3UADA

Multicopper oxidase cueo mutant c500se506q (data5)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHQDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An O-centered structure of the trinuclear copper center in the Cys500Ser/Glu506Gln mutant of CueO and structural changes in low to high X-ray dose conditions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Blue copper oxidase CueO
total genus 135
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uadA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uadA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uadA03
3IEAA 2IDSA 8PAZA 1E5ZA 4E9QA 4BWWA 2BW4A 2TSAA 3CG8A 1AR1B 2DY2A 3X1BA 2BP0B 2FT8A 2R7EB 3CVBA 2GI0A 2YAQA 1KCBA 2FQFA 2IH9A 2RACA 3FU8A 4BDVA 3H4FA 1J9TA 3ABMB 2J57A 5TK4A 2PP8A 1TKWA 4BWTA 2IDUA 4HALA 5I6LA 1OE3A 1SDDA 2OCCB 1ZIAA 1QLEB 2W88A 1M9WA 1M57B 2IH8A 1L9SA 1GS7A 5B1KA 2A3TA 1NPNA 1SHXA 2HRGA 2YAMA 1WS8A 4G7SB 4A66A 2P80D 4A2HA 5I5MA 4A2EA 3PAUA 1QHQA 1XB8A 2CALA 1MZYA 1ZIBA 1SNRA 4G71B 2XYBA 1MG2C 4A68A 2HLEB 2GSMB 4KOCA 1HFUA 2IDTA 4HZ1A 9PCYA 1JZFA 4HHWA 1OE1A 1GW0A 4AI7A 2BWIA 1J5DA 4KNTA 1BQ5A 2BO0A 1AZNA 3SBRA 1GY2A 1URIA 2FT6A 3QJVB 5B3SB 1YLBB 3UGEA 3FSZA 2DWTA 1IUZA 5I6MA 1PLAA 4EF3A 3NSFA 2CBPA 4GP8B 4YSOA 3ZBMA 1GSKA 3SBPA 1WS7A 2UXFA 4YVUA 3QJSB 3AW5A 2CCWA 4DP4X 1TEGA 1MZZA 1KDJA 3CVCA 1PMYA 3PXLA 4KO6A 1PZBA 3OQRA 4A67A 1WA1X 1I53A 4P5RA 2MTAA 1EZLA 1JZJA 3FPXA 3NJFA 3T9WA 1L9OA 3QJRB 2Q5BA 3AG3B 1OCCB 3X2QB 2XWZA 5PCYA 1SHWA 1SF3A 3TASA 3WNJA 4BK5C 2XX1A 4DP0X 2AZUA 1A65A 3ABKB 2PPDA 4HCGA 3IBOA 5PAZA 1PNCA 1RCYA 4KOBA 2DWSA 4QKTA 2GHZA 1HAWA 3S3DB 2XLLA 3IE9A 1NIEA 1JERA 4NB7A 2QDVA 3S3BB 3QJUB 3NJHA 5TK2A 2BZCA 2JXMA 1NIDA 4YSTA 1KBVA 2Q9OA 5B1JA 4YSSA 5B7FA 1ASPA 2GC7C 2DYSB 1AZUA 2B08A 4JHUA 2I7OA 4HCIA 1QNIA 1GY1A 2OV0A 3OMIB 2VW7A 2IWKA 4GXFA 4KNUA 1X9RA 2JKWA 5AKRA 2E86A 2QPDB 5I6PA 2BZ7A 2HX8A 3FU7B 3H4HA 3DIVA 4E9VA 5B7MA 2GIMA 2EIJB 1XB6A 1AACA 4A2GA 2GB2A 4P5SA 2YARA 4TXVB 3AG1B 3ZIYA 2TSBA 1BQRA 2FWLB 2XUWA 4KO9A 2VM4A 1KV7A 4G70B 3TA4D 3GDCA 2PPAA 4CSPA 2H3XC 2H47C 3NJNA 2QPEB 4MFHA 5I6NA 1N68A 4DPAX 2J55A 4NAJA 4HAKA 1SDDB 4DPCX 2BP8B 1VLXA 3AZUA 2YAOA 3FQ2A 5D4JA 3WNIA 1E65A 3SBQA 3WKPA 3IN0A 4YSDA 1AG6A 1WAEA 2XV0A 4L0PB 1AOZA 1X9UA 2GC4C 1WA0X 5F7AA 2FQEA 3V9CA 3WI9A 4G7RB 5AFAA 3CVDA 2AZAA 3MX0B 2PCYA 3FU9A 2HZHA 4KNSA 3FYIB 4HIPA 4UAHA 4YSAA 4G7QB 3RYMA 3TBCA 1JVOA 2UX6A 4YSRA 1L9QA 3OMAB 1AQ8A 4WTQA 1KDIA 2XU9A 4HCFA 1WA2X 5I5JA 3NJMA 3NSCA 1NPJA 2DV6A 3NJGA 1E67A 2VMJA 3N55A 3T6ZA 3UAEA 1AZCA 2BHFA 1J9RA 2XXGA 7PCYA 3MBWB 5I6OA 1T5KA 3T6VA 1GS8A 1BAWA 1JVLA 4WKXA 4YSCA 3NJKA 2IWEA 3CDZB 1FA4A 4BXSV 3EH4B 2YAHA 2ZONA 4AKQA 4E9TA 2WO2B 4PAZA 3SQRA 4F2FA 2B3IA 3FU7A 2FJSA 3KW7A 1OE2A 5ANHA 1A4CA 1JXGA 1KGYE 2JFCA 3NP4A 2UX7A 1ET7A 3TBBA 4GYBA 3WG7B 1BYOA 3X1GA 4AKPA 2ZXWB 2FT7A 4GY4A 2HX9A 4BDVB 4DP1X 3JT2A 1AANA 6PAZA 3UADA 1OCRB 2QT6A 1IKOP 1NIFA 2YAEA 3QJQB 1PZAA 2IDQA 3UAAA 2BP0A 2I85A 5B7EA 4DP7X 1DYZA 3QPKA 4DPBX 5I6KA 1W6LA 2QDWA 1ADWA 2VN3A 3ASNB 2XVBA 4ZK8A 3S8FB 1PNDA 1R1CA 3WKQA 3NJIA 1BYPA 1PCSA 1ET5A 1KCWA 3FYEB 3NYKA 5LDUA 4FA7B 1JZIA 1XMEB 2X87A 1CUOA 2CUAA 5I5IA 2XX0A 3C75A 5IY5B 2PPCA 2H5UA 2EIKB 1AS6A 1ETJA 1NDTA 3FSWA 1MDAA 4K9JA 4YSEA 1FFTB 1BQKA 1NWOA 3OM3B 1L9TA 1NICA 5A7EA 1ZPUA 3DKHA 4PCYA 2PP7A 1L9RA 3NT0A 2X88A 4AX3A 1JZEA 4A2DA 2ZOOA 1SFDA 1OV8A 3T6WA 3QJTB 1A4AA 4KO5A 3FT0A 2XV3A 1AG0A 1ZV2A 4JHVA 1IBZA 3AY2A 3S8GB 4CSZA 1CYWA 1NIBA 2BWDA 1KBWA 3DTUB 1ZDQA 2EILB 4DP8X 4YSQA 3U25A 1AS8A 1HAUA 5E9NA 2J5WA 4DP5X 4A2FA 1TEFA 3FS9A 2WO3B 1M56B 5B1JC 1E5YA 2J56A 1IC0A 2LLNA 2UXVA 4E9SA 3FQYA 1JZHA 2DYRB 4E9RA 7PAZA 2P80A 1JOIA 4E9WA 2FQGA 1NWPA 1RKRA 1AIZA 1CC3A 3ABLB 3ZX1A 5D4IA 5F7BA 3AG2B 3EF4A 3QQXA 3UACA 3WIAA 5I26A 1FWXA 4YSUA 1GS6X 4G72B 3X1NA 4W1TA 1BXVA 1NINA 5I28A 2YXWA 3FSVA 4Q89A 1PF3A 2BP8A 4AZUA 3S3CB 4RH4A 2MRYA 4X4KA 1GR7A 2PCFA 4DP6X 4UF7C 3NP3A 2HXAA 2CAKA 1KYAA 1NIAA 2YAPA 2ZWNA 3BQVA 3FSAA 5FC9A 3CDZA 2I7SA 4Q8BA 4DP9X 1NZRA 1IBYA 2FNWA 2GBAA 2YQBA 1GYCA 1JZGA 1PLBA 1A8ZA 2N0MA 2AVFA 2EINB 1ILSA 3ASOB 1UATA 3JTBA 3D12B 2VSKB 3IN2A 5EHFA 4M3HA 1CURA 1SFHA 4W9ZA 4E9YA 1JXFA 1ZDSA 1XB3A 3FQ1A 2Y1AA 1ASOA 1AZRA 1SF5A 2AANA 2PPFA 4YL4A 1AAJA 4N8UA 1ASQA 4YSPA 1JXDA 2PP9A 2VM3A 2YAFA 3ERXA 5D4HA 3PLYA 4E9XA 1BXUA 1V54B 4M4RB 3EH5B 4YVNA 1W8EA 2IAAC 3FPYA 1OOWA 1E30A 1ID2A 2UXGA 1OCZB 4GP5B 1ET8A 1OCOB 1J9SA 3PPSA 2XV2A 4KO7A 2WSDA 5AZUA 1W6WA 3TU6A 3GXUB 3KW8A 2OJ1A 3NJLA 4BWUA 1A3ZA 1BEXA 2HRHA 1PLCA 2UXTA 3X1FA 3GYRA 1A4BA 5B1AB 3OD3A 1MG3C 3G5WA 3T6XA 1ILUA 1CYXA 2IWFA 2VSMB 2VW6A 3N2JA 4HHGA 2AFNA 1NTDA 4FAAB 3PAZA 3HEIB 1N70A 1V55B 2BW5A 2Y69B 3NJJA 3T71A 1PY0A 1V10A 2CJ3A 3OMNB 3X1EA 3L45A 4F7KA 1AS7A 3ABGA 1BXAA 4F2EA 2PPEA 1AZBA 1RZPA 3CZUB 1J5CA 1L9PA 1B3IA 2VW4A 3BVDB 5B1BB 2YXVA 2R7EA 1PZCA 2EIMB 4AKOA 3AG4B 3EHBB 2W8CA 3HB3B 2FTAA 1RZQA 3V9EA 3H56A 4JKNA 1OF0A 3PAVA 1F56A 2PLTA 4GP4B 3PCYA 2HX7A 4NERA 3NSYA 4UANA 2IDFA 6PCYA 1J9QA 2XXFA 1PAZA 1TU2A 3EH3B 1DZ0A 3UABA 4BXVA 1EHKB 4DP2X 3NSDA 4QLWA 2NRDA 3ZDWA 4ENZA 1SJMA 4N4YB 2FQDA
