1EGJH

Domain 4 of the beta common chain in complex with an antibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGPELVKPGTSVKMSCKASGYTFTDYYMKWVKHSHGKSLEWIGDINPSNGGTLYNQKFKGKATLTVDKSSSTASMQLSRLTSEDSAVYYCSRGDGIHGGFAYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CYTOKINE RECEPTOR COMMON BETA CHAIN PRECURSOR
publication title Structure of the activation domain of the GM-CSF/IL-3/IL-5 receptor common beta-chain bound to an antagonist.
pubmed rcsb
source organism Homo sapiens
total genus 40
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2000-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1egjH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1egjH02
1ORSB 1BP3B 3ZTJH 4KY1L 1OAKL 4LOUC 5EC2B 1QRNA 1QVOA 4Y19D 4K3GA 5BRZB 3MV9E 2UY6A 5B39B 5CEZD 3MGTA 1T1YB 3TZVC 4RWHA 4APQA 4X6CA 1YNKL 2CXKA 1E27A 1N5AB 3QDMB 2GITB 3FT3B 4OT1L 3VI4E 2I27N 5HVWA 4WGVB 3EJJX 2AABL 5IJVB 3MOAH 2M8XA 2X89A 1LK3H 4L29B 5I8CB 2X40A 3O2WH 3PABA 2NQCA 1ZT1A 1U41A 3GIZH 3FQXB 3KPMA 4MDIA 2P4AB 3O6FD 3CXHK 2CUIA 2ADJB 5IB5B 2IGFL 4NN5B 5IKCA 2HJLA 3MRQA 4I18C 3LN4B 4LDEB 4IM8A 4OBSA 1D5IL 3QDJE 3FONB 1AC6A 4KKAC 5EIQA 3WE6B 1IGYB 2R2BB 2DQDH 2JF1A 1IAOB 2OR9L 3BXNA 25C8H 1HXMB 3JSSA 4ISVA 2DLIA 3CLFH 4NT6A 1AKJD 5ISZB 3KXFA 4AL8H 5GRVL 5GSRA 1YEHL 1EHLL 3KJ6L 7FABL 5IM7B 1YPZA 3C6SB 4MQ7B 5FA4A 1R3IL 2B4CL 2X7LA 1EVUA 2NPLX 1KCSH 5IB3B 1U91B 5EUOA 4H1LB 5B38B 1G0DA 2E8YA 1BVKA 2DAVA 4NHUB 2QQNH 3LMJL 1JGLH 5F1OB 1RUKL 2MCPL 3EYOA 4NCC2 1CD9B 2FX8H 3QUYB 4OCYL 2X4OB 1DQTA 3RWEB 4XCCL 4WHCA 4HS8H 1I85A 5D4QA 2V5MA 3QUMH 1U0QA 1KGCD 4K94C 5T5NG 4QRPD 2WP3O 1K3IA 5DLML 3LQMA 3QEHB 1I9RL 2JLLA 3IFNH 4UIMA 4Z7NE 4I2XB 1SQ2N 2EC9T 5LKNA 3TH4T 1PY4A 5FGBC 1FH5H 1S8DA 4KVNL 5J7CC 3U7WH 5D1ZB 4GAGL 4PJFB 1J1OH 1CGSH 1A9BB 3SDAA 1GHFH 3FFDB 1X5ZA 1KB5L 4RFEB 4JHBA 4KROC 4KJPD 4BSWB 1NEZB 1Z6JT 4Z0BH 4NRXB 2V7NA 4KJWD 1PEZA 5E8OB 3U1SH 1KLUB 4WFGD 4Y0GA 2EO9A 1I9IL 4GKNA 1BF8A 4FXGB 4P2RE 5T1DL 1C08A 2DYPA 3QIWD 4I0CC 3MBEC 5E1AA 1LNUB 3P11H 4MAYB 4NQDA 4WCYL 1AHWB 1UKTA 4EN3C 3VXRE 4GXVL 3EKCA 4QRSA 4CN6A 1ZGLP 4TSAL 3IETA 3RWGB 3QIUA 5F1KC 4J6RL 5HI4C 3KLHD 1TETL 5E8EB 3LHPH 5EU3B 1DQMH 3C8KA 4LLMA 5TQ2H 2MKLC 5CSGA 3PHQB 1SEBA 1KJ2A 1OAQL 3QEQE 1VKXA 3UPRA 3W5MA 2NY3B 4HIJB 4GKSA 5ICXB 4LAQH 4OF5A 5C0BB 3ZYZA 2X4RA 3T0XA 4F57L 1AJ7H 4P59L 3EFFB 1MCQA 5IFHL 1GVIA 1IGML 1U8NA 2XA3A 3QCTH 2B1HL 1U6AL 1MJ7L 4POYA 3MCLH 1LEGA 1SYVB 1TQCB 2B2XH 2NY4C 1SHMA 2ZCLH 4JM2A 1J12A 2LQRA 1OTSD 4PJ7E 4HCRA 1KB9K 3MMEB 3JVGA 4Z0XB 3IFPB 1F02I 5HYJE 1XIWC 3IF1A 1XGRA 3RVTD 1NGZA 4LLQA 1X5LA 2H9GA 1WBXA 2DKUA 3MZTA 4QOKB 1K8DB 4OLYH 3LZFH 3SE4C 2IANE 1I8LA 2VSDA 2WZPD 5GS0L 5T3ZD 4DTGL 4NDMB 4JHWH 1OAZH 3O3BA 5DJDB 2FHCA 5ACZB 4JANB 3QWOA 1NJ9B 2YD1A 2BNQB 3N50A 1XF4A 3EOAB 3HAEH 3BGFB 5DJ2B 3VFTB 2I9LA 1NDGB 4Q9RH 4C58B 3KPSD 4KMTL 3JWDC 5BVJB 2A1WH 1FO0B 1A1NA 4LLYA 4M00A 3CDFA 4GW1B 3O6FC 5GS1B 4OLWH 3KNBA 2CIKA 1K8IB 4JQXA 5DJ8B 3NFPB 4JDVA 2YOCA 4RGOL 3MJ8A 4XCYB 2FX7L 2G75B 3HPJA 2VITB 1CD1B 3GMQB 3HMWL 1KJVB 1QNZL 1P84K 1DCLA 2DQCH 4K8RD 5DZLA 1AD0A 4C83B 4QF1B 1D6EB 1YECL 1MUJA 5CBAB 3UYOD 1T03L 4CNIB 4XNMB 1JI1A 3HG1A 3K2UL 4ZUUA 4PLOB 4KKLD 2C4FT 4L8CB 3U0PA 1JV5B 3T4YA 3OAYH 2NY2D 2E9IA 2N4IA 2UV3A 3D2UB 3V5KB 5FOJA 2VQ1A 3BD4A 4MS8D 4NZUH 1TJHL 4JY6A 1J86A 3BH9B 4Y5VA 1U8OB 3W0WB 1WVZA 4KC3B 1KPVB 5DD3H 5LG1A 3B3IB 4OZ4A 5GHWL 1OD7A 1H15A 4XPHH 1W0WA 2V2TB 5BMFH 3SN6N 4NO0D 5JLZA 5CP3H 3SDDB 4B0MM 4GFTB 4QTIH 3NACL 5DHXB 5DURD 2WIIA 1NGQH 2VL5A 4RMWA 3H9ZA 3AU1A 1FL5B 1G84A 5B8CA 3MFGB 1PQZA 2VDNL 1UJ3C 3TT1L 3O8XD 5EU5A 1FDLH 3SKMA 5FO9A 5FKAA 4FQXC 1R3HB 4R3SB 3LEXA 5KVMC 3LRSA 1OW0A 1JYXA 4U1IB 5F3BB 5L8KB 5IVXF 5L7XL 2VDOL 5C0JA 2QHRH 3VXSD 1AI1L 4EI6B 1VGEL 5AZ2L 3V95A 4KJWC 4U3XA 1L4IA 3V6OC 2HAZA 2YPLA 1PZ5A 1LE5A 3V4PL 3X14A 5MENE 1S9YA 1C16B 3QIWC 3GBML 3N9GH 4PJCE 1BZ7B 1F2XK 4OJFH 1FVCA 5DD1H 4R7NB 5DS8B 1EEYA 1YDPB 3FJTA 2WLYA 4HWEL 2I9TA 1KCUL 3ROLA 3KLHC 1DJSA 1WC7B 2NXYD 4K9EL 1NCAL 1CG9A 2HRPL 3QUMA 5J11C 5A40E 2XWBA 2YSSB 5E6YA 3DTXA 4HG4J 4WGWB 4XC1H 3DX6B 5KS9F 5I1GH 2ED7A 2XN9B 1MCDA 1FZMA 1MI5B 5KJRL 1NGPH 3VH8A 3F12B 3PWNA 1F3DJ 3NZ8A 3BVNB 5DUBB 4LSTH 4GRLB 5HHMD 1FPTH 2GY7B 1BZ9B 4JCMA 1J1XL 5D7IB 4KQ3H 2IH3A 4PBVC 3WJLA 1RZ7H 3HCVB 4OF0A 3T0EE 1OTSC 4U2ZA 4RIRA 5B3JF 3TNMB 1UB6A 1CL7I 1CICA 2I60H 5L0QB 4KK6D 1R5IB 4YDLC 4HGKC 1O7SA 3NCCB 3V7MA 3RVTC 4HIEB 1YMMD 2LFGA 2J6EL 5L2JB 5LWYL 4QKXB 2D31B 2EYSB 1CLCA 5HPOA 1BFOB 3HRPA 4G8EB 1NCDL 2YEZB 3WXWH 2FSEB 2ZOLA 2Z8SA 4NQVB 3N1FC 5TPWH 3ULVD 2P5ED 5ILTL 5CJ5A 3LQZB 4JJHA 4JFPA 1EO8H 5GISL 3S5LA 3VFMB 2R8SH 4OD1H 2H32A 3T3PE 4UT9L 2F74A 3HE7B 2EKJA 4BELD 5DFVC 1F4XH 3KPNB 3MV8E 3RDTC 3ULUL 1FIGH 2XTLA 4K8RC 1CK0L 4GQ9H 3EOYG 1EEQA 4PB9L 3BUYA 1JNLH 4XB7A 3QH3B 4GBXB 3SDCB 3C5JA 1JWSA 4R0LC 5EZOL 3SGKA 3H42H 3PNWA 1U3ZA 5DRXA 3MC0A 3RTQA 2VIRB 3TO2A 1H3UA 4PJHA 4YR6A 4WVRA 2X4NA 5GJTH 1OD9A 5K9QI 1DP0A 3C5SB 1QFPA 4MS8C 1MVFA 4MD4B 3KWWA 1VACA 2ADFH 1URLA 2QKIA 1KCKA 2Y7QA 3ETBF 2VSCA 4BM7A 