3UADA

Multicopper oxidase cueo mutant c500se506q (data5)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHQDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
publication title An O-centered structure of the trinuclear copper center in the Cys500Ser/Glu506Gln mutant of CueO and structural changes in low to high X-ray dose conditions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 135
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uadA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uadA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uadA03
2XUWA 3CDZA 3FS9A 4A66A 1XB6A 2HXAA 4YVUA 2OCCB 4WTQA 4F7KA 3N2JA 4QLWA 2PP8A 1J5DA 4BXSV 2FQFA 3T6XA 4E9WA 4A2HA 4N8UA 4YSOA 3ZX1A 1TKWA 2PPDA 3AG2B 4E9XA 3T6ZA 5I6OA 1TEGA 3NT0A 4DPAX 3FYEB 1BXUA 8PAZA 2IDQA 1TEFA 1IBYA 1PLBA 2E86A 5AKRA 1AS6A 2XX0A 2GHZA 1E30A 5FC9A 3U25A 2FQGA 3G5WA 2BWIA 1SJMA 3DTUB 4WKXA 4YSCA 3SQRA 3SBQA 5A7EA 4KNUA 3X1GA 1OV8A 1B3IA 1GS7A 1FA4A 1CYWA 4W1TA 1E67A 3ASOB 1ILUA 4KO6A 1WA0X 1MZZA 1L9SA 3X1FA 1J9SA 4G70B 3S3BB 1CUOA 1MG3C 1BQRA 4A2DA 2WO3B 4Q89A 5I6PA 1NWOA 4AKPA 1L9PA 1EZLA 2BZCA 1PAZA 2ZWNA 1CURA 1OCOB 4G7RB 3NJHA 3NJGA 2YAHA 2P80D 2VW6A 2QDVA 3NSFA 3EHBB 1AOZA 3NJKA 1ID2A 1J9QA 3FYIB 3FPYA 2W8CA 1J9TA 3JT2A 5B3SB 4AZUA 4K9JA 1WA1X 1NDTA 2BP0A 2R7EB 1ASOA 3QJQB 4FAAB 1JZHA 3FU7A 2I7SA 2FJSA 2P80A 4YSEA 3CG8A 3FU8A 2DY2A 3IN0A 2BO0A 2YXVA 4EF3A 1ZPUA 3FQ1A 1PZAA 2WSDA 2J56A 2VSKB 2BW5A 2XU9A 1E5ZA 3FPXA 2IH8A 2UX6A 1AQ8A 1RCYA 2X88A 2IDTA 1V10A 4AKQA 1ADWA 1AIZA 1M56B 2GC4C 3FSAA 4HALA 3PCYA 2AVFA 2YXWA 2FTAA 2FT7A 2HLEB 3NJJA 3OD3A 4DP0X 1MDAA 1BEXA 2CALA 2IDSA 5B1AB 1VLXA 3PLYA 3PAZA 3ZDWA 1N68A 1NICA 1NZRA 2GBAA 2MTAA 7PCYA 3S8FB 1GR7A 2QPEB 1X9UA 1L9OA 5EHFA 2BHFA 2AANA 2GIMA 1WA2X 3NJNA 1FWXA 1ET8A 3HEIB 3DIVA 1GS6X 4E9QA 2CJ3A 3UAAA 2DYSB 1JZJA 5F7AA 1AG6A 1IUZA 2YARA 3GXUB 3X1BA 2WO2B 3V9CA 1SDDB 2GC7C 3AY2A 1DZ0A 3D12B 1GS8A 4G71B 3WG7B 2N0MA 4MFHA 4HIPA 2H3XC 3NYKA 1AAJA 4UANA 1GW0A 4BDVB 3AW5A 3TASA 1HAWA 2BP8B 3CZUB 3X1NA 1CC3A 1JZEA 2HX8A 5E9NA 1MG2C 2EILB 3WIAA 1A8ZA 2CCWA 3AG3B 1NWPA 1UATA 2Q5BA 4KO9A 3T9WA 2UXTA 1E5YA 3T6VA 4DPBX 3NSCA 2VM4A 1CYXA 2PCFA 4CSZA 4P5SA 5AFAA 1GY1A 4HAKA 1R1CA 4DPCX 4G72B 1MZYA 4L0PB 1ZIBA 1V54B 2FQDA 1KDJA 4DP5X 2IWKA 4DP9X 1ASQA 5TK4A 2R7EA 2TSAA 1JZIA 1PZBA 2FNWA 3QJSB 5B7MA 2PPEA 3NJIA 1HFUA 3H56A 2VW7A 3FQYA 1A3ZA 3WI9A 4ENZA 3OQRA 1ASPA 2CAKA 2UXFA 5D4JA 1NIDA 9PCYA 2H47C 2YAPA 1ILSA 5ANHA 4YSDA 4GP8B 3ABLB 3H4FA 3IN2A 1OE1A 3NJMA 2I85A 5I5IA 1OE3A 2H5UA 1M9WA 4QKTA 6PAZA 2JXMA 2QPDB 3DKHA 1OCCB 1PLAA 4W9ZA 2YAQA 4HCFA 2BW4A 3TBBA 4DP8X 1AZCA 1SF5A 1NIFA 4CSPA 3T71A 1J9RA 1JXFA 4DP1X 1A4AA 3CVDA 2XV0A 3JTBA 4BWTA 5B7EA 1GSKA 1ZDSA 2OJ1A 1ZIAA 1JOIA 1SDDA 2XX1A 4G7SB 4YSRA 1JVLA 2PPAA 3WKQA 1RZPA 3PAUA 3AZUA 3ASNB 1SHWA 2PLTA 3OMAB 3C75A 1JVOA 4E9YA 1EHKB 1YLBB 1PZCA 5LDUA 1AZRA 4BDVA 3S8GB 1N70A 2BP8A 4GY4A 3SBPA 1PMYA 1BXVA 4HZ1A 2CBPA 1OOWA 1SF3A 2HX7A 3FU9A 3MX0B 3BVDB 2DV6A 1KBWA 2J5WA 5B1JA 2B3IA 3KW7A 2DWSA 1ZDQA 3UGEA 1A4BA 1L9RA 1NIAA 1PF3A 2UXGA 1ETJA 3AG1B 2VM3A 1AANA 3AG4B 2TSBA 1NPNA 4JHVA 3TU6A 2AFNA 2EINB 1AG0A 1NPJA 3CVCA 4KNSA 2BWDA 1WAEA 4YSQA 5PAZA 5TK2A 1AACA 3CVBA 2XXFA 3NSDA 3T6WA 1BYPA 2CUAA 6PCYA 1AZNA 2XVBA 5I6LA 1WS7A 5I6NA 2XLLA 4KOBA 2YAMA 1BAWA 2HX9A 3NP3A 3TBCA 2JFCA 3V9EA 4A67A 4E9SA 2FWLB 1JERA 5I5MA 2DWTA 1KBVA 1QLEB 2YAEA 3WKPA 4GYBA 2FQEA 3EF4A 1L9TA 4NAJA 4UAHA 1X9RA 4HCGA 2IWFA 3IE9A 1W6WA 2HRGA 1PCSA 3UACA 2PCYA 1SHXA 4NERA 2QT6A 3IEAA 4FA7B 4DP6X 7PAZA 4F2EA 1ZV2A 3OMIB 5I6KA 2ZONA 2I7OA 4KO7A 1KV7A 1GY2A 3X2QB 2AZAA 3GDCA 5AZUA 3ERXA 1SNRA 3BQVA 5D4IA 2W88A 4G7QB 4GXFA 1XB3A 2XYBA 1AZBA 3QQXA 2EIMB 1W6LA 4TXVB 4JHUA 1BXAA 2ZOOA 4YSAA 2IWEA 1KDIA 1NIBA 2HRHA 4YVNA 4M3HA 3SBRA 4A2EA 1A65A 4BK5C 4P5RA 3FSZA 4Q8BA 1SFHA 3FT0A 3OMNB 3QJVB 1BQKA 3FQ2A 1J5CA 4KO5A 3ZIYA 3GYRA 2FT8A 1A4CA 2YAOA 3RYMA 4BXVA 1NTDA 1W8EA 1OE2A 3PAVA 3HB3B 4A68A 5PCYA 5I26A 3MBWB 3QPKA 2AZUA 2XXGA 3EH5B 1E65A 5D4HA 1NINA 2PP9A 1L9QA 3NJLA 2B08A 1PNDA 2Q9OA 3PPSA 3WNJA 2Y1AA 2XWZA 5IY5B 1NIEA 2GI0A 3L45A 1AS7A 2PPCA 1PLCA 1JZGA 3CDZB 1JZFA 1DYZA 2Y69B 4YSPA 1JXDA 4GP4B 4GP5B 4KNTA 3KW8A 4X4KA 5F7BA 1JXGA 3IBOA 5I6MA 4DP2X 2IAAC 3WNIA 3ABMB 1PNCA 4DP7X 4NB7A 4RH4A 1IBZA 2YAFA 1ET7A 3UAEA 2IDUA 3OM3B 4HHWA 3FSVA 1FFTB 1QHQA 4UF7C 1RZQA 1AZUA 1OCZB 1KCBA 5I5JA 1SFDA 2XV2A 4YSSA 1V55B 2XV3A 5B1KA 3PXLA 2PP7A 2ZXWB 4AKOA 2OV0A 1T5KA 3H4HA 2VSMB 4JKNA 1AR1B 3X1EA 1I53A 4E9VA 2X87A 2EIJB 2HZHA 4M4RB 1IC0A 5B1JC 3S3DB 2YQBA 4PAZA 1KCWA 2UXVA 2NRDA 1RKRA 3QJUB 1XMEB 4AI7A 5B1BB 4BWWA 4A2FA 4YSUA 3NSYA 2UX7A 1AS8A 1KYAA 4YL4A 2LLNA 4HHGA 4A2GA 3QJTB 1URIA 2VW4A 2GSMB 1F56A 2GB2A 2DYRB 5B7FA 3EH4B 5I28A 1OCRB 1GYCA 2J57A 2MRYA 4HCIA 1PY0A 2BZ7A 2FT6A 1BYOA 4E9TA 2J55A 3ABGA 3UABA 2BP0B 2IDFA 1TU2A 1XB8A 4DP4X 3QJRB 2JKWA 4F2FA 1KGYE 1BQ5A 3FU7B 4BWUA 3EH3B 4ZK8A 2IH9A 2EIKB 3UADA 3NJFA 1OF0A 2RACA 2A3TA 4N4YB 3ABKB 1HAUA 4YSTA 4AX3A 1QNIA 3NP4A 3TA4D 2PPFA 1M57B 2VN3A 3FSWA 1WS8A 2QDWA 2VMJA 4PCYA 3S3CB 3N55A 1ET5A 3ZBMA 4E9RA 4KOCA 1IKOP