chains in the Genus database with same CATH superfamily
4FX5A 1A1OB 2OTWA 4FRWA 3WN5C 4KI5E 2PXYD 2OR9H 4F5CA 4AGLA 2BP0B 1N2RA 5T3XL 3IGFA 4JM2F 2VXQL 5JPNC 2C3HA 1YEDB 5IQ7L 4E5XB 2I25N 1YEFH 2QKIA 5DJYB 2MCG1 1U41A 2DLFL 5BQ7B 1IM3B 1MJ7H 1FNFA 3QNXB 2NOYA 2BOBA 1PIGA 2EYRA 4Z7QB 3JWNH 1H8NA 1XTLA 3GPEA 5A2LH 5KVGH 3OQ3B 4OTXH 4X4XA 4LLDA 2BY0A 4POUB 1LP9B 3TPUA 2MHAB 3FB7B 3A4DA 4LPUA 1R3JA 4LVEA 5DUMH 1GS7A 4F1ZA 3SDYL 5EEWA 4K9EC 4OVUA 2IQ9L 1RQ5A 2Y9RT 2B1AH 1ED3A 2QHRH 3HC3L 5A2CA 3LV3B 2XFXB 2GJ6B 5D5MA 1UYWL 5TDOB 2BM3A 4KQ4L 1RZGB 2DTSA 1MZYA 1DCEA 3FONB 3TCLB 1HQRA 4CL7A 4HS6A 4M29A 1E7VA 1UM4L 2GSMB 2XPGB 3VGEA 5IB5A 3SCMC 3TZVC 4YXKH 1CS6A 3OAUH 1U6AL 2AP2A 1JNLH 3LKQB 3NCMA 1RK0B 4WI8A 1N7ML 1L0QA 1W9XA 1BQ5A 1W80A 4JFWA 3SBRA 3TZVD 1GY2A 2FT6A 2VDNL 3GB7A 1DQMH 1LGVA 3LRLA 4HC1L 4XP5L 4LEOA 5B3JF 1HOCA 1IGJA 1M05B 4G6JH 1J1OH 3SBPA 1RZ8B 4XPTH 2GEEA 3PREA 4BCXA 2Y6SD 2CIIB 1PZBA 1YQVL 4Y2DD 3CK0L 4P5RA 3AY4C 1EZLA 3MA9L 3OAZH 1TCRA 3CHRA 3PHQA 4Y8AA 3VSTA 2HTLC 2C9XA 1NM9A 5I1LB 2RR3A 2YD2A 3EBHA 4KMTL 1CD1A 2YD8A 5E8EB 2FX8L 1SF3A 1LO0H 3FUJA 2AV1A 2AZUA 1Q8MA 3G5VB 3KPSE 3QZWB 5C07E 2YPVA 4WTZA 3UMTA 3ARSA 4XPFL 4MQXD 2WZ5A 3TJEL 1L4IA 3DA0A 3MDJA 1AC0A 1FC1A 1MY7A 3PWJA 4CVUA 4JUSA 2ZXCA 3IE9A 1C5CH 3JZYA 5BOZG 2APXA 4LVNB 1NBZA 4AQ1B 2W0FB 1KT2B 2NSQA 3O41A 4D9LL 2PYED 4CADB 5ABZA 5ECGA 4NUJB 1IBGL 4P9ML 4BM7A 2FWUA 5GRVK 1V7NH 4NUPA 4WI3A 4Q4IA 3UJIL 1WWBX 1L0PA 4M7KH 3GIZL 4UYQA 2JKWA 4JO8A 5AKRA 3L2MA 2Z7WA 1IV8A 5D2LA 4LNVA 2CM6A 1EFXB 2V7HA 4BCZA 4E9VA 3RVWD 2OMYA 5AOJA 5LNDA 3M17A 3RIFF 5JPNA 4PJ5A 1WZMA 2V5YA 2ZAGA 3A0OA 2IMNA 3P30L 2H0PA 5F9DC 3SE4A 1N0LB 1DL7H 2OL3A 4XX5A 5HHPA 2VM4A 5H4YA 4PVBA 3HG1A 1CTMA 4YNYA 5BV7B 4UQ2A 2X4SB 3S36H 4MLSA 2GSGB 4I4WB 2FE0A 4HJ1A 4ZFGH 4NM4H 3HJEA 5E2TH 1YEFL 1HZHH 2QQLL 3V52H 3K3QA 3ZL2A 2WJ7A 4F3FB 1AQKH 5HYJB 2GK2A 4M1DL 3WTVA 2AF2A 3VD7A 1AG6A 1QFOA 2CO7B 1TVHA 1YC8A 5KVEL 2YFNA 3WIIH 1N3NA 3K80A 2Y36H 2UY7B 3RWGA 2ORBH 2WXHA 5AFAA 2ZUXA 4M7ZB 4L8CA 4BKSC 4XODA 4EXKA 3JWNE 3K6FA 1EHLL 3MNZB 3RKPA 2W80C 1R75A 4UAHA 1MFCL 2ITCB 3GK8H 1KFGA 1KNOB 2F74A 1J8HD 1A7OH 1Q9WB 2EDLA 3O8XC 4QDGA 4TS6A 1ZHLA 5F44A 4M1GL 4BEIA 1FH2A 3N91A 4XCFL 4QAMB 2VXTH 2EDJA 3O2VL 2NY5H 3FOMB 4YGAB 4U1NB 3LQMA 4PS4L 3T6ZA 2Y4SA 2J20A 4MJ4A 3BZFA 4DUVA 5LGKA 3D69B 4GT7A 4CMMA 2XXGA 3AMKA 1ETZA 4BUQA 2OMUB 1KTCA 4KKPA 1TQBC 2F53A 1L7IL 1XIWB 3P2BA 5C0AA 1SJHB 2BPBA 4HPYH 4NWTL 4OBRA 1KG0A 2ZKYA 3EJUA 2Y2WA 3N42B 2VZVA 1FH5H 3MRKA 1ACXA 2OMXA 3V5HB 1AXTH 3VUAA 3FK3A 5JORA 3HUJA 3CK0H 2FK9A 1E50A 1NGZB 3MKGA 5ACZB 1TETH 5GGRA 3SOBH 4BZ1A 1HE8A 4H26B 4U0RC 3KW7A 3LNHA 3QFGA 2JFCA 4M00A 3O2DH 2ITFA 3VQ1C 5DJ6B 1OZTG 4ZSOA 4H1LH 4BDVB 3MXVH 3BPOC 4KKBC 6PAZA 3U4BH 3NFNB 1X5XA 4N2AA 3GLDA 5KJRH 2BNQD 2P1YA 3O3EA 2ZCKL 5CIPA 3BUIA 1A6TB 2AJ3A 1BGXL 4ANUA 1E0OB 4FQXB 1TO4A 2V3DA 2AQ3A 3IU3B 3QPKA 4MQTB 1JE6A 4HKBA 1CGTA 3EJJX 4OTXL 3KYMA 2IH1A 1XF2A 1NCCL 4N8VA 4F7MB 3K1DA 1NCWL 1T1YB 3T1FB 3WNOA 1K5NA 1QW8A 4R7VA 1J12A 3NZHL 2NNCA 3OBAA 4S1QL 2DYPA 5T5FH 1ET5A 2VC2B 2YMTA 3CFJA 4OCYL 5LKNA 5D7JA 1KCWA 2EEDA 4GLRH 5I8OL 4BKLB 3IDXH 5EOCJ 5F3BB 3TVMD 4Y5VB 4DZ8A 3DX9B 1IEHA 3T0DA 3FOLB 1QUNA 2Z0UA 4NCDA 2EIKB 3O11A 5DEZA 3SPVB 3EO1B 2OI9B 2MQCA 4C56D 2ZCLL 5DMIL 1CGUA 5DZOA 4E0RA 4NO2B 3ECQA 1BWWA 1E4WH 2CJUL 4MAUH 4IOFD 4Z0BH 4PCYA 2YPKA 4AX3A 1YCSA 5I1EH 2X5PA 1SFDA 5DA4A 5I1IL 1Q0EA 1HTYA 1MW3A 4GQZA 3WCYA 1NFKA 4UIKL 4DGVH 3HI5H 5DU7A 4L9LA 2KZWA 1T0MB 3VB8A 3QXDB 3T0BA 2C3WA 2D0FA 1QAWA 3KXFD 4UCFA 3NFPA 1MCSA 4O02B 4BD4A 3SDDC 4M5ZL 3GLAA 2VABB 1KELH 1AQHA 4PYHA 3TO4C 4GIPD 2B16A 3D85D 3H9ZA 4PJFE 3UYOD 4NUGH 3FQUB 1JZHA 4YHPB 5FUOL 3PF2A 3UC2A 3ZT5A 3IJ7A 1MCDA 5DQJA 4QGTA 5EPMA 7PAZA 1FVCB 4PP2A 1KGJA 3H2QA 1LMKA 4ZFFA 3CUPA 4A55A 1UUNA 4TUJB 2HWZH 4LCWE 3ISWA 3WLWD 4P5MA 1CC3A 4JDVA 3AG2B 2ZD0A 3PUUA 3HR6A 4LKXB 1SOKA 3JWDC 3P3YA 4U2ZA 3GLZA 3GBEA 3C60B 4BGLA 1W72H 3L4WA 4GBXA 4HGKC 1OGTB 3MRRB 1E4JA 5DD3L 5AZ2H 3GINA 5J7CC 3RZCD 4UOQA 2FJFA 3JV4B 4Y2DB 4DOHB 5HGBA 5KSBB 4OV5B 1KPUB 1KGCE 2GBVA 3WFCL 2BC4B 1C08A 4HSQA 3OAZK 1LHZA 1OXYA 2E8ZA 4U1MA 3FCSA 3RVXD 4GI9A 2PNDA 1JZGA 2JXMB 1S9WB 4LLQB 2C9VA 3VW3H 5IMLA 1MRCL 3P0YH 4DNLA 4RDBA 5DSCB 1FG2B 3TZVB 2GVYA 4K9EH 5ICXB 2O5YH 3DUSA 2EO1A 5FO9A 3ROOA 3L95A 1R3KA 1I4FA 5F3HB 2AANA 4ORZC 3V5KB 1CLVA 1RUMH 1IAIM 3I6LD 5CBEB 1OGTA 2YAFA 3MRRA 3ERXA 3UJTH 5JIQA 1HQRB 1CDJA 4HD9A 3VXMB 3SDXA 2OBGA 2WVSA 4FZEH 4GFXA 1YDPA 2M83A 1WTLA 4YDVB 5F7DB 3BLBA 1ID2A 4A7GA 3F2LA 2DQFB 3PGDA 4FMVA 3SDXF 3LSOB 4U1IB 4MXQD 2P8LB 4J3SA 6TAAA 1NC4D 3GXUB 1ZEAL 1ZT1B 4HT1L 4MZRA 4DUXA 5D1XC 3GYRA 3MAWA 1RI8A 2ICEB 3G5WA 1T20B 3TBYA 1FFOA 3SGKC 1JF5A 5F3HA 1EAQA 3F01A 4O58L 1CDIA 4ZBJA 3FDWA 3O9WB 4RFNB 1MFCH 3GK8L 3TP4A 5IF0B 3U0TB 3QWQB 3IDGA 5A16B 1MQKH 2GJZA 2V5TA 2WWKT 3BPCB 3VFGH 4I88A 4KVCH 1ADQL 3D08A 4JM4L 2N1TE 2BY2A 1KWGA 1NEZB 1RZPA 1WWWX 3CAFA 2X4OA 2P4AB 4L3FA 3OXSA 4NT6A 