE 1UEYA 4HUKB 4ELME 1TTUA 4OD1H 3TJHC 3CXHK 4QTHB 5DSCB 4XHQA 2A74B 1YNLH 2FO4B 3CUPB 5DMIH 5B21A 5FECA 1MLCB 2VLLA 4U1NB 3SKNA 2WM0A 2IH1A 4KDWA 1RJZB 4XX1E 1WSST 4ZS6C 2ZUVA 4TUKH 3DXAA 1LEGB 4X6CF 4IOFD 1P4BH 1X5XA 1MHPL 3TN0D 3MV8E 2RR3A 4OGAD 3C60A 5A2KH 1JYWA 3G6JA 3BEWB 3LKQA 4KROC 4NC1C 4KRLB 5FB8A 1HYSC 3FFCD 4IOIA 5CEZH 5CHNB 1A47A 1C5BL 4YHIA 1KPUA 2O5YH 32C2A 3RU8L 2VDLH 4TUOA 4XC1H 5TE7H 1KENH 1LE9A 3ZE0E 2CKNA 1NC4D 1P4LB 4KH2A 5A40E 2EDDA 2VABB 1D6VH 4QYOB 3MRKA 1AGDA 3FB5B 1XGRB 4NRZA 1MAJA 2XQYK 5I1HL 1J8HE 3NIGE 3BAEL 4D9RD 5DDHA 1E4WH 3WL9B 3C08H 4I9WE 4Y4HA 1MREL 4OI7A 4HFUH 4K7FA 4HF5L 5DVMA 1G7HA 1LO0H 2HA1A 4JJHA 1FVCB 3BDBA 4ENED 2DBJA 3EUUA 1IM9B 3HS0B 2IQ9L 3SN6N 3LB6C 4P2YA 3WE6A 4OSUL 1N6QH 4PRPB 5H37H 1IGJB 1E4XH 1KJVA 4ZFZA 4AEHH 4DAGH 1RIUL 1G9EA 5DMGC 4LP5A 3KPNA 5IB4B 1WBZB 2AXJA 2NPLX 1K2DB 5F9JA 4R97C 3ZKMC 3QDHA 4ZPVA 1SVZA 4XTRD 1JTOA 4J3UA 3V4VH 5JUEH 3Q1SL 5EOTB 2EH7H 4Y16A 3PNWA 4M3JA 1TTFA 5C6TL 3LRHA 1ZT1B 2F58L 4JVUA 1YYLL 3VXUD 1BFTA 3QG6A 3KYNB 4EN3A 5IHUH 4FS0A 2XXMB 5D5MB 5E5MB 1VACB 1N2RB 3G5ZA 4ORGB 5GS1B 2YR3A 4AIZB 5C09E 2YN5A 1UJTA 5FGCE 4NO3A 5JA8B 1SJHB 2R23A 1ADQA 2JCCF 1KN2H 1U3HB 4LSRL 4WHYG 4DOHB 3BWUC 4WFHE 1I3RB 3NPSC 3T8XB 5I8OH 2RB8A 4PGZA 3P0VH 3VI4E 1RHHB 1FV1B 2NX5B 2CSPA 1T4KA 4JE4B 4PJBB 1MJUL 1VGEH 4XNXH 3VFWB 3GIZL 1G7IA 4FQQA 4F7TB 3ROOB 4N9GB 2WAHA 4GBXD 2H2SC 1NMBH 2EDFA 4QRPB 4OCRH 1D5BA 2BOCA 4KDTC 2MQ3A 1T0MA 4AG4L 5J7CC 3ILPB 3L7EB 3PWLA 1MCCA 4ZOAA 2WQRA 1JGEB 5A43C 1TVHA 4GAJH 3QNYA 2C3GA 1FE8H 1JUFA 1Q94B 2ICWA 2F5BL 1ZEAH 5C0DA 4H25A 1F4XL 3GMRA 1J11A 1I8LA 4NO5A 2C3VB 3IXAA 1E27B 5B3JF 3T09A 1QSZA 5AYUL 3BDYL 4QRRE 3HRZA 4WFFD 1MFCH 4NZDA 3AM8C 2R29L 1KJ2L 4D9QD 3U4AA 5MEOB 3VXRB 3HMXL 1KT2B 3HA0A 1OSZB 3TV3H 3JUYA 1R3IL 2YKLL 1SYSB 2WINA 1HKFA 4U7MA 1JI2A 3D39B 5GS3A 5J13B 1CF8H 1PZ5B 3T4YB 2EKSA 3QEUB 1UB5B 4QHLB 1KPRB 1NCBL 1YYML 1HH6A 4UIMB 3QUZD 3OKLA 3DUUB 4R4NC 2APXA 2HT4D 4ZUUB 4DQOL 1RMFL 3BKML 3CH8A 1OD9A 5HHOA 4PRHE 3QXWA 1I1AA 5BVJB 1S9XA 5DO2C 4WVRA 3VE0B 1KBGH 4X9HA 3VH8A 2C1OB 4FTVE 5DK2A 1RZJH 5CD5D 3BPOC 5T3ZL 1EV2E 5EU6B 3MRRB 3NACL 1OM3L 5ITFB 3KPSE 1A6VH 3KPLB 4GKZA 2A6KA 3FO2B 1Z0NA 4O5LH 1IAII 4RA0C 3KNBB 3VW3H 3ZDZE 3RFZC 4CN1A 1RV6X 2ZSWB 1QSVA 2X4SB 3RP1A 3ZDXE 