chains in the Genus database with same CATH superfamily
5IR1A 4HWZA 4PJHB 4Z7QF 2EDXA 2OR9L 4ABVA 2OCCB 4PM1A 2AK1L 2EYTA 3LZRA 1AHKA 5EBLA 5HY9B 4G9FE 2ZZUT 2GTZA 2G0KA 1ECYA 2XY2A 3PL6A 3OMZA 1ZLEA 2UY6B 1BZEA 1TZHB 2GQHA 4PGBA 3RVVC 3LVEA 5C0AA 3T6ZA 4R0LB 4IOIA 3WFHA 4XPTL 1FNEB 4PJIE 4RFOL 5IHZA 1N6QH 2FHFA 4AC4A 3CQPA 2OZ4L 3ALWA 4XNQA 1BF5A 1D2OA 1G6RL 1JCVA 1T5WA 1MN4A 3I75B 1G0YR 4KVCH 2OK0L 2C34A 3RA7L 3MODL 3IFPA 1CLVA 2NXZD 3LRLA 5CINL 1LK2A 1QEXA 1OEZW 4IS6A 5C09B 3WNMA 2NY1D 4F7TB 4Y1AA 4KO6A 3UGUA 1BJ1J 4AEHH 1G9ML 1BBDL 4TSBL 3RIAF 1A1OB 2IO5A 3UJTL 4FI7A 4HS3B 1K3ZA 1Q0EA 4YN3A 3FCBA 3RVUD 1ZD6A 4PTUA 4DQOH 2ZWNA 4YZFF 1VADB 4HJ0C 5F89B 3FCUB 4TLTA 4PGEA 3O3BB 2J8UB 3Q3GB 1BVLA 1H3XA 3ZU8A 5GGQL 3BQUD 4WUKL 2R0ZH 3NABL 4X6BB 1T1ZB 1IT9L 3UMTA 1LD9A 3KVQA 4DFIA 3RJOA 3EYSL 3T3PB 1I7UB 3BT2H 1NBCA 1XO8A 4PJFF 4YGVA 2VDPL 2ZX5A 4HS6B 1JZHA 5DLML 4X4XA 4Z18A 1JXJA 1UJ3B 3MGAA 2BP5M 4LLUB 3NIGF 1A6VL 4PJAF 1XSIA 1FH5L 1XR8B 4NZTH 3SQOH 3ZDXF 2V4LA 4MSWA 5DHEA 4P5TA 1UZGA 4OQ1A 2NNFA 3NIFF 4JMXA 1Z32X 2A6JB 2WUBL 3D0VB 1J12A 3AS1A 4GS7B 2GC4C 4UDUA 3HS0A 1YEHL 3A67L 3JYBA 1PU0A 3G7TA 3F7YB 5GGVH 3T0VA 2FTAA 4X5XA 4NP4H 3KLHC 1UD6A 2CALA 2IALA 4KWUA 5DGQA 5FGCE 1WAAE 3DJSA 3BCDA 4QHKJ 5B8CA 4NQSB 1AKJA 4DGVH 2HTKC 3ZOAA 5GZOA 3GXIA 3TF4A 1I7ZA 3OAUH 5GS1B 4OI7A 3C12A 1WA2X 1Z7JA 2D73A 5AALA 3TPUB 4JKPH 3BPLB 3NGBC 1ET8A 4NO2A 2X12A 2ISDA 1NKOA 2R1WB 1OM3H 3TJEL 2QR0B 4JKMA 3WS6C 1BLNA 1E5AA 1OAKL 2I24N 1P2CA 5I1IH 2V9QA 3FT3A 2PYEE 3B2MA 3GHEL 1KN2H 1C08A 3L4XA 4Y4HD 2V33A 1QA9A 4LLDA 5T3ZD 2ZAIA 3CBJB 4CVZA 2FATL 2ZOKA 4OCNC 4D7BA 1U8MA 4AV0A 5DS1A 4K8RL 1XF1A 1FJ1A 4U1KB 4ODSH 5F93C 4H25A 1RHHA 4KK8D 1TUPA 3U7YL 3QO0A 1JZEA 4FFYH 1OHZA 1QSEB 1BOGA 2NYKA 3LPWA 5K39B 4D9RE 5FUOH 1B0WA 4ODXB 2GEEA 4Y16B 3LN4A 4J27A 3KPQB 4F2ME 5GRVL 1B3JA 1H3PL 1I9IL 4KQ4L 2WZPA 2VQ1B 3O8XA 3MLWH 2WQ8A 5A6MA 3EOAB 2IBGA 1I3RA 1CFVL 2VXQL 2VL4A 3W5MA 1S7QA 3JQOB 4PJ9B 4AVJA 3KYOA 5GJTL 4DEPC 1GY1A 2ADFH 5CKAA 5HYQB 5J6GB 3MROA 1QHOA 1EBAA 1KGCE 1QBML 1NFIB 4L0PB 4HQQH 5TDPA 1KT2B 4AY0A 2VDNH 1OARH 3J27A 3OAZK 4B50A 3B7TA 3STLA 3S3SA 2XIBA 2D31B 5IFJB 3MRGA 1RK0A 2YJQA 4OM0L 1LO0L 3UDWA 5GRXG 2Y6SC 3BDYH 4N0FA 2V7HB 3VXUB 1BM7A 3IDXL 1U33A 4ENZA 3WDIA 1S7TA 3QNYB 1XIWC 4JHAL 2IVFC 1FL3A 2D0GA 3D87B 4Q74A 4AOFA 1WVZA 3FO0H 4ALAH 4NBYB 3H4FA 3RWGA 3WSQH 4GSXA 4CSTA 3C6LC 2Q7AA 3HE6C 4AWJC 3FAWA 1KSRA 4FXGA 4QKTA 2JXMA 4IMKC 4J3WA 1NCCH 3GBNH 4N68A 3VFUB 4JREB 2MHAA 2Z8WC 2VZOA 1MJUL 5GRYA 5HYJD 3TBBA 1E8ZA 3QRBA 3BFOA 1EERB 5BPPA 3EJPA 2H8PB 3WS3A 2OQJB 3J7HA 1FIGH 1MLBB 3PFUA 3ZJAA 5GISL 3WXVH 3CFEA 4UIMA 3OZKA 4GQPH 4P06A 1MI5D 2YN3A 3ZRSA 2C9SA 1U8LB 4POZD 4QKXB 2VC2B 5DK3A 3VFSA 5J3HD 5E2TH 3GIVA 4LVNC 4P57A 3QULA 4JX0A 2X3CA 5GZND 3LD8B 4OD3L 5J1AA 1N2RB 1E6OH 2JMRA 5BZWA 4HIXH 4GXVL 4AGOA 5CZRA 2HRPL 4IOSD 1BIHA 3N0PB 1D5XA 2PLTA 3KPSA 5M94B 1BF2A 1TVDA 4DKTA 3UZVB 1AD0B 4MQ7A 4H0GA 2O26U 2QLYA 4NBXB 4AG4H 1RZ8A 1RIUL 4P9HH 4MKTA 3S8GB 4TUOA 5F0PB 3ZO9A 3BSZH 4UTBL 5CCJA 1UWXH 1L9NA 3O4OC 1ZA3A 2JKRM 4TF4A 3QHFL 2F53A 3WFBL 2EIEA 2BCKA 1TJHH 2F7QA 3OPUA 1VRSA 3OR6B 2IH3A 2ICWA 3QQ9D 2IXQB 4D9QD 2DBJA 1P7QB 5I1CL 1XF2B 1TIUA 3TJPA 1F02I 4BE6A 2QEJA 4NN7B 4L48A 1E2WA 2R23A 2JNZA 5CWSB 4Z7QE 3LMJL 2HB0A 3LEVL 6FABL 4M7KH 1TETH 3QAZB 5JW4N 2F7PA 4JFQB 3L9YA 5AYQA 5DFAA 3TCLB 3ZHDA 2RALA 4P2OA 3LH8A 1G0XA 5KYWB 5L6YH 4GUCA 4ONHA 3M7FB 1UXSB 5JW3H 2C7UA 3TN0B 5T5NG 3LIZL 2XIIA 4MBRA 3PDOA 1JWUB 4RA0C 5IV2B 1KB5L 4P46B 5CEXA 1MFVA 1UB6B 3MCLH 2PTVA 2V5TA 5HD8C 5HHVH 1ZLSL 4GYBA 4ZQTA 5C0CD 1HHHA 1XGYL 4H0IA 1UVQA 5FHAH 1E5CA 2YC1A 4ZTPL 1IGTB 5DYOA 1MW3A 1KXTA 3MGOA 3CXHK 3O9WB 1QI4A 2I7OA 1YNKH 2QADC 4GAYB 3U6RB 3BKYH 1I8IB 1KJ3H 1YUHA 4IKJA 3BD4A 2NR6C 3B9DA 4HUMB 3ZRFC 1KIRB 1WV7T 4JRLA 2VITA 5EZLA 4TSCH 2FR4A 3VD7A 4AYID 4YZFE 4J2QA 2QVKA 1R19A 1GH7A 4KAQH 4N86A 1IBHA 3GBEA 2WMPA 3BRFA 1HXYB 2A74B 4OGZA 4LRNL 1BQLL 3QJVB 4LLYA 4PV8B 2YAOA 2BY2A 1E27A 4K55A 3BKJH 4MMXA 1T1XB 2Q0ZX 3KPRA 4K3EL 3ZTJG 4KDWA 4PJFE 5KBNC 3VDBA 2EIBA 5G4NA 1F00I 2Q9OA 5D6CA 1QBLL 3KXFB 5GGRY 1OK8A 1TQTA 3V79C 3U2SB 1PSKL 5D1XC 3WUWB 5DZAA 1IAII 1UCBL 2AJYL 4PJAE 4XBEL 5IW3A 3EKCA 3HKZA 1UADC 1R3LA 3MX0A 1IBBA 1PLCA 1KPVB 3E8UL 3ZO0A 5BV7C 2IJ0C 1PIGA 5DJ0A 4GP4B 5MENA 4KROB 1NFDF 1H8OA 2IAAC 3IRCA 4NQEA 1BVKA 2P46B 1WGOA 4U6HA 2ZKMX 2JJSA 1NGZB 4KXCA 3LRSB 4QXUH 4H8UA 2IDUA 1I9RH 3BC9A 4IKKA 2FH8A 3DVIA 4HHWA 3FSVA 4QTHA 1E50A 5E5RB 2UZIH 2BIPA 1OGPA 3VFMA 3WEAA 1P5UA 4HUUA 1DVFC 1CGXA 1G7LA 4AQAB 3FH7A 2NXYC 1BFVH 2AV1A 3MCKB 4CRPA 1XH1A 5KJRL 1YVLA 4YDVA 5E2UL 1MI5E 3WE1A 2FLBT 5IQ9A 3RFZC 5DQJB 4JPIA 1NCBH 5EN3A 4ZW3A 1CGSH 5H94A 1JMXA 3QDJA 2X4OB 3QNXB 3JV4A 4U1MB 4TTGA 4IJTA 1G7JB 1IFHL 1L3WA 1QG3A 1HH9A 2YBRB 5CF3A 5LWYL 1WCQA 3FQTA 4N0UA 4PRBA 3SIKA 3CSFA 2FVNA 3FH5A 1IGIH 3MJ8B 4Q6IB 2JI2A 3CMOL 1FZJA 1MFUA 3DDGA 2WB7A 2GKIA 2JLLA 3TTSA 4XXCA 1N6VA 3OHXC 3KEDA 5KSUA 2RHEA 2DYRB 3MRQA 4OFKA 