5HD8D 4XVSL 5B39G 5FO7A 2MQCA 3HAEA 3WS3B 1YC8A 2EDFA 4IOSD 4PJAB 3CSPA 1B0WA 3N1GC 4LVOC 1BOYA 5GGTH 1RIUL 2KBGA 1WTGT 1YEKL 3QDGA 1VFMA 1CDHA 2DMKA 4LKXB 3DRTA 4NWUL 3K7UA 5E8DH 5ID1A 1X3DA 4ZO7A 3O8XC 4RMVA 1MWAB 3SY0A 5DVNA 4JZJC 4MNGE 3ZZ1A 5DD6A 5KSAA 5JZ7D 4YZFF 3PGDB 1D3CA 1CZ8L 3ULUE 2Q6WA 5IK3B 4JFFD 5DO2D 2VDKL 2F54B 2WSKA 4WI4A 2Z9TA 1NAMB 2HKHH 1GGCL 3PE9A 1OTTD 5J1SC 1SMOA 1BD2D 4OZIE 5I76A 4BZ1H 4AEFA 4OI7A 5LAXB 3ULVF 4R2GB 2A6DB 4B5EA 4G9FA 2Q20A 2D0HA 3LKPB 3NTCH 5F1NB 1VSCA 5B38G 4H1LG 1CR9H 2NXYC 4I5BA 3DI2B 1ACYL 1GL4B 2BVEA 5CP3A 3H9HA 5CIPB 3L6FB 5F7MC 4JHAL 2EYRA 3LIZL 2FCBA 4RQQA 2Q87A 1JRHH 1MH5A 4L9LC 4U2YA 5D96B 4AENA 1ZE3C 1FGVL 2D7PA 2LTQC 3GBLA 5DJYB 4DGIL 2BRRL 2IPUK 5TJWK 4U6HB 3G5XA 4Y5YB 2MJWA 3SDXE 2AEQH 3MRCB 2P48B 2ZJSH 2AK1L 5JHDA 1MCEA 4I3SL 4NKIL 2P7TB 5D2LA 3A0OA 3VCLB 1FL6A 1MHPH 3ZKNC 4DOHB 1JHLL 4MXQD 3DUSA 5DR5L 3SDYH 4LNVA 1C5BH 4P2QA 3MRFB 2AJVH 1X5KA 3FO0H 1NEZG 4U3CA 4QY8B 5JDSA 3NCBB 3PHSA 1A9EA 4P2YA 1JE6A 3FAXA 3VI3F 3SKNB 5FM4A 3QHZH 3TN0C 4ZUTA 4CMMA 4E0RA 1INQB 4PREA 5HYSA 2V2WA 3WLBB 3OKYA 2GTZA 2VTFA 2RJMA 4I18B 2OS7A 4PJXA 4CJ0A 3MRJA 3FRUA 1C5CL 3ULVC 5DRZB 3FCTB 3E2HC 3LPFA 5IV2B 1B6UA 1ODAA 2ICWI 4RFOH 3GI9L 1R5WA 4G8FB 1CGWA 4PYGA 2ADGA 2D7NA 5F88A 5FUOH 1FNGA 3K80A 3N1PC 2SEBA 1CLZL 3Q6GL 4WI5A 3PWPE 4XPTH 1X4YA 3ZDYE 5F7UA 4NQCB 3FQTA 5D7KD 1P7QB 4Z7UA 1RV6X 3LKSA 4QRRE 3WJJC 3T8XA 2E27H 1FNHA 3I85A 4HXAH 4YXLL 3P0YH 4LIQE 3BDBA 6FABL 1AFVL 1U8HA 4RCAA 4X8JA 3RZCC 3V7AE 43C9B 3GMNB 5SWSD 2PYEA 4H26B 1LEIB 1DLHA 2Y1VA 4YHLH 1IKFL 4P23A 4ODXB 3B5GA 4BH7A 4UIKH 1U8IA 2YUZA 1P7KA 3MJ9H 3OPZH 5T3XE 5E2VL 5HD8C 4X6CF 3MO1A 4X6FA 4OCXL 4WY7H 4MSWB 1BWWA 4PRHA 4OB5H 3ARFC 4Z7VE 4C56A 5J6HB 1HH6B 5E8PB 3TBTB 1ZHNA 4TUJB 4ZFZB 4KTDH 2VLJD 1MFCH 4QNPE 4KROB 1UA6L 4Z7OE 5ALBH 3B2VH 1WTLA 2HP4A 2Q8AH 1MCNA 1YC7A 35C8L 3UTOA 4YDVA 1BBJA 4HWZB 5JZ7C 3I3BA 3MBEB 3GMMB 1DBKH 4EN3B 5DO2C 4U1HB 5BV7H 1BIIB 4EKXA 4MJ5B 3QQ9D 4N0UE 4YAQB 5EOTA 1QLFA 1OTTC 1EEZB 2Y5TA 2ICWJ 1QG3A 4NO2B 1KN2L 5DK2B 2BOCB 4RGNE 5DJ0B 4P9HC 1RZFL 1MPAL 4TTDD 1S7VA 3OR6A 5IIEA 3RAJH 3CUPA 3RKPA 4LCYB 4JM2D 4TQEL 3UJIH 5BZDB 1N0XH 2XV6B 4LSUL 1HINH 4JR9H 5CJOH 4XVJL 4MA7L 4DJMA 1YEGH 1A6AA 4HFUH 1T20B 1N6VA 4K71C 5FIEA 5GGTA 1KLFA 4PY7B 1CXLA 3V5HA 3MODH 4L8DB 3QXUA 2AS5M 4X7SL 2CQVA 2RCSL 4EUPB 2NY4B 5ID0A 5MP6L 3QQNA 2HFGH 3IDIB 5C0CD 3D87B 5DRWB 3RRQA 5EORL 5IEHA 1OARH 3RX5A 2PXYA 1I7ZB 1ZVHA 4APQC 1XIWB 2CK0H 4LLWB 4LHUD 1QFOA 5HHQB 3NBNA 4M03A 4NRYB 3BRDA 1HDMA 1QTYT 4Y19B 2AV1A 4ZS7L 1HI6B 3HNVH 3GMRA 3UO1H 2CLVB 1J5OL 3D0LA 3E6HB 3OKLA 1P4BL 4ZOAA 5IEKA 1CLOL 4JKMA 4TOYH 5A2JH 2WBJD 5ESQA 3SE9H 3NZHH 3EO0B 2P24A 5MI0C 4BKLB 1YYMH 2CR6A 1IAIH 3FQUA 5C0DB 2B5IB 5J1AA 1WT5C 1ADQL 1WIPA 1B0GA 1K85A 2EO1A 3O6FB 3VFUB 4KI5E 1DUZB 3FOLA 2A0LD 3VXPB 1JNHB 3STZB 3WUWA 1X6LA 3MRRA 4IDLA 4XP5H 3KR3H 1FFNA 3X17A 1RFDL 1AY1H 1AKJB 2JK5A 2EH8H 4G6KL 4XRCA 1CDYA 1GZPA 2D2OA 2OTWB 2Y4SA 1DQDH 2ITDB 3KHOA 3UTTE 2XQBH 3QQ4B 3GUTB 2DIAA 2CDFB 5KANG 4Z5RA 1XH3B 3BW9A 1SY6H 2VB5A 1UQSA 1I85C 4EI5A 5T1MB 5BVPH 5JW4Q 1T80A 5FGCB 3FOMA 1RZIA 3FO9B 4JM2F 4XMLH 2Z91A 4FQIL 4ZTOL 1W0YT 1FAKT 3IJSA 3AROA 3QYCA 3RZWA 3F7YB 2BCKB 3UTQB 1C5DB 4CDGC 3MUY1 2ICES 3L5XL 4WEMB 4PJ8A 3VD4A 4FOMA 1DFBL 3P4MB 4W6YB 4CN4A 2LAGB 4TRPL 4QRPB 3SDAC 4L4VE 2Z8VC 5F96L 3ZE1F 4YHNB 1F58L 1NMBL 4KUCF 1WV7T 4OFYD 1UJ3B 4FXKA 2AK4E 1BJ1H 1NCUA 3MV7E 1ZSDA 5CGMA 5K93A 1JYWA 4YE4H 4FQXB 1JTTA 4CVUA 1RVFL 5LQBH 1T04B 3P73B 1NCCL 1W2KT 2R29H 3TJHD 3DYPA 1Q72L 3P4NA 5C0IB 1QYGL 3QIUC 5IROA 3V4UH 1KPUA 4M1DL 1N4XL 3F6IA 4M02A 5L2KE 2V17H 3QIWB 3W9EA 1T0PB 3RWHA 2E6QA 4G8IB 3OF6A 2OMNA 4A6YH 2O5YH 1S7WB 4PJGA 3STLB 3RHWK 4LVEA 4IDJL 1TVHB 3QQ9C 3KYNB 3HRZA 5ITBH 3R0MA 5C09D 4MHHG 4WW1A 2HN7A 1A6ZA 5A2LH 4UI2A 5CBEB 2P1YA 4HPOH 1N2RB 3N85L 3F5WB 4P4RB 1T6VN 2I24N 4XTRC 2C1PB 3EAKA 4LLAA 1YEJL 4QLRA 4ZUVB 1Y6KR 5J11B 4KZDL 2W0PA 4TTDC 4HZAA 4O02H 4DZ8A 1JWMA 2Y07H 4YIQA 3MJ9A 5IWLC 3TVMA 4JM2C 3TNNA 4MQTB 3ARGA 1D5BA 3FFCA 3S4SG 2Y06H 3GM8A 1JK8B 1I7UB 4JPVL 4GRWE 1CFQB 4LLVA 4PV9B 3C8HA 3MGOA 5HHVL 5JPMA 1E4WL 4LFHG 1I8LC 1EK3A 1ZLVH 3MCG1 1ZVSB 2YRPA 4E9LA 3ARBA 1FVDA 4ODVL 2R1WA 4U7MA 3RBSA 3C08L 4YDLB 2BXYA 3TBYB 2EE2A 1IBGH 3HZYB 4RAUA 3VW3L 2AEPL 4JKPL 4UNTA 4TUKL 3SE3C 4YGVB 1HOCA 2ZG2A 3O3DB 3V9FA 1QSFA 4HLZG 4MJ4A 4RRPA 4XHJD 5DK0B 5HHOA 1LO5B 4K3JL 5JDJA 1LEKB 4NNYA 3LAFA 4NRZB 1M4KA 1DQLH 4HC1H 1ETZB 5LBSH 2WBJC 1BLNB 2QQLL 1H9VA 3KPSB 4AIOA 3V6ZB 3MBXH 4XBEL 5FFLA 1D9KA 3TBVB 2YBRA 1ZTXH 4ELMA 4BA8A 3H9SE 2ZWLT 2Q3ZA 5H94B 4QHNA 5AWNL 3BP5A 2A0LC 4D0CB 1UEMA 3GSXB 1QSEE 3RTQD 1LD9A 3MNVB 3X3FH 3RDTB 4Q6YA 5J12C 5FKPB 2DQTL 4PJIF 3STBA 3KYOA 4AM0A 5EZLA 5ESAA 3PJSA 1FLRH 1OAXL 1B2WH 5EU6A 3OKOA 4Y5XC 3DNKA 4RBPH 5DQ9B 1TJIH 1LO4L 1ZA6B 2CIIA 2X9YA 2IADB 5BS0A 2NY2B 2F5AL 4N90E 4WFHD 5EIIB 5BO1L 4Z77B 3UZVB 1PG7L 4UAOC 4QHUB 3X3GH 4AG4H 2AQ3A 4PRIE 3O4OC 3Q2CA 5GRYA 3EYQC 2FH6A 2QLVB 4QXGH 1XF2B 3ZE0E 5INCA 5B8CC 2WWMD 4TUOB 4ETYA 3WBDA 2OCFD 2GTWB 3UTSA 1ZEAL 