3UADA

Multicopper oxidase cueo mutant c500se506q (data5)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
489
structure length
476
Chain Sequence
b'AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHQDTGMMLGFTVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
publication title An O-centered structure of the trinuclear copper center in the Cys500Ser/Glu506Gln mutant of CueO and structural changes in low to high X-ray dose conditions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 135
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uadA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uadA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uadA03
1RZPA 2XLLA 3ABKB 4M4RB 1NZRA 4F7KA 1GY2A 3DTUB 1AS6A 1FFTB 4TXVB 2PPFA 2I7OA 1W6WA 4DP7X 2VW6A 3NJJA 2VN3A 2CBPA 2ZONA 1URIA 4HCIA 3HB3B 1GYCA 1SHWA 1IBYA 3OQRA 4NAJA 3PAZA 1ADWA 2PCYA 2GBAA 2HZHA 4DPBX 5FC9A 4HIPA 4Q89A 2Q5BA 3NYKA 2EIJB 2BWIA 1OV8A 1KCBA 2XWZA 1AG0A 1PCSA 4A2EA 2HXAA 2FWLB 3OMNB 1OCOB 1QLEB 3TA4D 1L9SA 4KO7A 4YSSA 4CSZA 3ERXA 1SFDA 3UACA 1ILUA 1A4AA 5A7EA 1V10A 2Y69B 4YSPA 5I6MA 4DP2X 1V54B 1OOWA 3S3BB 1AG6A 3BQVA 1WS7A 4YSEA 1AZRA 4KOBA 9PCYA 2QT6A 1A4CA 1OE3A 4K9JA 4YSDA 3TBCA 2HX8A 4GP5B 2FNWA 1X9UA 2Q9OA 2UX7A 1B3IA 1PZCA 3FU9A 2PP9A 4M3HA 4E9SA 3ABLB 1UATA 2FQEA 1AQ8A 2FT6A 2IH9A 2XV2A 3X1EA 3X2QB 1M9WA 1ZIBA 1KGYE 3QJQB 5B1JA 1ASPA 1ILSA 2CUAA 4HCGA 1JZGA 5IY5B 2OCCB 1AZUA 3PCYA 2AZAA 3NJGA 4JHUA 2I85A 4DPAX 1CYWA 2JKWA 1TEGA 5AKRA 1ZIAA 4PAZA 1OCZB 3H4FA 1SF3A 4KNTA 1TEFA 1L9QA 1OF0A 4HAKA 1GS7A 5E9NA 1NIAA 3OMAB 3GXUB 2GI0A 5TK4A 3FS9A 4HZ1A 2QPDB 2DYRB 3IBOA 4A2FA 2AZUA 1GSKA 1NIEA 3NJIA 3KW7A 4JKNA 1BXUA 1GR7A 1NWOA 4UF7C 2BP0B 1AANA 3EF4A 2YQBA 1BAWA 2W8CA 4KNSA 2UX6A 2W88A 2QPEB 5B3SB 2GC7C 2AFNA 2TSAA 3NSYA 1PAZA 5I6LA 1MG3C 1JZHA 4Q8BA 2EINB 3S3CB 1HFUA 3T6XA 1EHKB 2VW4A 3ASOB 3QJTB 1ET8A 4NERA 3H56A 4YL4A 4UANA 1MZZA 1R1CA 3GYRA 1F56A 3WNIA 2H5UA 2HRGA 3DIVA 2HX9A 3FSZA 1IBZA 1OE2A 1KBWA 1NWPA 3EH4B 1BXVA 3G5WA 3UGEA 3CDZB 2AVFA 2MTAA 5TK2A 1J9SA 4EF3A 2HX7A 3AG3B 4YSQA 1ET5A 4A67A 2XXFA 4QLWA 1WA2X 4A2GA 2BHFA 4DP4X 4HHWA 4CSPA 3S8GB 4G7QB 1E65A 2BW5A 3S3DB 1PNCA 3FQYA 1JZEA 1A4BA 2BP8A 1AAJA 6PCYA 4YSUA 4G71B 4G7SB 1BEXA 2EILB 4A2DA 1JVOA 1SF5A 4G7RB 2FQFA 1AZBA 3QJUB 3NP4A 3IN2A 3MBWB 2YARA 2PPAA 2VSKB 1N70A 2PPDA 1CYXA 2VM3A 2Y1AA 2FQDA 1E5YA 2PP7A 1ASQA 2YAOA 5I6OA 3ZDWA 3CVBA 3WI9A 1BXAA 2EIMB 4HCFA 2R7EB 3TBBA 2VSMB 3FU7B 3NJKA 3X1FA 4ENZA 2IWEA 5PAZA 1MZYA 3NJLA 4FA7B 1NIBA 1BQRA 4FAAB 2IAAC 4UAHA 2J56A 3AZUA 1MG2C 1NICA 4GXFA 1J9TA 1GW0A 2VM4A 2AANA 3PAVA 1JXGA 4BXVA 2H47C 1L9RA 5D4JA 3T9WA 1A65A 4N8UA 1X9RA 1PLBA 2J57A 2YAPA 4N4YB 5B1JC 1DZ0A 3AG2B 1V55B 2NRDA 1ASOA 4E9XA 3UAEA 1AIZA 4GP4B 1ZPUA 2I7SA 4DP9X 2A3TA 2FJSA 2YXWA 3NT0A 3NJMA 1E5ZA 1I53A 5I6NA 3FYEB 3ZBMA 1SJMA 1QHQA 3HEIB 1GY1A 1SHXA 2JFCA 3ZX1A 2X88A 4E9WA 3IEAA 4BDVB 1CUOA 2N0MA 4E9RA 3NSFA 1A8ZA 2HRHA 1CC3A 4AZUA 1AZCA 1NPNA 3RYMA 1SNRA 2YAQA 2DWSA 6PAZA 5F7BA 2IH8A 1EZLA 2PPEA 5I6PA 4A68A 1IC0A 4QKTA 2IDFA 2EIKB 1JXDA 1SFHA 3UADA 5B1BB 1AS7A 3V9CA 3PAUA 1ZDQA 3WIAA 4DP0X 4GY4A 1E30A 4GYBA 1VLXA 2YAMA 2OV0A 2CCWA 4BXSV 3S8FB 3CG8A 2BP0A 4GP8B 3AG4B 3V9EA 1PF3A 3ABGA 2DY2A 2BZ7A 3D12B 3QJRB 1IKOP 5B7MA 1E67A 5B7FA 5PCYA 1W6LA 5I26A 2YAFA 3AW5A 4DP1X 3QJSB 3PLYA 2BO0A 3T6ZA 1IUZA 3NSDA 2XX1A 1BYOA 1OCCB 4A2HA 2WO3B 8PAZA 3IE9A 3EHBB 4BWWA 2PLTA 3NJFA 1JZIA 4MFHA 4F2EA 4AI7A 1JZFA 3CZUB 3CVDA 1J9QA 1FA4A 5I5JA 1PMYA 3NSCA 3CDZA 4YSAA 2J55A 4BK5C 4BWUA 1BQKA 2J5WA 1SDDB 4KO9A 1ETJA 4E9YA 2YAEA 2B08A 5B1KA 1JERA 4X4KA 5I6KA 7PCYA 3UABA 3NJHA 2XYBA 3N2JA 1XB3A 2HLEB 3JT2A 2E86A 3X1BA 3AG1B 4YSCA 4DP5X 2GC4C 3CVCA 1QNIA 1FWXA 1RKRA 1NDTA 2XV3A 1L9TA 1AS8A 3FPYA 1PY0A 4PCYA 3FSWA 1L9OA 3NP3A 4AKOA 1TU2A 1GS6X 2GIMA 2WO2B 4G72B 3WG7B 3PXLA 1AACA 1HAWA 3ABMB 4JHVA 1BQ5A 1CURA 3MX0B 4WTQA 3SQRA 2R7EA 3DKHA 1GS8A 4F2FA 1NIDA 3FU7A 1PLCA 2GSMB 1RCYA 2IDTA 1NTDA 2OJ1A 2JXMA 3ASNB 1WA0X 3WNJA 4BWTA 5AZUA 1AR1B 1M56B 4YVNA 1YLBB 3FSVA 3FQ2A 3OMIB 1NIFA 5EHFA 3SBQA 2H3XC 3FT0A 4KO6A 2P80A 2CAKA 2PP8A 2QDWA 4L0PB 1KCWA 4NB7A 3FQ1A 3C75A 2P80D 1AZNA 2YAHA 2VW7A 4E9QA 4KOCA 1WA1X 4KO5A 1RZQA 3NJNA 3UAAA 1PNDA 2VMJA 1J5CA 2XU9A 3X1NA 3QQXA 2FTAA 1TKWA 5F7AA 1PZBA 3L45A 4G70B 2XVBA 1AOZA 4W9ZA 1ZDSA 1ZV2A 1PLAA 2FT8A 3X1GA 2IDSA 1MDAA 5LDUA 3IN0A 2WSDA 1DYZA 1KDIA 2UXVA 3U25A 2ZOOA 2PCFA 2IWKA 3BVDB 3FSAA 3SBPA 1OCRB 5I5MA 1A3ZA 2GHZA 1PZAA 4DP8X 2TSBA 2B3IA 4E9VA 5AFAA 3SBRA 4BDVA 1JZJA 4YSTA 1KBVA 1XMEB 5D4HA 3OD3A 1WS8A 5D4IA 3FPXA 2FT7A 3WKPA 1J9RA 2PPCA 2DV6A 3QJVB 7PAZA 4WKXA 5B7EA 1BYPA 1W8EA 2YXVA 2ZXWB 2DWTA 2XXGA 5ANHA 2XUWA 4DPCX 2IDUA 4YSOA 1KYAA 5I28A 1WAEA 1NINA 5I5IA 2XX0A 2DYSB 1JOIA 1M57B 3EH3B 4P5SA 3T6VA 2UXTA 1KV7A 2BWDA 2IWFA 2BW4A 3KW8A 2FQGA 1HAUA 4YVUA 4AX3A 2XV0A 1NPJA 1KDJA 1JVLA 4RH4A 3JTBA 3EH5B 3H4HA 2CALA 4ZK8A 3AY2A 3GDCA 3T71A 1N68A 1L9PA 2QDVA 4E9TA 1XB8A 2GB2A 1J5DA 2CJ3A 3ZIYA 2BZCA 5B1AB 3WKQA 4KNUA 4A66A 3QPKA 3N55A 1ET7A 3FYIB 3TU6A 4AKQA 2LLNA 2UXGA 3T6WA 3OM3B 4HHGA 1JXFA 4DP6X 1XB6A 4W1TA 2BP8B 2ZWNA 1T5KA 2MRYA 2RACA 3PPSA 4HALA 2IDQA 4YSRA 3FU8A 1SDDA 1OE1A 1ID2A 4AKPA 4P5RA 2UXFA 2X87A 3TASA
