3UADA

Multicopper oxidase cueo mutant c500se506q (data5)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHQDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An O-centered structure of the trinuclear copper center in the Cys500Ser/Glu506Gln mutant of CueO and structural changes in low to high X-ray dose conditions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Blue copper oxidase CueO
total genus 135
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uadA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uadA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uadA03
1SHXA 5B7EA 3T6VA 3ZBMA 1PZCA 7PAZA 2JXMA 3PAZA 1NPNA 3UABA 2H5UA 5I5MA 3NJGA 1A4AA 2B3IA 4E9YA 4WKXA 2H3XC 2HX8A 2FT7A 1NICA 1V10A 3NJHA 5AZUA 2X88A 3PAVA 3NJFA 1OE2A 2BW5A 2EIKB 2VSKB 4A67A 3AZUA 3FU9A 3OD3A 3S3CB 1SF5A 1DYZA 4AZUA 4BDVB 1XB8A 3WNIA 4YSUA 2GHZA 4A2FA 3CG8A 4Q89A 1PNCA 2UXVA 1ILSA 1AZCA 1NWOA 5B1JA 1KCWA 4YSCA 5B7MA 2I7OA 3TASA 5PAZA 4K9JA 4KO6A 1X9UA 2VW6A 1J9RA 3BQVA 2XV2A 1ILUA 3T6WA 4HIPA 6PCYA 2QDVA 5D4JA 1URIA 4TXVB 1SFHA 3ZX1A 1M57B 2XUWA 4UF7C 1IC0A 3T9WA 3NJJA 1PF3A 3FSZA 1ET5A 3UAEA 1IUZA 1ZV2A 1OF0A 4DP0X 3QPKA 1QNIA 1KDIA 1JERA 2GSMB 3HEIB 3WG7B 4HCIA 4HCFA 1E5ZA 7PCYA 1JVLA 2IWFA 1KYAA 1J9TA 1OCRB 2XX1A 3KW8A 2TSBA 1RCYA 4M4RB 2JFCA 1PZAA 1B3IA 1AANA 2VW7A 4NERA 1JZJA 3CZUB 4YSAA 1JVOA 2PLTA 2PPFA 2P80D 1SHWA 3RYMA 4DPAX 3UACA 3EH3B 2YAEA 5B7FA 4ENZA 4RH4A 2EIJB 4FA7B 1XMEB 3NSFA 5I6MA 3WKPA 2PP7A 1JXFA 1A3ZA 5I6PA 3FYEB 1L9QA 4KNSA 4AKPA 2GBAA 3SBPA 2UX6A 2VM4A 3CDZA 4W1TA 1GS8A 2GC4C 2YXWA 3X1EA 2GC7C 3S3DB 3GYRA 1BYPA 4YL4A 3X1GA 4E9VA 1SJMA 2CUAA 1IKOP 1QHQA 1TKWA 2J55A 2B08A 4WTQA 1BXAA 1CC3A 1OE1A 2EILB 2FT8A 2IH9A 2IDUA 4DP8X 4F2EA 1AR1B 3QJSB 1AQ8A 2GIMA 2Q9OA 3AG3B 2AANA 4HHWA 3TBCA 2XYBA 1EHKB 2FQEA 4YSQA 1MG3C 1OCCB 3DIVA 2DYSB 1N68A 3SBQA 3AW5A 1AG6A 2XV0A 4Q8BA 1F56A 4G70B 4YSTA 1KDJA 1AZNA 2XLLA 2AVFA 1E30A 1GYCA 2X87A 4YVUA 5B1BB 4BWUA 3NJIA 5TK2A 4A68A 3MBWB 4HZ1A 1EZLA 1CYWA 2HRHA 1NIBA 1AZRA 2YXVA 1JZIA 3L45A 4FAAB 4X4KA 1OE3A 2WO2B 3CVBA 1JXGA 2HX7A 4G7RB 1BXUA 1AAJA 1SDDB 3FU7A 2YARA 2BZCA 1ZDQA 2MTAA 3NP4A 4KO7A 4KOBA 3NJNA 4N4YB 4QLWA 3H56A 4GYBA 3IEAA 4G7QB 1A4BA 1MG2C 1M56B 3QJRB 3G5WA 1J9QA 3QJUB 4E9XA 5D4IA 3NJMA 3X2QB 1WS8A 4AKOA 2CCWA 4KOCA 1ET7A 3FQYA 3QQXA 2BO0A 1TEFA 1PNDA 1GR7A 4BXVA 2UXFA 4A66A 1V55B 2YQBA 3ABKB 1T5KA 3EF4A 2HXAA 3NT0A 2IWEA 1QLEB 1ZDSA 3T71A 4NAJA 2YAPA 5F7BA 1UATA 1W6WA 1L9RA 2FQFA 1BAWA 3CVCA 3FPXA 3NYKA 1J5CA 2BP8B 4YSRA 2TSAA 2BP0B 1BQRA 1ID2A 2AFNA 3V9EA 5I26A 1ASPA 1JOIA 2GI0A 3WKQA 5I6OA 2EINB 2HZHA 2IH8A 1ET8A 2ZXWB 1E5YA 2UXGA 2WO3B 4GY4A 2YAMA 2GB2A 3V9CA 1L9SA 2RACA 3FSAA 1MZYA 4AI7A 2I7SA 4L0PB 1PCSA 2Q5BA 1GY2A 2XXFA 3ZDWA 1ETJA 2XX0A 3FT0A 2HRGA 2PP8A 2YAFA 4GP5B 4JKNA 1CUOA 1HAUA 2P80A 1AACA 1AZBA 4KNTA 1OCOB 3QJVB 4E9WA 1J9SA 1PLBA 1ZPUA 2OJ1A 3U25A 2QPEB 5TK4A 2PP9A 2XWZA 3QJTB 1I53A 2R7EA 1A65A 2I85A 1W6LA 5I6LA 3KW7A 4G7SB 5F7AA 1V54B 1PAZA 1SFDA 4HHGA 2PCFA 1J5DA 3NSYA 1NINA 1X9RA 9PCYA 4M3HA 1BQKA 1R1CA 2J56A 3DKHA 1L9PA 1AZUA 2IWKA 3H4FA 1NIEA 1SF3A 1RZPA 2DWTA 3ASNB 3EH4B 4CSPA 2VW4A 1HFUA 1PY0A 3S8GB 4E9TA 2W88A 1W8EA 4N8UA 2FJSA 5PCYA 1WA0X 3HB3B 3OMIB 1FFTB 1TU2A 1WA2X 4DP5X 1HAWA 3AY2A 3FPYA 4UANA 1JZGA 4HCGA 1FA4A 3AG1B 2FQGA 1XB6A 2FQDA 1GS6X 3DTUB 2Y69B 2CBPA 2BWIA 4BWTA 3NP3A 4GXFA 4UAHA 1L9TA 3ABMB 3AG4B 1MDAA 5A7EA 4HALA 2PPAA 5B1AB 1PMYA 1A8ZA 3PCYA 2N0MA 3PLYA 4AKQA 1PLAA 3IE9A 1PLCA 1RZQA 1E67A 1NTDA 3OM3B 1JXDA 3EH5B 1GS7A 3NSCA 1BEXA 2R7EB 2IDQA 3OMNB 2AZUA 4EF3A 1SNRA 1JZFA 3X1BA 1JZHA 4F7KA 2AZAA 5I5IA 2CAKA 2VN3A 3QJQB 3SBRA 4AX3A 1FWXA 1RKRA 4P5SA 3WI9A 4A2GA 3IN2A 5I6KA 4QKTA 5FC9A 3UADA 2DY2A 2PPEA 3FSWA 1M9WA 2ZWNA 1BYOA 4YVNA 2VSMB 1NPJA 2IDTA 1ADWA 5B3SB 3X1NA 2J5WA 3TA4D 4DPCX 4G71B 3FYIB 4PCYA 4BK5C 5LDUA 2BP8A 4DP9X 1IBYA 4W9ZA 1OCZB 4MFHA 1WS7A 2FNWA 4JHVA 4A2DA 2EIMB 5E9NA 2IDFA 3JT2A 1GW0A 1AS8A 1PZBA 1ASQA 3BVDB 2NRDA 1DZ0A 1KBVA 1KV7A 2PPCA 4DPBX 4YSPA 2YAQA 3ABLB 3H4HA 3IBOA 2XU9A 4YSOA 4DP2X 2DWSA 4BXSV 2PPDA 3WNJA 3WIAA 2W8CA 1NZRA 1NIAA 3CVDA 1XB3A 1MZZA 1CURA 1ZIAA 3IN0A 3OMAB 4E9SA 1NDTA 2WSDA 6PAZA 3EHBB 2HLEB 3AG2B 4KO5A 3SQRA 3C75A 2H47C 2CALA 3T6XA 3UAAA 2ZOOA 1WAEA 3N55A 1NIDA 1AS6A 1OV8A 2E86A 2QT6A 4P5RA 5IY5B 3TBBA 1KBWA 2FWLB 1CYXA 1YLBB 3OQRA 4BDVA 1WA1X 1IBZA 2FTAA 3FQ2A 5AKRA 2LLNA 1VLXA 4GP4B 1KGYE 4YSEA 3GDCA 4DP1X 2HX9A 2J57A 3FQ1A 1AS7A 1L9OA 4DP6X 2QDWA 4E9RA 2DV6A 5AFAA 1BQ5A 3FS9A 2BP0A 2A3TA 4A2EA 3ZIYA 4GP8B 3MX0B 2IDSA 1KCBA 2PCYA 3PPSA 4G72B 5B1JC 3S3BB 3NJLA 1OOWA 3PXLA 3S8FB 2DYRB 2BHFA 2BZ7A 2UX7A 4E9QA 2CJ3A 2IAAC 2Y1AA 3T6ZA 3FU7B 1JZEA 3NSDA 2YAHA 1AOZA 3ASOB 2VMJA 3ABGA 3TU6A 4HAKA 5I28A 4PAZA 4A2HA 2XXGA 1E65A 4NB7A 2FT6A 5ANHA 2XVBA 3FU8A 3CDZB 2UXTA 3UGEA 1ZIBA 2JKWA 4DP4X 1BXVA 3D12B 2MRYA 1NIFA 5B1KA 2BW4A 1AIZA 4YSDA 3ERXA 4BWWA 2ZONA 4DP7X 1GY1A 1SDDA 4ZK8A 8PAZA 3JTBA 2XV3A 5D4HA 1A4CA 2QPDB 4JHUA 1GSKA 1TEGA 1AG0A 2BWDA 3NJKA 4YSSA 2VM3A 1ASOA 1N70A 4CSZA 2YAOA 4KNUA 3PAUA 4F2FA 4KO9A 3N2JA 1NWPA 5EHFA 3X1FA 5I6NA 3GXUB 3FSVA 5I5JA 2OCCB 2OV0A
