1GGIH

Crystal structure of an hiv-1 neutralizing antibody 50.1 in complex with its v3 loop peptide antigen
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
215
structure length
215
Chain Sequence
QVQLKESGPGILQPSQTLSLTCSFSGFSLSTYGMGVSWIRQPSGKGLEWLAHIFWDGDKRYNPSLKSRLKISKDTSNNQVFLKITSVDTADTATYYCVQEGYIYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG2A 50.1 FAB (LIGHT CHAIN)
publication title Crystal structure of a human immunodeficiency virus type 1 neutralizing antibody, 50.1, in complex with its V3 loop peptide antigen.
pubmed doi rcsb
source organism Mus musculus
total genus 31
structure length 215
sequence length 215
chains with identical sequence J
ec nomenclature
pdb deposition date 1993-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggiH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggiH01
1RJYB 4LLDB 1TETL 3PWNB 4FQXD 4WO4A 5EC1A 2E6QA 5GGSY 3QDGD 3GKWL 5C0CA 2F8XC 5FUCE 1JF5A 1HN1A 3ILQD 1CFSA 4XTRD 5I8KL 4PJHB 3QEUA 4MX7B 1U91A 2PETA 5HGBA 4I2XE 3O41B 1EO7A 3FCTA 3SQOL 2H1PH 1OAZL 3K81A 1OTSD 1AP2A 4ODBD 3BKML 5J1SC 4N90D 3RIAK 2AV7B 1PEWA 1NCBH 1YN7A 2XICA 5E8EB 4H25A 1G1CA 4FQLL 4Z0XB 1GVIA 4OZGE 2C1OA 4NUJA 3B6SB 2CRMA 5INCB 4XVSL 1D6EA 3K80A 1IGCL 4MAUH 4EI5C 4NM8L 5EBMA 1LE5B 3QUYC 1U2CA 4P57B 1MCSA 1G6VK 3B9KC 3WE6A 5IEHB 1IC7L 3D18A 1FNEA 4HXBL 3EFFA 5MHSD 1KC5L 1YEEL 1A4KB 4M7KH 5I6XC 3ZYZA 1YMHA 1MHEA 3E6HB 2VAAA 3DVGA 2Z35B 2ARJA 2X1OA 3KYKH 3IAPA 5GGSA 3GEWB 5CINL 2ORBL 5DRXB 3VH8B 3MRIA 3ZKXC 1U8MB 25C8H 3SO3C 1GZQB 4JAMA 4E41E 3RTQC 5I1CL 3ZSSA 3BJ91 3U1SL 3E2HB 4R4BB 1QPXA 3BQUB 4JG0L 5D1XC 1NCCL 2HTLC 1EFQA 1BQHG 2JTDA 3GHEL 1ZHNA 3RY4A 1QRNE 1OGAD 2D2OA 3H0TB 3QXAA 1JFQH 2WUCL 2AJSH 3GNMH 1ZT7A 5GQBA 1QLFB 4X6EA 1B2WL 1MCLA 5FYJH 4AIZA 2KKQA 1I9IL 4YHMH 4JREB 5I16A 4EI5A 3QUYA 1L6XA 4FXGB 5CEZD 1W8NA 5KVGL 4QWWD 3ARBB 5IMMA 3B9KA 3KXFD 3UXFA 4NSKB 4R2GD 2EEAA 2BMKB 2JKXA 1EFXA 5IB4A 2NY2C 1KIPB 5GPRA 1PEZA 4HWZB 2ZOLA 3CU1A 4L3EA 4LP4A 2BP3A 3C5ZB 2RFXB 1SQ2N 1DQML 4OAWB 1SJEA 5CWSB 3HHRB 3ULSA 3QJFB 5ID1A 4O9HL 1XH3A 4LMQE 2FLBT 3OXSB 3FB5A 3RTQA 3BIKA 4KQ4H 5D93B 5ERWB 5TFSL 1CQYA 5D1XA 2APBA 4UV4L 1AO7D 4GRLB 2BNRD 2VLJD 5TF0A 3T0BA 3A0OA 5IW3A 1FIGH 5EC2B 2AGJH 5IKCA 1V3MA 1AGCA 5SWZB 3E8UH 3IJSB 2VABB 3TBSA 4ZAKB 1NAKL 1K4DA 5IT2L 4JFFE 1XIWA 1FN4A 1Q1JH 2WUBL 3WIIL 1YMMD 1MRDL 4ZS7L 3KLAA 1G9EA 1I7ZB 4NC2B 2LVEA 1PZ5A 4ELKB 3DBXB 2NLJA 2A6DA 4DQOH 5D5MA 5TH2A 3SOBH 5SWQA 3VD7A 4U05A 5HVWA 1WBZB 3QBTB 4XPFL 5KN5B 1IEAB 3MFFA 5J3HC 2WIIA 1AIFA 2IAMC 5DMJB 3CH1B 3V6FA 1F3RB 4NQSA 3BGMB 3OG6B 5JW4M 1CFNB 4WI9A 4XP5L 2UZYB 2QEJA 1VKXA 4HWEL 4EUPG 4U1IA 1NDGA 5KOMC 2VSCA 3WEXB 3DX7A 4Q0XL 