4LVOB 5GRJL 1KYOK 3CK0H 1HZHL 4OZFH 2IAMD 5DURB 2DLHA 4F7MB 3SKJH 4U6TA 1M6OA 4Y1AA 4F2MA 3O8XB 3RWCA 3M8OL 4WJ5A 4BSVA 4JZJB 5FOBA 5FYLL 2NY5H 1FE8H 1ZT4A 4N0RA 5D72L 3GSOA 3REWA 2DM3A 4MB5A 4HV8A 4RAVA 5E7FA 2Z93A 3T2NL 3QBTB 2FO4A 4BQ8A 4ONFL 5IT2L 4I3RL 3IFLL 3S3JA 1VFUA 3MTRA 4JPKL 5H2BB 3VXSB 1I7RB 3OB8A 4CU8A 2DM2A 3FMGL 3MA9H 1Z5LA 4ZFOL 1JPTH 1YJDC 4MXVF 2X5PA 5FHBH 2DLTA 3DGGB 3CVHH 5DJXA 4KRLB 4S1QL 1SY6A 5DTFB 1ZMYA 3RU8H 3D69B 3U7YH 5JUEH 1L9MA 3CDCA 5EPMA 3L3GA 5F7LB 3F8UB 3BQUD 3OKKB 4V1DD 1JGUH 2VAJA 5D71L 3VD9A 3Q5TA 1UKSA 2CGRH 1EO7A 1NCNA 3S36H 4R6UA 2CJUH 3HC0B 2ZUTA 3VRLF 4JFOA 2Q86A 2NXYB 2X4QA 2FR4A 4DGVL 3E3QC 3IXAA 4PJHF 1SJXA 1LVEA 3QUZD 3RIFK 2QEJA 2NX5A 1MVUA 3L95A 1UC6A 1YNLH 4L9LB 1ZGLB 2DQEL 2CO7B 4XBPA 4K3EH 3WJLC 1E4KA 1Q8MA 3PP4H 2LTQB 2DQIH 5JW5B 3QNYA 2GYSA 1T0NA 2NCMA 1MIEH 4M6AA 2ZG1A 4IRSD 4PJBF 5MHSE 4NNPH 4WFEE 1UVQA 1JHKL 3MRIA 5A3IC 2ZUSA 3GNML 2J4WL 4PJ5D 3D3VE 2YD5A 5FA3B 4OLXH 3RY6A 5I2IA 2Q8BH 1A7QL 1UM5L 4J3WA 4TPRL 4PGDB 3VDAA 1RULL 1CTOA 2YMXL 4Y7MA 4YDIH 4A6YA 1LK2A 4DCQB 1YMMB 2X4UB 4DN4L 2QR0A 4XP6H 1I3VA 2IMNA 1TDQA 3PGFH 3PDOB 1EZVX 3TN0B 2K7QA 1QPPA 1M7DA 4F58L 43CAB 1U58B 4PD4K 2APBA 3MLTB 3EBAA 5GGSB 2YUXA 4WUKH 2UYLA 3P77A 5IHLB 5EO1B 1JZ3A 2P5EB 4JJ5A 5LGJA 3E2HB 3UTPE 2Z4QA 2K7PA 1JZ6A 2J5LC 3MLSH 3P9WB 3CFEA 3ET9F 5C07E 1EVTC 5AG8A 2R2EA 5HDQH 5F9WC 2FATL 3VWJA 1GC1C 1KXVC 4G5ZH 3SGKC 1S5HA 1ACZA 5A16A 4HDIB 3P9MB 3RTQC 3O0RL 4O51B 1UXSB 3DURA 2MFNA 3MXWL 3V0AC 5D5ME 4P23D 1WWAX 4JRXD 2OK0H 1WWBX 4EUPG 5K9JL 4ODTL 1CL7H 2A6IA 4A2MA 1FVEB 3G08A 4K7PL 4G3YH 4I0PA 3RZCB 4PRPA 1K5NB 1WF5A 1T89A 1OAUH 3BRFA 1BQLH 2V7HB 4HWBL 3SOBH 1NC2A 3TA3D 2BXZA 4N8VB 5ICZA 1CFTA 2H6PB 4KXZI 2WWMC 2D9QB 1EUTA 5DYOB 5FYJL 3O6MH 3B8SA 5KSAC 1OGAE 4NQEA 1ZLUK 2HA1A 4ZSOB 5JNYB 4JFQB 2IAMC 2ZSWA 3D0VA 1MJUL 3U4BL 4TULH 4PGCA 1GOHA 2AQ1A 2W59A 5J6GB 4UTAL 2I25N 1YQVH 4LCCA 2E7MA 3FL7A 1NC4D 1YY9C 5BRZE 3HNTH 5HHNB 5ABDE 4ALAL 3Q6FA 4PJXF 3QDME 5D1QA 1HSBB 3VRJB 1MNUH 4JFFB 3BP6B 4WI2A 1Z3GL 4IIQC 2EC9U 5IR1B 5IF0A 1G6RL 4UNUA 5KSVB 4LSDA 1QUNA 3IFOA 5IHBA 4KY1H 3L3KB 1OAKH 2BVPB 4Z78B 1CE6A 3KYAA 3MRGB 3GSVB 1OSPH 4OTXH 4Z7UF 4MJID 1AIFB 5JW3H 1H0DA 3G6DL 5TE7L 1FC2D 4LCWA 5HJ3B 4OT1H 5L8LB 4NBZB 1IM9D 4ODHL 4TVPL 2NY7L 2W0FA 4ZYKB 2W1NA 1JNJA 5FYJE 5ISZE 5FYJU 3QUZC 5D70L 1G9NC 1K2DA 4K71B 4TNVF 3U2SA 3FQNA 5DRNA 1QRNB 3IDGB 4FFWD 4MA1C 4NUJA 1QVOB 2IGFH 4UU9B 3PDDA 1KIQA 5CUSL 4IS6B 2YD9A 3MGTB 3ZHDA 4APQB 4X6CB 4YQXL 2I07B 5T5FL 1YEIL 4U1GC 4JKLA 1AE6L 5ITFA 5K9OA 1YEHH 2ZG3A 3MRPB 5DD0L 3KJ6H 2BNRA 3PABB 4QCIA 3CVHA 3K2MC 4KK5C 4IMLA 1TITA 1ROWA 1R3IH 2B4CH 2GSIB 4KZEL 3L3DB 2NW3A 5IKCB 4HGMA 5D6DC 3RWIA 4I2XE 2HJLB 1CBVL 3MRQB 5EOQL 2QQKL 5GSVA 3LMJH 1TCRB 1RUKH 5MI0B 1KIPA 4PJFE 4OCYH 5D8JH 5JOFA 3BXNB 2AJUH 3RQ3A 4TVPE 5GZND 2VMFA 2DI7A 4HIXH 4NT6B 3PIQB 3KXFB 1R3KB 4OGZA 5GSRB 2VKWA 1CF8L 3RY5A 5GJSL 5D7JD 3AGVA 4FNLL 4S1SH 5DLMH 5FA4B 4ZOBA 4E41A 1R6VA 2FIKA 1RJLB 1E4JA 4EI5D 4Y8AA 2BOBB 3BKCL 4AEIH 3ZL4L 2ZUQB 2ITCB 2FGZA 4HUWA 4FHBD 4FQQA 1VADA 1BWMA 3VXTA 3G5VA 5CFHA 1KB5H 2W60A 4R4FL 2XTJD 4GW5A 2AAVA 3TPUA 4OBRA 5ADOL 4ODWA 2R1YB 2A9NL 1I9IH 3EGSB 4P23C 1A47A 3OBAA 4OZGF 3VRIA 2ICEA 4GXVH 4WUUA 1J0KA 1F8TL 4NZTL 4K3DL 4R4BA 3P4LA 4TSAH 5C0BE 1V3LA 3RKDD 3NIDF 1TTGA 4FQ1L 1A4JA 1PAMA 3TA3C 3MLUL 4P2OA 2C4FU 1CXKA 4M43L 3TCLA 4F7EB 3A6CH 5E2TL 3DOSA 5C0EB 2DTML 3TIDA 2V7NB 1RURL 4HX1A 5FUZH 4PRBB 5EC1B 4GJTB 1OAQH 4LSSL 3BKML 3RVVD 4X7DC 5E1AB 4JREB 3QSKB 4NZJA 4IOIA 3MRBA 4QOKE 4F57H 3IETB 1DVFA 2GHWB 3WXVL 5DC0A 2B1HH 1MJ7H 1MAMH 1AQKH 2VWEE 5HYQA 1KTLB 4GG8A 4R4ND 3C8KB 1ORQB 2BNQE 3O4LD 1SEBB 4ZAKA 4KU1A 5JO5A 1VKXB 4ZDHA 1J9CT 2ZCKH 1H5BA 1X7QB 2MKWA 2YR3A 5E56A 1J11A 1BQUA 1SJEA 3IRZA 3I3DA 3NVQA 1L0QA 4OFKA 3MV9A 4XVUD 5GS0H 5CCKH 2YXMA 4I77L 3MJ7A 2HT4D 1LEGB 3WIHA 4JM2B 2W0LA 4U1NA 4HPYL 1A7PL 4XVTL 2HRLA 1AO7D 2PXYC 4X6DB 1FNLA 4WHYH 3BZFA 5I1IL 3IF1B 2R9HD 1XGRB 5E0QA 2C4XA 1NGZB 3HC3L 2DM4A 4KTEL 1JFQL 4DZBA 5DC9B 1ED3B 5DA4A 4FFWC 2AXGA 4J1UA 4RGOH 3FQRB 1B6DA 3QDJA 5F9OL 1KFAL 2EIBA 5C0CB 1S7XA 3BYYA 3HMWH 1KT2B 5CD5C 1GGYA 1YN7A 1QNZH 4RNRA 3W0WE 3Q1SL 3CPLA 1KOAA 3QWOB 3KDMA 5HTSA 5MERA 1YECH 3VFRA 2VE6A 4I4WA 2DICA 4LHUB 2EDOA 2I9LB 2VISB 3VXMA 3O9WD 4LLYB 2DMCA 3CDGA 1OSZA 1PKQB 3WLWD 4X4ZA 3KNBB 4QXUL 2GAZA 3MJ8B 3MLWL 1KLGB 1TJHH 4JO2L 1T4KA 2WBJB 4PJGF 2J88L 5C3LD 1AD0B 4KV5F 3FQWA 5GZNC 5EULV 2FJFB 1ITCA 3QCVH 4LK4A 2BSSB 4HS6A 3NAAH 4Y4KA 4ZUUB 5IOPA 4LKCA 3NACH 4LDLB 2DL9A 3U0PB 3V52L 4M4RA 4EI5C 2NZ9D 1INDL 2QBWA 3TT1H 5DEGA 2VH5L 3CSYA 4JY6B 2FBJL 4FRWA 4H25A 3TJEL 1UXWA 3HMXL 2WV3A 1QP1A 4OQ1A 2D0GA 3MRHB 4Y5XB 4OZ4B 3DJ9A 1DEDA 1W0WB 4XGZA 5L7XH 2VDOH 4U6XB 2GCYA 3DV6A 1BPVA 1AI1H 5F1SA 4HFWA 1VGEH 3KPPB 3QCUL 2VDMH 3GKWL 3AM8A 3LN5A 4OLUL 2CSPA 1KIRA 4UAOB 3O4OB 3GBMH 4U1SA 3AUVA 5T1LA 3ABZA 2Y72A 2A6JB 5B8CB 1VA9A 4G8GA 2XN9E 1PQZB 5HDBE 2XXCB 5EU5B 3EUUA 1MI5E 3SKMB 3RKDC 1KIUA 4XNQB 3D5OF 4WWKD 5FKAB 3PGCA 3DMMA 3BSZL 1KENL 2BX5A 4K9EH 5C0JB 1NCAH 5D7IE 