2LU3A 2XVKA 4NQXA 3D50A 3GS7A 1CL7H 4X83A 3ENEA 4LBAA 3RBGA 4GRLD 4D9QE 1CCZA 4RAVA 3WL9A 2NNCA 3VI3E 3AB0B 1D5ZA 4QRQA 1OAZL 4JFHD 2WLJA 4ZFFB 1A6ZB 4R7VA 3O6FA 1KTLA 3N41B 3R8BB 5TPWL 2EIKB 4UTAH 4N4YB 4XPGL 3OX8A 4R8WH 1UM4L 3RL2B 4GO9A 3OHMB 4WWKD 4IEFA 5A2CA 1S9WA 1YMMD 2VIRB 4OB5L 3L3JB 2CO4A 1C5BH 4IOFC 3HBQA 4RGND 1FLRH 2A9MH 4TQ8A 4D3CL 1JYWA 4WTXA 4F8QA 3LZLA 1NUGA 5IB4B 2W0PA 5IVZA 4OT1L 1DBKL 3ECQA 3SY6A 4BFIB 3NDYE 1QQDA 3NRPA 4FQXB 4B9ZA 1HSBB 4BZ2H 4XCNB 5HVHC 4AL8C 1AFVH 4GIAA 2DQEH 3BGMA 4NC1E 3JUYA 2VLKA 3GHPA 3VGHA 3ZZSA 2BERA 1YEEL 4BHUI 3GPEA 3PIQA 1Q72L 3NZHL 2MFNA 2WTRA 2GJRA 4Y4FC 4ZYKA 2WBJB 1Z5HA 3HHMA 4Q9QL 5J9PA 3D0LA 4LHUB 5F7DB 3CN4A 1WDAA 2W94A 4WI0A 3BN9C 4G7VH 3IAGC 1XR9A 2HFEA 4Y2DA 1RFDL 5DJAB 3X1GA 1OV8A 5I1HH 2WC7A 1X5XA 1WZ1H 4JZJB 1WO2A 2P8PB 3FFOA 4J6RH 4UB0L 3QDMD 1IU1A 1MZZA 3X1FA 4L29B 1NLDL 5BZXA 3A4EA 3QXTA 1G6RB 3QI9C 3SE8H 4PWFA 3ULVL 1OK0A 4IGBB 3QNFA 2DQFB 4QUOA 4X7CC 3RFRA 1FLTX 2ICEB 4IK7A 1KJVA 3FO1B 2PWDA 3MV9E 3MREB 2BZCA 4NQVA 5AW9B 4JRYA 3BX7C 1KXVA 3UTTA 4HPOH 3MNWA 3EFDL 2IPTH 5DD3H 4HLZH 3BPOC 5GS0H 2QDVA 2CMRH 2NW3B 4GW4B 1Y0LA 4G5AA 3V95A 4YDKH 1Z9PA 3ZSSA 2E6JA 4ZMPA 1MWAA 3MLYL 1EEZB 4W9KC 1N5AA 2ARWA 2W80C 4FNPA 1UWGH 4JJ5B 4FAAB 1LEIB 3FU7A 3BWSA 5C86A 5A6IA 5EZIH 4LP4A 1J18A 1SXCA 2CO6B 3GBML 3TVMB 2Q76B 2EDWA 3EH2A 1HCZA 4I48A 4QY8B 2W9DL 2OL3H 4DNLA 3WNNA 1EJ8A 5F1IB 1E5ZA 3T4AB 4DTGH 3S2AA 3AY4C 4APXA 2VDPB 4DUXA 4KI5F 3I9GL 1U8QB 3OF6D 4R4BB 1Z0MA 1UEYA 2VJXA 2Y6TE 3MRNB 3OD3A 3QIWA 5ALBH 3S98A 4DP0X 2WOYA 5J1SC 4XP6H 1I1AA 1G7HB 1HWHB 1U8HA 2BNQA 4FQLL 4LMQI 5DZLA 5EF0A 1JDDA 5D7IA 2NW2A 4L23A 3MOBH 3VWJA 4OZGA 3QHZL 4J8RB 2J4WH 2FWOB 2A73A 2G5UA 5KOVC 4GO6B 1GCYA 2BHFA 3CNKA 5IESL 4EUPH 2ZSVA 2Q3ZA 3GO1H 4BZ1L 2VLJA 5F1NB 1EAJA 1JF1B 3FB8A 5JHDB 5GGSA 4WK0B 2D2CC 4LL9A 2VUYA 3GXUB 3BZ4A 1KV3A 4OJDH 4APQD 3CXHJ 5INCA 2UWEF 3VVWA 3AXLA 3GSRA 4PJEA 5I8KH 5CIPH 5KVFL 1EANA 1IM3D 3HR5A 3QZOA 4I89A 5C0BD 4S2SB 3CK0L 1AIFB 1FFNA 4HS8L 4JFHE 1HCYA 3CHXA 4UUJB 2CIKA 3GXTA 4J1UB 1VZHA 1UB5B 2E56A 4XXWC 3F5WA 4XCCH 3E6HA 1HAWA 5BMFH 5CLXA 2A6IA 4JJOA 1S9XA 1MG2C 2N0KA 3Q8EA 1XGQB 5KANI 5EO9A 5SWSD 5BS0B 3UYPA 1YMME 4OLEA 4N0YH 3ZMEA 5T5FH 2GFBB 4RGNE 4EOWL 4EZMA 2RTTA 3PWPD 2DW5A 2WXKA 4GOSA 1J05A 4GIOA 1SOQA 4X6DE 5LCVA 1KIQA 4L37B 4O4YL 1F3RB 1MZYA 4M02A 2ESVD 5C8JA 3X12B 5CZVL 3L3HA 2IQ9H 4UQDA 1S3KH 4G9FA 5GGVY 1DQKA 1NFDE 3W38A 2E7CA 3BDXA 3SO5A 1XGUA 1PD1A 3QUXB 2K4AA 4CNIB 3PWUB 1AGBB 1LO2H 3QCUL 5B3JF 2IADA 4C56B 2NX5B 2JI1A 4FNLL 5HI5D 3FQYA 3MNZB 3QUZD 4G5ZL 3TV3H 4M1DL 3ATDA 5HVFB 4PVMA 3VSUA 4PBWD 2P5PA 4PJIA 1XHHA 4QHMA 4S1SH 2YAPA 3P4OA 4JFVA 1P0SE 3TJHC 3SY0A 3T3PF 3TO4C 4WWID 5DRNA 4EDWH 2Y3NA 3MGTB 2WWKT 1M1XA 5LLIC 3QIBD 2ED6A 5EU7E 2BCMA 3U0PB 5H2BB 1PLGL 2F7OA 4JFDB 4UYQA 3FFCD 3FH8A 1D5MA 3QDME 3VAEA 1WRFA 1RUQL 2A1WH 3CLFL 3FO9A 3DV4A 4TUJB 5JUEL 3T71A 5HYIA 2J3SA 4GRMB 3VFOB 4F1SA 3B2XA 4LDCA 1MF2H 5E6ID 2IG2L 2HT3D 4KKLD 1F3JA 1FL5A 4E68A 2YPLD 3L17A 1YNTB 1T20B 4PG9B 4CU7A 3BKMH 2WP3T 3RWJA 3H3PL 4PCKA 1DUZB 2H0FA 2G75B 4PIBA 5I17A 3CLEH 1G5AA 2XX1A 4G7SB 3DX6A 3QCTL 1QACA 4RFNC 4UT6H 4YQXL 4WF7A 2H9GB 3GRWL 1J0YA 2AJZA 1OCWH 1W72L 5EWIL 2L8AA 1JVOA 3AU1B 1U58A 5EUOB 3CQQA 2VXUL 4YHIA 5ESAB 4ATWA 3JWNE 2ALAA 4KHTH 3J8F7 4XN4A 3BH9A 4XMXA 2BP8A 3T08A 4LLAA 1UOWA 2CPUA 2YKLL 4LOFA 1JGLH 2HX7A 3UROR 4Z3TA 4N2EA 2J5WA 1U8IA 1DN0A 2CLVB 3REWB 2WUCH 5DJ6B 2JKTM 4X7TA 2XN2A 3EO1A 2DIEA 3TEYA 3UGEA 4YWGH 1EMTH 2Y7QA 1XEUA 4ERSL 1YJDL 5AW8B 3FT4A 4WCYL 1WAAA 2YWZA 5GSRA 5EOCH 5JHLH 3DOIA 2V5YA 2TSBA 3BI9X 3D48R 5DI8A 2XVLA 4GI9A 1CDHA 3O45B 4M48L 5T1MA 4XE5B 4ZS6D 1NPJA 1MW0A 3B9KA 2I60L 1S2EA 2X6CA 1DEDA 4XHQA 1WAEA 4IU3A 4AQEB 3CN0A 1K85A 2WLHA 1ETB1 1CVRA 2XXFA 5D5MB 2FX9H 1PDKB 2PYFA 4WWPA 2BSSB 1FZMA 1WS7A 4G2AA 3Q2LA 4KZCA 2BVUA 5I6NA 1I8MA 2JTDA 1FFOB 2X2IA 2YUVA 5L4IA 3ESOA 1G84A 3RX9A 2PYEA 1TYRA 3FU5A 2ZCHL 4YL9A 5I8OL 3ESVF 3MOQA 5CN1A 1NGXB 3RTLA 3VXME 5AENA 4OLWH 4AGLA 4DOHB 5C0BE 3VXSB 1KEGH 2KQMA 5I71C 4EDXB 2IGTA 4HCGA 1RUMH 1DJSA 4KX9A 1PCSA 2N59A 2WP3O 1SHXA 5EFIB 1MKFA 2HVKB 1DJYA 4RX4A 4BQ6A 2E27H 2Z7YA 3D4ZA 1XCTA 2EEAA 2AZAA 4V1DA 2Z31D 5C9JA 1RZJH 2IGFL 1J1PL 2C9RA 3I6GA 3OG6B 1I8KA 3BQVA 2IANB 4HMCA 4K4KA 4F2MA 5SWSE 3IJYB 1X7QB 3WAJA 1XB3A 3LS4L 1QZNA 1X3DA 4J3OD 5CN2A 4QRSB 3WU1A 1CMOA 4QWWD 4C4UA 4YVNA 5FO2A 1DE4A 1Q9LB 3SDAC 4YAQA 2CO7A 1SJHB 4PRIA 5ISZD 1H3GA 5B38B 5J89A 2QL1A 3NGBB 5T1LB 4J8QA 3TFKD 2BS8A 3GSWA 4JDZA 1GKEA 2WANA 3GSXA 4NM4L 2XQYK 2R83A 3Q9PA 3P11L 4QIRA 3J2PA 4NZ8A 3WKNA 1R5VA 3GKWH 4U0RC 1NINA 4YR6B 1C5DA 4QF1B 1OTSD 2B08A 2OMZB 4K5NA 2DWYA 2HLAB 3NEXA 2CZNA 3F8UB 4GRWB 1QHPA 4LK4A 4MWFB 2BHUA 2ORBL 2HH0H 2Y5EA 5IQMA 4JDVB 4YX2H 1SM3L 3QXVA 4ZX3A 1QYGH 4BH8B 1DQML 2Y24A 4N0CC 1PG7X 3QBTB 4WU5A 4HXBH 3KM1A 5C07B 3ZKSD 2D7TH 1S9VB 3HJ0A 4MVBC 1A66A 4A7VA 3V6ZA 2D4DA 1P4IH 3NAAL 4PP2A 1S7SA 2CA4A 1VIWA 3BT0A 3FFCE 3IFLL 2PETA 3OZ9H 1QSED 4H2CA 4NJ9H 3KWTA 4DEPB 5E6UB 4BE5A 4PGZA 3TT3H 1PW3A 1PZ5B 1NMAL 