2YMXL

Crystal structure of inhibitory anti-ache fab408
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
213
Chain Sequence
b'DIQMTQSPASLSASVGATVTITCRTSENIDSYLAWYQQRQGKSPQLLVYAATNLADGVPSRFSGSGSGTQYSLKINSLQSEDVARYYCQHYSTTPWTFGGGTQLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB ANTIBODY HEAVY CHAIN
publication title Molecular Characterization of Monoclonal Antibodies that Inhibit Acetylcholinesterase by Targeting the Peripheral Site and Backdoor Region
pubmed doi rcsb
molecule tags Immune system
total genus 53
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2012-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ymxL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ymxL01
3BP6A 5IJVA 5KTEL 2ZCLL 2H2SD 3OXSA 4Q9QH 4ZFFA 3KPSA 4E42A 3MRMB 5F8QC 4HC1H 4HGWB 3VWJB 3UTZB 3MGTA 1BJ1J 3LKPA 5BXFA 2EH7L 4Z7QE 1MCDA 5JXEA 43C9B 3DVIA 5JORB 1DUZB 1S5HB 4FQHB 3ARFB 5DMGD 4Z7VA 4UQ3B 4F7TA 4WWID 3T3MF 5C8JA 4KQ4L 4N0YH 3LN5A 1UEMA 1A6WL 3VXMB 1QPXA 3FAXA 5GGRB 1I1AC 4XHJD 4KZDH 4NPYB 1HKFA 3ULSB 5DA4A 1ED3A 3T0EC 5BMFH 3QFJD 1F45A 2VWEE 3WFEL 3RPKA 1MY7A 4FQJL 4M8QB 5HJ3B 3KPMA 4YPGB 4XAWH 3QZWG 4TYUA 3VFMA 4Z76A 1ACZA 3P4OB 4PGCA 4PRAB 1JFQH 4PGBB 3QT2A 1KLGA 5C0RH 3BH9A 4Q7DA 4GKNA 1MJ7L 2FO4A 4OM1H 2F54A 3UTSA 2R2EB 3TBSA 2ATKA 1S7SB 4UT9H 4DGYH 4EI6B 3GBNL 3PGCA 4QRRA 3ARDA 4Q2ZB 1TITA 5EUOF 1EFXB 4B5EA 1A14L 1OT2A 1NBVH 1ZHKA 3MNVA 2XZAL 3MGAA 1KIPB 2DQDL 5CUSL 1RU9H 4M7LT 2AEWA 3KVQA 4DZBB 5E4EC 3Q5OA 5FGSA 2P4AB 3D5OF 1J0JA 5E5MB 3VFOA 1FFQA 4RMUA 4G42B 3L1OH 2BVPB 3TIEB 2LU3A 3BKCH 5IUSA 2QHRH 1G6RL 4E0RA 1IFHH 3QUXD 3LKSB 4XNYL 2X1OA 3HZKB 5L9DH 1DANU 3EO9H 3V6OC 1A02N 2C9AA 2CDEB 1S7WB 3CGTA 3RGVB 1P1ZA 4PJ9D 1NMAH 1HDMB 4Z8FL 4XMLH 1L0XA 3NFNB 4ESKA 4OF8A 2B1HH 2ZSVA 1SHMA 2B7DT 3QDME 3ZDXF 1FZKA 4FFWD 5DO2D 3O9WD 3PHQA 5FXCH 2LAAA 3HI1B 4X9BA 4N5ED 5E8OA 1V7ML 3SQOH 4YDLC 1A7QL 5FFLA 3ZKXC 5EU3B 3VD3A 5IMKA 5DFWH 1YEDA 5BOZG 2Y36L 1FDLH 4CN4A 3UPRB 3CSYA 4JRWA 1P4LB 5I16A 4LNVA 4DAGH 3FO2A 1G7MB 3ZE2F 3MRLA 4P23B 1QNZH 4WI9A 3BRFA 1HHJB 3FQRB 1LVEA 3HE6A 3SGDI 3BGFB 3I6GA 1IQDB 1W0WA 1YEIH 2OJZH 1R5WB 4L8SC 1I7RA 5J06A 1ZAGA 5B22A 3QIUA 3L3DA 3QI9D 5ALCH 5DZNA 5C0DA 2NZ9C 1V7NH 2E8ZA 3LZFL 3MRDA 4PJFF 1ZHBB 1NLDL 3T2PA 4MA7L 2Y5TA 3O6MH 3BKJH 4QHMA 3BPCB 3OJVC 4LU5H 5AZ2L 3OKEA 3F12A 4JM2D 4XBPA 1IGTB 5B8CA 4J4PD 3GJFH 5CEZH 3NPZB 3MFGB 3RAJL 4R7NB 1CD1B 3FT4B 5DMGC 3P40A 3RIAK 3GSVA 2FGZA 3S36X 5HYIA 4GAJH 1RZGB 3AREC 5J8OA 2B2XH 4LVHB 2GTWA 5D9SA 3ME0A 3L3GA 1Z5LA 4NT6A 1KB5A 2BZDA 4AEEA 2DYPB 3FQXB 5D8JL 3JTSA 3F5WA 3RP1A 3TA3C 4XPAL 1A0QH 4TVPE 2ZWLT 3QZWA 1X5XA 1CXLA 4O00A 1NGXB 4PS4L 3U9UB 1C1EL 4TSBH 2D7NA 2BDNH 5AZEH 5ETUB 4JHAH 2OL3A 4F8QA 3QJFB 1OF2A 2EDBA 3G6JA 5F1SA 1ITBB 3BZ4A 4PLNC 4CMHB 1F97A 4XC3H 1CCZA 1M4KA 1E28B 3LB6D 3DTXB 4FQXB 2A9NH 3WE6B 4C54A 4HJGB 4NUGL 1YYML 1U2HA 1QSED 2X4RB 3W39A 1KC5L 4YBQC 2OXHA 2HT2D 1KNOA 2B5IC 1JUFB 4U0RC 2YD7A 1E27B 4BKLB 3EZ8A 1HQRA 4XPFH 1LE5A 3VJ6B 5HGBA 4Y16D 5FM4A 5GGTA 2ADIA 1IGIL 1FHGA 3QNYA 3F58L 5EC2A 2I25N 5DMKA 4P5KA 1DBMH 5FCUL 1JHTB 5IG7B 3OJMB 4J8RA 1EH9A 3LS5L 4ZOEA 4FXLA 5ABDE 5C0BA 3NH7L 4OCLC 5FO8B 4A6YL 1G6RB 3G5ZB 4JM4H 3C08L 2CIIA 5FO7B 3QWRA 3DRQB 3O3AA 4UU9B 5JXEC 4P2QA 4MVBD 1VFUA 5ERWB 1UKTA 1KN4H 3I6LE 1SJHB 3JTTA 3MRQA 3B2VL 5I1CL 4ZYKA 1ZKAA 4LAQH 1OTUD 5DFVC 3HZYB 3GMNA 1U9KA 3PWPE 2VUOA 3RZCC 2ZJSH 2ZCLH 3V7AE 4BQBA 4PP2A 3IKCA 1B6DA 4UNTA 5HHOA 4WNQB 2Q8AL 5BZWB 5GSRB 2EH7H 3BZFA 4KK9D 4PRPD 3TV3H 1X44A 4F7CA 4PJ7A 2DTSA 3JWNC 1T03H 5DC9B 3C60B 4DGVL 3RL2B 3BYTA 1FL5A 3VE0B 5BV7C 5CSBA 4L9DA 5DMJB 3B2UC 3H7BB 4PLKD 1PW3A 3LD8C 2EKSA 3WSQL 1DTUA 2QSCL 3FQUB 4KQ4H 5IFAL 1A6WH 1WC7A 3VXUD 1JYVA 3ARDC 3ALWA 4YHPB 2APXA 1NLBL 5E8PA 3IRPX 1U8KA 1MPAL 1HK6A 3WFEH 4M8VA 1BD2D 4PB0L 1PZ5A 5B4MC 1XEDA 2A6DA 4FXGB 3EW3B 2OMNA 4JANB 5L2KB 3KWWA 3T08A 5E9DD 5KBNC 3ES6B 4QF1A 5C07D 4NO5A 3O8XA 5IM7B 1YUHB 2CJUH 3U2SA 1JGEA 1EA9C 3GBNH 4JFDB 4QRQB 2PW1A 1W8NA 5DEFB 4F37F 1A14H 4KJWC 5JDJA 2XZAH 2DQDH 4P2OD 2XI9A 5CUSH 3V6FB 4JHZA 5D6CB 5AD0A 4YH6A 2M2DA 32C2A 4U7KA 4BH8A 3H2WA 3C87A 1I9JL 4QY8B 3ZKMD 5IW3A 2PKDA 3U30C 1ZA3B 1G6RH 5SX4I 1HE7A 3MLPA 5LGJB 1V5JA 4GMSL 4NDMA 3OKNA 5EU5A 2ZSWB 4XNYH 5T1KB 3AXLA 3VI3E 1TIUA 3CIQA 3KPOB 4NZUL 2OR9L 3H3PL 4Q9CA 2PUQT 4OCSL 1IEBB 4RGNE 4WUUB 1CDGA 2ITDB 4OLZL 4Z8FH 5CJQL 3DXAE 4NHCL 2IJ0C 3EO0A 3QPXL 2H3NB 5IBLD 4GW5B 4LLMA 3EBAA 3OGCA 3TM6A 4CADA 3INUL 5EZLA 3ILPB 1IKFL 1KTLA 3MGOB 5D93C 3DBXA 5IB3A 3HE6C 4MLIA 1V7MH 5I8EA 1ZGLA 4P2RD 4P46B 1CF8H 3JV5A 5EBMA 4G8GD 1BBJA 2Y36H 1CG9B 1UJ3B 1BVLA 4NKOA 4U6YB 1A4JB 3QUYA 5J6HA 1PY4A 1LO2L 3OPZL 1QYGL 5B8CC 3D3VB 1UYWL 4OFPA 1S9XA 4ISVA 1UFUA 4A6YB 3MXVH 2EDDA 3LVEA 4N8PA 5DGRA 1J8HD 4ZQKA 1JTOA 3RWDB 3KYMA 2D31B 5IQ7L 3I3DA 4JFXA 4W70A 3QFDB 3E6FB 3LZFH 1NLDH 4MA7H 3BO8B 5DQDH 1FNSL 4KKAD 4OCYL 1YMHA 3C5ZD 5AZ2H 1WICA 4JKPL 1Y18A 1MQ8A 2DI9A 4OI8A 2BRRH 5DUML 4ZPTB 2NY1C 5BVJA 2VQTA 3TO2A 4F7EB 1UENA 5I6XC 5C0CD 5KJRH 2DOCA 3KR3L 4HUWA 5IVOA 1M6OB 1YEJH 1GC1C 1KIRB 1HH9B 