4CU7A 2XWJA 1EHXA 1IEBA 1PZ5B 1LE5B 3X14B 2ILLA 1S9KC 1NAKH 1QLEL 2JJTC 4M7ZB 4JKWA 5J89A 1U8QB 1U3JA 3QUKB 1LO3L 1YNTA 1EEYB 4ELMF 3OG6B 4S0SD 3GIZL 3I2CH 2I9TB 3AREA 5SWQB 4X0KB 1BVZA 1KB5A 4FZEH 1J1XH 4HD9A 2ZKHL 2EIZA 4PJ7A 1CG9B 4R4NC 3JZ7A 4M6OH 5IGXH 5HYJA 3DO7A 4PJIB 25C8L 5C09B 3B43A 5FECA 1CE1L 2ID5A 1FZMB 4PGZA 2IANA 2J6EH 1BQHA 4HUVA 4FQCL 5LWYH 4XVUC 3PWNB 1ZHBA 4BFIA 2C1OA 4XPAL 3LKRA 4I1NB 1Y0LA 1QBMH 1KCSL 2HT4C 1JHTA 3M45A 2IH3B 1JMXA 4XNYL 3AAZA 3UJJL 2QQNL 3RNKA 4N8VG 1NAML 3ME0A 5GXBB 4HIHA 2WM0A 3U6RA 5ILTH 4XXDA 4FN0A 4ZO6A 4YHML 2JCCB 1UH2A 2R9HC 3CFCL 4XMKL 1H8SA 4HS8L 1OP5H 2ICWA 1XGQA 3QUXA 4L3ED 2P8LB 2KZ1B 4M9PA 4HF5H 4WTWA 4Q58C 4MB4A 3BN3B 4JO4H 3IFNL 3ULUH 3HC4L 3FN0L 1CK0H 2ERJC 4PB9H 4XNZB 1XEDA 1TMCB 3IGAA 1KJMA 2ZOLB 2AJZA 3U7WL 4HUUA 1UH3A 2OQJB 5EZOH 5F6HJ 1GHFL 3ULSA 4JFPB 4Z0BL 1G7QB 3O9WC 5FEBA 3ESVF 3WLWC 1WGOA 2H32B 1QR4A 3VWJD 3IDNA 1P2CA 3P9LA 3VGFA 1XF5A 4Y8DC 2HTKD 4YBHA 3TPKA 4KHXH 4GRMB 1S3KH 1LDPH 1WCBA 2VZOA 4XVSH 4RZCA 1T1WB 1QFUL 1RZJL 4JRYA 3C5JB 5F9WB 3D39D 4POZC 3LHPL 2QSCH 2J12B 3CX5K 3PNWB 5FCUL 1RIUH 5DRXB 4WWID 3RTQB 3TO2B 4DVBB 4PJHB 4TTGA 4I0PD 2YZ1A 4YR6B 5D7LD 1ZT7B 2VYRE 4NWUH 4J23A 2X4NB 2HKFL 4L1DA 3IJYA 2NZ9C 3ZE2F 2V9RA 5E00A 1CN4A 1PZUB 4LAQL 1B3JA 5JXAL 3KWWB 1VACB 2PO6D 2QKIB 5K9KB 3MA7A 1OWRM 2VDKH 3K1KC 1A7NL 1RJYA 1VEPA 5FO7B 2VZVA 5B4MD 3MRMA 1AP2A 1GGCH 4NKDB 4PJBB 3VGDA 2OJZH 1CQYA 1HEZA 3HTLX 2B2XL 2KH2B 2F19L 2XNAA 3HE6A 2VERN 1FG2A 1T83C 3SY0B 3GJFB 32C2A 5KSAB 4WWKC 1NGYA 1M7IA 4OLYL 2Q6WB 2IAMB 2MQ0A 3SJVD 1NGXA 1OP5K 1CDUA 1FG9C 4DOHE 4AQ1B 1AGBA 3MLYH 4JHWL 4QGTA 4JHAH 1OAZL 3L7FA 4M3JA 3LIZH 3GMOA 1T7ZA 4FMKA 5I76B 3PV6A 2XZAH 1VFAA 3PUCA 5DA0B 1MELA 2W92A 4JN2A 4Q9RL 1FYTD 3QO0A 4DGIH 4C4KO 3H2WA 4Z7QF 4IIQB 1TENA 3TM6A 4A2LA 4P0DA 4LCWD 4K94L 1S78D 4OLWL 1SVCP 2Q76A 1VFBA 3I6GB 4OM0L 1JHLH 3V6FA 1WEJH 3JV6A 3H9HB 5IJKC 2HG5A 2X4TB 2AVGA 4Y4HD 4LIQH 4U1JB 1C12A 2DQCL 2EYRB 3BQUB 3U48A 4V1DB 4RQQB 4UOJA 1SM3H 3DVNA 2EYTB 1MH5B 4OKVA 5D93C 1XCTA 2RHEA 2N7BA 1CLYH 4OCRL 4KDVA 5JIKA 2CLZA 3S3SA 4L5FL 3QUZB 1UM6H 1WWCA 5K33A 4NQXA 5T3XH 2CDEB 4NQCE 3NOIA 1FL6B 4MA1B 3BZEB 5BZWA 1HQRB 5H37G 5CP7A 3RY6C 3T04D 2BNRD 2J1KA 4XPHL 2VRAA 3BPNC 5JDSB 4U1GB 1RIHL 3BESR 3GI9H 1PG7W 4MCZB 2EXYD 2CLRA 2XQYK 3VXNA 5BW7A 4K07A 4PJ5B 1DANT 4QTIL 1NGQL 1CLZH 1JNNL 3MV8A 4CMMB 3UMTA 1E6JH 4M9OA 1FDLL 1P7HL 2R23A 1J05A 4D3CL 4YDJA 4JZOB 1FHGA 3DROA 6FABH 4FA8A 4CUCA 1IT9L 2C3HA 3BD3A 3HUJB 3G5YB 1FYHB 1BOGA 1D5MA 1CU4L 2J6EA 2Q3AA 3KPRD 5F88B 4P5KA 3TWCL 3VWJC 1CCZA 1FNGB 1E4XH 1IKFH 3RGVA 2HTKC 4LRNL 3H7BB 4QT5A 4D94A 1Q9OA 4ZUSA 1F3JA 5DD1L 3FQTB 2IPKA 4Z7UB 1G7MA 3LKSB 1PLGL 3RY4A 4QTHA 3T8XB 1YY8A 5HGBA 4BH8A 1XGPB 1MHEB 4J12A 2D7QA 4Q74A 3MCKA 2F9BT 1Q9LB 3QT2A 1U8HB 4WUUD 3RVUD 4I0PC 4XPFH 3WHE0 1HSAB 4NUGH 1UA6H 4XAKD 4CAGA 1OY3B 1T89C 4I48A 2PYEB 1ULVA 1N6QL 4KJYB 1DLHB 3B5HA 4WV1C 4FQHB 5JQ6H 4P23B 3B9KA 4XP4L 4JRXB 1MJJB 2B39A 2PO6C 3JWDL 4OGAD 2EDQA 1A1OB 4GG6F 4BZ2H 2Y23A 3NPSC 1JI2A 1Z0NA 1Y18A 3MO1B 4OFVA 3UTZB 5B4MC 4OIIL 3QI9A 4WEUD 1I1YA 1V5JA 4OZIA 1FPTL 3V8OA 4LHUG 4KQ3L 3RI5F 2FWOA 1GAFH 2RR3A 2FECL 3TA3B 1KN2H 4JQIH 1FZOA 5EOCL 1OAYH 5DJCA 2I60L 1MPAH 4YDVB 1X5HA 2EDEA 1GH7A 4PB0L 4UV4L 4TQEH 1RZGA 4G42B 4HQQL 2AJYL 4PJ9A 4Y16D 5GGRA 4XVJH 5C08D 4LNRA 4MA7H 4Y19E 1NC4B 1QLFB 2Y5TB 1FZKA 1Q94A 5CEZE 4OI9A 5GGVY 3MLPA 4RX4D 2RCSH 4P57A 5MP6H 4MMZC 1M05B 3ZTJG 2F8XC 3SDXA 1S9VB 5ALCL 15C8H 2WWKO 5IIEB 3MRNA 1D5ZB 4YEEA 1S78C 4OD1L 3ZDXE 3WO3B 2VXSH 4HK0A 2Z35A 3H7LA 2BRQA 2GSGB 1R24B 3DBXA 5SV3A 1A6AB 3U30C 4Y4HC 5E9DA 1CFSB 1XR9A 3FO1A 4MJIB 3CZFB 3BT2H 1JNLL 1N3NA 2B0SL 2XACC 5CMAA 5TDNB 1J5OH 1HWHB 1P4BH 1S5IH 1R0AH 5DUML 1RK1A 4OZGB 3ALPA 3K3QA 2NY5C 4MD0B 5E1HB 3SE8L 2APXA 1NFDA 5I15H 2OSLA 2EDKA 3G5ZA 5IP4A 4OCWL 2NR6D 1TQBC 1OP9A 1ADQH 3GMLB 3CXHJ 5T1KA 1HYSD 1RZKH 1HDMB 3VGHA 1O0VA 1X5FA 3BN9D 5FGCE 5JOEA 4U1LA 1YUHB 3D0LB 4PGJA 1YZZA 2VZTA 2EXYC 2WBWB 1Z9SA 4MQXC 1RFDH 3TBSA 2XZZA 1FFOA 1MF2H 2FJHA 4G6KH 1QKZH 3PWPA 2P24B 1MCRA 4I8DA 1KGCE 4YHIA 3FQUB 4K7FA 4QRPE 2JB6B 5DGRA 2IALB 3MSPA 4QRRA 1RIVH 4X5XB 3O11A 3FOLB 3QNXA 3CVIL 4FQIH 5I16B 4ZTOH 2FGWH 3CFBA 3BP7A 4KRMB 3ZMRA 3L7EB 2PTTA 1FFNB 5F9AC 4O2CA 3OGCA 4LEXH 4XRCB 4BZ1L 1GZPB 4GMTH 4WFGE 3V6OE 3EOBA 2WMPA 4Z5RB 4LSQL 3BW9B 3GSUA 1F58H 4S10A 3VH8G 5K59E 1NMBH 1J8HA 1UQSB 3W2DL 4EI5B 3JV0A 5EFIA 3FOMB 1RZIB 3O6LL 4Z7VA 4MAUH 4GRWH 5CGYC 5ERWB 1CR9L 4RFNC 3GSQA 1RVFH 5T3ZL 4G8GD 4H0HB 1NCCH 2UWEF 3O3AA 3RVUC 1YA5A 3UCRA 4F33A 1Q72H 4GAJL 1TXKA 4KWUA 4QRQB 1QYGH 4GKZB 2D7TL 1JRHL 4M1DH 2MCG1 4OZHA 2P47B 2NMSA 2RGSA 3I02A 1QR1A 2X4SB 5JIPA 1QSZA 1M71B 2E6PA 3U4EB 3V0WL 1ZXQA 1EXUA 4FXKB 1MCHA 4N0UA 3OXSA 4CVWA 1WFOA 1U9KA 2EDNA 3KAAA 3N85H 2L7UA 5E7BA 1DVFC 1JF1A 2DLGA 4ODUA 3ARED 4KZDH 5F7EL 3HLAB 3LH2L 5HVGB 4YK4C 3W9EB 3L3IA 5C2UB 3VJ6A 2OJEA 4HAGA 1VGKA 4PJGB 4NHCL 1M1SA 4JPVH 4BJLA 5I66A 1H5BC 3VFVA 5M94B 1TZIA 2HN7B 5HHVH 4BQCA 1E4WH 2EE6A 3MRKB 2A74B 4D9LH 5IMKA 2R0LL 3BJLA 1KB9J 3CFKA 4O2EA 