3GMQB 3BVDB 4EOWH 4XO8A 5EF2A 2DQEH 2P44B 2EIMB 4AKOA 3AG4B 4KKAD 2R39A 4H40A 3TT1L 2HYMA 3TTSA 1KEGL 3I74A 4XGZB 3B8SA 2FTAA 3QIWD 1OB0A 1DEEA 3L48A 1L7IH 4EN3C 2WM0A 5F1IA 1A7QL 3EW3B 2WZ0A 4XCCH 1TU2B 3K8KA 4NERA 4RGOL 2ICEA 2N56A 3DX9A 4KQ3H 5IFAL 5KYXB 4PV9A 3K6SA 4U7KA 4JFYA 2GITA 2A6DA 2NSMA 1YEJL 2WXIA 1JG9A 3HZMB 4HKXA 1AGEA 2EDNA 8FABA 3LS4L 1QKZL 4PCTA 4AEEA 4IRJD 1PZ5B 2CK0L 3UJJL 1BF8A 3IDJB 3STLA 1PD0A 2R56H 3LTVA 4BZ1L 2WVVA 1QLFA 2UZXA 5JQHC 5AOIA 3MGTA 1XR9B 4LMQE 4LVOB 4HOWA 5CAYB 1IBBA 1WUNT 1EMTH 4QRUB 1GC1H 5IVXB 3CHOA 5DT1H 3SKJL 1NCAL 5HI3C 3OSVA 1FPTH 2O5XL 4G11A 2GSIB 5E56A 1LEGB 3BT0A 1PZUB 3MLZH 3DO4A 3GUTA 1ZE3C 4WGKA 1B9ZA 3VWKB 3CZJA 1I3RA 2YQGA 1BZ9B 3BAIA 3BKMH 4AGNA 3EOAA 4BUHA 3FRUA 4OCYH 5IW3A 2CA3A 5F0LB 5HPMB 3WXWH 3FFCE 3MO1B 1A4JB 1SXCA 4IRJB 5FHBL 2ILLA 4K5MA 3RP1A 3OKKB 4PJEB 4ZMAT 1PL3A 5FYJU 1DN0A 3ARFB 4K5PA 3VFSB 1XB8A 3WIFB 1MREH 2IADB 4GS7B 4PJBA 4TRPH 1HHGA 3D0VA 5FDWA 3P9MB 3OPUA 3B34A 1MH5B 4HHWA 1MW0A 4HUUA 4JFOB 2OX5A 1DBKH 1F1AA 2B0SH 5ICZB 5IHZB 1NA8A 1BBJA 1WEJL 2VDRB 3FHAA 4IRSB 2I5YH 1MXDA 4H44C 4YHZH 5C2BL 4PUBH 1P5UA 2OCFD 3EHBD 3H1ZA 4KITB 1HZKA 4P2OA 2DWTA 1IUZA 2FEJA 3MRQA 4HC1H 4DVRL 3LRKA 4Z7UF 4X6DB 1MCBA 2CBTA 4I77H 2HTKD 4AM0A 5ISZD 1NC4B 4X9HA 2JWYA 4HIEB 4H1LB 5K69A 3WENA 3KLKA 4RRPA 1D6EA 4S11A 1U8JA 3ZHKA 2ZE0A 3BQUA 2X42A 3QBTB 1JHLL 1MI5A 3MBEB 3QUML 4ZS7L 3PWPB 2EJ1A 3NFPB 1DLFH 1IC1A 3NVQA 3CBJB 2C7FA 5FO7B 3QPQC 2LV4A 1CBJA 2XQYG 4GBXD 4AK2A 5DQ9B 3RDTB 3VFVA 3VSVA 3CFTA 1E9PA 1YYLH 4UILL 4FXTA 4E42A 2JJUA 1FRGH 2O5ZL 3UTPD 1HE7A 3CUPB 4WSJA 32C2A 4J7RA 5DA0B 1YY9D 5HYJE 1JRHI 3QQ4B 3GTTA 4IDJH 3RI5F 3GMPB 3HG5A 3BUQA 5IESL 4DKDC 4BBWA 2PCPA 2XA8H 3IMVA 1EV2E 1JZ6A 4TOYH 2WLNA 4FFYH 1LEKB 5SWQB 1B6DA 4TPRL 1QNIA 3F7YA 4FLHA 4LL1A 4BE5A 3T8XA 3UAFA 3SKNB 4P9HC 3RWEA 4ICXA 1DQJA 3H9SA 4OF3A 1HKLL 3DXAA 3B7TA 5GS1B 1GHFL 4OZIF 3VRLE 4WJ5B 4NBZB 7FABL 4LLAA 1TLMA 1LWJA 2DDQH 2JLLA 5IBUB 4TQHA 4HOZA 4PJIB 4B6ZA 2C1OB 4GMSL 4EIBA 1JDCA 4NFCA 4U05A 4DW2H 3QDJA 3HHRB 1NAMB 1T1XA 5J6SA 4LCYB 5J4MA 4I5BB 4MVBD 5DSCA 5E03A 5LG6A 2YO3A 3MYZA 4A6YH 2A1WL 2NLJB 3D06A 2A83B 3BMWA 3K81A 4MFHA 3NIDB 4GSQA 4NKDA 2DZEA 4NXKA 4X9GA 3ZYOA 3APDA 3N0PB 5DVKA 4DPAX 1BAGA 3EJZD 1UJTA 3D85B 3GSUB 5KG9B 5C0RH 4F80A 2GITB 4L37A 4RA3A 1EJ6A 1AOZA 3T4AC 1C16A 3FUNA 2M26A 4WW1B 5C07D 5HYSG 2X09A 3EYVA 4AQAB 1OCWH 1UENA 4GQRA 4MA7H 5IR1B 4KMTH 1LO2H 3QIBD 4JPWH 1I8LC 4HWBL 4DEUA 3GRBA 1BZ7A 1KIUA 2GG1A 4O58H 3CC1A 4XMWA 4H2AA 4YSAA 1BM3H 4G7QB 2NXYB 3HE7C 4OD1L 2BNQA 5CILH 1OAXL 1RUKL 1GGIL 25C8H 4W4OA 1A7OL 4YUEL 2OMYB 4MMYA 3GI9H 1VDGA 4Y1AD 3RLSA 1DQTA 3C8KA 5K9QI 3VRLF 5C08B 2NZIA 3NABH 1BX2A 3UPRB 3TN0C 4JANB 2WXNA 1SDYA 1YQ2A 1MCIA 1SJEA 3FO1B 4YQXL 1Y07A 4B50A 3LZQA 3V6FA 3WY2A 3ME0A 2OLDA 5C0DA 2KMWA 3N3EA 5CEZL 4LKCB 3JWDL 3L3DA 3D3VE 4OD3L 3GQFA 1XIWA 1HQ4B 4TMPA 3U9UB 4P23D 3BSHA 3QUZC 2FEEI 4JCLA 5KBNC 3CDCA 4BA0A 1GYAA 3AVEA 3WE6A 1R3JB 3SQRA 3BVNA 4MNHB 3RJDA 1GKOA 4H0IA 2OQJA 1WBZA 3R7QA 5ETUB 3WL9B 4PV9B 3K6SB 5DRNA 4R4BB 5IK3A 3E7JA 1F4XL 2UX7A 4JRYB 1NANI 2ETWA 1G7JB 2G0KA 4BFRA 3CSBA 4Z5RA 2EDEA 5ANME 3L3IB 3BDXA 5SWSE 2D31A 3UBXB 1T83C 1I1AC 2VDPH 2Y7LA 2Z6FA 5CFAA 3PJNA 4CNIA 3PGCA 3VE0A 1WGVA 2DTMH 4LHJB 4Z1PA 4XVUD 3U83A 5ES4B 1HZLA 2GBUA 3QJQB 3PDGA 2IDQA 5C0DB 2H0JA 2I85A 2NZ9D 4TLTA 3RGVB 1WG3A 2DBLH 2H2SD 5CZVL 4XVUC 3HMXL 2YD3A 3QIUD 5D1ZC 4O02L 5IMOA 2WBWB 1G7MA 5D2LF 4L8DB 2C9UA 3C87A 4JO2L 4KKLC 3ULVD 4E9LA 2VXVH 4WWKC 5FOJA 5E5MB 1T7YA 4GIAA 3WO4B 5E1QA 1F8TL 3A22A 1CYGA 3NYKA 5F7WC 1HH6A 1U8NB 2JI2A 5DZ9A 4B96A 5E24E 2WYZA 4FZ8H 3FT2B 4XRCA 2OYPA 5HXMA 4YHIB 2J1XA 2VH5L 2CUAA 4NKMB 3VFMB 2WXGA 5CGTA 2X05A 1AS6A 5BVPL 1MDAA 4OGYH 3LS5H 1L6ZA 1YVLA 1HXYA 4HHAB 3MNMA 3CXHJ 1UJ3B 2MKWA 5D7HA 1UC6A 2YD5A 4PLJC 4POYA 3GMPA 4N2BA 3EXLA 2PP7A 1L9RA 4R4NC 4UNTA 1ZE3H 2EO7A 1XIWD 2ZOOA 3DROB 3D4ZA 2F58L 2MFNA 3RG1C 2XV3A 2Y1VA 4CSZA 2BWDA 5A6IA 5FYJD 3DTUB 4DP8X 3GBMH 4DVRH 4J8RA 2FBOJ 1AS8A 1HAUA 5E5MA 2A9BA 4HAGA 4DAGH 4PGEA 4IBVA 1Z66A 1ZVHA 5C3TA 2YUZA 3CX5K 2P8PB 4W9KC 3U36B 1WF5A 2EH7H 2MCPL 4WWOA 4DGWC 2UXVA 2Y6SC 5KSVB 4F8OA 4AQEA 3IDIB 4UQDA 5AKTA 2R8SL 2A9NL 1TQCB 4L29A 1JPSH 4PJ5E 1JOIA 4IIQB 2WWNA 4XPBH 1U93A 4PIBA 1ML0A 3QIBA 2B1OA 4OCXH 4X98A 3ZTJG 3O6LL 4PIRF 2RHEA 5CM1A 1U8PA 2EE2A 2RH0A 2YLKA 4G72B 5A2BA 1IRAY 3F7PC 3ZMEA 2VZ3A 4GI6A 3DSNA 1TMQA 1BHGA 5AW2B 3RGHA 3CPLA 2XJKA 5I73B 4HIHB 4UZGA 4XNXH 3INOA 5ID0A 3UC0H 3ZRCC 1BOYA 1OAKL 4BUGA 2YD9A 2Z8SA 1K5NB 3FSAA 3W5NA 4OB5L 1IEAB 1J5HA 5DJXA 2FNWA 1E4HA 1GYCA 1GHFH 5E7FA 2DM4A 3VXUE 2EEAA 3ZPDA 4WFHE 1AYOA 4JAMA 1BVLB 4PJ7E 3QDMD 5DVNA 5I73C 1VSCA 1GGBH 2Y1AA 5JOPD 4CKQA 2HJKA 5FCSH 2MIZA 5EFIB 3NCXA 5FCUH 1ASQA 3NZUA 4YSPA 3Q6FB 4FQPA 5C08E 3SDCC 3T4YB 2CNZA 1N8OE 4JPVL 4KRMB 4XNQB 3PLYA 2QHLA 3QZPA 4YDIL 2D9CA 2P45B 3SZKC 3QGVA 4K7PX 1XEDA 4XHJD 2CLZA 2FX9L 3DNKA 5AVZB 4DN4L 3KM1A 1JYXA 4X9YA 1OT4A 5E1AB 3RVXC 1TSHA 4OAWA 4H8HA 4P2CG 4Y4KB 3WMSA 5KSAC 2Y22A 2E7BA 3D4GA 5IFJB 1L3NA 2HN7A 