4OF7A 1ACYH 4JQXC 4OZIE 1F3JA 1I3GH 5E6ZA 1QBAA 5CZVL 1U8NA 4ZAKD 3FRUA 5AWNH 1FPTH 2HRPL 3S5LA 3BGMA 5BJTB 4B7LA 5HDOA 2F19L 4HJGB 1S7UB 5EG6C 1Y18B 1CQKA 2W65B 3I75A 4KKLC 3QWOB 5HHPB 5F9DC 1MSPA 5TH2A 3TYFB 5IBTH 4EI5B 4Y4FD 25C8H 1KPVA 5HYJE 4LKCA 3QYCA 2ZCKL 2Q1EA 3QFJD 5IMLB 2DM2A 2IALB 3V6OA 2BSRA 3RIFK 1JYXA 3EGSB 1MOEA 4PTUA 4QXGH 1PLGL 1IC5L 1SHMA 2V17L 4RGNB 4FNLL 1F11B 5F7EL 3OXRB 3DX7B 1JYVA 4FHBD 3ETBF 1LD9A 1GRWA 1Q9OA 3T2NL 3MYJB 1SMOA 4LHQB 2YUZA 1FL5B 5DSCA 2WWKT 2A74A 1OPGL 2ZP0T 3CUPA 4JCMA 3JWDH 1JTTA 1JGUH 3WFHB 4XH2A 4IHOB 5DQJB 5C0CE 4NPYA 4D0BA 4FZEH 2X89D 4XWGH 1F2QA 5D71H 3REWB 1J0HA 1IILE 1LEGA 3U30B 5CGMA 3F12B 5E94A 5JIIA 4Z0BH 2JJVA 3U1SL 5CJ5A 3ROLA 3BGFC 1YEJH 3X3FL 1TVDA 3QIBA 2C4FT 2IAMC 4YUEH 4MD5A 4DGYH 4L3EE 2WNGA 4P4KD 4YHNA 5C07B 5GGVL 2BVPA 5IIEB 4OTXL 3QDJD 3AY4C 4X7SL 3RL2B 1GOGA 1TLKA 5E8PA 4HS6B 1GGCL 3VXSD 3TO2B 3ZKXC 5DJ6B 3VXMD 4DK6A 5C0JB 3WS3B 4OGYL 1QKZL 3FB5A 3MXVL 1Q0YH 4PJ8D 1AGEA 4F7PA 2PW2B 4LLMA 4JZJB 5C9KA 4JKMA 3QUXA 1EFXA 1S7WA 4P9HL 2ICWI 1UWEH 2QQQA 4PJGA 3DURB 4C56D 1FVCA 4TPRL 3OJMB 5F7WC 1IC1A 4M7KH 1IM9A 3HS0A 4RFOL 1DTUA 3X11B 4IRZL 1X5YA 2L7JA 2IF7A 4PRPA 3GIVA 4XVTL 3TH4T 2R0KH 1CXHA 5ESQB 5IB3A 4NZUH 5IB4A 2DL2A 3QZWA 3SDCB 1K2DA 2NY1C 1A6PA 3BD4A 1DQLH 1KCSH 3O3EB 4U1IB 3O3DA 3VG9B 4I5BB 4M62H 5GRJL 2Z8VC 3PHOB 1FG2B 1MCLA 3TVMC 4KTDH 1OW0C 4AQ1B 2NTFA 5HGDB 4WW2C 1K85A 4MD4B 1U8LA 5HYEA 1MCWW 5HHNB 5E5MA 1VACA 4LLVB 2PYED 4ORGA 4U1MB 5GS1A 1MF2H 2NY2D 4AIZA 3MLSL 5JZ7D 3RI5K 1SJHA 4R3SB 1AY1H 3V4PH 3MRNB 4PJEE 1U3HA 2NY7H 3VRIB 4KZEH 3L95A 4H88L 5E5RB 1CR9L 4CVXB 4PJHA 1AGCA 4R26H 4U05A 1I3RA 4AEEA 5F1OB 5C2BH 4ZOCA 3KXFD 5E2JA 1FV1A 5D9SA 1S7QB 2NMSA 4S1SH 1JL8A 1WZMA 1QUNA 3QPQC 1A7BA 4R96B 3VFWA 4ORZC 3RTQC 3GMLB 5FO7A 5D1QC 4QRPA 2YXFA 3D3VB 4G5ZH 3QDGD 3ILPA 2PXYD 2E9WA 3O8XD 4MZ2A 4LCCC 3S35X 3P77B 1JGEA 3MGTB 4OCXL 5FM8A 4P46B 5DHYB 1Q94A 2W9EL 5D1ZD 3GSUB 5JXAL 4OGZA 3RNQA 4GRMB 3BE1H 1EZVY 2Y72A 2YRPA 4Z6AT 1UVQB 2DKMA 1AP2A 1IQDA 3L3KB 1AQDB 1IGIH 2GAZB 2Q20A 1E4XI 4OD3H 2NY0C 3WYRA 4U6VL 4OKVA 1QSFB 2B2XH 4ONHB 3ZE2F 2AXHA 2D9QB 5MEOA 4M1DL 4B0MM 1KT2A 1ROWA 1XIWB 5L88H 4WI8A 4MCZB 3H9SB 1CD0A 3D39A 1XGPB 3F7RA 1UXWB 3T4YA 3J7HA 4M6MH 3N85L 1NC2B 4HEPG 4YBLC 4FQHB 4Z7WB 3MUJA 5CEXB 5GGSB 