chains in the Genus database with same CATH superfamily
1CL7H 3QZWA 5KUMA 3X12A 4OFPA 3I02B 4PVLA 4URTB 4YDZA 3GXPA 4W4OC 3SE3C 5IUSA 1AGEB 5EO9B 2ARJQ 2J20A 4JO1L 4L4TD 1VACB 4YGAB 1CTNA 5TE6L 3VMOA 4Z7WE 4XC1H 1UCBL 2B3RA 3LV3B 4WQOA 2BIHA 3WS6A 2R2EB 4HFUL 4HLJA 3B7TA 2WIIA 1X5MA 1ZHLB 2VSDA 1UM6H 1WRFA 3PABA 3BUBA 5AVYB 5TQ2L 1M7DA 1RUKH 4JO2L 4AEIH 4D0DA 5I16B 4GG6F 1IM3D 1KPVA 4G43A 4UM9A 4ZOBA 2VLJB 1L9SA 2BIOA 4KQ3L 5EG6C 1J8HB 2VJXA 2CR0A 1A8JH 2WUCH 3NGBC 5GRVL 1FVDA 1A66A 3QORC 1RUQH 2XBTA 4KOBA 4JDZA 1S3KL 3KBPA 1JG9A 1F5WA 5I71C 3HE6D 3N06B 1ETA1 1TCRA 3T1FA 3HKFA 2QQNH 3AABA 4JPVH 1U2CA 5ABZA 5CD3A 3EYUH 1YMMA 2X38A 1DVSA 4C4KO 3D2UB 4U3HA 4OGQC 3LPOA 5HYJE 2ZX6A 1UM4L 1G6RB 4MVBD 3P4MB 2WP3O 2R1XA 5CGTA 3K46A 3MJ6A 1RD6A 3BOVA 3ARBC 1QFOA 3OPZH 4IBLT 1Z5LB 1M4KA 2QV4A 3TVMD 3RPIA 2Y3AA 3BIAX 5TDNB 3JT0A 3C5JA 1MFVA 3VQ2C 1SVBA 5BO1L 3S35L 2X5PA 1KYOK 5G5DA 4KQ0A 1A6AB 4JKLA 3N0PB 4QI3A 2AS5M 2JKWA 5CMAA 1OP4A 2WNWA 4PAZA 5KG9A 4M29A 3H4FA 5F1IB 1T89A 1PZSA 1TEFA 4X4YA 4M3KB 1A2YB 1MUJB 1A6VH 4JAMA 2BSRA 2HKFL 4KX7A 4M5YH 2FO1A 1NIAA 2ZCKH 3IU3B 4YWGH 4Z76A 4Y2NA 3BP7B 4NRXB 3FBKA 2K0RA 1M05B 3L4XA 4JFYA 1MWAA 5EOTB 1F3DH 4Z7UB 4TL5A 3AACA 1INDL 1I3VA 4BSWB 4NN6C 5JXAL 2IH1A 3OJDB 4K15A 3V4PL 1TZHB 2JNZA 3B1TA 3C9NA 1K8IB 1I8AA 1A4KB 5E56A 1BJ1H 3OKKA 3HG4A 4HPYH 5FR3A 2EINB 2Z31B 3NEXA 1A9BB 2VW4A 5GIRA 3O6FA 4WHCA 1FORL 3H3KA 4KJWC 5AUMA 3SO5A 3IFOB 4BZ1L 3J8F7 5E6ZA 1BFOA 4NJAH 4PR5B 2B5IC 3FCSA 3EGSA 3HZVB 2DJMA 3RUGB 4P9ML 2YA1A 1PYWB 4QRPA 4YHPA 3NABL 4NQCE 1IKNC 1KTDA 3T6QC 2B59B 3IGFA 5AB0A 4NPYA 4KKCD 3TLRA 3VO0A 2DTML 2JK5A 4MGXA 2R0WH 2OTUB 2WXJA 1QPPA 2QSTA 4GT7A 3G04A 2H3NB 2OX5B 3K91A 5D93B 1JV2A 3SQOH 3L6FA 4QRBA 4U2ZA 5I18L 4UNVA 3OV6A 3X13A 1WFUA 4K2UH 1I75A 5D5MF 4G71B 2RGSA 1XGRA 4JL2A 1JF5A 4I3GA 2CBOA 1AY1H 3L3KA 4I5BA 2OZ4A 2MQGA 1NGQL 3V5DB 3I02A 1P9MA 2QADD 1SBBA 3T77B 3NDZE 1AGEA 2V9TA 4X9HA 5EO9A 4MA8H 1VACA 4ADJA 2X9YA 1ZLVK 1DBAH 3LV3A 4BHUA 2B0SL 3CNKA 4OV5B 1YEHH 5IVXE 2EIMB 4HCFA 1AR1C 1I1AC 2R2EA 4PRDB 4BIKA 1GAFL 3NJKA 4NQCD 4IK6A 5FHAH 1WTLA 2IWEA 4UM9D 3WSQH 1BF5A 4J2XA 1ZHLA 1BM3H 3HNTL 5EBLB 1Q38A 2NSQA 3QDHA 4UU9B 2YUVA 3F05A 5I16A 3EOTH 2VZVA 2VLJA 2VN5A 4LLWB 5HGHB 1LWJA 3PAVA 4YXKH 4OCXH 1J8HA 3S2AA 1YC7A 2VUOA 2UVFA 5FGCE 3ISYA 2WKOA 1IAIL 1HT6A 5GXBB 2NY1C 4NM8L 4M3JA 3ZMRA 1BVZA 4Z3GA 5D5ME 1DZ0A 2ZSWB 1P7BA 2MCAA 5FGRA 4FMVA 3LRSB 5T1LB 2VITB 4FQXB 4PW3A 3EJYC 3QFJB 4NWTH 1BAGA 1MH5B 1URLA 1OY3B 5C08B 1J1XL 4U4BA 1MHPL 3D2UA 2R0KL 1UA6H 1G6RA 1XV8A 1A02N 3FOLB 3N1QC 3P4MA 2G0LA 5IW1B 5I1HH 3ULAB 5I6NA 3IGKA 4NEHB 3RWEB 1SJMA 3IRCA 5EF0A 1LO4H 1Z5LA 1YVLA 2G60L 3DX6B 4MJJA 5TDNA 3IEAA 2JE8A 1X7SA 2Q8BL 2XVLA 2DH2A 1S7VB 1A6AA 3RWDB 1O6VA 2VXQH 2WNXA 3UIZA 3AM8A 3ZPDA 1TF4A 2H2PD 3FHAA 3ZU8A 5F1IA 4X6FB 4NQXB 4OM1H 1A2YA 1MUJA 1WIPA 3GMOB 4QKTA 3GHEL 4Z78B 1KFAL 4PBDA 2CE6A 2E9WA 4YXHH 3ZR6A 3BSZA 3IU3A 4GYBA 3BP7A 4FYTA 5LWYL 2BP5M 4NRXA 4JFEE 3S3PA 1M05A 1XX9C 2GBTA 3GXTA 5DK3A 5EOTA 4RX4A 1W72H 1RSFA 4Z7UA 3WS3B 1AZZC 4IKNA 4NZRL 3NRFA 4X0KB 1S7UB 3UX9B 1D5ZB 1KN4H 4BSWA 3OLIA 3OJDA 5JMRA 1NC2B 3BVUA 3QDME 4QRQB 3BEWB 1TZHA 1T5XA 4M5TA 3RIKA 3O2DH 4KKCC 2F68X 1HIML 1K8IA 1A4KA 3AW5A 2J6EH 4PG9B 5EIIG 1EZSA 2Z31A 1P4IL 2J8HA 3P2BA 1A9BA 5KSBB 4UTAH 8PAZA 3U2SB 3G5XB 4QRPD 4KTYA 5E8EB 4M1DH 3I3EA 4AC2A 1NEUA 1P84J 4PR5A 3BKJH 3HZVA 1OM3L 2FX7H 2DB8A 3RUGA 2J72A 5EC2B 1O9VA 1PYWA 1FA4A 2KT6A 2B59A 4ZDHB 3NZ8B 1MAKA 4RFOH 1UUSA 4KO9A 2W91A 2QADC 2OTUA 3NFNB 4KTDH 5KVGL 3SCMC 2IPUK 3MYZA 3RBSA 3CSYB 4JFED 4HLEA 2H3NA 2OX5A 1S2EA 1X9LA 5E7FA 3HS8A 4X6CB 1K6QH 4NO3B 3C09C 5I1IL 3R4DA 1E7VA 3QDMD 1R3IL 3SYOA 1BVLB 4OZFB 1E4JA 4JRYB 4L48A 3VGBA 1AI1L 2IC2A 4UB0L 3FTUA 5BS0E 1PY0A 3NTCL 2LU5A 3V5DA 4WI0B 3H55A 4HJTA 3NP3A 3RJOA 3T77A 3UXFA 1U3HD 3HZ3A 4P2QB 1VPOL 4P9HH 1H9DA 4ETQB 4P5TB 2AJUL 1XL6A 3UMNA 2WSPA 4MBRA 4OV5A 1WT5A 2DMGA 3VW3H 5DVLA 1GS8A 4PRDA 4F93B 3LVTA 4JGMA 1YAIA 4UWQB 1PLCA 5EU3B 5ACZB 5D1XB 5JHLL 1VFOA 4MLSA 1LGVA 1N5YL 4XCFH 5EBLA 3WNJA 1HNFA 2RQ8A 4UU9A 3FSVA 3V4LA 3VH8A 1HH6B 4OUOA 3ILEA 4LLWA 5LGYA 2F7IA 5HGHA 1EFXB 3V6BR 1A0QH 1VZHA 1WF5A 4BSVB 3LIUA 4RGMC 2TRYA 4ZSOB 4JL1A 1T66D 3UAAA 3MLUH 1GOHA 2ZSWA 3MLYL 3LXCA 4JX0A 4P4KC 3QXUA 3LRSA 5C71A 3D2UD 2GQHA 2VITA 4FQXA 1HNGA 3QFJA 1MH5A 1I85C 2XVBA 3GINA 4HF5L 2H2PC 5C08A 2ZAIA 2PWHA 4PLJD 2VNCA 3IE4A 1NCCH 1N0XL 3NFSH 3FOLA 5IW1A 3VU1A 3FQUB 4JLRB 1DQMH 3RWEA 2FJFB 3DPBB 4MJ5B 3CXFA 4A6YH 4EI5D 4JQXA 3DX6A 1NUFA 2EUWA 2IPUG 4F3FB 4AQ8A 4YSTA 1GGCL 1L9MA 3APDA 2J8UF 1I9IL 4NP4L 1S7VA 3VWKD 3K5RA 3RWDA 1DSFL 3NEOA 4JM4L 5ALBL 2APSA 4IDJH 1WS8A 4PHZA 3MJGX 4OIBA 5FCUL 3WKPA 3HR6A 4NIKB 5EEUA 5E51A 4KRNA 1YO4A 3OR7B 3U9UB 4X6FA 4FQCH 4NQXA 4ZMOA 4JQVC 3OAWA 1BYPA 2F18A 3O41B 4N86A 3GMOA 1N7ML 3TTYA 1JGDB 4MB3A 4BKTC 3P0GB 5D1QB 4Z78A 2XXGA 3BKYH 3WTYA 2XUWA 4YHLL 1M71B 