5FGSA 2MSPA 3PHOA 2ZUVA 2KQNA 3O4LB 4JY4A 4DZ8B 5A1AA 2Q1EA 4ODVH 3KPSE 1XGYL 1A3RH 1FNSH 3VW3H 3TNNB 4XBGB 3FFCB 4TUKH 3QXVA 4XWOC 3OKDB 3G04A 1FAIL 2EDYA 5F93C 1NUGA 2R4SL 4KGJA 1UZ6E 4U05A 3UBXI 1L9NA 1TVBA 3MGOB 4HK3J 4K3JH 1GGUA 2E27L 3WFEL 1ES0B 3UJTH 1CVSC 1FZJA 3DX7A 1P4LB 5IFAL 2C5DC 3SQOH 4EVNA 1N0LA 1AO7B 1P9MA 3PWVB 4XBEH 3O45A 2P5WD 4BUHA 1G7IB 2BSTA 3DUUA 5J3HC 4P3DA 2NR6C 2KZWA 1HYSC 2BVQB 4H5SA 4YHLL 3HZMA 5HY9A 3T08A 1HOCB 4NNXA 1DEEB 1QSFB 3OPZL 3EYUH 4X4XA 4AEEA 1CD0A 2UUDH 2ERJB 4NNYB 4ONGL 5B3JE 1OAXH 4YNYA 3QZWB 3UROR 1YMHA 2WW8A 2XYCA 4IHOB 1W0VA 1QFHA 4KTDL 3RPKA 2YBRB 5ALBL 3O9WB 1LO4H 4XCEA 2F5AH 4JRYD 1FSKC 1ZLWH 3WIFB 5BO1H 2BVUA 4Y4KC 1NQBA 4OGYL 1PG7H 4JVWA 3C60D 4PJ7F 4LGRB 1F11B 1LD9B 5E94A 5DC4B 3VFOA 3BIBX 4AM0B 1DLFL 5EZLB 2DDQH 5ESAB 3W81A 3C6LA 5INDB 3OKOB 3VXSE 2X6MA 4CVZA 1ZEAH 4F9PC 5GRJH 2EDRA 3IKCA 1MCLA 3QR2A 4L4VA 1HZHH 1RZ8A 4AZ8A 1ADQA 4I9WD 1MFDL 5BS0B 2AK4A 3MV7A 3M8OH 2BFVH 5C0FA 1DBAL 5HI5D 4XNXH 3UJIL 4HG4K 1N0XL 4KKNA 4Y4FA 5DJAA 5DVOA 2OL3H 5INCB 3T2NH 1T66D 3RWJA 4ONFH 5IT2H 4I3RH 3IFLH 4OAWA 4HFUL 3AFLA 3OTTA 4WENB 3OXRA 3HZKA 3R06B 3MODL 4LMQE 4TNWF 2RFXA 3UTSB 3WNKA 2CKNA 5L2KA 2B8OT 3DMMC 2MQ3A 3U9UA 3B9AA 1IGJA 4WTZA 3RWCB 4WJ5B 4BSVB 5DQDH 5KW9H 3ARDD 5FOBB 2CK0L 1ZT4B 4N9GB 4WWKB 3GSOB 3REWB 1EBPA 2J7LA 4U6YB 4HV8B 4J3UA 2Z93B 3GBNL 5LGHH 4J2XA 4M93C 5HHME 4XZUA 3JBG7 4F7TA 3RWDA 1S7SB 1TCMA 3HNVL 3C5ZD 1JYNA 4JM4L 1BVLA 1Z5LB 3UO1L 1IGIL 3AREC 2BMKA 2OZ4L 2AJ3B 3TH2T 4KQ4H 4NKMB 2DQEH 5HPMA 4TOYL 1JTOA 4F8QA 3WFHA 1T3FA 2UUDK 3SE9L 5EPMB 3L3GB 1YMME 3HZVB 2Z92A 4YZFE 2EDBA 1YYML 1IAIL 2O5ZH 3NIGE 3G6JA 3BWUC 1IRAY 5TF0A 1JHKH 1ZVYA 2X4QB 3GNMH 2ADIB 2J4WH 2B20A 1GGIL 3S96A 1EHNA 4M6ML 1ZLWK 5IW6A 2P8MB 1W72H 2NX5B 1MVUB 1A7QH 5D9SA 4TPRH 3ULVE 2P5EE 3GJEA 3KR3L 1RULH 4G7YH 2CMRL 5FXCH 5D93B 1AY1L 2EH8L 2HLAB 4P4KA 4ZQKA 3WKNA 3LS4H 5I9QC 1T0MB 2FECI 3AY4A 3TBWA 2VNCA 1IAIM 4F58H 3RPIB 2YWZA 3BP4A 3QUXC 3BHBB 4R96B 5LGKA 1R3LB 2KPNA 3EO1A 5I2IB 2BDNL 3LN9A 1EBAA 5F7DA 3IAGC 5L88L 5BJTA 3HS0A 3BPNB 1HHIA 3H9SA 4C59B 3I50L 4Z8FH 4O4YL 3VFNB 1U2HA 4J3VA 4L3EB 4L8SC 1QSEA 2IPUG 5SWZD 5HGHB 3O0RH 3UZQA 4JPWL 4PPTA 3MXWH 2LV4A 1HH9A 2D4DA 3IT8D 4ZUWA 5GS0C 3VXUD 4P2CG 4NYLB 4JJ5B 2VXQL 4LSRH 3VFWA 3AS0A 4J3SA 4MJ6A 4ZSOE 1CDCA 4FQPA 2R2EB 4FFYL 3SCMA 3VWJB 2V17L 1S5HB 5A16B 2EEAA 1HHJA 2EKSA 4A6YL 4XP9L 5I30H 2YA2A 3EDDA 3UP1A 3BDXA 4JFFE 1OGTA 4UDUA 5FYJH 1HHGA 1I8MA 2HJKA 1NL0H 3D39B 3CU1A 1BD2E 1PVHA 3G08B 3U4BH 4I0PB 1C1EL 4BSJA 2ARJA 4FTVD 2AV7B 4H1LH 3CH1A 4WV1B 1G7HA 4BFBD 1NC2B 4ALAH 1AGEB 2PO6B 5ICZB 1JUFB 3HE6C 2GIYA 3CC5B 1T66C 3NPSB 4PRNB 4JKKA 2EIDA 4Z7WF 2WINA 2CKBB 1Z3GH 4OIBA 1KV3A 3Q5YA 4DKDC 2W91A 3FB6B 3T3PF 3R0NA 1G6RH 4UBDD 1A6TA 4QRTA 5M95B 3D0VB 2DD8L 3DVGA 1QRNE 1XZ0A 3FAWA 5GIRA 1WCQA 1A0QH 2ZOKA 1HQ4A 3ARDC 4PRAA 3NFNA 3G6DH 2NY0D 3OAUL 3SDCD 2VJXA 3MNWA 4IRJA 2OP4H 5I0DA 4ODHH 4TVPH 1DN0A 3LCYA 4WDIA 3SJVB 2X4PA 3C5ZC 1GYAA 5IF0B 1HKLH 5D70H 1UZ8B 1DUYA 5TH2B 5GGSY 3DXAD 5FM5M 2JIXD 4HC1L 5LBSL 3ZKMD 2YWYA 4J8RA 1FYTB 4UT6L 5E9DD 5F89A 1EAPA 4FMFA 3LDBC 3L3JA 1H0DB 1ZTXL 3RWFA 2OL3A 4YWGL 4R97C 5T5FH 1YEIH 4LCWB 3ZKXB 1MIML 4AMKL 2N7AA 3W9DA 1AE6H 2FHFA 1JRHI 4U1KA 3D3VA 3BPLC 5F71A 2DRUA 3X3FL 4ZFOA 4P5MA 1CDIA 4YHYC 4HKZA 3CFJA 5DD0H 3U30B 4Y4HB 1K2DB 2YUWA 3U2SB 5F6IC 4GXUN 1FLRL 4K9EC 4KZEH 3ULUF 3D18B 3IDJA 2JJUA 1T5WA 3RIAK 5EOQH 2QQKH 1KIQB 2R4RH 5J1TC 3R4DA 4GG6B 3CGTA 2F54D 4P5TA 4DFIA 5DD5L 5KSBE 2DLEA 1CD8A 1TQBB 5BW7C 1GGBH 1NDMA 1QACA 4YHPA 2XG5A 3A6BH 2M1KA 5D7KE 5EBMA 4YXKL 4BQBA 1IL1A 4OQTL 3RA7L 1TZGH 1H8OA 1CF8H 1A2YA 5I19L 5GJSH 2BNRB 1EH9A 1J0IA 4QCIB 2OR8A 2E7LA 3CVHB 2ORBH 2R1XB 4O58L 1ZKAA 3CFDA 4TSCL 5C07A 1IC7H 2IH1B 2NW3B 3RWIB 3BKCH 2X1PA 3S37L 2MNUA 4X7TB 3ZL4H 4M48L 5C0AD 5I8OL 5GSVB 5SWSE 4J3OC 3WNNA 1KIPB 2UVEA 1KELL 1L6ZA 4YPGB 1X6NA 3LV3A 4R4FH 1KNOB 3VG9C 1V3KA 4C55A 4WI3A 4Z76B 1BZQK 5ADOH 1ZWIA 3QRFM 2DMBA 5D5MA 3MLRL 3RL1A 5FF6A 4PG2C 3RGVC 1W72A 1S9XA 4YJZL 3U0WH 1WZMA 3SDXF 2FIKB 1UWXH 1J8HD 1F8TH 4K3DH 3KPRB 2VLJE 5I1LA 1IKNC 3LSOA 4PJDF 5J4MA 1HILA 2E5EA 3QXDB 3VXTB 3MLUH 5CZKA 4JO3L 3BKJH 1I8KB 4WI6A 5E2TH 2W65A 1UCBH 3TPUB 1ERNA 2DTMH 1JGUL 2VR5A 3O41A 3OB0H 3TZVD 3S36L 2R2HB 4PYHA 1OGAA 1QBLH 2YPKA 2P8PA 3ULUC 3BKMH 1S7TB 5DMJB 3VRIB 4RFNB 3M17A 3K4DA 2WBKA 3O2VH 4WUUB 4PLNC 4GQPH 5EU4B 1NFDF 2HH0H 4R4BB 2YK1H 3QI9C 3WXVH 4OF3A 4PLJD 1EJOL 4LLUA 4RISH 3O3UN 2DQIL 3QDMA 3LKQA 2RB8A 2GITA 3FT3A 1NKRA 4D0DB 3ARTA 4JG0H 4LU5L 4HX1B 2WQ8A 3NCYS 2Z8RA 4L29A 4U0RC 5I8CA 4FQJH 2AXJA 5FDWB 4UBDC 4NNPL 4X6DE 1PJ9A 1DBBL 1Y6NR 3ZDYF 3QZWG 4PJ9C 1JPSH 4IOIB 4HIIA 4OLXL 5IB5A 2Q8BL 5GGUB 3LN4A 1ITBB 5IESL 1P7QD 2OTUB 4I77H 4YBLC 5C0CE 3KPTA 4MZ3A 3ZE1E 1KEML 2NY0C 3CMGA 5HYQB 3FB7A 3NA9H 4GG8B 1MCBA 5F8QC 1HXMA 3N1MC 1A7PH 5ISZA 5F9DC 1QLRA 5C08B 5EZIL 3RUGF 4MLIA 5JO5B 2EEDA 4ZDHB 1PBYA 5E2UL 5IM7A 1H5BB 3TV3H 4WUKL 3MPCA 3BUTA 1PKQE 2DKMA 5IB3A 3D9AL 3ZKMC 2QJDA 5F9OH 1KFAH 1T5XA 4H1LA 1MCJA 3VXOA 5DHYB 3KLAB 4Z7VF 5A2KH 3QUYA 