1NGZB 4AT6B 1JZ2A 2P5WA 3WFBL 1G6RL 1OARH 3HG1E 3AXLA 5E99L 2RGSA 1NKRA 4JHBA 3WDHA 2ICWB 1UJ3C 3M8OH 5JDSB 3SN6N 4PJFF 5H94A 4X7SH 3NTCH 5EBWB 2P8MA 5BS0E 4X6BB 5HI3D 4XX1G 3P4NB 1HHKA 4WEBH 4D9LL 1NUGA 1PLGH 2HN7A 4MD5A 5IB2A 2DBLL 1HQRA 4R3SA 3RVWC 4P2QA 1I8LC 2R9HC 3MV7D 4XMKH 2AAVA 3RZCC 4QTHA 4WI6A 1IAIM 2FX9H 2HLAB 4GRMB 1NBQA 3VFVB 2Z92A 15C8L 4UT6H 3QWRD 4U0QB 4YBHA 2HFFA 3T4YA 5CSGA 4ZYKB 3NIFF 1FZJA 1BVLA 1XCTA 3OKEA 5H37H 2HTKC 3QDAA 1RJZB 1FVDB 4YNYB 2ESVE 4FS0A 3LRSB 5K9OA 3I3BA 5C0AE 5F8QC 3GKZA 1M7XA 1A5FL 4EN3B 3AREC 1K9TA 2R2CA 5IMLB 2A6KA 3QH3B 5LJYH 2O5YH 2XXMB 2V2XA 3QUKA 1YECH 4GW4B 5KSAC 3UTPD 2HKFL 2ZSWB 3N85L 2YD4A 4NZUL 5C86A 5CZXC 1MCEA 1S7UA 1U8OA 3HR5B 1CICC 2EDBA 2NX5D 5JMRA 1UJ3A 3CVIH 4XCCH 1FLRL 4HWBA 1R5WB 3VMOA 3VXQA 1K3IA 5J8OA 2UV3A 4WHTB 2Q8AH 4X8XA 4GT7A 5DEFA 3OSKA 1I8LA 1GZPB 3B3IB 5E8NA 4QTIL 2EIBA 3ZTNH 1JHTB 3RZCA 2ZUVA 1QSED 1T4KB 1JCKA 4WHYH 3ARTA 4M1CD 5E5RB 4OLVL 3T1FA 4I48B 5E95B 2UY6A 4L3CB 4LIQH 5IVXE 1HKLL 3WFDH 2BNUA 1ODAA 5F7KC 2CRYA 2ICEB 3JWOL 1GGIL 1C08B 1XGYH 3NIDF 4QY8A 1HH9A 5TQ2H 4HF5H 1T21A 4Q74A 3LPFA 4U6TA 2YK1H 2LE9A 3P9LA 3BXNA 3H8NA 3GB7A 5KSAA 4Z95L 3UTSB 2JJVA 4BSVA 4XVJL 4DGYL 1CICA 3LN9A 4FHBD 2UWEE 3FRPA 4NKDA 5EU6A 1UT9A 4AEFA 4HT1L 3W11C 4NYLB 5HYEA 1HWGB 3GJFK 1A6PA 4U49A 1OVZA 4XP4L 1MLBB 1S9WA 4XWOD 3I6KA 2VLMD 3S35X 1RJYA 1UA6L 3LS5L 1MRFH 4XWGH 5KZCB 5JUEL 4YO0A 4I77L 4LLDA 2IQ9H 4WY7L 3KPOB 1FYHB 5KTEL 3CFCL 4JRYE 3T0XA 1H3PH 1SEBA 3IRZA 5JQHC 2EC9T 4MNGE 5JPMB 5KJRL 1HEZB 3IFLH 4ZD3H 1JF6A 3BPLB 9CGTA 3O41A 3E2HC 2JIXB 1I8IB 3BQUC 1PZUB 1MHPL 1A0QL 3MRDB 1MIML 5C0IB 1IC4L 4QHKJ 4QRPD 1SYVB 5DUPL 5B22A 5E8EA 4M6MH 5DYOB 4HXAH 5I8OL 3G6DH 4Z0XA 3B6SA 2EDYA 2OR9L 5INCA 1WQVT 4OCSL 4DOHB 4X6DB 4JREC 2QSQA 1IM9B 1K6QL 2B1AH 2MFNA 3QQ4A 4X99A 3QXTA 5FUZH 5AZEL 1N7ML 1LE5A 4P57A 4XVUC 3ARBC 4MGXA 5J0BA 4YHPB 3MLVH 4ZFZA 2D7OA 1M7DA 4M7LL 4N0FB 1EGJH 1A4KA 1G7PA 2YD3A 3DRTB 3E6HA 2GSIA 3RIAF 3A6BL 2OZ4L 1HYRC 1QHPA 2DQDH 4JR9L 4O58L 2NYYC 2Z35A 4OI7A 4LSQL 3C5ZC 1JHKH 1GGTA 1XZ0B 1ZT1B 4QXGL 4NKQB 4P2OB 3ZHLA 5ETUB 3VH8A 4OD3L 1VACB 1QEWB 4BFBD 1LK2A 3LN4B 1QFWL 1U8MA 5F96H 4K7PX 1E0OB 4LKCB 4HCRA 1GZQA 3MA7A 5HDBF 4UT7H 5D93C 4PB9L 3RWHA 3T0DA 4OQTL 3FQRB 3BQUA 4YXKH 3SE8H 4P9HC 4ZO8A 3T3MF 4GRLC 3DI3B 2DAVA 3H0TA 2Q7YB 3K2MC 5SWSD 2CIKB 4DW2H 2VKWA 4B5EA 5K59E 1JP5A 2VXSL 2EKJA 1MFEL 1CLZL 1QLFA 3W5MA 4ZAKC 1KSRA 5HHXH 4DTGL 1SVZA 3MRJA 4TPRL 3X14B 2HVJB 1TLKA 2VR4A 4NCC2 1MY7A 4FXGA 5T3XL 3ARBA 1WK0A 4NSKA 3HNTL 2BMKA 1CXHA 3U36B 1KCSH 3P0VH 4KPHH 5E6YA 2Z8WC 3SKJH 3FB7B 1KIPA 1QA9B 4ZXBB 4PLJC 1QBAA 5DD5H 4IM8A 1ZA3B 2KQMA 4HWZA 3O3EA 5D6CB 4I0PB 2J88L 