2XVKA 3BPLB 2AMGA 5E6RB 3S48A 1SYVB 5CP3H 2W80C 4A7SA 3H85A 4PJAB 3NRPA 4X7SL 5CJXC 2BWDA 2DQJL 3LZFH 4HW6A 1TENA 2X9WA 1TITA 3WS3A 4X0KA 1S7UA 4P48A 1D5ZA 1PLGL 2Z65C 4NUQA 4MQSB 1G7MB 4S2SB 1JVLA 4ZPTB 1NC2A 2OJZL 3G7TA 4QRQA 3BEWA 5DJYB 3MNDA 1ZKAA 4E5XB 4JFPB 4LL9A 4Q9RL 3IWUA 3RVVD 4PG9A 2APWA 1XB8A 4ODHH 5AB1A 2YWYA 4M6AA 4CMMB 5KSBA 4LSTL 1I8IB 3U2SA 1G7IB 4PJIB 3G5XA 5E8EA 3VQLA 2W9DH 1CL7I 1FO0L 4LEOB 5HD8D 2VABB 1NMAH 3CHPA 1J48A 1G9MH 1FNSL 5EC2A 3EFDH 3N40F 1Q9KB 3LPGA 4ZDHA 4M4PA 4YUEH 2QHLA 3NZ8A 2X2HA 4MRBA 3W1ZA 3NFNA 5LKNA 1U3HC 3GMRB 3CSYA 2E74C 2UXFA 3C6LB 4RSVA 2DQTL 3BDYH 2HTLC 1RZPA 2I60L 3PU7A 4YOKA 4IBSA 4X6CA 3ABKB 5HGDB 3BH8B 4NO3A 3R4RA 5LHDA 1GXEA 2XBZA 3QFJE 1EHAA 1OANA 3EXLA 5AVZB 1MQKL 2WQRA 5EEWA 3OKDB 2QPFA 4MD0B 1B4JL 1BVLA 3LHPL 4OZFA 4WAFA 1QYGL 3KGTA 4JRYA 3LRGA 3FDWA 3E9TA 3AWFA 1MW1A 3QI9D 1SJXA 1YEWA 4WI0A 3WMPA 4XNQB 4Y1AB 5BUPA 2AV1B 3FB5B 4Y2DB 4BINA 4P2QA 4Y5VC 4ETQA 4P5TA 4QHLB 4TOYH 1OSZB 4A2EA 3PWUB 5LN4A 3KWUA 3ARYA 1EH9A 4I3RH 5BV7C 4YSSA 4P23B 4F7PB 4MB5A 2Y7MA 5EU3A 5BMFL 5ACZA 5D1XA 1LWHA 4N8CL 1GW6A 4LLMB 1MKFA 3J07A 1I31A 4GW1B 1KXQA 4I13B 1DVQA 3BAKA 4PLJC 1C8PA 3BZFB 1HH6A 4K9JA 4JY6B 2I24N 1HHGB 3N91A 1EFXA 4GI8A 5TE4L 3OLDA 1B3IA 2N1KA 4M6OL 4XN1A 4BSVA 4GLRI 2QTEA 5T1LD 4EI5C 4FQXD 3ZUCA 4ZSOA 3QFJD 1E27B 1SOKA 3ABLB 3FCUB 4GKNB 1YQVH 5MHSE 3GUTB 2FQEA 2QHRH 3CE1A 2XTJE 4XP5H 4JPQA 1ZIBA 3VWKC 1P0SE 1F2QA 1QNZH 4GMSL 5C2BL 3OAZH 4GRWH 4UIKL 3VFGL 3JQOB 2AZAA 3B9DA 2TRHA 1V7NH 1XGYL 2VQ1B 1FDLL 2YEQA 4YQXL 1AH1A 3VVVA 3KNBB 3LZPA 4FLSA 3FQUA 3SDXB 5HY9B 4PG2A 1S5HB 4JLRA 2FJFA 1UC6A 2I26N 3DPBA 3F85A 4MJ5A 5FYLL 2B9BA 1HX0A 2XWXA 3QEQB 4XVOA 4TUOB 4F3FA 3SE4C 3B83A 1MFMA 2UWEF 4JVWA 4QLRA 1CXEA 2MCG1 1OAYL 1MW3A 5A2BA 5TK4A 1UXLA 2QPDB 3I3DA 3SO3C 1P4BH 2DYRB 3S4SG 2YQGA 2AZUA 1MCQA 1NAMB 2QSCL 3OR7A 4WW2F 3U9UA 3KW7A 3O41A 4JPKL 1JGDA 3WIHH 4LVOC 1JNNL 5D1QA 1EVUA 1C12B 4FXKC 1Q1JH 4HBCH 1M71A 3D4ZA 4GUCA 5MHSD 5HDQL 2R29A 3C6EA 4WWID 1I3RB 1SJEB 3AMLA 3HZMB 1SYVA 1WWAX 3TN0C 4KITB 4L2LA 4PJAA 4KVNH 5I1JL 3MMEB 2ILLA 3FHQA 5FWQA 5IREA 4Q8BA 4JRYE 4MAYB 3T0EB 4KK8D 4OCRH 5C0DB 1ZLWH 1C8QA 3THMH 1G7MA 4S2SA 4ZPTA 1GCFA 1MZZA 4E9LA 4G3YH 5DJYA 3BRGC 2E27H 1R1CA 4Z18A 4Q52A 4HZLB 3NQKA 2B1AH 1BREA 4ZS7L 3VXUE 5E6SB 2HRGA 4E5XA 4JFPA 5B38G 4JQIH 4NN7B 3QZLA 2B2XL 4PBVC 1DLFH 4OGZA 4CMMA 4FG2A 4NYLB 1KCSL 4WW1B 5D7IF 2PXYD 1FGNL 1EX0A 1I8IA 4KDVA 1G7IA 1XR8B 4PJIA 4F8LA 1RUKL 2XDHA 3RDJA 4AEIL 4LIQE 4LO9A 5F9DC 2PW2B 3ZR5A 2RAMA 2UWEE 3BVXA 4YLCA 3CJJA 4LEOA 5DD0H 4WKZB 2VABA 3FO1B 3BVNB 5DF0A 4HKBB 1JV5B 1Q9KA 2OL3B 2WVTA 3M1CA 3B2VH 5DZOA 1ADQA 5AG9A 3SPHA 3F12B 3QI9C 4EDXB 4NXSA 4Z77B 5E1HB 4X9FA 1IGCL 3O11B 3GUFA 3BUYB 4G7SB 2Y1VA 5HYSB 4A2DA 1JVOA 4BFOA 4BK5A 1E5BA 3GMRA 3CHSA 2FQFA 3C6LA 4JPVL 2VO8A 3FQWB 3Q6GH 1SOSA 1WGVA 5HGDA 3BH8A 1IJNA 1JUFB 3HS0B 4JRYD 4QXTB 3NK4A 2FX8L 3OKDA 4MD0A 4XPHH 4ZOEA 2FQDA 1X6LA 2PWFA 2WYTA 1ASQA 2X42A 3ESNA 5CINH 2DTSA 3VSTA 5HHPB 3V0GA 4YHKL 5I8KL 3POHA 3BSGA 4OD2B 4P5TD 3Q01A 3DARA 4NRYB 2AJZB 3FUEA 4XNQA 4Y1AA 4B9PA 2AV1A 3FB5A 4Y2DA 3VMPA 3JWOH 4FG6D 4JFVA 1GKEA 1NIBA 1BJ8A 2IAAC 4QHLA 1OSZA 5D1XD 5D1ZB 2H6PB 5E2VL 3PWUA 3C5ZC 3UTPE 4P23A 4F7PA 1JXGA 3MV8B 1QLRB 4H20H 1PS3A 4LLMA 2CDEB 3RP1A 4GW1A 1HC1A 1J0ZA 2DS4A 3BZFA 3VD7A 5EBGA 4JY6A 1HHGA 3P2DA 3E2HB 1U8OB 4GUPB 2Y9RT 3MRFB 1E27A 2ENJA 4GKNA 3ML9A 5L0QC 2YRPA 3GUTA 2NZIA 1D7CA 3U1QA 2NY0C 3FYEB 2NY4B 1HQRB 3QCUH 4HPYL 4DQOH 3NPSC 1URZA 4WHYH 1BQHG 2EKSB 1UT1A 2IALB 4P3CH 4TNVF 2ICWB 1CC3A 2NR6C 2VQ1A 1EAJA 5IFJB 4O2EB 3KNBA 3SDXA 3HKZA 5HY9A 1S5HA 3GD1C 2JJSA 4TNWK 4KFZC 3LMJL 2XTJC 3UTPD 3QEQA 4TUOA 3GTNA 1JVKA 3MV7B 1A5FL 4M00A 3I84A 3WIAA 3RVTC 3CQFA 3V0IA 1NCNA 2FB4L 2JMRA 2KBGA 2WZ0A 3DX8B 4KK8C 1EDQA 2R59A 5J9PB 2N3JA 5A2LH 1NAMA 3DO4A 4PJ9D 5E1GA 1GKOA 3MUJA 1Q94B 2OCFD 4D8OA 1JAEA 3AS0A 2O93L 5C9JB 4OLUL 5FLVA 1C12A 4PUBL 5IK3B 3T5WA 1E67A 5IR1B 2PXYC 1AY1L 3G6JB 1I3RA 1SJEA 3HZMA 3OZ9L 4KK6C 4R26H 5GRYA 4FA6A 4XAKD 3P2TA 4J3XA 4UILH 5AYQA 3MMEA 4P3DB 1BVNT 1TJXA 1GL4B 1DFBL 4MAYA 1OT4A 4HKZB 5C0DA 4Y88A 3T0EA 3MCKB 3LNDA 1TZIB 1F6LL 1SXNA 5CCKL 4HZLA 3US9A 1IKFH 1YEHL 3ZUNC 1JZFA 3N6YA 3QPXH 2LR4A 1D5RA 3WSQL 5AAPA 4NYLA 5I75B 1BM3L 4WW1A 2NCMA 2DJUA 5D2LE 3OWRA 1LEIA 1XR8A 3OKMB 2FSDA 2MMXA 2PW2A 3EO9H 5AOKA 3EOTL 1ETJA 2Z8VC 5T3ZE 1W15A 2AXJA 4WKZA 4F7EB 1R46A 4QT5B 4TSBH 4OCXL 4YXKL 3OF6A 1CDCA 3FH7A 3UERA 3FO1A 3BVNA 1RERA 1JWMB 4XP9L 4HKBA 1JV5A 2OL3A 4NUGL 3I6GB 5EZOH 1KEML 3PWPE 3F12A 4CC4C 3HLKA 2FE0A 3C6LD 4D3CH 4E0RB 4YE4H 4P5TC 2EEDA 3JT2A 4XE5B 4EDXA 2X12A 4Z77A 2GSIB 3GFUA 3O11A 3BUYA 5HYSA 1K72A 1LP9B 4GI6A 3MCLH 4AIOA 4HJ0C 5E2TL 3FQWA 2I5YL 4MCYB 3VG9C 4FQ2H 4K3GA 4M8QB 1YYML 1JUFA 3HS0A 1UA6L 3IPEA 3K2KA 4QXTA 4JFXB 5ISZE 5I1HL 3CVHH 2A5UA 4WW2C 3QQ9D 3ARQA 2VN7A 1E8WA 4HP5A 4AMKH 5FIEA 4Y2DD 5AZ2H 1JRHI 5IVNA 5HHPA 2WC7A 1F00I 3WUZA 4OD2A 4NRYA 2AJZA 4J3BA 1JF6A 1NTDA 1RZJC 4K5LA 2VXQL 2RA1A 5JORB 1A25A 1DR9A 4YVNA 4B27A 5D1ZA 2H6PA 5T3ZD 1QMUA 3PG2A 1S7QB 