chains in the Genus database with same CATH superfamily
1TVDA 4GKZB 5GS2D 3MACL 4LEXH 3U4EB 3GGWB 2Z1KA 4ZOBA 5FYLD 3RIFK 5JIDA 5J1SC 1MRCH 2X4TA 5I5MA 4EN3D 5T5FL 2G9HA 5L88L 1MY7A 4JDZA 4XP9H 5EUKA 2Q3AA 4EUPG 2BVPA 3QHZL 1NICA 4FG0A 4NQCD 4NOBA 3M1BA 2X88A 2Y6SD 1VA9A 4FFVD 3Q13A 3LKRB 5DMYA 2IG2L 1JGVL 3T5WA 5E00B 2J5LC 3S3CB 1ADQH 5DRZA 4GT0A 3FB7B 2G60L 1G0DA 4OZ4A 4BDVB 3BYTA 2X9ZA 3ZT5A 3L1FA 2D7TH 3VXMD 2Z6FA 2XA3A 3DRQB 2XN9A 1KOAA 2DQIL 4X7SH 2WYTA 2KERA 5I6XC 5EF3A 1KCRH 4PJBA 3KYKH 1I8MB 4ODBD 3NTCL 5TQ2L 1XH3B 3S9DB 4NNYB 4OQTH 2V6HA 1URIA 4OM1H 2WUBL 2R1YA 5CHNA 1HHHB 3MFFB 4UF7C 1L9MA 4Q9RL 3CLFL 2YMOA 1T6BX 4JNXA 1UXWA 5BOZG 3CX2A 4OFYD 2BPBA 3VGHA 4PVBA 1LEGA 3S3PA 3F6LA 1G87A 3KXFD 5D2NE 1RJYB 2NSMA 3W0WB 5C3TA 1CZ8L 5DLMH 4GBXD 3EBHA 4PWIA 4TSAL 1T03H 3V2AR 1U2HA 1AH1A 5CZXD 3PQYA 3RDTC 2AQSA 4OCXL 4JO5A 2X28A 3DUHA 2HKHH 4HJIA 3N50A 1PZAA 4NERA 3BT0A 2MJWA 2GT9B 3UTQB 3FT4B 3S7GA 4KJYA 1Y6MR 1Q1JH 2Q86A 2PLTA 3TH2T 3ML8A 4XO5A 1DQDH 2JKXA 4OLYL 4M5ZL 3S0PA 1XF2B 3D39E 5E24E 3BFQG 4ZNEE 3ES6A 5AKVA 4DH2A 2X4SB 1GGIL 3KDMA 2LTQB 1JWMB 2RFXB 2YPKA 1KTCA 4P2OB 3WFDH 3DV4A 1JZ4A 3UC0L 2GC4C 2XZAL 3GXNA 1O7SA 4PRNA 1JWUB 3CCHB 4LK4A 4QD2E 4IKJA 3N85L 5I1LB 1QHQA 3RWCA 4HKXB 1EO8H 3JWNE 2Q7YB 2B1HH 1CO1A 2B08A 2AEOA 3KE0A 5LGHL 3LKRA 3N1PC 1WBZB 3K3QA 4MAYD 3UCRA 4KKPA 2X3BA 1QRNB 3Q5TA 3DVNB 4LCUB 1J0YA 4H8VA 4I5BB 5HHVL 4XNYL 3SDDD 3MV9E 2F5BH 3PJLA 2WLLB 1EXUA 2A83A 1IVTA 1SYSB 3SDCB 5AW3B 5KYWA 4IU3A 4WFHE 2Y5EA 1QLRB 3HNTL 3OQ3B 4PJ9C 3TN0D 5MENA 5FB8A 1XGZA 2C1PA 1CFTA 3ARSA 4GQRA 3UGXA 5C0CD 1VGKB 3AM8C 4P46D 1TYRA 2F68X 3O11A 2R56H 3T04D 2IQ9H 4KK5D 5AYUH 3BAXA 5GGRY 2DWYA 3TESA 5IVNA 3KPRD 3KH4A 3M8OH 1F11B 2P5WE 2N1TE 3BKMH 4FFWC 3ZTJH 2OTPA 2V37A 4B3EA 1PCXA 2VMCA 4TSBH 2GCYA 3LRLA 2AVGA 1P5UA 4BFKA 1GZPB 3ZT6A 3UZVA 2BY0A 2DQHL 2H2SD 3B7TA 3S37X 3KGRA 3FKUS 1I8AA 2VYRE 4AYSA 4F15C 4PJFF 3PGFL 1O7DE 4QR7A 4JRWA 5DJCA 3LPFA 4HJSA 4Z7WE 1O5DT 2M2DA 3MODL 1H19A 4MCZA 4MNGB 4XCEB 3GHPA 4L3EE 3BN9C 4N0YH 1L6ZA 1NEPA 1UCBL 4IRJC 4TOYH 2V3FA 2UUDK 3OPZH 5DUPH 2B4CL 2PYFA 5M94B 2YUWA 2EXTA 5E1GA 3BRDA 2K70A 7FABH 3CFTA 1I9JL 3V4PL 4GIAA 1O6TA 3UTSA 4TTDC 2DZEA 4L2LA 1IX2A 1NDGA 2C9PA 4Y1TA 3CXHK 1P7KA 3Q01A 2EC9U 4DKTA 2TSAA 2Z7ZA 4RETB 1MFBL 3HE6B 1EGJL 3RFZB 2EDFA 3MA9L 4NO2A 4UIKL 5JPMA 3OKDB 1A3LH 1AYOA 2WO3B 4MNQA 4F57L 3ECVA 4NHUA 3TNNA 1M71A 2XA8H 1JHTB 1DN0A 3GXPA 1GY2A 4LSDA 2Y06L 2YLHA 1BZ9B 4NQSA 3DRTB 4WO4D 4GP5B 3DMMD 4YHLL 2J8HA 3CZFB 3DJ9A 3ABZA 2F58L 4IOIA 3L7EA 4QRQA 5E51A 3TA3A 1J9SA 3EADA 4E9WA 2ADIA 5HHOB 1B0IA 1E5CA 4MJ6A 4CBZA 4PWJA 5IFAL 3HAEA 4JCMA 2ZF8A 5IBLD 5CGYC 4YX2L 1Q4NX 1W0WB 4LSQL 2DWDA 1X5XA 3SYAA 4ZXBB 5EORH 4PG2C 6TAAA 4CN1A 3FCTB 1MCWW 3ZDZE 1ID5I 4EKJA 1CGWA 3T0EA 3OKMB 4BZYA 2QGEA 4F7CA 3MLTB 4UZSA 3AREC 4L2YA 2JNZA 4P5TA 5B39B 4UOZA 1E2ZA 3CMGA 3NZ8B 5IM7B 4Z0XA 4MGXA 3H4FA 4Y4KA 4IBLT 3PP4H 5ANMA 2IH1A 4MWFB 3TVMC 1RZIA 2W88A 1ZAGA 4PB0H 5AL0A 1INDH 2EVHA 5DLLA 1C5BL 4OF7A 4K94H 3PNWB 5BVJA 3DOHA 4JFYB 2H6OA 4AV5A 3D34A 1OM3L 3VI3A 3HHMA 3QXWA 1Y07A 1XGTA 2KHAA 1S78C 8CGTA 4QOKB 5I1KH 2IAMA 3RZCA 2EUXA 5BRZB 2QVMA 4B9CA 2WZAA 4MZ2A 3CFIC 5MEQA 2Y69B 4Z0BL 1E7UA 1UD6A 4ZO6A 3A6CH 3P0GB 3ABMB 1HE8A 3L3GB 4MNQB 2HH0H 1C5BH 1NGYB 1FAKT 3TZVC 2ZZUT 1RAMA 1JGLH 3HE6A 1O6SB 3APDA 3EFFA 3IJYA 1J5IA 1WIOA 1XF5B 4NN7C 1S7TB 1SPDA 2HVKA 2ZKHL 3FQ4A 2BIMA 1GKEA 4O00A 4LOEA 1TYJA 2CAKA 3F7LA 5H94A 1EVTC 3QDJA 1LO4L 4H5SA 2IBZY 4LSQH 2PXYB 3MJ7B 5FC9A 2X6CA 4WI8A 4TUJB 1PEWA 3UBGA 3P02A 4MDRA 3VJ6B 3GS4A 5FYKU 4HS3B 1KXVA 1A7NH 1CXFA 1U95B 1SJHB 3PWPA 4UM9A 2Y36H 2FSDA 1CU4H 3GBLA 2JCCF 1V3MA 1A6UL 5DHVB 4HU2A 1SQ2N 3MUGA 4FFZL 1RUAH 2XRAL 1S7WA 3SDAB 4LPTA 2EIMB 1KACB 3QFJE 5C0DB 1KIQA 4FXGC 1WO2A 4I18B 3NPZB 4PD4K 3UG4A 2FEDD 3RZCB 3ABLB 4PJHA 4ICXA 2C1PB 4R4FH 5CMAB 1LTXA 3R06B 3PFUA 4FTVA 4G8FB 4GJTB 5AYTA 5K1VA 4XC3L 2YK1H 1NLBH 5SWZB 4KZCA 5GGTL 1MCSA 4MA1B 5EB9A 4KRPD 1AGEB 4HLEA 3N43F 1NIAA 3KVDD 1FHGA 1PYWA 3FOLA 3OJDA 5I0WA 1QO3A 2BS8A 4ZTOH 2DBLL 2Z92B 1AD0B 3RPIA 3GJEA 2H4EA 4L48A 1MLBB 5FGCE 2WSDA 4U1MB 4ZFZB 1H9DA 1SXCA 4KX7A 4XNXH 2P8MA 4U6VH 4GG8A 3TF7C 3U2SB 4ZXBA 2VXVL 2X2HA 5I1LA 1KIUB 3OB8A 3QUHA 1HSBA 1UJ3B 4F9LC 5GS2H 1EHNA 4DQOH 2Q76A 3FMGL 5I1IL 4P9ML 3QUMA 1KTBA 1SLUA 2J88L 4Y16C 3ARDB 1IAIM 1VLXA 2RFXA 2YPKB 3ECUA 3GDCA 3JXAA 4LGPB 3G5ZA 4P2OA 1CLZH 4QRTB 4PU2A 4U3SB 4XNQA 5F9DC 1NSNH 5ADOL 5AFAA 5JYMA 2Q2LA 4JX0A 5LNDA 1BOGB 5DRXA 1N3NA 5DJAB 4K71B 4TQEL 3HLKA 4TS6A 1BQHB 5IEHB 2VXQL 3NJLA 4AMWA 5EC2B 4JY5L 1CGTA 5I1AA 3QJHA 3S8FB 1JHKL 3HS9A 1H8SA 1XCQA 3DLQR 2LTQC 4JG1L 4NHCL 2WTOA 3DURB 4MA3B 5EO9B 3GMMA 2MCMA 2BC4A 5DD1L 5EU6D 1CDYA 1LP9E 4R3SB 1AOZA 4YHOH 1NDGB 4RGOL 2B2XH 4KI5D 3FAWA 3MLSH 3HFMH 1DQTA 3W38A 3FRPB 2XQYA 1Q9LA 3K8KA 1XEDA 2IH1B 4MWFA 4HSQA 2CSPA 4Y8AA 3IVKB 3FN9A 2UXTA 5H2BB 2JKWA 5IT2H 5C9JA 5HY9B 3B8SA 4PVMA 4JFEB 3GT6A 1XR8A 2FEDC 3H9SD 2AW2A 3BKCH 4UQ9A 3U36A 