3D25A 4ZODA 2DI8A 5C0EA 3V5KB 2ARWA 1MLBB 2DQJL 3BKYL 1SQ2N 3EGSA 5GS0L 2GJJA 1PEZA 2W60A 1OCWH 3MXWL 4WU5A 3NABH 4PS4H 1C1EH 2WV3A 2OTWB 4ZAKA 3QQ3B 5IVXF 4KK6D 1RJLA 4PJ5A 5CP7A 1CD9B 4NUJA 5I1GH 1OGTB 1KJ2A 3KLSA 2C7UA 3L5JA 3DMMD 2Q3ZA 4KMTL 4PJEA 3QDGD 2IPKB 3ZE1F 1TZHB 2I5YL 3C9NB 1A3RH 4QTIH 1UKQA 3RWEA 2JE8A 4PJHF 1G84A 4R0LA 1JGUL 2VAAB 4PLJD 4KTDH 4KXZI 3QWOA 4JFQB 1CFNB 3S88H 3O2WL 3VGFA 4GQPH 3KDMB 1IGIH 4IRJB 1DQTA 4PPTA 2BVOA 2XQBL 1CN4A 4KK8D 1V3MA 5FCUH 2P5EE 4GRMB 3WL9B 4HLZH 2CD0A 3EJYD 3GMMA 2DQTL 2EE6A 4HIJA 3LS5H 2WINB 1MCRA 4G43A 3M45A 3MNWA 5EIQA 1N3NA 3DI3B 4IRSA 5JNYB 3O4LD 5JIPA 3NH7H 5ESAA 2EH8L 5CZXD 4OKVB 4OD1L 4A6YH 5GS1A 3O3BB 5IKCA 4KZEL 3C08H 4PV9A 3BP4A 4XH2A 5IBLC 5E24E 4X6CF 3ARZA 3T0EE 4KHXL 5D7JA 3WUWB 2D7MA 2G2RA 3HN3A 4EZMA 5DJZA 4NQDB 3D85D 2JCCB 4JY6B 4JY4B 3WYRA 1NCBL 2CDGB 4R7DB 5HPMB 3ARBD 5KSBF 3TVMD 3W9DA 1AKJD 3RIFK 5SWSE 3R4DA 2Q8AH 1G7IA 5F9WB 2XWJB 4KKCD 4NWTH 4XVTL 5MHSE 1HHGA 2JB6A 4CJ1A 5JQ6L 2EEAA 2HFEA 3U0TA 1S7XB 1AGBA 1KGCD 2D7TL 3WSQH 3VWJD 4EUPG 1B88A 1QLRA 5IFAH 4U1JA 5F3HA 4CVXB 3ZE0F 1J05B 4JPWL 5IEHA 4NQVB 5SWQB 3GSRA 4OZHB 5D1ZA 3RUGF 1KN2L 3P0GB 5SWZB 3ESVF 4PB0H 3ARFD 4ENEC 5D2NA 1VERA 1WFUA 1I7ZB 1CIDA 1CR9L 2CMRH 1P7KB 3ZYIA 3STLB 1EHLH 4M7ZC 1BZ7B 1FV1A 4KAQH 5HVWA 2RJMA 4NQEE 3QEQB 1NCTA 2JF1A 2WBWB 3VXRE 4AEIH 6FABH 3D6GA 4XXCA 5BVPL 4QRPA 5D7KE 3SKJL 1FRGL 1WTLA 4ZUVB 2D2OA 2DQEH 1T66D 4OD2A 1T21B 5FF6A 1A6AA 3FQTB 1XH3B 1I9JH 1ETZA 3QA3A 5DUPL 2R56L 3LQAC 3NGBB 3KPRA 1U91A 3BE1L 5CEZD 3DARA 3L3KB 1EFXD 5FO9B 1OAQL 3PQYE 4Z7VB 3DIFB 4F7TB 2HAZA 5CZVH 1IM9B 4HJ0C 4NZUH 4ZNEA 2OR9H 4WO4B 2R1YA 4OCSH 2OI9C 3VWKB 4ALAH 1ED3B 2NY4B 5BS0B 3PWJB 1GVIA 3MQIA 4OV6F 4NHCH 5CJQH 2J4WL 1EAPB 3QUYC 2BCKB 1IEAA 3NIDE 3IFLL 5LAXB 3RHWK 3E3QC 4P9HC 5F7HA 1YECL 4KRMB 4XPTL 5JO5A 3UTPE 4H20L 4BA8A 1F2QA 5E95B 2OTUA 3IDJA 4WFEE 5T33L 4LLWB 2HFTA 1WT5C 2Y9RT 3DWTA 3RGVD 1H8SA 4LPWA 2W59A 2ED8A 2YEZB 1SYSB 4NM8L 1P7HL 1AHWA 1FAIL 1G9EA 1MNUL 3BN9C 4KUCD 1GZQB 2ATKB 3M17A 3RJQB 1I1RA 1N4XL 5K93A 3MNVB 2I60L 1LO2H 4TTDD 2DWDA 1P5UA 3NCMA 3VGEA 3OPZH 3J7HA 3EFDL 3QFJE 5EA0H 2IALB 3ARQA 1QSFA 1UYWH 2HVJA 4BFGA 4Y4FA 3TPKA 1JF1A 4UI2A 4BSWA 3HMWL 3GI8H 3HE7B 3GSWB 4ELMB 3VFOB 1NJ9A 5GGQH 5CCKH 1KJVB 1I3RA 2IMMA 2F15A 3Q6GL 5FGCB 3S98A 3UEZA 4LASL 1KOAA 5EO0B 1EJ6A 1EX0A 4OCYH 4P23D 3CSPA 1NBYA 5KSAA 1Q94A 3MROB 4ZAKC 4U3XA 4U6XA 3PWNA 3FN9A 1S8DA 4HEPG 3OKDA 4ZFZA 2ZG2A 4OT1H 4YBLB 4EUPA 3LCYA 3KR3H 1CFVL 3QP3A 5F9JB 1J5OL 3RIAF 3B9DA 1CDIA 1G0XA 5J4MA 3L3OA 1JNLL 3EOTH 2DQJH 3PGDB 3BKYH 1CS6A 5GS0H 3MXWH 4DGIL 2F58L 4LLQB 4R0LC 5IIEA 2VLME 4ZUTA 3VFPB 3C6SB 1JF6A 1LO3L 3KPSE 3FO2B 4L1DA 1I8MB 3MCLH 2DYPD 4JKWA 1U8IB 4Q6YA 3Q6FB 1QFHA 5E8NA 5JPMB 1T2QL 5DJDA 4RSVA 4PRDA 4M43L 2I5YH 3QIUB 3L3DB 4XMPL 1ORQA 3HLAB 4IRSC 4M93B 1N6VA 5DS8B 1MFCL 3GSXA 3MRDB 5GS1C 3JBG7 1C5BH 1KCUL 4LDLB 3NVQA 3STBA 4MD5A 2EDOA 4X4XA 3WEXB 3RVUD 4RQQA 2FLRT 3QEGL 3O2WH 4MJ5B 2NXZB 3K8LA 5D7JC 2I26N 5E2WL 1BBDL 1U3HB 4FQXD 1HYSC 4JZJA 1UGNA 2V2XB 2WIIA 5I8OH 4P3WA 2YZ1A 4Z78A 3FFDA 2DQTH 2DQFA 2WUBL 1IGFL 3HS0A 2GTWB 2QR0B 3BT2L 5MEPB 5HYQA 4U1MA 2VC2L 2EH8H 4Z0XB 2I9TA 4YQXH 3V6ZB 2GSIB 5IK3B 1EV2E 4U1NA 4ZO6A 2F54E 2AXGB 3UTSE 3MYJB 3QH3A 4QRRE 3VRJA 4KHXH 4K7PL 4L4VB 1GPOH 1CLYH 4JQVA 1X5GA 1G1CA 1NCBH 5I1DB 3KYNA 4FABL 3G6JB 4C59B 2V2TA 5GGSA 1D5BB 2J88L 5HVGB 4ORZC 4NGHL 2X4PA 1T2JA 1YNKH 3A6BH 3H0TB 4X6FA 5D1ZC 2VN7A 4M5YL 4XB7A 4KRLB 1NANI 4NFBA 3UCRA 4QHKI 1NCCH 3CU1A 4K3EL 3SE9L 3TF7C 5L7XL 1K9TA 5D2NC 2XV6B 4NQCB 5JQ6H 3MV7A 2ADIB 3PV7A 2D7TH 3FO1A 1H3PH 3QIWA 4P5TB 3O0RL 5DMKB 1CQKA 4ODSL 5ICYB 1BVKA 3KPLB 2ESVA 3HNSL 4JPWH 4LCYA 5LXGL 2MQ3A 2HVKB 2XWTB 4JB9L 4XXCC 3DRTB 3C60D 4LOUC 2X4TB 3P9LA 3IDNA 4PJIA 3MLZL 2HTKD 3REVB 3O3AB 4R96B 1N64L 2ENYA 1CR9H 2R0WH 1RZJC 1WAAF 1DSFH 3MRQB 3QR2A 4HXBH 5MP6H 4NO2A 1EVUA 3WXVL 4KH2A 1LEGA 4LPYA 2D7QA 5CHNB 4MJ6A 5BVPH 4N0FA 3SKJH 5L2KD 5DJ2A 3ZYOA 5HHOB 3L5WA 4PRNA 4EXKA 1FRGH 4M5ZL 2ZOLA 2NTSP 1FP5A 1P4IL 5I8CA 1KTDB 2R56H 4NKIH 3VFGH 3BE1H 3LPFA 2MQ0A 3CFEB 1EO8H 3H9SB 3LSOA 3M1BA 1OAQH 3RWJA 4DOHB 5I1AB 3QXAA 5HVFB 4DWHA 4D0DB 4KV5F 4MLSA 4JDTL 4C55A 3BN3B 2YUWA 1LD9A 2J4WH 4RIRA 3VFRA 5HSFA 1GH7A 2OM5A 5JW5A 1GC1H 1E0OB 1V3JA 1YECH 4XPTH 3GMQA 5EU6B 3T8XB 2NY2B 4H20H 5ADOL 2A6DB 2AK1L 5T1KD 4Y4FC 1RHHB 4OLVL 5T33H 3KNBA 2EDQA 4B41A 3ARGB 4J23A 2YXMA 4NM8H 4WUUD 5CSGA 5GRVK 4Z7NE 1FAIH 3O8XB 1TVBA 5KSUA 1MNUH 1YEHL 5D72L 4Z7WF 1N4XH 3L5XL 2XWBA 3QPQD 2Y06L 4G80A 5GGTH 2WBJA 1I1FB 5JR1H 5KSAC 3MV11 1U8JB 1HHKA 4FA8A 3EFDH 1MI5B 3PUCA 4CU8A 2MKWA 4P46D 3MRFA 1EGJA 4BUHA 3Q6GH 5EBLA 4K3HA 5E9DE 4NDMB 4LASH 1TETH 4YAQA 1ZWIB 2FLBT 1I9RL 2YPKB 4AG4L 3EFFA 4PJDB 2Z31A 1H0DA 4WU7A 1LDPH 5DRWA 3SPVA 3D3VD 2DIAA 4Y5XB 2CXKA 4WJ5A 5DJYA 2FNBA 2YD1A 4G9FB 2FEEI 2Y7QA 4W4OA 2EDJA 2P47B 3P3YA 5DLML 3VFTB 4NZRL 4U1HB 1KTKE 3S3SA 5GZOD 1UQSA 3QXDA 3RVTC 5DVLA 1YNLL 4P2QE 3CVIL 4LCUA 4DUXA 2J7LA 3SKOA 5JW4R 2COQA 2DQGH 1NGWA 1JNLH 3VFWA 5D2LB 3VCLA 1J18A 2WQRA 1AD0A 3U4EA 4S1RL 4DGIH 