3UADA

Multicopper oxidase cueo mutant c500se506q (data5)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHQDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Blue copper oxidase CueO
publication title An O-centered structure of the trinuclear copper center in the Cys500Ser/Glu506Gln mutant of CueO and structural changes in low to high X-ray dose conditions.
pubmed doi rcsb
source organism Escherichia coli
total genus 135
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uadA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uadA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uadA03
2XWZA 3FS9A 1ILSA 4ZK8A 2HZHA 4W9ZA 6PAZA 1IUZA 1NPNA 3CVDA 1A4BA 1UATA 1GW0A 3WNIA 4GP8B 2OCCB 3FYIB 5I6KA 1BEXA 1J9RA 4YSTA 4KO7A 2DV6A 1AAJA 1V54B 2VW4A 1XB3A 1A4CA 1M56B 1WA1X 2GBAA 3AY2A 1TU2A 4NERA 1KV7A 4HHWA 4KO9A 4A2FA 4UF7C 2BWDA 1N68A 2FJSA 1AS6A 1M57B 1PNCA 1URIA 2W8CA 1J5DA 1OCCB 3S8FB 1JZIA 1QHQA 4GXFA 1NICA 2XYBA 4A68A 2HX9A 2FQDA 3X1GA 2QPEB 1OE1A 4YSSA 2XXGA 3NJHA 3PCYA 1OE3A 1SDDB 1QLEB 1SHWA 2YAQA 3FT0A 2YAPA 2PCFA 1ID2A 3T6VA 4GP5B 2IDTA 1ZV2A 1GS7A 3AG1B 3PAVA 1ASPA 2YARA 2OJ1A 4KO5A 2GB2A 3NJMA 1N70A 2FQGA 2J5WA 1XB6A 4E9YA 1ET8A 2J56A 4KNTA 1IKOP 1WAEA 4AX3A 2Y69B 4F7KA 2CCWA 1NWPA 1XB8A 3KW7A 5AFAA 1QNIA 1MZZA 2IDUA 1JXFA 2E86A 4E9QA 2B3IA 5B3SB 2IDFA 4E9SA 1PZCA 3NP4A 4QKTA 5A7EA 5B7MA 2IWFA 3CZUB 5I6NA 2GC7C 2FNWA 1AZRA 2DY2A 1JZGA 3OMIB 3WKQA 2AVFA 3NSFA 4HCIA 1L9PA 3PXLA 1MDAA 4HALA 1BAWA 1PNDA 4ENZA 2XX0A 2DYSB 4L0PB 2GIMA 3AG2B 4YSAA 1SNRA 2WO3B 4TXVB 4HHGA 5AZUA 3X1NA 4DPAX 4YSEA 3NJNA 1NTDA 4HCFA 3FSZA 1PF3A 2PP9A 2AZAA 4P5RA 5I26A 4WTQA 3NP3A 1NIDA 2YAEA 1J9QA 1OV8A 2BO0A 4HCGA 1AIZA 2HXAA 1AG6A 3IN2A 1W6WA 1AACA 1X9RA 2GSMB 4A2GA 1MG2C 2CJ3A 4A66A 4G7RB 2FQEA 3OQRA 4YSDA 4E9VA 1NIBA 3NJIA 1PLAA 3FSWA 5PCYA 3FU9A 2W88A 3QPKA 2UXFA 2R7EB 3PAZA 4YSPA 3GYRA 2QPDB 1ILUA 1NINA 1OE2A 1MZYA 1OF0A 1ADWA 2AZUA 3TASA 1CC3A 3EF4A 1PLCA 2PP8A 3WKPA 2PPFA 4JHVA 1WS7A 2IH8A 2HX8A 1BQKA 2JXMA 1BYOA 3EH3B 1F56A 5F7BA 3T6XA 2IWEA 4N8UA 2CAKA 3HB3B 4DP7X 5B1JC 2XV0A 3FU7A 1L9TA 4X4KA 3ABMB 5EHFA 1GYCA 1FFTB 2H3XC 2IAAC 1A4AA 3ABGA 3FPXA 4BWTA 3ASOB 4UANA 1FA4A 1NDTA 1GY1A 4BDVA 1HFUA 4BDVB 2Q5BA 2I7OA 1PLBA 2XU9A 1EZLA 2GI0A 1AZUA 1JERA 2YAOA 3NSCA 2ZONA 4YVUA 5F7AA 4BK5C 3UAAA 4AKPA 3ZBMA 2VW7A 2YAFA 1PZBA 1RZQA 3T6ZA 3NJFA 1T5KA 2GHZA 1CURA 1SF3A 1R1CA 3DIVA 3NJLA 1JZJA 1NIFA 3JTBA 1RKRA 3ZDWA 1M9WA 2CALA 2GC4C 3CG8A 3OD3A 1ZIAA 3PAUA 2HRHA 3BVDB 1FWXA 5I5JA 2WSDA 4W1TA 1EHKB 1J9SA 3V9EA 3U25A 2QDWA 2PPDA 2EIJB 2PPAA 3H4HA 1OCOB 4DP5X 1KCWA 6PCYA 1W6LA 1OCZB 3ABKB 2XLLA 2PPEA 5FC9A 1VLXA 7PCYA 1GS8A 2WO2B 3BQVA 4E9TA 4N4YB 2BW4A 5D4HA 1ZDQA 4BXVA 2PCYA 7PAZA 4AZUA 4KNUA 2AFNA 1RZPA 1GS6X 1KBWA 3RYMA 4YL4A 1E5ZA 3QJRB 3CVCA 4E9XA 4PAZA 2YXWA 1KCBA 3AW5A 2XXFA 2Y1AA 1TKWA 1HAWA 2FQFA 1AQ8A 3EH4B 2CUAA 2BP0A 2FT7A 1E30A 2H47C 3OM3B 2BP0B 4PCYA 4QLWA 3T9WA 3T6WA 4BWWA 1B3IA 1JOIA 3ZIYA 3IBOA 5B1AB 1SFDA 2MTAA 1WA2X 3S3CB 2ZWNA 1NZRA 1E65A 2A3TA 3NJGA 2VMJA 3UACA 1NWOA 3UGEA 5IY5B 1PZAA 3WIAA 2PPCA 3PLYA 2X88A 3T71A 2EINB 2FWLB 1A3ZA 1NPJA 4G72B 4NAJA 2VW6A 4K9JA 4Q8BA 2RACA 3FQYA 1TEFA 3X1FA 5I5IA 2P80D 3X1EA 1L9SA 2XV3A 2VN3A 3WNJA 4NB7A 3WI9A 4WKXA 5PAZA 1ZDSA 1AS8A 2VM3A 3HEIB 3QQXA 2BZ7A 2QT6A 3FSAA 3QJQB 4P5SA 2IH9A 3X2QB 3H56A 1V10A 5I6LA 2FTAA 4Q89A 5E9NA 4A2HA 9PCYA 2OV0A 3AZUA 1V55B 2YAHA 1KBVA 4A67A 1KDIA 5I6OA 3ZX1A 1L9OA 2VM4A 3UAEA 1ASQA 1JZHA 5B1BB 2IWKA 1L9QA 4KOCA 1DYZA 1JXDA 1AZCA 5B1KA 5I28A 3OMAB 3QJTB 1PMYA 4EF3A 1AZNA 3IN0A 1J5CA 3NT0A 4HIPA 5TK2A 2UX6A 3FU8A 4DP2X 5TK4A 3FYEB 4A2EA 2UX7A 4DP6X 1BXUA 1WA0X 1BQRA 5D4IA 3WG7B 3NYKA 3FU7B 2I85A 3N2JA 3ASNB 4DP1X 4DP4X 4MFHA 1J9TA 4A2DA 2CBPA 2HRGA 3ABLB 3S3BB 1XMEB 5B7EA 8PAZA 2P80A 1SHXA 1ASOA 5B1JA 3SBQA 4GY4A 3EHBB 4YSOA 1BXAA 1I53A 1RCYA 2J55A 2TSBA 3IE9A 2XX1A 5LDUA 1TEGA 3H4FA 3CVBA 3TBBA 2J57A 1PCSA 4AKQA 1WS8A 1GY2A 2PLTA 1AZBA 1JXGA 2YAMA 2VSKB 1AR1B 4YVNA 1CYXA 4KNSA 4GYBA 2EILB 1NIAA 1KYAA 2FT6A 4AI7A 4DP9X 5AKRA 4BXSV 4GP4B 3NJKA 4FAAB 5I5MA 3C75A 2YXVA 2FT8A 2DWSA 4JHUA 1BYPA 2IDSA 2UXGA 4G7QB 3AG3B 2XV2A 4M4RB 2HX7A 3UABA 1JVOA 1L9RA 1MG3C 4BWUA 2BW5A 4KOBA 1SDDA 2JFCA 1HAUA 1ET7A 1A8ZA 4DP0X 2DWTA 2NRDA 2EIMB 3NSYA 4G7SB 3UADA 4DP8X 4KO6A 4M3HA 5I6MA 3QJSB 4YSCA 1IC0A 1SFHA 1ETJA 4HZ1A 4F2FA 3JT2A 4E9WA 4FA7B 2XUWA 3AG4B 4DPBX 4CSPA 3QJUB 1ZPUA 3FPYA 3KW8A 1AS7A 2EIKB 3DKHA 1GR7A 2UXVA 3FQ2A 3QJVB 1KDJA 1DZ0A 3X1BA 3S8GB 2VSMB 3V9CA 2HLEB 2Q9OA 3SQRA 2DYRB 5D4JA 1BXVA 3G5WA 2BWIA 1KGYE 1NIEA 1PY0A 3GDCA 3SBPA 4RH4A 3FQ1A 3NSDA 3D12B 2LLNA 2UXTA 3N55A 3FSVA 1ET5A 2I7SA 4JKNA 5I6PA 1ZIBA 2ZXWB 1JVLA 1SF5A 3NJJA 3DTUB 1SJMA 4YSQA 1CYWA 4YSRA 3ERXA 3TU6A 1CUOA 4E9RA 1AANA 4UAHA 1AOZA 1PAZA 1OOWA 4G70B 4F2EA 1JZFA 3L45A 3GXUB 4HAKA 1W8EA 2H5UA 4DPCX 2PP7A 4YSUA 2ZOOA 2BHFA 2YQBA 3OMNB 4AKOA 3SBRA 1AG0A 2BP8A 2BP8B 1JZEA 3IEAA 2XVBA 2AANA 2MRYA 5B7FA 2X87A 1X9UA 2TSAA 2B08A 1GSKA 3TA4D 3MX0B 1IBYA 1IBZA 1YLBB 3CDZA 1E5YA 3EH5B 3MBWB 3CDZB 2QDVA 5ANHA 1A65A 2IDQA 4G71B 2BZCA 2R7EA 2JKWA 1BQ5A 1E67A 3TBCA 3PPSA 2N0MA 3S3DB 1OCRB 4CSZA