2RFXA 3LIZL 5BXFB 3CZJA 3WN5B 4OAWA 1MCPL 2H2SD 1A7QH 5HGAB 3QJFA 2PNDA 4M5ZL 3OXSA 3GZKA 3VRLF 1SJVA 5ERWA 2ZCHL 4NOFA 4Q58C 1EHXA 2EDXA 1HSAB 4FP8H 1Y6NR 4PJ8D 1VADB 4GRLA 4LARH 2XOTA 4B7IA 3BYYA 4XCFL 5EC2A 2NY1B 5I1DB 4NO0D 5DJ0B 5KSBB 3EYSH 5SWZA 5EZOH 1JZ4A 3IJSA 2VABA 3W2DH 3MJ8B 2YMXL 3T0EB 3QO0B 3V5KA 5AWNH 1S9KC 5KVMC 4PGEB 2AABL 1YPZA 1QLEL 1S7XA 2MNUA 3BW9B 4JKMA 3RFZC 1I7ZA 2QSCH 1M05B 5D5MF 2FR4B 1OAXH 4LLWB 1HZHH 1NMAL 3WNPA 4CRPA 4ELKA 3WDJA 3DBXA 5HHME 4MZ3A 4TUJB 3F7PC 1MAKA 3TFKC 4OQ1A 5C0BE 1MFNA 2PYEB 3TN0A 1WBZA 5KN5A 3BP5A 1R3JB 2FX8L 1IEAA 2OR8A 3C8DA 3SQOH 1BJ1J 3CH1A 3EJYD 3BGMA 1EERB 4Z76B 1CFNA 1GC1C 2MKLC 4LF3B 2I60L 3UMTA 3CMGA 1TJGL 2BC4A 1XT5A 1JBJA 3HUJE 5E2TL 2X1QA 4EN3C 3RDTD 2EIDA 1VGEL 2F74B 5ICXA 4YHZL 3W0WE 1NGZA 4YHOL 2HRPH 3K8KA 2FJGB 2EXWC 4EXPX 1S78D 2ICWA 2XY2A 2OP4H 2DYPB 5IBTH 1IC7H 5KAQG 5MEND 5JDSA 4HXBH 2E6PA 4YXLL 5EBWA 1YEEH 3OR6B 4ZUTB 1WJ3A 3FQTB 4OD1H 2OM5A 3P4NA 1E4XL 3UYOD 1A6UL 1BVZA 3DRQA 3H9SB 2R0WH 4LLQA 4IBLT 5D7LE 1I7TA 3IAQA 5IR1B 4RMUA 1GGCH 3ZKNC 4D0BB 4M8VA 4NFCA 1A3LH 2HLAA 4GRMA 3VFVA 1OSPH 3B5HA 3RWIB 2E7HA 3FB8B 5A40E 4KVNL 1J1XH 4GXUM 2RB8A 4ZYKA 3MJ7B 3U1SH 2ZUYA 4JG0H 4PYHA 1NCCH 4LCUB 3C6LD 1FVDA 4YNYA 3GHEH 3LRSA 1T6VN 3ZDXF 4X80L 2B20A 2BSRB 4F57H 4EN3A 2VJXA 5EZIL 2R0KH 5C3LD 3ALWA 3D2UD 5IMLA 4HC1A 4R96B 3QH3A 1I9IH 5FO7B 4TUOB 2X1WL 2W0PA 3QUZD 2ZSWA 1FDLL 1MELA 3EYQC 4HPYL 3HR5A 1R5WA 3BWUC 1SYSB 3MRLB 4OF7A 3QI9A 1HIML 4NCDA 2PF6A 3T1WA 5C07E 2HT3D 5HHQB 1BIIB 4ODTL 3OL2A 4ZO6A 2JCCB 2EDKA 1GZPA 1NJ9B 3B3IA 5C0CE 1JHTA 2MQCA 1HNGA 4NKOB 2OK0H 2Q7NA 3CC5B 3HNSL 2OJZL 4BM7A 4KJPC 4I48A 4WNQB 2ZUUA 1AKJA 4L3CA 5TFSH 4OFVA 3SCMD 3BPLC 3H42L 1RUKL 5BMFH 4XRCB 4JM4L 4K3JH 5DRNB 4UV4H 5KAQF 2ICEA 4G6ML 2V9QA 5SV4A 5C09E 1P7HL 2DQFB 1NDMB 1CG9B 3OJDA 5TE4L 3S37L 4S1QH 2CK0L 3FOMA 5KOVC 4PJ7A 4WUUB 3ARDB 4GAGL 4F58L 2VAJA 2OL3L 2ZKHL 1P7QD 3UTSA 3TBYB 5IT2H 1MAJA 4J3XA 4QOKD 2NTSP 2PW1B 4N8PA 5IFJB 5FO9B 2WUBH 1G7HB 3WIIH 1LEGB 1A1MB 1MRDH 1HNFA 2CO6B 1C7SA 4TSAL 3P4OB 1MLBA 5JZ7C 4J2XA 4F7PA 5EH1A 5JOFB 4J8RB 4PJHF 4JY5L 2NR6D 4HGKC 1P6AB 4I4WB 3QG7H 4P2OC 5DFVD 1NMBL 4Z5RA 1HEZA 5DMKB 2FBOJ 1KJVB 1OD7A 4HX1B 5L9DL 1ZGLP 2JIXA 1I8IA 5GS2H 4PBXA 1T1WB 5CSZB 1FG9C 3MRDA 4R26H 1JWUB 3PIQB 3H3BC 4HWEH 5C0IA 5J13B 5C8JB 3W39B 5DYOA 4ZS6D 4QHMB 1MFAL 3RU8L 3WFBH 2YOCA 1G6RH 3NIGE 5E99H 4HLZH 4FQIH 1G7QB 2V2WB 1IM9A 1PKQA 1YJDL 4LPVA 3SE9L 2QKIB 1T04B 3MJ9A 5B39B 4YHPA 2R4SH 4KUCF 1WAAE 4N0FA 2Y9RT 4ZXBC 3DRTA 2JJSC 4WIQA 5A2KH 2GFBB 3F5WA 4L3EE 4PLKD 1DVFB 4YUEH 5E1AA 1IILE 4I0PC 5E08H 1BJ1H 15C8H 4P2OA 3V7AE 5ETUA 3WN5C 2VQTA 1QEWA 4Y2DB 3ROLB 4HK0B 3BPNB 5EB9A 4C4KT 