2F58H 5KS9B 3HAEG 5DZOA 2BSED 3T4YA 1FVCA 2QLVB 3QUYB 5J6HB 5C70A 3SKMA 1CDCA 5C6WH 4NN5B 4Z95L 3BUYB 3IGAB 1KPUB 3MRBA 4PJ7E 5IR1A 2BOCA 1T2QH 5CWSB 1DLFL 2R9HD 5DFTA 4M43H 1QHOA 4M00A 3KYMB 4XMPH 3N1GC 1MFCH 2LAGB 1J0KA 3BEWB 1BREA 4KVCL 3U0PB 1KCUH 4MB5A 3TJHC 2YD5A 2QADC 3S6CA 4GKSA 3TFKC 4HV8B 1YMHB 1X5IA 3DETC 2DBLL 4ONHA 4PFEA 1RK1B 2D9QB 5C0JA 3BDBA 1BBDH 2PXYB 1BJMA 4JQVC 5BVJB 1JHLL 5L0QB 4S1SL 5DTFB 1AQKL 1NFIA 4R2GB 1MJ8H 3NA4A 4LEOB 1LNUB 1IGFH 1CGWA 3BT2H 1RZFL 5EUKB 5L8KB 2NPLX 4M7JL 2VC2H 5ITBH 2LTQB 5E03A 4RA3A 1YEFH 4JRXB 4EI5B 4PJGE 5C0ND 4UUJB 4IRJD 4EIGB 1NQBA 2R23A 3MFFA 4WU5B 5AYUL 4XP1L 5F7KC 2C3VB 2JELL 4LHUB 2FB4L 4NOBA 5GIRA 4NUJB 4DUVA 5DJAB 2C7UB 4G8FB 4M1CC 5DYOB 4YX2L 4F15B 4FABH 2D4DA 3QIWC 4HH9A 2MOVA 4PP1D 4ZNCD 1CTOA 1IBGL 2NY7L 4WUKL 3LQAH 5ANMB 1JZ5A 1XR9B 3IDGA 3RWEB 3NFPA 1ZS8A 4OJFL 2XNAA 3GKWL 2LQRA 4NQDD 3NMEA 3P73B 4UV7L 3SE9H 5JDSB 5J13C 3MRKA 5HHNB 5DQ9A 1DLHA 4LSDA 4WRLA 2J5LB 3O0RH 4PRHB 3WIHL 3HNSH 5GRJL 5DSCB 3GJFK 3OF6A 2I27N 5LXGH 3GNML 4JB9H 4XC1L 3QDGE 1YQVH 1A6TB 3F65A 5DK0B 1CE1L 3KJ6L 5IKCB 3QDAA 1D6EB 1S7RB 3LS4H 3MLZH 4PV9B 4YUEL 2AEPL 3BP4B 3FJTA 2WWMC 4IHOB 4JPIB 1N64H 4M62H 1SY6L 5I71B 3F7RA 3CDFA 4UDTB 1UVQB 4Y88A 5C2BL 2O5ZL 3E3QE 1UWXH 3RWGA 2DM2A 4G8EB 4LLAA 1WV7T 5SWZD 3WXVH 4EVNB 4Q97A 1H5BB 4PJBF 3HAEA 4YHIB 4UZGA 5EFIA 4DEPC 2X41A 4YIQA 3VXPB 3STZB 1WITA 3MODL 1LEIA 1P4IH 1UZ8A 2IPTL 4UT6L 4JFEA 5HY9A 4KK5D 4AYFA 1PSKL 1I4FB 5KSVB 5I1IL 3PP3H 4DVBB 3QEQD 4HBCL 2R9HC 2BOBB 1QFUL 4PG2A 5E94B 3RDTA 2UUDH 1QVOA 3EDFA 3D2UA 4NKDA 5AWNL 3ULUL 2NQCA 4NZTL 1BF2A 1KEGH 4JDTH 4HZAA 3EDJA 3QUKB 3IXAA 4JO1L 4ETYA 1A7RL 4NJ9L 5F9DC 1KJ2H 3PV6A 3GSRB 2AEQL 4HFWA 5D1ZB 5E08H 1WCBB 5EUOB 4Z77B 5HYJB 5GS0D 2WIMA 1YEEL 5E1AB 1PQZB 2DL9A 1S7TB 5ADOH 2AK1H 1OP5H 1NCWL 3U4BH 3I75B 4MDIA 1IM9D 4OLVH 2CUMA 3L3HA 4WO4D 2P24A 3KHOA 2X4NA 3VWKD 5BS0D 2NY4D 3EJZC 3AC0A 4JM2F 4ZOCA 1FG9C 1KGCE 1S7QA 5D72H 4UNVA 4FG6D 1CFTA 2Y06H 2UZYB 2Z31C 1MH5B 4PJEE 4XPBL 3BQUB 4W4OC 4OAWA 4OD2B 1PVHA 3AY4A 4EDWL 1ETZB 4YPJA 3RBSA 4UQ2B 3PGFH 4KI5C 3EYFA 1JBJA 4OGXL 4ZTOH 1B6UA 1KEML 1HNFA 1VACB 3VFVA 4G9DB 2A73A 3NZ8B 3U46B 5GHWL 3RVWD 3A6OA 1I9RH 2DDQL 3WHXA 2WAHA 2WK2A 3DYMA 5F7EL 2E7HA 4R97B 4LLUA 2GW5A 3O3DA 1PKQA 3HUJB 3HE7D 5ACMA 2R8SL 1F6AA 1YPZE 3BDYH 4JDVB 4NZRH 2E7MA 1YNLH 3CVIH 3PL6A 2V2WA 3CAFA 5JIHA 5F44A 2UWEA 1FE8L 4GO6B 4HIHB 2NTFB 3HPLA 2EXYD 4PD4J 3N9GL 4KJYB 4YC2B 4YGAB 3C6LB 3V79C 1AHWB 1CFBA 4X80H 4S1RH 3GKZA 3MLSL 4Z5RA 1IARB 25C8L 3MRPA 5C0GA 3TESA 3HI6H 2X4OB 2ZUQC 3MO1B 2VDPL 3DV4B 4F7MB 2GT9A 5GRUL 3MJ9A 1LEKB 3W2DH 2HVJB 2MPAL 4BSWB 3UTOA 4DCQA 3S36L 2XKUA 2I24N 2P8PB 1DLFH 3RVXC 3LH2L 4AZ8A 4QOKA 2I9LB 4MZ2A 5C0FA 1X5JA 2FHCA 2G9HA 2GK2A 4KVCH 1TQCB 5I19L 3BKML 1BIIA 4QRTB 1IZKA 4K71B 4JR9L 1Q94B 2OQJA 2Q7YA 3KLHD 1MAKA 4X6DB 5C6TL 1JHLH 1XCQA 1QKZH 3IFPA 3QIUD 4S1SH 1AQKH 1LK2B 1QOKA 1DBJL 5GJSL 5F88A 5D2NE 2OJEA 2AVGA 1RZ7H 1RZFH 1A1MA 4M7JH 3KHQA 4KVNL 3L3OB 4DTGL 3LDBC 4UT7L 3HA0A 1F4YH 3L9RB 2NXZD 5KVEH 2VISB 5BRZA 4RWYL 1U3HD 1EAJA 5AYUH 1CD0A 2JELH 4MCZA 3ZDZF 4WFGE 3ELAT 5FUOL 4QRPE 3HG1B 1S5IL 2XZQH 2EDHA 4LF3B 3P9MA 4ELKA 2MCPL 4YX2H 1N59B 2GKIA 1RHFA 1KCSL 2R1WA 3EYOA 5CILL 4ZDHA 4PJ8B 4CL7A 4PRBA 2DMBA 2KQMA 1BQHA 3HC4L 1IBGH 2NY7H 3KPRE 4KQ3L 1OQXA 1CDYA 3QXTA 4L4VD 2YA0A 3CFBA 4TUJA 3IDIA 2VLRA 1IAIM 4OJFH 1BX2A 2P5WA 4Y4KB 4L3AA 4UV7H 4TRPL 4ZNEE 2FZ3B 2G5BA 1KYOJ 3X11A 4V1DB 2EDFA 2NLJB 2EC9T 2KBGA 4JREB 1CK0L 2IGFL 4JZJB 4BFIA 4CDGC 1YN6B 3SO3C 2WIIB 5B39G 3WIHH 1HIML 1QRNA 2F8OA 5GRJH 2EXWD 4PG9A 3ZDYE 3GNMH 4XTRD 2HLAB 3BDXA 4YHZH 4D2NA 1RK0B 3KJ6H 4U1MB 1EGJL 4UAOB 4L8BA 1P5VA 1CI5A 4NQCD 4K7FA 3SDXA 4QRSA 3H42L 4P5TD 2R1XA 1SY6H 2XTJB 3VRJB 1YDPA 3S7GA 1X4XA 1N26A 4KGJA 1OP9A 2DIBA 5C2BH 2O5ZH 3I84A 4R4ND 2P7TA 4M48L 4JDZA 3CH1B 3X13A 1FC1A 3RDTC 4G6ML 1QSFE 4L4TB 2W0FB 1FH5H 3OG6B 5J3HD 5IEKB 3IU3B 3FB7A 1QSVA 5C1MB 3I2CL 3DYPA 4KMLB 4I0CC 5BQ7A 1BMGA 1M71B 2ZZUT 2H32A 5F7YC 1P7QA 4EUPH 1N8ZA 2MMXA 3OKMA 5C09B 5DD6A 3FOLA 3MODH 3B4NA 4UT6H 5LCVL 1PSKH 4LLVA 4GW1A 3GIZL 4E41B 1FGNH 4XCFH 2X1PA 5DK2A 5I1IH 4XNZC 1EXUB 2UZIL 4MNGB 4HBCH 5D5MA 5MI0C 1QFUH 5I30L 4PTUB 4HIIA 3ULUH 5AWNH 1T1WA 4PJCF 2X40A 4OLXL 1D9KB 4OZGA 4JO1H 2OR7A 1A7RH 5IW6B 3GMPB 1GL4B 2WLZA 1Z9LA 1WFTA 1WCQA 3HRZA 3H9SD 1YEEH 4RWHA 4UDUA 3IDNB 1NCWH 3K2UL 3DUUA 3V0WH 4LDEB 3AY4C 3HFMH 1G6VK 2HN7A 4TUOB 2Z91B 4C4KO 3WKML 1XGUA 3K8KA 1W8OA 3JV0A 3F7PC 2YHGA 2W1NA 2W91A 2QEJA 2BNQA 4KJPD 1X7QA 3CMOH 5EU6D 5HDBE 2NY2D 3ALPA 5E5UB 4J6RL 2VLLA 3TPUA 3G6AB 2Q86B 4XPBH 4HPYL 2YSSB 4L3CB 5D1XB 1U95A 5DMIL 3ARGD 4LNRB 1A6UH 2HJLB 1JPGB 3OX8A 2FHBA 2VR5A 1VFMA 3O8XD 1JYXA 2CUIA 5KOMC 5KVGL 2BVQB 3FHAA 1KEMH 3SY0A 2NZIA 3LSOB 4FQPA 3PL6C 2VR9A 4HWZB 5GHWH 3RWJB 1F3JB 3P0YH 3MYZA 1FVEB 1TPXC 5F7EH 1A2YB 2CH8A 2VXQH 3BD4A 1MI5D 3VXNB 1J1PL 4DEPB 3CC5A 1NSNH 2P8LB 3IJYB 2R8SH 1T7WA 3PWUA 4X4MA 4YK4C 1X4YA 2FX9L 3HB3C 5F3BA 4OCRL 2IWGA 1KBGH 4Q6IA 4I5BB 5B39A 3O2DA 1LE9A 1KIQB 2SEBA 5E7FA 4B50A 3DECA 5D1QB 3IJHA 5DJ8B 