3DUUA 4PD4J 3U0PB 3IFPA 5ACMA 1BFVL 5BVJA 4YZFE 2XZQL 4XP6L 2ENSA 2Z92B 5IQ9B 3PIQB 2C1OA 1OB1B 2AK1L 4LEXL 2IANB 3HI5L 3VFRB 3TYGH 3X13B 1KLUB 3OGOE 1FO0H 3FO2A 1IRAY 2XY2A 2HWZL 1N64L 2VQTA 1KG0B 3U4EB 2ZSWA 2X4SA 3VMOA 5BOZG 2HJLA 3CFBB 3CJJA 4JKKA 4KI5D 3MROB 2E7CA 2A1WH 1F00I 4HS3A 3OB0K 3N0PB 4HJGA 4Y5YC 3EYSH 1CE6B 5HD8D 1S7UA 5DJ0B 1Y18A 2W65A 5I1AB 3QWOA 4QHMB 5HHPA 3OMZA 3AVEA 4I1NB 5GPRA 3FQWA 3OF6D 3TN0B 4YDJA 4HS8H 3Q5TA 1GGBL 4M61B 4S1RL 3S88L 2X1WL 1H5BC 1CWVA 3GSVB 2YWYA 5MP6H 1BGXL 4PB0H 4S1QL 3FFCB 3ULUL 4I3GA 5HHOE 5IMMB 3FT4B 1OGTB 3IDNA 3QPXL 1AQKH 3G5VB 3TBWB 1JVKA 5B8CC 3KLHC 1NC4B 3RVUC 3S97C 3DX7A 3OB0H 5TDNA 1K8DB 2FZ3B 3FB7B 4JZNA 3PJSB 2P7TB 3VFNB 3HNSL 3G6AB 2FLBT 5ISZB 2PO6B 5KSAC 3MYJA 5J12B 3H9YA 3EYOA 2DLFH 2K3TA 5CEZE 3QI9C 4F37F 1ORSA 4RMVA 4N90E 5J6HB 2QHLA 5DQJA 4IHOA 3STBA 2FX9H 4MXQC 5TDPB 5IFAH 2UZYB 1NGZB 3UCRA 2Y06H 2ICWJ 3F12A 1GGTA 5KVFL 3LN9A 1BJ8A 5BZWB 1RZKH 3VU2A 1CCZA 3BP4A 5EA0L 3GBML 5CGTA 5FAAA 3ARFD 2H9GB 5IEKA 3VD3A 2A9NL 4B7IA 1OF2B 2H6PA 3VXUB 5IIEA 4K3EH 3V8CA 5J57B 3AS3A 1A1NB 2IPUK 4KV5E 5FUCC 3RL2A 4OUUB 3MRMB 5CSBA 5DJ6A 5HHXL 5C0JA 2BVOB 1JWSB 3MRHB 3WFZA 4KK9C 5IESL 1NUNB 2PW2A 5EULV 3P9WB 3GFUA 4WWKA 3S37L 1BFSA 4OM0H 4MNQE 4FFWC 1QFWM 3DURA 1E4JA 4R4FL 1DSFH 1DBKH 4NKQB 4JKPH 2YS4A 3VGAB 4PBVC 5FK9B 2F53D 3Q6FB 4NIKB 3S9DB 2DQTL 1DZBA 1N4XL 1HQ4A 3QA3B 1JJUA 5ESQA 4K9EH 4I3RL 4S2SB 1N6VA 5CBAB 4E9LA 3MBEA 1IT9L 3O3EA 3ET9F 1BREA 4GSDH 3CXHJ 1TVBA 4LLQB 3HE6C 5BCAA 4JFZL 1FG2A 1RZ7H 4PJ7F 1EK3A 3MA9H 1J1XL 4IRSD 1PYWB 1FNGB 2XZCL 4MD4A 4JJ5A 1QLRB 5HHNA 4KKBC 3WJJA 2VLJD 3GI8L 3G5XB 2FD6L 1SQ2N 4PLJC 2EDWA 3W81A 4R3SA 3VWKC 1HI6B 5DVLA 3FMGH 1EGJH 1G9MH 5D7JA 2GJ6D 1LGVA 2AQ1A 1A6ZB 3MRNA 3S36L 1T3FA 4NFBA 4ACPA 5IMOA 5EIIB 4PGEB 3HC4L 1I9RL 4R0LC 4DTGL 3LKPB 5JDSB 1JRHL 4PJGE 1VDGA 4ONFH 5EBGA 3FT3A 2E6JA 3WJLC 1EVUA 3U46B 1R0AH 1I8IB 2I60L 4R96A 3VG0H 1TJHH 3FB6B 4DGVH 3GMLA 1J05A 3RA7L 1UWGL 1FIGL 1JGVL 1R5VA 3CVIH 5DQ9A 4C59B 2DD8H 4JFPA 3S35H 5HGHA 2VAJA 4HIXH 1FCGA 3P77A 5C0IB 3PDGA 3MGTA 4HUVB 4W6WB 1JFQL 1QBBA 4QXUH 5AZ2L 5DHYA 3P0GB 5FHAL 4JLRB 3GSUA 4NJAH 4GRMA 4KI1A 3QWRD 1HILA 4NQXA 3WFEH 4Q74A 4PREB 4Y4KA 1G1CA 1UVQA 1S8DB 3OX8B 2NNAA 2DQHH 2GAZA 2Y6SD 2FNBA 3EDEA 3VGDA 3LPWA 4AENB 4XT1C 