4BQBA 5I1AA 4NBZB 5J06A 4MA7L 3FQRA 3BMWA 3QULB 5C6TL 1G9NC 3PWVB 1OY3B 2DMKA 1CF8L 3JTSB 2Q7YA 3EFDH 4YDVB 2CIKA 1IQDB 2NY1C 2HKFH 4JHWL 3KPSE 3T0EC 4IHOB 2HVJA 2DJSA 1JK8B 2DKUA 2DWEB 4MNQB 4CN4A 5GIRA 5CKAA 1C16B 3U36A 5KS9B 4JN1H 3FB7A 4ENED 2QV2A 2ZCLH 3NCFB 1QA9A 4PJDF 2JJSA 4X4XA 4B50A 4CADB 2YZ1A 1ZA3A 3RUGB 3QPXL 5D6CA 4NQDA 5EDXA 1OM3L 1IQWL 4OLVH 3O9WD 5J6HA 1JZ3A 5HGAA 1FGVL 4M1DH 5GRXG 5DVNA 2MPAL 4MHHG 4UOJA 3JWOH 1GGIH 1HSAA 3SHSA 2R1YB 4YDLB 2OTPA 4KUZH 5HGHB 1WT5C 3TO4B 4Z7VF 3P40A 1NEZB 1RZGB 5KSBA 2UVEA 2W0LA 2DTML 5GGTL 5L88H 3MJ8A 4DGYH 3T0EA 3QO0A 5EPMB 1MRCL 5D1ZD 4PGEA 2DN7A 4HT1H 1I1YA 3I75B 3OPZL 3UTQB 2AJVL 4XP4H 2DWDA 4UNUA 5T1KB 3VXUD 3KYNB 3BW9A 3IFPB 3LS5H 1OAKL 3OAYH 2EKSB 4P2QE 5MEQB 5JUEH 3U6RB 4I77H 1M05A 2FR4A 4LLWA 5CSBA 3CFCH 1G0DA 5E6IB 3LKNA 4TUJA 4A6YL 1JGUL 1WV7T 1E4KC 1IZKA 2PYEA 3M17B 1BM3L 1R3JA 3QIWD 4JFHD 1GYAA 3LPWA 2AJUL 4O02L 1EMTL 1MHPH 1MIMH 2LU4A 1J8HB 4OIBA 1LGVA 4Z76A 4LF3A 5DUPH 1RIHL 1Z0NA 4NOBA 4X5XB 4UU9B 4Y0GA 5I8OH 1WT5A 2OR9H 5FYLL 1T03L 3RGVD 4KMTH 2F74A 3Q5TA 5CBAB 4OCSH 2XG5A 3QFDB 3FL7A 3EOBB 1DE4B 2MMXA 5CKGA 5AZEH 5I19L 4RGNB 1B3JA 1FBIH 3JWDL 2FJGA 4R8WH 3CUPA 1KN4L 2X2YA 3BRFA 3WXVL 3VGAB 1G0YR 1C12B 4XBPB 4ZUTA 3U4AA 3FQTA 5KW9L 4TVPE 2ZG3A 4KQ3H 5DURD 2NMSA 4TUKL 1D6VH 2WQRA 4JANB 4Q6IA 3QZWB 2KBGA 3QDJE 4JG1L 4D0BA 3ARGC 4UILL 5DRZB 3BN3B 4OD3H 2GJ6E 4U6VL 1IEHA 2XA8L 1QFWH 5EU4B 3FB8A 4KY1H 2CGRH 1KJ3L 3MJ7A 4LRNH 4PB9H 4OQTH 2BHYA 4NP4H 3T2PA 4LCUA 1IARB 2DIBA 4JFQB 3RPIB 3RKDD 2BSRA 4OF0A 4PV9B 2VXSH 4HIEB 1MFEH 1CLZH 3P4MB 4R96A 3ARDC 2WBJB 4NDMB 5FO7A 3NZHL 3DETC 1YNLH 4TRPL 1R3KB 4HKZB 4TPRH 5DEGA 2C4FU 1PYWB 3NACL 5T3XH 3SDAD 4OF5A 5EU6E 1XCQA 2IPKB 3OKMA 1Q9OA 1SYSA 3MRLA 4F3FB 5CJXC 2OXHA 3AS2A 4Z0BL 4PJXB 4NWUH 4XPGL 3LRGA 3WYRA 2XN9D 3ZE0F 2YN5A 3MRCA 3UTOA 5HHQA 1RAMA 1PD6A 2EDTA 1BIIA 5H8DA 2JCCA 3D6GA 1XF5B 1NJ9A 1MEXL 5JHDB 2ED9A 1MCPH 2JK5B 4NKOA 3CC5A 3BMVA 1BGXL 4RZCA 4M5ZH 5SV3A 4WNQA 1YEKH 5IBUB 2ZCHH 3FN0H 2VDQH 4XRCA 4Y4KD 1PX3A 5DRNA 5GXBB 4M9OA 4JO3H 3BP4A 5J13C 2DQFA 1NDMA 1CG9A 4XCFH 1DCLA 4WUUA 2ZG2A 3ARDA 1XMWA 4KDWA 3O3BB 5FKPB 2B4CL 5F9WB 2H3NB 1GPOL 5HDQH 1CDCA 2ARWA 3DHMA 2AABH 2FEEI 2PW1A 3IDXL 1QLEH 1UH3A 5IFJA 4GRWH 1WFOA 2HLFC 3V0VA 3PDOA 1LEGA 1A1MA 5E7FA 4IEFB 4L5FH 3ZL4L 3P4OA 1Z6JT 4HHAB 1DVFC 2KQNA 5F21B 3VCLB 1NMAH 5JOFA 5FGSA 4J8RA 3CX5J 2F9BT 5BRZD 4I4WA 3AUVA 4WTXA 4Y2DC 2FX8H 3BPNC 5DMKA 1KJVA 4F2MA 4HX1A 2B1HH 4P23D 3VDAA 2I60H 2F5BL 4PJEE 1T1WA 4P0DA 5CSZA 1RU9H 2FJHA 5E2TH 1JWUA 1WZ1H 3PIQA 1ND0B 5BZDB 3PNWB 5C8JA 3W39A 1VGEH 4X6DF 1MCOL 2EXYD 4D8PB 4YHZH 3PV7A 4QHMA 4YHOH 1S9YB 3RL1B 5B4MC 1G6RB 4JPIB 4R4NC 1G7QA 