4UQDA 2HFGH 3BUDA 4GMSH 1GY1A 2FYYA 2OP4H 4JQVC 1SDDA 4GRMA 4MQXD 5HHMB 1TQUA 5TGBA 5EULV 3S4SA 1HL4A 3DX9A 4NO0D 4WK4B 1A4JA 1KZQA 4DFHA 2BNRE 2ZT9C 4HC1H 4NFCA 5EN2B 4D2NA 4CSZA 1IGYB 2VE6A 4PJXE 5K59F 3AS0A 1XSJA 4XP6H 4JGNA 1XGYL 3BGFB 3QFJA 3GI8H 4A38A 2BOCA 3NACL 3DRTA 4PRDB 5HD8C 1PX3A 5I6NA 1OD7A 2A74B 4N5UA 2E8YA 2ADFH 4PJAB 1EXGA 4DGIL 4G8EB 2K3TA 2IBGA 1QA9B 1KBGH 1ES0A 1QSFA 1MCWM 1S7VB 3TJPA 3EYUL 3R4DA 3WIIH 3CK0H 2X4TB 2OM5A 1Y18B 4HBQA 3QO0A 4HCRA 4FEMA 4TNFA 2WIIA 1CXHA 1UM5L 5F7LB 5FB8B 1A4AA 2Z7WA 4LHUD 2FUTA 4U05A 1X5MA 4OV5A 1MCNA 3DGCR 2H6PA 2P24B 3JYCA 4X6BA 1IGTB 1E4JA 3AWEA 1AKJA 1H5BA 1NGXA 5BV7B 1AI1L 3NJFA 5IBTH 2A6KA 3RWEB 5C6PB 4IRSB 5ERWB 3CD4A 3OD3A 1KJ2H 4MSWB 3U0WL 4EZMA 2J2ZB 4O51A 3L3DB 3X13B 3JYBA 4LL1A 5GSVA 4ZUVB 4AVIA 3DGGA 2YOCA 3HZKB 4W6XB 1NWOA 4ADIA 4R97B 2NW2B 3MLVL 4XMWA 1TZIA 2Z1PA 5JORA 2ICEB 3WY4A 1RZKL 4CILA 1CDGA 1FZJB 1QLEH 1A6UH 1PD0A 3O8XD 2AK4E 1S5IL 5F9JA 2F54B 4LOUC 3ZSSA 5FR3A 2YFOA 3ULSA 3ISWA 4MNGA 4XCEA 1X4YA 4D7PA 4ZFFA 3KYNA 4ALAL 4KK9D 3L4TA 1PF3A 3OKYA 1XT5A 3DDGA 4G9FE 1FNEB 2LT9A 1HWHB 2G2RB 1IM3D 4HQQL 4KJPD 4QTFA 4WUUD 3P2BA 4AEEA 4EIGB 5EBLB 1AIFB 2DI8A 1HEZA 5ICXB 4HCIA 2GFBA 1EK3A 1V7ML 3RY6C 1KT2B 4PRDA 5JXEA 3FTGA 4JUTA 5DDHA 2DQTH 4JREB 5FF6B 2BIOA 4IRSC 1HN1A 5KUMA 1RCYA 3ULUD 2V9TA 2VW7A 4ZX5A 3RKDC 1VKXB 3LDBC 4O2EB 4P3DA 3GUTA 3SDXA 5IB3A 1UFGA 1P4UA 2FHBA 4PJ9A 1ZRUA 3UZEC 3VFVB 1BBDL 4MD4B 1J48A 3K8LA 4ENZA 3AY4A 3ESPA 1N0XL 3AS2A 1BLNA 4C56B 4HXAL 3FT9A 2UY7A 3DJRA 4P23D 3ZDXB 4KNSA 4WCYL 5GZND 2PXYD 3D30A 1FN4A 3O6KH 4HS6B 3OX8A 3VFRB 2UZXB 2WTRB 4YL4A 4G8EA 1F02I 4ZQKB 3FB8A 3QDJE 4OGYH 4R26H 1M1XA 3RNKA 2DKMA 4CVWA 4FHJA 2WQVA 3HZ3A 2IH9A 2VSDA 2AAVA 4MAYA 2QQNL 4MAUL 3MBEB 3OAYK 3S36H 2XN9B 4HHWA 4X8GA 1FV1A 5JTWA 3QWRA 4FFTA 4UQIM 2EDLA 4KMTL 2Y2WA 4U1JA 4KPHH 2F7PA 3J7HA 2NUPA 3HOGA 3POHA 2LR4A 4IDJL 3RWGB 4B9FA 2QBWA 3LQAL 3CQFA 1JZ7A 4HQQH 2AVFA 1J5OL 3FNKA 4PWHA 1Q94B 5GRZA 5IBTL 1C8QA 4YVUA 4NUPA 1IFHL 5A2KH 1B4TA 5JW4M 1INEH 3MBED 1P5VB 2YUXA 1HILB 2FLBT 4HUWB 1V3KA 4FG4A 3WEMA 3DWTA 1AZRA 3HHRB 5BMFH 4IIQC 3RL2B 4FQ2L 1YN6B 3QEHA 1TJGL 1SEBB 4WI0A 3QXAB 5I17B 3IGFA 3I6KB 1UASA 3EFOB 2HX7A 5TPWH 3QNXB 3B2UD 2IH3A 1TXKA 3SPVB 3BEWA 3MLYL 3NP4A 4RDBA 3Q6GL 4UIKH 5EBLA 1LDPL 2V33A 1GKOA 1F4XH 3P4NA 2AJ3B 5C0FA 5SX4I 4QLWA 2IGTA 3APFA 4GYBA 2X7LA 4AE0A 4BUHA 1I9IH 1M56B 3BISA 3TCLB 1LO5A 3VG0L 4E9XA 1GVIA 4N0CD 4EI5D 4KOCA 2WO4A 5DVLA 4JFPB 2NX5A 3MJ9H 5E7FA 2OBGA 3VGAC 4ABUA 4PJHB 3EYUH 3WIIL 1V55B 5CFAA 1CXLA 3KPSE 3QNZA 2LQRA 2KKQA 3NDYE 1ZHBB 3AMLA 3NGBB 4HXBL 5GS3A 4G80B 4MSWA 4N86A 2VC2B 5D7JC 5DK0A 3CTTA 3JT0A 4GLRH 5ICYA 1QHOA 2IMMA 2JJVA 2AKRB 3V6OC 3L2LA 3TF4A 4YSRA 2YGOA 2EEBA 3V0FA 1AD0A 2ZWYA 1OANA 3RPIB 3V7AG 4QHUA 5BV7C 2BSTB 2G3ZA 2E3VA 2C3GA 3KPPB 5ID1B 1ASPA 4OD1L 3IM1A 3EYFB 1S7UB 4LLVA 4PRHA 1IQWL 3P4LA 2IH8A 1D5MB 4XNZB 1RZGB 1D5BA 3MLWH 2WCSA 4FLSA 5D7SH 5F72S 3T4AC 1IBBA 2DLFH 2RACA 3GKZA 3ZDZF 4NUQA 2E6PA 4KWUA 4YE4L 4BFBD 4JFSA 4YOKA 1ML0A 2XXFA 2A74A 5DUBB 1K9TA 2AV7B 2ZP9A 1CI3M 1NGWA 2FX9L 5CBEB 3BAJA 3DTXA 1OCOB 4L4TE 1EJ6A 3ML9A 2VE6B 1IGML 2KZBA 4HDIA 1DJGA 3BEVA 1SOQA 3JTTB 4N87A 5FLUA 4I18A 1KCSL 4TUOA 1PG7L 4LOVA 2WVVB 3VXOB 4AMXA 2ZAGA 3Q2LA 4JO8A 3KW7A 1QLFB 3HNTH 5IROC 2JQMA 3BP6B 2VWEC 1KIRA 4MVBC 3T1FB 2VLME 3SO5A 4CW1A 1KTJA 4HHGA 3MOQA 4ATTA 3VI4F 3HUJF 5KSUB 1NCGA 1YYLL 2GJ6B 2MCAA 4TVPL 3Q8FA 1R1CA 2YHGA 2YA2A 1LLAA 4ZUUB 2NY0C 4FNLH 4NQEE 1FGNL 2FBOJ 1QFOA 5CU9A 1KTDB 5TDNB 5DMKB 5H2BA 1SF3A 5D6DC 4AOFA 3NH7H 5DJDB 2R23A 1ZS8B 1BVNP 4MLSA 4U4IA 4OZHB 4YHZL 1MXGA 2K78A 2CZNA 4KDWA 3LMJL 2RIKA 1CN4A 1H8LA 1RZJL 2C9AA 2FD6H 2QADD 2J88H 3SY6A 3FN0H 3NFSH 1UH4A 4R0LB 3DX8B 4ZDHA 1JFHA 1GS6X 1GC1L 1QACA 2ALAA 1ECYA 2XPGB 1I7TA 1QYGL 2V3EA 2VXVH 4HJUA 4OAWA 1OB1A 2UVEA 1FI8C 4YDMA 4EE2A 1GH7A 4HALA 3P73B 4HMDA 4ONFH 4LAQH 5SWSB 1MFCL 1NMBH 2G0LA 1Q1JL 5DRXB 3KG5A 4N5EC 5FK9B 3G5YA 1WC7A 4EEEA 1M7DA 3QBTB 1UD8A 3BESR 1CU4L 4M6OL 5HHQB 2ZPKL 5I8OH 4PS4H 4K5LA 3D05A 4G1MA 2WWOA 3WUZA 1ZSHA 4F7TA 3O2WL 3FQNA 2OXHB 2ZXAA 1I7RA 2Z4QB 3MBXH 4JGJA 5EFIA 5FA3B 1DUZB 3U6RB 3CFBA 3BGFC 1G6RA 1U8PB 4NKDB 3WLBB 4PJEE 3WYRA 4WWKD 5IFJA 3KPQA 4R4FL 4OCLC 4YHNB 5DD5H 2VMEA 3FZUD 4V1DB 4LCWA 3D07A 3BZ4A 4Q0XH 3S5ZA 4BZ1A 4Z7UE 4JY4B 4X6DE 2XT1B 4X4XA 3CAFA 3TPUB 3DXAE 2ZXDA 2AABL 2WLJA 2H2SC 2ERJB 3PJSA 3WN5B 3MAWA 5L2KA 2X1OA 2WVUA 2XNAA 2ZOKA 4CW1B 3DA0A 4JMNA 2Y36L 3R8BB 4JHVA 5D7LA 2HN7B 5BW7C 5C0RH 1XQ4A 1T20A 3UO1L 2PCPA 1MFEH 1UD2A 1EAQA 5CJXA 4V11A 3U9WA 3AMKA 2IEPA 3U48A 4ODUA 4BFFA 4XC1L 5KZCD 2BNRA 5JYLA 3P3RA 4XCCH 3F83A 3O6KL 4S1QH 4IMLA 3RA7H 1MHCA 4GXUM 3BMVA 3JWDL 5FV2A 2WLMA 5BNXD 4JM2C 4MRCA 1I85C 1WZLA 4DN3H 5L9DH 1N59A 2R2CA 1ZVSB 3TIDA 4HF5H 1OM3H 2WC7A 3ZT7A 1UZ8B 1D9KD 2W9DL 1NUGA 5EU6E 1KZYA 3C6EA 4M7LL 3IYLW 4AH2A 2K9UA 2XIDA 3B3IA 1GZQA 3CN0A 1FNAA 5CU5A 3ISYA 3JTTA 5HTSA 1F4HA 2HLEB 2AKRA 4N9GB 2NY6C 4Z77B 4YGVA 4OFQA 5IVZB 1QR4A 2VZ1A 1AVAA 4I87A 3IJEB 4XVUD 3FXIC 43C9B 4IRJA 5LCVL 5L9DL 