1MAML 1T7XA 3SBQA 4ELDA 1QEWB 4FFYA 5TGBB 4L0PB 4K3EL 2YEZB 3MV8A 1A7BA 1QLRA 2Y07H 3ZYOA 4EZJA 3ZSTA 4WNQB 2KERA 5EF1A 2EDFA 3PWPD 1VERA 2CDEA 3C2AH 1Q0EA 5C0JB 5DJXB 1HI6B 4NZFA 3X3FH 1CGXA 4ZTPH 1W72L 1RH8A 2IWGA 3AAZB 1R3LB 1H15B 3L45A 3L1FA 1U8OA 1KN4L 2X4TB 4WEBL 3SE6A 4GUPA 3MRFA 4PJGB 1C16B 1XSIA 3S97C 2O5ZL 3O2DL 5HSFA 5LDUA 1KDIA 1N10A 1OAQL 1TTFA 1G0XA 2QTVA 2J6EL 3QHZH 1B4LA 1HQRA 2DQFB 5JHMA 3TONA 3ULUF 3BFOA 3WBDA 2P8MB 2WIMA 5AFAA 4P8QA 2IALA 2EKSA 4G5AA 4KZ0A 4PJ9C 2ZWKA 2ICWA 2P52A 1KBVA 1DANT 1ZANL 3QEQD 4IOFC 2C8NA 4NAQA 5IFJA 4O2EA 3BKJL 2CCVA 3U2JA 4OCLC 3S5ZA 3UP6A 2EIBA 3S3JA 3MV7A 3LPWA 2YXVA 1QSEB 3IGLA 2Y0SA 3PJSB 3WIIH 4AE1A 1GYWA 1IGIH 3GJFB 4KTDL 3DX8A 3MXWL 3Q44A 1OAKL 4FDWA 5J9PA 5AVSB 4XPAL 1K6QL 3NCXA 2CGYA 5F7EH 4NI3A 2J1KA 4TLKA 1Q94A 4AUYA 1HAUA 4LGPB 4M7KH 5C9JA 1NBVL 4NOFA 2Q7YB 3HI6L 1WGOA 4JBSA 5T1KB 5IK3A 4QGTA 5IR1A 2MTPA 3PQYE 3U1SH 3G6JA 4AITA 3T0ED 5AOZA 4N6QA 3VGEA 1TNNA 1KB3A 1UJ3C 4P3DA 3GXFA 4ZXBD 3B8SA 1QFPA 3SYAA 2BZCA 5HHOB 4KXZI 2JJTC 4HKZA 4Z23A 4P9HL 3MCKA 2NXZD 1TZIA 3BP5B 1CCZA 4JO5A 2PO6D 2P44B 3FYIB 3NA9H 2D7OA 2AXHA 3H2PA 1AXIB 3PY9A 3B2UD 1JGUH 3LQZB 3MLZL 1CXHA 1U8KB 4JO4L 1RZKH 4QO1B 3ZTEA 2VZ3A 4XCFL 4A2MA 4LRNL 5ANME 3OKMA 3FU8A 4IOIB 2CKNA 1DTUA 4ODSL 1NAKL 4W9HC 3EF7A 4F7EA 2QSQA 2EZ0D 4P5RA 4QT5A 3QQ9C 1A0QL 4ZOAA 1OHZA 4MD4B 3KL0A 1JWMA 4OKDA 1XQ4A 3I6GA 4E0RA 5T3XD 3FTXA 3OAUH 4HCRA 2DQUH 2YEVB 4FQHB 3WNKA 1SEBB 1TETL 3Q2NA 1ED3B 1LP9A 3TJEL 2HFFB 2F8IA 4NENB 1UENA 4OSUL 1F97A 1B9KA 3PJLA 4MCYA 3VI3B 4M8QA 2HZHA 3Q7JA 4I3SH 4JFXA 1FSKC 3RY5A 4V1DE 1Y1DA 5F9JB 1DQML 2BNRB 4PMEA 3ZE0E 1M1XB 1X4ZA 1WZ1L 4ZFZB 1KBKA 4JZJB 4ZUUB 3VTMA 4EKXA 1HKLL 1ILUA 3JVGC 5EDXA 3ULVF 5F3BB 2NY5C 4IDJL 1CQKA 4H8WH 5JORA 4UMGA 4S1RL 1S7QA 4HIIB 1QSVA 1QEWA 5TGBA 3BD5A 2YEZA 1LHZA 2WYHA 2EDQA 2UX7A 2OQJB 3MVSA 4WNQA 1PPIA 2IGTA 5BW7A 5C0JA 4KKZA 2VUYA 5DJXA 3BYYA 1MFBH 1HI6A 1M9WA 2ADIB 3AAZA 1R3LA 1SOQA 1H15A 2VL4A 3QCVL 3NACH 5F7YC 4W9EC 2IVFC 4HCGA 2D2CC 3RZCB 2X4TA 2NY4D 3CIQA 1J0JA 5IBTL 4PJGA 3VGAB 1C16A 4V1DD 4HWEH 5E99L 3ZK0A 1MELA 2DQFA 3RDTD 1FFPB 1HYRC 2CHDA 1H3XA 2P8MA 3I6SA 1PSKH 4NC1E 5AB9A 3MA7B 4X2UA 1YEKH 4IOSA 3T0DA 2WXPA 2X09A 3OGOE 3MV7D 1NMAL 1G9ML 3P30H 1E5UI 1UWYA 2Y36L 1BXUA 3OBAA 4YUEL 1I7RB 1QSEA 4GS7C 4G8GE 3PJSA 2VZOA 4U4IA 1HYSC 1AANA 5CUSL 2A4ZA 3GJFA 4ZXBC 5A16B 4G6FD 3TA3D 1ZLEA 3BDYL 2NXZC 2YD8A 4GG6B 5HHME 1IZJA 2PO6C 2YFNA 1KACB 1N6QH 1AQMA 3D18B 3EOYG 2IAMB 3GS7A 4BRVA 3QJTB 2Q7YA 1A7OL 5T1KA 1DVFC 3QUXC 2ZE0A 1NFDF 3SPVB 5IMLB 4KX8A 2JIXB 5C6WH 1XEUA 4Z7VF 4HEME 2CJUH 1A14H 4JZNB 1FPTL 2EZ0C 3SJVE 2P9RA 5DURD 3V4VH 5HHOA 4F57L 5DS8B 2MTAA 2ZOUA 5I0VA 5HJ3B 1IFGA 1KBPA 3NEEA 2NSXA 3BP5A 1MLBB 3I50L 2XYCA 4TOYL 4JPIB 2ZYSA 4XBPB 2MKLC 3MV11 5HGBB 4ABQA 1N26A 1EO8L 3FHEA 2W0KA 3LQZA 4HHWA 4HK3J 1E65A 1U8KA 4X6DB 1LEGB 1L5GB 1SLVA 5IUCA 4QO1A 1H8OA 1F90L 2XZAL 3WNMA 1A6WL 3K7UA 4ZS6D 1ADQH 1SVZA 1E8YA 4IOIA 2BX5A 4UT9A 2YRLA 3D85D 4X9BA 5DHYB 3HUJF 1KY7A 1AXTL 1PG7W 4LLUB 3CXDL 4MD4A 2IOOA 4JFZH 1DJZA 1NLDL 4MNQB 5DC0A 4HMCA 5DD3L 1YQVL 4ADGA 3DOIA 3FH8A 4FQHA 1I1FB 1SEBA 2ZPKL 4M6MH 3ZXAC 1ED3A 2XQYA 4LSVH 2HFFA 2V7HB 4NENA 2VM9A 1CTOA 4KKBD 1P4LB 1V7NL 3BVTA 3VI3A 5L4JA 3SJVD 4JGUA 4XNBA 4WEUD 3JXAA 4FQQB 4PRHB 5AVRB 2ODIA 2G3XA 2XY1A 5F9JA 1H5BB 2BNRA 1MCOH 2VDKL 4KQ4H 3LIZH 1M1XA 1RSYA 4ZFZA 1UT9A 3B9KB 4JZJA 4ZUUA 3UP1A 2VM4A 4Z7QF 5KYNA 3BVWA 3UBXB 4B41A 3O2VH 1HESA 5F3BA 3LKPA 1EZVX 4GAYB 4FZ8L 4J3OG 4KRLB 2BDNH 1F3DJ 4PN6A 3N9GH 2AGJH 3A22A 5JW3L 3EOAB 4FP8H 3UJIH 4TM9A 3HUJE 4HIIA 4JRLA 2HFTA 1MWAL 5JXEA 3LDBB 3RDTC 2DIEA 2OQJA 1KTBA 4U6VH 3RNKB 4ISVB 4OVVA 1J9CT 3KPPB 2YXWA 4ANVA 4F2MB 3WTVA 2BY0A 4OD3L 3NT0A 4OGXH 3GI8L 1I53A 3W5MA 3IT8D 3G6DL 3PUCA 4JJ5B 1J86A 4N0RA 5CU9A 3KPSB 1O9ZA 4L37B 3ES6B 4QOKE 4ACTA 3RZCA 4OCRL 5EUOF 2Z8WC 4KUCF 3THML 4E9RA 1T21B 3K8LA 2H26B 4X5LA 4G3YL 3ZTJH 2E27L 1NCDH 1J1OH 2VR7A 5CSGA 4LF3B 1U3NA 2NLJB 2NSMA 2VJ8A 4J23A 1YECH 3WENA 2A38A 4WNJA 4IOSD 3CK0L 1FFPA 1UB5B 4QNPF 3TA3C 2YD1A 4L3FA 5F0MB 3EGDB 3MA7A 1UASA 2HTKC 4XWGL 3BUTA 3IJ9A 4UAOB 2FLMA 2FK9A 1MCWW 2XC8A 3RJQB 3CSTA 1G5AA 3WTUA 2DEYX 3B2VL 4WJ5B 4G7VH 4NP9A 1T7ZA 2FEDD 1DBKL 1I7RA 3AGVA 1JNLH 2HVKB 3RE0A 3MLVH 2BZ7A 5FOJA 5F9WB 5A16A 4DZBB 4NM4H 1D3CA 1IC5H 5T1KD 4GG6A 5I75C 4S0HA 2OZ4L 2W1NA 3VI4B 2NMSA 3D18A 2IAMA 5AYUH 2XX1A 1AMYA 1BYOA 4R96B 4J6RL 2GVYA 2V0AA 3HTLX 2GJPA 3HG5A 2Z3FA 2GABA 3SPVA 5IMLA 2VQUA 3AFLA 4ZS6C 1KBGL 1IGMH 4Y5XC 3BZEB 4HAFA 4F27A 4M5ZH 4JZNA 1CDYA 3NCEB 3WO3B 4XNZC 1RUPL 4DUWA 3M8OL 3JWOL 3CLEL 4TMPA 5DS8A 5HJ3A 4A2LA 1IRAY 2HP4A 2KZ1B 3T3PF 1MLBA 1DL7H 3SPCA 4JPIA 4M56A 4XBPA 5HGBA 2FH8A 3D3VB 5HP5A 1OLLA 5KS9F 4X6DA 7PCYA 1LEGA 1L5GA 3ZQWA 3OJ2C 1L9NA 3UAFA 2O1AA 2OL3H 3E6FB 1EEQA 3L5XL 5DHYA 2Z93B 5I9QB 4LPXA 4LLUA 4U7SA 1RKRA 1VFAB 4WI4A 3FRPB 4WWKC 5AW2B 4MNQA 2NY2B 1XZ0B 3AQYA 3TEUA 2VO5A 1B9ZA 1F1DA 1CK0H 1G6RL 1I1FA 1QBML 2V7HA 3GHPA 3ABMB 4Y1TA 3MRJB 1Q0YH 1G1YA 3HN3A 2BNRD 4KKLD 4HJ1A 3ZL4H 1DQQB 1P4LA 4N0FB 3QZPA 1HZLA 