1OOAA 2V2WA 4PTUB 3TNNA 4OBRA 4X7DC 3EZ8A 2QKIA 1A6VL 2P46B 5I8CB 4GG6A 1OLLA 1DSFL 1LMKA 5B39A 5IVNA 2P24B 1KELL 1E4XH 3NCJL 3VFTA 3PP4L 1BOYA 2GFBA 3HZKA 4WTZG 3SJVD 1QFHA 1BJMA 3N1QC 3U7WH 4NQED 1T3FB 3DURB 1F2QA 2DLFL 1BF8A 1LO3L 4G6FD 1ZXQA 4Y2DA 3ROLA 4Z7NF 4Z7QE 4WENB 3J7HA 2NY6D 1T7WA 3RX7A 5IFHH 4HJJL 1UACL 4ZG1A 4X80H 3BH9B 3MGTB 3QULA 4NC1E 4YDLC 5BJTB 1S7RB 1RUAH 2PO6A 2Z91B 5BW7C 4DGVL 5HDLA 3TO4C 3PWVA 4IRZL 5DDHA 3JTSA 1X6NA 4YDVA 3PL6D 1FDLH 1L7TL 3VXOB 3ZTJH 3FFCD 1NGWB 5C08B 4IHOA 2QADB 2GAZB 1V05A 1YPZE 3LKSA 2A6IB 4MNQA 5DFWH 1C16A 5KS9A 1OP5H 5F7YC 3UZVB 2NY0D 3FMGL 3DHJA 4AQOA 2BY0A 5F7UA 3GHBH 1EBPA 4CADA 4M6AA 3RUGA 1A7NL 2V7HB 1P53A 4V2BA 4M7ZB 5E6IC 4C83B 1EV2E 5GGVL 5CLTA 1DBJL 1KEGL 5FOJA 2VN4A 3R1GL 3H42H 4JM4H 1BIHA 1TTFA 4G6MH 4PRIB 2EH7L 2R1YA 4GKNB 3S37H 2CK0H 5KSBF 3TBWA 4F80A 4GAGH 2OL3H 2ZKHH 3U0WH 3WLBB 1N2RB 1NEZA 1RZGA 3O2VH 4L4TB 3ZE2E 4OGXH 4RGNC 1LO0H 4QNPE 5EPMA 1YQ2A 4PJ5B 2ZUSA 2E27L 1TVBB 4PRAB 1P2CA 2H2PC 4I3GA 3VGAC 3I75A 4TSAH 3UTQA 2R39A 5EIIA 1EVTC 3B8YA 3KYNA 1YY9C 5HHOA 3IFPA 3O4LD 4OM1L 5MEQA 2EKSA 1OAYL 4G6AC 3LZFL 5MEPB 4K55A 4HUVB 3CFKB 3HC3L 3OB8A 4KROD 1CWVA 4UNTA 2V5RA 3NA4A 5E6IA 5TDPB 2DI8A 2EE3A 1IZJA 3HAEG 3L95B 3BPCB 4KJQC 5DK3A 3QIBD 1CBVL 1J0KA 3M17A 5F9OL 2AP2A 2J6EH 3JXAA 3MBEB 4QKXB 1NGXB 1J8HA 4R0LB 4OCWL 2C3GA 2E7CA 3B4NA 4NFBA 1X5AA 1MFAH 3RU8H 1UB6B 2G5BB 3EYVB 1MI5B 1DEEB 5JW3L 3ARYA 2A1WL 2WBJC 3UPCA 5CBAA 1V7ML 5CGMA 3EOBA 1ZGLB 1X5LA 4AIOA 1A7RH 1EHLL 1XGQB 1DZBA 3K8MA 3RJQB 1BFOA 3GIZH 3RAJL 1A2YB 3NZ8B 3MTRA 6FABL 3WNNA 1C12A 2BOCB 4PY7A 3I9GH 2Q3AA 2CR3A 2P43B 4CVXB 4M62L 2EH8L 3X13B 3QRFM 4LRIC 3CAFA 5CP3H 4JANA 3QZWA 5I1HH 4DKDC 3P0GB 5DRZA 4PJIB 2RR3A 3D9AL 3RA7L 5EU4A 4K9EL 4XP6H 2FO4A 1UXWA 1RULL 3T0AA 3QQ3B 2Z8RA 2ATPB 5C6TH 5I1GL 1DTUA 2R0LL 4JFQA 4H20L 1AGEA 2F5AL 3UEZA 2P42B 4G42B 3RPIA 1CF8H 4TULH 4PJ7E 4PV9A 4HIEA 4PJ9B 3P4MA 4OZHE 4HMCA 2WBJA 4JHWH 2A2QT 4I5BB 2Y7QB 5F9WC 1R3KA 3C09B 3E3QE 3TIDB 3VXRB 4U1NB 4ZTPL 2DDQH 5IROC 3V52L 3HRZB 2IPKA 2UZXB 5DHXB 4F3FA 2EDQA 5DQ9A 5ACLA 4PJXA 3KNBB 3BEVB 2WK2A 3DGCR 2R2HB 3QPXH 1I85C 2IBBA 4JVPA 2D7NA 1OM3H 4EEEA 1XF5A 1I3VA 2VDLL 4M4RA 5JHDA 1ZLWH 2ZP0T 1F3JB 3K74B 2JK5A 3WFEL 1WFTA 5B3NA 3SGJC 1IGMH 3V0WL 2MPAH 3L5XH 4LASL 3G9VA 2DQEH 3KPRB 4ZNEA 5JLZB 4J23A 5IGXH 2BY3A 3K1KC 3GM8A 3CDGB 5DT1H 2ICES 4AK1A 4EJ1C 3OF6A 4MD4B 4XBGB 3DYOA 5GGTH 4DOHE 1I1CA 5LAXA 5FKPA 1PKQE 1J0YA 3LVEA 2H3NA 2VZTA 3EOTL 2J8HA 3ESUF 5IROA 3DSFL 1QLRB 1MCCA 3OPZH 2AJVH 3CK0L 3ZKMC 4GRWB 3BD5A 3BUYB 4P46B 3BJLA 2VE6A 2BVOB 1OAKH 4LAQL 4HHAA 1I85A 3AGVA 1AQKH 4FTVD 4KI5C 1KF9B 2VWEC 5IHUH 3W9EB 2CDGB 1JGUH 3JZ7A 4TVSa 3GJEA 