4XNQA 1FE8H 5FOJA 3KNBB 4UIMA 3WLBA 2RIKA 3MV9B 2BSSB 1CL7L 4YDIH 5K9OA 5ESVB 2MHAA 3N9GH 4G9FD 3GSNA 1Z0NA 5KG9B 2A6KB 4X6EB 3D0LA 2Q6WA 3WIIL 4B0MM 4N1HB 3MBXH 4G80B 2WBJB 1FZMA 3MV8B 1FL3A 1OD9A 1MOEA 3QEUB 3MNZB 3D0VA 4MNHA 4L9LA 5GRUH 2JK5B 2MPAH 5GZND 4R26L 5CAYB 2XA8L 3MJ8B 3RBGA 1ZHLA 2AJ3A 3FO9B 4UBDC 1OL0A 3LH2H 3FN0L 3HZVA 3GIVA 2V9RA 3ILQD 3MRRA 3MV7E 3PIQA 4HKZA 5I2IB 4JN2B 3T04D 2APVA 1H0DB 5I19H 3H8NA 2ESVE 4JR9H 2GJ6B 2CRZA 2E9BA 3PDGA 4XAKD 1BM3H 4Y2DA 1IT9L 4O5LL 5IVXB 2FRGP 4O58L 3MRJB 5F7NC 2AGJH 4XNXH 5GJSH 4PJIE 5HI4D 5BW7A 1N7ML 2EEDA 2ILLA 4PR5A 3QSKB 3FB6B 4DTGH 2IPUK 4GRLB 3O45B 4UT7H 3LEVL 3D69A 4PY8I 4NRZB 4YFDB 2ZG1A 1N5AA 1VB9A 2PXYD 5T5FL 4HK0A 4N8CL 3D3VE 4KXZH 2O5XH 1ZSDA 1H3VA 1I8LA 4J3UA 4PJHB 4R2GD 4PGZA 4HX1A 5FUOH 3V6BR 4GG6A 1N6QL 4NBYB 2FYYA 1S5IH 5L88L 3DROA 2BNUA 3H9YA 4CN6A 3UJTL 5E6ZA 4NCC1 1KCSH 4EI5D 4JRXD 4MJIA 4LSTH 5CILH 5GJTH 2A83B 3C8KA 4LBEA 4P2CG 2NYYD 1VESA 1XZ0A 1R3JA 1U3YA 2PNDA 4LHUD 3MOBL 1E6OH 1FO0A 2QJDA 1UKSA 1HI6A 2OXGA 2OK0H 1V3LA 2IC2A 4TRPH 4I18A 4H1LB 3T77B 1G9ML 5FGBA 3PABB 3VI4E 4RISL 5CGYC 3DNKA 3HPJA 4X6CB 1CK0H 4NQXA 2IGFH 3U7YL 2NY0C 3WS3B 4HKJA 4MWFA 3HHRB 4MXQC 4X5WB 1N2RB 4I48A 4X7TB 1GOHA 4R9HA 4ZUUB 1MHEB 1EGJH 3H7LA 2W65B 2GCYB 3BHBA 4DZ8B 1D5ZB 4JE4B 4JVWA 4K94C 5LJYH 3H42H 3ZO0A 5T1DH 3MFFB 4PRHD 5TPWH 3B9AA 4PRIB 5F1IB 2AXFB 1MCKA 2Y6SC 4FHBD 3KLAA 3C5SA 3B9KD 5I1LA 5GIRB 3TYFB 4G6MH 5J12C 3FT2B 2AKRB 3CFKA 2FL5B 4QCIA 4POZD 4YXHL 5HD8C 4P99A 5F7WC 2A6JB 4PJXF 5I1JH 1XF2A 3VGHA 3F6LA 3VFSB 3SOBH 1BFOA 1WBZA 3REWB 3NFPB 3FZUD 3RUGB 3SBWA 5LCVH 3AUVA 3GIZH 3B8YA 4UB0H 1E4WL 4Y5YA 1OAZL 1P4BL 1GYAA 2H9GA 5BOPA 2FEDD 1FG2B 3RQ3A 4E9LA 3BMWA 2JB5L 2JJTA 2PCPA 4MA1B 4LVNB 1XF5A 2EZ0D 2XFXB 5ISZB 3QG6A 4PY7B 2BY3A 2DMKA 4OLXH 3RPIA 4NO0B 2EIEA 1IC5L 4KI5E 3P11L 1HOCA 2E9IA 1RJYB 5CJXC 3SGKA 4NQDE 1VFAA 1D6VL 3G5YB 5IV2B 1KSRA 3EIFA 2FECI 3WKMH 3DHMA 2PW2B 3NFSH 2QQKL 4LCIH 4C56B 4HFUL 1R3LA 3GBLA 5HYJD 3G9VA 2VZUA 3UZQA 2EDYA 4Y4HB 2YC1B 3PG2A 3WO4B 5L2JA 1YNTB 3GM8A 4JAMA 4J6RH 5DHYA 4PJAB 3KJ4C 5FYLL 4OZ4A 4DK3A 5KAQF 1JWSA 1OD7A 2IEPA 3RKDC 4Y19B 5DMIH 4QLRA 3WNLA 1Y0LB 4Q6IC 2ICWB 4BK4A 1SMOA 1II4E 1RZ8A 4J2XA 1MIML 1HINL 2DRUA 2YWZA 3LEYL 3TBTA 4YGVB 1AGEA 2GFBB 1XGRA 3QNZB 3BQUD 4I9WD 5SWZE 1J1PH 1N6UA 1AXSA 2CRYA 3QUZA 5EZOL 1K4DB 2ADFH 3TN0A 3EJJX 4KPHL 4KROB 2BNRA 2NY3D 3HC3L 3FKUS 4G6AC 5JHDB 2D3VA 2FX9H 1T5WB 2EYSB 3MLTB 3ZTJG 5DRXA 3FHQA 2DQHL 2Q7NA 4L9LC 5A16B 3BW9A 3W0WA 4XNZB 5A3ID 5C0AA 2DIJA 4G6JH 4I0PB 1RMFL 5MI0B 4HMDA 4OF7A 4JPKL 1CL7H 2VLJB 4U1GC 3UC0L 3WIIH 4WEMB 1Q1JH 1CFTB 3IF1A 5FV2A 2HP4A 4HWBA 4XVUC 1NC4A 4BQ6A 3WIFA 4OAWB 2XA8H 5CIPA 4LLYB 3TO4B 4Y2DC 3VMOA 2AQ2A 1K2DA 3C6LD 2AEIT 4J3WA 2R2BB 4DFIA 1EEUA 3K74B 5BW7C 4X5XB 3VI3F 2VZSA 5DT1L 1BOGB 3WLWD 2O93L 3FB5A 4FQLL 1PG7W 1FIGL 1MFAL 4OQ1A 2H6PA 2YUZA 1M7DA 1OLZA 4LLUB 2X9WA 2D4FA 4W6XB 1PKQB 2VITB 3GMOB 1B0GA 5ILTL 1H3WM 1K6QH 2NY6B 1I8LC 4HKXA 2YK1H 1NBZA 2IAMB 2KQNA 3HAEH 4QGYA 3EYUL 4RX4D 4QXWA 4GBXA 4WW1A 3UTQA 2XXCB 1Q9WA 2AP2A 3PXJA 3MJGX 3PL6B 1F90L 2V2WB 4PREB 1EBPA 1CBVL 4ODWA 4XVSH 4DVRL 3LEVH 5B38A 1FL6A 1UM6L 4MQ7B 5T3XE 4Q58C 3BIKB 2UYLA 1I1YB 2AV1A 2G60H 5DEGB 5LKNA 2K7QA 5I73C 3MREA 3MLUL 4N8CH 4JRYA 1DEEA 4I18C 3C5JB 2GSGA 1N6QH 3VGAC 3K1KC 5FGBC 5L88H 1HWGB 3UJTH 4EBQL 2B1AL 7FABL 3GBML 3DGGA 1HQ4B 4IDLA 4JFEE 4ZPVB 3VXSA 1BFVL 2N4IA 1OGAB 1FFNB 2XZZA 4GSDH 3ULUD 1FZJA 4TVSa 1G7LB 5C0FB 5M94B 3QRGL 1UZ6E 5INDB 4OF6A 1MRCL 1U8PA 1E4JA 3HG1D 3DJ9A 3MLXH 4H25A 3JV6B 3SJVA 5DJ0B 5F7LB 4R90L 4Y1AA 1KT2B 1BIIB 4OGZA 3Q2CA 4S0SD 2AJUL 5KN5A 4PJ8D 5TDPA 4P5MA 4OZIA 4NQSB 1RZIB 3U7YH 3MBEB 1XCQB 1I75A 3GSUA 1C08A 1SYVA 3QIBD 3S3JA 4X7CC 3ULVL 2VABB 4Y4KD 2ENSA 2LABA 2BSRB 5LQBL 4JFYB 1IGCL 1MHHA 3BISA 3OMZA 1AQDA 2FJHA 2PR4L 1AP2B 4V1DD 1EEZB 1NANH 5BRZB 3CCHA 1Z9OA 1ND0B 1MVUB 4XPHL 2IAND 3CMGA 1UG9A 4TUKL 1O0VA 2JIXD 1X5HA 4FQCL 4Y5YC 4F2MA 4OLUH 4YE4H 1D5XB 4TULL 1WWBX 2JJTC 5KVDH 2R4SL 1K3ZA 4YXHH 4NIKB 1C16B 2E5EA 4S1DC 1QTYT 2YD8A 4YXKL 1MCFA 2XTJD 5B3JF 3SDAA 2WZPD 4MAUL 1BX2B 2P5WB 1NL0L 4RAUA 3SGKC 3VG0L 1RVFL 1BECA 1OAZH 4L4TD 1P4BH 5J1SC 2ICWJ 4L4JA 4KKBC 1K5NA 3QISA 1IAKA 4GAFB 2FATH 4BFIB 1F3DJ 1FC2D 5C09D 1ZVSB 1IC5H 4P4KA 5TDNA 3UTTB 3MJ9H 4E41D 1T5XA 2UWEE 1JPST 3GB7A 1QA9B 1TCRB 1Q9OB 2VDNH 1BEYL 4LPUA 1DQJA 3PJSB 1QFWI 2X9XA 4HXAH 1D6VH 4N9GA 4EDXA 4HSQA 1FFRA 1D9KD 1YDPB 2Y23A 3RWCA 1A4KA 4GOSA 1UXSA 2QQKH 3MLVL 4S11A 1QFOA 3LKNB 1AGFB 3MUZ1 1I7UB 1XT5A 1AY1H 3EYSL 2G75A 3EUUA 2CUHA 4KMQA 3FB7B 3QUZC 2X70B 5ID1B 1U8HA 1FORL 5FYLH 3TN0C 2H32B 4QOKE 5I76A 1NCDL 5F6IB 4H26A 3BGMA 1D5MB 4NQCE 1TJIL 3PP4L 5IB5B 3UAJC 2PTVA 4AENB 4LLVB 2IFFL 5C0IB 5CBEA 4FQQA 1JNJA 5DK2B 1MIMH 5LBSH 1WIUA 5H35A 2BFVH 3LEYH 4K8RC 4HH8A 4JFFB 5IB1B 1Z0MA 5D1XD 4OZGB 4M03A 2HH0H 4KPHH 5D7IE 2H2PD 3HC3H 4WFFD 4Z7WB 3HRZB 4WHDA 2DQHH 3EO1A 5JMRA 4UDUB 1UT9A 4NN7B 3DURA 5CJOL 3P9WB 4MJ2A 4JPKH 2HN7B 1REIA 3D87B 2PTTA 4OFYD 5JOEA 3GSQB 1UB6A 2XOTA 4JFPA 4OGYL 3V2AR 3DSFL 2XKSA 1T0NA 3RNQB 5DDHA 