3ULUL 4AQ1A 3HBGA 4X4XB 5IOPB 4UOW1 1A3ZA 1PQZA 2HRHA 2F53B 3GMLB 3G5YA 5DLLA 4LFHG 4K5LA 1AO7B 3D85A 5KG9A 4QWWC 2FATL 4P9HL 3WJMA 3RIKA 4QT5A 4DGUA 3OHXA 4NSKB 4PGDB 1ECYA 3Q8BA 3CVIH 4ZOEA 5EORL 1CYXA 3RTLA 5JUEH 1WSST 3QT2A 2JF1A 3KPPB 5C70A 4KJQC 3HEIB 2VLJD 3M86A 2Z8RA 3RNKB 3K72A 3QI9A 4KGLA 3RI5K 1V10A 4G82A 4J3TA 3LS5L 2C26A 4AVHA 3SGEI 2IFGA 1RV6X 4JL1A 3VI4F 1JSYA 2MPVA 1U8HB 2VW4A 4YXKL 1UASA 2A6JA 2DEYX 3A4EA 5B38A 4GSDL 4Q56A 4ELMF 2W8CA 2AW2A 1NCTA 3KXFE 1RZQA 3L6FA 4FKHA 3AXLB 4F15C 3BKJH 1WC7A 4L8BB 3QCUL 3VRIB 3QDME 1F56A 5F7EH 2HX7A 3L3JB 2A6IB 1KACB 2F7RA 3DRTB 3GF8A 4XPTL 1O6TA 2DQIH 5DHMC 3GXTA 4IU3A 1LO4L 3UYPA 2FZ3B 3POHA 3UABA 3TESA 3P0YL 3S35X 3B2VH 5ACZA 1XZ0A 1UD2A 4U6VH 3T65A 2QQNH 4HPHA 3EDJA 4K7FB 5E2VH 1QKZH 5GGUB 1B9KA 4XOCA 3IEAA 5E94B 4X80H 4JRXE 4Y4HC 2AMGA 1JHKH 3FRPG 3DIFB 3PGFH 1XCWA 5IB1A 4TNEA 2YD4A 5IQ9B 2QELA 2FT8A 4ZS6D 4KZDL 2XTJE 1A6WH 3VFOB 4OZIB 2I9TA 1XSIA 5FV1L 3KWWA 5DVMA 3B9EA 3VGAC 3QZWG 2RQ8A 2A7BA 3MBWA 2ATPA 3C5JB 3NA9H 3IDNA 4AVJA 2KS0A 4ALAL 2WZ6A 3FHQA 3PP3K 4Z7OE 3V4PB 1FGVL 2R69H 3ARUA 1FNLA 1P9MA 1S46A 3MUUA 1RMFH 3GSXB 1QTPA 2P7TB 2GKIA 4G9FE 4UMGA 3B7SA 3V0VA 3P4NB 3DI2B 4JB9H 1AYRA 1DBJH 4GXUN 4MMZA 3FFOA 2HRLA 3FKUS 3LKSB 2OP4L 4P8QA 2LE9A 4MA3A 2QPSA 5D8JL 2LTQB 2MMXA 5BS0E 1G7MB 4R0LC 1AHWC 1LE5A 1C5BH 2CDEB 5GGVY 5IQMA 1QVOA 2ADGA 3VGFA 1F18A 1SOQA 3IJ9A 1JWMA 3D52A 4JLRA 4NKIL 3WDJA 3TBWA 2EDOA 2VDOB 3I3EA 4APXA 2ZUTA 3VFPB 2AAVA 3L4UA 4NEHB 3NCYP 1Q0YL 3KL3A 4JY4B 4PWIA 4N3UA 1CLOL 3QUHA 3G5VA 1FIGH 2M2DA 5IVNA 1JGEB 1QBBA 1A2YA 3KE0A 1EXGA 1A4KA 4C83A 4F7CA 3HPJA 2C7UA 4HIQA 4L9LC 2I5YL 3U7AA 4J2XA 3OJ2C 4EF3A 5C6TL 3VD1A 1KIQA 2EXWC 4AGPA 4HH8A 4R96A 2P8LA 4U3XA 3EJCA 4UV4H 5GJTL 3ZE1B 2OJEB 4EKXA 4DOHE 2D7PA 5GGSA 1RHFA 3QEGH 2WSKA 1DVZA 1L9OA 4OZFG 4XC1L 1OTUD 1SQMA 3PNWB 1IBFA 2XWZA 3QULA 4U1HB 3VXUA 5IW6A 2R56L 4N0FA 1S7TA 5DJ0B 3U4EB 1ZHBB 3KPSD 4F7PB 3AAZB 3FT1A 3T2OA 2VLKD 2CJTA 3M7OA 5FO9B 4IRZA 1I3VA 5BMFL 2BRRH 2B1HL 4YHOH 5FUZH 5IQNA 3ATDA 3LEYL 4IBLT 4XXCC 4RESB 4WUKH 2CO1A 2HTKC 1FAKT 3I2CL 4FFYA 5BZXA 3S9DB 4EIZC 4KFMA 2GC7C 3DMMD 4Z8FH 1C08B 4FFYL 4HCIA 4D9QD 4OB5H 1P5UB 3FQ4A 4GXFA 1E27A 2C9PA 2OMZB 1T2QH 3N42F 5FA4A 1J5IA 1GIGL 5BZZA 3WEXB 2ED9A 4QRSB 1DDHB 2H1PL 2JKNA 3D2UB 1TIUA 2NY3D 3F58H 3O4OC 1MNUL 4OGAC 3BQUB 2BSSA 2PYEA 3MRCB 1FL6B 1FE8L 1HHHA 2V17L 3GSNL 4UTAH 1A3QA 5EPMB 3L1OH 5KBPA 3DYOA 3O3EB 3U0TA 1I7UA 1J7VR 3CN3A 4L4VD 4LDOB 5C0BA 3E6FA 1UB6A 3QEQD 1YEKH 3DX8B 2AJSL 2CPUA 3ECUA 1N68A 3C8DA 2NX5B 3CX2A 3FBQA 4ZYKB 4ALAC 1T0OA 1SDDB 4M1CC 3WY1A 1USQA 4TQPA 3LKQA 4OCSH 3TA3D 3GSOA 4JKPH 3GXMA 2G3MA 3LQAL 3VH8A 4B3VA 5B4MD 3TC9A 1A9EB 1ZA6B 2F1AA 4DVBA 1I7TA 1N6UA 4S1SH 4Z3IA 2Q8BL 2K4AA 2PO6D 3VI3A 2VLKA 4WFFE 3CVDA 3HR5A 4FLSA 4MXQC 2CLVB 4LCWB 5E1AA 1KBKA 3FCUB 3S96B 2BWQA 5DR5L 4NJ9L 4FABL 1N64H 1F58L 1LWRA 2KZBA 5IR1A 1FV1B 4OZFB 5DO2D 2ADJB 1IGYA 5DYOA 3VD4A 5DF0A 5IJKA 3AB0B 4O2CA 3Q8FA 5SWSB 4M61B 1T21B 2CO3A 5HHVL 1BQUA 2IANA 2FGWL 3GRGA 3KVDD 4X0NA 3HC2A 2WVTA 2K70A 4NZRH 2Y1YA 4HFWB 3QXDA 3UBFA 4O9HL 4N2NA 5GRVL 3X3FL 3TGXA 4H0HB 1L7TH 4JDEB 2ENJA 2NDGA 1JDAA 4B7IA 4NNPH 1EO8H 5D71H 2E5EA 2OXHB 4G8IA 4I9XA 3CFEB 3EFDH 5FS5A 1RIVL 2LT9A 3F5WB 3HNVL 4GQ9L 4BH8B 3FQNB 4E41A 4YEEA 3W39B 1BZ8A 2ESVD 4ZX4A 3OKDA 2VN4A 2BY1A 1SVCP 5J1AB 3QISA 4GKSA 3HRZA 4I3RL 4FD0A 4MDJB 4L9DA 4TUUA 4YX2H 4MZ3A 3WMQA 1D5RA 1VRSA 2H32A 1UH3A 1UM5L 5I1AA 4PU2A 4YFLI 4MAYA 5HVHC 2DMBA 3MRJB 4AQZA 4ONOA 3FU3A 3MV01 3QFJB 1XF1A 2J1KA 1F4YH 1WFIA 2FT7A 1MHEA 4DP1X 2WSPA 4JMXA 4XN8A 5IT2L 2YPLB 2DQCL 1QFPA 5C3LD 3P3SA 4LSVH 5DLMH 3N43F 4Y2DC 4NXSA 2H1LM 3UBHA 4DF9A 1CLYH 4M48H 4PYGA 3DO3A 2FIKA 2WWMD 3VFUB 4KK9D 2J88H 3ARGB 3OB8A 3GMQA 5IROC 4MHHI 4R2GB 1AOHA 1B4TA 3K7UA 5HJ3B 1FDLL 3ES6A 2W9LA 5F88A 4X6EB 5I30L 5BZDB 3F85A 4WFED 2J72A 3V7MA 1TDQA 1NMCC 4U33A 5E9DE 4QHPA 3DBXA 3G08B 3KYOB 1OSPH 5SV3A 2IF7A 5A6LA 3MRFA 3FCGA 4J1UB 1UYWH 2X1QA 4H8WL 2YQ3A 4YSEA 4I1PA 1WLHA 3CFBA 5ICXA 1WH0A 3BIBX 1ZCRA 1VJSA 3PIQA 3WFDH 4ESKA 1KNOA 1S7QA 2VLMD 1TFPA 1KBGL 5CUSL 2X4PB 4HK0B 3T6WA 3WFBL 3PL6C 1U33A 2DLTA 3L16A 3HI5L 3HG2A 3LKOB 2XN2A 1GGUA 3WLBA 4KI1A 4I7ZC 3QQDA 4XP5H 1JGEA 4BK5A 4PEEA 3COOA 1NCNA 1RFDH 1A02N 1TEFA 3U0PA 3JWOL 1EVTC 1KB5B 3TO2B 3HE7A 4AMWA 5JW5B 5DDHA 5KYWB 1DHKA 3JTSA 1I31A 5DZLA 1KTBA 3FBKA 3RZCA 5CU5A 4E9RA 1XT5A 5J5EA 4DQOL 4GEJA 3EYUL 4U6YB 4PLJD 1ZLSH 3QO1A 3OAYK 4AJVA 3IETA 1OARH 4K3JL 4FQ1H 3Q1SL 3LJ3A 2X4OB 3VGDA 3ZX1A 2EXSA 3W11C 5CSGA 5I26A 5DQJB 3X1NA 1H8SA 4MA1B 4ZMLA 1JXJA 1MQ8A 2BS9A 1MJ7L 1QX1A 1X6NA 4J27A 5C08A 4QO1A 3GNMH 2BERA 3FSVA 3LEYH 1HVXA 1HDMB 1BPVA 3HHSA 3UDWA 2F19H 4JANA 1K4DA 2ICWA 2VLRB 4URTB 3VSQA 1S4IA 4NO5A 1QO3A 3BQVA 4UZUA 3LHPH 1FN4B 3U2SB 5GZND 3PJSA 1WZ1L 3L3DB 4JN1L 4Q74A 2G3XA 4HKZA 2IPUK 2ZOKB 4DTGH 2YQBA 4KK6C 4KKNA 4YLBA 4GRMA 4O00A 2Z31B 5EC2A 2IXQB 4X5XB 1T83A 1P7HL 5EHFA 5K39B 1UOLA 1RZIB 1FNSH 3QJHA 5ERWB 2KDYA 3VFWB 5F7HA 3B8YA 1EUUA 2J8UE 4WENB 2HP4A 1GGCH 3OPZH 2GFBB 4V1DB 1JXDA 1JWMB 