2VZ3A 4ONHA 1GZPA 1IC4H 4HKJA 5SWSD 4JPVL 1ZA3B 2DMBA 2VITA 1KN4L 4PJHE 3MLVH 3VFOA 2JLLA 4U7SA 4MCZA 3DSNA 5I1JH 3SDXA 1WCBB 4XPBL 3UTTD 1XGPA 1UXWA 5IV2A 4MAUL 4TNVK 4FQHA 5GRUL 2V2TA 2J4WH 3B9AA 4NBYB 4Z7WA 4Y4FB 2JJTA 4NZTH 3W39B 3U0PA 4ESKA 3M1BA 3TZVD 3QFJB 3QIWB 5HXMA 5ALBL 1T7XA 3EKCA 5I8CB 4NNPH 1H3TA 1ZV5A 5TGBA 2Z92A 1CGWA 4G3YL 3PIQA 3GRWL 4LPCA 3ILQD 1OB1A 1T1WA 5LGJA 2IANA 3VFRA 5GIRB 4YDVB 1KLUA 4N0UA 2B1HL 5ERWA 3FO0H 1UM6H 3DVFA 3CFDA 3CFBA 5IVNA 1JTPA 3GSWB 5FCUL 3ULUF 3E2HB 3KJ4B 5EU3B 5LG1A 5J06A 4QOKD 4L9LB 1EIBA 2MOVA 4KJQC 1CE6A 3L5WB 2CDFA 4RGOL 1V7NH 5EC1B 2R9HD 5DK3A 3RX7A 1BIIB 1Z3GH 2FBJL 4M5ZH 3TN0A 4PRBA 1GZQB 5KVGL 1AD0B 3LPFA 2VXVH 4G7YH 4M61A 5CILH 3SHSA 1JHLH 3GSVA 4NDMB 1G6RH 3MRDA 4P4KB 4KXZH 4M8QB 4OLXL 3FFCA 4LPTA 5E2TH 1CLOL 3QDJB 3FT4A 1OGTA 3WFCH 4GXVH 4LPXA 4FXLA 5CD3A 3VXSB 5I18H 3QUKB 1NC4A 1K8DA 3FB7A 3PJSA 1RURL 3VXMB 4LVEA 3G6AA 5E2UH 4OFDA 4ZFGH 4PJ8B 4YPJA 3ARBD 3HR6A 4FQJL 5F7NC 3WLWC 3KPMB 2ED7A 1YPZB 3L5XH 5JPMB 1RZFH 4DW2H 1EEUA 3T77A 4O4YL 1T7WA 2P5EA 5TDPA 1NAML 4PR5B 3GO1L 1E0OB 1IGCH 1EGJA 1R24B 4NQDD 1T5WB 5DS8B 3AUVA 5IGXL 5IW1A 4HMDA 4LGPB 5DGRA 5EZOL 4APQC 1K3IA 4OF6A 4GRLC 2HLFD 3MSPA 2R1WB 4H0IA 5EZIH 1JHTB 2YUWA 1I75A 5BZWA 2WMPA 2W9DH 1MJJB 4K94C 2ERJB 3MV7E 4PG2A 1KF9B 5DTFB 5TJWK 4MA8L 2EDLA 2FWOA 4ZUWA 2R2CA 4Z8FH 3EOBA 1FH5H 3MJ9H 4Z7VA 3OKYA 3MNZB 3GM8A 3HE7D 1T5XB 3TNNA 3B6SB 1HH9B 3A0OA 2E5EA 1IC7H 1MQKH 3MRHA 3GI9H 3KHQA 1HIMH 1EO7A 4MJ6B 4PJAF 4OQTL 4YHKL 3WEXB 2W0FA 4PJCB 1JK8B 2BRRH 3RVTC 2ADGB 1PSKL 2H2PD 3NCCB 4NGHL 1AJ7L 1O5DT 2RQ8A 4NWTL 2KPNA 4HWUA 4L29A 5HHVL 2GT9B 1D5IL 5FK9A 5L2KD 4GKNB 3Q6FA 4HWZB 4MAYD 1KIPB 4NWUL 4GBXA 3ZL4H 3LKNB 5IVZB 4EJ1C 5MHSE 1KLGB 4DZ8B 3AGVA 2R0LL 3RIAK 2VQ1B 3FN3A 3EO9L 3FOLB 12E8H 4FQCH 3QDGB 4QLRA 1KGCE 2PXYB 1DBAL 4ALAH 4LLQA 4NCDA 4NJ9H 1JGDB 1MIML 2WBJD 3L5HA 3A6BL 5D1ZB 3AREC 1HE7A 1FNGA 3BZDA 4Z76B 4ODUB 3ARDD 2YD4A 4MQXD 2XA8H 5HDBE 5IVXF 3VXNB 4GG6B 1A1OB 3PWUA 1HI6A 1REIA 4HIJA 8FABB 1A6ZA 3F6IA 3UBXB 5H94B 4KMQA 2C3XA 4LSDA 4PGEA 1TPXB 1EAPA 1A7PH 2A9ML 3RUGF 5BV7B 4G6AD 4RMRA 3ALXA 4LLUB 5M94B 1I7TB 2FBOJ 4DK3A 1B9ZA 3U46A 3FQNA 1I8IA 4P9ML 4O02L 4IOSD 3T0WA 3AROA 3QUZA 1ZLUH 4JO2H 4KQ4L 5BS0D 1GGIH 1YECH 3ZKNC 1VEOA 3UTSD 1XF2A 1YEGL 4W81A 5C0IA 