1SJEB 1KPVB 1UWXK 2A1WH 3TPUB 1HSAA 3BRDA 3WFCL 3I3BA 4YHKL 3P4NB 2NNAB 5D1QD 4M9PA 1U95B 4LCWA 3NN8A 1FCCA 1FFOA 3MV9D 4W6YB 1CFSA 3KYOB 3OX8B 3V4UL 4GBXC 4BZ1H 3DX7A 1RIHH 1PYWA 5FUZH 1DBKH 4BSVA 1TJHH 2WBJD 1N5YL 1FIGH 3MV8D 2KUTA 3TNNB 1ORSB 4R4BA 5HDLA 4MNQA 3QQ4A 1QRNE 4PIRF 3SDCD 3DX9B 1ZHNA 3WS6A 5ILTH 5EO9A 1OTTD 1R5VA 3LOWA 4AT6A 4CN1A 4X4ZA 2EO9A 1WZ1L 3FMGL 1AIFA 5F3BB 5KSBA 2X89D 4Q6IB 2RBLA 5HYSG 1CGVA 3QULA 3SDXE 4ZFGL 4JHBA 2FR4B 2APTA 2H32H 1LE9B 5CGMA 2GI7A 3K2MC 1F90H 4K94H 4XNQB 1CBVH 4DVRH 4Z7UB 2GJ6D 3UBXI 1UXWB 4W6WB 1CD8A 2C3GA 3MLUH 1IGYA 2D0HA 3WFHB 5E5RB 2DI7A 1FZMB 3K1DA 1RURL 1QR1A 1GXEA 1U93A 4LSQL 4D8PB 3D0VB 2PYEA 3FOMB 4MNHB 4EBQH 4YEFA 1AJ7H 5J11B 4WHYG 4GRLD 1JGDA 1EZVX 1BFVH 3V5DA 5D7LA 3L7EB 1DL7H 5EOTA 2XN9B 5F72S 3HZVB 5D5ME 4LVOC 5K9KA 3OJDA 3W9EA 2XA3A 4OZHF 4R90H 5F9OL 2NW3B 1HILA 2AJUH 2V7HB 4FTVB 3KXFB 2Y5EA 4FQ2H 4WFHD 3GK8L 1VGEH 4I2XB 2D7PA 4LFHD 5JW4M 1TQBC 4NC1C 5AUMB 5I1EL 3QO1A 2VH5L 3ULVH 5AG8A 3FRUB 2MWCA 1GRWA 4K9EL 5LQBH 4X8XA 3X12A 1X6NA 3TP4A 4BH7A 3EZJB 5JOFA 1XF3A 2PR4H 3D69B 5E6IA 1GGBL 1IL1A 1FGVH 3MMEA 3C8DA 5DRNA 3SDAC 1WVZA 2A6IB 2CXGA 1GJIA 1XGQA 3KPPA 4ZXBB 3TT3H 3PHOA 1XFPA 2VLKB 4HX1B 5IVZA 1QLEL 4LLDB 3L7FA 4C58B 3K81A 2R4SH 5TFSL 4MJIB 2NW2B 1RUAL 4P4KC 1RFDH 4Z7VF 3MRHA 1HCVA 5CD3A 1R3JB 5TQ2H 4WWKA 4YXKH 1KLUA 4PRID 4O2CB 5F7MC 1NAMA 1IKNA 1QP1A 2LU7A 5EN2A 4JG1H 5I73B 1NL0H 5GGSY 1RVFH 3B9EA 4ONGL 5HGHA 4FZ8L 2DBJA 2V7NA 4JN1H 3MR9A 1KUMA 4OV5B 4X4ME 5F89A 3VD5A 4PUBH 5INCA 3AB0B 3B6SA 1UACH 2C26A 3AFLA 4PGEA 4HGMA 2RFXA 5E8DL 5DRZB 4LDOB 1FNHA 3TNMA 4HKJB 4POYA 1B0RA 3V7MA 2VZOA 4PJBB 4ZS6C 2CKBL 3BHBB 1BEYH 2O61A 1GAFL 5HYSA 5CJ5A 1IEHA 4KDWA 5JLZA 3E2HC 1GSMA 5ISZD 2ADGB 4HS6B 4I3RL 1T1XB 4NO0D 1TTUA 4QXTB 3SHSA 1JPTL 1YJDL 1YY9C 1ZE3C 1F58H 4WTZG 4AIZB 2NXYC 4BFBD 1U92A 5FYJD 3RL1A 2YBRB 1EBAA 3KYKL 2GK0A 1P69B 1JJUA 2NY5L 3CFKB 3F7YB 4FQIL 1TTGA 4HUXB 4BK5A 1INDH 4XBGA 3IDMA 1W0YT 1BFOB 5F6HJ 1FFPA 1IJ9A 1HXMB 1CE6B 3B3IB 4C56D 2IFFH 3QUMA 4QHNA 4OIBA 4AQ1B 5HHME 4F9PA 3QDJB 4WV1A 4Y4HD 5J56B 1U8NA 4TNVK 2DTML 4HAGA 5F70A 5FA4B 1EO7A 2NX5A 3ROOB 3G6DH 1T4KB 5GGUB 1HZHL 3QG6B 3EDDA 4Y19D 5F21B 1IAII 2BSTB 4Z0BL 2IADB 4XCCH 1FZOB 1HOCB 3OZ9L 3GJEB 4M6OL 4QWWC 3ZKND 3QNXA 3U83A 4F58L 1ZT1A 1FLTX 2A74B 3OR7B 4XCYB 1R3HB 3QJHA 5CJOH 1TJGL 5DI8B 3MUGB 4X6BA 3O6FA 4WHTB 1H8NA 4YHYB 4U2ZA 4GG6E 5F1KC 3VDBA 3T3ME 1HKLH 1YN7A 5CBAB 5JHDD 1MREL 3DSFH 1HHIB 1FNGA 5T3ZL 4JHWL 3BZEB 1WFOA 1NKRA 3T0VA 5GGVL 4X0KA 3WFCH 2CK2A 3DXAA 4Y8DC 3WS6C 1BPVA 2C1OB 3LIZL 4I0PD 1ZA6B 4KWUA 2DD8L 3K4DA 3AU1A 4XXDB 3V4UH 3MRNB 2VLJD 4QRUA 3K0WA 2F5BL 1J87A 4NP4H 2VMFA 2X4UA 1R0AL 3HI5L 1RZ8B 3ZL4L 1KELL 5EC1A 5ALBL 1N5YH 1RPQA 1CGXA 1G7HB 3NZHL 3G5VB 1YMMA 4NNXA 5BO1L 2HT4C 4HULB 1U8LA 3TO4D 1SVCP 4YDJA 5AEAA 2B4CL 1YQ2A 3IXTB 1U8OA 1NAKL 2R0ZL 2YXFA 4XVJH 1JMZA 5DRXB 3BD3A 4TNWF 3BUTA 4V2CB 1FN4A 2AK4D 4D0BB 5DXWA 3Q5TA 4JJ5A 3MRCA 5C0AB 4H8WL 2NCMA 3V5HB 1Q8MA 3ETBF 4Z7NF 3S34L 3KLDA 5CSZB 5J1TC 4JKKA 1VDGA 3G6JF 3DO7B 3BEVB 2NY6D 2KPNA 4MX7A 3GSOA 1GZPA 1F8TL 3IFOA 3OG4B 4YHOL 2XPGA 3VRIB 1CLCA 2IAMD 1W2KT 3ARWA 5CD5C 4RZCA 2AJSL 5FM5M 3OV6A 1WWAX 1NGYA 4OM0L 5EZJA 1JRHI 4LSQH 4WTZA 3ZDXE 1WBXB 4ZUWB 3VD9A 3R8QA 1ZOXA 3RVVC 2CKBB 2ERJB 5GRVL 5T1LA 1MWAA 4JZOA 3FRPG 1C12A 4ETQA 4P49A 2EYTA 2IH3B 1DANT 5D7SL 2YD4A 1TZIA 3R0MA 1OSZB 5E6IC 1S7VA 4P0DA 4FFVD 5T5NG 3TJEL 3WKNA 5IHBA 2VZ3A 3NIGE 3LKRB 4HIXH 4OUUA 4Q9QL 3ARSA 4HKXB 4OF5A 1OGAD 3UZVB 2HT3D 4UV4L 4GBXB 1T22B 3SDDA 5IFJB 5I1EH 3W11C 2VH5H 2YPLB 1Q9WB 4MD0A 3W5NA 1A1OB 3B5GA 1I3UA 2WNGA 3C09C 1S9YA 4WWKC 4PJFE 1DN0B 3SCMA 3JUZA 2AV1B 1IKNC 2HG5A 4JY5H 4NHUA 2H8PB 5FYLD 3MBED 5JUEL 3QYCA 5MENA 1U8MB 4ZMAT 5CMAB 2OYPA 3BWAB 4JFOB 2MFNA 3IDYC 3BIAX 4JFHD 3LQZA 2ZUSA 1IAOB 5JZ7C 1A47A 4HMCA 4YDVA 5TFSH 3DGGB 3CJJA 4R6UA 5C08A 1YY8A 4N1EA 1JFQL 3BP7B 5DF0A 4MDJA 5EIIB 4OCNC 2F53A 1BHGA 4OM1L 4ONGH 5FYKE 3SJVB 4DGYL 5ELIA 1VADB 2F19H 1NBVL 3SDYL 3JV4A 3Q3GB 4I3SH 3MCKB 2E9WA 2YN3A 1RU9L 5K9QG 3EKCA 5E8DH 4HWBH 3BZDA 2HTLC 5MEOA 1W72A 3BOVA 1BQUA 5SWSA 3WCYA 1DVFB 5I9QB 4XB8A 5C9JA 3D39A 1I7TA 4PTTB 1GAFH 4LP5A 5L9DL 3EO9L 1NEZB 2BJMH 3UBXA 4MAYA 3GO1H 1I8IB 3UTTD 1NDMA 3RFZC 1JPTH 1NMAL 3ZSTA 4F9PC 4J1UB 4UILL 4WV1C 4JCMA 4GRWB 2HMID 3OKLB 3C8HA 3KYKH 4YXLH 4I0KA 4FQIH 4ORGB 2WWKO 4PJCB 1D5IL 2A77H 3DX8A 4HIEA 3CVHA 2YMXL 4PJDF 3ET9F 1AR1D 3O41B 1ZT7B 1P9MA 5A40E 4HQQH 4XZUB 4YNYA 2FJFA 1QLFA 3VXTA 3EYVA 2DTMH 1J0YA 3P4MA 4U1SA 2IANE 1RZKC 2VDQH 3O6FC 2HJKB 1K5NB 2ARJB 1P2CA 4HD9A 4DAGL 1U58A 3QHZL 3V9FA 1JWMB 1QNZL 4NCDA 4M1DL 5EOCL 5D2LF 5J0BA 3OZ9H 4M6OH 1YEIL 4F80A 4RGNC 2BY0A 1PX4A 4F58H 1X4ZA 2FWOA 3KPNB 5K33A 5J57B 1V3KA 4HF5H 5ID0A 2R0KH 3JWOL 2PO6A 4JFFD 4AEHL 1MCHA 4MSWA 4G7YL 4IM8A 2ICEA 4JRYE 3G5XA 4IS6B 4TVPL 3PQYA 3OKKB 3VRLE 2EIZA 1HNGA 2HRLA 1AXIB 1IGJA 5T3ZH 4JHWH 4PGJA 3BAEL 5DJ6A 3VXSE 1XR8B 4WDIA 2AXJA 2QKIB 2B2XL 1U42A 4ZO9A 3BMVA 1JPFA 4E41E 5I76B 4H26B 3BGMB 2DD8H 4AL8L 2X4QA 2JKXA 2FIRT 3T0DA 1WJ3A 5CKAA 3O2VL 1A0QL 2IQAA 2VKWA 