3SKNB 2I25N 2OMWB 4ZAKA 3CDGA 3IJ8A 5INDA 1MCSA 2VQUA 4WV1C 3QRLA 5J6SA 4N2LA 2Q86B 5LN4A 4PJ9D 1OPGH 2VSMB 4KJYA 4B5EA 4GKOA 4Y19B 3QPXL 2IBZX 2D3NA 4JG0H 2DJ4A 2X6UA 3WD5L 4PJHE 2AMUA 3MMEB 3OL2A 1ED3A 2YQBA 1ZLVH 3I3DA 4AQZA 1RUPL 4B96A 5I1EH 3HNTH 1MRFL 2XQ0A 4JRWA 2VCOA 4XI5D 3TT1L 2J1KA 3HC2A 3CVHH 1U6AL 3WTYA 3OKKB 5D7JC 3C09C 4UI2A 5IK3A 1O9WA 2QSTA 5CMAA 3C6LB 4L8DA 2B1AH 3HE6B 5E8EB 5FA4B 1ADQL 2VE6A 2BY3A 4LO9A 3SGKA 5JORB 4XO8A 1U3HA 1F11B 2JCCB 3UMNA 4E42A 4ALAC 5I6XC 3EO0A 3HB3D 2OI9C 3KPMB 1E7VA 4XWGH 5FYLL 1ZY9A 1WFJA 4GPVA 3OKLB 4ZMYA 4NRZA 4ZUWB 3RDTC 1KWGA 3LH9A 2ZJSL 3T0WA 5C09E 1BQ5A 4HKJA 2FO4A 4O2CB 5D7SH 3FT1A 1WK0A 4HFWB 3F7QA 3LCYA 3V6FB 3K6SB 2YPVL 2P8LB 2X9ZA 4WGKA 4LVNB 2DI7A 2A5UA 2LLGA 3V5DA 1EGJA 3KLAA 4ZDHA 1JNHA 4OCMC 4I3RH 2VQ4A 3FQWB 4UZUA 3LV3B 1LDSA 5B3JE 3X14B 2OYPA 2QDWA 3PGDA 2YWYA 4XPHL 2RD0A 3PHAA 3IU3B 1TJXA 2J8UE 1N6QL 4E9RA 2KYIA 3OG4B 3FS9A 3G9AB 1FSKC 2PXYA 4WI4A 1L0PA 3W3BA 4Y4HA 1MFMA 1MUJB 2FJUB 3R18A 5C0RH 3FQUA 1QLFA 3GSVB 3WDHA 3T3PE 1G9EA 2PP8A 3O4OB 5IKCB 2D03H 2YD6A 1AHWA 4A2HA 4JFZL 3DO7B 3VFVA 1IE5A 3L54A 3ZMNA 5IJDC 1A21A 4P9HC 4HMEA 3ARSA 4AEHL 3NT0A 1U4FA 5I19H 4NZRL 5K9QI 4K7FA 2VR9A 3RUGB 1TF4A 2ENYA 2XWJB 3CFIC 2AF2A 4NEHB 3FB6B 1DVYA 3L4TA 4PGCB 5IVXF 2WOBA 2XPYA 4JW3A 2YRZA 4HF5H 4ZTOH 1KFGA 3QWQB 4NRYB 3GRBA 2L7QA 4JM4H 3S4SA 4RWYL 2R0ZL 1U8NA 3IDYC 4W1TA 1D5BB 1FRGH 4W9FC 5H37G 4L3FA 4B9JA 1SY6L 4LHJB 1ILUA 4ANUA 3CSYB 3BP4B 3CN1A 1M05B 3L3KB 1QX1A 3MYZA 3SQBA 3IDIA 2Y2WA 1AKPA 3FTUA 5IVNA 1O6SA 2WO3B 3FRUA 3FRPA 4GMTH 4GT7A 4KUCF 3MUJA 4PJFA 3FTXA 1C7SA 1KPUB 1Z2KA 1TQSA 4HJJH 3UYRH 1FZKA 1UOVA 4PI2A 3LB6C 4R2GD 2YAHA 3BEWA 4PJAA 2JJUA 4NDMB 4P46D 3I85A 4AT6B 1HXMA 3LKSA 3C2AL 4FG6C 1ID2A 3BWUF 1DUYA 2GIXA 5CFHA 3EH1A 1UXMA 1MVUA 2BRRH 4K9JA 2WINA 4G8GB 2QQKH 3M86A 3KPLA 4NP4L 1NDGB 3IDMA 3O3EB 3RPBA 5AVSB 4R7NA 5A16B 3ZHFA 4NHCH 3O9WD 2BSTA 5IJBC 2FRGP 4KDTA 4XPFH 4BFBD 1QSEE 2X9YA 4KHXL 5EU4A 1RLWA 3FPXA 4ILDA 2UX6A 3OAUL 1FV1A 1B0RA 3TH3T 3TOPA 1MCFA 3KPOB 4WU7B 2IWGA 3MCG1 1MI5A 5DFVC 4LPVA 4A2MA 1UASA 2O61A 5E9DD 2YXWA 2VXSL 5IM7B 1L5GA 3ETTA 1TR7A 4ZT1A 1OM3L 4DZ8A 4JFXA 4O02H 5GZNA 4XE0A 3V6OC 5JNYA 4V11A 1PZSA 5F88B 2A83A 1ES0A 3R1GL 3P1VA 4TQPA 4HK3J 5GSVA 4IOSA 4LSRL 4ICWA 4YHOH 3EYFA 1CK0H 3ECUA 1IL1A 1MY5A 4J23A 1YN7B 5D1XB 3WDJA 2BNRB 1X9UA 5DD1L 2AANA 3PP3H 1UJTA 2VAAA 5JW5B 4QAMB 5BV7B 1PAMA 1FWXA 3VXUE 3QXUA 5KYYA 3KXFD 1GS6X 2CJ3A 3HC4L 3ZUCA 5JXAH 3BP5A 5FUOL 5I18H 3ARRA 1YYLH 3NZUA 2FL5B 4Y9FA 1KBGH 4ODVH 1KIPB 3PXHA 1SLXA 2UZXA 3FN3A 4KROD 4F27A 3VI3A 1GS8A 1SDAB 2WCGA 2N0MA 2A4ZA 1EVUA 2CCLA 3WG7B 4E5XG 1IM9A 1QVOB 2QVMA 2VL5A 1DVFB 5CJXC 4C57C 2V37A 4LIQH 4NYLB 1D9KA 4HQQL 2NXYB 1HOEA 4FFWC 4LDEB 1GTNA 1X5MA 4W9EC 4FYTA 2HVJA 4WO0A 4U1NA 2VDNL 4MS6A 3RFZB 4UZSA 2EYSA 2J12B 5K9KB 5FO7B 5EDSA 4MNQD 4XNZC 5HGAB 2ZUTA 5BOJA 1J5OL 4DAGL 4KO9A 3HZMB 4OF7A 3R4DA 5C0IB 3BDYL 1BMZA 4MD0B 5DQDH 1MCBA 2ADGA 1IGYB 4FA6A 3FKUS 4K7PX 4HUWA 3LZNA 4PTTA 1X9QA 2KS0A 3OPZL 1BHGA 1QFWL 3T8VA 3BWAA 1YEJL 3FO0L 3VFRA 5C0NC 3HRZA 3WSQL 3UDWC 2AMGA 3OHXB 1GZHA 1JYXA 1AR1C 2R7EA 3DIFA 4KBPA 4WSJA 4RMSA 4HX1B 4JFSA 2PPEA 4QRRB 4QRFA 3CZLA 4FQHB 3NA4A 1KGIA 2MIZA 3MZTA 1JGVH 1A3ZA 2CM5A 4M1CD 1MIEH 2N1TE 2VLLA 4NJAH 5SX4H 1T22B 3ZKXC 4DGIH 1TITA 2DJSA 2HKAA 3C60C 4MMZC 3C08H 3SBWC 2Q87A 1RD6A 2WSKA 4GP8B 3ABLB 4F37K 3WXVL 1GRWA 4XP9H 2B39A 3DETD 3KNBB 3K72A 2ZQKA 3QZNA 2WXNA 3EOYG 3TYFA 2OKMA 4WZ9A 1T83A 3VGFA 4Z8FH 4BFRA 4H20H 1A8JH 4RESB 4LLQA 2J6WA 3BYTA 3SKMB 3U4EA 4AGNA 5FS5A 3MRJA 5FM8A 2P8MB 3ARGA 1T04B 1E6OL 3D39B 1FPTH 3QQ4A 3DRTB 2LU7A 2PW1B 3HOGA 1SF5A 3HN8A 4M5ZH 4ETYA 3ARBD 3H7BA 4AQ8C 4DVBB 5IOKA 1A1NB 2G2PA 3H9SD 3IXTA 3CVDA 3V9FA 4AG4L 3CDCA 3MV9A 1PKOA 4P9HL 4FP8L 1QFOA 4H0LC 4LSQH 3GMQA 5BJTA 4O00A 5HVHB 1NCAH 4FFZA 4WK4B 4NOFA 4W6YB 4I5BA 3P3SA 4PCTA 1RJZA 1KNOB 3I3BA 3ZYIA 3NACH 1L3NA 1TJHL 2FJFB 3CV5A 5BVJB 3BUYA 5IEHA 2DQMA 1M4KA 3NH7H 3UO1H 1SHWA 1DVUA 1XGTA 1V5JA 4Y4FB 5ICYA 1TXKA 5IB5A 3C5ZC 3ZT6A 1R33A 4ONGH 2GIYA 4GSQA 4E9LA 4F8LA 1YRKA 3WIHA 1IVTA 4NT6B 2WBJD 4IRZH 1W72B 3ZXAC 3NESA 1TVBB 3CXFA 4LHUD 1IGCL 1AXIB 4BA8A 1HL5A 4N5EC 5DJXB 2C3GA 4N87A 5GGRB 3QI9B 5JW3L 3FONA 1L9RA 1HYRC 2K3TA 5FKAB 4J3TA 3VCLB 2EP6A 3DHUA 3MV11 4UQCA 3T0XA 1A6PA 5C0DB 4N20A 2O6FA 3TU6A 4FADA 3FCTA 4AIZA 1TVHB 1IKFH 1LDPH 5HHVL 4KZEH 1S7UB 3VE0A 4ADJA 4FXKC 2P7TA 2E59A 5ICZB 2DWEA 3BPOB 3QH3A 4L4VB 4XGZB 5ERWA 5IG7A 1PD6A 1MAKA 1ND0B 3N9GL 5A40E 3BRGC 1NAMA 5DC2A 2JJTC 4IKIA 3IF1A 5LG6A 4Y88A 3N43B 1TSHA 3IS0X 4G80A 1YNKL 3KXFE 2F58H 2PCPB 5E8PB 2JFCA 1THCA 3BKYL 3VO0A 2DLFH 2YQ3A 3IT8D 2V2XA 5L88H 5GS0C 2DQJH 1IIIA 4YBLC 5HGGS 1JZDC 1QTPA 3DRQB 3KCPB 2P47B 4GRLA 1X6NA 2EE9A 2YD2A 4TSCL 5FYKE 4PJ8C 3L7EB 3KPPB 2MNUA 4E41B 4NERA 2VUOA 3WFCH 3U7WH 5DUPH 4OIAA 5I6KA 3OR7A 1IFRA 1HT6A 4IDJL 2V8MA 4JN2B 5L2JA 2Z1PA 3BKJL 1N7ML 4WWKA 1SQ2N 1F1AA 1B0IA 2XYCA 2G0LA 3R7QA 5AW1B 1DBMH 4AIOA 1BAFH 4F33B 4TM9A 5F3HB 2ZTBA 2J1ZA 4NO0D 5F7HA 4TXVB 4UOJA 1KDIA 1OF2A 