3B9EA 1OTTC 1W8OA 1ZLUH 4GMTH 1WCQA 1KOAA 3SGJA 3RKPA 5T3ZH 1RIHH 3UO1L 2HT2C 5AD0A 4JRWA 3TM6A 4KK8C 4ZTOH 1ZLSL 1ND0A 1R3IH 2CLRB 5CGYC 5FYLH 1T03H 4LSPH 1H9VA 3ZDZE 5F70A 1S9YA 1LD9B 1MJUH 3RL1A 1G6RA 3JWDH 4YDIL 3QHZH 2VLKB 4JPIA 4PG9A 3KLDA 4PTUA 4J3SA 2D7TH 2QADC 4WFHD 1JWMB 4OFYD 1J1PH 1I1RA 4WFFD 1HQ4A 1YEGL 1RZ8B 2P24A 3EO0B 3MV8B 4POZC 5KW9H 2F58L 4ISVB 4KC3B 4IRSD 1PJ9A 4LSVL 4YFLI 4XP1H 2E7BA 1HILB 1CZ8L 4JCLA 4TUKH 4PRHD 4NQDE 5GGUB 4GOSA 1VENA 4JG1H 4UILH 2VXUH 4Y5YB 3DURA 4M7ZC 3KR3L 4U6VH 2XA8H 2DQHL 5AEAA 3D39D 3TCLB 1WZMA 4M9PA 3MREA 1JPSL 1KJ3H 5HYSB 1X5ZA 3ZMRA 3GMPB 4KZEH 3HE6D 4XB7A 3BH9A 3JWOC 3WNKA 2DJ4A 3MGTA 4NQCD 1AXTL 4P5TB 3EHBD 4BK5A 5BJTA 2FHFA 1S7RA 5JXAL 4OSUL 1T80A 3GMQB 5C1MB 1IAOB 4PJBE 4GKSA 4UT9H 1QBBA 4TRPH 5JW5B 4XNMB 1KUMA 3VXOA 1EAPB 4O51B 3UBXA 3NACH 2UY7A 4POYA 4JM2D 1NGWA 3VD3A 5C08A 4QXUL 2GAZA 5C6WH 3BKJL 2WQ8A 4AH2A 4XPGH 5FHAL 1QRKA 1JRHI 3RUGF 3ZT6A 1MCWM 4S0SD 5F1NB 2D03L 2E9BA 3GI8L 4PD4K 4NN7B 2UYLB 1LO2H 4N0YH 3BDYL 3CVHH 1JZ7A 2V7HA 5H35B 1NC2D 1QFUH 5LG1A 4OCRL 4U1SB 1BGXH 4C83A 1U3HB 3OAYK 4XNUL 3MBEC 5TE7L 3LAFA 4Z7UB 4GH7B 4BH7B 4PRIA 4R0LC 4GKNA 1KNOB 4YWGL 2DQIH 4CU8A 2L7UA 4LSUH 1KLUB 4NC0B 3SGDI 4L8CB 4LKXB 2OL3B 4P2CG 2B4CH 1CFTB 3U2SB 4L4TA 4OKVA 5IM7B 1NFDF 4NHCL 1WTGT 5E9DE 3HPLB 5E8DH 1RMFL 2BHZA 3CMOH 4L4VD 2V2TA 3MRPB 1J0JA 2AEPL 5DK2B 3WD5L 1TVBA 4PRAA 2CMRL 4KRLB 1JNJA 2D7PA 4PUBH 4LCWB 4UNVA 4MAYB 5E6ZA 1LK3L 4HUKB 4FFYL 4MQXD 1ZVHA 5MEPA 4HUVA 3CFKA 4PIRF 3UTTB 2NZ9D 3RWFA 3KPPA 1NCNA 4MA8L 1WEJL 1SBSL 4FABH 3L95A 3LPGA 2VLRB 2DM2A 3BPCA 1FPTL 2QQNL 2YA0A 1AD9B 2F5BH 3MBEA 4LDOB 2D4FA 1N6QH 3O45B 4PLNC 1NGXA 2FATL 1KJ2L 1BD2E 4R0LA 4S1DD 1R3LB 1SEQH 3LEYH 4Y16D 4MJID 5IBUG 4K2UH 4PJ9C 1UB6A 2G5BA 3EYVA 1MI5A 1DEEA 4Q9BA 5CJOL 3F7VB 3LCYA 5DD1L 5A2JH 1S7TB 1E6OL 3C09C 3UROR 4HFWA 1XGQA 1H15B 4NUGH 3QO1B 4JO4H 1A2YA 4FZEL 3GI9L 1KELH 3NZ8A 4M5YH 3NCJH 1ADQL 5ESAB 2BOCA 1BWWA 4XHJC 1HCFX 4IJ3B 5LQBL 4RFOL 1F6LL 3EJZD 3HB3C 4CVXA 2CLZB 2JCCE 2OZ4A 3X13A 2VDRL 4D94A 5I1EH 2R15A 5F1SA 2W07A 4FQXB 2GIYA 2DLFH 4RBPH 1LO3H 4W4NA 3EIFA 1K4CA 4PJIA 4UOW0 1HXYB 4IOFC 1BPVA 2N1KA 3QFJB 4NM4L 4LCCB 1FZKB 1J0ZA 3QQ3A 3AROA 4KKCC 4OQTA 1URLA 3RVTD 4F7MB 2ATPA 1V3KA 4DGVH 2HWZL 4G42A 4IRZH 1YA5A 2XTJE 4IOSD 4WUUE 4PJ9A 3VMPA 3N0PB 3DMMD 1HDMB 4I5BA 2C7UB 2H41A 4X6CE 5FYJU 3VXRA 4LQ1A 4U1NA 3ALXA 3HRZA 3VWJB 2ADIB 2IWGA 4P46C 3MRNA 4FQ1H 5E4EB 1UWGL 3DXAE 3KNBA 3BEVA 4HLZG 4P4KD 2F19L 2R2HA 5HDOA 1NC4D 2YKLL 1A7NH 1IAII 5F7HA 4JB9H 4KK5D 2F15A 4PJGE 5H2BB 4G6KH 3N1PC 4QRSB 2FEEL 3L9RA 3KHOA 5GGVH 1C1EH 1F3JA 1DBJH 4P4RB 4UOW1 1JPST 4ALAL 3V8CA 3MXVL 3VXME 5I30H 5I1KH 3QWOA 