5EOCH 3W3BA 3DUSB 1V54B 5JW3H 1KTJA 1P1ZB 1PAMA 2IAAC 2PO6A 4WGWB 3A6OA 2NY4B 2HPTA 4B9ZA 5E8DL 1FO0B 3CFCH 2R2BB 4HUXB 5T8IA 3VA6A 3RIFK 2BNUB 4OM0L 1O9ZA 4R2GC 2V5MA 5DHYA 3L3OC 1F00I 2AEPH 4HUMB 5E1HB 5MEND 4KJYB 1XGPA 4O4YH 2X2HA 3Q2VA 4HT1H 2CO7A 2DYPD 4F1SA 3TFBA 4KROB 1XD1A 4XNMB 5EOTA 2VWEC 1EJ8A 3FCSB 3MJ7A 3JV0A 4D8PA 5AENA 5HDQL 2EUZA 5CLZA 4L2LA 2R1XA 2J6EA 5E2JA 2P5PA 4BK4A 3ZU8A 4YHML 5I8EA 4NJ9H 5GZOA 1EFXD 1EHLH 1H3WM 3N2JA 3HUJE 2AFNA 1NTDA 3ZL4L 3HC3H 1Z5HA 3PAZA 4FAAB 1A7RH 2AQPA 3OLEA 3NJJA 1RZGA 3PP3H 4FLOA 2XTJB 4WHYH 4IQHA 1BXAA 3E38A 4NQXB 5F6HI 2X9WA 5JOPE 1J5CA 2A77L 4K3HA 4TNGA 1BBDL 5E6ID 5I0XA 1CXLA 1MHHA 1IGYB 3WHXA 1VPOL 3CDGB 2QSCH 3IMRA 4ZUUB 4ANVA 2VAJA 1FORH 3R19A 1X5JA 5LBGA 3TPUB 3LD8B 1GOGA 1DJSA 1Z5YD 4IBZA 1X5MA 4LK4A 4LOVA 3AMLA 3GHEH 4FXGC 1PSKH 4P57A 3BAXA 4BGDA 4JKNA 1CMOA 1OF0A 2PLTA 5CIPH 3QO0A 2AK4A 4LCCB 2B39A 1E28A 1C5DA 4J2QA 1IGCH 3KLSA 4P49A 4HWUA 4LOFA 2WNXA 4L4TE 2NNRA 3GFUA 4ZMVA 4JO3H 4DEPB 1WP6A 3QA3A 3RNQA 4LDLB 3TEXA 5SWZB 4EVNA 1DTUA 1KFAL 1FZJA 3IF1B 4MCYA 1YEIH 3FTGA 4OI9A 4PJCF 1ZHLB 4AWJC 5MI0C 3P2TA 1MWAA 3K5RA 5GSRA 5DD0H 3BZ4A 2IDSA 3LD8C 3IT8D 2TSAA 2OXGB 4XNUL 5H37A 2R4RH 1MLBB 4O51A 4NC1C 1HHKA 2W65A 3LKPB 4P0DA 5HVFB 1GC1L 3MRCA 1EZUA 1U30A 4MAYB 4Z7VF 1CXEA 1JDDA 1QBMH 4Q7DA 1I8KB 4MA1C 1JK8A 2BNQE 2N4IA 4LHUA 4KPHH 4XNBA 4IDJL 3EH1A 3APCA 1CXHA 2JQAA 3H9YA 5KBMA 3TBTB 1LLAA 1S7UA 1T5WB 4PGJA 1N19A 5FYLL 5TF1H 5HGHB 2CUMA 2NZ1A 2WBJC 2GYSA 4X8CA 3IU4H 1IAIL 4ILDA 5C9JA 4QRTB 2J4WH 4GIOA 5FLUA 3LZFH 5JPMC 1J5OL 1G4RA 1XTMA 2EH8H 2YAMA 3BSZH 2QGCA 5JA9A 1OP3K 2WOYA 1JJUA 2BHUA 5BZWA 2AGJH 3HPLB 1A8JH 3DYMA 4A2EA 3QDHA 1ND0A 4K5OA 4X83A 4ZSOB 5BW7A 1MREL 3MRNB 2WCSA 3FRPA 4D0DA 1ETB1 2DW5A 4LO9A 1OE1A 2OSWA 4IYKA 2MCAA 5D2NA 2GQHA 1NBVL 1OPOA 1K85A 1DVSA 1NC2B 4PMEA 3WFHA 1HEZB 5KW9L 4ODXA 1CD0A 1JGDA 1G43A 2DMCA 3MOQA 2Q2EB 2NW3A 4QRRD 2O1AA 4IOSD 4LRIA 5EBWA 3Q2NA 2ATKB 2BNRD 4D94A 3U30B 3VWJD 1M6UA 2K8MA 5EC2B 2OKMA 2PXYB 3VM7A 1I3RB 2I60L 4OFQA 1SY6H 4JHAL 4P2RE 3KH3A 1MCNA 4AY0A 3TIEA 3ZQXA 1OGPA 2FBRA 1QHOA 1PG7H 2E75C 4M5TA 2EE9A 1SJXA 1JHKL 3OR6B 5D7KD 1KLFB 3CN2A 3KD4A 1F45A 1HH6B 2NT1A 4KDTC 5E4EC 2DLHA 3KGTA 4I2XB 4D7PA 4EN2A 4QHKJ 4BK8A 4QCIB 4OFYA 4RWYL 1CVRA 2R0ZL 3HLAB 1YYLL 3N44B 1LE9A 1L6PA 4B27A 4O2EA 2VQ1A 3S37H 2BNUA 3B2UC 4N0YL 1NJ9B 2F08A 2A77H 2IBZY 2XLLA 4GAGL 4HQQH 3EGSA 1JERA 4NRXB 1ZVSB 4KX7A 2QDVA 4ZX3A 2EUWA 2H8PB 3VXSA 2J1WA 3NFSL 4P5TA 4FMFA 2APSA 4YBHA 3TO4D 3U1PA 2X40A 3BUYA 4XOBA 4MJ6B 4WWID 1N5AA 4Z8FL 1NFDB 1BAFL 2C3VB 2P46B 4ZW6A 3WFCH 3IFOB 5EEUA 3BFQG 3WD5L 2WIIB 3BGAA 5CEYB 2E74C 4Y5XC 1NMCB 1VADA 2QPDB 4UTBH 4QXVA 3NIFE 4HBCL 4MJID 4FFZL 3HUJB 4QLRA 5B7MA 5FYKH 2FHCA 1FBIL 2A4EA 4F7EA 1AACA 5C0BD 1UOVA 3PHQB 4ONFL 3QQNA 1N4XL 3HG1B 1RU9L 5EU6D 1JYWA 1XGZA 1FIGL 1KV7A 3WJLA 2DWEA 1EEUA 2HVKB 3JTTB 2GUOB 2FRGP 4R0LB 3HCVB 3WJJA 1H3XA 1ETZB 5G55A 1JNHA 2G4EA 4HPOH 2H47C 5DJ0A 4GXUM 2QPEB 2BFGA 2XZAH 2QVTA 3C08L 4FQJL 4MMXC 3WS6A 3CFCL 5ICUA 3PWNA 1LP9A 4UOZA 3CHXA 2FYYA 2EVHA 3WY4A 1OD9A 2WUBL 3HZVA 4MRBA 1KELL 1T66C 5EBLB 5L2KA 3N9GH 4ZX5A 4YC2B 4RX4D 3ARBB 5I0ZA 1OW0C 2DL9A 3B9KC 3LHAA 5E1GA 3JUZA 1DQQB 2G2RB 3ARGC 3PWPE 4Y4KD 3GBDA 1IU1A 2PXYC 3T09A 3V2AR 3ZDYE 2XNAB 2ZYIA 4WFGD 4RMBA 1INQB 3BVVA 4ODVH 1W0VA 5CJOL 3ZSTA 3C8HA 4OD2B 3PXHA 2CDGA 3W82A 1CN4A 5AB9A 1H3GA 4R4BA 5IK3B 4JRXB 3VMPA 1XSKA 4D9RD 3MRGB 1G6RB 5C0CB 3SE9H 3JXAA 1ORSA 3TBTA 5AZEH 3WO3B 4X42A 3PAYA 2FWSA 2EDYA 4M93B 3FB5A 1TTFA 3UO1H 4QHUB 4OIFA 4DWHA 5HVHB 2X70B 1AKPA 1OHZA 2XWRA 3GSUA 3P3RA 1XQ4A 2XIIA 4PRHB 1CTNA 3D07A 4U1MB 4IMKA 1MCEA 3D2TA 5KBDA 3MLPA 3L3OB 5EU6A 1AE6L 1QSFB 1KCVH 3PQYE 5T1LB 1DANU 4IIZA 4XMXA 3ARPA 3GO1H 3MV11 5JIDA 4RMRA 3OKDB 5HDWA 2NUPA 5CZXD 1MJ8H 5F72S 2Z4QB 1OK8A 5DWPA 2AQQA 2C4FT 3FTYA 3ZTJH 1YHPA 2B3IA 4GS7C 4WI0A 5C0CD 3DURA 4KTEH 1KENH 5C09A 3DVGB 3WFHB 1B0RA 1DVXA 1RZKL 2ZXWB 1KCKA 1IGFL 2N01B 1A22B 2ZX5A 4GKOA 3O41B 3KVPA 5SWSA 1F6AB 4P5TD 4RGMB 1RERA 1IKOP 2GT9B 3MNVA 2LLLA 5D7JC 3CLEL 1H9VA 5F7DA 4P99A 1QZNA 4C57C 5IHLB 1J0YA 3LSOA 1KCSL 1LP9E 3A5VA 4PW4A 3MLSL 4UT6H 5D7JD 5G4NA 4DPBX 4NKOA 4NPJA 3RUGA 1P0SE 2QPFA 3PDDA 4L8SB 3VSUA 1R1CA 5DD1H 2F8XC 5KYYA 2EXYC 3MRHB 5HYSA 4APQC 5AAPA 4M8VA 1F8TH 1FL3B 3ARDB 4U6HA 4XOEA 3RFZA 1WC7B 2IAMB 3HAEB 4L8BA 4LBEA 3U48A 1BQSA 1JZIA 1KIRA 1XMEB 2EH8L 2A6IA 3NACH 3MLXH 3L4ZA 4YBLB 3K2KA 2XX0A 2VJ0A 4PY7A 4XNZC 3OLDA 2P3YA 4NLAA 4LAQL 1NWOA 3OM3B 3GSNB 1NICA 5DVLA 3S5LB 3WS6C 3OGCA 3VXNA 3B3BA 5KTEL 4EQ2A 3CFBB 1E9OA 4GQPH 5ELIA 1H5BB 5EU5B 5FCUL 3FU5A 5C0BB 4YXHH 3QW9A 1ZPLA 1A4AA 3DX7A 1MCLA 2EDKA 3UP1A 2CBQA 4ZQTA 3KWVA 3AY2A 5TQ2L 4WNQA 3S8GB 2IGLA 2XG5A 4Z18A 4EDXA 3TN0B 3CHQA 3EF7A 3ARXA 3G5YB 1HWWA 4LSUL 3T8XB 5GZOD 1HN1A 1F6FB 5LHDA 4HZLB 2R1YB 1TXKA 1FGNL 3MV7E 5FFLA 5F96H 1U8MB 5CHNB 4H1LG 3CFUA 3MUGA 4EI5C 1TZHB 5BRPA 4Z0XA 3DARA 4K23L 4TUJA 2Z3FA 4YFEA 1U8IB 3K91A 3MLUL 4NQVB 4P3DB 2R0WL 5DQDL 3HE6A 5DTFB 2D0GA 3FTGB 5D4IA 3WIAA 2XFGB 4DO4A 5IEKB 1GS6X 1AJ7H 2EDTA 