3MUGA 4GUPB 3WIHL 3VGFA 1MCJA 1A22B 5F7DA 2IBZY 2EDYA 3FTGA 4FXKB 4CUCA 1EO8L 1UG9A 2EYRB 4NO0D 1MRCL 2QEJA 2YPKB 3EYQD 4M1CC 1IEBB 4J4PC 5I1KL 1A3RH 1TFHA 5TPWH 5ICZB 3FB8B 4OZGB 1SVCP 3QUYA 5L7XH 1J9CT 1MH5A 5FF6B 4HUWB 3UP1A 4ZAKA 1JWMA 1KACB 1CS6A 2AJXH 5K9OA 5IFHL 4E5XB 3ZYJA 3PV7A 1ZT4B 3U7AA 3GUTA 5ANME 4HKZB 4OZ4B 3T0BA 1SYVB 3P9MA 1WCBA 1B2WH 3O2VL 3AS2A 5C0RL 4WHYH 2X40A 1BM3H 1NQBA 4LL9A 2YUXA 4Y4FA 3W39A 1NEZB 5BZDB 3U0WH 1F58H 5DUMH 4YO0B 3MLWL 3KYAA 5K59F 1A3LL 2HAZA 5A16B 5I8CA 3PDOA 4RA3A 3QQNA 1NDGB 2YD6A 1S9VB 2I5YL 1S7XB 2X4QB 3KG5A 1KB5B 5GIRA 4YDVA 4Y5XB 4LSQH 5ILTH 2W92A 2YRZA 3BH8A 1AHWB 4NN6B 5I1GL 1LP9F 4C4KO 2EXYC 3RWDB 5B4MC 3CXDH 2R69L 2Y4SA 2XKUA 2B0SH 5F9WB 3QUML 5EU3A 4OT1L 3Q5OA 3LAFA 2UWEB 2WBKA 2X89A 1FGNL 2ADJA 5EC1A 3GHBL 1Y6NR 4WFEE 1NGPH 2R0WL 5CS7A 1GZQA 3SDXE 1BD2D 1L0QA 3DJ9A 4RAHA 4O2CA 1AD0A 2ZG1A 3QCTH 4AIOA 4LF3A 5BVPL 7FABH 4I18B 5EUOF 3IDMB 5TQ2L 4NDMA 3ARFB 4P4KA 4M8QA 3UPRA 1P9MA 1E4KA 5DD6A 1H3PL 5SWQB 4IRJD 1AR1C 5D93B 5FUOH 4P4RB 1QNZH 4Q6IC 1H8SA 5INCB 2XTJD 3VXSA 2CIKB 4IMKA 5C0EA 4XP1L 4LLYA 5D2LA 3VXMA 3SOBH 4P5TC 1JZ8A 4MSWB 4PJ8A 1IKNA 4GRWB 4MNGB 1KJ3L 1Z9LA 4UT7H 4UB0L 1YPZA 1A7QL 5JPMA 4C56A 1C5CH 4MVBC 5JR1L 3TC9A 5GRVL 4OI9A 2CPCA 4J6RH 1F4HA 5J9PB 1IGML 1WLHA 3MRBA 3GMNB 4QTIL 4ODHH 43C9A 1T5WA 5DS8A 3SDAD 4YX2H 4K7PL 2F53B 3U9UA 1WZ1L 3TCLB 4ODSL 1CICD 1FORL 2JB6B 3LKRA 3GHEL 2R1WA 2WUCH 1JHTA 1KCKA 4XVUD 1WT5C 5K33A 1MJJA 1IBGH 3BT2L 3T0ED 5DHVH 1FBIH 5E4EC 2ESVE 2E7HA 4Y5VB 4QWWC 2ZSVB 4F15C 1BECA 2NY5L 5CEYB 4IRSB 4CMHC 1MCPL 3O9WC 1UENA 2GCYB 4NCC1 5EOQL 2VLJB 2PYEA 2AK4E 1EZVX 3B6SA 1HH9A 3FQRA 3PDDA 4PJDA 4Y2OA 1G84A 4BJLA 1ULVA 2CJUH 5C2UB 5HYFA 2AVGA 2GJ6B 4MJ6A 2L4OA 3LKSB 3GZKA 2Y25A 3N1MC 4PJCA 1FJ1B 4Z95H 3KXFA 3OQ3B 1HSAB 3LHPL 2P5EE 4KXZI 4WUKH 1FGVL 1AXSB 1FDLH 3ARRA 1RIHH 1MIEH 5D70L 1ES0B 4GKNA 1MJ7H 4HWZA 4KAQH 3SKJH 3V2AR 3WIFB 1KIPA 1PY9A 2HH0L 1FP5A 3E8UH 2DJSA 3LKNA 4UV4H 5EZLA 5IVZA 5T33L 1NBVL 1YUHB 2Q8AH 4X0KA 2H3NA 3FOLA 3LVEA 1T1YB 4Q58C 1DUYB 1MUJA 2ICES 2PXYA 3GMQB 3MLRL 3M17B 3QDGA 3IVKB 3O8XA 3MPCA 3CAFA 1JGDA 1GPOH 2A77L 2ID5A 4L5FL 2PR4L 3GJEB 3IU3B 4JDTL 2OQJB 5DJAB 1CLCA 3MRCA 4NNXB 2HTLC 5HHMD 5D1ZA 4YHML 2DQEL 2I9TB 4Z76A 4FQXD 4NP4L 1NDMB 4XNUH 4NM4L 1RUPL 4NSKB 