2X4OA 4M62H 4JFZH 3HNSH 4U1NB 1UWXK 1G6RA 4QNPF 2UWEB 3BZFB 1I1FB 2VZ3A 2XPGA 2V5YA 1QPXA 3ZKSD 4ZPTB 3QEUB 4G6ML 1RU9H 3S34L 4WNQB 2YUVA 4OZHF 2H1PH 4I2XA 5C8JB 3QQ3A 4J1UB 5EBGA 2OK0L 4GOSA 4JO2H 3OB0K 5DSCA 2RAMA 5EO0B 4EN3D 2VXUL 4D9QD 2J88H 5I75C 1KTKE 4RNRB 5DEZA 4PJFA 3CPLB 3L3OB 4R90L 1A9BA 3KDMB 5MERB 1J1PL 3FFDA 2VE6B 3HR5B 3JTTA 1BQLL 2HFEB 2J2ZA 1NEZA 3RP1A 3SOBL 4BSWA 2DF3A 4NRXA 5E8OA 4FXGA 3V52H 3VXMB 1LNUA 1OSZB 2MWCA 1IAII 2VH5H 5MEOB 4X5LA 4FZ8L 1I3RA 2FBJH 3EOTL 1T4KB 2ATKB 3TJEH 4JFDD 5E8EA 3QJFA 4PIRF 5EU3A 2VQTA 3TH3T 1YQVL 1I4FB 3FQWB 4AIZB 3W82A 5I6XC 3HNTL 3QCUH 1FSKB 5MEPA 2J3SA 4Y4KB 4OLUH 3PHQA 3PWUA 1I9EA 4LKCB 1EDQA 4HIJA 1MNUL 4MD5B 3MREB 3VG0L 2G60L 2XY1A 5C0BA 4L8BA 3QPXH 5DEGB 2BC4B 3QAZC 3DX8A 1HN1A 5HGAB 3R8QA 4MCYA 4WI8A 1D6VL 1AXSB 1VEOA 3BSZH 4WW2F 4KH2A 1OSPL 2I26N 1LO0H 4NQTA 1KENH 4OTXL 3BZ4A 2X2YA 5JW3L 5GRUH 3MMEA 1HYRC 3LN5B 1F6AB 2OI9C 4OF7A 5JXEA 4PJIE 4U1SB 3WEXB 1QLEH 1NANH 5C09E 3EJZD 4G8GB 4XX1G 4QOKA 2V2XA 1KTRL 1NMAH 1LO3H 1YN6B 2YA1A 4HUXB 5KZCD 3E3QE 3PWLB 4PLJC 4KI5F 3BPOC 4NDMA 5D1XD 3DMMB 2Y25A 4V2BA 4DUVA 4F7CB 5DJDA 3Q3GA 5ACZA 4JANA 2VLMD 1XGTA 1I9JH 1Q0XL 2ZKHH 2BNQA 4Q9QH 2E8ZA 3VGAC 1IEBB 1NDGA 1Z9MA 5BVJA 2H8PB 3B8YA 4IJ3C 1A14L 2JCCE 1MQ8A 3VE0B 1CE1H 4M93B 5GS1A 3LKNA 5DHVB 2A73A 4FQCH 1K8IA 2NNAB 3NFPA 4XCYA 3EFDL 2F5BH 1X5YA 4UDTA 1X9QA 2EDWA 1MWAH 1CD1A 3GMQA 5GRXG 3AREB 4XPAH 1XGUB 5B3NA 4C83A 5DZOA 4XNYH 3UJJH 4CNIA 5JMOC 2ICCA 3KS0H 3RL2A 1NAMH 2GEEA 3DO7B 5D8JL 2AJUL 5ANMB 4YHMH 4ETQB 4L8CA 3CFCH 3LOWA 4XMKH 3OHXB 1JV5A 3MR9A 4HIXL 5EWIH 5FECB 2IANB 1BMGA 2GT9A 3D2UA 4HUVB 1KULA 4WW2C 4S1SL 1MCSA 3QRGH 1U8OA 3W0WA 1A6WL 1KPVA 1Y0LB 3HC4H 1JHTB 2VUYA 3FN0H 4AEIL 1RAMA 3PQYD 3NA4A 3AAZB 4FQXD 4YHZH 4X4YB 4M5ZL 5CIPH 3SDDA 1K4CA 4HIHB 5F1IA 5I9QB 1RD6A 1I8IB 4WFFD 1V05A 2XWTA 4PJHE 2ICWB 1XGQB 4WO4D 3QUXB 3ARZA 5KN5A 1LP9A 1WQVT 1B9ZA 1F6LL 3VFSA 4GW4A 3JWNC 1BJ1J 1D5XB 4F37F 2GJ6D 4JZNA 2P5WB 4U1IA 5F3BA 1QHOA 5CD3A 1QFUH 2R0ZL 1RZJH 5EU7C 1JZ4A 1KJ3L 4EI6A 4UZGA 1UGNA 1A7OH 2CRIA 2KKQA 4R8WL 1JN6A 4L8SB 4PJBE 4WFHE 5FCUH 3F62A 1B90A 1IGCH 1C16A 3A6CL 3OR7A 3ULSB 4O2FA 3DX9A 1CXIA 1BZ7A 1VB9A 5FUZL 2HKFH 3SCMD 2C7UB 2ZUUA 3IDNB 5DS8A 1AXIB 1P2CB 5MEQB 1YDPA 4JFYA 5DFWH 5JXAH 2W9DH 1MRFH 2YHGA 4LPWA 4ERSL 1P6FA 3U46A 1WC7A 5BOPA 5GZOD 3AS3A 3G6JF 1A7NH 4G6JH 4EZMA 4JRYB 4GAYB 4OF6A 1MAML 1AQKL 1DANU 4WU7B 3C60B 3EW3B 2ESVD 2BK8A 2F19H 1OCWL 2EDTA 3DX6A 5IBUB 1IE5A 1J0HA 2WP3T 4L3CA 1JIBA 5E00B 3LEYL 3F12A 2ZCKL 2IQAA 4Y4FC 1ZK9A 3BVNA 5DUBA 4GRLA 1P1ZB 4PG9A 4C54A 5D7IA 1IGFL 1BX2A 5CCKL 4ZOCA 1LGVA 4WTXA 3LVEA 1XF3A 5C9KA 1A5FL 3C09C 2V5TA 3TNMA 4FS0A 3V5DA 4PJEA 3M1BA 2GW5A 4V1DE 1EZVY 1R5IA 2EE9A 3B9EA 3HE6B 4RMTA 1FG2B 3EJZC 3MOBL 2FB4L 5L2JA 3U79A 3FB8B 1F4AA 2D31A 32C2B 2DQUL 1H3WM 3HMXA 4K94H 1NGYB 5D1XC 4IRJD 1UT9A 1SBSH 1BFOA 1I3GH 2X70A 4G8EA 1NCWL 1OB1A 1B0RA 5DFVD 4OM0H 4EOWL 3GRWH 3RDTD 4LVNC 1AGBB 4X98A 1R5VA 3L7FB 2R15A 3ARDB 5D2NC 3PV6B 5E4IA 1PKOA 3WIIL 1IAKA 4JN2B 3VFMA 4HXBL 3WN5C 4OCRH 1MFAL 5FYLD 3IVKB 1BIHA 4UTBL 3HE7A 4PJ5E 1ZS8B 3C5ZB 4L5FH 3KPNA 2C3WA 1Q38A 3V6FB 3JV6B 1TLKA 2HG5B 3QH3A 4GBXA 4ELKA 3H6JA 3SGJA 4UV7H 5EBWB 1WJ3A 4NCDA 2HLFD 4R97B 2VIRA 1RIHH 3QCVL 4KDTC 2APVA 3HUJE 1XCTB 4XXCA 2QHLA 4P4KC 3NAAL 4QHLA 2JELL 3BPLB 2CLZB 3C5SA 1FBIH 4YHYB 5J06A 1JNNH 4CMHC 5IMMA 4F9LA 2F8OA 4L4TD 1VEMA 2RQ8A 5BZWB 5LVEA 4J3TA 3KPQB 5CP7B 4D3CH 2LVEA 3IXTB 3TESA 3HI5L 1A6UL 4FFZL 3DYMA 2YKLL 1T2QL 5HVHC 1IT9H 5CEXB 4Z7WB 1MAKA 2JJWA 4O5LL 3X13A 2VDML 5IMOA 1CU4H 3VXNB 4WO4C 3TWCH 4EUPH 2HVKB 3L5HA 1U36A 5F70A 4OM1L 4O9HL 1EFQA 2PYEE 4PR5A 3NCEB 3L5IA 1HXYB 4LRNH 3PGDA 2FLBT 4JRXE 2FX9L 3ZSTA 3REVB 2XKNB 1PLGH 3VWKD 2AW2A 2M2DA 1VDGA 1NAMA 4JDZB 3T0VA 5CHNA 3DROB 2FZ3B 5CEZH 4XC3H 5SWZB 3VDBA 5JORB 4MDJB 1F4WH 2IPTL 5LAXA 1D5MB 4OD3L 3VG9B 4P5KB 3SCMC 4JVPA 3T65B 1N6QH 5F44A 3VXUB 2BP3A 3LKPA 3RGVB 4XP4H 1NAKL 3F7VA 5F1NA 3JWDH 4W81A 5FYKD 5GZOC 1G7MB 5DDHA 1N64L 1RK0B 2VC2H 2LU3A 3I2CL 1NBZA 4OIIH 4NN6C 3VA6A 4BH8B 4FZEL 1JPST 2ZNWA 5FV1L 3ZKND 3BOVA 1P53A 1U95B 2G9HB 1IJ9A 3D25A 5EOCH 4WI7A 4M6OL 2VDRL 3ARYA 5IGXL 2FHBA 4KRPD 4I48B 2Q7NA 4U6HA 3BGMA 3MYJB 2FYYA 4XH2B 1KPRA 2IG2H 4PB0H 4UV4H 5EBLA 3QFDB 4MMXC 4HQQH 2AJYH 5FM8A 1Y18B 4KRNA 4EXKA 2WUCL 3TN0D 3CXDL 3QI9B 4FTVB 3VXQB 1I1YB 4HAFA 1QBML 1KCRL 3MRFA 3B6SA 5ELIA 2FBOJ 4MJIE 1U8MA 4AJ0A 4QY8A 1FZOB 2F53D 1QRKA 4LARH 1BFTA 4OZGE 3SKNA 3SQBA 1BEYL 5ALCH 4U0RB 4JB9L 4HZLB 1T22B 1IZJA 4IRJC 1RZGB 2GK2A 4HF5L 3UC0L 5K9QG 3NIDE 4P99A 4PJ9B 3WLBA 2ED9A 2IBGA 3E6FA 1LWRA 5GGRB 4JO4L 3FO2A 5JW4R 1A7RH 4I18A 5TDOA 5E5MA 2F58H 3MYZA 1I1AA 4O00A 4DAGH 5M7QA 3C2AL 1FZKB 4YBLB 3FCTA 5D5MF 5DRZA 2B0SH 5CINL 5IV2A 2NY0B 2ATPA 3UBXA 3ECBB 2NTFB 3JUZA 5DUMH 3J8F7 2G2RB 4LLDA 3GSWB 3SDXB 4N5ED 4WHDA 4QXTA 4H8WL 3SE8H 3RZCD 4GH7B 1PG7X 3BFOA 3DXAB 4OCWH 4HK0B 4NQCA 2EH7L 5KVDH 4PJDB 3S4SB 3PDGA 2JIXB 3G6AA 3DBXB 2H3NB 4KHXL 1S3KL 1LDPL 1WITA 5E9DB 2WUBL 3FO1B 4QHMA 1N3NB 1KF9B 1JCKA 3V0VA 3KGRA 2HLFC 3E1F1 3FKUS 