chains in the Genus database with same CATH superfamily
1E4JA 3AU1A 5DZVA 1MFBL 3NFNB 4M1CD 3KCPB 2YRBA 4LAJH 3ZRCC 1NSNH 5GJTL 1RP9A 1LTXA 1EBPA 1AXTH 2AJVH 1ZVNA 4JN1L 3O3UN 3FYIB 4Y5VB 1RPQA 2APFA 5FS5A 5F3BB 3PHQA 2O93L 2JTYA 2VW4A 3Q0HA 1XB3A 5EC1B 2FEDD 4X9BA 4A39A 3QCTL 4AK1A 4D0BB 1RZ8B 2MH4A 1CDUA 2R4SH 3R1GL 4KAQH 2YSSB 4LCUB 3AY2A 4G42B 4I1NB 3D39B 5JIIA 4XVSL 2VDNL 3FCSA 1Q9LB 1UZGA 4PJ9B 3B1UA 2VRQA 4NQTA 3EDEA 3QYNA 1DQQB 1QHPA 2JH2A 4YE0A 2QPEB 3KWTA 4ZO6A 3MNDA 5T1KB 3GXFA 1DJWA 4ODTH 5E0QA 3B2PA 3LKRB 2BCMA 5F8QC 1IAIL 3UIZA 2A2QT 3NPSB 1GW6A 2PW2A 2JI1A 1QFHA 5IG7A 5EU6A 3BH8B 2QADC 4MVBC 2Q1EA 1HNGA 4XCYB 4JFSA 1B0RB 2BIPA 2RMNA 4K23L 3AG1B 4FQPA 4YHPB 2JJSC 2WXNA 1E4XI 3ISRA 3QRGL 3S6CA 3MKKA 4Z77B 4NNYA 3ISYA 3RWJA 1MSPA 3E9UA 5EO1B 3A21A 4D2NA 1I1YB 1XB6A 4Y2LA 5I24A 1R6VA 3QS2A 2AEQH 5JNYB 3P2TA 4K8RL 4J3OD 3MJ9H 2VERA 4H1LA 5FB8A 2FIKA 1TTFA 1NAKL 2B1AH 4NO0B 5J6SA 2ZIDA 4ZZFA 4GQ9H 4ONHB 1OTSC 4M1DL 5KSBF 5M94B 1LK3L 2E5EA 2DY2A 2KDYA 5D8JH 5ESQB 3VWJA 2HLAA 4LRIA 2ADJA 3QXAA 5DFVC 2OMVB 4GW1A 1EEZB 3T4AC 5T1DH 1AH1A 2DQJL 3OVUB 4J6RL 4K9EL 1YY9C 3EJSA 4H25A 2RH0A 5KG9A 4D8PA 1SNRA 1XIWC 2ODIA 3RFZB 3NEXA 2O6CA 2AEWA 4GEIA 3B9EA 3LS5H 3EG9A 4ZFGL 1W0WB 1V05A 3OMZA 2W80C 1XZ0B 4JO2L 4FJYA 5CJBA 4YFDB 5B39G 4HCGA 3FO2B 1KCUL 5JPNC 3NA9L 4NC0B 3VRIB 4UINH 5GGQH 3SPIA 4JRYE 2DBJA 3K0WA 3UGXA 3VAEA 5HDBE 4NFCA 4DN4L 5I1GH 4JFPA 4QJ5B 4YSDA 5C0DA 4ZMVA 3CFDB 3OL2A 3OHXB 1LP9A 1NFDE 2DIEA 4R7DB 4U1HB 4XWOC 2KL6A 1U8JB 4CVWA 4MMZB 1S5HA 4NZFA 4XPFL 3PAZA 3VNYA 4HWNA 4YSPA 1SY6H 3FUJA 5F1IB 2A99A 1NINA 1OAUL 4KMLB 2J20A 4ZUSB 3EBHA 1EAPA 1UOVA 1HDMA 2GJZA 2X2UA 4H8UA 2TAAA 1PLCA 1X5GA 4XO3A 4Y8AA 1WS7A 1JXJA 4KK5C 4MHHG 4U1IB 5D96B 1J87A 5T3ZD 5LNDA 5MEQB 1BYOA 3F64A 1T1XA 3ASWA 5AW2B 1JL8A 1F1DA 1VJSA 2V9UA 3I2CH 1G9NC 2OP4L 1LK2B 1P9MA 5E7BA 4XMLH 1MLCA 2AQPA 4HSCX 4ENED 1WAAF 3HZYA 4UNVA 2J73A 1T4KB 1D6VL 4L4VE 5BO0D 2IAAC 4I13B 2R15A 2WBJD 3GS7A 1C08A 4S1DC 2Q6WA 3WHXA 4KQ4L 4HC1H 5LWYH 1UJ3B 5ITBL 1NCTA 4HFWA 4DNLA 1QWHA 4FADA 4JCLA 4DQOH 2GI0A 4PGCA 1HJCA 1UZ8A 1EXGA 3MRRA 1I3UA 4XP4L 1MF2L 2L8AA 3G6AA 1BAFH 2BIMA 3QORA 4TQHA 2OL3H 1YUKB 3JTSB 1PZBA 4Y5YB 4J3XA 3E8VA 1GYWA 4ZI8A 3DPBB 1LEGB 5HYSA 1N3NB 1V3KA 1T04A 3KLHC 2CUHA 2CE6A 1JZJA 4ALAC 15C8H 3DDFA 4DKEH 2H7WA 2AV7A 1MPAH 1T21B 4U1JA 2H6OA 5IV2A 3AQDA 5ERWB 1N59B 2X2YA 1JF1B 4XCCL 4PJDA 1GYAA 3OD3A 4XE0A 1T1WA 1CQYA 1FHNA 1QUNB 2BDNH 2PCPA 1ZS2A 3QW9A 5IQ7H 3ELAT 5BZWB 2XG5A 1K8DB 2Z7UA 2AEPL 4NYLA 2ZX9A 2ATKB 1M7IA 4QR7A 3L3JA 4RGNE 4Y4KB 3T65B 5DJ8A 1J5IA 4Z7UE 1TO5A 3TZVA 5HVWA 3ZR6A 2O5ZL 1BM3L 4JRYB 3QI9D 4XODA 1HHKB 5HDBB 1IX2A 4FXKB 4YNYB 1KTDB 3BWUC 4JM2D 2NY6B 1GS8A 4WAFA 2WTOA 5D4HA 2YD0A 2FR4A 1NFDB 2IPTL 4O2FB 5DD1L 4ERSH 4HIJA 3LKQA 1EEYB 1RHHA 3AXIA 3U30B 4Q9QL 1WLHA 1AXIB 2QVFB 2E6QA 5E00B 3WEXB 5LLIC 1QACA 1S9XB 3BGAA 1TKWB 1CBVH 2AK4D 1WQVT 2BRQA 3IDIA 3ZL4H 3T9WA 1DJSA 1QZ1A 4FZ8H 4KGLA 1YC7A 4AH2A 2CDGA 2ZCLH 4ZX6A 2HYMA 5B1AB 3L4TA 4U31A 5FDYA 1UEYA 1SHMA 1QABA 2VMJA 1H8OA 4JFOB 3W57A 5J12B 3MV7A 4RZKA 1JGUH 2C4FU 1A66A 5DEZA 4NAJA 4ODSL 4BHUI 2RACA 4L4VB 2ZUYA 1T7WA 2YA0A 3N40F 5DR5L 5D2NC 1XH3B 4TVPE 3GBNH 1T6WA 3HG0A 5E6IA 3A6CL 4L3CB 3G08A 4R5VA 5LBVA 1X9LA 3DBXB 2D73A 3FXIC 3S4SB 3NFSH 2OMWB 3S36X 5C0CD 3VI3F 1VEMA 1R3LA 3MRDB 4O4YH 2J8UE 3RIFK 1UA3A 1J05A 5LDSA 2R69L 4L1TA 4PFEA 5E4AA 4Q6KA 1JPSL 3SJVD 4OZHF 1U8KB 3TV3H 4JVUA 5TE4L 4YFLF 5B1KA 5EIIA 3MRQB 4P5TD 5D7LD 4WV1C 1PMYA 1T22A 2W9EL 3S5LG 1MLBA 4TLUA 4ZNEE 1A7NH 4RGNB 1NGXB 2XKUA 2O1AA 3GFUA 3MBEB 3F7RA 4Z7UB 5DUBB 1P53A 1FL3B 5DVMA 2ZX5A 1K3IA 5GRVL 1OAKH 1WFTA 2EE3A 2YEZB 1SMAA 4QHMA 1JYXA 1MNNA 4NQVA 2E6JA 1X5AA 4XCEA 4AYDC 1AQDB 3DTDA 2HRGA 8PAZA 2OCJA 4DESA 2H0FA 4YHNA 4GXVL 5E6SB 1RUQH 5IT2L 4Y16B 1B90A 3GB7B 5KVGH 4JPVL 4YR6B 5GRJL 4W9KC 1PLGH 1SLUA 3SDXE 4TNEA 1HH9B 3WMQA 1NEZG 4BZ1A 4CRPA 1A25A 1UM6L 1UVQB 1A0QH 3H0TA 2R0KH 4JJHA 3GF8A 4RFEA 2ICEA 4B9YA 5G4OA 1XGRA 3GJEA 3DX2A 4Z76B 2OZ4H 1CYXA 1FUNA 4GYBA 4LSRH 3K6FA 3HUJA 2MNUA 4GP4B 2DYPB 4HD9A 2RFXA 5I5MA 2WLHA 2B59B 2ZF8A 2VR4A 1S7TA 2HFEB 4JLRB 4EN3C 5IWLA 3EYQC 5DS1A 4CSSA 5AW1B 1MRDH 3QP3A 4MNHB 4HJGA 4PW9A 3H3BC 2NLJB 3MGTB 4N90D 3W2DH 5C0RH 1L0YA 3SIKA 1S5IH 1NMCC 3EGXB 1U2YA 4IKJA 1OHQA 1A8ZA 1BQHB 2C9XA 3QQDA 4NOFA 3OKDA 1WWAX 5FO7B 1SFHA 2YO3A 4CADA 5DUML 1VGEH 4GRLC 1F00I 3GSVA 4L48A 5AAMC 4LKXB 4DVRH 4BUGA 2XUWA 2J8UB 4RFOL 1U58A 1IFRA 2VB5A 1ULVA 4KI5F 4C4KT 25C8H 3OXSB 4L1SA 1CDJA 5B22A 1JK9B 1T03H 4IRSB 4KQ0A 1O9ZA 3QJVB 4FQIL 4LVNC 5BQ7B 2HT2D 4NS0A 5L9DH 2HN7A 4NZTL 4X7DC 4FEMA 3G5XB 3ZZQA 4YHML 5TJWK 3SN6N 3HAEH 4P2CG 1IKFL 1WTGT 4J8RB 4NQCE 5F7FA 4BFNA 4K3EH 3K4DA 3MRKB 4JNXA 3DARA 2Q0ZX 1E6JL 1L7TH 1ZVSB 4KK9D 4AOFA 5JW4Q 3B2UD 5FKPB 2BNQA 1SVBA 1FFOB 5GGVY 2JCCE 2YUWA 4D3CH 2GSIB 1HZLA 2NY5H 4G7VL 4AQ8C 4H8QA 2YPLA 3FRPG 3O9WC 4HIXL 3QG7H 5I6PA 3I9IA 3TA3B 7FABH 3DTXA 4H0GA 3JVFC 1OB1A 2IG2H 3ZO0A 