4CW1A 4H5SB 2F5BH 2DLTA 5SV4A 1T7VA 2DLGA 4Y1AE 4TOYL 8CGTA 3HI5H 1R0AH 3ZTJH 5HBBA 3ZL4H 1WIOA 5ALBH 1XIWB 1CFQB 4RNRB 4TSBL 2BDNL 3TZVB 4OZIE 4JHAL 1IC4H 1Q9LA 1CQYA 2IBBA 3ULVD 5E7BA 5F7DB 4YHNB 5BO1H 4TSAH 4GKZA 5IB2A 4GRWH 2B4CH 3EDEA 1V8HA 1NAKH 2A9NL 2LE9A 2R0ZH 3H9HA 3QFJA 2DM7A 4P57A 3S4SB 1WWCA 3S5LB 4XGZB 1NBQA 3SGEI 4H8WH 4KRPC 4IOFC 3S34H 2X4SB 3TT1L 4ZG1A 4LKXB 4XPFL 3U7AA 1OSPL 5HHPA 1M7IA 1H3GA 1TXKA 3VA6A 5I1HH 3UJIH 1F8TH 3N1MC 4YHOH 3DUSB 1T0NB 1DBML 2ADJA 4MXWL 4OM0H 5BJTB 2VQ1B 3BPNB 1FPTH 3U7WL 4MQXD 5IMLB 4LSUH 4RAVA 3PWLB 1CICB 1NMCB 3Q1SL 4LQFH 4RFEA 3WDHA 3QDMB 3NN8B 1SEBA 4ZTPL 4MMZC 2ZNWA 3SDDC 1EFQA 1OB1A 1PYWB 5DJXB 2YR3A 2VUYA 3P77B 5D7SH 2VNCA 3QUXA 5DK3A 1A1NB 2Z8SA 1UA6H 1AR1C 2VDRL 2Z4QA 5D96B 3SCMC 4AJ0A 3CZFB 3RI5F 2ZJSL 1DQLL 3VH8G 4PJ9A 1R5VB 1ZK9A 3L3IA 5ITFB 1JTPA 3CFJA 2IH1B 3I02B 2XN9D 4HUUB 3F6IA 1BQLL 2NR6D 4CVZB 1AIFB 3L3JA 4UV4H 5MEQA 4CMMB 4O51A 2DLHA 3TV3L 3O9WA 4X8JB 1T03L 2J8UA 3PNWB 4ZFOA 2FSEB 3L95B 3P2TA 1VFBB 5EWIL 4OQTL 4YZFE 4FTVD 3KXFD 3RZCA 2CDFA 3DV6B 4IMLA 4A2LA 5JUEH 3MRIB 4U6VL 3UYRL 5JQHC 1L7TL 3T1WA 5F71A 4S2SA 3BWUC 5TH2B 4TTGA 1INQB 4AIXA 2FX7L 1VA9A 1S3KH 4GAYB 2Z35A 3AS1A 1G9NC 4OGAC 1GCFA 2APBA 1K8DB 1F2XK 2ZPKH 4XWOD 4ZXBD 5I75C 3L6FA 4HW6A 2VLKD 1LHZA 3QI9A 4RDQG 4Y5VB 3TIDB 3OJDB 5K9KB 5A2LH 2CJUL 2EDNA 3LKOA 3GJFB 1F6FB 4XBEL 5I18H 4GG8A 5IVXE 2ITCB 3AAZB 3MCG1 1XF4A 4OZFB 3BXNA 3SDYH 3FQNB 4MAYC 1LWRA 4R3SA 2Q76A 4JM2A 5IBUG 1NC2B 3QEHB 4J4PA 5GS2D 5T1MA 2YUXA 1EHNA 3FB8B 3V95A 4IMKA 3VD4A 4ODXB 1QSZA 2P8MA 3NCYP 3DX6B 5IMMB 1DE4A 1RD6A 1NFDA 2GTZA 3VG9B 3DYOA 5JOFB 1FYTD 5FDWA 5HGGS 3MMEB 4I4WB 4PJXB 3MZTA 4QHUA 3JWDC 4YHLH 1XGQB 3KPPB 4PV8A 1I3VA 1P9MC 4UOW1 1PZUB 1R5IA 4JJHA 5DWUL 4PB9L 5EORL 2EC9U 4M02A 4D0CB 1DQMH 4UILH 5IVZB 4F33B 3ECBB 1EO5A 4APQB 1F4XL 3L7FB 4DKFL 1CXIA 4LCCB 3OR6A 4LCWE 1ES0B 4J3OC 2C4FT 2AJZA 2VXUH 3ARRA 4KKLD 1D5IH 4OBSA 5CD3B 4R4FH 2YMXH 4XNMB 3DOSA 4X4YA 4WY7H 1EEYB 4AM0A 1CF8L 1QSEA 1YEKH 5CGTA 3HUJF 4EN3D 4HZLA 2EE3A 4X6CE 4MNQE 2ATPB 3NIFF 4X99A 3T4AA 5FB8B 2PO6C 2C1PA 3MR9B 3IDYB 1LP9A 4IIQA 4Y16A 1N0XL 2CLVB 5DD5L 5J9PA 3QHZH 1Q38A 5KSBE 2XT1B 4O2EB 4K7PY 3PWPB 4M1DH 5EOCH 2GITB 3MXVL 1OAXL 5I15H 3VH8A 2DWEA 4DFHA 5IT2L 5H2BA 2H2SC 5ESQA 3QDJD 1LO4H 4WW2A 3KPQA 4PGDA 3JWOH 4AEHH 5DQDL 4G7YH 4XRCB 5I66B 1DEDA 3I6KA 5ADPL 4TVPH 2MSPA 3QAZB 3GI9H 2BRRL 2PYEE 1U92B 2EDLA 2FJGB 3ZE0E 2X05A 4OZFH 1O5DT 3SE3A 2VN4A 3BAEH 2GK0B 5KJRL 4WI6A 5D7LE 1NCNA 1YEJL 1LO5B 3BH8B 3E6HB 3U36B 4XHJC 2QL1A 4XBGB 5TE6H 1CT8A 4AL8H 1KPRB 3O2VH 4PRPA 1KXTB 1NGQL 4KU1A 4YO0A 2WP3T 1OCWL 1H15B 2OSLB 3JVGA 4TOYH 3NABL 5H37H 5ISZE 3P0VH 4X6DF 4U1IA 4L5FH 1KG0B 3OKOA 5I1GL 3LN4A 5FYJE 1HEZB 3LEXA 4NSKA 5J6GA 1S7UB 4N8VB 4ERSL 1AXTH 1SBSH 3VXUA 3HCVA 4YR6A 1PLGH 1ZXQA 3HR5B 4GS7B 3ARYA 3SE4A 1A3RL 3MJ6A 4QTIL 3ULUF 5EO1A 1BD2A 2XQYK 4FOMA 4D9RD 2CRMA 3OAUL 5ICZA 3G08B 1FSKC 3BPLB 1UB5A 4KTDL 1NAMH 4X6BB 2V5SA 1DQQA 3TT1H 5E9DA 3VDAA 3S88L 1OSPH 1FJ1B 3QCTH 1M05B 3QUXC 5HDBF 2MTPA 5C07A 1WFNA 3ZYZA 4MXWH 1VKXB 2W38A 3TBWA 3U7WH 3DXAB 3QO0A 3V0AC 3LRSA 4P2OA 4PJ9C 3U6RA 3X14B 3Q1SH 1G9NL 3F8UB 2YN5A 5EOCJ 1UEYA 2XZCL 2ZCKL 4ZTPH 5HGAB 4KDTA 2GHWB 2W0LA 3PDOA 4F7PA 1HXYB 4FFWC 1Q9KA 5DO2C 3O9WC 2X4UB 5HI3D 2P48B 3ABZA 1B3JA 3C2SA 4XP4H 4N5EC 4U6HB 3MJ7A 2YPVL 2VDRH 4CNIA 1AGCB 1HYRC 3S96B 4DN3H 1DQLH 4EN3C 4WGWB 5DJCA 5H94A 1OP3K 1A6ZB 1BQLH 1F6LL 4U1LB 4YBHA 3T65B 5HGDB 3HMXA 1QEWA 4NWTL 2CR3A 4Y89A 4WHYH 3OXRA 1MHCB 5EWIH 1A9EB 4OQTH 4P2RA 4X98A 3FT3A 4WI4A 2WLYA 1MFNA 2A0LD 5TGBB 3QI9C 2XPGB 4HKBB 3RTQB 2EDRA 4M61A 4G8GA 4N0CD 5CEXB 4MCYB 4XT1C 5C71A 1T89A 3LRGA 1MLCB 2VL5B 1NGYB 2YPLD 4NN6B 5JIIA 4U6VH 3UYRH 2J6EL 1L7TH 1K4CB 4JM2C 2OLDA 3CFDB 5FKPB 3IVKA 5F1NA 4J4PC 2FX7H 1QQDB 1FQ9C 3U1SL 3OHXA 2AK4E 1R24B 3O4OB 4LKCA 4IMKC 3X17A 1J8HA 2EYTB 4RMVA 2CMRL 3OSKA 4OIIL 1EHLL 1UCBL 3N0PB 2NX5E 2AQ3A 4PJGA 1KB9K 4KAQL 1HCFX 1OAKL 1GGIL 5F97E 4XBEH 3CUPA 1MJJB 4AEIL 3C5ZA 6FABL 5EBWB 3SKNB 4MD4A 3TCLA 3VMNA 5IMOA 4M6NL 2DQEL 5JOPE 1ZT4A 2IBZX 3IYLW 4U1KA 5DHVB 3NOIA 5C0CA 4HWNA 1G7QA 1XGPB 5M7QA 5DHXB 1C5DA 2X5PA 1AO7E 3LB6C 5T3ZD 5GISL 4JQIH 2BXZA 2KZ1B 2HKHL 5CZVL 1E6JL 1JNHB 4AQOA 2Z8RA 5DWUH 4PB9H 2MJWA 1K8IA 4X9IA 1AD9B 2XTLA 5ENWB 2HT2C 4HC1A 4XCNA 1RJZA 5EORH 4NYLA 3RJDA 4ALAL 2OP4H 4FMKA 1F4XH 4DKFH 4IIQC 5L8LB 3D9AH 1DVFD 3KG5A 4Y16C 1B4RA 1VEPA 2DJ4A 4XCEA 2P5EB 3C2AL 3DVGB 3DMMA 8FABA 1C7SA 3QDGA 5FYKU 3EOBA 3GHBL 1HSBA 4OI9A 5DD0H 5HTSA 4WW2C 1XGTA 3UPCA 1YMME 3N1FC 5HXMA 2VSCA 1I1AB 3RWFB 1T0MA 3T0EB 1MEXL 4M3KB 2YRLA 2GJZB 3BX7C 1BAFH 2I07A 4MVBC 3Q5YA 5ACZA 4L3EB 1N0XH 5DD5H 3I3EA 5EA0L 5FK9B 4N0UA 1A9BB 1BWWA 1JK8B 3GI8L 1NUFA 4ACPA 1OTUC 3SE3C 1OAXH 5MEOB 1G7PB 1A3LH 1WT5A 5GGQL 1DUYB 2DN7A 5SWSB 5CCKL 5IT2H 2E3VA 3O4LA 2CO6B 3CPLA 1JV5A 3W81A 1A22B 4P4RB 2KZWA 4D9QE 5IQ9B 5FECA 4KK9C 4NKMA 1T3FB 1E4XH 1G7JA 2LU4A 1VCAA 1NDMB 2XKNA 1DFBL 3JVGC 5ADPH 4RA0C 3T1FA 1YA5A 4JG0L 5DD3L 3LKQA 4NRYB 3OJ2C 3D85A 1ITCA 4GUPA 5E4EB 1I8KB 3EOAA 4GW4A 4OT1L 4HJJL 4PLKC 