4QWWC 3ARFD 3GMNA 3JV4B 5I1EL 2QSCL 5AG9A 2C3XA 1J7VR 3ARSA 5FUCC 4BQ6A 1LEIA 3ESUF 5F7NC 1JJUA 1NFDB 4KTYA 4V2CB 3G5ZB 1N7MH 1WAAE 1LILA 4ORGA 1SYSB 3GRWA 3CVIH 4MSWA 3DUHA 2GUOB 4KK8D 2GI7A 4KI1A 5J6HA 1HH6A 5E8PA 5I75B 3T0DA 4J4PA 4YHKH 3TBTA 1I1CA 3HKFA 4TUJA 4UB0L 5HGDA 5KOVC 1BGXH 3QWRA 4WHTA 1FFPA 2IBZY 2OJZL 1CIUA 2XTJE 1X44A 3OX8B 2FJHB 3BZDA 3I84A 5L9DH 3OAZH 3PWPB 5IG7B 3JV5A 4U33A 3MBEA 3GMMA 3RNQA 4LPYA 4LSQH 3UYPA 3S3PA 5E03A 5E24E 3W2DH 1BIIA 3VWKC 2VLLB 3O11B 3RIAF 3ARWA 4LSPH 3O6LH 5IW1B 5C0AB 1PYWB 4M61B 2BNUB 5T3ZH 1X4XA 1G9MC 2BOCA 5ENWB 4GAJH 3MLYL 1U8KB 3RUGB 2QQQA 5DJ0A 5H8DA 5I6XB 1KBGL 3OGCB 2W38A 2D7TH 3LPWA 5GGQH 1QRND 4XMPH 2XZAL 3A67L 3WYRA 3GSNL 4DVRL 3O2DH 4LCYA 3L1OL 5BZDA 3V0WH 1J8HB 4APQD 4PJGE 1A21A 4Z7VB 1T20A 2I5YH 2AKRA 3SKOA 4AQOA 1VHPA 1P4IL 1WEJL 2X89D 3O3AB 5DF0A 1G7PB 4LIQL 4EUPA 3IDIA 4KRPC 1OF2B 1U8PB 1SM3L 4ZPVB 3TZVB 5F7EH 5DGQA 3MNZB 1LO2L 3LH2H 3QHTC 2OI9B 4ZNEE 3O4LE 4OZHB 1RUPL 1CLYL 3I02B 4LLWA 1PW3A 5HHQA 1TIUA 4NRYA 3SE4A 1EXUB 1UM6L 4NHCH 4Y19A 1ZANL 5BCAA 1K4DA 3OXSB 4MNQA 5T3XL 3T09A 2H41A 4LGSB 1N59B 3BPOB 3KXFD 2WQRA 3E6HA 2HVJA 1P5VA 3OG4B 3EZJB 2R0LH 5JPNB 1JF1B 5DZNA 3VGAB 1WIOA 3P2TA 3IKKA 3EO0A 3NH7L 1AO7E 1XGYH 3L3IB 4LAJH 3H8NA 4IJ3B 4HJ0D 3VJ6B 2OJEB 1L0YA 1IQDB 1FAIH 5CLWA 2R4SH 1E6JL 3OAZK 5I66B 3VXPA 1MY5A 5E99L 1BM3H 1TZIB 4NM8H 3WFEH 4RMRA 5IFAH 4MA3B 4YGAB 1AKJA 1XFPA 4K7PX 5EN2A 4N5EC 4JY4B 5IBUG 5I8EA 3QQ4A 2CDFA 3QUYC 1O5DT 1YEFL 1CFNB 1E4XL 3QJHB 4FP8L 3P4OA 4JLRB 4WW2B 3SDAD 4HUMB 2CRYA 3R1GL 5KVEL 5HDLA 3LEVL 1QBAA 4DWHA 3ARRA 1GCFA 1AR1D 4ONGH 3F7YA 3DX7B 2BCKA 1LQSR 2DYPD 1NLDL 3AB0C 4NQDD 5B22A 3ZT6A 3S88H 4EVNB 3P4MA 4P9ML 4LP4A 4ODBD 4XPFL 4NUGL 1CVRA 4QRPA 1OTUD 3QIUD 4ONHB 4P3DB 5C71A 4YHNA 2BZDA 2DI9A 3MLVH 4H5SB 4GUPA 5JQ6L 5HY9B 1JPFB 1UJ3A 5KG9A 4NCC1 3MRDA 4OGYH 1S7RB 4KK8C 4BZ2L 3KYKL 4E5XA 3DV4B 1D7FA 1A6PA 3OWEA 4KKBC 5I1HL 4CW1B 1R3JA 3L9RB 1DLFH 1NFIB 1C8PA 4JVUA 4YNYB 2VLKA 3E8UL 1YMHB 1GAFL 3V6OA 3I6KB 4HKXA 1MCKA 1W0VB 3K0WA 4JQIL 4K55A 4MVBD 3HN3A 1YPZF 1OAYL 3VD5A 1RJZB 2O5XL 4XTRD 3T3MF 1ZHKB 4G8IA 4XCEB 1MFDH 3WFBL 3SPVA 1Q0YH 5DVKA 1S7WA 5EUOF 3KYNA 2BJML 3LQAL 1DBAH 1T1XB 3TO4A 4M6NL 5C0ND 1OM3L 1IC4L 4RMQA 1UYWH 4JFDB 2QSTA 4HH9A 4W68A 4EDXA 3VFOB 2MMXA 4YUEL 4N1CA 2C1PA 1SVZA 5I74C 3QG6B 1KSRA 3ULVH 4L4VB 1S7QA 4B7LA 5C0RL 4GS7C 2AK4B 4KUCD 1PGRB 4CVXB 15C8L 1WLHA 5C0FB 1I7UA 1CFQA 2VXSL 4PV9A 4Y4FB 4ORZC 2LE9A 1DE4B 3GBNH 3F58H 3X11A 2PYFB 1ZVSA 4JM4H 3BT2L 1KXTB 1IGIH 3C09B 3QA3A 1X5JA 5HXMA 1LP9F 1NSNL 2OZ4H 1S5IL 1R0AL 4WIQA 2D0FA 3TBYA 3ZE2E 3HZYA 1IGJB 2DS4A 3ZYIA 4NJ9H 5I15L 3EYFB 5KZCB 5F72S 4OD2A 2HT3C 2D7OA 3NFSL 5D1XB 2C3GA 3HG1D 1RZKL 5DK0A 3CLEH 1LEKA 1VENA 4XZUB 3CDYA 3WFZA 1GGIH 4NRZA 1FCGA 5FB8A 4LVNB 1BVLB 4M6MH 3MLXL 5BXFA 1B4RA 3OKEB 3V6ZA 4S11A 3O2DA 5D2NB 3L5WA 3V4VL 1HNFA 2CMRH 4X5WB 1TZHA 4HJ0C 1MF2L 5DJ6B 1QKZL 1T3FB 3WN5B 4HGWA 3ILPB 3UYRH 4L3EE 4KKCC 3G6JB 3DWTA 5HYIA 3MNVA 1BFSA 2VZ1A 5E6IA 1HE7A 3VD7A 1RIVL 4HBCH 4YO0B 2J8UE 1RMFH 2FGWL 3EYQD 3S96B 4CRPA 3ZHLA 5IW6B 2BDNH 3GHEL 5I17B 5DK3A 5L88H 1GGTA 4D2NA 5DQ9A 2YD3A 2AEIT 1ZA6A 4Z7QE 4LEXL 1FN4B 3I50H 4GMTL 4P4KB 4O4YH 3FT4B 4Z77A 5EO9A 3CMOL 3N1QC 4P9HH 4JHZA 2XI9A 4QHUA 4MX7B 3TBWB 5DI8A 4CMHB 3T1WA 3IJHA 5ADPH 1XF2A 4JPWH 2YPLD 4PJEF 1AR1C 1W8OA 1Z9OA 2XT1B 1XCQA 4MAUL 4TUOA 3PQYB 2WNGA 4PLKD 4NO0A 1BREA 3EO1B 3GMPA 3CAFA 2GTWA 3OKNB 4G80A 2APFA 2VXQH 5TFSH 3D39E 4UOW1 5HVHB 4AIXA 3GIVB 1OTUC 5I18H 4YX2L 5C9JA 1YEDA 1J0ZA 2ENYA 4FFYH 4WO4B 5D7LE 3Q48A 3JTSB 3L3HB 4Y89A 2ENSA 4JZJA 3P3YA 4MWFB 3LRGA 2A38A 3NCMA 4XP9H 2GJ6B 2Z31A 4ZUWB 4Z6AT 5H2BA 3VXSA 5J0BA 1MRDH 3BEWB 1NKOA 3QDHA 5I1JH 3CX5J 1QA9B 3VFWB 2PTVA 3WHXA 4MVBC 3DGGA 4ENEC 4YXHL 5IBTH 4MJ6B 5KSUB 1C1EH 1IQWH 3SCMB 1HHKB 4PP1D 3U36B 4NIKB 3CSGA 4NM4H 3LY6A 4GLRI 5C0NC 2PNDA 3JVGC 1L0XA 2GY5A 1CICD 1G7LB 3U7AA 1CI5A 3SJVE 1J88A 4UDUB 4F7PA 4NN6B 5C7XL 2HJKB 1XR8A 5A3ID 3SGDI 4D9LL 2ESVB 3S35L 4L9LA 1ZGLA 2DD8H 2ARJB 4HULB 3BIAX 2FJGA 3SO5A 5JW5A 2HMID 4D9RD 1FYTE 2Q7YB 1I7TA 1REIA 1A3RL 1G7HB 1FNSL 5L0QC 1BAFL 4J3XA 3OAUH 4LCWE 2XKUA 3THML 5IVXB 1F45A 4JAMA 4DQOL 4LGPB 1K6QH 12E8L 4M7LT 1FLTX 4JG1H 4ZD3L 1J10A 3UJTL 5TE4H 3OV6A 4JQXC 4PGDA 3RBGA 3WHE1 2NXZC 3SQOL 4JQVA 4X4ME 1AQDA 4YHOL 1XZ0B 2AJXL 5IB1A 3CSBA 3JWOL 4UT6H 1Q9KB 2X4UA 1E6OH 2ZOKB 1HQ4B 4PRAB 4XHQA 4GG6E 3PDOA 3TFKD 5FDYA 1CXFA 1NLBH 5H37H 4YWGH 4AMKH 1MIMH 5HVFB 4JCLA 2VABB 3MLZL 1IGTA 4IRJB 3MLTA 2XZQH 1U8LA 4WDIB 3TYFA 3EYUL 3WD5L 2VR4A 4N68A 4TN9A 3V7AG 2P5EA 2BNRE 1E28A 5LCVH 5C6TL 5IHUL 2J8OA 3T0WA 3O6KH 4RMSA 3MUGA 3IU3B 5KS9B 1U8JB 2CDGB 4R0LB 4Y5VC 4J8RB 5DJZB 5F89B 1EAPB 4JEGB 3SGJC 4DK3A 1QO3A 3ILQC 5DD5H 3RWFB 2A83B 1TNMA 4S1RL 4O51A 1UXSA 3GSRB 3IS1X 3W9DB 4XXCC 1L7IL 4QEGA 1RY7B 1ZA3A 4YXKH 2HYMA 4OQTH 2EIEA 3RA7H 2AGJL 4JFEA 5DEFB 3QDGD 5I19H 4ZFOB 1T21B 1ZV5A 4I0KA 2HTLC 2OZ4A 1JBJA 1VERA 3J7HA 4JFHD 4U3HA 1UADC 4O58H 2DDQL 4UQ2B 4TSCH 1T7XA 3WFCH 5F7KC 4W4NA 3T4AA 5KSAD 4LRIA 3IDJB 1T5WB 2DKSA 3QNZB 1A4KA 3S37H 