2I07B 5HVGB 5KVFL 4HK0B 1FVDB 1IM9D 5DEGB 3RVWC 2MPAH 3NQKA 4J3TA 3O6FB 1DLHA 4LSPL 3SDXB 4MLSA 4I1RA 3U46A 4IBSA 1NUNB 2CKBL 4HUNB 4X80L 3GUFA 2WCPA 5C86A 3MGOB 2ZP0T 4RGMC 3QPQD 4ZX3A 4XBPA 3WSQL 1LWRA 1ZGLP 1BV8A 3KPTA 1K85A 2BP8A 1NFAA 5KW9H 4B7LA 5KSUA 2OMTB 4KXBA 2DQHH 3GSWA 1MWAH 7CGTA 5JHLL 5HTSA 5LQBH 1N7MH 4HX1B 1ADQA 3L4UA 2WVSA 1HHHB 3QXVA 5DO2C 1S9KC 4OLYL 4YHLL 2X0VA 3CDZB 4FNTA 5FW8A 4YHIA 2WWKT 2IDQA 2V2WB 3UTTE 3WY1A 1SJEB 3IJYA 2R7EA 3NBNA 4HZLA 4HUVA 1CB4A 1D7DA 4NUJA 1AIFB 2VC2L 3DYPA 4NC1E 3ULVE 3MODL 4B41A 1NA8A 1A1NA 4QXGH 3G6DL 2OMZB 3GSUA 1UZ6F 2ITCA 1QPXA 5LO7A 1RZIA 4ZK8A 4MB3A 3MRNA 4WGVB 1AY1L 1U8IA 3ETSA 1A4BA 2XG4B 5ALBL 1WZMA 4OLXH 4URTB 3V0VB 2D2OA 4C56E 1K4CA 4L4JA 2V3DA 4XPHH 2DI9A 3ZHKA 4PRAA 1I4FA 4D9RD 2M1KA 2WKOA 1XF5A 3FB8B 1NCWH 1H9DA 3EJYC 4LSQH 4Y2DB 4MMXA 4U1LA 4NO0D 1TU2A 4HUMB 4LCWE 1A7QL 5IMLB 2JCCB 1KY6A 5SX5K 1JGLH 5E1IA 3S3JA 1J1OH 3LVTA 5INDB 1JZIA 4PGDA 3H9SE 4I77L 2OMBA 1DQTA 3KDPB 1T2JA 2W94A 3QJHB 4WK2B 3IJHA 1QSVA 4N9GA 1UKSA 2V17H 5FO2A 4OFIA 3NJHA 2VR5A 3OZ9L 1ZT4B 1SDDB 1DTUA 1TITA 3CU1A 3FK3A 5C09A 1EMTL 1UWXK 4NUGL 4LLUA 2BHUA 3L3GB 1Q0EA 3SSGA 4KC3B 5DYOB 3E0GA 1XGPB 3C5JA 1VZGA 5I1IL 3PV6B 1HIML 5JORB 3T0DA 4NM4L 1TZGL 2Y69B 4JN2A 3P4NA 4IDJL 2UZYA 2CCWA 4JHAH 3IDMA 2FJHA 3L3IA 3P0VH 1JYWA 5IB3A 5D1XD 3GKZA 4WGKA 3GSNB 3ILPA 1NBYA 3J8F7 4G6AD 4JY4A 4M6NH 3SPJA 1X7QA 2IDFA 4H88H 4E9SA 2YUVA 3EGSB 3UTTB 2OM5A 4YIQB 1OP4A 4M3JA 1X5KA 2WQWA 3A22A 1XBRA 3KPPB 3LIZA 5IEKA 1KUMA 3DSFL 2IVFC 2WLIA 4W9DC 2FNWA 3K7UA 4CJ0A 2OW7A 5KBLA 1LQBC 1FNHA 2ZAGA 2ED9A 1AHWC 1XSKA 1FFNB 2IXQA 5CILH 3BJLA 4ZS7L 4P23A 3FO1B 2NNAB 3GS4A 4FQCL 1XX9C 2B2XL 1Y7VA 2PW1B 4OZ4A 4OLUL 2EDYA 4XMUA 4JZOA 4FDWA 3S7GA 2JF1A 5EU6E 1CICA 3AQZA 3PWJB 1Y07A 4HS8H 1Y18A 2JKLA 4OKDA 4YSEA 4C56B 2BH0A 1Q0YL 1LEIB 4A7GF 3I3BA 4WTQA 4KJQD 4XBEH 1OV8A 1WZLA 4AGNA 1AG6A 2ZUQB 1D9KA 1F58L 4X8XA 4Q52A 3ARBB 4IBLT 3RA7H 4N24A 4UILH 4LCWB 3T0EC 4A66A 3PFUA 5HHVL 1FPTH 4MNGE 2ZOTA 3OR7A 5AQ0A 4P9HL 1ZPLA 1DBKH 3H9SB 4AQ1C 5EG6C 1UB6B 1UWYA 2H0PA 1IAII 4WUUD 4UWQB 5J6GA 1UM5L 1XCXA 2DWYA 3C2AH 3QUZB 4UT9A 4P8QA 1H9VA 3HG2A 1TQWA 5D1QE 3V4PA 3OSKA 5DF0A 1NC4B 1G6RL 1OE2A 4ZPTA 4BM7A 2AZUA 2OTWA 3CVHH 3P11L 3DIFB 2O5XH 4LASH 4BUHA 1JPFA 5JR1L 3ULUC 1EVTC 3LKSA 1MJ8L 5GGUA 3K6IA 1DQVA 3E6FA 5TF0A 1WYJA 1GGIL 4XNQB 2OA9A 2AQQA 2A9AA 3B9KB 1MUJB 4OGYL 3EH3B 1F56A 2JXMB 1BIIA 1M1SA 1AR2A 3V5HB 2YC1A 4JRYD 4WHYH 4DP7X 3A4EA 5JIDA 4H5SB 1VKXB 3VGHA 1X4XA 2CZNA 5GISL 1A14L 2NY6D 3QO1A 5F6HJ 4YXKH 1FA4A 3VFGH 1W8OA 2VJ8A 2WW8A 1HFUA 3VXRA 2V2XA 2YRZA 3Q8FA 3LKPB 4LKCB 1XDTT 4I48A 1R19A 5BV7B 4HKZA 4XNMB 1LP9E 1RZQA 1FIGL 2Z7WA 3NJFA 4L9LC 4HETA 1R3IH 2C26A 3CPLA 3HG1D 4MA1C 5IBUB 3VG0L 3D2UA 3RIKA 4AM0Q 2OX5A 5F0MB 3CFJA 3U82B 5H37H 1X4YA 1NJ9A 4A2LA 4YEEA 2CBMA 1TJGH 3EO1B 1RQ5A 1DUYB 1FWXA 3U6XA 4FFZH 4XNDA 4L4VD 3JWOC 4KUZH 5DD5L 4J39A 5FR3A 5JQHC 2AJSL 2O72A 1T5WA 1KCRL 2OXGA 2PPDA 5C0GB 2EC9T 1KBGL 4XPGL 3HC3L 5I1CL 1BG1A 4OIIH 4XHQA 3P9MA 4FI6A 4OGXH 2EXYD 2WNWA 4MNGB 1BFOA 4OZGE 1ECYA 3VSQA 1DANU 3JWDC 4F8PA 1S78C 2VXTL 4S1SH 5JMOC 4DZBB 1HSAB 1ZMYA 4R5XA 4DGVH 4H1LB 5L88L 3RU8L 1F8TH 2R51A 3T3ME 5EOTB 2FX8H 5D1QB 1TZHA 1R3JA 4GSDH 1FAIL 5EORH 3CDFA 1I7RA 2XXFA 1AQ8A 3VMOA 3H8NA 2HLAB 3VWJB 2BP0B 5CIPH 4YDIL 4NZRH 4K94L 5JXED 2ALAA 1JCVA 4UQAA 4RGND 4DVBB 5BS0D 1NFKA 3A0OA 1RZGB 4J3VA 1RZJL 2R2EA 1EJOH 5DS2A 1OGAE 2YA2A 1YEHL 4PJDE 5BZDA 1PD1A 5FYKH 1PBYA 3UACA 4D8PB 3QWNA 5KG9B 4MXVF 5FIEA 2H1XA 4AYEC 3PLYA 5CCJA 1ZJBA 1DQLL 4LARH 2NY1C 4G9DA 1INDH 3B1TA 3R0NA 2EDKA 3APCA 5JUEH 3EKCA 1WFMA 2EIZA 1J8RA 1OT4A 3IRZA 1MCDA 4XVJL 4Y16D 4EUPG 1MCWM 4RX4A 5C2BH 1EV2E 4J1UA 1KLUA 5E8DH 3QQXA 5HHME 5CJOH 3QIUD 1EXUA 1ORQA 1YEFH 2QT6A 4GBXA 3SE8H 5C0DB 5IQMA 3HHSA 1PEZA 5KSBA 1LP9B 5E9NA 3BUTA 1OAJA 1UM4L 3OGCA 4LSUL 1ERNA 1V55B 4NHCL 3TIDA 1MAKA 1AQMA 2VDOH 5K1VA 1EUUA 3VFWB 2CGRH 2Z4QA 5CU9A 3M17B 2JVUA 1L9QA 1RXLA 1EAPB 1JI1A 2VDLL 4NO2B 3SDDC 2XWJB 3FQRA 5FUCC 3HZMA 3MRBA 3VXSA 5DK0A 3TS8A 3C8KB 1UXSA 1JV5B 2UX6A 4XRCA 1E8XA 3QJFA 2MHAA 5EZLB 1NLDH 2HG0A 2A9DA 3ARXA 3TH4T 2ED8A 2NTSP 2UZXA 4DP6X 3QDJD 4UDUA 5HGDA 4K3DH 1VERA 1X6LA 3BEWA 3NYKA 4JE0A 3SDAD 1MLCB 4MAYA 4OZGB 4ANVA 3KR3L 1PSKH 4JRLA 2NDGA 3M86A 4EI6A 3STZB 1U8MA 3WHXB 4IRZH 3PAYA 4N1EA 1MHPH 1RFDL 3RE0A 2DQGH 1BXAA 3FUIA 1RCYA 3T3MB 1WT5A 3VGAB 5JXAH 4Y1TA 1UZ8B 2BOBB 4R4ND 4AENA 2Z31D 3G6AB 3II1A 3Q3GA 3QORB 3WNNA 4U33A 2NX5D 3HBPA 3QIBC 1P7QD 4LLVA 3EFDL 1TJIH 2J5LC 2J8HA 3MO1A 1NUGA 2L3BA 1T04B 4I85A 4LLWA 2FLMA 5SX4I 4HOXA 1Y0LB 5LN8A 5IV2B 5EZJB 1M2VA 3E2HB 1OGAB 1S7UA 4PJDB 1T1WB 2ZXQA 4KKNA 3N85L 5CUSH 4B53A 1FO0L 2CRYA 4JCMA 4PN6A 3ARDD 3X3FH 4LPWA 2VDKL 4ISVA 3TA3D 5MENA 3BIKA 4NYLB 4TTDD 3ZK0A 2UXGA 4MD4A 3L3JB 1WAAA 2BVOA 3Q1SL 5DJ8B 3WFCL 1NGZA 3TZVB 1J48A 2WTRA 2F5AL 3O6FD 3CNKA 3CN3A 4ZUVA 1QBBA 5HHMB 2QJDA 3A67H 4J4PC 3SO5A 4W93A 4H0HB 2V5TA 5C8JA 2FR4B 4LMQE 2EP6A 4HZ1A 5F97E 5F7LB 5DD6B 1XF4B 3SPVA 3TN0C 3K2IA 1B2WL 3DI2B 3AQYA 1DBBH 1FIEA 2WXKA 