5GZOA 5D72H 2VR5A 2CIKB 2Z0BA 4FQQA 2X6BA 1FP5A 2V37A 4PRHA 5EBMB 4M93B 3QEGH 1H5BA 4R2GD 4FEMA 4YDMA 1I7UB 3T3MF 3S37X 4JHWH 3B9KA 2J1ZA 4P2YA 1G4MA 1NIFA 4JNXA 1M42A 1NPUA 1ZOXA 2YKKA 2CAKA 4O9HH 4Z95H 3UBXA 4IKIA 4FFYH 3VXRB 2WXFA 4GAYA 4JKWA 3RWHB 5JXED 2HJFB 3BSZL 4I0PB 4PJDB 2X70A 3RFZC 1A4JB 3EOAA 1IAII 1W0YT 5FLUA 5I0XA 3A6CH 1JD7A 5KAQF 4UV7H 4JB9H 4PRIE 5A7BA 1HS6A 3RNKA 2IPKB 4ISVA 3GTTA 3KPPA 4CBZA 4HPOL 4R26L 1CIDA 4ERSL 2QVFB 4F2MA 3RZCD 3GNMH 4N2LA 3RI5K 3IMWA 3KDMB 4HJUA 5FGBC 4JJ5A 1TZAA 3SBPA 3KPSA 4L37A 3RWGB 3ES6A 5FYJH 4KMTL 1OB1B 4XVTL 3RIFK 3WJJC 1T21A 5IM7B 2H26A 3VD5A 2E8ZA 2FEDC 4MAUL 4LF3A 2NLJA 4AEHH 3QPXL 5DQ9B 4Y9GA 4HGKC 1TEYA 4GFTB 1UB5A 1E2VA 1UXMA 3EGDA 1CFNB 1IQWH 3RX7A 1ZV9A 3IDUA 3O6ML 2NDFA 2FR4B 4K9EC 4F9PA 2XPZA 3KR3H 4ZD3H 2QPSA 2XX0A 2DYSB 1HINL 1E4HA 1EEZB 5MI0B 5JIIA 4UYPA 4WJ5A 3FTGB 4D3CL 4NC0B 1CN4A 2HVKA 4PRID 2I27N 1KOAA 1TIUA 1MWOA 4DZBA 1V5JA 1BDYA 4RETB 5ICYB 1E42A 2Q76B 1AYRA 1VB9A 4M7JH 1LL1A 1FAKT 3VI4A 2JIXD 4HLZH 5DZJA 3SGDH 3TEWA 1KB9K 4R96A 5FUCE 3NCWA 3NZSA 4EBQL 2R0LL 2WXKA 4HXBL 3FFDB 5C0IB 3BPNC 3GK8L 1ULVA 3IMBA 3BZEA 3TU6A 5ICUA 5EOQH 1CXLA 2JKLA 1SDAB 3PP4H 4K73A 4B60A 4XODA 5EEXA 2BK8A 4UTBH 4MMZB 2IPTH 1U93B 4AKPA 4PP2B 1A22B 3D3VA 1NOAA 1U58B 4HIXH 1OTUD 2LU4A 2J12B 1EAPB 3R8QA 4KDTA 1HWGB 4KKLC 4UOW1 3ILQC 1SLWA 3E6FA 4FL4C 3WMSA 1KWGA 1NSNL 1VENA 1FL6B 4Q74A 1MREH 4MNQD 4HCRH 4ZTPL 2WKLA 3LS5H 2Z93A 4R2GC 5GRVK 4HCIA 3TCXA 1VFAA 3MFFB 3FRPA 4HK0B 1MJUH 2KQNA 1DDTA 3OQRA 1NCGA 3QUML 4G9FE 3L5HA 1XZ0A 1WUZA 4QJ3B 4H0IA 4ZFGH 5CGMA 1AKPA 3QHZL 4OJYA 5JIHA 4BELD 4I89A 2FX9H 4UDTB 1DBML 5JXEC 1I7ZB 4HQQH 3MRJA 1NBYB 1DQQA 2J8OA 4GRMB 4N0FA 4DN3H 3ERXA 1SFDA 4LVHB 3B9KD 2CIKA 4XTRD 1I9JL 3N1PC 2WZ5A 5EBMA 5DR5L 3PDGA 3UH8A 2V6HA 4Y16B 4IK7A 4CC1A 1I7UA 4U1HB 2QT6A 3UTSE 1NEZB 2EH7L 4YSDA 1ITCA 4FX5A 2G9HB 3KYNB 5GS3A 5D7SH 2ADFH 2V8MA 1X9UA 3WIIL 1NC4D 5IT2H 1IGIL 3PNWB 4FD0A 4KKNA 3VXRA 1B4RA 3D4GA 4GIAA 2X05A 3RWHA 4TNWF 1EK3A 4YK4B 3U9PL 2HJFA 4I0PA 4PJDA 5F7EL 1A4JA 5B1JA 4M7KL 5F1OB 1ILSA 2BY2A 5IY5B 1SJHB 3VWJB 1QSFB 2IPKA 3ARZA 1X3DA 3U1SL 2L7EA 3MBXL 3TL5A 4EXKA 2WLZA 4DPAX 2VMFA 4J3TA 2XN1A 5D55A 2FBJH 3RWIB 3KDMA 1JZ7A 2MKWA 1OCZB 3RWGA 2YD0A 1OB1A 3K4AA 5JPMB 4QXVA 2ZWYA 5AW8B 1LYQA 5IM7A 3MNZB 5AVQB 2VXSL 4ZQTA 1HILB 1RXLA 4IYKA 5KYUB 3RX5A 4HMDA 5DQ9A 4LU5H 2MOVA 3ZT7A 1WD9A 2GI0A 5IQ7L 1LVEA 3UTSD 2APXA 3SYCA 4P2AA 5IHUH 1KTCA 1CFNA 3KXFE 4QRFA 2V5TA 3D3VE 3BPOB 1AQKH 3QT2A 2YD4A 2W88A 2FR4A 4DVRH 3GJFH 5CR1A 4GAGH 3FTWA 4XNUH 1EEZA 4ZTOH 2HH0H 1UD3A 3FTGA 4MQXD 4GRLD 2IMMA 2NY6B 2E8YA 5AZEL 1A47A 2DQUL 3MUY1 5CILL 1JMZA 3CZLA 3EH2A 1ZV5A 1F56A 2RHEA 3EYSH 5ICYA 2Q76A 4CDGC 3W0WB 4I3SL 1JD9A 5KVEH 4OD1H 3TWCH 5E8PB 4WV1B 3MZGB 3FFDA 5C0IA 4OZIF 1ET5A 4G6MH 2R0ZH 3O3UN 1P2CB 2FD6L 4K07A 4AEFA 4M62H 4IGBB 5A2AA 1TTBA 3KVQA 3CVIL 1I8UA 4OCSL 2VE6B 2ADGB 3KXFD 4KY1H 2HJKB 4Q9BA 3TNNB 4J4PC 3RJDA 3D3VD 3SDDC 5I8OL 3H8NA 2OYMA 4XXWA 4MMZA 1BBDH 4DSYA 3C2SA 1U93A 4PJ5B 5CJBA 5FUCC 4PP2A 4RFNC 3ZDZE 1BEXA 4F5CA 3PWLB 5E9DB 3K2MC 4LLYB 4UT9H 1U58A 2K45A 4BKSC 3UAJC 2UZPA 2X9XA 1EAPA 4GSDH 3OAYK 3FK3A 3KEHA 4KWUA 3FT9A 1QATA 1CIUA 1TU2B 5GGVY 1FL6A 1MFBL 2JKIS 3B9KC 5FW7A 3FBQA 2NY2D 5C1MB 3NACL 5F7HA 3EH1A 3MU3A 1S6NA 3QWNA 3MFFA 4E2OA 4HK0A 1EHLH 1G9EA 1YEEL 4N0CD 3Q43A 4XH2B 3F01A 3NCJH 2APBA 4HWEL 1KV3A 3O8XB 4JPWH 1SLXA 2ROXA 2UY6B 2AJVH 5AOLA 2UY7B 1RJLB 2GCYB 2FRGP 2W92A 4UDTA 2QVTA 1I7ZA 3B7UX 1NBYA 3MRGB 4GRMA 1O6SB 2VTFA 1YEKL 1XCWA 5DZAA 4FA8A 1U8NB 1JTPA 1PLBA 1WCBB 3L1EA 4Y16A 4LPTA 1M3JA 2FGWL 4U1HA 5F7UA 1NEZA 1BZOA 4JGJA 2AEPH 1A6UL 2G9HA 2WLJA 2ZUVA 1MCBA 3KYNA 4I0PD 5ESAB 4I18B 4J12A 4G6JH 3PNWA 4R7LA 1A9VA 3L4CA 3AS2A 1NFAA 1QG3A 4R0LB 2H1XA 4HD5A 4TTDD 4YX2L 3ARPA 2R29L 4H4NA 2OJEB 4APQC 3ZBMA 3IU4L 4XBMA 3I75B 1N6QL 2QVKA 5D7LB 1QUNB 5TJWK 3BQUD 3WOVA 1ROWA 1SJHA 3VWJA 3VD4A 1QSFA 2K4WA 4DGUA 1UFGA 4F9PC 1YEIL 1CFBA 2BRQA 2CO4A 2XWBB 2G4GA 3RWIA 1MFEH 3QAZC 2CJUL 3BAJA 3STZB 3VFUB 2QQKH 2GJZB 4O58H 4PB0L 4TKWA 5JPMA 4YNYB 2HMID 1PY4A 3S36X 3MNZA 3QG7L 4ZX5A 4MQXC 1JXDA 1GGIH 2LE9A 1SFHA 1HILA 3BP4B 4GRLC 1LM8V 5KYUA 5JIDA 2BOBB 4GY4A 3I2CL 1BWMA 2ZUSA 4TPRH 2WXRA 3FONB 2YAMA 2DLFL 1RJYB 3QNZB 5LCVA 4QRUB 4F5CE 2GBVA 5DUPL 1ID5I 1W9XA 3CPUA 1ADQL 4L5FH 4HUVB 1PG7H 3GXNA 3V9EA 4IM8A 1ACXA 1PF3A 1QW9A 1T04B 4N2BA 3EFFB 1X6NA 1AFVL 1W80A 2JTYA 3N3EA 4DEWA 3P3RA 3MSPA 2EAEA 3CBJB 5PCYA 3A0OA 1C7SA 3HNSH 4JFZL 5J11C 4LSQL 3M45A 1XTMA 2M26A 3MTXA 4QXGH 5IFHH 1KJ2B 2B77A 5I1GH 1OCCB 4LSUL 1DP0A 2RALA 4HS6B 1DQIA 1KB9J 4PIRF 1YCSA 2F2HA 4Q6IC 5TFSH 3ZGHA 4F2EA 4UQBA 4GI9A 5B1CA 3W0WA 4M8UA 3HMWH 5DUMH 2COVD 1BF2A 1MRCH 3NSCA 4KQ4L 4WU5B 1MCOL 5E8PA 1I4FB 4WV1A 4IMKA 3RRQA 2P1YA 2YKLH 1P2CA 1VGEH 2DI8A 1HNYA 3C8DA 1PZDA 4IGBA 4YC2B 6TAAA 4OCWH 2BY3A 3Q6FB 2XQBH 2VE6A 4Y7MA 4UT6A 3RL1A 2ADGA 2DOCA 2X6CA 2HJKA 5KW9H 1RK7A 2IADB 2LT9A 3TNNA 3TZVB 3F3HA 4RRPA 2BDNL 2HFEB 4R7DB 5T3ZL 1Y0LB 2OK0L 2AGJL 3QSKB 1G87A 2K70A 4N0CC 3QH3B 4PJ5A 3AG1B 4WI8A 2GC4C 3PWLA 