4M48H 5I1CH 5I8OH 3KPRE 1OW0C 2V7HA 2OM5A 3CD4A 4J4PD 4DEPC 5CWSB 1KG0B 5F7YC 1KELH 4N8VA 1YY9D 3AXLA 1NDMB 4YHPB 2BFVL 5EBMB 1J8KA 2X09A 1IC1A 4L4TB 4XNXL 3MLRH 4PLKC 4OGXL 2OL3L 4N5UA 4LF3B 4ZSOA 3CFDB 5JNYA 3WDJA 1TJGL 4G9FD 5JTWA 4WUUE 5J6GA 2BSRA 4XAKE 3LRHA 5IVOA 2X1QA 5HHNA 4QO1A 4QYOB 4JO3H 2A9ML 2AXFB 2DJUA 4UUJA 3VMNA 3ZDZE 3WKMH 1HSBA 3VRJA 5KW9L 3HPLB 1ZWIB 5DQDL 3VWKB 3RL1B 5FF6B 3UX9B 4RDQG 5LGHL 2VXTH 2X41A 1E4XI 1BD2A 2BVPA 3I3EA 4Z78A 4ODSL 4LPTA 5JHDD 2DTSA 3GSVA 1F4YL 5I1LB 2P43B 4JN1L 4PP1C 1EJOH 4KQ4L 1HILB 4JDTL 5FO8B 5AYQA 5HYEA 3U9PL 3VD3A 1S7UB 5HJ3A 4P2QD 2W65B 3BO8B 1CICC 1ZLUH 2O5ZL 4PBXA 2EICA 4LU5H 1ND0B 2XXMB 2YN3A 5ESVB 3S7GA 1C7TA 4ZMAT 5C08E 1G1YA 5CKAA 1DBBH 3M17B 3NN8B 1W8NA 3PXHA 4AEHL 3W39A 2E7BA 3MFFB 1RZJC 3IDGA 3QFJA 4HKBA 4UU9A 1W72L 2NLJA 4KK5D 3CCHB 3ES6B 4KRPB 5IESH 2HMIC 4MNQD 1JPGB 4IS6A 4G7YL 4LLUB 1BHGA 1S9WA 1KEMH 3B5TA 3T77B 2I07A 1KC5L 3LKQB 3ZSSA 3OMZA 3LS4L 1U92A 4GXUM 3MRPA 5EZIH 1FIEA 5E2UH 2UWEE 1DDHB 4HSQA 1DQQB 3HHRB 2GSIA 1A8JH 5I0ZA 3L3DA 1FL3B 1CGUA 3D9AH 3HFML 4HIIB 2F53B 2PW1B 1I1AC 1GPOL 1TCRA 3TFKC 3P0VL 3E0GA 5DT1H 3S98A 4Z8FL 3FB7B 1MHHA 3I75A 1WT5A 1CGYA 3PIQA 1MCWW 1R3KA 3B4NA 1QLRB 4MGXA 1MCFA 1INEL 4YFLI 1QQDA 1U3YA 3MACH 5CLTA 4NKOA 3VXME 2PYED 4G6MH 1RJLA 4AH2B 4G43A 3S34H 4NSKA 2BOBA 1F42A 3D85A 1T5XB 4LSRL 3I6LD 3BEVA 2ITCA 1H3VA 2CRMA 2APTA 3VXOB 2VXUH 4MXWH 5KSBA 2VN7A 3UZEA 1YJDH 4R90H 3RFZC 4PRHD 1J1PH 5D2LF 4C56D 2CH8A 2DQFA 2VDPH 2GJZA 3PL6A 2R1YA 1G6RB 3EGSA 5I30L 2XPGB 4CU6A 3FHAA 4HC1A 4Q2ZA 1BBDH 3ZKQD 3W11D 3QQ3B 3C9NA 3ARFB 1NL0L 2K1MA 4N0YL 4FZ8H 1JGVL 3AB0B 5SWSA 5DSCB 3EOTH 3GB7B 4J4PC 5IFJA 4WTZG 4F7EA 4N0FA 3JTTB 2EZ0D 1JZ7A 2VLKD 5C0EA 5J57B 4NQSB 4PRBA 4X99B 5EC1A 3DIFB 3CFIC 2QADD 3VG0H 2G60H 2OYPA 3ZDXF 4G8GE 2VLJA 1I3RB 3TO4D 2QL1A 4DKAA 2O26U 1D6VH 3QJFB 2R0WH 5CJXA 3FRPA 1KTLA 1WFNA 1A0QL 3DETD 5E8NA 4OQTA 2DOCA 1ORQA 2IEPA 5MEPB 2G5RA 3EJYD 5ECJE 5JHLL 3GK8L 1X5XA 3PWUB 1IILE 3WMSA 3FB5B 3IDXL 3RX7A 2OP4L 1JGEB 4DN3L 1X7QA 4PGEA 3WO4C 2PXYD 4OLZH 2ZCHL 3BWAA 1HKLL 2VDLH 4L8BB 2H32H 3DX8B 4OZFA 4MCYB 4LASL 1MEXH 1A7BA 5I74B 2FO1A 5JW4M 5DMGC 3KYMA 4IRZH 4OKDA 4FFVD 3BZ4B 5IWLA 1Q0XH 5CD5D 2P46B 1G7JA 4GS7B 1GIGH 4WU5A 4ZXBA 1E27B 4MJ2A 4X6DA 1GC1H 4NFBA 3EYSL 1L6XA 1A14H 5ANME 5D7SH 3ZLQC 1EHAA 3AVEA 2HJFA 1ED3A 2V2XB 4MNHA 1CFVH 4PS4L 3FQRA 3EFDH 1ZT1B 5C0CA 1KT2A 3KPMB 4MDIB 3Q3GB 2Y36H 1JVKA 4UILL 1XGTB 5TF1L 2R4RL 4LHUA 3QG7L 2ARWA 3B9VA 3SE3A 4HJJH 1N8ZA 4W4OA 4DKEL 1KACB 2VISA 4NP4L 4ISVB 4JE4B 1GGBL 3A6BL 2B5IC 2VLRA 4JGJA 1TZGL 1PKQA 3LKNB 2A73B 3ZT7A 5K59F 1KLGA 1YPZB 4UDTB 2ORBL 2WBJA 3GJFH 2X7LB 5E6ID 1FJ1A 1IC7L 1A6WH 4NZRL 4TYUA 5EUOB 2P5WE 1BVKB 2FJFA 3RL2B 2BSSA 4GMSH 1XMWA 4M5ZH 3EYOB 4U1MA 1UM4L 3EZ8A 1VESA 4PJ8D 2ZPKH 3MR9B 4B50A 3MROA 2GT9B 4LQFL 2D4FA 1L7TH 3OJ2C 4WI9A 3U0WL 2ZZUT 3FT2A 2W0KA 1FO0L 4UIMB 3MRHA 4Y5XA 5SV4A 3DSNA 4U6XA 3JUYA 1CGXA 2XFXA 2R0ZH 1S8DB 1KJ3H 3KPPA 3MOQA 4JRYE 4R8WH 1K4CB 3NIFE 4HLJA 5F1IB 3SDAB 3BKJL 1UCBL 2XWTB 2A6JA 3F7PC 4RGMC 4GKNB 1QBLL 3W11C 5KN5B 1C08B 1LP9B 2DYPB 3VFSB 3FN3A 4GW4B 4NQDB 3OF6D 4XNQA 3O2VL 4ERSH 1G9NH 4QRSB 5AYUL 2HH0L 4JZNB 2Z31D 2YK1L 5C86A 3PP3H 3QIUB 5CD3B 2EZ0C 4HK3N 4KJPC 4I9WE 4RISL 4OFYA 1SJHA 1JN6B 4NOFA 3KLDA 5KVGL 3OR7B 2JTDA 4O2FB 1DSFL 3DX9B 5T33L 1OCWH 4LLMB 4OCMC 4JG0L 1VPOL 2QADC 1KJ2B 4HS3A 1U8QA 4FQJL 4NJAH 3QUKA 3LEYH 3UPRB 5JIIA 4QRUA 4GKSB 4JFYB 4I13B 3TVMD 3TO4C 3ARGD 3FFCD 3EDEA 5AAMA 5SWQA 1JPSL 4X0KA 2MHAA 2X4RB 3U46B 1UZ6F 4YC2C 1NBVL 2DJ4A 1IGFH 1G0XA 2R0KH 1U8NB 3DETC 2E9WA 4HT1H 3EJYC 1A5FH 4QGYA 1T7VA 4PJIA 4L4JA 3NA9L 3GJFK 4Q9CA 5C09A 4L3CB 4MA8L 3ARBD 4CADA 1UACH 2FB4H 3MOBH 3C87A 4EQ3A 3TV3L 2R2CA 2DQUH 2IQAB 4NPYA 4LLQB 1MJ8H 2H9GB 1WBXB 2M26A 2X05A 4LCIH 5CKGA 4PG9B 4R7DA 1NCWH 1QSFD 4FFVC 4EOWH 2ZUXA 3HI6L 1BX2B 3OAYK 3ARPA 1JL8A 1WZLA 1XF3B 5HHOD 3O3BB 4X80L 3V5DB 4PJEB 3M1BB 1TNNA 2JCCA 4JFZL 3HNSL 3IDMA 4M62L 1XF4B 5FK9A 3WIIH 3N06B 4HXBH 4KAQL 4GT7A 4PUBL 3UXFA 1V8HA 2ZUWA 1WBZA 3H3BC 1MFAH 2OBGA 4PRDA 2P8LA 1D9KD 4UTBH 4YLQT 1YEEL 1A1NB 4DKFL 3B2UD 1CGVA 1RU9L 2H1PL 2CIKB 2X70B 4JDVB 2NXZB 5JA9A 1MFBL 1OB1B 1B0RB 4WRLA 2HT2D 3HPJB 5JR1L 2CUMA 4U0QB 4X98B 1R5VB 2YA0A 4R9HA 9CGTA 4N9OB 2OQJA 4ESKA 5CSBA 1MUJB 5EU6D 4GAFB 1G7QA 1P5UA 2NY1D 4Z7WE 1IAKB 3HG1B 4POZD 4U31A 1MLBA 5EH1A 1CT8A 2JELH 3INUL 3PP3K 1A22B 3T4YB 5BS0D 5J12B 3U4AA 5J9PA 4GRMA 5E6IC 1LHZA 4S1DD 2VQ1B 2E7HA 3T2PA 1T1WA 4JFED 5E2WL 4Y5VB 4ELKB 3HI5H 1A6UH 4FFZH 4HJGA 2YKLH 1H15B 1T2QH 1UJTA 3O81A 4KKLC 1SBBA 3G9AB 4DVBA 4PJ8C 4O5LH 5SWZE 5JLZB 3UTSD 3MQIA 1ZT7A 2NY2C 4P2RA 4QHLB 1DQJA 5GS2H 1CIDA 4OM1H 1EMTH 4O9HH 1A6VL 1UWGH 2WIIB 2VL5B 1WISA 3VXRA 3VXUE 3AU1B 4Y1AD 2LAAA 1QD0A 2FX9H 5K9KA 3QPXL 4NZDA 5IMMB 3QIBA 1SEQL 4YEFA 5FO9B 1KTDA 4NKDA 3LEXB 1WZKA 4PJBA 3ELAT 3LRSB 5BOZG 2VL4A 1LO0L 4DEPB 1H3TA 4NKQB 3OZ9H 5IROC 4OV5A 1YYLL 3MJGX 3X13B 2IPTH 5GRUL 4K23L 5IMOB 4OD3H 4X8XA 2COQA 2YPLB 3K4ZA 3QEQA 3O3EA 2A6KA 4NC2B 1F97A 2VN4A 1S9YB 3LS5L 4PR5B 3GJFA 3NIGF 1FVCB