5J13C 1I1AA 3EJQA 3W39B 1T3FA 2NYZA 3RVUC 3WENA 1MKFA 4KKCC 3TWYA 2WV3A 1VZHA 2G2PA 3C5JB 3GLZA 4IDLA 5J57B 1D5RA 1PEZA 4R2GD 1KIPA 4PJ8A 4H13C 4GO8A 1R4XA 3TJHC 2FWOA 2CLZB 4W70A 5E6IA 1C8PA 4FLRA 2C3XA 3VXSE 1X44A 2AJVH 4B5ZA 1GL4B 4KUZL 4M03A 4KK6D 3MROA 12E8H 4GW4B 1N4XH 5JW5B 4JFDB 3MX0B 3PP4L 1KCBA 2EDHA 4J1UA 1VRSA 1B2WL 3PXLA 1KLUB 4ZPTA 2ZOLA 3ORJA 3FQXA 5CR8A 4D9QD 2VR6A 2QKIC 1J0JA 5LGYA 5FO2A 1XFPA 4P4KB 4XI5C 4Z5RA 3HUJB 3T6ZA 3D25A 4DKAA 4LEOA 4NWUH 1AGFA 5F3HA 5KYNA 2FB4H 4ZYKB 2R0LL 2EDNA 2F8OA 5EIIG 3SPGA 4WF7A 5IQOA 3EYQC 4I3RL 1KLGB 3EJUA 2HPTA 1YN6A 4OZIA 2A9NH 1R5IA 1YNTB 4GRLB 4KGJA 4AJYV 5FYJL 3TCTA 4CJ0A 4Q52A 1XZ0B 5CKGA 1IEBB 4ZX3A 5ANHA 4AJWA 4UT9A 1VESA 2FH8A 4H88L 2VJ8A 5CZVH 2TRYA 1IRAY 4N0UE 3RDTB 3SGJC 4EI5B 3GRWH 2OJEA 5DUJA 1EJOH 2IANE 3O6LH 4OFKA 4A7SA 4QGTA 1KBGL 3MV11 4AEHL 3NCYS 1OLLA 2XFXA 5L2KE 4DP7X 3SB3A 2ICWB 5C9JB 3AREA 4R7VA 4PG9B 4J6IA 1XGYH 2G2NA 1EGJH 4JHUA 4DGVH 4TULL 4A7GA 1MFMA 2DI7A 4HJGA 5FA4A 3U7WH 3MUUA 1ASOA 3BX7C 4YL9A 5DVKA 2Z31D 4GW5B 2AV1A 3QCTH 1F86A 3LMJH 4NZFA 4PYHA 2FO4A 2H0PA 2IMNA 1XWVA 1LEKB 3ZMNA 2AJSH 4N2EA 4FFVC 3RWHA 4L0YA 3NDZE 4PRHE 1XCQB 4OUUB 7PAZA 1ZGLM 2O26U 1V27A 2W9EL 3K6DA 5CNHA 4A39A 2EQDA 3PDGA 3V4PA 5K9JH 1FZKA 1BFVH 2WQWA 2RTTA 1L5GA 3QUZD 2XC8A 3GI8L 4FQXA 5EZOH 1BQHG 2P5EA 4E9YA 3F7YA 3GZQA 4JVPA 3L1EA 4JFQB 1BAGA 3HE6C 4PLJD 2WN3A 1GA2A 2DQHH 1GTFA 3KS0J 2ATKB 1UWGH 2DTML 5IR1B 4MXVF 3SPHA 1OVZA 4AZUA 3GXMA 4Z7VE 2E9JA 4NOFA 2ARJB 5I73C 1FVEA 1UOVA 1RPQA 4OF5A 3K2UH 1HZHH 4YDVA 4APXA 1EMTH 1KJ2A 3INOA 4K9JA 4QPEA 3TASA 5C3IA 3C5SA 2H1XA 15C8L 4N9GA 4WHYH 3D3VE 4PM1A 4I3SL 5DVNA 3ATAA 1DBJL 4OLUH 4P5MA 1Y6NR 2ZWSA 1ACZA 5ADPH 3AGVA 1U8KB 3T9WA 4M7JL 5BQDA 1QATA 3X14B 2YA0A 1QBLL 3JVGA 5HDQL 2ENPA 4RGOH 3ULSB 1AHKA 3DX0A 9CGTA 5I1IH 4JN1L 1R5IB 4GRLA 3RVWD 3DROA 1JERA 4MJID 4YIQA 3X17A 3VI3E 5LWYH 4HJEA 3L9RB 5DHDA 3DV6A 2OMZB 1FIGL 4XNYH 4J3OC 3ZTCC 3PAYA 3KW8A 5DYOA 3ARDC 1DVTA 1HI6B 3T8VA 2VDKL 1T20B 4KRMB 4LSRH 1YNKH 4Y2DA 3DI3B 3ZLQC 4RA0C 4TQHA 3CZUB 4WU5A 3ARFC 4Z3TA 4H26B 4KVNH 2EDKA 4UM8B 4PREA 2P52A 2BP3A 4JFDA 3IDNB 4K7FB 1IIKA 1WAAA 2VR5A 5GGTH 5DUMH 1NDMA 1G1CA 1WSST 3ARUA 5DA4A 5KSVB 1JPEA 3LS5L 4WV1C 2JXMB 2DIBA 2PXYA 5HPMA 1LDPH 3ARVA 5AUMA 1FUNA 3IJ8A 2QEJA 4OLYH 2OMUA 4E9VA 1NBYA 4O51B 2DWXA 3D18B 3OG4B 4WTQA 1J88A 1R6VA 3NK4A 2HJKB 5IVZA 1MHPL 1NBCA 4M1DL 4OQTL 1IBDA 4PJ7B 3JUZA 5I75C 4BZ2L 2NR6D 2AANA 5AD0A 1YUHA 3KWVA 3QUXD 2CJUL 4NQDA 1FVEB 2YWYA 4ODXA 3BAYA 4MNHB 5H37H 5CFHA 5KBDA 1MJJA 4Q6KA 1WD9A 2WLKA 1LE9B 1OCCB 3H9HA 4GS7B 3ZE2B 3QJZA 3TIDB 2W0KA 4RDQF 4W9CC 4OF8A 3G5XA 4BK5A 1MXDA 2X2UA 2OCJA 4ZSOE 4M7ZB 4KI5E 1AFVL 4K2UL 1NEZB 1OP4A 1YEDB 3A21A 3VH8B 4XPTH 3NSXA 5FYJE 3FO2B 4E5XA 3L45A 3BP4B 2EIBA 4M02A 1ZXKA 3EGXA 4OT1H 4PLNC 4NO5B 4D8PB 4PLOB 4DERA 3EOBA 1NCBL 4GW1B 1V7NL 4HJJH 1S9WA 4FXLA 3M45A 2AJVL 2VLKB 1S2EA 3CQQA 3ULVD 1TLMA 1XGQB 2EYTB 1NCAH 4OGAC 4XOEA 2Y7SA 3EO9L 4WVRA 5DJ2B 2IQAB 5C07D 4JR9H 5LCVA 1JPST 2WGNB 1U2YA 2BK8A 3STLA 5FCUH 3GIVB 1KEGH 1USQA 4Q58C 1J9QA 3SQBA 2I9TA 4JQVA 2VRAA 3SDDC 5IJKC 5D7JD 5IB1A 3X12B 2VH5H 3WMQA 4JUSA 3OVUB 1KLGA 2M8XA 3JTSA 5L6YH 5AVSB 3SCMA 1MRCL 2Z31C 3IU4L 4L9LA 5AWNL 4Z3FA 1W72H 5KVGL 3C60B 3HUJA 5J06A 4NJAL 1AQDB 3BUYA 5JPNB 2V9UA 5A2FA 1KCSH 5DD6B 1DN0B 4D0CA 4HWNA 2RCSL 3CC1A 3U46B 1DEEA 3OHMB 2FQFA 5DHVA 3CVCA 3UC2A 2JE8A 3MJ8B 3L5JA 5HHXH 3QFJD 1QABA 4S2SA 1EUTA 5ID1A 3ARWA 4L0ZA 5D6DA 1WEJL 3IFLH 5K39A 4GRLD 1UUSA 1KYFA 4ATWA 1XD1A 1T2XA 3FDWA 4XMKL 4XZUB 5KVEH 4RRPM 1F13A 5DK3A 2E59A 4QIRA 2X0VA 1WAAE 3QO1B 1JXKA 1I3GH 4GY4A 4L8CA 4PGZA 1VCAA 4HK0B 3AITA 2H2PC 5JW5A 1N8OE 4EIUA 4OJFL 1AGBB 5F7UA 5E6IB 1GJUA 1XZWA 1WFNA 2PYEA 2YRBA 3QJTB 2OMWB 3GC3A 3MRBA 2I85A 4C56D 1IIIA 3K2KA 3P77B 4JFHE 5LO7A 1CTNA 2Z91A 5EORL 4NRZB 1OAQL 1KCLA 2P7TB 3OLIA 1TQVA 5C0CB 5LNEA 4GRWH 2Z0UA 4BFJA 2EUVA 3EYSL 2NXYB 3DNKA 2AJ3A 1NINA 1J8HA 5D7IE 4JM4H 2KZKA 2YD4A 4FZEL 3HZVA 3NFNA 3GSNA 5FUZH 2MOQA 4XE0A 4EZKA 4GUCA 5CCGE 3DPBA 4HGWA 1MI5B 1NIEA 1RZPA 5D2NB 2Y25A 1FDLL 3W0WE 1T22B 2VR9A 3O3EA 4APQB 3FSOA 1JK9A 4DGIH 1C08A 1TZ8A 2FJSA 4G3YH 4TOYL 1CFNA 4N0YL 4NZRH 4HH9A 2BIQA 4DOHE 3PUUA 3VFTB 3HBQA 4FULA 3FPYA 4I1RA 4UU9B 1HHGB 1ETA1 1UB6B 2LHAA 2OFQA 4LAJH 3FQTA 1GGBH 4TLTA 1C1EH 2ZUXA 4F58H 3VDBA 1KG0A 1ZANH 3PGDA 3ULUF 2WLZA 5CM1A 2PCPB 1E3FA 3UZEA 1I82A 4NPKA 2J20A 4OKVB 4UAHA 2OSLA 1Z9PA 4KU1A 5EOCH 1KXHA 3D39B 5AW8B 2OTWB 2CO6B 3I3EA 3OKNA 1DVFC 4J6RH 4XN9A 2OR8A 4MVBD 1AO7D 5IG7A 3CBJB 1FO0B 2ZXBA 3EGSB 1ZTXH 5IQ9B 2NZ9C 4NPJA 3SE6A 4LHUG 2R4RH 4LVNB 4FA8A 1KMGA 3PJNA 2FX7H 4PGCB 5G4OA 5D2NC 4XMTA 4NM8H 3KPLB 1DSWA 3EJJX 5DD0H 5DJ0B 5E4IA 1MFNA 1MIEL 3FFCE 3PP3H 2VXSH 5C2UB 1PDKA 3PREA 3ZRCC 4RMVA 4LFHD 5IOPA 2IQAA 3BE1L 1RUPH 2EDTA 3ES6B 5I30H 2VSMB 2W59A 1CXKA 3AWGA 5F1KC 4AYDC 5KS9B 3BKML 2J5WA 3TS8A 1SEQH 3OR6B 4HWZB 4BKLA 5EA0L 4X80L 5E2VH 4GH7B 4WEEA 3F3HA 2BS71 1IBYA 3RGVB 1QSEB 2EYRA 5CEYA 3BGAA 1UJ3C 3PHSA 1MCDA 1LWJA 3SJVD 2VR4A 4IS6B 1H6UA 5CSGA 2IDFA 3QUYD 3BVDB 