2W91A 2ZUTA 2HPTA 2HPOA 1TZOA 3S3SA 3SY0B 3VGEA 4BJLA 4EOWH 3DKHA 3DYOA 1XGTA 3L7EA 3NZHL 3IDIB 4JKPL 5F7MC 2DEXX 1I9JH 4JO1H 2E9WA 4RVBA 2DYRB 3GJFB 4AH2B 2CDGB 3CK0H 1ZLSH 2FJUB 1LL1A 3HKZA 4IHOA 4UIMA 4JQIL 35C8L 1CD9B 4FABL 1EH9A 3HUJE 4NPJA 4AXWB 1PCXA 4U7SA 1Z3RA 1D5MA 4L0YA 2ZT9C 3RJDA 1UHVA 1K2DA 1QNZL 3FSVA 1G7PA 4P3DA 3DX0A 3E8UH 1E5AA 4AGMA 3VRLF 1PGRB 5T3ZL 2ZXWB 3EYSL 2EXSA 3W11C 1MJUH 5D93B 3RNQA 4J8QA 4YSQA 1XGQA 4HWEH 4IOSA 2PUQT 3KEHA 1F4YL 5EBMA 4XOBA 4E9RA 4PVBA 5GZNA 5IHZA 2NY0D 4H2AA 1NKGA 4UAHA 5JQ6L 3CSBA 1OOWA 2R8SL 5HXMA 4UBDD 3W56A 1PKQA 1BF8A 2J43A 5C6PB 4XAWH 1R3LB 5AVVB 5DJ2A 1J05B 2X4PB 3PXHA 1MOEA 3BDYH 3CFMA 4E0RA 3THMH 3PG2A 1KEML 4UNIA 4H8HA 4JFHD 2TSAA 5SWZE 5HYQA 1T22B 3JV0A 3PFQA 1E0OB 2DLEA 2ADFH 3REVA 4CDGC 1CDCA 1UFUA 3MUGA 5TDOA 1SM3L 2BNQE 2N1TE 5KTEH 4AG4H 3DVNB 3CFEB 2WZPA 2R9HC 3N1GC 4UT6L 3HN8A 2CM6A 3BWAB 3O3EA 4NQXA 5KSVA 4OZIB 2C1OB 1PD0A 2HJKA 5FAAA 1F4WL 2NXYD 3MXWL 3L5XH 2PNDA 2DQDL 1U9KA 1OVZA 2DRUA 5DJXB 4YHNB 3II3A 5E4OA 1LILA 1YNKL 2FCBA 1OSEA 3NCBB 4GINA 4G5ZH 3MYJA 3VI3A 1G7HA 4JB9H 4B0MM 1XXDC 3DX3A 5AOJA 5CEXA 4PWIA 1T89A 1AMYA 3GHEH 4NSKA 3V4VL 3EJZD 1PX8A 1BEXA 5K59F 4JZNA 2APWA 2D03H 4QRUA 2YKLH 4OZHA 4JFFB 4HKBB 2Y06L 4RFEB 2ICEB 1WA1X 3GJEB 3L7FB 3MV8E 3UTTD 5DUPL 1I9RL 2E9BA 1R5VA 1OCWL 4F3FB 4NAQA 5B4MC 3B9DA 3HNTL 2EH8H 4K5PA 4QHLA 5L0QC 3ULVD 3AQXA 1HHJB 1S7TB 2WBKA 3GI9H 3ZTEA 3F7YA 3ARVA 2P5EA 3ET9F 1MVYA 4FL4B 3VFUB 5T3XL 4HJGB 2AV1A 3MA9H 1KIPB 4ZFOB 4NJ9L 1FI8C 1EO8L 2JKRM 1G1KA 2CIIA 4TSCH 1WSST 4QGTA 1D5XA 4C56D 1CK0L 2WIMA 4CADB 5HVHC 3CZFA 2N59A 3WEBA 3D52A 2HJFA 3ZL2A 1TJXA 2YARA 3ARBD 4NRZB 4JY5L 3IKKA 3ME0A 4ABWA 3MXVL 3B5TA 2OZ4A 4NFDA 4LCWD 3T04D 2VAAA 5B8CA 1UCBH 4MCNA 2I5YH 3H1ZA 2WB7A 4N68A 5EUOF 1NCGA 4M7KH 4MDIB 2VXQH 3H9SD 4HIEB 3KYNB 3KW7A 3F85A 3QUZD 3BEVB 3MROA 1PYWA 3GMQB 3LRMA 4NZUL 4AZ8A 4KKPA 1RH8A 4ONFH 1N19A 2BNQB 4GRWE 5D7HA 1N4XL 1HSBA 1NC4D 3F2LA 5KVEE 4OCWL 1U91A 4A55A 4MAZA 5CJXA 1J0YA 2C9AA 5F9DC 3CZJA 4OY9A 1MFMA 5FGBC 3DTXB 1OB1B 3WY3A 5JO5A 4MD0A 3B9KD 4JHWH 2ICWI 3CZKA 2CRZA 4DN3H 5BMFH 3C12A 2VDPL 3MRMB 2G75B 4JRFA 1XZWA 1JHKH 3L3DA 2QGDA 3RG1C 3UDWA 2ZUSA 3GGWB 5C09E 5IK3A 3TEUA 4ACTA 4L8SC 3WKML 3IKCB 2B1HH 4UOW0 2B9BA 2Z64C 3ARZA 3HAEA 3LD8B 2Y7NA 3IWVA 3ENEA 4WUKH 3EHBD 3MV8B 3HR6A 1TVBB 1RP8A 3OKMA 2LABA 1IQWH 4H8WH 1U3HB 3N9GH 4J3OG 3ZHDA 1KMGA 1WFNA 4DO5A 1A47A 2E4FA 3EYUL 1FL6A 4FFYL 2K70A 4YBLB 1BM7A 4R0LA 3EW3B 4PS3A 3FFOA 2E76C 5EBLB 3FSWA 4NN5C 5GZOA 2JSFA 4RZCA 1KC5L 3TVMD 3AAZA 3IJYB 5F7EH 2R7EB 4JG0L 4Z7IA 4HZLB 4HUVB 1DBMH 1IGYA 2BPBA 2VLRA 2EEDA 1MJ7H 1MZYA 2QV4A 3NJVA 1TJMA 2C9SA 4KU1A 5KN5A 32C2B 3MOBH 1LO2H 2ESVA 3WKPA 1I85A 4JGNA 4P5MB 2K7QA 2WXIA 4GG8A 1F6AA 3UO1L 2XYCA 2FJFA 3HZ3A 2DJUA 3KVPA 4J12A 1AE6H 4WZ9A 3QARA 5G55A 1MWAA 1RMFL 2Y5QA 5EU4A 1K4CB 3K80A 5EPMB 1I1AB 1NBQA 2XTJC 1I4FB 4KKLD 4X4ZA 4KXDA 3Q2NA 1F90L 2QSQA 1HCYA 1P4IH 2EYTA 2CU9A 4MMXB 1SZNA 4U1LB 1I31A 4XHJD 1W72L 1TU2B 5D1QD 4MYPA 4ZDHB 5F9OL 2Q7AA 4GRWB 2A9MH 3FTWA 1AZUA 2YPVL 5C0BE 2ZONA 4YDKL 1Z32X 4AV5A 2YMOA 4WFHD 4PGDB 4A1RA 4BKLA 3AROA 1XCTA 1CURA 4HGWB 1SF3A 1NANH 4KNQA 3OLIA 3O3DA 3IJHB 1JG9A 2WNGA 2D7NA 2QVIA 3ISWA 2GCYA 1RKRA 2YD2A 1ACZA 2YBRA 1SBSH 2CALA 3BCDA 1QMUA 4OCRH 1YYML 2VUKA 5AVSB 1H5BC 3JUYA 3Q44A 3VFTB 1U21A 3V0HA 5C09B 5I19L 5CLXA 1VDGA 2OK0L 2YK1H 5IQ9A 4ES9A 3PJLA 4M61B 4HFUL 5I9QB 5IIEA 1CD8A 1QP1A 5MEPA 2EUZA 3LKOA 4Q9RH 4Q56A 1FBIL 1I7UA 4MKMA 4ZTOH 1QI5A 5FFOA 5CCGE 3H2WA 4DP5X 3C5JB 4S1RH 5EZOL 4PJCF 5ICXA 2EXTA 4ZQTA 3VNZA 2V7HB 1T0OA 1OCZB 2I27N 4JN2B 4FC3E 1M53A 2PPEA 3P4NB 1NGWA 5E8PB 4OM0H 3IDMB 3L3IB 4PRIB 5L7XH 4K3GA 3D09A 1C5DA 2C7UB 3ILPB 2K8MA 1HH6A 4JY4B 3CHQA 4Y4FC 4GSXA 4KX8A 3VXRE 4E5XA 3I9GH 5IEKB 1OZTG 2MQGA 2WLIB 2FZ3B 2FQFA 3C87A 5E4EB 4B3VA 1AXSB 2IXQB 5A6LA 6FABH 1CCZA 3SGJC 4P23B 1CE1H 4BWWA 3TP4A 1C12B 1EFXB 4L2YA 1GGBL 4JZOB 1SUJA 4WW2B 1E65A 1CICB 4KK6C 1ODUA 2BNRD 1KTRL 1Z9PA 3HG3A 1VFBA 1GZHC 1QW9A 5FA3A 1Y18B 5IY5B 4M8VA 1PG7L 3ARYA 1HE8A 1NPJA 3UG5A 4Z3JA 5E9DA 1QRND 4A7UA 2XA8H 4I3SL 4AGQA 1WZKA 1TEFA 3GHPA 3WTUA 2CHWA 4NN7B 1FNGA 5SWZB 4AW7A 3CBRA 3AACA 3WI9A 5IGXH 1J8KA 1MFEL 5GS3A 5CFHA 1I8KB 4MJ5A 2WUCL 5C0BB 1U4EA 4P5SA 4PVLA 2Q2EB 1GTNA 3VTMA 3QFDA 1WUNT 4HIQA 3KVQA 4QRQA 4V2BA 3AZUA 5J6GB 1MQKL 3KS0H 3MRLA 1H8SA 2NUPA 3ATEA 3P4MA 4LLYB 4Q0XL 2AQ1A 8FABA 4Q6IC 1OGAD 5I1JL 4OSUH 2Q8AH 4NRXB 2UZIH 1JZHA 4L05A 1UQSA 1S3RA 3EYVA 3L9YA 4ORZC 4P4RB 4XZ4A 4ZD3H 1INQA 1FJ1A 2NQCA 3E6FB 5D2LA 3K8MA 5DD0H 4Z18A 2OMYB 4OUUB 1Z9OA 4APXA 4ZO8A 3NIDE 2E7CA 4RMVA 4OLWH 4A7GA 3GUTA 1H0DB 4TMPA 3WDIA 3GMOB 4XVUD 1Z0MA 1BXUA 2N7AA 3PP3H 3RVVD 2BOCA 4NKMA 4ZMYA 3JQOB 1OAXL 2CLVA 5B1JA 2AGJH 2WJ7A 2VLKE 2J25A 3C6EA 2DQUL 1V7NH 4H8VA 4RMTA 3VXRB 5L2KE 2YN5A 2DDQH 1KTCA 2V2XB 3D2TA 3KYOA 1DFBL 2DTSA 3LNGA 3B2VL 2YGQA 3NUKA 3QA3B 1KGCE 4HKZB 4XMXA 1F4XH 5KSBE 1CG9A 1K4DB 5KJ7E 2PO6A 1MRFH 1QFUL 3K6OA 3CPLB 4JFQA 1KEGH 1F18A 4KKRA 1LNUA 4NHUA 3ATAA 4B9JA 3SKMA 3D2UB 5GS1B 1F4AA 1HOCB 1JWSA 