4X6DA 4AENA 2HKHL 3GLAA 3Q43A 1FL6A 5SWQA 4H1LH 1WUZA 3UBXG 4W4NA 2V2TA 3LQAC 4HT1L 4JVUA 4LOUD 5B39G 1JK8A 4NCDA 3FT9A 5GGUB 1NFDA 1OE2A 4XNBA 1IEHA 4I77H 2G9HB 1O7SA 1PL3A 1YNTF 4L8CA 2FYYA 1HL4A 2BSDA 4XPAL 2RAMA 3DVGB 2JB5H 5JHDD 2UZIL 1KYFA 3RTQC 3S36X 3RY6A 1OW0C 1JZGA 3DSFH 2OMXA 1CFTA 2Y69B 1YECL 3RNQB 1BFVL 1OAUH 5HYSA 3IVKB 3HMWH 4OUUB 1A9VA 1CFSA 5EUOF 5FO9B 2XRAH 1CFNA 1T5XA 3NCJL 2WKLA 1CGSL 3IGFA 5JIHA 3V0GA 1E3XA 3B34A 4XC1L 1IBZA 4JKKA 1ET7A 3PWLA 2PCFB 3PXJA 5DEFB 3QDMA 3WJJA 5GS2H 5E9AA 5E1QA 1D3CA 1G0DA 3CFKA 2F61A 4L9LC 2XNAB 5DDHA 1L0XA 3KM2A 5BS0D 1LWJA 3O6KH 1OL0A 1ORSB 1MIMH 4KH9A 5D72H 4K8RD 1UXWB 1TT6A 1EXHA 2AQ3A 2ZAHA 1M3JA 4JO4L 1KIUA 1QBBA 3FQ4A 1SOSA 4E9VA 1T0OA 1DLFH 1H3VA 4FQCH 4WI5A 2Z35A 2AJUL 3MFFB 4FLSA 1CL7L 5K1NA 1FFQA 1FUNA 4EKXA 4JGJA 4UNVA 3AWEA 4LQFH 5IHUL 4Z77B 4RQQA 2QKSA 4C56D 1CDCA 2X38A 2H6OA 1UXLA 4MAYC 5I1LA 4ONOA 4FMVA 1RZ7H 1URLA 4TULH 5E1IA 3TO4B 5FCSH 5I16A 2BOBA 4R8WL 4PW3A 3MRPB 4EZJA 3O81A 3V0WH 1GGIH 4M8QA 4X98B 1GYCA 1SVZA 2J57A 5FW6A 4ZMZA 4YHNB 1D5RA 1HEZB 4HCIA 3UC2A 3WEXB 4LEEA 2AV7A 2FB4L 3MLTB 5DHVA 4PJGF 1MHEA 4DGWC 3H7LA 4EO5A 2Z8VC 4FQQA 2IEPA 3GSNA 3QS3A 1J8HB 2A9ML 2X4RA 3U1QA 3KVDD 4G1EA 2J8OA 3ZTDC 1RIHH 1T66C 2JKWA 5CU9A 4JFDD 3UTZA 2YBGA 4HKZA 4PRHB 4HK0A 4GJTB 3FQRA 4U1LA 1ANUA 2VUKA 3JV6B 3IDGB 1AFVL 3MLVL 4RBPK 5C6WH 5FFGA 4MTMA 4IBQA 4NKOB 4OM1L 1WBXA 35C8H 3K6NA 3NCBB 3DUUB 4RFNB 3MR9A 4TPRH 3OKOB 1BFOA 1RU9L 4TTDC 2E76C 5HDBF 4XMTA 2FGWH 1C16A 3UZEA 2ICWJ 3MC0A 2IMNA 1BQHB 4KMLB 3GMOA 2LR4A 2FEEL 2F74B 4APQA 1OP5H 4HUXB 4BM7A 4YK4C 2O5YL 4YDIL 4CGTA 2R2EB 4LLMB 1EEYA 3RVVD 1E3FA 4BKTC 1NEZB 3VXMA 4G8EB 2MH4A 3WTVA 1IM3A 4WTQA 1AGEA 2XQBH 3MXWL 4G7VL 5C0BA 1GOGA 4RETB 2AQPA 2X4SB 1KTDA 1J5DA 2CG9X 2Q8BL 1T6WA 4U7SA 1A7RH 2E9JA 3WJLC 1WWCA 2JIXA 4GKSB 4XWOD 2BVTA 1U21A 2J72A 1T1YA 1DO6A 1JF6A 1YDPA 2AXGA 5SWSA 1V7MH 4XPBH 1OAYH 1KLFA 1JGDB 4BD4A 1WC7A 2VKXA 3W9EB 1W8NA 4XMKL 4HPOL 1I7TB 1A6AA 2IPTL 5TFSL 5DD3L 4ZMLA 5ID1A 3M1OA 4NNYB 5GS0L 1BX2B 2CMRL 3T0EC 2P48B 4Y8AA 5F6HI 1PZUB 1KXQE 2EADA 1L9SA 2MPVA 5LBSH 4E36A 3H2PA 1J9SA 2E46A 1KB9K 2EKSA 1MQKL 5JOFA 4HHAA 5HGHA 4PBXA 4YFLI 3AACA 4N8PA 4PJXB 1UWGL 4ZG1A 1E9QB 2EE0A 1AI1L 1O0VA 2R29H 5DO2D 3T2OA 3QUZA 5JHDE 2L04A 5I71B 3L1OL 2OL3L 2VW6A 1M2VB 1GJWA 3FT2A 4A6YH 3VM5A 1DQLH 5DEZA 1DL7L 1YEDA 4MA3B 4QRBA 4RSYA 3VXSD 5BRZB 2J73A 1F2XK 1SN0A 4AMKH 2Z34A 2EH7H 4MAUH 1NJ9B 2VO8A 2OCFD 4XP6L 2R8SL 3QXDA 2TRHA 4BUGA 2PKDA 3FFCA 3LQAL 4NS0A 4X9HA 3VRIA 3MOBL 2E7HA 2CBMA 3DX4A 4X6FB 3B1TA 1UGKA 3DJ9A 2QGCA 1HHIB 3BVNB 3KLHD 1RZJC 3SDAB 2IAND 4LEXH 5C70A 4KGJA 4MDIB 5BS0E 5ID0B 5E6IA 1LVEA 1BZ9B 5DS8B 1AIZA 5GRJH 5LN8A 3PFQA 2NTFB 1RPUA 2HTKD 4Q9RH 3WN5C 2X10A 1G7PA 4F9PA 4IBWA 1JGEB 1BZQK 4U6TA 2PTTA 5JDSB 2V7NB 4U0RB 3VD1A 5T1LD 1XGRB 4OJFH 2WTOA 2BSRB 5HY9A 1BPLB 1ZVNA 2UY6A 5C0JB 1TZHA 3ML9A 4C56E 2NX5E 5DMJB 3NFSL 5DGRA 4XCCL 1G1YA 5BMFL 1FG9C 4R0LA 5J0BA 1IGJB 4N8VG 4L5FH 4CA4A 5B21A 5EEUA 1FNEA 3HNVH 3BKCH 1YHPA 3AVEA 3SDXB 2XTJC 1HJBC 5F8RC 2GABA 4N0YL 1JF5A 1IZJA 1XSOA 3I75A 3QUMH 5J57B 1JPGB 4J3XA 5C09A 1QFWI 4JFDE 4DETA 2Z7UA 4F7TA 1I1CA 4FMKA 1P4LB 2EVJA 4G42B 3TNMB 4JO3H 4WV1B 5GIRB 1CC3A 1VJSA 2IQ9L 1JI2A 1FO0H 5E9NA 5JIDA 1A1OA 4GINA 1JRHL 2ZUUA 3IKCB 1T21B 4MDJB 5KEZA 4HS3A 4K73A 5FGBC 1LO2L 3MAWA 4L05A 4NQDB 4AUYA 5E94B 1VADA 2VDKL 2VRKA 3L4CA 4K07A 5F89A 5GRUL 2CUIA 3CMGA 2VDNB 4Y19D 3O3BA 3TV3L 3Q3GA 3TPKA 1YNLL 1T1ZA 4X6BA 2Y6SD 2IPUK 4RGOH 4Y1SA 5C1MB 5D7JB 3C09B 2CBOA 1Q0YH 2NQCA 4NUQA 5AW3B 1CJYA 1FYTB 1B4TA 4LT7A 3BOVA 4NWUL 5IWLC 1I7UA 1XIWD 4EDWL 3H2WA 2TSAA 5EUOE 3BXNB 4HS6A 1GJUA 4JFOB 1AD9A 1UJ3A 3S35H 4LLUA 4R7XA 5EBWB 2OI9B 1XR8A 1ASPA 3C6LD 3HE6D 5D4JA 3IDJB 5D6DA 5F70A 3KYNA 5AVRB 1EXUB 1Q0XH 3RDTB 3M45A 5ICXB 2A6JA 3D0VA 3R7RA 2ICCA 1MF2L 4F93B 2EC8A 2IBBA 3F7YA 5K59E 1ACZA 1M7UA 3GPSA 3BAEH 3STZB 3DARA 4BFGA 1NFAA 2QFPA 4U4IA 1MCEA 1F6AB 4UT6L 3SGDH 3Q5OA 1NEPA 4NQSA 1XV8A 2H1PH 4GMSH 5J5EA 5DEGB 2DICA 1GVIA 4Q97A 5GS1A 4KHTL 2NT1A 4Z7VF 5D5ME 1FSKB 2YPKB 2OP4H 2V3EA 3VA2C 4LPWA 3RKPA 2R1WA 4Q0XH 1SEQH 4UOZA 3LZPA 2YEQA 2QR0A 4MA7H 3S3JA 1JGLL 3CH8A 4MJ2A 3P2DA 1Z9MA 4AEIH 1NCUA 4ZX6A 3G6AB 3T0DA 4DOHE 4NPKA 3VXSE 1ONQB 1F1DA 2YXFA 3AXHA 3BUDA 3MV01 2TRYA 2BXZA 4XVSL 1KG0B 5EOCL 2IDCA 1V27A 4G6MH 4U1KA 5F9DC 2H0JA 4Y5YC 1S7XB 1QSEA 2FEDC 4HC1H 5K39A 5KVMC 4ODXA 3W39B 3AROA 4HGKC 4Y16A 4QJ5B 2IANE 2QTVA 3KPQA 2AI0L 5DUJA 3IDYB 5JPNB 2FGZA 2QPFA 1ROWA 3DTXB 2VQ1A 4KRPC 2FX9L 2CKBH 4KJQC 3EOAA 3BVWA 4PBDA 4PJ7F 4PJ9A 4PTUB 1T3FB 5HYQA 1F4YL 5J6GA 1OOAA 1PF3A 1NFIA 1I8AA 4NENB 3KBFA 1Z9OA 1KT2A 2WCPA 1PJWA 1KYOK 5DSCB 4OLWL 4AITA 3B7SA 1KEGL 3VFNA 5JPMC 1RUML 2D31A 5IFJA 3OKEB 1AACA 5ADPL 1XBRA 4HOWA 3T6WA 6PCYA 5HD8D 1ZA6B 4JPWH 3VXUA 2GPZA 2XVBA 1NCNA 4OV5B 2VDRH 1KCSH 4FQ2H 4GRWE 3QNYA 4OQTH 3NP3A 1LHZA 5E70A 1RZJL 3ULVD 4LRIA 4Z1PA 1ZT4B 1VFBA 2J7LA 1UH4A 3NCFB 4FKEA 4L1TA 4N8CH 4UV4H 4ELMB 4F9LA 3PUUA 1FDLL 2DWTA 4KGLA 1E8YA 2QADD 4G8GD 3K4AA 5C07E 1JJUA 5F9JB 4BKSC 1CU4H 