5E1IA 1KBVA 4KKRA 4UTBH 5E1AA 1K8IB 2PPCA 4DPBX 2ENJA 3GI9H 4ODTL 3S35H 2EABA 1U8QB 4BXSV 4TVPD 2P5WB 1OF2B 4U7MA 3WNJA 5KBNC 2X4OA 4L29A 3WFBL 4ENED 2OAAA 1LEGB 3Q8BA 4K8RC 3DO7A 1CURA 3MYJB 4MDJA 5DEFA 2CMRL 1EHLH 4N1EA 3B6SA 3K4AA 3OZKA 4EN3C 3WUWA 5JZ7C 1FV1B 2IPKA 1L6XA 2PWEA 4FHBD 3RZCC 4BSWA 1N2RB 4GRWB 2YKLL 2Y22A 4MNGE 3W2DH 3C75A 1DJZA 4XE5B 3N6YA 4ZXBD 1PZUB 2TAAA 3UTZB 4L3EB 3F5WB 3HLAA 1X4XA 3KHQA 3H0TA 1URLA 2YPVL 5JQ6H 4XC3H 3QEQE 1QWHA 3GTNA 3JZYA 4XMXA 4C8XA 2YA1A 5AKRA 4YSEA 5B3NA 3BD5A 3FQ1A 3MBWA 5IMLB 3CFUA 1DQDL 5KOMC 2BSED 4AXWB 4CC4A 1AD9B 2BY3A 2V3DA 5CN2A 4YJZL 3GK8H 4JZOA 1EAOA 1XGRA 1U8HA 1YY9C 2A3TA 4PRPB 5EUKB 4KJQD 4WFED 5BZZA 4R97C 1KCVH 2FO1A 2D7QA 5BS0A 3U7YH 5G5DB 1AMXA 1GZPA 2Z7UA 2MKWA 3QS3A 1D7DA 1XH0A 2D73A 3CDYA 3VD9A 5JXAH 1C5CH 1NAKH 3TFKC 2JCCA 3WJMB 1ADQL 1FL3A 3NSJA 4U0RB 4LNRA 4GBXA 4P2CG 3LNFA 3RU8H 4WGKA 4HAKA 3BVTA 1C5CL 1NAKL 3QULA 4HIXL 1NCWL 4OVVA 4UB0H 4A7TA 1RLWA 1FFRA 3I9IA 5KW9H 5HHOE 4OFPA 2FK9A 5EEVA 2CO7B 2HT4C 3ZTEA 1E8YA 4Y0GA 5EBGA 1ODAA 4QWWC 5DCCA 3WV0A 5D55A 3U9UA 1PGRB 5MENB 5E7BA 3H9ZA 4CVZB 4NM4L 2JKTM 2Q7NA 1BMZA 4YDLB 1JGDA 4OFDA 2APTA 1X9QA 5CEXB 2GUYA 4LE8A 3CBRA 3T08A 2JSFA 3VXUA 4LCIH 4HUXA 2X9XA 2EXWD 5ALCH 5A2JH 4R7NA 3VD4A 1BIIB 2CKBA 5L8JB 1DDHB 4HX1B 4RWHA 1NFDA 1TSHA 4D94A 3ILQC 4X5RA 3VCLA 2BHYA 3WHE1 1IAOA 3VD5A 1HILA 3BEWB 5TD4A 1CFVL 1XSKA 3CJJA 1KB9K 5FV1L 2B0SL 4RISH 4YQXL 3BPLB 4DZBB 2PW1A 3KM1A 1AMYA 2OCCB 2OMTB 3QFGA 4PJFE 1JYVA 1DO6A 4LARL 1WFIA 5JW4Q 3CXFA 1TZAA 1W0YT 4QF1A 4ZAKB 1EXUB 3UAFA 3PAZA 5KSBF 5GRUL 5IEHA 3GMOB 3QUKB 3FN3A 3UABA 3V4UH 1CI5A 1UD5A 5C0IA 4OF0A 4Z3GA 5ISZB 4G6JL 1OAXL 2O72A 4P2OC 2UYLA 4AUJA 3KAAA 1K8DA 4ZUTB 3WEOA 1X5JA 3HI5L 2WD0A 5JR1H 3HPJA 4IGBC 4ONGL 5EU7C 1DVZA 3LEVL 4ODTH 3S35L 1WBXA 2EE2A 4GSQA 4AG4H 1FYTB 3FU9A 2BNQD 5IUSA 5FLVA 2CLRA 4HJ0D 2V17L 4LXFA 4RRPG 1MFDH 3BQUA 3BPCA 5D72H 5E2UH 5LVEA 4M4RA 4BH7A 2LFEA 1E4KA 2V8LA 5CEZD 3O3AA 4YSCA 4WLCA 1VFBA 2ZSWB 3O4LD 3GTVA 5GSRB 2O5XL 3FUIA 4HIIA 3F7VB 2VDOH 4FXKB 2VLJB 1II4E 4Z7WA 1J9RA 1G6RH 15C8H 1ZLVH 3NZHL 2QDVA 5C0EB 1L0YA 2BIPA 4EJ1C 3ZX1A 2BNRD 5L0QB 2IOIA 4LSVH 1J10A 4NNXA 5F7NC 4UZGA 1NKRA 4JO2L 4NXSA 3K4DA 5FOBA 1IUZA 1WWWX 4NIYE 4Y9GA 5DJ2A 3UTTB 4DP0X 2WBJD 1JDAA 3HI6L 4YBHA 4MXWL 1KDIA 4FD0A 1XDTT 4A55A 1GGUA 1O5PA 2Y7LA 3BO8A 3L81A 2ZTBA 1A3QA 1NAML 4M8QB 5JLZA 2AITA 4W9DC 3BKYH 3DRQA 5EZOL 2NY5H 2VITB 3O6FB 4MTMA 5JOEA 1GIGH 4KJWC 3FQRA 3HBZA 4WO0A 4Y2NA 2VKXA 1P7HL 5CGMA 3V0JA 2MOVA 2VQ1A 3INUL 4PBDA 4PB9H 5C0BD 3SPJA 5BO1H 1E8XA 4JZJB 3UJTL 5DMJB 5SWZE 5F3HB 3UYRH 1IAIL 2H3NA 2WNWA 3W3BA 2R1YB 3OKKA 3EH3B 4ZODA 4ZTEA 2YAEA 2AJZB 3UACA 5GHWL 2UYLB 1U95A 3D4CA 3PWPB 4AC4A 1OHZA 1EIBA 2VKWA 3B2UC 2XICA 3SKOB 2I69A 5E9DD 5IJCC 4OB5L 4QRPE 3US9A 3FU6A 3HNSL 3CDZA 2QKIB 4W1TA 4K55A 2WJ5A 1GYWA 2CO7A 5LBSA 5SWZD 4Q9BA 4F5CE 2CDFB 4NQVB 4P3CH 1FO0H 1I8LC 4LP8A 1P7QD 2VR3A 3B7RL 5I8KL 3I6LE 4KZ0A 1NEZG 4JL2A 4XGZA 3UYRL 3BKCL 1UACH 3LXUX 5K69A 1FZJA 1X3DA 3F7RA 5CN1A 5KBMA 4AGMA 3O3DB 2GIMA 3AG3B 5IVXB 4FERA 3HJ0A 3JWNC 2VDOL 3HE6D 2VM9A 1JI1A 2NYYC 5FUZL 5F6IC 5D1XA 3SBWA 4L3CB 4YPGB 5FFGA 1BIHA 3C2AH 3GHBH 3SBQA 5E6ID 2XHNA 4Q8BA 3ZE1E 1U91A 4AV4A 5IV2A 3HC3H 2LAAA 4NWTL 2XLLA 4JZOB 3VGAB 3R8QA 2CCLA 5J56B 2NQDA 1H0DA 4X98B 1NH6A 4XVSL 3V5HB 4RFOL 4LCWD 1LHZA 1CYWA 1JHKH 3ARQA 3IFNL 3LKSA 3OXSB 4Y9EA 4WNQA 4KQ4L 4WGVB 4HIHB 1QA9A 5GZNC 4H20L 1S7WB 3SDAA 1AHWC 3BVXA 4MQSB 3BFOA 3G9VA 3ZHLA 4AQ1A 3ZTNH 2WQUA 2DDQH 2YGNA 3ARED 1FL3B 5JIMA 1NGPH 3QFDB 1IM3B 4XTRC 1MN4A 2MWCA 3TPUA 5KVEL 4YR6A 4OLWL 5FO7B 3NIFB 3CDGB 3VI3F 4LRIA 4GQPH 3VFGH 4D9RD 2MNUA 4XNMA 4LCWB 4WEMB 1OLZA 4HKJA 1MH5B 2VISB 3S3JA 3HCVB 5CR1A 1PY9A 3B2DC 1Q9LB 3QJUB 5I9QB 1WGOA 2NLJB 2G30A 1SJEA 3FQYA 5EO1B 4FQ1H 4JANA 3L3HB 5IBUG 4ALAC 1SUJA 4OZGE 1ONQB 4C4UA 4V1DA 4NDMB 5AOZA 4NM4H 2B59B 2DBLH 4MHHI 4X9GA 1PDKB 4A66A 2YQBA 3ABKB 4Z7UF 2OZ4A 3RTQB 2F15A 4PJXB 3QT2A 2E7DA 4U3XA 2IWEA 1G7HB 4ZFOA 2JV6A 1FYTA 4FCHA 1RVFH 1N19A 3VVWA 2BH0A 1J5CA 1D7BA 3M7OA 3P2DA 1E7VA 3B4NA 3WMPA 2WYIA 1ROCA 1X7SA 4H25A 3FCBA 2BP0B 1T1XB 5I26A 2A5UA 4ZPTB 4KRPB 4K07A 4LCIL 2A6JA 1JTTA 4MJ4A 1ET8A 3WFHA 4AL8H 4BGLA 4QF1B 1FG9C 4ZAKA 3UZQA 3UO1H 3QUMB 2WAHA 3OLEA 5EBMB 3VU1A 3SEPA 4IW4C 3P4OB 4ODSL 3LZPA 4JDVA 4CC1A 3D0VA 1YHPA 3SOBH 4R0LC 3IT8D 3KWXA 4ZFOL 4X9FA 1PLBA 1ZPUA 2XIIA 3GJFK 5T1MB 3U25A 5AB1A 4F2MA 5GS1A 1FBIL 4TSCL 1Q0XL 4AM0A 5DO2D 3TV3L 3HE7A 3K6FA 1OK8A 3DTDA 3OWEA 4TLKA 5L0QC 5EPMB 3RVTD 4S0TD 1U2CA 3UPRA 1OB0A 2AK4B 3BP5A 3HC4L 2VISA 4KXAA 2D7MA 3BZEB 2F54E 1PAZA 3ETBJ 2YQGA 2UZPA 3UAJD 1KJVA 5E99H 4H1LG 2XN9D 1S9XA 2W60A 5DMIH 3K1KC 4NCC2 3O2WH 3GJEB 4PV9B 3VNZA 5E8OB 2AQTA 5KZCB 5T1LB 1DR9A 1RURH 32C2A 1L9PA 4G9FB 4LMQE 3L9YA 3SJVA 4HS8H 1KUMA 3RRQA 2IWKA 3LB6D 4LEXL 3BUBA 1RHFA 3P30H 2PO6D 2YD3A 2EXWC 4Z7QF 1ZVSA 4HH9B 1JV5A 1M3IA 3OGOE 4JL1A 3VRIB 3ELQA 4DFIA 3VWKC 1DE4B 3U0TB 1L4IA 1LO3L 1HNGA 2WW8A 4K71C 4OZFA 5FGRA 1JZGA 1T22A 4ZYKA 3EYVA 2A77H 3WFBH 1MCFA 3KLAB 4EMZA 1E8ZA 1NGQL 