3VXNA 1GXEA 1A1OA 3HFMH 1P84K 2OR9L 1RULL 3RZCC 2DLHA 4PRDB 4N8VB 2QADC 5DRWB 3EYFB 2BSTA 1MLBB 3H9HB 3QCVL 5SV4A 3T2PA 4B50A 4CW1B 3ULUD 3ESVF 4PLKD 2WUBL 4JFFD 5DLML 5EORH 3WNLA 2J8UE 4JO1H 4LLUA 1W2KT 1LQSR 3MV9E 1V3MA 1I7TA 4I0PB 1VFBB 1QOKA 2BERA 1V3KA 3BQUC 2ORBH 1O7SA 2VLRD 4I2XE 4L1HA 4F58L 1INEL 1QO3B 1YN6A 4PJFF 4ZUSB 3WNMA 3TZVB 5JNYB 1JYNA 3QEHA 4UOW0 2DS4A 2W59A 2XXCB 3PE9A 2D7NA 3ZDYF 1AI1L 5CFHA 4FXKA 2JJUA 3BESR 4FMKA 1KULA 1JI1A 4PGBB 5J6GB 1AGBB 5AZEH 4ZXBC 1IEBA 1EHXA 3BEVA 4M4RA 4XVSL 5ICZA 2EH8H 3NZHL 4XRCA 3FB8A 1D3CA 5SWZB 5CSZB 4TVPD 4Z7QE 4WFFE 1TTGA 1D6EA 3W11D 4LVHC 2JIXA 4QOKB 1AXTH 1ZT4A 1IAKB 3VRLE 4HKZA 4OZ4A 3FAWA 1X9QA 1SYVA 4ELKA 5ABDE 3BHBB 4UINL 4QNPF 1KIQB 1IGTB 2VKWA 3JTTB 5TQ0H 3OF6A 4RIRA 1EVTC 3CGTA 3G04B 2EYSB 3HTLX 1JPTL 5BZDA 1JPFB 1MHPH 4YO0A 3BSZL 5IBUB 1A6UH 4HIEB 3FRPG 1FRGL 4MXWL 3CDGB 2FL5B 4DKFL 5IBLD 5A16A 5I6XB 4F9LC 1OTTD 1NDGA 1S9VA 1T0NA 2FB4H 2V9QA 4HC1L 4WI4A 3X17A 1PQZB 2NY4C 3HNVL 4Y1AD 1KB5A 2R2HA 1C5BH 5IT2H 4Y5XA 5D1XC 3RU8H 3HB3C 1GL4B 4OLWL 2JCCA 2IADB 5MENB 1AHWA 5IUSA 5BW7A 3ARBB 3NABL 1R3LA 2MHAA 4RAVA 1NMCB 3NFSH 1W72L 4YDIH 4E42B 4QHKI 1J10A 5I1HH 3BAEH 3MTRA 2MKWA 3W82A 3R1GL 5GGRB 1KXTB 1MREH 4P23D 1LO5B 2N7BA 4X7CC 1WJ3A 3VMPA 4EDXA 2KUTA 2IQ9H 3DRQB 3H7BA 4M5YL 2JE8A 4OSUH 3UDWA 3HNTL 5CKAA 3MCG1 2HVKA 4LEOA 3D2UB 1KJ2B 4I18A 3DTXB 1JNNL 3IDMA 1RIUH 5CZXD 4G43B 1ZVSB 2VDNL 3BH9A 4PS4L 2NY3B 1HHGB 1OQXA 2PETA 2EDTA 5SWQA 4KMTL 3Q1SH 1GAFH 1KNOB 4NQUA 3QH3A 3EFDL 4JO4L 5C6TH 3V79C 2F58H 1YYLH 2CIKA 4YR6A 3WDJA 4EUPG 1R5WB 3CFIC 5J11C 1GSMA 1FZOB 1NMAL 3MRIA 5FO8A 2EE9A 3W9DA 1MAML 3HCVB 2LTQB 1D5ZB 4MQTB 4KKAD 1RZIB 4MNGA 2ZCLL 3O4OB 1DBBL 1IL1B 1NJ9B 2DLIA 2DQUH 4H1LB 1OTSC 1CD1B 3KLAB 4LSRH 3ME0A 5HVFB 4YFLF 5J9PA 3GMNA 4JZOB 2FEEI 4HPOL 1T83A 4WW2F 5L2KB 2F53A 2CKBL 4MAYB 3RVWD 2ED8A 1OWRM 2JB6A 3QBTB 1TMCB 1K6QL 2C7UB 3BYYA 4AEIL 2HT2C 3GIZH 2X41A 5LGHL 3P9LA 2ZJSL 2WBJB 3BPNC 4AG4H 4AY0A 3JXAA 2ZSVA 3UZVB 5CEYA 1FSKC 3C5ZA 1CLYL 3CX5K 3ARDB 2GCYA 4JM2F 3RPKA 2VLJA 1U42A 2F5BH 1ZGLM 1XF3B 4HWBH 1F4XH 2WWKO 3D9AL 2VDQL 3MMEB 1R3JB 3LIZL 3MFFB 1N5AA 2H45A 2VXUL 5LCVL 4KK6C 4JO3L 4EZMA 2IQAA 3BDYH 1GIGL 1ZOXA 2IEPA 3A6OA 1PEWA 2R29H 1KJ2H 4C56E 3VFMB 2NR6D 3G6JF 3HMXH 1AXSA 4GKOA 5TDOB 3C60C 1ES0A 