1XCWA 3WTWA 2NR6D 4HULB 3VFUA 3P3UA 5TQ0H 3TA3C 4KZDL 3O2WH 5CSZB 5AVTB 2BC4B 1KV7A 2RCSL 2BM3A 1UFGA 4CILA 2H8PA 1SNRA 5D4IA 5FK9B 1MLBA 3OLDA 1N3NB 5K33A 4M7JH 4W70A 3GKWL 1U8LA 3OJDB 4JHUA 4BFFA 1NGPL 3B8SA 4ZPTA 4Y19E 3CFJA 2ZP9A 1R17A 4KX7A 5I74C 3EIFA 5DVMA 1N2RA 1QYGL 3FQ2A 4OIBA 5ACMA 1RZGB 3ZIYA 4N9OB 1BLNB 1A4CA 3ROOB 1NUNB 3MRMB 4HXBL 5D1XD 1AD0A 2ZICA 3DGCR 3UZVA 2BNRD 3G6JB 4JO8A 3SGJA 1R5IB 2Z8RA 5JYLA 1P4IL 3L9EA 5I66B 4HOMA 4MB1A 2CRYA 2HJFB 1GKOA 4IRJD 4LSSH 4NJ9L 4QYOB 2IFFH 5EH1A 4CKQA 4MA8H 3TT3L 3VRJB 4XBGB 1JHKH 1JNLH 3OR6A 5LCVL 2JCCE 2LABA 2IXQA 3NIDF 4ZOBA 2E4TA 1P7QA 1XF2A 5H35B 2NTSP 3KJ4C 5TH2B 1T0PB 1DVFD 1EFXB 3FCGA 4XNZB 5C08B 3ARTA 4JG0L 4L2LA 5EU6B 4LEBA 1JZ3A 2NXYD 1N59B 2CHNA 3DJZA 2RQ8A 2PR4H 3EZ8A 2A6DB 5I1EL 2ZXEB 3O0LA 3HNTL 4OVUA 3UPCA 4WSGA 3VW3L 2C9PA 3TCLA 4JQIH 2PP7A 2OBGA 2XBDA 5KYWA 2EH8H 4PYGA 4FZ8L 4Z0BH 1UXSA 5D8JH 4U2ZA 3TN0A 1AR1B 1O7VA 2NCMA 1JWUA 5IBTH 5IV2A 4EUPG 3KHQA 2EIJB 4P46A 1SZNA 1UB6A 4PSRA 3RPIB 1AE6H 3RIAK 4UNTA 4XWGL 1SEBB 5CP7B 2CH8A 2WQAA 2XHNA 3RHWF 3ZKXB 4QRRD 1IGTA 3C60B 4MMZB 3N43F 4N2BA 1OZTG 4HHGA 3WKYA 3EJYC 4JG1H 1UH2A 3O9WA 2DIBA 5D7SL 4BGLA 4YIQB 3PJNA 1D6EA 4GAYA 3U6RA 3VNYA 1I8IA 4P07A 3TL5A 3RUGE 3GIZL 4W4OA 1KIRA 1P4UA 1PY0A 3D34A 4I3RL 1XGPB 1EHXA 2MCPH 3DX8B 4FXTA 5DS2A 5E08L 2WNXA 4D8PB 4X42A 4DP4X 3MSPA 3DIDA 2FEEI 2X4PB 1M6OA 1HXYA 2A74A 3MJ7A 3FMGH 3P3TA 4IOFD 4PV8A 3UERA 3GSUB 4MLSA 5BZWB 1T1XA 2ZWSA 3MRHB 2D03L 2I26N 4NFCA 3DX1A 5E2WH 2ZXBA 1HNGA 4PW9A 3IDUA 2PWEA 3QUKB 3KXFA 3RVXC 3U2SA 2WVVB 1E2VA 2VN7A 2JWYA 2ZUYA 1QLRB 1KPVA 1DVZA 3C5ZB 3R0MA 3WNLA 3BAXA 3PE9A 5TF1H 4ZUVB 4F7KA 4G8GE 3JTTA 4Y4FD 4GT0A 4HF5L 4PS4H 1NGZA 2KZ1B 2EEDA 3LRSA 1BOYA 4M56A 4OCYL 4WUUB 4WY7H 2YD7A 4U1GC 3B37A 3U6XS 4F8NA 3BN9D 4S1RH 3QDAA 1H6EA 3D51A 3I2CH 2IDQA 1TEFA 4XN2A 3ROLA 3QZBA 4W9CC 4GMTL 2GHZA 3F04A 5CO1A 1JPFB 2C9XA 3OTTA 3QA3B 4M03A 1B9KA 3MCKA 4HBQA 4AQAA 3UYRL 2QZQA 4EE2A 2X70B 3QJFB 4YEEA 5DQJA 3N0AA 4FXKB 3QI9D 4A7GF 2X4OA 3QNXA 1KCUL 4U1MA 3N1MC 2VH5L 1G7JA 2YBRA 3WMQA 3UJJH 1YMHB 3UIZA 2BRRL 2PW2B 3S3BB 2ZSWB 2GVYA 3MJ8A 3TS8A 5D1XE 2QQKL 4Q6IA 4UILH 4L4VD 2BNRE 1KCRL 4P2RB 5C0GB 3Q13A 4Z23A 4QTIH 4LLWB 4LSUH 1AJ7H 4YBLB 2H1XA 1HHHB 4NHCL 1IFGA 1SMDA 1UD3A 4M1GH 4PJ8B 1KTCA 2NZ9C 3BP7B 1EUTA 1JWMB 3BWZA 4G1MB 1RK1B 3GS4A 4I87A 3IWUA 4OZFG 2VDOH 5J4MA 1A9BB 1U3NA 2ENQA 3F84A 4NZUL 2NCEA 4FQ1H 2W65B 2BVOB 4ZFFA 1CR9L 4E41D 1A6ZA 2OL3B 3CFUA 4Y2OA 3MRDB 1J11A 4YHLH 2DQCH 2F5BH 1AP2B 4LOEA 6TAAA 5GGTA 2MPAL 2EO7A 4YHOL 5HXMA 5JTWA 3CZSA 1CK0L 3RL2A 2VMDA 2XU9A 1KYOJ 2IH8A 3KZ8A 4J3UA 1O6TA 2VIRA 3L3JA 4AKQA 4HEPG 1ADWA 1X5KA 1Y18B 3V0HA 1QNZL 2W59A 4DGYH 4KXZH 4PB0H 5F97E 2FT7A 4MYPA 5IB4A 5JXAL 2JF1A 3E9UA 4IIQC 4BFIA 3MXVL 1V7NL 4FN0A 1TQCC 2PABA 1A9EB 4FQXA 5TE7L 4B0MM 1NICA 2GBAA 3SYOA 3P30L 4EUPB 1KBGL 4ODVL 1HSBA 2EXTA 2YRPA 5FGSA 3F64A 4XCNA 3PYCA 3RTQB 4QRRE 2WXQA 1UM5L 4G6FB 4NOBA 4NQEB 3WELA 1VB9A 2DLGA 3OB0K 1GGCH 5F8QC 1SQMA 4ODUB 2WBJA 5L7XH 1JRHI 3Q2NA 1X4ZA 4PMFA 3V9CA 2GC7C 1NLBL 4LHUA 1GAFL 5F7DA 1DZBA 3SE3A 4WLCA 2G2RB 2L7JA 4HUUB 1VFAB 2ADIB 3OJ2C 5DQDL 5EDXA 1JNNH 2GTWB 3FU6A 2NPLX 5DJAA 4MFHA 2Z1KA 3MA9L 3RWCB 4L9LB 4QGYA 4JZJA 3L95B 2P8PA 4BDVB 1A7QH 2OZ4A 1MCCA 3D39E 1CXHA 3D18B 4OD2B 3JV4B 4PRPB 1DJZA 4IGBA 1ZHLB 2DQFA 3FQTB 3LIUA 4N0UB 3B9AA 3WXWH 3ISYA 4CSSA 2WXJA 3PGCB 2ICEA 2N7SA 3FO1A 4JPKL 4X6CF 3MREA 1B88A 1JGVL 3A0OA 4GAJH 1CYXA 4P5SA 4HAKA 4MXWL 5TQ2L 5L9DL 1MIEL 1RP9A 4QMEA 5HGBB 2NW3A 4GW4A 3C08L 1KCVL 2ADJB 4MAYB 2IWKA 1T7ZA 4NC1C 4XP9L 1HHGA 4FHBD 2CHZA 3RZCD 1EEZA 1CF8H 4J3SA 5I5RA 4PJXF 1SOXA 4H20L 1LP9B 4P2CG 4JANB 4JJ5A 4UM8B 1LEIA 4MA1C 1DQQB 1HFUA 2CO6A 5K9QG 3TVMA 3ES6B 3TO4D 1UT1A 3W0WB 3WGVB 4QY8A 3LKNB 1WFUA 4MQTB 1R46A 2PN5A 5F1IA 3T4AA 4N2MA 4P04A 4AVKA 5DYFA 3UBGA 1U8QA 4R4BA 5TF0A 1NANI 1MFDH 1J8HD 3MRNA 4GUQA 2Z7ZA 1NCAL 3B2VH 3MJ9H 1H19A 4NPJA 2G5RA 2K7PA 1G7HA 4MRCA 3WFDL 3L3GB 2ZWZA 3NACL 1PLAA 1KXQA 4PRHD 2Q7NA 3GUTB 3IBEA 4NIYE 2LT9A 3NH7L 4J8RA 2R59A 2FWOA 2AJXH 5FYLD 5FFLA 3FTGB 3N85H 4L4VE 4YK4B 2Z3FA 2G4EA 5JIPA 4OLYH 5F1NA 1JF1A 5JHDA 4YDNA 1ODUA 2FIKB 3ELAT 1NPUA 2CBQA 1G4RA 1UUNA 3WKQA 1BVNP 4ZYKB 2X05A 4I7ZC 1E6JH 3DVNB 2Y36L 3TTYA 4S2SA 2EDEA 3N3EA 1AIFA 1QSFB 1A7NH 2P5EB 3R4RA 4UUJA 1MCQA 3DVFA 3G04B 4J1UA 4ATTA 4E41E 1UB5A 4PRAB 4D8OA 1YEWA 4JEGB 3LZFH 4GY4A 2YGPA 1IKFL 1LDPL 3SBPA 2XY1A 1OM9A 2CBPA 3SDXF 3ULAB 3E9TA 5BS0A 3HI6H 3T0EB 1F4XH 1GOFA 5AUMB 2O5ZH 1TJIH 2GFBA 2QLVB 3KW7A 5K93A 1JGUL 4D7PA 2W07B 5EMYA 3JYCA 4L37A 2DLFL 5MP6H 2H1LM 1P9MA 3AG1B 1S7WB 3AM8C 4RAHA 1NPNA 4N2IA 3X12A 3CXDL 1SJEA 2XXCB 2F54B 2VXQA 4KNSA 2BWDA 3H54A 3QUXA 4CNIA 3PWUA 1AGBA 1SBBA 1HINH 1L6ZA 4MBOA 4O2EB 4C56A 4NUPA 2NX5A 4LGPB 4ZW7A 3MNZA 3ILPB 5DUPL 4H8WC 4PJBB 2EVFA 1CGYA 3T6QC 2WIIB 4V2CB 1P7BA 2APBA 2DTSA 3B5GA 5FKPB 3HUJB 2BIQA 4DVRL 3D25B 4PS7A 1ZTXH 4KKRA 4K5LA 3CDYA 1MFBH 3CX5J 5DJ8B 4B9PA 5J8OA 3T8MA 1UM6L 3MGTA 2ODIA 1Q94B 4WTWA 3D30A 2KDYA 3WTUA 3U0PA 5FDYA 3SPJA 2HJLB 5H2BA 4JFDA 