3RLSA 4B0MM 5C0AA 1CGSL 3MKKA 2AAAA 4TNVF 1E6JL 2HFFA 1JF5A 5B39G 3U6XA 4BWTA 2PUQT 1I3VA 2BRRH 2NY4D 3IBEA 3LPGA 1FC2D 2AEWA 4JGUA 4NBXB 2OTWA 3I84A 2CDGA 3PCYA 2YPVA 2EP6A 1MEXH 4PIRF 1SN0A 3O6FD 2L7UA 3IFPA 4FQHB 4KUCD 4LRNH 5BO0D 5EOCJ 2FVNA 3QUML 4FNTA 4Q56A 1BVKB 1NTDA 3Q5YA 4LLUB 3EH5B 3VWJC 1GS7A 1UKQA 1AXIB 2MCPH 3UBHA 3BCFA 3KVPA 4XRCB 1Q72H 1UHVA 2AXGB 2YKKA 1NQBA 4NT6A 3IRZA 4JKWA 3HG3A 1CD0A 4G11A 2E47A 1JZ2A 4PJ8B 4AUYA 4E2OA 5DJZB 1JZHA 2CIKB 4PRIA 4K3JL 3GTTA 3CCHA 3HAEG 2YRLA 4IRJB 4Q97A 3S96B 1NC4A 1QFWL 1X5GA 3K6IA 4Y4FA 1SJXA 1NFDE 3IKCA 3C60A 4NN5C 3KDMB 3TO4A 3UZVB 4M8VA 3UIZA 3ARGB 4AGLA 2IDTA 1TIUA 4EKXA 3WL9A 3DSFL 1F58H 4DPCX 3FYIB 2FEEI 3ZSTA 5SWSA 5HJ3B 5E5MA 1NANH 4MFHA 4PJFA 5EA0H 4MD0B 1GJIA 1I7UB 4NP4L 4FJZA 3SY0B 2WQAA 4ZNCD 3EXJA 3MA9H 1UXMA 5EOCL 1VHPA 4ZUSB 3PQYB 1CFSA 4MXQD 5GJSH 3KGSA 5E08H 2XG4A 4ORGA 1R3JA 5IF0B 4KJWD 3ARBB 3UROR 2PPDA 2WWKT 2EXYD 2XBTA 5KYWB 1LP9A 1T5WA 3QQDB 3QC5X 3H7LA 4KY1L 3IXTB 4CDGC 1JRHI 5C6WH 2VLRD 4ANKA 3L3JB 1FJ1B 3HPLA 1I9EA 1RIUH 3O2VL 1RUQL 3ARXA 3CLEH 3BUPA 3F04A 4R4BA 1SXZA 2OMVB 1G9MH 2OK0L 1BEYH 1YECL 3SCMC 5F1NA 3ZOAA 1WAEA 2NT0A 4XB8A 3VDAA 1HX0A 3V5KB 4WI7A 3BVWA 1SLXA 4NAMA 3NMEA 2BZDA 4WNQB 4XWGL 5LBSL 5AD0B 4MJ6B 5DMGD 5F1IA 3QAZC 3MRFA 4JDTL 1ONQA 5CJOL 5B8CB 1YEDA 4ADGA 5FCSH 2J8UA 3ECWA 4P4RA 3TVMB 3KXFB 1ED3A 2IOOA 3BW9A 2DTSA 4YK4B 3E0GA 5BO1L 3NZHH 4OJFH 4MD4A 4UINL 2W38A 1UOLA 4HJTA 1TFPA 3NIDB 3KCPB 3WEXB 3PIQA 4X2UA 2BVTA 4PJ5D 3RTQA 4YZFF 2X4PB 2NY7L 5KSAC 2VB5A 1B4LA 2C4FU 2VC2H 4RA3A 3RILA 4OKDA 5BUPA 1A7RH 2CHZA 3D9AL 4NNPL 5FA4B 3W1ZA 3LQAH 4GAYA 3TZVB 3EJRA 1MWAB 2FO8A 1HINL 4PAZA 4TRPH 4PEEA 1YMME 2F5BL 2QGDA 4P48A 4NB7A 4UTCA 3WNPA 1T4KB 1AQKH 2FT6A 5KVDL 4DZ8B 2QV4A 2XVBA 5JDSB 4DP4X 2K0RA 1DJYA 4QXUH 3FTGB 1X5KA 4I0PD 3D12B 1B2WH 2E0PA 1SUHA 4PW9A 1DBAH 1MQ8A 5B8CC 3D2UD 1JUFB 2ZKXA 3DARA 3VFOA 5B1KA 1VFAA 3REWB 2B1HL 1OD9A 5CS7A 1C5DB 2GJ6E 4E9LA 4WW1B 2APXA 4EUPA 5KYYA 1MFDL 2V17H 2QHRH 4WFEE 4I7ZC 2APWA 1RUML 5DS8A 2V7HA 4HIHA 4XBMA 3H7BA 4DGYH 4XN8A 1TEYA 3GSQA 2VL5A 4M00A 2DS4A 1ETB1 4TVPE 4WEBL 3GBEA 4HDIB 4OZHE 2AXHA 5EUOF 1E3XA 3O9WD 5DSCB 3KWUA 4QNPE 5IP4A 3O3BA 4LIQH 4R7DA 4XMLL 3I9AA 1EXHA 3IMUA 4PQXA 3B2VL 3WNKA 3IWUA 4PJCA 1YNLH 3SDCA 1FVDB 2EVGA 1QG3A 1TZGH 5DVOA 2FHFA 4LARH 4RGMC 5T1KD 3V9FA 1W72L 2SEBB 3FTSA 4N0RA 4AYID 1NM4A 2DQ6A 3HG1D 2K7QA 3TT3H 2JI2A 5ID0B 5FPIA 1D7FA 4WI5A 3RGVC 2KPNA 4TSAH 2O5NA 3HZYB 5F93C 3PGCA 3PE9A 2EEAA 2Y4SA 4QOKD 1TQTA 3U2IA 4JZJA 3QO0B 4O58H 1N8ZB 5ETUB 3WNIA 1IJNA 3B7SA 2MQGA 5DD6A 5DXWA 4D0CB 4TSCH 1QBBA 4R96B 3U9PL 1KXQE 2H26A 2I25N 1ILSA 4JRLA 2ZIDA 5B1JA 5HHPB 3BMWA 3UMTA 3VRLE 4KI5F 1ACYH 4WTZG 1IT9L 1XBRA 2EDWA 5J0BA 6PCYA 2BFVH 2F53E 3ZDZB 2RHEA 3OKOB 2CUMA 4P8QA 4JCWA 3SJVE 3GRGA 1DBKL 5KW9L 5C08A 4BKSC 1RZKC 4ZMTA 1G7IA 3HMXL 3TBSB 2WXLA 3DXAB 4J4PA 2FJFB 3H53A 1F3RB 2I27N 3F6JA 3HN8A 3I75A 4OI8A 2DBJA 5DD3L 1QNIA 3BFWA 1A6ZB 1TTAA 2XKSA 4MKMA 3VE0B 2NY4B 5B22A 1VPOL 4TNGA 3D0AA 4N2KA 1EGJA 5F96H 3EFOA 2QPUA 4P2OD 4ZI8A 2NQCA 1G4RA 2GJZB 4D8PA 2LABA 2XKNA 1UWEL 3W0WA 3IDMB 1DQMH 3P2TA 5KYUB 4X6CA 2VABB 5BRZE 2QTEA 5T3ZL 5IROD 3LN4A 2JKNA 4PGDA 3T8XA 4AJVA 3AXLA 3W9DB 1JYWA 2VR8A 4AWJC 3WAJA 1F6AA 4MJHA 4MNQE 2EIJB 3Q6FB 3DSNA 1A9BA 1FZOA 4JFFE 3EO0A 5DJYB 3RTQD 1Z2KA 3BRFA 2B8OT 5GZOD 3IMSA 2NUPB 3QUXC 2WSKA 4RWYL 2VM4A 4M6MH 4RQQA 3O3AB 1GCYA 3S3DB 2H0FA 1U3JA 2H26B 1P1ZB 3Q06A 4NZJA 4ZW3A 4HIEB 2MNJB 2IF7A 1WTGT 5DRZB 1MF2L 2UWEE 5HI3C 3EJYC 4ODHL 4JRYE 2WLNA 5FGSA 1G6VK 3QUZB 4W93A 2ZYHA 3VFSB 4PBXA 3HZKA 5E0QA 5EC1B 3SGKA 4H8HA 4HX1A 3CHPA 5DZOA 1J11A 3PABA 2FQEA 2F7QA 4KFMA 1ECZA 3DIVA 2DYSB 4HBCH 2JKSA 4NKIH 5HDLA 3NCMA 5DQJB 2QTVA 4XCNB 2XV0A 1A5FH 1KDJA 2AK1H 2OMTA 1CR9H 4JAMA 4NM8L 3MRLB 3PWVA 3RUGA 3O3BB 1FGVL 1DQLL 1R5VB 5F8QC 4Z7OB 4ZXBC 4Y4KD 1AR1D 2VZUA 1EZLA 4G8AC 5KJRL 5IUCA 1ZTXL 1FVDA 2R29H 4XB7A 3P9LA 3HUJE 1CTMA 1KIPB 4PUBL 4UT7H 5CLXA 5FHAH 3QIUB 5E5RB 5MERA 1SEQL 4GBXB 1JXGA 4WNSA 43C9A 1YYCA 1HZHL 3FU7A 4NPYB 5GGSY 1VAHA 2W95A 4Z3HA 4HKBA 3FT3A 5I16A 3ARGA 3QRGL 4GXVL 4JFVA 5D7LB 4UBDD 2WMPB 1SN2A 4MB1A 5ECGA 5A1AA 3Q8CA 2IANB 3IEAA 4X7FC 1WZAA 4TULH 1X7QA 2YSSB 5E56A 5AVTB 5L2KB 1JZ5A 3VSQA 3NJMA 2X6MA 2GAZA 1YY8B 1YEJH 3HE7B 4GUPB 1JUFA 2VDPH 4JFEA 2FLRT 4W9KC 1T5XB 1F3JB 1TITA 3INUH 2C1OB 1IEAA 1DQQB 4HULB 2NW2A 4RZKA 1BG1A 4IOSD 3HC0B 4XPAL 1L6PA 3V7AE 3LZFL 1KJMB 1NFAA 1T0PB 1I1AB 1LMKA 4HK0A 4PRAB 4HV8A 3W39A 5CEZH 1N5YL 3MV7B 1LILA 1PZSA 2EYSB 1XXFC 1W6WA 4CJ1A 1BPVA 3TP4A 3BAIA 4HEMA 2CDEA 1W80A 1CFBA 5GJTH 2WUCL 4GQ9L 1T1XA 1OAQH 1UH2A 4PJ8D 3IDXL 1TCRB 1BQRA 1I4FA 2Z31B 1WC7B 2QSTA 2AFNA 4XX1E 4LSVL 4LEEA 4MDJB 1HJCA 1LWRA 2UXGA 1XGTB 1WD8A 5J3HD 3BDYH 5LXGL 1DSFH 1MZYA 3KPOA 5KVEE 1FP5A 5H4YA 5MEQB 1ETJA 2XV6B 2HRGA 4LLYA 2FO4B 2W5PA 1CGYA 3H2QA 4LL9A 2P80A 4P2QE 4PP1D 3QEGH 3QJVB 2JKIS 2O93L 3CSYB 1KPUA 4G5ZH 2IXQA 4HZAA 2HCZX 5IGXL 1XF4A 1W6LA 3W5NA 1WEJH 3QG6A 5FUOH 2R0LH 1IILE 1RZIB 4IDJH 5DJDA 2YQ2A 2DJSA 5JOFA 2DMCA 2ZOKB 5F1OB 