3ARBA 1HHHA 4RGMC 2VR4A 3TVMA 4RBPK 1AKJA 2AV7B 2OZ4A 3EHBD 5DHVH 1NMBL 2A9ML 3EOTL 4NWUH 3SE4C 4J7RA 3RRQA 4MXVF 1NGQH 4XPGL 1WWWX 3VGGA 1BFSA 1QHPA 1U8QB 2R2CA 1BJ8A 1B4JL 1U58B 3MCLL 3MRMA 3VWJA 4HGWA 5I74C 3UTZA 4ERSH 4NQEB 2IBGA 3HC0B 4WIQA 3VXRB 4L8DB 3VFUA 4YDLB 43C9A 2R29L 3BD5A 3AROA 3ZKXB 3PWVB 4KTEH 4P2OC 5FOBA 1XIWD 4GH7B 3TZVD 2XICA 1DUZA 4FQHA 3ARFA 3OAUH 4UQ3A 3UROR 5BV7L 1C5BL 3UYPA 4QT5A 4KDTC 4NQUA 4H88L 3ZKMC 5MENE 5EZIH 3D18A 4LK4A 5GGRA 3ZT6A 1JZ7A 3PQYB 4NPYA 4NZDA 3ULSA 4AEFA 5I8OL 1QBML 3IJSA 5HVHC 4M8QA 4L8SB 5HJ3A 2CIKB 3OBAA 4YPGA 1BZ9B 5C08E 5DQJB 1KJMA 4L8CB 15C8L 2F74B 5IHUL 5IW1B 3U48A 3P4OA 5TF0A 4PLOB 1G9NH 1YPZA 4MA3B 2XZCH 2ZCKH 4PRAA 4PGBA 5DUBA 2F53E 4AH2A 4YQXL 3RWIB 1W72H 3FONB 4LGRB 2H1PH 2ZUXA 5C3TA 4W68A 1JI2A 3WO3B 2R2EA 4YFLI 1S7SA 4EI6A 3EYQD 1IQWH 1MCSA 4PYHA 4Q2ZA 1EFXA 1GPOL 1CLYL 1VGKB 4RMRA 1JN6B 2YPVH 1Q9LB 1KIPA 4Z7WE 5IF0B 3WFBL 4HK3N 1CICD 3AREB 1OM3L 1A7PH 3QDMD 4LQ1A 4DZBA 4N0RA 4P3DB 4ZSOB 5FKAB 3VFNB 3TBYB 1T89C 2BXYA 3MA7B 2M8XA 5E5MA 1YNKL 1ACYL 2Z93B 3TIEA 2BVPA 3TA3B 3A6BL 2VDLL 3D39E 2XIDA 3CSGA 3OB0H 3FQWB 4QYOB 1NCCL 3HZKA 3V8OA 2UVFA 2CDEA 1Z9MA 1OPGL 3JWDH 3S35H 2X9YA 3B5HA 3RGVA 1M7IB 1HDMA 1YEGL 1H3PL 1SM3L 1JMXA 4G6FB 1S9VB 4KKAC 3FFCE 3C5ZC 3HI1A 4RAVB 1JZ4A 1AGDB 2J6EH 3G9AB 1GGYA 1L0YA 3GGWB 5CFHA 2B5IB 3U1SH 5DD1L 4U0RB 5EU3A 3RNKB 1IC1A 5HHQB 3WNKA 3VXMD 2R0WL 4OIIH 1UCBH 4XP5H 3UPRA 1DSFL 4HXBL 1XCTB 1AFVH 1OAKH 1P4LA 5MP6L 1GGIH 4QXGH 5DZLA 2AW2A 1HWHB 1G7MA 3BP6B 5IJVB 5MERA 2VIRA 4P23A 1MFBL 3OXSB 4K3JL 1HHJA 3FQRA 4WEUD 3T0BA 4ZFFB 1IQDA 4ZS7H 3KPSB 4E42B 3O11A 2UY6A 1R5WA 4KK6C 3MGTB 3LKPB 4M6NH 5BXFB 4FFYH 2NMSA 1KB5L 4TVPD 4NKIL 3VFGL 1ZHBA 3DMMC 4U05A 1EO8L 3BPCA 3K4ZA 4M7LL 5GISH 1IGTA 4WEBL 2HKHH 1NC2D 4P9ML 3RZCB 1E6JH 1B2WL 2WANA 4PJAF 2RGSA 5C8JB 3LN5B 4R7NA 2YD9A 1CD1A 4KJQD 1FYHB 4PLJC 1RZGA 2OL3L 2R15A 1MCNA 1URLA 1MRFH 4G6KH 4Y7MA 1GC1L 3KPMB 4DJMA 2DYPA 3C2AH 3FQXA 4MS8D 3VFMB 3IB4A 4Z76B 4KK8C 4JZNA 4PGCB 3R0NA 3EJYC 3H6JA 5BV7B 2YOCA 3GHBH 1KLGB 2AJXH 3U9UA 2L7UA 3BH9B 3LD8B 1CWVA 4GKNB 2FO4B 5ETUA 5E2VH 2F54B 5CZXC 4APQD 3UTSB 3TBSB 3LKOB 4GQ9H 4I2XE 3PGCB 4QRRB 3QJFA 1TENA 3ARDB 1MEXH 5GGTL 1FAKT 1ZHKB 5JR1L 2D0GA 1J0IA 1E28A 4FQXA 1EUTA 3WE6A 5T1MB 3LHPL 5EOQL 5JXAH 1S78D 2X4RA 3ARBC 3TVMC 3IT8D 3N1QC 4E0RB 1P53A 1TETL 1EERB 1E27A 4J12A 3I6LD 3VJ6A 4QHUB 4XMKH 1LDPL 3WHE1 4KKCC 4P59H 1P1ZB 2ORBH 3PWPD 1DFBH 5IG7A 4JG0H 5DD3H 3PF2A 2ZSVB 3T0AA 4HJJH 1U3JA 1FZKB 3PHQB 5FO8A 3U30B 2AJZB 3VWJC 1MY5A 1U2CA 2PTUA 5E8OB 5FO7A 1MCJA 3DRQA 3ALXA 4UU9A 2DQGL 3B8SA 1NMBH 2A9MH 2R39A 1FYTE 5ERWA 1TTFA 3VD7A 5IMKB 1SJHA 1KCVL 1LQSR 4HZLB 4XPGH 1YEDB 2DKSA 3ARFC 5A1AA 1EHXA 3HZYA 4TQEH 2J12B 3CSYB 4HWEL 1B4JH 5I16B 5J1AA 3MRLB 4WNQA 1Q0YL 2VKXA 2VO5A 4PYGA 5D93B 5BZWA 2UWEF 1F11A 5GSRA 3HE6B 2XRAL 3BI9X 3I6GB 5E2UL 1W0WB 1Z3GL 2XG5A 4GFTB 3VH8B 2J8UE 2R29H 1I7RB 4OFDA 5DA0B 4WW2B 5C0DB 3C60A 3RL2A 3VE0A 2OCFD 5BV7H 1T66C 2Y5TB 3H7BA 4QHMB 4H88H 3FQUA 3OKEB 2J8OA 3F12B 2IF7A 4XBPB 5B8CB 1NH6A 2BC4A 1QBMH 3GSVB 2AABL 3ZTNL 1MJ8L 3CNKA 5D9SB 3L3GB 1Z5LB 4FS0A 15C8H 1KB5B 4NT6B 5IHUH 5SX5K 5L2KA 1CT8B 5ITBL 1PDKA 1YEFL 3JTSB 3F5WB 1LMKA 3ES6A 3MRGA 3VGDA 3QZWB 3NCBB 5IM7A 1YUHA 3VXOA 5GSVA 2V5TA 1JI1A 4QRQA 5FM8A 2CR6A 3OKOB 2NY1B 1P84K 5C86A 2OL3B 3RGVC 3WFBH 3V6FA 1OF2B 5I6XB 1OM3H 3KGRA 4NSKB 3BZ4B 5IHLB 4IDJH 4QY8A 5HHVL 1NCUA 3KPTA 3GHEH 2GY7B 1ACYH 5IBUB 3RY4A 1JRHH 2VDLH 4TTDC 1NFDE 3LQAL 5LGJA 3W39B 3NBNA 1JWUA 5CS7A 2ZSWA 1RULH 5ICZB 5T1KA 1Q72H 1KNOB 2DKUA 3MUJA 1PAMA 3BFOA 2FBOJ 3KPOA 1OPGH 1HQRB 4XI5D 1LE5B 5HGBB 1ZLUH 1IEBA 4WUUA 1YEGH 3QNYB 5EC2B 1SM3H 2K3TA 2PF6A 3WFZA 4DW2H 4P5KB 4GW5A 4J8RB 4P9HL 5F7FA 1KCLA 5CZKA 1OOAA 4P23C 2ZNXA 3LRSB 1YQVL 1T7ZA 4FFZH 5C0BB 3BGFC 2IG2L 1RJCA 1QSEE 2AAVA 3LS4L 1AC6A 2CIIB 4P46A 1R6VA 5DD1H 1FVDA 4M62L 4F37K 1Q9KB 4P2QB 1EDQA 4NCC2 3W5MA 2DJUA 3RTQD 1MFEH 4I13B 3AS3A 1MCOL 1UJ3A 3OAYK 4M1GH 1LP9E 2BP3A 1A4JA 3JTTB 1H3TA 4Q74A 2DMCA 3OAZK 4ZYKB 3O3UN 5B3NA 3GMNB 3D3VA 3CXDL 1MFBH 2BHYA 4FP8H 4K3JH 4WI5A 2X6MA 1KENL 4PP2B 3IKCB 4HT1H 4A6YA 3X3FL 3BRGC 3RWDA 4LVHC 1GOGA 1MAMH 2D31A 1RSFA 3BZFB 4CKVX 1JZ2A 4UINH 1KB5H 3QFDA 4F7CB 4PJ7B 3OWEA 3E6FA 3IU4L 1QO3A 2CKNA 5FAAA 3BO8A 4JFDD 4M7LH 3JUYA 2EICA 1FL5B 1OTSD 4JO2L 2WBKA 4WEBH 4P9MH 2EKSB 1B2WH 1KEGL 4M61B 4ZPTA 1WC7B 3BIBX 4F7EA 2OL3H 2R0LH 1KJ2L 5E8PB 1M6OA 4LIQE 3RVUC 3RZWA 5E08L 1U8KB 1KIRA 2X1WL 4CMHC 1HH9A 5E00A 2R4RH 2VOTA 3T2NH 3V5KA 1PZ5B 4FQXC 4PRPE 2HLFD 1MLBA 5D5MF 3U4BL 3KWWB 1Y6NR 5GQBA 2OTWA 4OZGF 3QQ3A 4QF1B 1S9KC 4PJGB 1OAYL 5A2KH 4NO5B 3U2SB 1JGEB 1GGCH 1H9VA 4KDVA 2PW1B 3CH8A 2CRIA 2P5ED 3VXUE 4UTBL 1DQDL 1F4WL 4QEGA 5E8EA 4ZOBA 5AD0B 3H9ZA 2M1KA 2IPKA 1TZHA 1V05A 32C2B 3C9NA 4IBLT 1BD2E 1ZT4B 3LHPH 4BH8B 4U33A 2BHUA 5EOQH 1OAUL 3V8CA 3PGFL 4XX1G 1I1AD 4M7ZB 4ZTOL 2VAAA 1O7VA 3T0ED 4JFQA 1CFNA 3OKNB 4FXKA 1MELA 3IETA 5EU5B 3AXLB 2JJSA 5DR5L 5C07E 4L3ED 4IRJA 1J7VR 4GXVH 3ULVF 4UIKL 1TNNA 3WL9A 1NUGA 4GRMA 1RJZB 4YWGL 1NCAH 43CAA 4LHJB 3EO0B 4JVPA 