1T22A 1U8NA 3KPRA 1VPOL 1CXIA 3OTTA 5JLZA 3MRRB 3O2WL 2O61A 4M6OH 3OZ9L 3AU1B 4P59L 1IGIL 3CDGA 5CJ5A 3NPZB 5I8EA 4XNXL 4OBSA 1EZVY 4CVZA 1YEFL 4XBGA 4ZUSB 2F8OA 2KZ1B 4GG6E 3VW3H 5I2IB 1QLRA 3FHQA 5HYIA 2LAAA 2VN7A 2FLRT 5LGKA 1QNZH 3BUYA 4P46A 3GM0A 5ALBL 2BVOA 3WO3B 1OAYH 3LZFH 3U48A 3QCUH 2QSTA 4JJHA 3TCXA 3HC3H 4W6XB 2XIDA 2NY3B 3RY5A 3I50L 3W9EA 3CFBB 1ZEAL 5CP7B 4Y5YC 3WIFB 4M1GH 3BKYL 2Y06L 4HUMB 5EOQH 1CLYL 5HD8D 4N8VG 5F9OH 3REWB 4E42B 1LDPL 2PYFB 2YD1A 2WWMC 4FFZL 1NUFA 3SDXF 2FH8A 5IBLD 4P5TC 4KHXL 5DC4B 4ZDHB 3CSGA 2CLRA 1FFNA 5JW3H 3MLUH 1QO3B 2GSGB 2XZCL 4HKJB 3MMEB 1JWSB 2VUYA 1JV5A 3VFGL 2ZJSL 1J86A 4U1HA 2VLKA 4HPOL 3T09A 1XEDA 5GGRB 1JWMA 5J57B 2FX7L 6FABH 4P2RB 5KS9E 4EZMA 4N0CC 1YMMB 3R8QA 1IEBB 3EO0A 3MV8A 3PWPD 1LILA 4ISVA 2CKBL 4XNYL 4JFXB 1ROWA 4XCYB 5F7EL 4OJFL 4NN7C 5GGUA 4X9HA 3ULUF 2YRZA 1OAQH 1WZKA 4GLRI 1KXVC 3B2UC 4Y5YA 3K4AA 2Y6SD 3L1OL 4HFUH 3RA7H 1DP0A 2EYSB 1OP5K 5AG8A 1U3HC 1MJ8L 5HYSA 1RULH 5HHPB 3BISA 4ELMF 2X42A 5EBLA 3VWKD 5I1GH 5I18L 2VUOA 1RK0B 2F5AH 3DYMA 1AXSB 2XV6B 4WJ5B 5IVZB 4P5TA 3WFHB 1YYMH 1QSFA 5LXGH 4DUWA 1I9EA 5JW5A 4XNMA 1XFPA 2W9LA 4O51A 3P4LA 4G43B 4TSBL 5CEXB 3V52H 3RWDB 3KAAA 4XP9L 1NAML 1QBML 1OTUC 2DQCL 2OTWB 4PRPE 1P84J 1NCTA 1PVHA 1KJMB 1QZ1A 4OD2B 3OAZK 5HHOE 1C8PA 4MAYC 3V4PL 1SVCP 5F1NA 1MFBL 4B0MM 1FNFA 3KYAA 1T20B 3MV7B 4GBXD 1AJ7L 2VDLH 4RA0C 5LKNA 5H35A 1I1AB 3WFEH 5CHNB 3VFWA 4U1SA 3UJIL 3PGCB 3ES6B 4LP5A 5FM4A 1U3HA 3WL9B 1OCWL 4HS6B 4TVPL 1GJIA 2ADGB 3UAJC 1FVEB 1J8HE 4F7EB 1YNKL 4JGJA 4Z7UA 4BH7A 4HUXB 3GIVB 4NNPL 2VZ1A 2HG5B 3SDCD 1KLUA 5B38A 2EICA 1Q0XL 1KEMH 4L8CA 3UJJL 2IPUK 3D25B 4LKXA 2OL3A 4TTDC 3FQUB 1CFTA 4E41B 5IM7A 3BOVA 3EOTH 3DSFH 3HPLA 1BQLH 3BZDA 3MRPA 5DK2A 4G3YH 3CK0H 4XXDB 1QRNB 4LCWA 5ESQA 2UUDK 4MAYA 1YC8A 4IJ3C 3RWGB 4LPUA 3BGAA 4S0TD 2Y23A 4RAUB 5TDNB 5FFLA 4FQXC 3S98A 2YRLA 1NCUA 1PGRB 1I3GH 4OIAA 3UTTA 1UZ8B 2FB4L 1IGJB 2JB6B 4XTRC 3OR7B 4LEXL 3L5HA 1EJOL 3DTXB 5IJKC 3CX5K 4AL8L 2RHEA 2V6HA 2N7AA 2VLRA 5GHWL 3QXWA 4LCIL 4LCCC 1I75A 2DKMA 1AD9A 2VISB 3FN9A 4ZUWA 3UO1H 5ISZD 5JHLH 4WO4D 5DSCB 1WSST 3BKCL 2H32H 1U41A 4EIZC 1CE6B 1ZLSH 4NO2A 1R3LA 4YPJA 4U6XB 3X17A 1CT8B 1JGVH 4NZDA 4KTDL 3T2QA 4YDIH 3MROB 1BZQK 3F7VA 3UTZB 3L3IA 1S7TA 3KPQB 3V7MA 2ZG1A 1A9EB 1DLFL 1H15A 3B43A 2P7TA 1YEGH 3EBAA 3IDGA 3QO1A 1NGPL 4PJXE 3VWJC 5IFAL 5ESAA 1S7QB 5E4EC 1Y18A 4PGDB 2FJFB 4PJIF 4XMLL 5D96B 2C3XA 4FQXA 3D0LB 5CP3A 2DQHH 2BNQD 4KGJA 4DKFH 2VDOL 1HYSD 3U7YL 3CLFL 5IJKA 1JPSH 3LQAH 4ZFFB 1HXYA 2EECA 3QFJA 4ODHL 2OX5A 2WV3A 5EORH 5DZOA 1VESA 4WU5B 1FL6B 4F7MA 1AXTH 4GW1B 3HR6A 4HZLB 4QRPB 1ZLWK 1VGKB 2NTFB 1PG7H 1P5UA 5JMOC 1BAFL 4YGAB 4PRBA 1HDMA 1IC5H 