3VGDA 5LCVH 5B39A 9PCYA 1H5BC 5IREA 4M3HA 2FEJA 3K2IA 2OJEB 3IPEA 1T7YA 3WGVB 1Y7VA 4X5PA 4IEFB 1XIWC 1FIEA 1PY0A 1HFUA 2GYSA 1A14H 4POYA 3O0LA 4MAUH 2CRMA 3EDJA 2DMBA 4AT6B 3TX4A 1XXDC 3B9VA 1YN7B 3A6CL 1IC4H 2AJYL 5F1SA 5HYQA 4X83A 3V5HA 3WS6A 3TOPA 2HRPH 5AG8A 5DC0A 1URZA 2Z31A 1RK0A 1E9PA 4UQCA 1NCAL 4P4KC 1YYMH 2P5EE 1IJ9A 4FCAA 1QFUL 4Y5XC 5E6YA 4XVOA 3P3TA 1YAIA 4HJJL 4NO2B 4PRHD 2RR3A 3QDMB 4YDIH 4NUGH 1T7VA 2GABA 2BSTA 1IV8A 1THCA 4O4YH 1FSKB 3F62A 4AGNA 4JRFA 4YAQB 5A3IC 2F0CA 1V3JA 3D0LA 3L1OL 4BFGA 3FU5A 5EWIL 5MP6H 2FWOB 1JZFA 4JO4L 5E99L 1FO0A 1TQCC 2XWEA 3II1A 3MXWL 4WDIA 3DX6B 1MPAH 1OSEA 3X1BA 1KEGL 2NY6D 3K72B 5DUBA 5I5IA 3ME0A 1CS6A 4HKZA 3U4BL 1FWXA 4QRBA 1T6WA 2X2YA 1OCWL 5FUOL 3MHZA 2G3MA 2MHAA 4XC1H 4ZFZA 3R1GL 2VQ4A 1OGTA 2EICA 3EJZC 3HI1B 1GAFH 4V33A 1V7NH 1DBML 4NAQA 2ZPKH 5I8OL 5JHDA 4F7PB 1PY4A 1VB9A 1KCVL 4W9ZA 4G43A 1FL6B 4JY6A 2EDBA 4FYQA 2X9YA 4BIKA 4P46C 2Y24A 3VSTA 3QORB 4XBEL 1UT9A 1K5NB 3GNML 4GSDL 3VSVA 4YBQD 3SDXE 4J3OF 4G8FA 1J0KA 4UZUA 3UTPD 1TZOA 2JB5H 1X5FA 4PJGB 4PWGA 4OZFB 3WE1A 1KIQB 4ONHB 4XPFH 1DUYA 3WE6B 2DIAA 3HS8A 3RL2A 3K5RA 1G4MA 4BJLA 3CFEB 3NPSC 3CVHA 4NNXB 3WTTA 4L3ED 2EDOA 2W80C 3PQYD 2VMDA 4G7YH 2MSPA 3KYOA 4EOWH 1A02N 4E9SA 1MHPH 3IDIB 4M1DH 2GITA 1T80A 4QAWA 1SOSA 1S9YB 1FLRH 1HDMB 3J07A 5ICZA 3M17A 3AG2B 1J86A 5AW9B 1A1MB 5GISL 3TLRA 3VA6A 1DO5A 2CHDA 3BZEA 3QDJB 3IF1A 3UAAA 2E86A 2H32B 1MSPA 2ZSVB 3SKMB 1BZ7B 2FWLB 5ESVB 4BRVA 1A6TB 1Z66A 4NSKB 1AGDA 4EVNA 3MRNB 2B1AL 2WNKA 1AP2A 5B38A 2DQUL 4YZFE 2X53A 2DWEB 4GQQA 3NCYP 1HNYA 4LLWA 4C4KT 1VEPA 2FGWL 3JTSB 6FABH 1BBJB 1AXSA 4Y2OB 5DC4B 1L7IL 5DJ6A 1A9BB 1FZOB 1P7QA 1RUKH 2FJGB 3GWJA 4N2AA 3IS1X 2WM0A 3VQ1C 5IKCB 4GP8B 4D8OA 3N41F 5A2IH 4FGMA 4KQ4H 1P69B 4PLKC 2K45A 4XXCC 3H9HB 2AQQA 2OI9C 1OGSA 1L3WA 4R9HA 2OSYA 4FQJH 4JRXA 2UX7A 1J0ZA 1YMHA 2BERA 3VGEA 1TENA 2XKNB 4JDEA 4YUEL 1YUHB 4NQDB 5DI8B 2ZYSA 4FQQA 3DX7B 1MCBA 5LN8A 4L4VD 1BX2A 5MEPA 1IZKA 3ZL2A 3RL1A 2EYSA 4X6DF 5ECJE 3D18A 4Q74A 3TU6A 3CFNA 3ZE0B 2WOBA 2H9GB 3LHPL 1EZVX 3GSUA 5AVVB 3L5WB 1I3RB 1KFGA 1A1NB 2BXYA 5E5LA 1F8TL 4KHXL 1K72A 3MUHL 4PJIA 3OAZH 3MXVL 1I1YB 2O6DA 5ENWA 2NQ3A 1J12A 4U3HA 1TDQA 3KYMA 5IK3B 4YSDA 3RG1C 3NJVA 3QXUA 3ZW3A 2NTFA 1WP6A 3BGMB 1UTDA 2GG1A 4M93B 2P8PA 1J0HA 1HH9B 1A4CA 1Y1DA 3QXDA 4I0PB 1BQLL 1UWGL 2DTMH 1MJ8H 4K0OA 1GC1C 4GUOA 1QZNA 5C09A 4YSSA 4GG6F 1MI5E 1KPUB 4OB5H 2NW3A 4DVRH 1GGIH 2HLAB 2W07A 4ANVA 3T2NL 3ULUL 1JZDC 3HPJB 3T6QC 3Q6GH 1BA9A 2BDNL 1RD6A 3GXUB 5IROA 2EO7A 2ED8A 2DQGL 4FEIA 5T8IA 2IWGA 3H42H 3HG1E 3ARPA 3NG5A 5CBAA 4GQZA 1U3NA 1N6VA 1P1VA 5KSVA 3LY6A 2H5UA 2A1WH 5BRZD 1GOHA 1IGTA 4D3CH 1I4FB 2XFGB 2JJSC 4WV1B 4N2BA 3BC9A 3FTYA 3L6FA 4U33A 5DZJA 3U30B 4AJ0A 5IVXA 2BIHA 4WW2F 1WV7T 2B16A 2ZUWA 4ZUWB 4J3SA 4QTIL 3VXSD 3OAYH 1RZ8B 5CINL 3I3BA 3AT9A 1ZHLA 3UXFA 1JN6A 2HG5B 4L8BA 1DYZA 1JNNL 3TFBA 3EUUA 2WNGA 4YSUA 3VCLB 1N67A 3HZMA 1TQBC 2KZWA 4L4TB 3WU1A 3MV8E 1OWRM 2VRQA 4QXTA 1D9KA 2L4OA 4NI6A 4LVHC 5ERWA 4FS0A 2I9LA 2IBBA 5SWSD 3ILQD 3UPAA 1M1SA 5FM5M 4YXLL 1IBGL 2UY6B 3IGLA 3BQVA 1IT9H 2XV2A 4JREC 5BVPL 2QVKA 5D4JA 1CGXA 2OX5A 3X3GH 2LU3A 3TCLA 4JCLA 3FH5A 4AH2B 3T3PF 1HHIB 1M57B 2VJXA 3E80A 5EEXA 3ZUCA 5C0JB 1CT8B 1NC4D 1JWMA 2EDXA 2QADB 5D1QD 4BSJA 5KS9E 2FX8H 3LEYH 2DLGA 3K8MA 3PWLA 2ETWA 2DN7A 4MA8L 1OARH 1QSEE 2CRYA 3A22A 1JD7A 4PGEA 5GGRB 1TZHA 1S7RA 1XCTB 2WQ8A 3UYPB 4HCFA 7PCYA 1I1RA 5I71C 2N7SA 1R3KB 3ATFA 1GOFA 5IFHL 4NJAH 1SHSA 3ZVVA 1DJWA 1TZGL 2OXGA 4UILL 5DMGC 3WKYA 4Z3JA 2FBJL 3BGMA 4LZKA 1OZUA 4BCZA 2VZVA 1EEZB 2HFTA 2MPAH 4NFBA 3QWRD 5HDBF 5B7FA 4HWZA 2X6AA 3LYRA 1U21A 2HG0A 1CCZA 4P4KD 3QDAA 2AJUL 4OJCA 4Z0BH 5FCUL 3ZO9A 3P40A 4YFDB 1T1WA 3NIDF 3S5LA 1R33A 3NIGB 3SBPA 5BW7A 5T1KB 3WLWD 1EZVY 4MJ2A 4ZX6A 3QH3B 4ZO8A 5FX3A 2DI9A 2XI9A 3X1EA 4LSSL 2ADJA 5TQ0L 2CG9X 3GYRA 3BPCB 2E9BA 2J55A 4ECNA 2FBJH 1RK1B 1I85A 1VACA 3DVFA 3LKNA 4QHNB 4WHDA 5JUEH 3EGSA 4PJEB 5HJBA 5FFLA 4K4KA 4JDEB 4ZQKA 4MCMA 4UV7H 3L5XL 1U8MB 4V1DE 3CHSA 3DETC 1WDAA 4HF5L 3QXDB 3FB7A 4OZ4B 4X6DB 1MG3C 3LQZB 1OQOA 4KDTA 3W11C 4GG8B 1MDTA 2WXGA 4RCAA 1G43A 1N68A 5D71L 1CL7I 5T5NG 3L3KB 2XFXB 3B5HA 3JV5A 5C09D 3ESNA 4PY7A 5F89A 1A2YA 4X0KB 1KN2L 1E30A 3MMEA 4BFIB 1MOEA 5IMKB 1G9NH 3K6OA 2Q86B 4ALAH 3RTQC 1JS4A 1JGUH 4L9DA 4RMBA 1A64A 2P3YA 3GKWL 4HA1A 4JQIH 4HG4J 5E6IC 1OALA 2ICES 4IS6A 3F84A 2OL3L 3QUGA 2OYMA 2MPVA 1R3LA 3ZHNA 5IQMA 5E6RB 3P3SA 3D25B 4S10A 3L5HA 3QDHA 1HKLL 1ZDQA 4Y16A 1HCFX 1JV2A 4JM2D 3G6JA 1EBAA 4WSGA 3RVVC 2EE6A 5MENE 2P8LB 4N4YB 3HA0A 3IKCB 3T0AA 2H1PL 1FL6A 4JY6B 3Q2CA 1CDBA 1XF1A 1KYOJ 3QJRB 4HGKC 1WISA 1T0NB 1W72B 4POZC 2F54A 4D3CL 4U1LB 2MMXA 2GEEA 3K6SA 2V2WB 1Z7JA 3LZFH 4YHZH 3ZZLA 1TEFA 4Z18A 5KANG 5L7XH 3FL7A 2ARJQ 2APBA 3MXVH 2WVSA 2BVEA 4XP4H 1NCNA 3IETA 1T5KA 5ESVA 4LAQL 3C5JA 5C0DA 2BCMA 4XMVA 1E9OB 3NT0A 5B4MD 3IFPB 4FQHA 4JN2B 2GK0A 1JN6B 4WDIB 2FECI 4KV5E 5FW7A 4K23L 3NYKA 2EXSA 3PNRB 4AIEA 2QFPA 4QJ3B 5FYLL 2D31A 4AENA 5HYSB 1S7QB 3O41A 4N1CA 4PCTA 1ID2A 3M1CA 4WO4B 3TT1H 5FS5A 4YK4C 3UBXI 