3JWNC 4WNQB 2YKLH 3MRJA 1I85A 1P7KB 3BISA 4X6DF 2I25N 2UVEA 5I8EB 5CBEB 3UC0L 3NAAL 5IB2B 5BS0B 2EO1A 3SEPA 4HKXB 1T1YA 2AJSL 1DUYA 1NCBH 3HAEH 3GMQA 2EE6A 1YYMH 3UTSB 3PGFL 3ZHKA 4HKBB 5DJAA 1UFUA 1RMFH 3BKMH 4NNXA 1BZ9A 3OAZK 3MOQA 1MCOL 5L8LB 3R0NA 3QWRA 3KPRD 1NDMA 4F7EA 3VD5A 4NO0B 4ZS6D 4HQQL 2H8PA 5T3ZH 1YN7B 1Z5LB 2PYEE 1XAUA 3NACH 3QXUA 1OM3H 1CLZL 2X9WA 5KSUB 3EYFA 4JDVB 5F7MC 5SWSA 3TNMA 3V5KB 4KROD 2VSCA 4XCFL 1WBXB 2D7OA 4JFDA 4JREB 2AJYL 1KJMB 1BEYL 1PKQE 5ID1B 2B4CC 1RUMH 5CZVH 5E2VL 3KXFE 3UTTA 5CUSL 4JR9L 4M7ZC 2XPGB 2F19H 3O3AB 1I1CA 3OZ9L 1MCRA 5D7LB 2FYYB 3TZVA 5JNYA 5BXFB 1XF4B 4P2RB 3B2UD 2ZCKH 4EN3C 4X7EC 4TYUA 5IR1A 1I8MB 2X4PA 2EEDA 3DLQR 4U3HA 5T1DL 4MCYA 4PB9L 1P69B 5DMYA 1UB6A 4OI8A 2ZUQB 1CIUA 1IC5H 1PLGH 5ENWB 2V17H 4MLIA 4YEFA 4OF3A 4FNLH 4PRIE 1T6WA 3O6ML 3B9KB 1YY8A 5CSZA 5DMGD 2DDQL 3ZKMD 1U3JA 4LPUA 3T2NH 2N4IA 1HXYB 3DROB 1LILA 1ZT7B 3Q6GL 1EFQA 1FZMB 4XBPB 4QOKA 2OTPA 4UTBL 1A02N 5B38B 1OPGH 3RKPA 4O2EA 3D1MC 3BHBA 3WNNA 2APTA 1TJIL 1ZK9A 1KIQA 3PQYB 3JTTA 5HI4C 4Q9RL 4G9DA 4QHKJ 3G04A 5D6DC 1BD2B 4X6CE 1L6XA 3QAZC 3IFLL 4MWFA 4ZS7L 3VXPA 1X5JA 1RK1B 4HIEA 1ONQB 3OSKA 2FL5A 4BQ9A 2GFBA 4HBCL 3U1SH 1CDJA 1BQHB 5F1IB 1I7UB 3H8NA 2D3VA 4PJ7B 3X3FH 4A6YL 1I8LC 5A2FA 2YPLE 1PQZA 1QLFB 4HHAA 5GGVH 3B9VA 4OTXH 4XCYB 4WFGD 3QRGL 4X7SH 5EN2A 1BJMA 1GGCH 2IADA 4LKXB 5LKNA 5F3BA 3ARBA 2MSPA 2H2SD 4OGYH 3NFPA 1QKZH 3W5NA 3MXVH 5HGGS 1TENA 4G8GD 3RHWK 4E42A 4LFHD 1Q8MA 4NBXB 3KJ6L 2EC8A 5GGRA 4U0RC 3S37X 2Q7YA 4XNQB 2X4RB 3K8LA 3HC0A 1LO5A 4NQDA 4TPRH 3BW9B 3SDAB 4XZUB 1BX2B 2XIDA 4RFOH 4IRZH 3DRQA 3OG4B 5E9DB 3PWPB 4XNZC 1CICB 2FEDD 1I1AC 1S9KC 5EBWA 2LE9A 1KJ2A 3BN3B 3DTXA 5KW9L 1YMMD 3R06A 3JVGA 3HMXA 4G43A 1RJCA 1ZVSA 4MJID 4XB8A 2HLAA 5IWLA 1UKSA 1HHGA 1MRFL 3FL7A 1A9EA 1KNOA 1JZ7A 5GRJH 4M48H 4LVNB 3HE7A 3HAEA 4UILL 5I74C 1DBML 1R5WA 3CMGA 3IT8D 5F1KC 2EECA 5GGUB 1WVZA 3HCVA 3AXLB 1D5ZA 5TF1L 4JKWA 1RZIA 1L6ZA 1PG7H 1Q0XL 1NKOA 3MLSH 3SPVB 5B3NA 1IL1A 3VXQA 1FG9C 4NRXB 1QEWB 2F74B 3IJYB 4H88H 1A7RL 5DO2D 1CR9H 4LLAA 5IM7B 3CH1B 5KG9B 5HVHC 4OLZL 4BH8A 3ARGB 3IS0X 5HY9B 1QD0A 1SM3L 4MAYA 1CBVL 5H2BA 1IKFL 4KZDH 1T2XA 7CGTA 1V3JA 1UCBH 2D7TL 1RZGB 2VOTA 3VXTB 3K74B 3SE8L 1QBLL 2WBJA 2VXSL 3CFCL 3MNVB 5T1LD 5M95B 1I9JL 3DBXA 3ZHDA 4FQXB 