4LKXB 5FW7A 2XZQL 3OMIB 4Y5VB 1HYSD 3OLEA 5JHMA 2C3HA 3INUL 4Y4KC 1UG9A 4TUJA 5AZEL 3WN5B 1T2QH 2YUZA 3SDAD 1QSZA 2ID5A 1UUSA 4GRMA 1ITBB 4OZGB 4GXFA 2A0LC 3VQ2C 4JG5A 3BPCB 1F58H 3QQXA 1YNTA 3EYVB 1T20A 1X4XA 3JVFC 4PG9A 4MB5A 3VRLF 2C8NA 1DUZA 4NCC2 1HCFX 2G75A 1AYRA 3SO3C 3V0VB 5HPMB 3TIEB 3Q1EA 4IBSA 2Y5TB 5GGSB 2H9GA 3DSFL 1SFHA 4ZODA 4PY8J 3D4YA 3SPVB 3BZ4B 3AU1A 1CQKA 5EUOA 5IJVB 3V52L 4A68A 3LXCA 3SN6N 3IPFA 2B4CH 2Z4QB 2XTJB 1MHCB 4TMPA 1GIGH 2E9BA 2AKRB 5BO1H 4N0CD 2ITDB 2DM7A 1KFAH 3L45A 4MVBD 1PS3A 2Q6WB 3O6KL 1JXDA 2CLVA 2EIZB 3REWA 5DJ6A 4HP5A 2F8IA 2QMJA 3KH4A 5F7EH 2OSYA 1J8HE 3U1PA 2E5EA 1WYJA 1DLFL 3DBSA 4FQCL 3MLZH 4PRHE 3TYGH 1X5GA 3O45A 4EIBA 4TVPH 4OFQA 1AZUA 3A6BH 4QEGA 4L0ZA 3ZTJH 2DQIL 3NJVA 1VPOL 2GK2A 4LQFL 5FYLE 4AQEA 4FNSA 1FNHA 4XP4L 5D5MA 4XT1C 3FW6A 4NQDD 1HSAB 1PDKA 5HHMD 4PD4J 4R26H 1FNLA 2IF7A 4ZNCD 5JIQA 1FFOA 4OCSL 4JPVH 3X1EA 4XB3A 3PF2A 4J3VA 4F92B 1W0VB 1CE1H 3V0WL 4M4RB 5HHPB 4QNPE 4PAZA 5D7JD 3CVHB 4UU9B 4AYBA 4HOZA 1FIEA 1FYTD 3VXSA 4EKJA 4FI6A 4EDXA 1QOKA 1XAUA 1YY8B 3VFPB 4A2FA 3L7FB 2CJUH 1RIHL 5D2LB 5BZZA 4QCIB 5EFIA 3KS0J 3GK8H 4Y8DC 1ZWIB 2HVKA 1JG9A 3QJTB 4DSYA 2PF6A 3T2LA 1DBJL 2XSKA 1BP3B 3RDTD 4LPCA 1M6UA 2IANA 1TZOA 1MCHA 1F3DJ 5CP3A 35C8L 1X7QA 3IJYA 4PSPA 4TPRL 1EHLL 2FT6A 4QRSA 3LHPH 4ICXA 1P1ZB 4I4WB 1XB8A 1GGUA 1N18A 1Q9LA 2C3XA 1ZTMA 1FL5B 2QPSA 4EI6B 5B38A 4ZD3L 2FAUA 4XR8C 1MHPL 3DPBB 4XX1E 1CGWA 5T1LA 4YUEH 4CU6A 2YUXA 3ABKB 4DKEH 2D0HA 1X9LA 4PW4A 3G9VA 2PPFA 4PJXE 2KUTA 2XFXB 1S7RB 2HUHA 5CD5C 2AQSA 1A7RL 2EDNA 2VN3A 3IMWA 4QF1A 3FSWA 5FCUH 2OMZA 4YR6A 4YHIB 2QHRH 3F83A 2HLAA 3PL6D 4MWFA 1OD7A 3ZN6A 1K5WA 3VXQA 1FCGA 2EE2A 4JDVA 5TE4H 4JM2C 1KGJA 1V7ML 4HPHA 2HXAA 4G6KH 3GKZA 4BH8A 4KRLB 4Y5YB 4NX0A 3QZPA 1K3IA 5C07A 3G6JF 3N2JA 5BRZE 1S9VA 2XN0A 3D69B 3VGEA 3CU1A 3II3A 3O3AB 1NKRA 2GG1A 5IQOA 3EO1B 1RZFH 3PJSB 2HSIA 4BFEA 4KRPB 1GGYA 5AZ2H 5KS9B 1NAML 1WPCA 2E8ZA 2X3AA 1R24B 3DOHA 3TBVB 2H45A 5E99H 1IVLA 1PZ5A 1CTMA 3B2PA 4X4ZA 3SKNA 1KGWA 1XCQB 2OMWA 3RWIB 4H8WL 4MB3A 2IGLA 2WLLB 4IU3B 1IGMH 2Q86A 5A7EA 1V8HA 4Y19A 2KZBA 4Q56A 2KQNA 5JPMB 5I1DB 2OFQA 3E6FB 1E67A 3MMEA 1I8MB 3GI8H 4A6YL 3LB6D 3FUKA 1FC2D 1OGTA 4OR1A 4Q89A 4AMKL 4G3YH 4MAUL 4HGMA 5GHWH 5FB8A 1ZGLM 4FG6D 3OKKA 4OZHF 2HFGH 4G7RB 4CDHA 4G8FB 3C6LA 5EIIG 3NJGA 3HE6A 5T3ZH 5FA4A 4IMKA 1IILE 4YDJB 3SDXE 3VFGL 5JORA 1F11A 4V1DB 4U1SB 1XSKA 4KI5C 3TA3B 2JCCA 5JZ7C 5CCHE 2O6EA 4GXUM 4LKCB 5B3SB 1D6VH 4WGWB 4AZUA 3KPMA 2L7UA 3OKLA 4WK2B 4ZUWA 1IC7H 4WTZA 2Y23A 3QO1B 3NZ8B 4U1JB 3JWDH 1WZKA 2DQGH 3SGEI 3VI4F 3JSSA 4PRDB 4O2CA 5DFVD 4Y0GA 4MKMA 2DY2A 4HFWA 3V6FA 4PRIB 2YXVA 1S46A 2P8LA 1MRCL 4YHKH 4HYTB 2AERT 1KBBA 5I74B 3FQWA 1AKJD 3LV3A 2YQGA 4NQDE 3PP4L 5GZOD 4DKFH 3X14A 1NMBH 5BRQA 4GO8A 1JTTA 4C54A 1R5VB 3QG7L 4F7PB 1MDAA 3IU3A 5MEOB 1MJ7L 2C26A 3HNVL 2X3BA 5I24A 2X4NB 4YHZL 1EJFA 1C12B 2DPKA 4M3JA 3MUHL 4Z95L 4PH8A 2FH6A 3DHJA 1MUJA 3GSVA 3KG5A 3QUML 1FYTE 1RH8A 2WLYA 4LXFA 5IKCA 5EHFA 2I69A 2WVUA 2GIMA 4P05A 3DO7A 2OM5A 2QQLH 4WU5B 3NJNA 3N44B 2BOLA 4Z7OB 3L2LA 1QD0A 1E4KA 4LU5H 3H85A 3KJ4B 1KJMB 1NGWB 3RUGA 4XAKD 3BUBA 1MREH 2XWJA 1NUFA 3RVTC 4FFWD 3FB6A 3KYAA 3OWRA 4PGCA 1JHLH 1P53A 5C2BH 1Y6KR 4M7ZC 5AOZA 5INDB 3VG0L 4PS3A 5I30L 5C08D 1D7CA 3G6DH 3VRLE 2EVGA 2H3XC 5EU6D 3T0BA 1D5BA 3FO2A 4XZ4A 4GKZB 1U2HA 3CSYA 3BP4A 1M05A 3L3KA 3AFLA 4KK5C 4DO6A 2WKOF 5KVDH 3JWOH 1C7TA 3MLPA 2UY7B 4UT9H 3DLQR 3LY6A 3WIAA 2SODB 1SHSA 2GUYA 4IMLA 3T9WA 5C0ND 4NGHH 2F7RA 4FYSA 4S10A 3DBXB 3NSCA 1PG7W 2GAZB 1H9VA 2LLLA 3A5VA 4JUSA 4WEMB 1VFMA 4NDMA 3U83A 3LX9A 5EORH 2DLEA 4GLRH 4AT6A 1VA9A 1V54B 4L8DB 3RLSA 4DP5X 1K8IB 3IJEB 3K6OA 1H3UA 3ZTCC 4G8GA 7CGTA 4N0RA 5T1DL 2CLZB 5SWZB 3SKOB 3FUFA 3BAEL 1PZBA 2NR6A 1NDGA 3DMMC 3O3EA 1I1FB 3MACH 1DQDL 4LEOB 5A16A 4LCIL 3RIKA 2JKNA 5EA0H 3PHQB 4FLHA 5IW6A 1J0HA 2ODHA 4HKJB 4WI7A 5GJSL 1T4WA 1QAWA 4GMSL 5IFHL 2OTWB 2BIIA 3M1CA 4PWHA 1U8JB 1QABA 2Q8AH 5IHHA 4W81A 4OU3A 1S4IA 2APXA 3KPOA 4WU7A 1ETZB 1GC1C 2CIIB 4JRXB 4XAWH 3K3QA 5IM7A 1M9WA 5DK2B 5KN5B 1T2XA 1TTUA 4HA1A 5D1ZC 1JZ2A 4MA7L 4MNHB 3MV7B 5F88A 3TFBA 3O2DA 2MMXA 2VN5A 1ZHBB 3EYQC 1YY9C 4HCRH 5D1XA 3SPHA 1YN7A 3AS2A 2BNRA 3BPLC 4JGNA 4ZX5A 2KLSA 1G7IB 1MCWW 3NK4A 5JW5A 2DDQH 2LVEA 5F44A 1ZE3C 4G6ML 3QPQC 3CSBA 4F8OA 1OHQA 2YXMA 2VO5A 4B9GA 2ATKB 3LTVA 1BMWA 4HC1L 4HSQA 2V5SA 3GSOB 2W0LA 3C5ZD 3E8VA 3QQ3B 4ELME 1SLVA 4BZ1A 2XXMB 5KAQF 2F53D 4I0PC 3IMUA 4F15C 4AE0A 1QVOA 1DVFA 4P2QB 4WUUD 4J2XA 4NYLA 3GLDA 4N5ED 1T89C 1L0QA 3PDGA 3RFZA 3U2IA 5D93C 2XTSA 4X8XA 3OB0H 1MXDA 5FO7A 3FU3A 5HGAA 3K8LA 3V6OE 3P69A 4AC2A 2GSIB 3HZMA 4YE4L 2W9EH 5C0IA 1EO8L 3BUIA 4MD0A 3ARZA 1O6SB 3HFML 4S0HA 3FRPB 1H0DB 1IGYA 2KERA 2Z9TA 4KY1H 1KCSL 4FQ2L 4OQTL 2NDFA 1DEEB 1XMWA 4OFIA 4BQBA 3KS0H 4UV4L 3NIGB 2ZOTA 4N8CL 1RPQA 2BFVL 3ZZQA 3ZDXB 3DX7B 4QHNB 1AG0A 4Y5XC 3OHXA 1HXMB 2Z6FA 4TLSA 2X0UA 3NIFB 4P2RD 1F3DH 3G6JE 1AY1L 1CU4L 1KC5L 4HX1A 4O51B 4FQHA 2Y9RT 5AOMA 5GS0D 3DYOA 5ECJE 2YS4A 2HTLC 5C6TH 4NZJA 4B3VA 4PJ8D 5AKSA 5E56A 3V9EA 1T22A 