2B8OT 5FHBL 1CDHA 2WINA 4LLMB 3BDYL 3OGCB 4CADB 3U0WH 5DVOA 5EZLB 4OKVA 3O3BA 3TCXA 1KTLB 3ROLA 2HWZL 2D7OA 3DBXB 4RFOL 5IB3B 5MHSD 3QDGB 5I8EB 1ZGLB 4HEME 2Y72A 1HSBB 5LGHH 1XGTB 3C60C 5GS3A 1KCVH 4X80L 5EBMB 4NQDA 2JCCA 4JY6A 4JY4A 1BBJB 5AG9A 2OI9B 1BVLB 2HTKC 3CLEL 4NKOB 2CDGA 1RUQH 4R7DA 5HPMA 1UWEL 4HWEH 3HI6L 3WXWH 2ZOKA 2BRQA 1L6ZA 3N50A 3I50H 3W2DL 1Q0YH 1S9XB 4ISVB 4MZ3A 2XRAH 2XWJA 4Z7UF 4KGLA 5E2UH 1Z3GH 4ZQKB 2HFGL 1LK3L 3UYOD 4P2RE 4JFXB 3R06A 2Z9TA 1EUUA 1PKOA 1CXEA 1U36A 1FCGA 4G8GE 1G7JB 2VB5A 2VDKL 4HMEA 3FAWA 4NQED 4CVXA 1J05A 3VXRD 1Y18B 3T1FB 2DB8A 1KXQE 1QFWM 5SWQA 5D7KD 4C83A 3D85B 4OZHA 3EOAB 4GW4B 4GLRH 3TO2B 1QKZL 2AABH 2V17H 4OTXL 5SWZA 3ZTNH 4OI7A 4LEXL 4HUWB 1RZ7L 3CDGA 2ZG3A 2CSPA 1J8HE 3D25B 5C0EB 1I7ZA 3O3EA 1P7KA 1F4YL 3PQYD 3STLA 5KVEL 1RZJL 5CP3A 3EGSB 1I9IL 5K9JL 1BZ7A 1MIEH 2W60B 3RA7L 3SGEH 1FNFA 4ODTH 4ZAKB 1B90A 3QEQA 1RJLB 4PJ5B 5CP7B 3D1MC 1JGLL 2XZQL 2AXHA 5ECJE 1KJ2B 2NZ9D 2RR3A 4ZUVA 4HG4K 1ODAA 1T21A 5C0CE 5EULV 3UTPD 3VFUB 3FQTA 1XH3A 4PJEB 5HHVH 1C5CL 3QPQC 1MVFA 4WFED 3WUZA 3RIFF 5FOBB 2W92A 3L3KA 5FO9A 3DIFA 4R0LB 4YDKL 4GG6F 4P46C 3ARED 3QWOB 4QT5B 1IM9A 3D18B 1Q0XL 4WO4A 1UJ3C 3VWKA 5BS0A 3OGOE 3PWJA 2BVOB 1CGUA 1EAPA 3TA3D 2BCKA 3IJSB 5LAXA 3GMMB 4P9HH 4HIJB 2EDEA 5JHLL 4G43B 1KJMB 3LN9A 3MNWB 1N3NB 4IRSB 4YHZL 4WI2A 1YPZB 5ESAB 4LLWA 5GS1B 2IG2H 4GXUM 5DUBB 4AH2B 2MCG1 4XH2B 4YJZL 2YEZA 1A64A 1SYSA 3ZKQD 5GZOC 1GZQA 4G6FD 5D7JB 1MCOH 2G2RB 4RRPG 5IGXH 2XQYG 5DJZB 2RAMA 4LRIA 2YD3A 4N0UE 1FH5L 1A7NL 2IALA 4YBQD 3CXDH 3AM8A 3W9DB 3HE7A 1KENH 3GSWA 4ELMA 3X3FH 1KJVA 1M1SA 3O4LE 2QHLA 1G7IB 1MCPH 2OTPA 4POUB 1WZLA 1MUJA 3IU4H 2OZ4H 1FGNL 4XCFL 1I9EA 4OD3H 3O6KH 5EO0A 1HHGB 4XP9L 2JB6B 4JO2H 2HFEB 2VLMD 3U0TB 1AGBB 1X5LA 3MROA 3KPSD 2F8VA 1QLRB 4U1JB 5F3HB 1RY7B 5JXED 5IEHB 2Q1EA 4XHQA 4Q0XL 5F9JA 5ACLA 3HNTL 4WHCA 5DFVD 3PGDA 5D2NB 3RHWF 1U41A 3V0WL 3RZCD 3HFML 4LSPH 3BYYA 3O6LL 4LLQA 4OF0A 3WD5L 5IROA 1GGUA 3NIGF 1OAYH 5F96H 1FV1B 3VFPA 3C6SA 4TN9A 4LAJH 5DURB 2JJSC 4Z6AT 5C0NC 3CMOL 5MERB 4IRJC 1I8MA 2E8YA 2VIRB 1BQHG 1U8IA 4UTBH 1DQDH 1QBLL 1F4WH 3RU8L 4QRPB 3Q6FA 5JPMA 3O11B 1CXHA 5DGQA 3B2UD 1PJ9A 5FF6B 1A6AB 3T3PF 1A6UL 3HLAA 4N5UA 1SJXA 1OAUH 2FX8H 3QA3B 5DS8A 2F54D 3UTSD 1XMWA 1U91B 3KPRB 3AMLA 1VEOA 4QRRD 4PP1C 3ARDD 3UX9B 3VXME 1CVSC 3WEXA 4BM7A 1MHPH 3P0YL 4MJ5A 5DR5H 1KJ3H 1IC7H 2VXQL 4P3CL 1U3HA 5B4MD 4QO1A 2R1YB 2V2XA 2W0KA 1NSNL 4UIKH 4YWGH 5FHBH 2QR0A 1IEAB 5MEPA 4FQ1L 1KBGL 5JO5B 4Z0XA 1MFDL 3V6ZA 5LWYL 2GSIA 5IK3A 3SGDH 2HWZH 4RFOH 2OTUB 3IDJB 4JZNB 5JMOC 2JJWA 2AXGA 4KJWD 5F9WC 3MYJA 3NTCL 5CEZE 2AERT 4YDIL 1FBIL 3MLYH 4L4VA 2A38A 3MLWH 2EIBA 2QQLH 1RIVL 3GM0A 1HN1A 2VZVA 4JO4H 4Y0GA 3M17B 3CLEH 5I1DA 3MBXL 1UWEH 1D5BA 2DWDB 4RRPA 3UO1L 4OCXH 1QSFB 3MV01 4JVUA 4Y4FB 1JF1B 3H0TA 2O5YH 1MCWW 5JTWA 4PJXE 2VRAA 5IWLC 1NJ9B 2AJYL 2HFGH 4H0HB 1I3RB 1LK3H 4LARH 1A8JH 2APFA 4NQCA 2K1MA 3LPGA 4P5TA 2VDKH 1CXKA 1NBYB 1MRDH 4KK5C 5KSAB 3AS2A 3HE6D 5ICYA 1WEJH 3KPLA 3EDKA 4HLJA 1CDJA 4U6XB 3PWNB 1BM3L 2HVKA 2XWTA 1S8DB 3DRTA 3OKDB 4ZFZB 4OTXH 2AGJL 4XNXL 4EUPB 1PX3A 4LEXH 2X4TA 5D7IA 4N68A 3REVA 3JZ7A 2Q8BH 4R96A 5HHXL 3MTRA 5TJWK 4X7DC 3NGBC 1RZJH 5GS0C 1G0YR 4U7SA 1I9IH 5K9JH 3K3QA 2ZKHH 3RA7H 4NM4L 1MCIA 5IIEB 3S97C 2O5XL 5KTEH 4ZUTB 4QXUL 5CHNA 2A2QT 1WZKA 4WO4C 1JGLH 1X6LA 1Z6JT 5J1AB 1IGML 3VWKC 2NY4C 3ZMRA 4EIZC 1LO0L 1F11B 4LSTL 5GJTL 5E8NB 5DJDB 4FG6C 1C5CH 4PRDB 1KTDA 1SMAA 3CFEA 1ORQB 1E6OL 3H9SA 2E6PA 5IB4A 3GSXB 2NY1D 5I1AA 4U0QB 3V52L 4YDKH 2OK0L 4D0DA 2GY5A 4MD5B 4X4XB 3VRLF 4RQQB 1Q0XH 5FIEA 5EB9A 1TCMA 3RVWC 1JNNL 2BC4B 4LRIC 4Z78B 3FFDB 4FQJH 2DQFB 4X7SL 5EU6A 3T8XA 2RQ8A 3HS0B 3AM8C 5JHLH 5F9AC 5HYQB 5A2IH 1CTNA 3WHE0 3HE7C 1RHHA 4LHUG 1BLNA 1ZLVK 2I9TB 2QQQA 4WI3A 2QADB 3ARGA 4U1NB 3MRGB 4F8TA 5T1DL 4ZUSA 4OZIF 1MJ7H 3QH3B 5M95B 5TPWL 1F3RB 3VXOB 5GSVB 4LPCA 4HS3A 4BELD 4N90D 1I1FA 3TBVA 2CLZA 1U8JA 2EXYC 3KYNB 4HHAA 5C0BD 1A7NH 1MI5A 2V2TB 5GGSB 3QWRD 2X4PB 4YBLC 3DGCR 5I1JL 4P2QD 1M7XA 4X6FB 3SOBL 1DDHA 1JYWA 1JWUB 1ZWIA 2BVEA 2YPKA 4UB0L 4HWUA 4PJDA 2YZ8A 4XP9H 4GRWF 4Y5XA 4MA8L 2N7BA 3MV7B 4G9FA 4EQ3A 2QQNL 1EJOL 4DKDC 1KIUA 3FO1B 5IROC 3QIWB 5HHOD 4DKAA 2OMBA 3O81A 3VFTA 1BVKB 5CJ8A 2ESVB 4LVEA 4U1HA 3QQNA 4LCYB 4Q0XH 3BPOC 3HNTH 3KLHC 3P9LB 4DUWA 1JTTA 1A7QH 4PJIB 5D2LA 1WLHA 1X5AA 3QIUC 1FVDB 5EBGA 5J13B 4M93C 5KS9A 3O6LH 1QG3A 2Y07L 4OIAA 5SX4H 3WD5H 2Z8VC 3NFSL 4LCIL 1TLKA 3R8BB 4M9OA 4NO2B 1X3DA 3BUYA 2NXZC 3IGAA 1LEGB 1U3HC 1QBLH 4MJ6B 1KPUA 3RU8H 4N0FB 5CJXA 3VA2C 4Z7QF 4LRNL 5DJ2B 5CWSA 3L5WB 4PRNB 5H8DA 2C4XA 2ZOLB 4RAHA 2CQVA 5I8CB 4M7KL 4YZFF 1QO3B 3BEWA 3U0PA 3M1BB 4HV8A 3OB0K 3QXAB 1RK1A 3RGHA 1OVZA 3QXUA 4P3CH 3RY6A 3RAJH 1ZEAL 2PXYA 3WNMA 1L4IA 4ENED 2LVEA 2ADFL 5DTFA 1LD9B 4LEOA 1LNUA 5AYQA 4RIRB 3VFRB 5L2KE 5JW5B 5EUKA 4FQ1H 3GMQB 5E00B 1MFDH 2X42A 4EI5A 4JRXA 5D8JH 5LWYH 1KXVC 4XPAH 4UUJA 3CSBA 3NTCH 4G6JL 2EXWC 4JFDE 1FBIH 2C3VA 4LHUA 4XTRC 1ZLSL 5D71L 1RIVH 1TVBB 5KSUB 1Q1JL 2XWBB 5DJAA 4G8FA 5DYOA 4HBQA 4NNPL 4CU7A 2KH2B 4P5TC 1WK0A 1HHKB 1SBBA