3MI6A 4JKWA 3MREB 1NJ9B 4HKJB 1NIAA 3RPIB 4HUXB 1R0AH 4PJ8D 3C6LB 3U48A 3UTZB 2FWUA 1ZHKA 4XBMA 2VDMH 3LB6D 4BZ2H 3BFQG 4QRRE 5KSAC 3VXSE 1N6QL 4N5EC 3RTQD 3TO2A 2VN5A 3X14B 2OXGB 2C8NA 3CHRA 4XP9L 1Q72L 1L4IA 5E9AA 1CVRA 5GRUH 4IBTA 3HHRB 4KH2A 1J0IA 1BEYL 2Z1KA 4HKXA 2R1YA 4YXHL 3VG9B 2J3SA 5IMMB 3G5YA 2JCWA 3QJSB 1JWUA 3UTSD 3JWNE 1MHHB 3W81A 4YGVB 1ZHLB 4IM8A 3OJ2C 2QGEA 3HS0B 3QIWA 2XN2A 3TBWA 4IOFC 1TZHB 5H37A 3FPYA 4L18A 3U4BH 4HJJL 4H2CA 5IBTL 3QHFL 1I7RB 4IIZA 3FO0H 1NL0H 3BQUA 4IGBA 5IR1B 1JRHI 3GMRA 5AKTA 4IBVA 3ZSTA 4BSJA 3F65A 3NIDB 2EEXA 2WKGA 1AGBB 5DDHA 3D69A 5BZDB 1HL8A 3GDCA 3D0VA 5F88A 4GW4A 1IJNA 4WWPA 3SEPA 2MNWA 2UXTA 1EEQA 4Y9EA 4AUJA 1GZPA 3AVEA 5IJVA 4UM9B 3MMEA 2HG5B 3GZOA 1WAAE 5KVDH 1FZJA 2Z7YA 3PDOB 4F8TA 1TJHH 2VLKB 1LO4H 4N0YL 3CDGB 1G0YR 5L2KB 4MX7B 2R1XA 1T7XA 1ORQB 4GBXB 4EBQH 1A7RH 4PQXA 4MQXD 1P1VA 2YRLA 1K8IB 1X7SA 5KSBB 5CIPA 4JFFD 3VD4A 3WJMA 1WITA 2A9BA 2XWDA 3VD9A 3MLRL 2HFGH 3TIDB 2HTKC 5A2AA 1VGKA 2IPKB 5M7QA 2X1OA 3ESMA 3SBRA 2YD1A 1W8NA 5E8OB 2E59A 1JZEA 1NCCH 2NY4C 3BPCB 1EGJL 3IU3A 1UB5B 4P06A 5FGRA 1SXZA 3SO3C 1OZUA 3V2AR 3GRWH 3FQRB 2YD5A 4F9LA 2WXMA 4QRRB 5DK0B 2E74C 1G9NH 4XRCB 4X6CF 2MHAB 1KZYA 2BK8A 2P5WA 1OK0A 5LAPA 2P8PB 1YN7A 1LO5A 4U3SA 5JW4N 4FJZA 2BZCA 2KBGA 4G6FB 3D4GA 4UDUB 1E9QA 2VXUH 2Z7ZA 2DKMA 3BEWB 1RUML 4A6YH 4MAYB 3WXWH 1A6WH 1HZHL 4EI6B 2QSCL 3MTXA 1OGTA 1G9ML 1TLMA 3D30A 3QZOA 3NA4A 3UG4A 4YC2C 3KPNA 1NEPA 2BJML 5T1LA 1MFAL 1QSEA 2X9YA 1L5GA 3P77B 3QQ9D 3P3SA 2VTFA 4PCKA 1GAFH 4NNPL 4PRPD 3MO1B 4Z0XA 4HQQL 1TYJA 5CJQH 3GMLB 3VD3A 1B4JH 4HIHB 4ICWA 1X5LA 4X5LA 1CTOA 3WHE1 1TTUA 4GKSA 1A4CA 1A7PH 1BD2A 1EAQA 1ZVHA 2DBLL 2FSDA 4U0RB 3AC0A 1M2VB 1ZVYA 2OQJB 4Y19A 3BRFA 4BYHA 5CCKL 2WN3A 3FJTA 3LS4L 3OJDB 2NZIA 3QZWB 1N68A 1XF2A 4AEEA 3B3IA 4ISVB 4X7SH 1NICA 3DOSA 4V1DD 3BIKB 5CZXC 4DGWC 2NPLX 4MD4B 1KZQA 5F9JA 2BVOB 4F9PA 6CGTA 4IRZA 3FRUA 1B0IA 2K3HA 4MWFA 1CLYH 1URLA 2WTRB 3RWFB 3UYRH 2WWMD 4G8AC 4KX9A 2XY1A 4ZUVB 3BKYL 2X53A 1TT6A 4DETA 1MRCH 1HWWA 1E4XH 4P3CH 4Z0BL 3F5WA 3NN8A 1QA9B 4K07A 3T6VA 3K5SA 1FG9C 1EA9C 1MFDL 2HWZL 4MA3B 2C1PA 4UB0L 3U2JA 1E27B 2V8MA 3SPVB 3MV8D 3VI3E 4CILA 1CIUA 1YHPA 2QKIC 4LB8A 4Z3FA 3L3OC 5A6IA 1QVOA 1U3HD 2FEDC 3NJMA 4Y9FA 2J5WA 3S35H 1RUKL 2HLFC 1ONQB 2HKHH 4R2GB 4G82A 3E1ZA 4OZHE 3Q7JA 4W4NA 1P1ZA 3R8QA 3ZTDC 4AYMC 1JIBA 4F33A 1A6VL 2G60H 4U1SB 5D9SA 4IHOB 1XHHA 1MJJA 3T2NL 2B3IA 3IDGB 4NBXB 3IFLH 1FL5B 3NP4A 2GIXA 3O4OB 3HG4A 3HPLB 2IWFA 2Z34A 3CZUB 5KS9F 1K2DB 4NKIL 3GT6A 4P3DB 4YHKL 3T4YB 2RAMA 2H1PH 3FAWA 4OFQA 3FQNB 1A4JA 3WKQA 4I0PA 3RTQA 3H3PH 1TVHB 3ABZA 1MFCH 4TVPL 5TE6H 4N8CH 3RNQB 4ENZA 3OZLA 2WQ8A 3CSPA 2JKJA 1Q0XH 5KVGE 5JOPD 1FVCB 2Q76B 2WVVA 3BPOC 5HI4D 5EBMB 3MNWA 5A2KH 5IHZB 1O7VA 5AZUA 4HHGA 3ZHLA 4F15C 5HDWA 4G2AA 1I1AD 3QB7C 1G1YA 2VGLM 3LZRA 2YPKA 3OAWA 4OLZH 4I18C 5E6IC 2H41A 3KLSA 4N85A 4X50A 4YUEH 3GQFA 3TPKA 2EDRA 2OMUB 2UUDH 2D9QB 4JK0D 1F1GA 1XWVA 3KM1A 3OKEA 5EU5A 1N0LB 2N0KA 1U8QA 3G6JF 3W37A 4MXWH 3GKWH 4HPOH 2X2JA 1KCSH 2R4RL 2ZOLA 4R6UA 1ZLWH 2D4FA 5I23A 4N86A 1IIIA 2YEQA 1TTBA 4XNBA 5PCYA 3FU9A 5BW7C 1XH1A 3FTGA 2UXFA 2VMFA 4AVKA 1VPOL 5FF6B 2QPFA 3KJ4B 2FD6L 3FB5B 2HRLA 1SMOA 4KH9A 2ZKYA 4BH7B 4CMMB 3MLXH 5KSVB 4ZMPA 1ZEAL 2V5RA 2HJKB 3WJLA 4FHKA 1GOFA 5I0YA 3PWPE 3U9PH 2F68X 3R19A 1WEJH 1WD9A 5IROD 3BHBA 4U3HA 4XX5A 4TNGA 4ZW5A 5FW6A 2G9KA 3MRIB 4JGUA 3VI3B 1G7HB 3VXUA 2FNBA 5CEXB 2XWCA 3SPCA 5EN2A 1UGNA 2CAKA 2N01B 4IMKC 3AS2A 5AVYB 3QUMA 3VFOB 4JZNB 4PRID 4JCWA 1X5XA 4N2NA 4OZHB 4PB9H 4QRUB 3E6HB 5C9KA 4PTTA 5JYLA 4WU7A 3KBFA 4OV6F 4ETYA 1EDHA 3EF7A 4RIRA 2DQFA 5HSFA 3MLZH 4TNFA 3VRJA 1KG0A 2CD0A 3SYCA 2J88H 4QHLB 5HDQH 3OAYK 3UJIL 1SJXA 3ZTCC 4U4BA 4UTAL 2Y6SC 4YAQA 3LQMA 1OM3L 1FC1A 2A7BA 3T6ZA 5CEZH 1JFQH 1L7IL 3F7YB 1VENA 3O45B 4ZOEA 3KPLA 2NQDA 5DZOA 3BVTA 1EFXD 1NIFA 4BK5A 4YDLB 1CXKA 3CVIL 4CDHA 3CZNA 1A1OA 5JTWA 2CIIB 5IWLC 5H8DA 2K78A 3FO9B 3BT0A 2ESVE 4QTHA 2KPNA 3C5ZB 3B7TA 4PJBF 3U25A 2BP3A 5F6IB 2EDXA 4KVCL 3VQMA 4GOSA 1M71A 5EV7A 5SWZD 3L3HA 4YH6A 3TNNA 1BJ1J 3MUJA 5B8CB 1D7CA 3QEGL 4LCCC 2NW3B 2WBJC 5MEOA 5C0BD 2ICWJ 1CIDA 3S37H 3L48A 5K69A 4G9FD 3PHOA 1MI5A 5D6CB 1ZDQA 5AOLA 5IJDC 1MN4A 3F7PC 4PU2A 4BK8A 4LL4A 5TE7L 2B0SL 1YEGH 1H6UA 4NO3B 1JZ6A 1GS6X 4A04A 2HT4C 1HSBB 1YEDA 4K71C 3SKUD 3AW5A 4PJIF 4XNZB 4R4FL 2R29H 1E30A 3CLEL 4KXZH 1GIGH 2YUZA 1V3JA 3OR6A 3PWPB 3OAYH 4PG9A 1JNHB 1JOIA 3ZIYA 4MD0B 4CBPA 1QFWL 1UZ6E 3AB0C 1H3UA 3O8XD 4KZ0A 2C3HA 2KZWA 2WGXA 1SEBA 4F8OA 1JNJA 4RMUA 4KFZC 2XWBA 2A3TA 4HF5L 5D1ZD 3L3DB 4NZJA 5B21A 3ZKXC 4KQ3H 3ESNA 2HT3D 5MP6L 1H3XA 2XQBL 2VXQA 4J2XA 2YR3A 4GUQA 4XVTH 3DX8A 1AC0A 4GJTB 5J13B 5EF3A 5EUOA 5L8KB 4K9JA 4HCRH 3QI9C 3RZCB 1KIUA 1MAJA 1YJDH 2UYLA 2MCPL 3RGVA 4NC2B 2D2CC 5KANG 1NEUA 4JM2C 4EQ3A 5JLZA 3QEHB 1FE8L 1YEIH 4LLQA 2VM3A 3FSAA 3NZUA 1DVTA 3GNML 1MEXH 1ZHNB 4GQQA 3GO1L 2OJZH 2EC8A 3GSNL 2X4TB 4UQ9A 5BCAA 9PCYA 1PZ3A 4YWGH 4XZUA 1GOHA 2VSDA 3BUYB 2EUVA 1LO3H 5FCSH 5HHPB 1OAZL 3AAZB 3EO0B 2EDEA 3PGCB 1IGYB 1DJZA 1I82A 1OSZB 2V3FA 