3C87A 4LOUD 4LLYA 5E9DA 3FN0L 4FNLH 1T20B 1QHOA 4MMXB 5BRZE 7CGTA 2YPLE 1KYFA 4OGXL 4AKOA 1TU2A 5K93A 3ALWA 1GS6X 5F7FA 2GIMA 3OGCB 4JG5A 4YH6A 1VEPA 5B3NA 2J2ZB 1ZTXH 2NY5L 3ALXA 1MNUH 4QHMB 2D31B 5CGYC 2HT4D 5BRPA 2VXUL 5DT1H 2F5AL 4B0MB 5KZCB 2VYRE 5ICXB 3GRWA 4YHZH 3IDIB 3DKHA 1JZ6A 1NCDL 2GJJA 4L4JA 4XH2A 5CZRA 5GGVL 2EECA 3O8XA 1H6EA 2AI0L 3DGGB 3PXJA 4XHQA 5L2KB 2UY6A 3OKOB 4ODVH 2UY7A 4HOZA 1RJLA 3BLPX 3DYMA 2GCYA 4KRMB 4WI6A 3BN3B 4KK9D 1NCHA 4TTDC 2P5EE 1QWHA 1L6PA 1TMQA 2EDXA 3FT0A 1WHPA 2P80A 1O6SA 2QDWA 3MRGA 2PF6A 4GQRA 4N2MA 4Z7NF 4Y4HD 1GJIA 4LVNB 4LL1A 4OFVA 1U8NA 3BQUC 5CLZA 2DH3A 3JVFC 3QHFH 2NNXA 1WCBA 5E1IA 1IL1B 2R69H 4TSAH 4TF4A 4RWYL 1T6VN 1K8DB 1DVZA 3X1NA 4MBOA 1PX3A 4RSYA 1NAML 5T5FA 4ZMXA 5ESAA 4I18A 4UYQA 1R47A 3ECUA 3PFUA 2CJSA 3IYLW 4R0LA 1PLAA 2D7TH 5D96C 3VFMB 5E7BA 2XIBA 4Z6AT 1IC5L 2EUVA 3VWJD 2OJEA 2VDMB 3I75A 5D7LA 4J8QA 1QUNA 1EWHA 1ML0A 2GHZA 3HBPA 4YL9A 4DP8X 1FNHA 2B3IA 1HHJB 2MPAL 3KPRB 5F1NB 4WUKH 3W0WE 5FYKU 1IGYB 2X1PA 2XWBA 2MCPH 4OLVH 3TOPA 1AO7B 2BJMH 5DZLA 4DTGH 4QYOB 3J2PA 4WY7H 2FT7A 5LAPA 3STZA 2P5ED 3VFUA 2GJZA 3V0WH 1J7VR 2HLAB 1Q72L 1U8LB 1ZLDA 4YNYA 4EUPB 2ZXWB 3VUAA 1JZ4A 1VCAA 3BP4A 1SUHA 1RIVH 3M17B 2BOBA 3LH2L 1E3ZA 2Y23A 4FLOA 5I28A 1WAEA 3ZVVA 2PNDA 3FONA 3SGDI 3SGEI 3LNHA 3QNZA 1RJYA 4QRUA 2OL3L 4KRPD 1H3TA 2V5SA 1RIUH 3DHUA 4HUVA 1QFHA 4LGRB 4WJKB 2VZUA 3GKZA 4PJBF 1T04A 3EFFA 1IGFL 4AYFB 3KLLA 3MLXH 5F89B 1G7HB 2OXHB 3CPLB 1BEYH 3RAJH 5HDBE 5T3XL 1K2DB 1THCA 4S1QH 1KJ2A 3FW6A 1JHTB 4QXUL 4JG0L 5LNGA 2Z6FA 3SOBH 3W0WD 4HS6A 1ZEAH 4NQUA 2HA1A 5A6LA 3S37H 2XCMC 4KVPA 3DJZA 4TVPE 3QISA 3ZKND 5D72L 4YIQB 3PRZA 4LOUC 3QQDB 3T2NH 2DD8H 4WWNA 4WU5A 4IGBD 4F7TB 1I4FA 5C0RH 4QAMB 1BIIB 5C0CE 5SWSE 3QIWB 4YSRA 4RGNB 1DO5A 3NSJA 4KPHH 4ANXA 4QWWD 3P9WB 1TOXA 1GH7A 2C3GA 4I87A 4MSWB 1MFUA 3Q6FA 4FFYL 4K55A 4PJ5D 1KXVC 5CN1A 1RULH 2IADA 3TZVA 4BYHA 2HFEA 4OJFH 1RUAL 4R7DA 1Y0LA 3FN3A 1GY2A 1TPXB 2X10A 3DTUB 4LMQI 1F18A 1UOKA 3QH3A 2I7OA 4DP7X 1GA2A 1D5XB 1XCXA 2EUZA 1URIA 1SM3L 5I19H 4H8UA 5DMGD 5I15H 1T20A 4MMXA 3GBNL 2DBJA 4XNDA 3PWNB 5D6DA 2FNBA 4AE0A 2FGZA 1D9KD 4Y4HC 3OGCA 5FC9A 5CFAA 1F4XH 2J2ZA 2DMHA 3C8HA 4QHMA 1ZHKB 1G5GA 2D31A 2NY7H 2XWZA 4F15B 3P11L 4J3OD 4TVPD 3L9RB 3LTVA 1L0QA 3DSFH 5ICXA 5JA8B 2MQCA 4ZMNA 3IDIA 2VLLB 2C9RA 3E9UA 4ZOCA 5K9QG 1QEXA 4PRPB 5A7EA 5DYOB 3U4BH 4YSPA 1X5KA 3DGGA 5L2KA 3S3BB 1V3MA 3OKOA 1H19A 3D50A 5IMKB 1PU0A 4OFYA 2AP2A 1J8SA 3OSVA 4Y19E 4XXDB 1IQWL 4KDWA 4O02H 2JTDA 5E5RB 1JCVA 1N4XH 1A7NH 3TCLB 2Y7NA 2FLRT 4FLQA 1IL1A 4LKXB 4LE8A 1K8DA 4RQQB 2M83A 2WWNA 3CBRA 5AKTA 1ZK9A 2VQ4A 4GAFB 4G59C 4DKEH 5JNYB 3Q5YA 3MV01 1S8DB 2Z92B 3VFMA 2WBJC 1CD9B 3UBHA 3BKML 1UJTA 3KM1A 4L8SA 3MGTB 2AJXL 2R23B 4EN2A 2IFFH 4DGIL 4WNSA 2BS8A 3KEDA 4KHTH 3PDDA 1HHJA 2VLRB 3KPRA 4UQCA 5F1NA 3F64A 1IGYA 4CGUB 1FG2B 4KRPC 3LSOB 2XKUA 2HRLA 3LB6C 3K6DA 1AO7A 2E76C 4IBYA 3PP4L 1XSJA 1CDIA 2CG9X 3FS9A 4QYOA 4Y19D 1T83A 4OTXL 4PS8A 4A2FA 2ISDA 2QR0B 1MIEH 2B16A 4IBZA 2HLAA 1U8LA 4EUPA 4ANUA 2IPTL 1RHFA 3M1BB 5JIQA 3Q8CA 3M17A 4AQEB 2E7MA 3E3QE 3HC4L 3TYFB 2VGLM 2Z0UA 4YHIB 5SX4H 3CFIC 2X6UA 2F5BH 1F3RB 1JGEB 1MHHB 1U8MB 3AC0A 3ASOB 2NY3D 5HI3D 3L8QA 3AITA 5EZLB 4IQHA 1JPFB 3WXVH 1TVDA 4AYFA 1TQWA 1TJGH 3QULB 5F89A 1G7HA 2OXHA 3CPLA 1NCBH 2YPVA 3I9AA 1MJUL 2HX9A 3CAFA 5J1SC 1K2DA 1R17A 3AWGA 4AGPA 3K8MA 1JPST 1JHTA 1BXVA 3LX9A 5CZVH 2VLME 5AVWB 5TK2A 1CLVA 2ZUTA 4GBXB 3IMSA 2L8AA 3AG3B 4WFHE 4XP1H 1G4RA 4HD9A 4N2NA 3TO4B 5KEZA 3D9AH 4Y5YB 4DN3L 3V7MA 4YIQA 1MAJA 3HG2A 1KF9B 2BW5A 5HJGA 3QQDA 4UQ9A 2KH2B 4GIOA 4F7TA 5JUEL 3CU7A 3B3BA 1BIIA 3QIWA 4YSUA 1K5WA 4H26B 4KGLA 3TZVD 3W11D 1D9KC 4QHUB 5D7SL 4MSWA 3GBMH 1OXYA 4MNGE 4J3OC 4FNRA 4B5ZA 2R9HD 1NL0H 1PKQE 3K6OA 4NNYB 2K6ZA 2N7SA 2ZQKA 3UTQB 3GI9L 3QR2A 3F04A 5C6TH 4AL8C 4OCNC 1D5XA 3L3IB 3WI9A 2ERJC 1DVYA 4K7PH 4XMPH 4HSQA 1Y7VA 2VLMD 3PWNA 4FXGB 1OAJA 5IKCB 4F8PA 4NKDB 4OB5L 3NIGE 1VFMA 1ZHKA 5JIPA 1UB6B 1ZSDB 3LCYA 4MQ7B 5JOPD 3L9RA 5L2KD 1NICA 1AXSB 1GW0A 1AO7E 2VLLA 4N85A 3BT2L 3GB7B 4PRPA 3RGBA 3RNQB 4BXVA 3U7YL 4ZMPA 5DYOA 4I8DA 3RI5F 3UGXA 4RCAA 4ABWA 3BDXA 4ZODA 2YAPA 3HN5A 3FTZA 4H8VA 5IMKA 5E8DL 4ATWA 1NFDB 1MQ8A 5IHUL 3RIFF 3CHXA 4XXDA 5I8EB 3L5IA 4Z7VB 1MOEA 3H9HB 4PU2A 5LXGH 3QVAA 3D52A 1EXHA 3NIFF 4MQTB 4LNVA 3V0JA 3TCLA 1FQ9C 3CN4A 4LKXA 1SQ2N 2FEEI 4RQQA 2A6IB 3HVDA 3NZHH 5F44A 4QHPA 2J1XA 3QYNA 3MV9B 4TQPA 5EZJB 1WBZB 4YPGB 1EZVY 5JNYA 4LP8A 1U8CB 1PVHA 3ZDXB 1S8DA 2Z92A 3EYSL 1L3WA 2A2QT 3PV6B 4MRCA 3MGTA 1H6TA 2R23A 1UTDA 5KVEL 1GC1L 4OD1L 3TWCL 5DMYA 4FQ1H 1AO7D 2C3WA 5HBBA 1WBXB 4ES8A 2CGRH 1IC0A 3UO8B 4XVUD 1FJ1B 1Z9OA 2EIKB 4UUJB 3S7GA 1FG2A 3JWNG 1AS7A 3LSOA 4KBPA 2NY3C 5HI3C 2JWYA 5CEZE 4FKEA 1U95B 4PCKA 1VLXA 1JI2A 2EVJA 4RGNE 2QR0A 1RI8A 2F8OA 4YAQB 4R4BB 5JLZB 2BRRL 1BBDL 5LCVH 3M1BA 4AQEA 1QBLL 3NIFE 4D7BA 1TQSA 2IXQB 3TYFA 4UT9L 3DVNB 2VDPL 4YHIA 2YMXH 4IU2B 5D7KE 4GSDL 2YAFA 1X5XA 4PSPA 5AG8A 1JGEA 1MHHA 2JKSA 3EBIA 4Q4EA 1U8MA 1R19A 5EZLA 1JPFA 2CRMA 4TQEL 1JZ5A 1LO2L 5E2WH 3QULA 2ZJSH 2ZICA 1M6OB 