1NINA 1PJWA 1HKFA 4PB0L 1X7TA 4X7SL 1XH3B 2YZ1A 4EOWL 1BOGA 1CF8L 1JNNL 5D1QE 5L2KB 4QYOA 3K4AA 4NO0B 1RK7A 3DX8A 1MOEA 4UB0H 4GAJH 3MFFA 3L13A 1SUJA 1SLUA 2VDMH 5EU4B 4N2CA 3S3JA 4YDLB 5GS0L 4PJFA 4UT7H 2N0KA 3ZYIA 4TLUA 1WJ3A 2JB6B 4M02A 2P5WE 5J9PB 3K6OA 1SJVA 4FFZH 3A3YB 4R4FL 5KBLA 1SDAB 5BS0D 4L8SC 3P4MA 3BKYH 1XGTA 5ILTL 3O11B 5MEQA 4PJDB 4F20A 4LU5L 1J48A 1JPGA 5ESQA 3RHWK 3U6XS 3H3BC 1S7RB 5E8OA 2Z8WC 5KN5A 4R7DA 2Q86B 1AFVH 4YL4A 1VF5C 1QUPA 2CO2A 4K8RC 5LAXB 5C08D 5IROA 3H3PL 1DEEB 3RURA 5DJZA 3QORD 4TM9A 5JW4N 4FQJH 2JKSA 3G6JA 2XTJC 4PY8I 5KANG 1TZIA 1TJIL 1I9IL 1XGQB 2V9TA 2YSTA 3GHPA 5C0RL 1H5BC 2R2BA 4HUXA 4MXVE 4K7PY 2WZPD 1QSFE 1PVHA 2V33A 4PS7A 1OSYA 4BA8A 4D0BB 3IFLL 2XTSA 4NC0B 3QFDA 4PJAF 4WI0B 5EIIB 5KVDH 4OBSA 5AW4B 3OD3A 1MG3C 1H6EA 3FQTA 5F1KC 1N5YL 3E2HC 1E8ZA 2EE3A 2JV6A 1EFXA 1F13A 2OP4H 5D5ME 5EBLA 1N8ZB 2VSMB 2F54A 3HRZC 5FA3B 5FO2A 2BW5A 2Y69B 3ZHFA 3QXTA 5LCVH 2X0UA 1NUNB 1HHJA 5FOBA 4Q0XL 3ABGA 1AS7A 2VLME 3NN8A 3O3UN 3C5ZB 4Y88A 4LSPL 4JFFB 1HJCA 3M1CA 4L1DA 1UD5A 2YXMA 5FYJL 4AXWA 5JPMB 1OTSC 2F19L 4ETQA 4PB9H 2E8YA 5IJDC 4X5PA 3M46A 5ESAB 4TOYL 1C16B 1SXAA 4M7LH 3OV6A 2GAZB 1R5WB 3LQZB 4TLKA 3V95A 5F7EL 3QCUH 5L4FA 5CGMA 4K0OA 5HHNA 1YDPB 3ZZ1A 1B2WL 1T03L 2GTZA 1K2DB 3GTVA 1YNKH 2WXMA 3EH3B 4TSBH 4MJ6A 4DP2X 2BP5M 4KUCD 2QQNL 4PJCE 5MHSE 2NRDA 2OW6A 4ZUWB 1U2YA 3V0WL 3RVTC 3TZVA 1L5GB 1J10A 4N4YB 4UBDC 5AAWA 1D9KC 3GXDA 4QMEA 3IETB 2C1OA 4RGNE 4XPHH 2ZX7A 4IOFC 3IFNH 3GZPA 4FJZA 1I9RL 3IJYB 3ZKQD 2JI3A 5BV7C 1RK0A 2GI0A 1AR2A 2D31B 5DUPL 2IH9A 2LAGB 4OQTL 1KJ2L 4BH7B 1W0WB 2W81C 3VVVA 4Y19A 4GBXB 3T4AB 4UT6L 1NLBL 1ZOXA 4JCWA 4L3CB 4XXWA 1K2DA 3BFWA 5I6LA 1EEZB 5BZDA 3WAKA 1NOAA 1CGSH 1TQWA 1VHPA 3IDNB 4JB9L 5EF0A 4P46C 5BNXD 1L9SA 3CFMA 1BQLL 1FZMB 2MPAL 3NGBB 1BFVH 1QHPA 5DHXB 4PJ9A 1IAII 4M7JH 1FVEB 3U7YL 2OMXB 1EJOH 2H0FA 5F7LB 3Q3GA 3MLXL 5IOPA 2XBZA 1OAUH 3VX0A 5EUOB 3GMMA 3CJJA 3BQUD 4UTBA 4NKIH 1BXXA 3KNBA 1EEYA 1I1AD 1QSZA 3QVAA 3W0WD 2X9ZA 4PP2B 4RQQA 2WAHA 1JZFA 2V17H 3MODH 3PABB 3WNPA 5BQ7A 5I1EL 2D4DA 4JR9L 3RL1A 7CGTA 1AP2B 8CGTA 4P4RA 2OMWB 3UCRA 2J8UF 2A73B 3ESOA 1FORL 1HL5A 2AEWA 3EDEA 3KPRA 4QTHA 1DQKA 4R5VA 1B4JH 1BCIA 4Z95H 1P69B 3RWIA 3O6FC 3QUXC 1URIA 4TUKH 2DJUA 1UADC 3F7RA 1GPOL 3U79A 1N10A 2R2HB 4X5QA 1R3HA 5IWLC 4JHZA 4OKDA 3PS6A 4OZHA 3HFMH 2AJZA 4DP4X 4TULH 1Q72L 1VGKB 4FG4A 1X9QA 2CHXA 1U3HB 4GG8A 4XTRD 4B9FA 4P48A 4EQ3A 1GH7A 3G6JF 4OCLC 3AGVA 5E9AA 5C6WH 3EG9B 4ECNA 2NR6A 3TIEB 2D7TH 2G9HB 2ALWA 4PJBF 4XVOA 3X14B 1SHWA 2NPLX 3A4FA 3TASA 4NRZB 3MRMA 3PNRB 1CBVH 4N8CL 2CA4A 1A1MB 2YBRB 4OCXL 4JRYE 1KC5H 4U1GC 2CUHA 2IPKB 2EYSB 4LP5A 5A3ID 2B1HH 2O6PA 4JPSA 3ZKXB 4LSSL 4M6OL 4ZW8A 4G3YL 4RSVA 1CR9L 1F02I 4U1KB 1XMWA 3S3BB 4G8FB 1PKQE 2WO4A 1MFAH 3F5WA 5TK2A 5GRZA 4XWOD 3QORB 3FB6A 3O0LA 3UGXA 1X9LA 5TJWK 3ZDZE 1AZUA 4NPYB 3EYFA 4NQCB 3ZVVA 1E2ZA 1HEZA 4I1NB 3H9SB 4JFZL 4ZTPH 4PJFF 4HYTB 2V9UA 4LCCA 4P4KA 4XBGA 2E27H 5IZ7A 5HGDB 5KSVA 3NIFF 5CEZH 2IWKA 4WV1C 1NBYB 4NO0A 1A64A 1QABA 4JO4H 3BDYL 5E5RB 5D5MB 1J1XL 5FXCH 3QUZA 1U4FA 3L7FA 1SEBA 3W2DH 1QW9A 1XWVA 2JCWA 3CDYA 4KRNA 4KK6D 1D6EB 3SJVD 4X6FB 3M07A 4A2GA 2X3CA 4ANWA 5AB2A 2ZUSA 3KGSA 4QRUA 1AR1C 3IJSA 3CLWA 3SDAB 3PG2A 1CG9A 3MCLL 5EZLA 4G70B 2QR0B 4IS6B 5CCGE 2F58H 2E3VA 4MS8C 4NJAL 4OFPA 4PV8B 3I75A 1ZTXH 4CSPA 2H3XC 2FSEA 4HPOL 4XNYH 2AJSH 4PCSA 3R4DA 1FCGA 3D69A 2C9RA 4NFBA 5L2KD 5M94B 3ARYA 3KPSA 1YAIA 2A0LC 3VFRB 4DN4H 2JI1A 4Z7UB 2YEZB 1KYDA 3ZYZA 1IMHC 1WAEA 4W9FC 3CU7A 3BVWA 2BIMA 3MCKB 4LLWA 1OAQH 3MLRH 4KV5E 1VEOA 4R8WH 1OB1A 4WI9A 4X8JA 2DLEA 3MBXH 4YZWA 2WINA 3N40P 4RGNB 2V3FA 5L4JA 4RMQA 2NNAA 3Q6FA 2G2RA 2J43A 5E9DA 1L9QA 3B9VA 1AQ8A 4PRDB 1MFDL 2EYTA 3BVUA 3T08A 5JOEA 2FGWH 3EYSL 1M4KA 1XBDA 1ZHBA 4GAGH 4J3OG 3VXMD 2VMEA 1H3PH 5JIMA 2R15A 1YMMB 4LVHB 2CCVA 4N86A 3LH2L 1XCQB 1XZWA 2D4FA 1IGMH 3O81A 4PB9L 3OAYH 5DXWA 5G5DB 2N7SA 3NQKA 1JPEA 5L6YL 2BHFA 1TVHB 3QS3A 5AW3B 3ZDXE 3MRKB 3BPLB 3HZYA 4PVLA 2YGPA 4A7TA 1G7IB 3UJIH 4ZAKA 2G5UA 2R23A 2A2QT 1MCQA 5C8JB 1SUHA 4HPYL 4XP6L 3QEQE 3LV3A 3NQIA 2KLRA 3FQWA 1ZV9A 1TQUA 4AW7A 2B9AA 3EO0A 3BW9B 1T4WA 4QY8A 2CJSA 1KY6A 1WPCA 3VI3B 3HKZA 1CFBA 1BZ9A 1QRNB 2EIBA 3D39B 2Q7YA 4O5LH 1BJ1J 2GK0B 3HG0A 3DVNA 2VJ8A 4PP1D 3HIZA 4W9DC 1N0LA 5JDSB 3MUHL 5T1DH 2YOAA 4L4JA 3MREA 4A7UA 5LBSH 4DQOH 4WHTB 1IEBB 3A6BL 3ZE0B 4MX7A 5C71A 1QLEH 5AVSB 4FQHB 1BYOA 1ODAA 3AXHA 3SE6A 4JK0D 3D4YA 2HKAA 1ZHKB 4FEIA 1YN6B 3HG3A 4EZKA 3OHXC 4E68A 1PY4A 2IEPA 4LSVL 3R8BB 2ADIB 1A9VA 5IEHA 2B2XH 2BP0A 3BMVA 1JAEA 3MLWH 1TTAA 1R6VA 4G1MB 5I6KA 5KVEH 4P5TB 4ES9A 1W6LA 5IMMB 1EERB 2DMKA 4N0UA 3R7RA 4NM8H 3N85H 3VXOB 1A25A 3UTTD 4JFUA 3MA7B 1BYPA 2NT0A 3X14A 1EJOL 4C4KO 3DK2A 4M7JL 4DESA 2LOEA 4ACPA 5GS2H 3C5ZC 2E56A 5FKPA 4MX7B 1J05A 1R5VA 2WUCH 4Z77B 4H8WH 5JHLL 3B37A 1JFQL 2ZXGA 3NTCH 5HHOA 1TZGL 3VACA 1CJYA 2GJ6E 5D7SL 4BCYA 5DEGA 1CXFA 4TVPL 1XF4A 3JWNG 4JM2D 4XCFH 5FW6A 3DMMC 4Z3TA 5EBGA 2Y7QA 4LGPB 5IUCA 4BV1A 2ZPKL 3U6XA 3NT0A 3DHPA 3ML8A 1KGWA 2KLTA 3AUWB 3QJTB 4EAEA 