1QO3B 2JTDA 1E5YA 5E03A 3VXNA 2CGZA 5D6CA 3DETD 1FNHA 1WGVA 1ZSDB 1NL0H 5D1XC 1AQMA 4TNVK 3VXRE 1Q9WB 4PHXA 5E4EB 1UM6L 1FYTE 3HLAB 1AD9A 1YO4A 3LKPA 4WI4A 5CO1A 1RJLB 5JPNA 2CR0A 4LHUA 3T3ME 4KK8D 4X8XA 3UBXB 5JHLL 4F7TB 3L95B 3F12A 5TK4A 2WXFA 4GSRA 3TT1L 1CLZL 4FOMA 3GSRB 1P9MA 1H3PL 1UENA 1S9XB 2YGPA 5DS8B 3T3PE 3NEOA 3FONB 2J6EH 3HS0A 4FHKA 1B88A 2AK1L 2XQ0A 4MS6A 3MLXL 3CHXA 4PN6A 1KPRA 1ZJAA 2X4QA 4Z78A 1XD0A 1TJIL 1SJHA 4UM9B 1INQA 4I9WD 2R51A 3JWOL 2HA1A 3WTVA 2AERT 2W60B 2PO6A 2Z65C 3PDOB 1OGAD 5GXBB 2JJTA 3JV0A 4ZRGA 1QASA 5IFJB 4XMPL 3VQLA 1W8EA 4ISVA 1RUKL 4N8UA 2ED9A 2W65A 5A16B 1OF2A 4P2RE 5IMOB 4KQ0A 3W9EA 2GUOB 3RY4A 5I8CA 2UZYA 1XX9C 2IGLA 2WY3B 2BNUB 3GJFB 3LXAA 5E9DE 3X3FH 1P5VA 4LVOC 3VWJD 2O6FA 1NMAH 3QDJD 4JQIA 5T1JA 1XB6A 1RV6X 2KH2B 5KVDE 3PIQB 3DTUB 2CBPA 2BWIA 5IB4A 1UB5B 4B9GA 5FW8A 3AG4B 4HXBH 2VDNB 3VWKD 4HOMA 3O9WA 4GAFB 3SPIA 4AKQA 1B0GB 3IE9A 3KPMB 4GAJH 1U8PA 2CGRL 4NKDA 2I60H 1PLCA 4J39A 1TVBA 2OKMA 3EJCA 1D2OA 3OM3B 4BA8A 1FFOA 4KROD 2JK5A 2Y7OA 5TH2A 1OTTD 5IIEB 4Z7VB 4ABVA 1J9CT 1UM4H 2IAMB 1T0MA 2D8KA 3HVDA 5DFAA 4ZPVA 4NRXA 1DJSA 2EIZB 3PWUA 1Y6KR 1R24B 3R1GH 4QHLB 3OC8A 3PNWA 4I3RH 4JRYA 4AEIH 4ZX4A 2EDYA 3FB5B 1CMOA 3GSVB 4XOBA 5F1NB 3ATBA 3D3VB 3WTUA 2R2EB 3SGKC 3WI9A 5BQ7B 5GGTA 2A6IB 3VXNB 4QYOA 2C1OA 2DY2A 3S34L 2XWDA 3JBG7 5CD5C 1VADB 5EO0B 3DHJA 3DMMC 2X4NA 1SJEB 4HWUA 4JO4H 5EO1A 1YY8A 4R0LA 4WI6A 4K9EL 1M2VB 4MCYA 5HVWA 3BDBA 1BLIA 1DJXA 3LRHA 4YC2B 3SD2A 4BQBA 3A4FA 2DWDB 4J3VA 2GK0B 5DHEA 4EI5C 1T7ZA 4P2QD 4G9DB 1X5LA 4PMEA 4R26L 5CSBA 5E8DL 3TEXA 5A16A 4Y4HA 1BGXL 3ARBA 5DJ8A 4QUOA 2D7TL 1ZS8A 4UV4H 4N0FA 3BWUC 3FCSA 2IALA 3N91A 1CJYA 2H45A 1N7ML 2XU9A 2OL3A 1G7JA 1HQ4A 3PV6B 3U4BH 5JW4N 2V2WA 1XCXA 3H9YA 3EYOB 5ICXA 5KJ4A 2GTZA 4TTDD 1ZSDA 1BZQK 2VLRA 3C8KA 4XP9L 2IPUK 5HYSG 1MZZA 1CT8A 1RJZA 3WIFA 4PB0L 1U58A 5DS1A 4WO4A 1WFOA 2AXWA 4O4YL 1X6NA 4YE0A 2DQJH 1JYXA 4M7KH 1ERNA 5DO8A 1VZGA 4RNRA 3MJ7A 3EJSA 4U1NB 1F1DA 2GIXA 5EZJA 4PGJA 1DANT 2BVOB 1R3LB 1XF3B 3DJTA 4BE5A 3LKPB 1AS6A 5JO5B 2OMUB 1BPLB 4PJ7E 2HJFB 3BSHA 4HWBL 3CDFA 1UWXK 5TDPA 3B1TA 1WA1X 4JVUA 4ILDA 5D70L 3HG4A 2LU4A 3AFLA 1LK3L 5EBWA 4M4PA 3KPPA 2R2BA 1DP0A 4HLZG 5FOJA 4LU5L 2XPZA 4ELKA 3HR5A 1UD4A 1H8NA 1O75A 3KDPB 3PPSA 5DJCB 4BRJA 4ZSOB 2Y7QA 3LZOA 1P2CA 3DYMA 1G7QA 3V4PB 2I5YL 4UNTA 1DEEB 2P8LA 1OK0A 4PJ5A 5DFVD 4KTEL 4ZO7A 5JHLA 1BW8A 4L1TA 1AQKL 3CWGA 4IGBB 5KVDH 4Y4FC 3UP1A 4FMKA 5CCHE 1V7MH 2XVLA 4NBYB 2IAAC 1J05A 3FT2B 1QSFE 3MV01 3ZTJG 1MRFH 1J1OH 3AJ7A 3D39D 1RSYA 3HC3L 1AI1H 2FX8L 4I1NB 4ZFOB 2P42B 5BVJB 4G5ZL 5D7HA 2VLKE 1UUNA 1OAKL 2QQLL 4DCQB 1IAKA 1M42A 1VENA 2FEEL 2A0LC 3X3GL 1ZIBA 2CJUH 2DH3A 3NZ8A 5C0BA 2FYYB 2FR4A 1MHHB 5EMYA 3VE0A 2ZKMX 3VI4A 4YS4A 2C34A 1NIFA 4ZT1A 3UTTA 2E6JA 1BJ8A 2VUOA 1J0IA 4PS7A 5EF2A 4FABH 3MRCB 3GIVA 5I8KH 8PAZA 5CEZE 3ULUH 2VDOB 4BYHA 2QPDB 1XIWA 3RWDB 2XOTA 3MRRB 4U6XB 4C58B 5IQNA 4U0QB 2VSCA 3MV7D 3O2DA 1JP5A 2XWJB 1XMWA 1ZTXE 5HHOA 2YAOA 1J8HD 1EDHA 1WBXB 4KNUA 5T1MA 4DQOL 4Q9CA 1WBZA 3V6BR 3LEXA 4HH8A 3CX5J 3QZNA 3RWIB 3RNKB 3F7YB 3P4OA 4HK3N 2E7LA 1KFAH 3AU0A 3DURA 4LPCA 1MCHA 4MA3A 5EO9A 3UJTH 4Y19D 3OX8B 3VFRA 3L4ZA 1FZKB 4G7VH 2ZD0A 3JWOH 1MVUA 3EJZD 3T65B 4MJ5A 3FFCD 1C12A 4P2AA 4YO0B 3HG2A 4MHHG 4H25B 4WKXA 2H3XC 3NJHA 3M46A 3NCJH 1OTTC 2B2XL 2HJKA 1X5AA 4H0HB 5FO8B 4NENB 3DHMA 5HDQH 4A67A 3E9UA 1T66D 5IQ7H 1P4LA 3VXSA 1G0YR 5DD1H 4HUVA 5E6SB 4MNHA 4KH2A 2ITEA 2FWSA 4HJ1A 4DZBA 1XGUA 5I2IB 5TJWK 4NQDD 2E9GA 5C8JA 1PVHA 1WE5A 4JY5H 5HYFA 3B3BA 2ICWA 4GAGH 3SE9L 4HGMA 3SGDH 5AYUL 2VW6A 3QK0A 5C0CE 4AYGA 2P24A 1AO7B 1HL5A 2GITB 1SFHA 1G1YA 5D7IB 5T5FA 3RVXD 2XUWA 1DVFA 4ESKA 3AQXA 2WIIB 3CHOA 2NY3B 1MRDL 2YPLA 5KBKA 2ITDB 1ZV2A 5K1NA 1AJ7L 1H8OA 3ZDYE 3SZ6A 3RWJB 4OCWL 4R90L 1I8MA 5F88A 3STZA 3KGTA 4K23H 3EZJB 3WDJA 4GKNB 3ROLB 3TCXA 3D48R 5JXED 1JF1A 2VLLB 4ODWB 4DOHB 4XP5H 3ZYJA 4PGEB 4Y2DB 4YIQB 1PFCA 5DVPA 2L7QA 5A6LA 2YC1B 4OF3A 1R19A 3EOYG 3IGAB 3DX9B 4PJ5B 4WK2B 4UDTB 4BFEA 2A6KB 1M05B 3JUYA 2V2XB 2E7MA 3Q3GA 4WWID 4QKXB 4Y19A 3EG9A 3GSWA 5E94A 2BVYA 3QISA 5F97E 4L8SC 2X2JA 1ZLEA 5INDA 4UQ2B 1CDIA 4FA7B 1VEMA 3WKPA 1VADA 5EO0A 1A3ZA 3RZCD 5EBWB 5BZWA 3IXAA 1F6LL 3Q2WA 1XR9A 2VZSA 5GS0H 3WD5L 1YEWA 2BSRA 5DT1L 4QXTB 2HTKD 2YXWA 2PYEE 3C6LC 1SHMA 2DQFA 3W11D 5L4JA 3WNNA 5ILTH 4XH2A 4GG6B 1NC2A 3VFSA 1E6OL 3ARFB 4XPHL 5BZDA 5FO8A 4DP8X 2ZNXA 2BFVL 2YRPA 2Q9OA 3LRMA 4PTTB 3LSOA 4LDEB 1C12B 4R4ND 2HKHL 2CDFA 2ZUUA 1A22B 4TLSA 3VX1A 2GTWB 1A6AB 1OAKH 4YSQA 2BVUA 2A4EA 2YJQA 3KXFE 2CRZA 3KPNA 4JKPL 4NENA 3V10A 2P48B 3F85A 1S8DA 3R0NA 5J8OA 2X6VA 1E28A 2D2CC 4PRID 2HTLC 3TL5A 4OAWB 3AT0A 1GYCA 3Q2NA 1SQMA 3MO1B 3NIDE 5TK2A 1FBIH 1OAZL 4HZ1A 4FQLL 4M61A 2WLIB 3L7FA 4UOQA 4OM1L 4EDWH 1NFDF 3RAJH 4WFFD 5JUEL 1ZVYA 3BVNA 1OE3A 5J7CC 1C7TA 3B2VH 3LNHA 4KUZH 4TL5A 1OSZA 1YMMB 1KY6A 2UZIH 2YARA 4CVXB 2BZCA 5LUMA 3OGCB 4OZFG 4NBZB 5TDNA 3FQUB 3J27A 3WKML 2X4NB 1NGZB 3FUDA 2LOEA 4K7PY 4KOBA 3QQ3B 1I7UA 1MJUL 4PJCF 3N5AA 4KUCF 5I1AB 4HWEH 3C5ZC 1JAEA 3KLHD 2JIXD 4GRWE