3A67H 4H25B 3DBSA 1LQBC 1ZVSB 4OIFA 1EHLL 3E3QC 3PGCB 4RRPM 1VHPA 4AYBA 3W11C 3TT1L 4ALAC 3BESR 3OXRB 3IRPX 2IG2L 4FZEH 3JV4B 4DEPC 4BWUA 3PUUA 4GBXA 1BQKA 4F7MB 5IV2B 2R9HC 2UYLB 5CEZD 4MA1B 1X5FA 15C8H 3TO4A 3SGKC 4Y5YA 4DO6A 4DQAA 4RGND 4XNYH 5DFTA 4PV1C 4Z1PA 2YOCA 3NJHA 1FCCA 3TXAA 2XYBA 2NUTB 3QFGA 5EUOB 4UT6H 4CMHC 5IWLA 3D8MA 1F4AA 5DO2D 12E8H 2BPBA 5CJQH 4BFGA 4U3CA 4Y4KC 4DVBB 2V8LA 4H26A 4YSCA 2AEPL 1D5BB 5IGXH 2YMTA 4QHUA 3KGSA 2EKJA 2CKBB 5D7KD 1E9QB 4G6JL 3TIDB 4FLRA 3CFEB 4ZNEA 4M48H 4NN5C 1UD2A 1A7PH 3BKCL 4NNYA 5JQIB 3C5SB 2WO2B 1JN6B 4GINA 3UTQA 5CLWA 1H8SA 3WN6A 3L3IA 3BISA 3AS1A 5E2UL 3WDHA 2VDRB 1YEGL 3LXAA 5AYTA 2VC2B 1F58L 4FXGA 4NGHL 2IDTA 2YGVA 2CPUA 4IJ3B 4NKDA 5IKCA 1CU4L 1MCPL 4JHAH 1MFEL 2Q0ZX 2VLRE 1WA0X 4PGBB 5ADPH 1M56B 1UB6A 1JHKL 1EEUA 1ZSDA 4I0KA 4MQ7A 3OMIB 1HQ4B 3PYCA 5K33A 2V3DA 1AXSA 1VF5C 5ILTH 3GB7A 4FADA 3RNQA 4E41E 1GGIL 3N43F 4QUOA 4NB7A 1EDHA 2KKQA 1L0YA 2YAHA 3QDGE 3QJOA 1J5CA 1NFDA 2BVYA 3E8UL 4PGZA 4RGOL 4WZ9A 5I8EA 4NX0A 3JYBA 4Z7VA 4L5FL 3V10A 2EDHA 3H9HA 1PG7L 4AQAB 1NGPH 1J0IA 4FG0A 2GIYA 4CDHA 4AIEA 2V5YA 1OW0C 2IDSA 1ZJBA 4XVUC 3T3PB 5KBPA 1DQVA 3HNSL 5DD6B 1BMWA 2WSDA 1KGIA 2A6IA 2ZOOA 3BVDB 4S1SL 2FBOJ 4GW5B 5I1GL 4LCWE 5EZJA 4NDMB 3DV6B 1WBZA 5KS9B 4F9LC 4YPGA 3MUZ1 4GAAA 1U8CA 3TT3L 4G9DB 2VLRD 1NMBL 3PV6A 3DJSA 5L8LB 3L1OL 3ZKQD 3FPXA 1VCBC 4JN1H 3CZSA 4N24A 3WFDH 1IVLA 1MRCL 3PHQB 1WBXA 1ZK5A 3OX8B 4E41D 2DMKA 2EXWD 5EF2A 1FJ1A 4HWZB 5I74C 2DQGH 5JYMA 4UUJA 2YKLL 1AVAA 1PD6A 3AUVA 1VGEL 3ZDYF 3VG0L 4OCWL 1FUNA 1U95A 2BCMA 3WFCL 4PYGA 1IM9D 4WK4B 3O4LB 1YJDH 4R4BA 1S7WB 2GI7A 4YAQA 5JLZA 3ZT6A 2FQGA 2UZIL 3GBDA 3L5WB 1BWWA 5T33L 1DQDH 3HAEG 4HS8H 5KN5B 2EVIA 3ULSB 3S34H 2IXQA 4KK5D 3FU5A 2Q86B 5B8CB 4NNPL 3DVNA 1YMHB 4OVUA 1L4IA 4ZK8A 4R5VA 4FNLL 3T3MB 1XIWB 5JXAH 3N44F 4IU2A 3WFBH 5KOVC 1FL5B 1UWEH 5IIEB 2AXFB 4XMLL 4RGNC 4NKIH 5GRJH 4WU7B 1MNUL 3MLTB 3P0VL 2C9UA 5DT1L 1KB5H 5DO2C 1M6OA 2WWMD 2A74C 3LQAC 4H25A 4H44C 4YHZL 1ZVSA 2XKNB 4BM7A 3PGCA 3LYRA 4DP6X 2P7TB 3OXRA 1YA5A 3MFGB 2Y4SA 3BWUC 2QGBA 1F8TH 2ZAHA 4MZ3A 2L4OA 3JV4A 4U1NB 2ZWNA 2ID5A 5CAYB 4F7MA 5IV2A 3AWEA 2UYLA 3ZDYE 4X5QA 4JCLA 5TE7H 4G6KL 5KJRL 4PVNA 1ZJAA 2IBZX 4A37A 1HSAB 3JV6B 2R2BB 2ORBL 2NUTA 5CZKA 5EUOA 3RGVC 1P7QB 4TSAL 4DVBA 4B0MM 3VNZA 1XBDA 2PPFA 2VW6A 1D5BA 4HV8B 3II3A 3QJHB 2CKBA 2X4NB 1E9QA 2A99A 2J3SA 3UL4A 3CFEA 3Q2WA 3BIKB 1NUDA 1OF2B 1FZMB 3O45B 3B9EA 4HUNB 3MV9E 3C5SA 4MKMA 2ZCHH 4HIPA 4DPBX 5ADOH 1JN6A 1IBFA 1GMEA 2NX5B 2YK1H 2WVVB 2J4WH 4GXUN 2ZP8A 4LKCB 4MS8D 1OPOA 5AAMA 3ZDXE 3KJ6H 4WCYH 5EB9A 1IT9L 2QKSA 1LTXA 3QGVA 2CXKA 1F4WH 4XMKH 5EORH 3K2IA 4LFHD 1V54B 2CBMA 4OLVL 4BCZA 1NBQA 1CDGA 4KXAA 2BJML 3VTAA 4PGBA 4E42B 2V17L 4OZHE 2UUDK 3MJ9L 4GXVH 3HBQA 3R1GH 2WXGA 1MJ7H 4LAJH 1HQ4A 3K6SB 3DHPA 4TUKH 4PY7B 3L5JA 1HHIB 4KMLB 4N8VG 1FG9C 4OKVB 2IGFL 2C3XA 4M7LH 3B5TA 4JANB 3UGUA 1F45A 5E23A 2AK1H 1UATA 3KZ8A 1OSPH 3BGAA 5FX3A 2IH9A 4AT6B 4LRIC 1C5BH 4WI7A 1WK0A 4FNTA 5IJDC 3AXHA 1RIUL 4EOWH 4XMWA 4AQAA 3PV7A 3Q1SH 2G5BB 3PL6B 3UG3A 1UVQA 4D9LH 5B21A 2OCJA 3MV9D 1YPZB 1CXFA 1BEYL 1QI4A 5DD6A 5G4OA 1MHCB 1SXAA 5DC9B 4IBUA 2LVCA 3KBEA 5K1NA 4GW5A 4AH2B 4NDMA 1CLYL 3DV6A 2JKXA 5KS9A 3V4UL 5HHQB 1ZEAL 1Q0XH 1EGJL 4ECNA 4HWBA 2NXYC 2WCPA 4G9DA 5SX4I 3S37L 1BQLL 3IDGB 1EUTA 1L0XA 3F7PC 2X4QB 2WXNA 2I07B 2VXTH 5FO9B 5AW1B 1BP3B 2J5LC 5K39B 2WINB 1UFUA 1GSKA 3SDYL 4YS4A 3PHQA 3OX8A 4LXFA 2ZKWA 5DI8B 3D0VB 4HWZA 2NNRA 2BP0B 1QLFB 4YLBA 5AAWA 2F08A 4EUPH 2W95A 1L7TH 1FRGL 4RESB 1A3LH 1LO0H 1R5VB 5AVXB 5GGTA 4BQBA 2GC7C 4YO0B 3NSYA 2PTTB 3BJ91 1WWWX 4HUXB 1RULL 3RVXC 4K7PY 2L7JA 3O4LA 2OI9B 3SZ6A 2E9GA 1S7WA 4LEXH 3DMMB 3IPBA 3L5WA 1EHKB 3P54A 1MSPA 4UOJA 5KN5A 4NFBA 5C0ND 3ULSA 1OHQA 5B8CA 2Q86A 1YMHA 5DRNB 2H4EA 2QVMA 3BW9B 2ESVE 3WNIA 1UEYA 5I19L 2VIRB 1XIWA 1OIOA 3H3PL 1MVUB 2YPVH 1OLZA 4LESA 2CK2A 1FL5A 3L13A 1NLBH 1GGUA 5IIEA 2AXFA 3EH4B 3RVUD 3GXMA 3QZNA 4FGMA 2AVFA 5BOZG 1F4XL 2P8LB 4WU7A 2HX7A 5ES4B 3ESOA 2WWOA 3MLTA 4NO5B 3SYPA 4L3CB 1AE6H 1T3FB 3DSFL 5IHWA 5L8KB 2VQTA 4LLQB 2XKNA 4RISH 3UTTB 4EIGB 3WE6B 4GSRA 3DDFA 3U4BL 5DO8A 1FCGA 3LH9A 5HI4D 4BE6A 3DC0A 4NKOB 3APFA 4IRSC 2GEEA 4U1NA 4KKAD 3U6RB 1AAJA 4LK4A 3S96B 3BLBA 1R24B 1H6FA 4I1PA 4XPTH 4ZMLA 4D0BB 1T03H 2HB0A 1C1EL 4MXVE 3WHE1 1HSAA 3ALPA 3JV6A 2R2BA 3QJUB 4LHUG 4WGWB 3ULUH 1XGPB 1LLAA 5C0AB 4UIMB 1HWHB 1I1RA 5K59E 1P7QA 2YJLA 5I82A 1HOEA 3S5LG 5J0BA 4N26A 4HV8A 1KCRL 5DJZB 2ESVD 1I1CA 1S7TB 2XFXB 3QJHA 2M2DA 2X4NA 2AVGA 1AKJB 4I85A 3QZWG 1LWRA 3BIKA 3AT9A 2R7EB 4A7UA 3FTSA 4Q56A 1QFWM 5DJ6B 1OF2A 2F9BT 4PGDB 1FZMA 3O45A 3A4DA 1UCTA 1OP9A 4MA3B 5C7ZA 3M7FB 4K94H 2WJ7A 1BQRA 1RK1B 2NX5A 4FAAB 1FIGL 3ZHKA 2WVVA 4GQ9L 4LKCA 5AW3B 1S7XB 4AGQA 4YHOH 2X9ZA 1BFVH 2MFNA 4BE5A 1U42A 5TQ0H 1U3JA 5F88B 3PGFH 4L9LB 1L9RA 1FNEB 1WE5A 2G5RA 4AC4A 2WQWA 5LG6A 3KWXA 4E42A 1TZGL 4FNQA 4N4YB 2CPCA 2F19H 4FCAA 1QFWH 2SODB 3AG2B 3DDGA 1YEFH 4U0RC 3K6SA 2BFVH 4PY7A 2WCSA 1HHIA 2WBWB 4I2XB 4OKVA 3WLBB 1CZ8H 4HG4J 2A9ML 4N5EC 3EZ8A 4JANA 3GHBH 1USZA 4QHNB 1NANH 