3C5ZA 4NNYB 2YMXL 2AKRA 1O9WA 4EN3B 5B3NA 3CN4A 3RX5A 4U1JB 4WQOA 4QO1B 1ZDQA 2EILB 2GUYA 4QPEA 3Q9PA 2BIOA 3EDDA 4IBTA 4QHLB 4DP5X 3BZDA 1AE6H 3RU8H 2W95A 3TVMB 1IE4A 2OI9C 2R1WA 4HXBL 5M7QA 4KXZH 3GJEA 2J56A 3DMMB 5T33H 2WQAA 1F2QA 4MGXA 1R3IL 4PREB 1NM4A 3LXBA 5TDNA 2HH0L 4LP4A 2I26N 4UYPA 2BJMH 3SYQA 4MD4B 3UAJD 3ARRA 5CINL 3VMNA 4M7ZC 5KYWA 3BJ91 5A2JH 4N28A 2DKUA 3MV9E 1G7JA 4E42B 3UAJC 2J8OA 1E6JH 2C4XA 2Y72A 3LDBB 1MFBH 3S88L 1BXVA 1G9MH 3K6IA 4XPAL 3V0IA 3HG1E 3SO3B 2JIXD 2Q87A 3R18A 4KX9A 1OF2B 5AW7B 2Y3NA 2YUWA 4U4BA 2BSCA 4KTYA 4JFHE 3VH8B 5JOFB 3L6FB 4RX4A 2N1KA 2C3VA 3DJSA 3OHXB 2HKHH 4NSKA 4TPRH 1JK9A 2VUYA 3LN4A 3NMEA 4C55A 2VDRH 2Y0SA 5TE4H 3GBNH 2N0MA 3V7AG 1UATA 3QH3B 4GI8A 4WJG3 3PXJA 3PHOB 3LQAC 5ISZE 4PJIA 4EVNB 1KGXA 2EEXA 4XE0A 1LDSA 3TO4A 3SZ6A 1OVZA 3IAQA 3QHFH 5ENWA 1T5XA 4YAQA 4FCHA 2ENSA 1G6RH 3OKOB 4PPTA 4X8GA 2Q8AH 2BIHA 4NZTH 3NIGF 4C59B 2P5ED 4JGMA 4Y4FA 5DTFA 1RK1A 2A1WH 1BXUA 1INEH 2ADFH 5HI4D 5J3HD 3QRGL 3RWHB 4PJEF 1JI1A 3QQ4A 5DRZB 1U42A 5C0CE 2PMZA 2ZG2A 2ZG1A 3I9GL 1NUFA 1FLTX 2PR4H 1JGLL 4GUCA 5D7EA 3S4SG 1W6WA 3FRUB 3IJHA 4A7VA 1D7CA 4FEMA 3NJLA 4OUUB 1DVTA 4DVBB 4LRNL 5DJDA 3RA7H 3F6JA 3KYNB 1QRNE 2VLJA 4Q6IA 4GW1A 4HLJA 3TBSB 5T1MB 4D7BA 4S0TD 4QXUH 3SDYH 4HS8L 2VB5A 4OY9A 5DQDH 5KOMC 1BIIA 1ES0A 2XSKA 3RL2A 3FT2A 3ISRA 2NCEA 1JZ2A 3U4EA 3OX8B 3V6ZB 4DKFH 2F15A 4JVUA 4CN6A 4F7KA 3RWCB 3QDJB 4Y4KC 5IROD 3VXNB 4PI2A 2B59A 3O3AB 2O4EA 2K9FB 4X7SH 1IE5A 2X4TB 1IC5L 1BLNB 3MRQB 4JN2A 4QRRB 1Y0LB 3V79C 4WW2C 5GZNA 4U3SB 1LL1A 1QWNA 4GW4B 3FN9A 4PRAA 2P8MA 1X7QA 4OGXL 5FUCC 4JFQB 4M7LL 3TH2T 1MWAL 1EEQA 1CXKA 4LVOC 4R7XA 3EFDL 4UQIM 5HYEA 2XDHA 4OD3H 3SCMB 3QDGE 3NSYA 3MU3A 1T5WA 4W9LC 3BXNA 1CE1L 1KCRL 3HLKA 4IEFA 4N2MA 3MJ7B 2ADJA 3SDAC 3MRHA 1U93B 3KPNA 3ZDWA 5K5YA 2MCPH 4EMZA 3KJ6H 5IM7B 5GHWL 3VFPA 4DCQB 4NUGL 3QEGL 1NOLA 4IHBA 4XC1H 3A6CH 1HK6A 4X7FC 3RBGA 1FE8H 4UQ3A 4XZUA 4UTAL 1QEXA 2XWJB 4OLUH 2IMMA 2B59B 3P0VH 5BXFB 4IIQA 1AR1B 1E4XH 4J4PA 1E3ZA 2W0KA 5EIQA 5CSZA 4KHXH 1KZQA 5KSBF 3MXWH 5T3XH 3AAZA 3ZSSA 2IG2L 1F6AA 4KY2A 4JY5L 4KHTH 5MERA 5E7BA 4GUQA 1LEIA 1DBAL 4ABWA 1KCBA 2EVJA 4F5CE 5IG7B 2NTSP 4M9OA 3TVMA 2WD0A 1YC7A 3SD2A 4ZUTB 3WBDA 5FPIA 3D34A 3W9EB 2J88L 3R8QA 4DK5A 3EFOB 3VXTB 4PJXF 5GGSB 4CU8A 3SO3C 4HVBA 3C6EA 3WEMA 4AZ8A 3L3GB 2HTLD 4Q6KA 4MSWA 3KPRD 5B1KA 5EIIA 1NPNA 1A3LH 1JHTA 2X9YA 3CZLA 1OLLA 2HT2D 1AD9A 2VO5A 1YZZA 4FZ8L 3GJFK 5DHDA 1WS8A 5DS8B 2KDGA 5SX4I 5CEZE 1X44A 3MV7B 1U8MA 5CHNA 4BYHA 3KPMA 5C1MB 1LQSR 3D6GA 4PMFA 5D1QC 3DOHA 5AB0A 1Z9NA 3LPPA 3WNJA 4F7EB 4JHWL 1HFUA 5CLTA 2VR4A 1N4XH 4Y16A 2FEDD 3MJ8A 1S78C 4YHNA 1A4KB 2HB0A 4PRID 3UBXA 1XHHA 3LZNA 4WNQB 1KZYA 1U8PB 5KS9F 3STZA 2BO0A 4B7LA 1AZNA 4HA1A 1SYSA 1W8OA 5E8NA 4IJ3C 2G3NA 2OK0L 4GP8B 3WNLA 3ZBMA 2ROYA 3Q01A 1GSKA 1S9WA 2KZ1B 1IAKA 2VKXA 4L3EE 5DJAB 5BUAA 1DSWA 4L1LA 4F8LA 4GMTH 5LGJA 3U1SH 3FB8A 5E51A 2WOBA 1YEJH 4DETA 4GOSA 3W0WA 3KLHC 3O3DB 5DFVC 1FL5A 4LRNH 1GVIA 1JPFA 5DUBA 2JLPA 1IAOB 3P4NA 4P9HH 2CK0H 3AG3B 3QJZA 2A9NH 3CFKB 1U8OB 5A7BA 1FL3A 3EYUH 3QJHB 2XKUA 3VFWA 4DP0X 4KY1L 4NQTA 5KS9A 1XF3B 3EJZC 1ZANL 4KKRA 2VLLB 5JDSA 1QBLL 5IGXH 4UTCA 1W72A 3QJXA 2AI0L 4QI3A 4WF7A 4PRPB 3Q8EA 4ZMOA 2I69A 4W6YB 1NCAH 1VFMA 1XL6A 2VDLL 2ZUQC 4FTVD 4U1IA 4PI0A 3S3DB 3CMGA 3SKMB 4D0CA 1NIEA 2DWEB 4Q58C 4M56A 1PZDA 3T2NH 3QDJD 5I15L 4Q9QH 3ZOAA 3KDMB 4AJYV 1EGJH 3QIBC 4MB4A 2FSDA 4YSTA 3TT1H 2G3ZA 3LZLA 4F8TA 3AITA 3CFDB 1IBGH 4KTDL 4N87A 2I7OA 2JKRM 3ESMA 2O6EA 1JBJA 1JZ5A 4RAUB 3OG6B 4G6AC 1F3DH 2EICA 2E27L 3CVHB 2VO8A 2WXQA 3D50A 5TE4L 1U8OA 3QZOA 4IBWA 4JVWA 4ZTEA 5DZAA 3DX6B 1SVZA 1USZA 4RCAA 1KIUB 2E7LC 2APBA 3BN3B 2ADGB 1KIPA 5JW4Q 5I1AB 5C0BE 4KMQA 1PW3A 1KPRB 3HPLA 1D9KB 3ESVF 2PUQT 2X7LB 3BRGC 2Z93A 3MYJB 2FD6L 2BMKB 4K3GA 4UQAA 3S36L 4RISL 5FGBA 1E3FA 3BP6A 4LLYA 5DRWA 1WV7T 1HZHL 1XGRB 3HTLX 4G6FB 4WW1A 2EYSA 4Z7QE 1ZA3A 2E4TA 2ATPB 3C5JA 5IVOA 3UTQA 1QBAA 3O8XB 2W59A 2XN9E 4F9PC 4WHCA 2WLIB 2R29L 1HC1A 5B39G 3OZKA 2DEWX 4Y1AA 1RMFL 2QSVA 1P4LA 3I3BA 5KYUA 3ARED 5E99L 1RURL 2ZQKA 5C0AE 2ATKA 2DWXA 3PGDB 4TN9A 5TDOA 3QIUC 1D5ZA 2L4OA 4AH2B 3TV3H 3UTPE 1JN6B 2P24A 4OZFA 3GSWB 2BK8A 1AHWB 3N41F 5I8OH 4AENB 4Y4HD 1KLGA 5ISZA 4YDKL 3TBCA 1JVOA 3B4NA 3MOBH 3L9RA 1MFVA 4KJWC 3VMOA 1JFHA 4MD4A 1EO7A 1GJWA 2HVJA 4WTQA 4APQB 5BS0A 3FHEA 1KDIA 3KEHA 5EFIA 3LDBC 5I5JA 2BFVL 1HL4A 5D70L 2K1MA 1BBDH 5D6CB 3ILQC 1O6SB 2NY2D 3L3KB 5IESH 2A73A 4Y16C 5C9KA 3DX0A 1OP5K 1VEPA 1KY7A 1MCHA 1UQSB 4GSDH 1MIEH 3IXAB 4UIKH 3T3PF 2J6WA 4IRSC 4X5LA 5LQBH 4IBQA 3T6VA 4YQXH 4MD0B 5HHQB 1ACCA 4NQEA 4Z7AA 2YD6A 1NBCA 1T6BX 2IWEA 2VL5B 2IO5A 3GSWA 4FULA 5JORB 4LSTL 4XR8C 2ZONA 4WW2A 1QEWB 1DCLA 2ITDA 4TF4A 1IGTB 2A74C 1U3HC 1FZMA 1A7NH 4PGDA 4W9JC 4FFVD 1FNSL 4MMZC 1QI3A 1VADB 3EG9A 3LN5A 3NK4A 4MDIA 5EO9B 3EBIA 2MSPA 1UZ8B 4UNVA 1HXYB 5AVWB 3ZT7A 5T3ZL 2P47B 4OLUL 1KSRA 3NP4A 4ADIA 4B53A 1E5AA 1NUGA 2H7WA 3MXWL 4NJAH 4TNFA 5CWSA 4HOMA 1U8LB 2VNCA 4PV1C 4NKDB 1KJ3H 1KCLA 2FJUB 1M2VB 2O26U 3MRGA 4N24A 3B7YA 3HZKB 1DVUA 1BMZA 