3C6LD 3FKUS 3GBDA 5AB1A 2F53B 1JZ7A 3ULVL 2ICCA 3WUWG 4P2QE 5F3HA 3STLA 2HP4A 1PS3A 4KWUA 2X1QA 2CSPA 1C7SA 2EKSB 2ESVB 1HYSD 1X3DA 4ONGL 2FEEL 4AL8C 4QY8A 4F7MA 4CUCA 2MQ3A 2VMEA 5C0AD 4OF0A 1F6AB 3S88H 1P5UB 4PLJD 2FJFB 1E42A 3NFPA 1PEWA 3WY4A 5EEVA 4O9HH 1G9HA 2HKFH 1CXFA 4JDVB 4DP4X 4Q9CA 3QG6A 5E9DE 3PNWB 5CN3A 3NPZB 12E8L 2XZCL 3GD1C 4HXBL 4RMBA 3TPUA 5TGBB 1IQDB 5ABZA 1A7OL 4JDZA 3QEUB 2EYTB 1E4HA 2IAMA 1IEBB 3GBMH 1MHCB 2TSBA 5HP5A 4F24A 4AMKL 2LFGA 3TM6A 2V8LA 3DMMB 3CBJB 2J1WA 3GK8L 1CN4A 1GGCL 3TBBA 3BLPX 3CZSA 1AP2B 1BVNT 3O3DB 3RWEA 4XWGH 1YEKH 2FEJA 3QDMA 4P5TC 3MUHL 3IJ8A 1XGYH 5ITFA 3MJ8A 2J12B 3HR5B 4O02H 1GYVA 1KYAA 2JJVA 4D0CA 4EE2A 2XSKA 4WK0B 2E7LC 4AM0B 5D2LE 4UM9D 2XV6B 4RRPG 1NMBH 2AABL 3EOBA 4X9YA 4OBRA 1BQHG 5MEPB 2XV2A 4M4RB 2HX7A 3WENA 1ZGLA 1S3KL 3IJEB 3RWCA 1DEEA 2VLKD 1L9RA 1VZHA 5ICXB 1RULL 3MZTA 4Y9CA 5L2KD 2BS71 2WZ0A 4X7TB 4DP0X 5E51A 5FECB 1GXEA 1KGCD 2L4OA 2DQMA 1J10A 3Q8BA 4P9MH 4UOJA 4DGIL 1C5CH 1C5DB 4GS7B 5LJYH 2DTML 4TQIA 1QPPA 2KERA 4AIOA 4DPBX 3P9LB 2VLJA 2ZUUA 3NK3A 5BV7L 1J7VR 2NXZC 2CLZA 2QFRA 2W0KA 4NNXA 4RWYL 1GR7A 3A6OA 3FQ2A 4P2QB 2NOYA 2V6HA 3X1BA 2DLIA 1ZTXH 4QRRD 4UCFA 5K9QI 3VXQA 2VN6A 4ZXBA 3G5WA 5IVZB 2GVYA 3A4AA 1AO7D 4N20A 4ELKB 1INEL 2YWYA 3K0YA 4G6FD 5JW3H 4GMSL 4OQ1A 2IALA 1AQKH 1VFBB 1R4XA 1Y1DA 3T08A 3HE6D 2P9RA 4JPWH 2BY0A 3N55A 4PJCA 4Z8FL 1WIOA 4OCYL 5E9DB 3QC6X 2F74B 5DGQA 2W9DH 2XZQL 1FNGB 3IU4L 4P4KA 5CMAA 1T3FA 2K0RA 4QRPE 5CGYD 3L5IA 4MB4A 4MJ5B 4DGUA 4POYA 1UEMA 1O6SB 1QOKA 2Y4SA 2ZYIA 4YX2L 4Z7AA 1TTRA 5EDXA 3PF2A 4AE1A 4MXQC 1FV1A 4G8IA 3BCFA 4QRQB 3F62A 3DX9A 3ULUF 2NUPB 3O2DL 3P4MB 4Y8DC 2D7QA 2GJ6D 2YQBA 3T3PF 3IDUA 3MRPB 5E24E 3QQ4A 2CO7B 5DHEA 1CTMA 4PD4J 2MRYA 3MKGA 3VX0A 5BVPL 3JV4A 4G7YL 1BF5A 3AS0A 1T1YA 4FHBD 5D2LB 2WYZA 2AJYL 2XWEA 3MBXH 5DQ9B 1I1FA 1JP5A 2IV9A 4F57H 3GUTB 2QFPA 1RUPL 1PG7W 4NPYB 4P46A 3FTSA 2FBJH 3GC3A 4NKMB 1M7UA 3GEFA 3KG5A 4LEXH 1ODAA 1AZZC 4RFNC 2CR3A 2ZE0A 4XN9A 2G9HA 3RURA 1BDYA 3KPSA 5F7UA 3FS9A 4Y9BA 1MREH 3MLVH 4Y5VC 3W9DA 4WNJA 1HXYA 3GSRA 3WCYA 4L1BA 1FGNH 3KYOB 4NM8H 3QPQC 1UATA 4TULH 4X9IA 1HEHC 4R2GD 1SQ2N 2PXYB 5I6KA 4HJIA 1RUAL 2PO6B 4LP5A 2NSMA 2F54E 1LNUB 3PUCA 3RNKA 4BSWB 1KJVA 4JFXB 2MJWA 3ZDZE 1BFVL 2BRRL 3WLWD 3UBXA 5GIRA 2GBAA 2YQ3A 3ZZ1A 5FYKE 1DL7H 2QSVA 3KYAA 5C92A 3K72A 2IAND 1WWWX 2BSTB 4M00A 2FLBT 3B37A 4MXVE 4QCIA 4PV9B 2WLJA 5I8EA 5MERA 4GXFA 1WK0A 5J1SC 4P5KB 3V95A 3TO2B 3LN4B 1CU4L 2BY3A 4ORGA 4HA1A 4YL9A 1P84J 3W82A 1QLEB 4QRPB 3TF7C 2BS8A 2Q8BL 1KGJA 1T2QH 4X6BB 2IGFH 1ZS8A 3LCYA 3LRLA 3GXDA 4YJZL 4MDJB 2ERJB 1KXHA 3CLFL 4XNXL 3QWRD 2W07B 3LQAH 2CKNA 4IW4C 4LXFA 1X6NA 2NY3B 2VR9A 4N2FA 5GS2H 4HHAA 3D48R 4PRBA 3QIWB 3O2VH 3MN8A 3PGFL 3EOAB 1IC7L 4HJTA 4W68A 5TH2B 1FNEB 1DCLA 5AB9A 2J72A 1GC1L 3KGTA 1YYLH 3UG3A 1IEAA 1EHAA 1FZKA 2JJSA 5FYKU 3TT1H 4QXWA 2R23A 5LB1A 4IGBB 4R7VA 4BZ2A 1E8WA 3GMRB 3P54A 4UT6H 3S5ZA 4LHUA 1MFBH 4KJPD 2Q7NA 3ARQA 4G1EB 5GJTH 3D0VB 1CFBA 2WCSA 4Z7WF 1CFSB 1GZPB 4LVHC 4JN1H 3Q8AA 2PR9A 3MUZ1 3VD1A 4OF5A 2YD3A 3IMVA 2XRAH 3NSFA 4U6YB 2EIBA 3SY6A 4HULB 4BFFA 3ZL1A 1FZJB 3U4AA 1BAWA 1AHKA 1D6EB 3QCTH 4ODHL 1U41A 3R1GH 5DHXB 3BRDA 5J3HD 3Q1EA 5DI8A 4DPAX 4CU6A 3NJNA 4XMZA 1WBXB 2VDNH 3WJMB 2F54B 3PWNB 1XIWA 5FFGA 3ZDZB 4NQUA 5AYUL 4Y4HA 2VQ1B 3L3KA 1OAQL 5D1XC 4TNWK 1IAIH 1MCPL 5D4QA 3X12A 2VZ3A 4TSBL 1NC2B 1REIA 3I85A 5JPNA 1Z66A 5FM5O 2RQEA 2H3NB 5CZKA 2WGNB 4JO8A 2W88A 4JPQA 4K23H 4U3SB 1YN7B 1LO5B 3QEQB 1W80A 3QRGH 4I2XE 1UJTA 2QPDB 2MWCA 2GTWB 3FHAA 1JF5A 1THAA 4HS3A 3QZBA 3RUGF 3C5ZD 3W39A 4N2AA 1OGTB 2FGWL 4NQDA 2WCGA 4HK3N 1SRDA 4K8RH 5KYUA 1YMMA 5E6UB 4ODXA 1KGUA 1Z5HA 2FATH 4UM8B 4EIBA 4EO5A 1D5BA 5T1LB 1OKEA 4HJ0D 4KJQC 1NAKH 5DC0A 2C4XA 3GSQB 3RWDB 2Q3ZA 4Z0XB 1BVKA 3Q8EA 1UD8A 2WLLA 3SKOA 4OAWA 1FF5A 5GGVL 4PJEA 2KLTA 3VUAA 1KB9J 4L0ZA 2DQJH 3MRGA 4J6RH 4K9EH 4X6CA 1DVXA 2FBOJ 1EZLA 2HMID 1S7SA 3FQUB 3FT1A 2XN9A 3CUPB 2MSPA 3BESR 4A6YA 2HFFA 3B3IB 4Y9GA 1HHIB 5IW3A 3PWPD 1U4FA 5E56A 5J6HB 5F9JB 2DM4A 2H0JA 4S10A 3VRLE 3FRUB 5DVOA 2X4SA 1EBAA 2FX9L 2C3WA 5AVUB 4JO2H 4ES8A 4WHYG 4WSJA 5ICUA 1WIPA 3WFHA 1KCUH 2Y0SA 2X4QB 3NA9H 5HGBB 3TJEL 3NN8B 1PX4A 4ZUTA 4DT2A 3SE9L 3W0WA 2DWDB 4DN4H 2AMUA 3FUFA 5I2IA 3RZCD 1TQCC 4ZO9A 1QHOA 3DX6B 5IF0A 3VYOA 4BV1A 4FXKC 4NAMA 1Q1JL 3VXUE 1OCOB 2GSGA 4NLAA 4XPFH 1S2EA 1W6LA 3Q5YA 2CO2A 3JTTB 1QSZA 3DHPA 4UZUA 1OAUH 3WN5B 5IJCC 5D9SB 43CAA 2N7BA 4OVVA 2PCYA 1BG9A 2WWNA 2ZWYA 5F96L 1N0XL 3CBKB 3VWKD 2PYFA 4NO5B 5T5FA 2F53D 2FHCA 4I2XB 2FSEA 5AUMA 4N2KA 5FUOL 4BGLA 2XQYK 4NP4L 2EEBA 1MFNA 4KDVA 3CN1A 3IRPX 1KPVB 4PS7A 3KWWA 4ZFOL 1B3IA 3LOWA 4XI5D 4OJEH 2AKRA 1QO3B 2YS4A 3E3QC 1D6VH 1LDSA 1KLGA 2ENQA 4U6HA 5F9AC 2FB4L 2WVVB 4KRPD 4KQ4H 2ZNWA 5A6MA 2OSYA 3MAWA 2GKIA 2BSRA 5TDPB 5ITBH 4XAKD 3DNKA 3A4FA 3V52H 2VN4A 1L9NA 3IVKB 2AVGA 4XP4H 1DN0A 1MF2H 2JJTC 5CCHE 1QLFA 5K59E 4F7EA 3IXAB 2EXYC 3IGLA 4MNQA 4PI0A 1E7VA 4JG5A 4EZKA 1P7BA 4JFYA 3DMMD 4XCCH 2IBZY 2ZOLB 3GIVB 5D2NA 2AXFA 1Q94B 2P7TA 3VE0A 5KS9A 3KDMB 2H2SD 4JZJC 1GA2A 4B3EA 