3GEWB 3O3AB 1XSOA 5FO8B 4Z3EA 1E5ZA 4QTHB 4K71C 4K3DH 4JE4B 4AT6A 1XGQB 5FOBB 4X4ME 1CT8B 4E9WA 2G5BA 3PL6A 3L4UA 4KFMA 4BDVB 2R2CA 3K3QA 4ZZFA 1RU9L 1AHWC 1TJGL 4JK0D 3IB4A 3MOBH 1NCBL 1YPZA 1CE1H 1TQCC 5HVHC 4J27A 1MHCA 3BUQA 1SNRA 4R4FH 5DFWH 1ZLVH 1OGAE 5D9SB 3UJJH 3HBGA 5DUJA 4AH2A 5GS0D 1YNLL 5IQNA 2D4FA 5HHQA 1T2QL 1G43A 4EZKA 3EADA 1TSRA 3IDGA 2XA8H 1L6XA 2X4QA 5C0NC 2I07A 2ZUQC 5FO9A 3LPPA 2R2HB 4U1JB 2AEIT 5K39A 2WINA 3H9ZA 1KENH 4KJQD 3V2AR 2VH5H 3DETD 2EDMA 5DI8A 5SWZB 3D0VA 2CH8A 3QZOA 3MRRB 2O5YL 4FNUA 3T0XA 2BP0A 1QLFA 1SZNA 5B22A 5LBSA 3O4LD 1DEEB 1HXKA 3RVUC 2X6AA 1R5VA 4L8DB 2V2TB 3SBWC 2Q10A 2HG5B 2PTTA 4WGKA 4UDUB 4HUXA 4J7RA 1NL0L 3DMMA 1J5OH 1XIWD 2FATH 5DHXB 1BGXL 2OMBA 4OI9A 4LCIL 3ATBA 4YR6B 3WD5H 1UACH 4ZMVA 2ODHA 4IRJB 5DRNA 3ULVH 1UKQA 3BW9A 2HRPL 1MFAH 5FPIA 2VIRA 4AI7A 3KCPB 1QRNE 3ECWA 1MVUA 4K7PL 4WTWA 4AV5A 1WTGT 5TF1H 2NX5E 5E4IA 2E7LA 2BIQA 4LAQH 4P2RB 4PIBA 2P8LA 4X83A 1KGCE 2WAHA 2J5WA 3CMOH 4NO5A 4L3CA 1OPGH 1T3FA 4M7ZB 4AUUA 4LLQA 4NBZB 3UTTA 5FB8B 4X4KA 3WE6A 5I5RA 1E6JL 4NKOA 4KI5D 1D2PA 4TUJB 3N2JA 3U6RA 3S96A 4FQJH 4NFCA 1R24A 3ZRFC 3VD3A 1JP5A 1QD0A 3ABZA 5ALCL 1S78C 3LKOB 4JPSA 4D0BA 1QRKA 3GLEA 2XRAH 5LXGL 4ONGH 5F70A 4XOAA 3U9WA 2XV3A 1GPOL 3FPYA 5E95B 3W2DH 1JK8B 1XGPA 5C0AA 4EI6B 2QQLH 4UIMA 1A3RH 4CA4A 3H9SB 1XWVA 1YAZA 3VTTA 1FGVL 3RY6A 3NZHL 1I8LA 4KVCH 4ZW6A 4LLAA 3LD8B 3WG7B 5DJZA 2W38A 1S7TA 2R51A 2R1YB 2XFXA 1RIHH 5EBWB 5GRUH 1QRND 1AKJA 4PJFF 2NX5D 2R7EA 5DJ6A 3CN0A 1Z5HA 4M1GH 4PGDA 3BIBX 1IE5A 3L4ZA 5IJKA 4MA3A 5I1KL 1KGCD 3CC5B 1RK1A 4AUJA 1RZ7H 3DX4A 1S7XA 3FQ2A 4P0DA 3MNVB 5F88A 1UXWB 1YYLH 1THAA 2VISB 4HC1H 4XO9A 4L9LA 1FNEA 5D6CB 5JZ7C 5LXVA 1KIQB 3GIZH 1G7QB 2R1WB 2Y06H 4GSUA 2XU9A 2EVFA 3DX9B 3QQXA 3B5HA 3ZMEA 4HJJL 4JFHE 4POYA 5LCVL 3N5AA 4I2XA 2CR6A 3WLBA 4PV8A 1MCRA 3OSKA 1KJMB 1CGTA 3QIUD 4RMBA 4QHNA 4JFQB 2ZWLT 3KH4A 4QMEA 1MI5B 2FZ3B 3O3AA 2OM5A 3AY4C 3OKYA 5FO8A 2YMXL 3PL6D 3LZNA 3N50A 4QTHA 5KOMC 4CADB 4Z7OB 1ES0B 1XGQA 2C9QA 3DXAB 5FOBA 2E4FA 1Z2KA 4FXLA 1B0WA 3STBA 1A3ZA 2YUZA 3FJTA 3U48A 2CM6A 1CT8A 2A4CA 1LDPH 5J3HD 4DGYH 4BDVA 3OVUB 4N1EA 5E6UB 3OC8A 2P28B 4P5KB 3A67L 4WTZA 5EU5B 3OD3A 1G0YR 2JJWA 4WHYG 5D9SA 2VL5B 3LS4H 3MGOB 4G2AA 1OAXL 2DV6A 2ZUWA 4FFVD 4JKKA 2VR4A 2IF7A 3O2WH 3RX8A 4D9QD 1MIML 1YNKH 4PY8I 5F9OL 4S1DC 1EUUA 2IFGA 1KLFB 4PS7A 2BZDA 4NQQA 4XNYL 3U30B 4C4BA 5HHXH 4HUMB 5GGUB 2R2HA 4U1JA 3UCQA 4LHQB 4JFHD 2L0DA 4UT6L 5SWZA 3KW8A 5MENB 3MRRA 3DECA 3TH2T 1M53A 1DEEA 3K4DA 3DMMD 4PJ8B 3VMNA 2XSKA 3VVWA 4L8DA 5HGAB 5ITBL 2V2TA 2DQHH 1E5AA 2DJ4A 2HG5A 5FCSH 3AB0C 4UDUA 2YN3A 4M48L 1ORQB 4N1CA 4XOCA 4F58H 2BERA 2XXCB 3DX7B 3K2UH 5J12B 5GS1B 3QUZB 3TGXA 3QXWA 4XCNB 3DWTA 1EJ8A 2ICEA 4Z7NB 3RU8H 5ABDE 5J6GB 2HAZA 4YR6A 4LPWA 5CP7B 2X4UB 2EE2A 4IRJA 5HJBA 3FMGH 4A66A 3OXSB 5F0LB 3N55A 4OT1L 1ET7A 4YDKH 3BEVB 3SY0B 3KCPA 5LGHH 3GRWL 3S36L 1OOAA 3T6WA 2BIPA 4P2RA 2OR9L 2XQ0A 4PB9H 2H9GB 3K6FA 1DSWA 3MGAA 3T09A 1GHFL 1W91A 4ZAKD 1WD8A 1OEZW 1QWUA 5LG1A 2VMDA 1RAMA 1MEXH 5FB8A 3QIBB 4RZCB 3O0LA 1CQYA 5EA0H 3RWJB 2NT1A 5F7KC 4YDIH 4AL8L 4YBQD 3H9YA 4XP4L 1WC7B 4TUJA 1JHLH 4K3JH 4P4RB 1IAMA 1U41A 5KBMA 3HE7C 3IS1X 3LKOA 4L1SA 1INEL 4PPTA 2F8XC 4XE0A 3HB3B 4AVIA 5T5FL 4F24A 2BHUA 2D3VA 3AROA 1JK8A 3PAZA 4EI6A 3H9SA 5DFAA 1AKJD 3IK2A 2ZUYA 2B14A 3MLSH 4U1GC 3AMKA 1L0PA 4XPFL 3UYRH 1A1OB 1E6OH 3JWNE 4YXLH 1KEGH 5EBWA 4IIZA 2PR9A 2R1YA 1OB0A 3MI6A 5IW3A 1QLEB 1RVFL 3CDYA 4FNSA 2VDRH 5I6MA 4QIRA 4DO4A 1V10A 4LASH 2DLEA 4WFGD 1LDSA 3INUL 3QIUC 3CC5A 1ZMYA 4JN1L 1U8JB 3WFDL 1UZ8B 1UKSA 3SDAB 1AD0B 4OQTH 1DVTA 3H42H 3MNVA 4AYGA 1UXWA 3ARFC 3CBKB 3GC3A 4ZQKB 2DQIL 3GT6A 2VISA 4Y4FB 5BRQA 4BZYA 4F20A 3W38A 5CD5C 5D6CA 3BXNB 4DK3A 1KIQA 1OTSD 4Z5RB 4KUZH 1G7QA 2NZ9C 2R1WA 1FN4B 1VZGA 3DX9A 3VH8G 5IEHB 5B4MC 4L3EB 1X9QA 2Y22A 3CZJA 3EJTA 2CUAA 3TM6A 1KJMA 2CO6B 3SPGA 3VD9A 3PDOB 3S34L 2OCCB 4JFQA 3KL5A 4WK2B 4UBDC 4A7TA 1MI5A 2FZ3A 2HSIA 4FFVC 2O30A 2OW7A 2BOCB 3B6SB 3ZE1B 4CADA 4A6YB 1ES0A 1NKRA 1U2HA 3DXAA 3ZHNA 2E4TA 4OCMC 5HVFB 5DUBB 5EU6E 2XXMB 4NKIL 1KJ2L 5SV4A 3L4VA 3DTDA 4N87A 4P5KA 5JHDB 2P45B 5EU5A 5L7XL 2HLFD 3GXUB 5IVZB 1D2OA 4KTGA 1P69B 2PCPB 4XC3H 2VL5A 5D71L 3MGOA 1H3PH 2MHAB 3MN8A 1CD8A 3T4AC 5T8IA 1BAWA 1T0OA 4KNSA 4WTXA 5IFAH 1A64A 1WFIA 5SWZD 3UTZB 1KLFA 4ZW7A 1W0WB 2H1LM 5GGUA 3MLWH 4UQIM 1D6EB 3E0GA 1UA3A 1MG3C 2BVEA 5MENA 1HFUA 3T6XA 4BD4A 5E08H 1E9OB 4AQ1C 4YL4A 1IU1A 2A1WL 3FFOA 3H56A 5DS2A 3UEZA 4PJ8A 4QXWA 1J5HA 1B2WL 4PJHF 5HGAA 3GWJA 4PGEB 4ZAKC 1ORQA 1T0NB 3DX7A 1IBZA 4NPJA 4UTAA 5AW5B 5EU6D 9CGTA 3QUZA 5GS1A 4KZDH 3UJTL 3OPUA 3R19A 4XCNA 5J6GA 2ZCHL 3EJSA 3K6NA 5ADOL 2ZAGA 4IIQC 1IC7L 3AXLB 4P46D 5CP7A 2X4UA 4JW3A 1XR9B 3OXSA 4K8RD 4P2RD 3BEVA 3NUKA 3SY0A 2O5XH 4EEEA 5FK9B 3ZIMA 4XMKL 4K23H 3S8GB 2R4RH 3HHRB 1PNCA 2R15A 1V8HA 1UM5H 4JDEB 4Z8FH 2H9GA 4OLXL 2GTWA 3KS0H 1OK8A 2EIEA 3KLKA 2F6AA 3DYPA 4CKQA 2AQ2A 4TUKL 3AREB 3SIKA 4DGVL 4QJ5B 4FI6A 4PJXF 3TIEB 3QIBA 4RZCA 4AYID 4G7RB 5KSAB 2JELL 3RWJA 4Q9QH 1AZBA 3HCVB 4FYSA 3IN2A 3I9GL 1WC7A </