4OZGB 4R83A 3DGCR 4C4UA 4JO5A 2VDLH 1VKXA 5EV7A 2ZCKH 1WIPA 3PP4L 1J8HE 4JPKL 4N8VG 1EXUA 4KGJA 5D1XB 3S2CA 4LQFL 2XKNB 2QV2A 3KCPA 5LDSA 2XWXA 4G1MA 3DPBB 1FFQA 2WB7A 4HCRH 4LSRL 4MB5A 4ZK8A 3S8FB 1T0NA 4P2OC 2HG5A 3NZHH 3U7WH 1O9VA 4LPWA 5FF6A 1OP9A 1FNHA 1S5HB 4ZI8A 1IIIA 2O6CA 3AU0A 4FA7B 1VGEL 2OMZA 1FG9C 1FNEB 2DBJA 3FO9A 4Z7VB 4JDTH 2GTZB 2DQJL 5I5IA 1M1XB 5GSVA 1MJUH 2R29A 3ZQWA 5CZKA 1PY9A 3AM8A 3ZDYB 5DMIH 5D1QA 1ZGLA 4K71B 4KKAC 1G0DA 3NAAL 1D2OA 1U3ZA 3QUYD 2ZP0T 1Q94B 2AQNA 4DHLA 3LH2H 3ZTDC 5KSAB 3RUGF 4MJHA 3PWLB 2JCCE 2XICA 2Q6WA 1AG0A 5JQIB 3GIVB 2J5LB 2EEFA 5EIVA 1FN4A 3ZL1A 3P73A 5M95B 3HOGA 3PUCA 1CB4A 4FQCH 1YNLH 4TUOB 3ME0B 4B9JA 3TLRA 5J6GB 3OXRB 5B8CA 1CFQA 2UYLB 4DKTA 1UGKA 4R26L 4NHUA 3ZKND 5KVDE 1J0IA 3IFOA 4ATWA 2FLRT 4XRCB 4MBRA 4R5XA 4JFYB 4QYAA 1A21A 2D73A 5SWSD 1QSEE 3CWGA 4E9SA 4PJAB 3ELAT 4EI6A 4XNAA 4XXDA 1KXQE 4FXKB 1NC4A 4OLWH 3WJJC 1TZ8A 3VXRA 3ISYA 1AQDA 2F68X 4HAFA 5LUMA 1DSFH 4XBMA 3IDJA 3GMOB 3BCDA 1WZAA 3STLB 4XMPL 5IHBA 3BIKA 4DZBB 3PHAA 5FK9A 2Y6TE 1AIZA 5FKAA 1SM3L 4L3AA 3SY0A 2PO6B 3WV0A 1T1WB 3EF4A 5H37G 3CSTA 25C8L 3UACA 2BSSB 4D8OA 5D96B 1A3RH 4KJQD 2ZAHA 4R7NB 1E42A 2B2XL 2KBGA 5JHLA 4MMXB 2GAZA 3M1OA 4IRZL 4LSDA 1FUNA 2BP8A 1SHSA 2TRYA 3OKYA 4Y2OB 4PGEB 5FECA 3L4YA 5L8KB 3BP4A 4PVNA 2YA2A 1JMZA 4M5SA 5D1XD 3VXOA 3I50H 3WLBB 2HKHL 4BQ8A 4I0KA 1VFAA 5GXBB 3EAKA 3RKDD 3BW9A 1M05A 2P52A 3GBNL 1D7FA 2E47A 3IDYB 1MWOA 1R5IA 2JJVA 1MKFA 3DIFA 4Y9GA 2GIXA 3HI6L 3L5WA 3RPBA 4XP9L 3DMMA 1DEDA 3OSKA 1UM4H 1XB3A 2Z0BA 3GRWA 5GGQL 3UPRA 4RFOH 1NCOA 5CBEA 4M5YL 3MV8A 2Y2YA 5DJ8A 3VQ2C 1R0AH 2BSTA 2VAAB 1G6RL 2NX5E 3TONA 3U46B 3SBWC 2X6VA 4PD4J 2BCKA 1TF4A 3I84A 1RIHL 2WCPA 2X6AA 5C92A 2DQFA 4ZS6C 1J0JA 1IZJA 4OZ4A 1X4XA 2CMRL 1CFVH 2UZYA 3PPSA 4Q4EA 5EEZA 5DZPA 2VN6A 3KPQA 4KRPC 4LASH 1K3ZA 2OJ1A 4FERA 3TNMA 5KJ7E 1BEXA 1G7IA 4Y1AE 1I9JL 3K72B 3QI9B 3WL9A 3B2MA 5KVDL 3IK2A 4UNUA 4HZLA 4N85A 2JSFA 5L0QC 3CSYA 5E5LA 4APQD 3RJOA 3AADB 3GJFA 4JY4A 4XPGH 1BFOA 1PY0A 4XBPA 4Y19E 2GIYA 2OJZL 2WYHA 4XMKH 5HY9A 4CVZA 4JCMA 1JK8B 3TTYA 4KK5D 5JQ6H 2B14A 1I8IB 2PPEA 3X3GH 5FB8B 5JIKA 2ATAA 3CZUB 1C5CL 5L88L 3ZE0E 4ZTOH 3O4LB 1NJ9A 4OZ4B 2XKNA 5MP6H 3SE9L 5K9OA 1N2RB 3APNA 3X3FH 2NQCA 4PS4H 5AYQA 5B3JE 2Z31C 4JFTA 3GS0A 3BAEH 3V9EA 5F7YC 4LSQL 3H56A 4HX1B 4UDUB 2NTFA 4LNRA 3HI1B 1SXBA 3PAVA 3QQ3B 4QYOB 1CFNB 1NGQH 1JD9A 1R9FA 4I77L 5BUPA 2IDFA 5IIEB 3IS0X 4ABUA 5IREA 4JGNA 5HJ3A 3SDCA 2LGNA 1PPIA 4IHOB 3DVNB 5F88B 4U6TA 3V4UL 4XI5D 4ENZA 1KEMH 1JHLH 4ZS7H 5GHWH 1G5GA 2VUKA 3T6QC 3P1VA 4QRQB 5IQLA 4RMUA 5BRZA 3BESR 4M6NL 1N6QH 2XFXA 3UZEC 2DS4A 5D1ZA 5IW1B 2J25A 1XGYL 4I0PB 3KBFA 1BF2A 3QZWA 4WTZG 3SIKA 4N6RA 2G75A 5AEAA 3F7VB 4PCKA 3V52L 2RACA 3SKJH 1IQWH 4NQXA 4OV6F 3CLEH 4OZIE 2XG5B 4M6OH 1N0XH 5FUCE 1CICA 3ULVH 2WXRA 1MVUA 5J06A 2H3KA 3TIDA 1OTUC 1HWHB 2IQAB 1P9MC 4QF1A 4XMUA 3FL7A 4Y5VA 3QORA 3THMH 2ID5A 3UC0L 2Z34A 2F8VA 1W0WA 4BH8A 3HE7D 1HOCB 3BKML 4JFQA 4XVTH 4NRYA 2A3TA 4N68A 3ZTEA 2YKKA 2HRGA 2EKSA 4HUWA 5BZWB 4V2CB 1VGKA 3IDXL 3UTSA 4A66A 2EP6A 3DPBA 3F3HA 2DQJH 4FG6D 3HVDA 2OTUA 4G80A 3JTSB 3CLFL 4AH2A 3OX8A 3K4ZA 1HHIB 1FYHB 3VXRE 1CLCA 1CTOA 5J12B 3LCYA 2BVQB 4G71B 4LRIC 4OFKA 2OX5B 1FZJB 3LIZH 3MNDA 4GUPB 4MCYB 3LNDA 4C47A 5TD4A 1PCXA 2ZOTA 3S5LG 1I1FB 3BIAX 4IOSA 1MVUB 2DQ6A 3N41B 1PZSA 3M8OL 4YXHL 5FWRA 3T8MA 3NIDF 1IQDA 3BD4A 4U3SA 4Z95L 1HHKB 2W65B 3GSRB 3LKPA 4RQQB 1YNLL 3QI9D 3RDTC 4Z78B 4IKLA 2ZX6A 3ZO0A 1UT2A 1YECH 2XWTA 2O61B 5DO8A 5SX5K 3SDXE 1WS7A 4NRYB 4LAJH 3BLPX 15C8L 2XQ0A 2HT2C 3IJHB 3RWFA 1T22B 3PXLA 4ENEC 2VRKA 2NYZA 3VYOA 4I87A 1T89A 4F9PA 3W9EA 4A67A 4N5EC 3IYLW 2R2HA 4OZHF 1JZJA 4ZRGA 5LN4A 3REWA 3W9DA 1YPZA 3IF1A 1PX3A 1DLFL 4ZG1A 5F9WC 3UMNA 1OCCB 3B5GA 3L5HA 1OARL 3VFNB 3T4YA 2E7MA 2VR6A 3SGJC 3CFQA 2AXGB 4HEPA 3L5XL 5CSZB 1ORQA 3V6OC 3IBOA 4UILH 1EHXA 4KJPC 4NAQA 4N3TA 4K2UL 1UB6B 1MFDH 3CU1A 4OH2A 5FYKD 3ZYJA 2AVGA 4HC1A 3VRJA 2VQUA 4N2HA 4Z78A 5JA8B 2AABL 2ZXDA 4HEME 2VXTL 2VE6B 1GZPA 1S7VB 3K4DA 3O4OB 1XGUA 2ED8A 1MRFL 2XRAH 1WITA 2ZUYA 3EOTL 3FB5B 1RZJC 5IHUH 1QR4A 2F5AH 2WP3O 3EFFA 3QQ9D 3LN4B 4GLRI 4S1QH 5HTSA 1C9SA 3UOAB 1QPKA 1U8CA 3IFPB 3APFA 4KNUA 1A7PH 3ZR6A 1U8NA 2BZ7A 4NN7C 2GCYB 3D0LB 1WFOA 3DIVA 3LKNA 1HYRC 3P9LA 4CGUB 1Z9OA 2GIMA 3E8UH 1AXSB 3VTTA 3F58L 4RSYA 2CIKB 3IMSA 3LRSA 1FAIL 4P5SA 2RGSA 3PPEA 3EGDA 3BN9D 5I1JH 2GJ6D 1GCYA 1UJ3C 3OGCB 5E6IC 3TH3T 2F8IA 3A6BH 5AG9A 2B7DT 4BSWB 2ADIA 2VE6A 3R06A 2R4RL 4R5TA 2HT4C 1E6OH 2ROXA 2X7LA 3VXQA 4CN1A 2A6KA 5EZIL 3Q13A 5E8NB 4FTVE 1LE9B 5DJ8B 2GPZA 4QTHB 3GKWL 3HS0B 2VLRA 3U46A 4NQDD 3T77A 2YSSB 1FGVH 2X4SA 4I3GA 3RPIB 4H8WC 1RPKA 1FFOB 5HPOA 2CR0A 1CL7I 3DRQB 1XXFC 4E36A 2OMTB 2GC4C 2R4SL 2Y06H 1KB9K 4G7RB 4YO0B 5AL0A 1GZQB 1IFHH 1CFMA 1PJ9A 1TYRA 2PCYA 2IGTA 4R8WL 2HZHA 1T04A 4I8DA 2AXFB 1A6AA 3MUZ1 5DEGB 1G9NC 2B4CC 5FYJE 2ZYHA 4AQ8C 2Z1KA 3R4RA 2IFFH 2QFRA 3BO8B 4BJLA 2BVOA 3MOBL 3CLFH 1T7WA 2X38A 4MA8H 5DJCB 3OMAB 4N90E 4N25A 4GKNB 3FFCA 1MSPA 3NRFA 5JMRA 1ORSB 2EO9A 3ZZQA 4WNSA 1LQBC 3L95B 3DXAD