3TP4A 4BUHA 3CN3A 1N10A 3CCHB 2XQYG 4MJIB 4QJ3B 1JBJA 3KNBA 2OMBA 5JMOC 1KBPA 2V9TA 1LP9F 2KZKA 5DVNA 6CGTA 1SLUA 1U2YA 4WW2C 4GI6A 3SKMA 5C08E 1WCBB 1JFHA 2P8MA 2P9RA 5EU6E 4F2EA 1T04A 3F58H 4K3HA 3D39A 1CFQA 1KELH 4KO7A 2NUTB 3HG4A 2DIJA 3H55A 2PW1A 4CGUB 3OAYH 4DVBA 3AT8A 1A1NA 1JFQH 2CXKA 3Q7JA 3EADA 4IIQB 2GK0B 4E2OA 1TQCB 3CZEA 4X80H 4H1LB 2XI9A 5CJ8A 4RRPM 5LGJB 2FX7L 3O11B 1OB1B 2JE8A 5FM5O 3FDWA 3BFQG 2PCXA 2MOVA 3FSZA 1KNOA 2IFFL 3G5VA 4MJ5B 4CJ0A 2EXYC 3GXMA 5KYYB 2FJFA 5BVJA 2ZUWA 3OMNB 2B59B 1JZ6A 1IEBB 4DESA 3SB3A 5DJYB 5CBAB 2WHVA 1QMUA 1QUPA 2IC2A 3RTQD 1NDMB 1OT1A 1AQMA 3KE0A 4G6FD 4NQED 2BINA 4NPYB 5CHNB 3VGBA 5E1AB 2MCAA 1N19A 2NNXA 1LO5B 4K3DH 4P23C 4NT6A 2PR4L 2ZCLH 1ZXKA 5FM4A 3MO1B 1W72A 5KVGH 3QSKB 5JQ6H 1TVBA 3MLXL 2VDLH 3CDZB 5DJXA 2DLHA 5CKGA 1PVHA 2J1WA 3C5SB 4AVHA 4XZUB 2EH8L 4Z0BL 3MRFB 1B4LA 5DRZB 3DUHA 3QI9A 5D8JL 5GGRA 1S5HB 5F1OB 5FKAA 3SOBL 4KVPA 4NB7A 3VCLA 1W0WB 2WXGA 1PPIA 4LSDA 4IU2B 1IGFL 5C0DA 1TVHA 2X41A 3QDJD 4NN6C 5FYJU 1DP0A 1S7UA 3Q1SL 4L3CB 5DD0H 1AE6L 5ICZA 2CDEB 3R06B 4FXLA 4YDLC 5I5JA 2QZ5A 4L4VA 4XGZA 1YQVH 2JQMA 1ND0A 2XJKA 3H42H 1MCJA 4JVPA 2JCWA 3V0JA 2ZXWB 4AKOA 12E8H 3MNMA 4AV5A 2R56H 2PCPA 2J6EH 1ZT1B 2W38A 2VRQA 5E8PA 1T03H 1A3LL 4M5TA 4FABL 1G43A 4XNMB 2A77H 4JHBA 3BP6B 3E80A 3W82A 4MA1B 2R4SL 4XMLL 1KCWA 3DRQA 3GF8A 1GC1L 3SYPA 2MCPL 4MJHA 5EPMB 3RWEB 5B1BB 5BO0D 2OJZH 2H7WA 3L7EA 3KPPA 4JDTH 4X0NA 3BYYA 4JE4B 3CZNA 4WUUE 2EDTA 4NO5B 2D7NA 4E41A 3AY4A 4JL2A 3FMGL 4OCWH 3ULUF 2H3NB 1EH9A 1IBDA 5BUGA 2WYTA 3W0WD 4CVUA 8FABB 4JN2A 4Z3HA 1HEHC 1X5ZA 4JHZA 1Z3GH 1JP5A 4OD1H 1T66D 1G7QB 3EYOB 4XN1A 3SDDC 3SYQA 2N01B 2YFOA 3B7RL 43C9B 1TJGH 2BZ7A 5E2WL 4F33A 5CU5A 5F3HA 2YGQA 2C5DC 3BLBA 3PV6B 2JKLA 1G9NC 1BREA 1L4IA 2WQXA 1M53A 3DWTA 4QHUB 4K23L 3ZYOA 1E2ZA 1ZSHA 1IRAY 3BE1H 4PR5B 4XVUC 4TTDD 5HDRA 5JYMA 2D4FA 5DMKB 4JBSA 3S5LB 1GXEA 3CFBB 5TF1L 5GGUA 1ZXQA 1MCIA 4PS4L 4P2RE 3KMDA 2F5AL 2WXFA 2G9HA 3MLUL 1GZPB 2P42B 3DVGA 4S1RL 1GMEA 4XVOA 3I2CL 4QOKB 5L4JA 1XBDA 4KOCA 3P4MB 1N5YL 5DR5H 4TOYL 3WKMH 4MLIA 4XXWA 1PBYA 2ENJA 4RMRA 5ETUB 4YVUA 2AEPH 1NGYA 3RNQA 3IVKA 3N1FC 3LPFA 4OUUA 4IM8A 5FO9A 3ZZLA 1AGCB 1BGXH 3RIFF 4OIFA 2P5ED 2X4UB 3T6XA 3B1UA 4A7GA 1HI6B 3AQYA 3ESPA 1JI1A 5DEFA 3FUIA 3AQZA 1URZA 4R6UA 1L7IH 5IROA 3FYEB 1ZEAH 2O6PA 2EE3A 3Q8BA 1VDGA 3SSGA 3DK0A 3V55A 4QXTB 1WWBX 2XNAA 3AS0A 1ORSA 3T0ED 1WBZB 4NQTA 1AJ7L 1D7BA 1OLLA 2VT0A 1UXWA 3IPBA 3LRHA 4JO1H 4YH6A 5CGBA 1A25A 3RDJA 1NAMB 2UZPA 4M1GL 1CICC 1HTYA 1CFBA 3BLKA 2CD0A 3HI1B 2GITB 2D9CA 3BWUC 4U6VL 4LCYA 4F7MB 4I8DA 3MFFA 4HKBB 3LS5H 4K9EH 2F54D 1MG3C 1DVQA 4Z77A 5J1TC 1ZAGA 1GYAA 1I9JL 3NTCH 3WIFB 5EC1B 4NQEE 4JY5H 4YHLL 2DQCL 4N2HA 3NJHA 5FHBH 2NY7H 3TO4A 4A6YB 2CRZA 3FUDA 4KX8A 3L08A 1CTNA 2NNRA 2YSTA 3MRPA 2VC2L 4ZFGH 1SYSB 5AOJA 4X98A 4YHNA 1I1YB 3WEXA 1F6LL 3MLTA 2W8CA 4DGYL 2RMNA 4U1HB 1WTGT 3HN5A 4DF9A 1J8HA 1RJCA 2DOCA 3AWGA 4PB0L 5D2LF 4Y4KB 2R0KL 5H37H 4Q14A 3GXNA 4MJJA 4KKZA 5LKNA 3FUEA 3HRPA 3GFUA 3AADB 1ADQA 4YXHH 4KQ3H 4PRHA 4AENB 3BZFB 1N8ZB 3IN0A 3L8QA 4QGTA 5AD0B 2CRMA 2JH2A 3JV6A 4M93C 3QXAB 3IDGA 2BNQD 3FQ1A 4ZS7L 4PRPE 4PCSA 3SO3B 1AXSB 4NKOA 4N0UE 3V0IA 2DLTA 2XN9B 1V3LA 3FSOA 2IDTA 3DUUA 4LFHG 1EZSA 4BEIA 1H6TA 1GGCL 4LSPL 1K4DA 2H0EA 4PFEA 1BQHA 5CSGA 4RISH 5C3LD 1SOKA 2F74A 1HQ4B 3P73B 4NP9A 3PAZA 4HUXA 1NC2B 1N64H 2A9AA 1CPUA 4YBQC 2R2EA 4LLMA 5EZOL 1NEZA 4G8EA 7PCYA 2NY2D 5IW1A 5DJ2A 4N28A 3BIBX 5EIVA 4A1RA 2X4SA 2E7BA 1LP9E 3NRQA 3HJEA 1R0AL 1PIFA 4J7RA 2XTJD 1YEIL 1CFNB 1H5BC 1U0QA 2B4CC 4JHWH 4GKSA 3DIVA 2BY0A 3AREC 4HH9B 3W0WE 2C4FU 3QUMB 2Y4SA 1TMQA 2YARA 3W11C 4OZIF 4ZFZB 2Y07H 2HT4C 1MXGA 1Q1PA 2MWCA 4N25A 3WXWL 4TSAH 1SYVB 2CU9A 1JGDA 3MJGX 2XJLA 1B2WH 3W9EA 4X6CA 3CN2A 3RURA 4MQXC 1I7TA 2MQGA 1EHAA 2DH2A 3I9AA 4HIPA 1MW1A 4NNYA 1BX2A 4FE9A 3TEWA 1T6VN 3TWCH 5J13C 1XF4B 2UVEA 3UBXA 3US0A 1F1GA 4FULA 1LK3H 4UOQA 3QIUC 4NM8H 4BV1A 1UD2A 5AKTA 4PJXA 2PUQT 5AYUL 1M1SA 1E9QA 5HVGB 2QSCL 2JKSA 1SY6A 5DZOA 5K1VA 3SE9H 1PEZA 3VUAA 1RULH 5E95B 5A2KH 4I3GA 1OIOA 1M2VA 5HGDB 4UT7H 5LXGH 3ZHKA 1IAOB 2ITEA 3GINA 2MTPA 3GXFA 4MA3A 1G9NL 5FUCC 5BRZA 1OGSA 2NOYA 2X6BA 3H3KA 3B2VL 4F5CE 1O9VA 1QSFE 1NJ9A 2P5EE 3MJ9L 3QRFM 5B7MA 2VR8A 2DQ6A 5I0XA 3HTLX 4TV3A 3G5XB 3DJRA 4M6MH 1L0YA 1OT2A 4K5PA 4X6FA 3E3QE 2UUDK 2AJXL 3BVNA 2L7EA 3SDAA 4KNQA 1G94A 3N85L 1M2OA 2LTQC 4KMQA 4MDIA 1RJLB 2E7MA 1NBZA 3B3IB 1BZ9A 5DS8A 1FGNL 2NXZC 3T0EE 1A4JB 4OLYL 1XL4A 1RVFH 3WFEH 1OE3A 5DRXB 3EDEA 4EPSA 4GAAA 4ZMAT 3MR9B 3HBGA 1JGEA 2R69H 4OLZH 4CC0A 4UOW0 5FYKL 5JDSA 1U41A 4OBRA 4Q2ZA 1JN6B 4AV4A 4ODHH 5D70H 3QWOB 1XGRA 1P6WA 1AZCA 3S34H 1E6JL 2BSRA 5HJBA 2F54E 1FAIH 4FA8A 5B4MC 3S36H 1RZKH 1EEYB 1A7NL 5SX5K 4XNXH 1WP6A 4JM2B 1N0LB 5C0JA 1ACYL 1AQKH 3JTBA 3OC8A 1JPTL 4PJBE 3ZT5A 5CLZA 1A02N 3P0VL 3T2NH 1IGJA 4NUGH 4XOCA 1O6VA 5BNXD 5IGXH 3HUJE 4JN1L 3SDXA 1HILB 4TNEA 3HI6L 4C59B 1F4XL 3ZE0B 3QEQA 4QLRA 2VMCA 4Z3EA 1UA6L 1CLYH 1WIOA 2WXIA 2FEDD 3FTVA 1EA9C 4JFPB 2C9AA 1JPGA 4FFYA 5I1KH 3SYCA 4FL4C 2G60H 2O5XH 5HYEA