3I02B 4U3CA 2AEPH 3FTGB 1C1EH 4KKCD 1ZE3C 4TRPL 1YYCA 4QIRA 4WFGE 5JXEC 5D7IE 1HEJC 5B1BB 5HHNB 5D7JD 1T7VA 3JZYA 3UXFA 2O6PA 3MRHA 2O5ZH 2Z35B 1BM3H 3ATFA 3OLGA 2KC0A 5CWSA 4K3HA 3GI8L 2WY3B 3O6ML 1HE7A 2ZAIA 5I8KL 3CFTA 4CKQA 2IQAB 3BHBB 1U92B 3PUUA 1EWHA 2IPTH 4HEPG 5EO9B 1XGUA 1QYGL 3VXUB 5EEXA 4QMEA 2X3BA 4WV1A 5ANMA 2A6IA 4FYTA 5HI5C 4M43H 3TWCL 1KV3A 3ZKMD 4UTBL 3US0A 3QUMB 3GM8A 3DURA 4DP1X 3ZUCA 5EF1A 4Q9QH 3G6JA 5EUOE 2YOCA 1U6AH 4PTTB 4KJWC 4WU7B 3QIUC 1T89C 4J27A 5GRVK 4PSRA 2EEAA 4C47A 4CC0A 3H4FA 4PWGA 4UYPA 4P2QD 1QASA 5SX4H 2FL5A 1UA6H 1QFWI 4LLMB 5ADPL 3LZPA 4YDVA 3OPZH 4ODBD 4ODSH 2SEBA 2NYKA 4FNPA 2HTLC 1BZ7A 2E27L 1DE4B 2CJSA 3FU0A 4DP9X 2IF7A 2ZYHA 3LQZA 1BMWA 3A6CH 4QTHB 3ZDYF 4CU7A 5INCB 4QEGA 4FF9A 1HINH 3UX9B 3SDAC 5LBSA 5FYLE 4AK2A 1M71B 4X9GA 4Q4EA 3HI5L 2K9UA 4K3JL 5JOEA 1VESA 1JNLL 2LGNA 1WGVA 5A1AA 4G5AA 3F8UB 3ROOA 2R69H 3NSYA 1AYOA 4DP8X 1IV8A 2JE8A 1JPSH 4Y2NA 1XL4A 3L81A 4M3HA 3D50A 4HEME 2COQA 1OSPL 2R56L 4AIZA 2AF2A 5TE4H 3GS0A 3NMEA 4PB0L 3RHWF 5KYWB 2OSLB 1DBJL 2ZPKL 4R4NC 2Z31C 3T0BA 1NDMA 2W9EH 2ZWKA 1HQ4B 5KVEL 3AG4B 3BH4A 3HE7A 2XPGA 1HJBC 1TFPA 5D7IB 1T7YA 3C8DA 2EIKB 4HLZG 3T6QC 3EZJB 4GRLA 1DZ0A 3C60B 5AAMA 5IOKA 2VSMB 3TGXA 3DGCR 3DUUA 5T1MA 3OR6B 2VUOA 3BUDA 4PG9B 3STBA 5JIPA 2IH3B 3QDME 3BGMB 4IRJD 2XHNA 3ARDC 4PJBA 1VRSA 4JBSA 2DQCL 2XWBB 2JV6A 2M83A 4GXVH 1NAMH 3E80A 4FLRA 1CQKA 3M1CA 5IT2H 4JPVH 1OAYL 3EJQA 4N1HB 3GLZA 3OKNA 4W81A 5GRJH 4RESB 3VB9A 3G5VB 5EUOB 3LAFA 1BREA 4PJ7E 2G5RA 3RGVB 1UM6H 2BIIA 3SKJL 2L0DA 3UDWC 1SF5A 3BKML 5FWQA 3MJ7A 4KI5C 5HGHA 4I88A 1A6ZB 3O9WA 2KS0A 1CUOA 2IDCA 4ZOAA 2PXYD 3QDAA 4OF6A 3K71A 1KENL 4PJIA 4XZUB 4HAKA 4G3YL 4AQAA 5ACZB 2EYSA 1J8HD 1O6TA 4KROC 2ZSVA 3T2QA 2E4TA 3U2SA 1JDAA 2NY5C 1J12A 1UH3A 2BSSA 4NWUL 4XTRD 1AG0A 4R0LC 1FDLL 3H7LA 2CG9X 1VACB 2OJEB 4B9PA 2YFNA 5F3HB 5FHAL 3STLB 3TFKD 3BPNB 1GSKA 5DEFA 5ABDE 4PJ5A 1A3RL 2W38A 1IL1A 3A47A 1R33A 1G84A 4F7MB 3R06A 4HCRA 3RDTD 2OS7A 5DUMH 4HOZA 3HC2A 4YPGA 1JXKA 3ARGA 2JKWA 4JO3L 1SN0A 4QRPD 1BQ5A 1KXQA 1MIEL 3IF1B 1RK7A 4RFOH 2QHRL 1VCBC 2OI9C 3IXTB 4PMEA 3S34H 4ZW6A 3QG6B 2VITB 3ZPDA 4CSZA 2PF6A 3P1VA 5EEUA 4FQIH 43C9B 3TPUB 3VMPA 4JDZB 4NZTH 3QNXA 2NY0C 3ZUNC 1BQLL 2IAMB 3OAZK 4YHMH 4LDEB 2GY5A 1IKFH 1XQ4A 5JA9A 1BZDA 1MCQA 4ZTPL 2VDRB 3WO3B 1DVQA 5J1AA 1I3RA 3TT3L 3W38A 4M6OL 1B0GB 4GP8B 1UTDA 1J9RA 3SPGA 3MHZA 2DEWX 1JSYA 4G7VH 3B6SA 3CFKA 2W65A 2NR6D 4YOKA 3VFSB 1G6VK 3RWEB 1CFTA 2NCEA 4HIXH 3QDMB 4KRLB 5ES4B 1Y6MR 3MJ8B 3F01A 3RBSA 4D0CB 2YJQA 2DLFL 2GITB 5GSRA 4HHWA 5FYJE 2LW3A 5KVFH 5ISZD 1OT1A 3M07A 4AT6A 4LSPH 4PV8B 3UAFA 3GIZL 3UAJD 4L4TA 3AREB 2CKBH 1FG2A 4X80H 4PJ7B 3I6KA 1DEEB 2UWEF 4F37K 1Y6KR 3DUHA 3IPFA 1DUZA 2NXYC 1MCOL 4U1NA 2BOLA 2MCMA 5EBWA 1GRWA 1R24B 5E1GA 2N1KA 4G6KL 4XNUL 5JHLH 3RL2A 5DMKB 5I1DA 1F3RB 3ZRFC 2OMNA 2F54D 3RX8A 2A6KB 4G8EA 4XXDA 3EJZC 5HJGA 4YHLH 1XCQB 1RJZA 3N04A 3CC1A 2OJ1A 1THCA 1LXMA 3FFCA 3QE5A 4KXAA 1E4KA 4O02A 4E2OA 2X4UB 3DJ9A 4NNXB 3OAZH 1ET8A 2UVEA 5HHOA 5C07D 2PR4L 1NC2D 3CN0A 2I25N 3MCYA 1ICTA 2B20A 2VC2H 4EDWL 3I6GA 4JEGB 3DJZA 4ZXBB 2CGYA 3MODH 3G6DH 3WGVB 2E7BA 3D85B 3QEQD 3C09B 3L9RA 4DTGL 2Z8RA 5C0FA 4I8DA 1BJ1H 2CJTA 2IALB 1N5YL 3J07A 2OXHB 4FMVA 4LOVA 4KK8D 1HEZA 5ALBH 5LN4A 4EUPH 1N18A 3HG5A 2QPSA 1KF9B 1JZGA 3OMIB 4HIIA 4TQEH 5B3JF 4F91B 2ZYRA 1MDAA 3PIQB 1OTUD 4JM0A 4P4KB 2CDFA 4NFBA 1TXKA 5FA4B 1AHWA 4ZAKB 4GXUM 4X98A 1OQXA 1A7QH 1RIHH 4FQ1L 4TXVB 1NTDA 3PL6A 4PJXE 3L95A 1ZA3A 1FV1B 4P5RA 4AV0A 2K1MA 5D55A 2D3NA 5D7KD 2OAAA 1ZV9A 4I77H 5K9OA 4YDZA 5ESVB 2K6WA 1IE4A 1AACA 4MZ3A 3VFRB 4NP9A 5B39A 3QUZC 2G3NA 2XPYA 1TPXC 3T09A 3KAAA 4LEOB 4XP5L 5BOJA 5CFAA 4JFTA 3T0EA 4FQLL 4JAMA 5DHYA 3OKLA 3UBHA 1KB3A 3UTPD 4K8RD 4BQ6A 2AEQL 2L7UA 4IYKA 3KPMB 4P46B 1KNOB 1LYQA 3G04A 5K93A 1ADWA 1CDGA 2K45A 4YQXL 1YAZA 5I1IH 1HIMH 3HN3A 4NM4H 2G9HB 1DVFD 1TZGH 2G2RB 4FG6C 2PP8A 2VZUA 2BC4B 4MB5A 4PTUA 4M7ZC 3BSZL 3LHPL 2WVTA 3VU2A 4FNUA 1ROWA 1HI6B 3GSRB 2FWSA 3TO4D 2E8ZA 1H3GA 3AM8A 3L2NA 5CLZA 4NIYE 2DKUA 1KFAL 2ZX8A 1XFPA 3RIAK 5B1JC 4XXCA 3EHBC 3LV3A 5T1DL 2RHEA 3UEZA 2EDFA 5EEWA 2MKWA 2LAAA 4B7IA 1GYCA 2X89A 4KKAD 3RNKB 4E41E 1GJWA 1KJVB 3FPXA 4UQIM 5GS0L 2DD8L 2FDBP 1NDTA 3UBXB 5H35A 5LXGH 4BDVA 2XC8A 4FQCH 2Q5BA 2ATPB 2B2XH 2EADA 1XSOA 4R96A 1BHGA 2GAZA 4KRMB 3TVMC 4LFHD 3DGDA 2D0FA 1NCNA 1SJVA 4QCIB 3L17A 4KXCA 2BWQA 5I8EB 5MERB 3VM7A 4C8XA 2GHZA 1WD8A 1QBMH 4UINL 1Q0YH 5E5RB 2IQ9H 2BXZA 4ORGB 5FK9B 1J1XL 4L9LA 1F58H 4C83A 1FYTA 1KIRA 1ZS8B 2M8XA 3RL1A 4GEJA 1JGIA 4JL1A 5HHVH 3M46A 4FNSA 5IZ7A 4PJXB 4B0MB 4AQEA 4P9HH 1AGFA 1MCJA 2YMTA 1YMME 4PRNA 4Z3IA 3R4RA 4J5VA 3V8CA 2EIJB 2QADB 5DLML 1UM5H 2WXFA 2Y1ZA 3QDGA 2QLYA 4KKLC 5FUZH 3VU1A 5IVOA 5G5DA 3SOBL 3ABKB 3MV9E 3EUUA 2R23B 3J27A 2VDMB 4QXVA 3VSTA 3RIAF 1G6RH 3RB5A 4FXTA 3RVTC 3BD5A 3P11H 3PE9A 1NMAL 3RI5F 5JR1H 4PJEE 1MJ8H 3BQUC 3I2CL 4L5FL 5F72S 1KELL 2Z8WC 4X6CE 1GGIH 3OB0H 4FTVA 5DO8A 4XMLL 4OGYH 4QRAA 1R3HA 1U33A 2YIHA 2XN9E 4E9XA 4EKJA 4WJG3 5E8NA 4F1ZA 4QLWA 1ES0B 1XGZA 1AGEB 1RZKL 