4Y8DC 4RRPA 3ARDA 4OCXH 1ZTXL 4HXBL 4CRPA 4WO4D 1II4E 3LDBB 4YLQT 1XF3A 5JXAH 4KKLD 1WFOA 5B3JE 4TTGA 3MMEA 6FABL 4MA7L 1PGRB 1J5OL 1MRDL 1S5IL 3LQAL 2R4SL 1DDHB 3W0WD 4AJ0A 4U6VH 1U8JB 2WSKA 1BWWA 3FT2B 3R4DA 2W07A 4M1DH 4PJ9C 3PWNB 4J7RA 5HHQB 4V1DE 5TDOA 4WNQA 2VLRB 4W70A 1G0YR 3OR7B 3QIBC 1X4YA 4OZFB 5DT1L 5ID0B 4MDJB 3D25B 4Q7DA 3N85H 3PHQB 5BS0A 5IB2A 4HKXA 3UTSA 4IJ3C 2O61A 2P46B 1HNFA 5D7IE 2G75A 1KUMA 4HKBA 3O0RL 4U1GC 3OAUL 1NBYB 1BFVH 4AL8L 4LU5L 1NLDL 4YDLB 3LS4L 4XP6H 2P8MA 4NO0A 1MHHB 1VFMA 3CMOL 3RX5A 2AK1H 5CIPB 3HI5H 5I1DB 1YN7A 1V05A 2P45B 3QUXC 1Z5LA 3O2WH 4U31A 5DJCB 3RWJB 1MVUB 1Q9KB 2HWZH 1N64H 4G7VL 1C08B 4HIIB 5GZOD 1IMHC 1WC7A 3C09C 3V5KA 1WBXA 1I1YB 3QRFM 4QGYA 4UMGA 5ID1A 3V6ZA 3S5LG 1WISA 4HJJL 2QQLL 3B2VL 1IAMA 3M45A 3O3AA 1TQBB 2R1XB 3R0MA 1N59A 3DV4B 5D5MF 2FGWL 4KRPB 5BXFA 5DQDL 4X80L 4GG8A 1GGBH 4JB9L 4S1RH 3S88H 3H2WA 4WEBH 1QACA 1PBYA 3EJYC 4E41D 1BGXH 4S1QH 2EC9T 1IGFL 1MCEA 5ESVB 1RZJC 1M71B 4NKMA 5KS9B 4GQPH 4PJBF 3JTSA 4PJAB 4DZBB 3HNSH 5FYKU 2XN9E 5F7HA 1B4JL 4DVRL 4UBDC 1AD9B 1M05A 1WCQA 3DROA 1HXYA 1ZT7A 3VFVA 2R4RL 1FZMA 4IEFB 2XNAB 5KBNC 4YIQA 4BZYA 3K8MA 4P23B 3TVMD 4JFDE 2FR4B 4UU9B 2DI9A 3M8OL 4LLDA 1BD2A 2AXFB 1WBYB 3UTTE 4E0RB 35C8L 2FJHA 3VWJB 4XWOC 4XNYL 1RK1A 4Y2DB 2BRQA 1ONQA 3T65B 5CIPH 5GS2D 4DCQA 1I7UA 2ATKA 4YDKL 4B41A 3SBWC 4PJ7A 5EA0H 4IRJA 5ALCH 3IDIB 2Z31B 3GBMH 1K8IB 4ZODA 5ETUB 4JM2D 4R7DB 4XCYA 1BOYA 4OZHB 3O6KL 3CK0L 3CDYA 2OTUB 3V6FA 2PW1A 2D0GA 3BIKB 5H35B 4LKXA 1MY7A 5ECJE 5HHXH 5MEQB 2VIRB 1JZ3A 5IESH 5I71C 3WNPA 3HHRB 1EHLL 2DWEA 3GDBA 3QXVA 2A6JB 3S37H 5AD0B 3GBLA 1NCAL 5JW3L 1L7TL 4MS8C 4TSBH 3H3PL 2A83B 4R4FH 3SDAA 4W68A 3CSYB 3JWDC 4XZUA 1BX2A 1LO2L 3DVNB 2HT3C 1CICA 3WNOA 4NYLA 1XZ0B 4S10A 2DQTH 4JEGB 1N4XH 2QKIB 4I3RH 3T0EA 4CVZB 3F7YA 1D9KB 4JPWH 1RU9H 3BGAA 5EO9B 4LCYA 4P2OC 5HYSB 1RQ5A 4XXDA 3K1KC 1UT9A 1ZAGA 3HI1B 2XWBB 1KTLB 1M7DB 1J1XH 3QQ3B 4M6OH 2XZCH 3B5TA 5GGUA 1MY5A 3AXLA 3CZJA 1ZGLA 1Q38A 5CINL 3GI8H 5I30L 2FD6H 4GT7A 4MB4A 3SPVA 5IP4A 2YWZA 1W0YT 1QEWA 3UJIL 3H0TB 2CK0H 2OX5A 1ED3B 1H3WM 3IJYA 1T04B 4WU5A 3RL1B 3UTOA 3C6LA 3HG1B 4EXPX 3HC4H 1I9RH 3ZTNL 4DVBA 4DTGH 1JRHH 4JRYD 4JDZB 5HY9A 3PP4L 5B39B 4N8PA 2IPTL 4NQDE 1H9VA 2AV7A 4WU7B 5B22A 1RZGA 2I60H 2R2BA 5KVDL 3I02A 3L3OB 5C0FA