5GISH 1A14H 4RISL 3HLAA 4PD4K 4PJFF 1N2RB 5E99L 5JIQA 4PLOB 3DXAA 2A6JA 4L3EB 1KN4L 3T4AB 3OBAA 3T71A 5SWSA 4C55A 5ACMA 2EUXA 1QTPA 3W0WE 1YN6B 1FCCA 4JPKH 2A1WL 2VW6A 4DKEL 2WOYA 1KLFA 2ZXCA 1U8LA 4UT6A 4B60A 1FIGH 4E41B 1JN6B 1M05B 3CMOL 2CH8A 3L3KB 1S9YB 5F7YC 2E75C 3VG0H 2X7LB 3RX7A 2M2DA 1AS8A 1IAMA 1IU1A 3D33A 5JW5A 3X12B 1SHSA 3QJQB 4D94A 4OFYA 3SCMD 5DURB 2MQ0A 3PRZA 2FTAA 4Z7WA 3HHMA 4HUKB 2AI0L 2E9GA 5F70A 3WTWA 2VRAA 1ZLDA 4X6DE 3FF7A 3H42L 5DD5H 3KZ8A 1GGUA 3TEXA 2AJSH 4F9LC 4I5BA 1KCRH 3KYKL 4LMQI 3HC3H 5I1CH 4FJ6A 1R5WA 3UBFA 1KJ2A 2ENYA 3W39B 3OV6A 1U8HB 1SJHB 3WO4C 1WTLA 4LF3A 1XEUA 2VXTH 3QFJD 5KYUB 1SN5A 1YMMB 2ZWZA 4ODXB 1G87A 4DP2X 3OC5A 3SDDA 5I75C 3ARFA 2UX7A 4LQ1A 3TTYA 5L88H 3RU8H 4BZYA 4ZTEA 1IGFL 3ZL4L 1BQRA 1J11A 2YGPA 3IT8D 3LSOA 3MV9B 4FZ8L 1FAIH 4A38A 5B1CA 1ZY9A 1J9TA 3QCUL 3P2BA 1WVZA 2HB0A 3BC9A 1P84K 4OAWB 2ADGA 4MNQE 4YDIH 2F8VA 4PJEB 3SBQA 5DMIL 3V0WL 2CPUA 2X09A 3HCVA 3OHMB 5IQLA 4ZX4A 5JHDA 1OHZA 2H45A 1RZJH 4OF7A 1YEHH 4A6YB 1TZ8A 2XN9B 5D2NE 1BF2A 3C60D 4IKIA 2HFFB 4WJ5B 4XBGA 3D18A 3ILQD 4RBPK 4AKQA 3I6LD 2ILLA 2C3VB 2F7RA 1DQLH 3ZIMA 1AZBA 3RUGA 1YZZA 1BBDL 3QUYB 1NEZA 4PRHA 3QIBA 4WJKB 3WFHB 1K5WA 1F5WA 2X5PA 4XVJH 1YPZE 5I1EL 2F9BT 3UFIA 4F9PC 4IK7A 4E36A 1DQKA 3CLWA 2YJLA 3W0WB 5I2IB 3GLEA 4JHUA 5AVXB 1NGQL 5IF0B 3MACH 1UM4H 5CP3A 4LSUH 1HNFA 2FRGP 2HJLB 3IGUA 4NHCH 1ZT7A 3OXRA 1KJMA 3X11B 2X10A 2VE6A 1PIFA 3DYMA 4M62L 2R59A 1ZV5A 1RAMA 1YUHA 1E8YA 1S9WA 2X2IA 3CCHA 5IFJA 1KGWA 2VDLH 1HS6A 4F80A 4R90L 2BFGA 3OF6D 4GNKB 3L2LA 3C6SA 3QPXL 1XH0A 4J4PA 4X6DB 5HJBA 2PYFB 3KLAA 5DWUL 4LHJB 4CSPA 2YZ8A 3B7SA 5CJ8A 5EF0A 3VXMD 1UGKA 5GQBA 2FSEB 1DQIA 1TFHA 3G5ZA 1U93A 3N40P 4LHUG 5EEZA 3HMWL 5AENA 4OGQC 4Z3HA 3TN0A 1P4BL 2GK0A 4RGOL 5GGTL 2GBUA 2HLEB 4PJ8C 3KR3H 5H94A 2AKRB 2B14A 3SQOH 8CGTA 4QOKA 5CSGA 2EYRA 4P2RD 4WWKD 3NDYE 4RBPH 1I8AA 1KLGB 1PLGL 2X70A 2WV3A 2G4EA 1P7KB 2Z0BA 1DEDA 1CJYA 1IGCL 1A8JH 1A64A 2QBWA 4I0PC 1RFDH 3FQ1A 3RTQC 3NSDA 2A9NL 5FLVA 3TYFB 4RMSA 4WW1A 5MI0C 4J3OF 4ODUB 1MCFA 2R0KL 5CZVL 1U8CB 2XFGB 5CR8A 4NWTL 1DN0B 1QLFB 4J3OH 2P24B 4IHBA 1ZIBA 5D7EA 2OZ4L 4H8PA 3EFDH 3WV0A 4MNQB 4MJ2A 4GSQA 1R5IA 3FRPA 4JDEA 2VR6A 1OIOA 4UZSA 4S0TD 5DRXA 4NN5B 2QQNL 5FCUL 1F42A 1WHOA 3INUL 3S96A 4AY0A 5J0BA 5D2NB 1SYSA 2EACA 5CEZE 3N85H 2NUTA 1FO0H 5LGHL 1CGVA 2IFFL 2VDKH 5FLUA 3BN3B 4YSUA 1Z3GH 4HVBA 3WFCH 3ECUA 3IEAA 4MZRA 1T80A 1KJ3L 2F5AH 4DQAA 1YPZB 2CMRH 2LVCA 2B08A 2WQXA 3MRHB 4JDTL 4MD5B 1F13A 3CXHK 3BKJL 1FN4B 2GYSA 3ARED 3EJPA 1IAKA 5E5LA 1KB9K 2QDVA 3OX8A 1EZVY 3D07A 4WO4D 25C8L 4J23A 3FC8A 2MPVA 1T03L 3WJLC 4WV1B 3TIEA 2EUWA 3PPSA 4WGWB 1B2WH 2XACC 3IPEA 5T5NG 3DURB 3SDCA 1DJHA 3NVQA 4K3EL 1FYHB 4YZFE 2F2HA 4Z7QF 1KB5A 2XWZA 4QLRA 3NZHH 4XMVA 4JKPH 4MQXC 2WLKA 1U42A 3RPKA 1IUZA 1PPIA 2I60L 3FFDB 2AXGA 35C8H 1JZ4A 1H6EA 3IMTA 5I1LA 2CR0A 4FLQA 1GW0A 4L3FA 2OCCB 3KPRE 3EXLA 4ZODA 1IE5A 4W9IC 1TQVA 4PJIE 4P49A 3QXWA 2X44D 1ETZA 1QNZH 4YDVB 4BK4A 2WC7A 3D85D 5BRQA 3ZMRA 1JPGB 2MPAL 5T3ZH 3SGDI 3MC0A 1BZ7B 3EYSH 4HW6A 4IDLA 1H15A 1CGTA 5HJ3A 1J86A 3DO7A 3OQ3B 2JELL 4WI4A 3NH7L 1F4YH 4PJ5E 1PAMA 1Z5LA 3HJ0A 3EJTA 5DZLA 2WB1A 5JQ6H 2R8SH 3DGGB 3FCTB 2V9QA 3BVNA 5KYNA 3PCYA 1ID5I 3CN4A 1KXQE 2RJMA 4I3GA 3ROOB 3UTQB 1W15A 4ZAKD 3RTLA 3UGUA 4EN3B 3CH8A 2I32A 2GUYA 3PJSA 1B4LA 1BXXA 1KEMH 4AIZB 2IFGA 4M8UA 4ELDA 1IB5A 1IM3A 1NMCB 1VADA 1XCWA 2XVGA 1P6FA 4ZO7A 5KJRL 2NW2B 1IFHL 4GAGL 3BPLC 3CFBA 2XPGB 3LEYL 1EIBA 3K5RA 4X8JA 1SM3H 2FQGA 4E9YA 2J56A 2YLKA 1AKJB 3WJJC 2QELA 4PJAE 4UI2A 4OI7A 1L6PA 2E56A 3AABA 1IC5H 4ELMA 2H8PA 2G2PA 2XKNB 2IDUA 1F4WH 4E9QA 3IE4A 2R0LL 3MXWH 1XF1A 4LVNB 4G59C 4R7LA 4FQXD 2DQDH 1YEWA 1YNKH 2EXWC 2YXFA 1CXHA 5AW9B 1A1MB 4M1GL 2R69A 4XPHL 4JM2F 1MIML 4EDXA 4UQ2B 5BRZA 1I75A 2WWMC 3A24A 4L4TE 1N5AA 3TXAA 1TZIA 1CZ8L 1YNLL 4W6XB 2XXMB 5HGHB 4Z3GA 3MJ7B 4R97C 2BSEA 2Y06H 3ILEA 2XX0A 5IUCA 4XVOA 4K4KA 1B88A 1ZCRA 5DUPH 1BLNA 1I9RH 4ZSOA 3RWHA 1OCWH 4WI7A 3HNTH 3KPRB 1BVZA 4PWKA 1CDYA 1Q8MA 5LKNA 1TCRA 3LDBC 4PJIB 5I26A 4AQAB 4GUPA 2BVQB 3NP3A 2EYSB 1NIDA 2WHVA 2NTFA 3AS1A 3FUDA 4ODWA 2BO0A 4OV5A 2BSSB 3GRGA 5SV4A 2VOTA 5T3XH 2OR9H 1SVCP 1M1XB 1X9RA 4L8SA 2X9XA 2A4EA 5HHOE 1NAMA 4BD4A 4NJ9H 4RGMB 4KZCA 1EO8H 1HESA 2FQEA 3LX9A 5L4IA 3EDKA 4PJ5B 1CK0H 3R06B 2OTUA 3E9TA 4Y1AA 2DL9A 5B3NA 2Y7MA 4UDTB 3UC2A 3IMWA 5EA0L 5FM4A 2XZAL 3GPSA 4YPGB 1R3KA 3SKNB 1SGKA 2Z3FA 4XO5A 2JQMA 3IM1A 3P0VL 3HFMH 3MRJA 3MXVH 4GAJL 5F89A 5I6XC 1OXYA 2E9IA 1MVFA 4M6NL 3WL9B 5HI4C 2D7TL 3Q6GH 4H8WC 2PPFA 4LCIH 4GI9A 4XP1L 2O6FA 1FZOA 4GW5B 3WFBL 1E28A 1I3RB 3KLLA 1ZT1A 3QULA 4NZUH 4GI8A 3LMJL 2YD4A 4JRXD 5CILL 5F44A 2VL5B 3V6OA 3U0TB 4UV4H 1H3PL 3MRFB 2N56A 3IDJB 4OCWH 4PJAB 1Q9OB 3B6SB 1HCZA 1JVKA 2W65B 4X5QA 5EHFA 4PG2C 1WH0A 4G83A 3ECVA 4U6XA 1AD9A 3I74A 5GSRB 3JBG7 2L7EA 2VDPH 3FUEA 2NYYC 4AT6B 1ZXQA 1FRGH 3ROLA 3Q2LA 4L4TB 3T0EE 1R1CA 3DIVA 3RKDD 1KSRA 4W9GC 1WFOA 3LZNA 3RA7L 4POUB 3I6KB 3WKMH 4CVXB 3QSKB 4U1NB 4A7SA 5GPRA 5EBWB 4B96A 3DV6B 4L3ED 5IROC 4K73A 3BZEA 3PAUA 4F7PA 1HX0A