3D87B 2C7UA 3C6SB 5GS3A 4FOMA 1TZHB 4QWWC 4JFZL 3VG9C 5FHAH 1JN6B 4CJ0A 1CXLA 3VWJA 2ADIA 2VL5B 3PHQB 4L1HA 4ONHB 3X11B 3S36L 3HG1B 4CUCA 5L6YH 1UWEL 3QUYD 1IRAY 2NY3C 3D48R 3B9KD 3PJSA 5H2BA 4QRSA 3V6ZA 1S7VB 4OCRH 3TF7C 4L9LA 1NSNL 5D71L 4Q9RL 4ODXB 5F7MC 5BS0B 4P4RA 4A2MA 3VI4F 4Z7WF 2XA3A 4ODSH 4HBQA 4FNLH 5F9DC 2BY2A 2OYPA 4KMQA 2AKRA 1KTDB 3AU1A 2PR4L 1OGAA 4HUUB 1A21A 4N5ED 1ZLUK 3C08L 1GIGL 7FABL 2B2XL 5FEBA 5F1IA 1KLGB 2VDPL 4V1DD 3T4AB 4NHCH 3RTQD 5ENWB 5GGTA 3ZDYF 3JWDC 2GY7B 5D1XD 2B39A 2HTLD 4GRWF 3QNXA 4XZUB 5I2IA 1MF2L 2D0FA 4G8IB 3MODL 5J12B 4OLWL 3RNQB 1LK3H 1INDL 1IAMA 5T5NF 4BUGA 3HMXL 1DUYB 5JIIA 4XI5D 2ADJB 5C92A 5E5UB 2DF3A 2J1KA 3CFBA 4DZ8B 5CP7A 2ZPKH 2DBJA 1PX4A 3LY6A 1F4XH 4LGPB 1W72H 2NY2D 4ESKA 2WZPD 2AJXL 3SEPA 3QRGL 3REWA 2XWBB 4E42A 4FQJH 2AXFB 2FATH 1KJ2H 3HC4H 5DUMH 3AVEA 4BZ2L 3L6FB 5L2KD 4HJ0C 5L7XL 5FYKD 4UQ3B 2FRGP 4L8SB 1AO7A 5FUCC 1XGUA 4X9FA 1TTGA 4ZDHA 1GOGA 2XWTB 4PGCB 1QO3A 3T04D 4L3AA 5CMAB 5DD1H 3MMEA 1E6OH 1JWSA 1ZHBA 2E9JA 2XACC 5IVXB 4RRPG 5FB8A 4U1LB 3STLB 2BRQA 1WZLA 1ADQH 4LSDA 4YFDB 2FEDC 2B7DT 3G6JA 1SM3L 2EDDA 2VNCA 1YMMA 2A9NH 1IEBA 3ZYJA 5C71A 1F02I 5IVOA 4JFXA 2P5WD 5ID0A 2VDRH 3EDJA 1CD0A 3FO2B 5I1JL 2DQJL 2UWEB 1I1AC 5ABDE 2IBZX 2Z93A 4PBWD 3TGXA 4N68A 1N6VA 3FO0H 4UIMB 1AE6L 2EYSA 4EIGB 1JRHL 4AENB 5HHPA 4U6YB 2ITDB 5M94B 1JZ8A 3PABA 1RK0A 1R24B 1AXSA 4WJ5A 2FHBA 5IVZA 4KTYA 4LLUB 3REVB 4JRYB 4JGUA 2ADFL 1G7LB 3RDTB 3WFHA 1A47A 4G5ZH 2IPUG 1TNMA 1YQVL 4MNGB 3C8KB 4S1RH 3UP1A 2IAMD 2B4CC 5E56A 1HCVA 3N1FC 4Y4HD 3ARZA 3RWDA 3QEQE 3RBGA 1ZGLM 4ODUB 1OSZB 1R5IA 1GOFA 5E2WH 2GITB 2OTWA 1CK0L 1RFDL 1UWGH 3LKOB 4XGZB 5J6GB 1KJMA 2F19H 3TT3H 4OD2A 4DAGL 5JNYB 1RUPL 2E8YA 5CGTA 3FTGB 4YPGA 1F13A 1J05B 4JO1L 1T20A 3MV7A 4HBCL 4PJDE 3RPKA 4KVCH 1QYGH 4ORZC 3OB0H 3DV4B 5CHNA 3QWRA 3MXVH 3PGCA 3ES6A 4D9RE 2EC9U 1FJ1A 3WL9A 4HS6A 1KTKE 2ADGA 1FVEA 2R9HD 4E0RB 3OZ9H 4NZTL 3RZCD 3ZSTA 1IGIH 3MFGB 3O3UN 4BZ1L 2MCG1 1ZA6B 4PV8A 3D2UB 2EIEA 1KPUB 2YUWA 4Z7VE 3FQUA 1FFOB 3VA6A 5HHVL 1VA9A 1MWAH 2AVGA 2F54D 1C5BL 4YAQB 5ITBL 5F7FA 4IOIB 4JFYB 3VFUB 1JUFB 4XXDA 1QRNA 3ARED 1MCBA 5ALBH 2YPKB 3H3KA 4IRJB 1VFMA 1UEMA 4RGOL 3RWGA 5CZXD 4UQ2B 1I9RL 4G8FB 4RAUA 5D96C 3I50H 1CICD 1X6LA 5TDNA 1IC1A 5JR1L 3BZEB 4AMKL 3BT2H 3S4SG 1UZ8A 5T33H 2JB6A 5DRWB 5HBBA 3K7UA 1QSEA 5FIEA 2Y06H 4KV5F 1CLYH 5DA0B 3DTXA 4OM0L 4RMTA 1LDPH 5LGJB 3VDCA 5HXMA 2DI7A 5DSCA 1VFAB 2C3VB 4RBPK 2H32B 1CDJA 2Z8SA 3VFSB 2XZAH 3IGAB 2FO1A 4U6XA 4HGWB 2AJYH 1CT8A 2X1XR 1EBAA 2BK8A 2VKXA 5MP6L 3VFGH 4JQXA 3V4UL 3KPQA 1AR2A 5DTFA 1A14H 5JPNB 1NUNB 1OP3H 4QOKB 1KCRL 2FX7H 2F53E 4ZOEA 2NNAB 3O11B 1B6DA 4M6NL 2R69L 3LS4L 1CD9B 4H1LH 4YDKL 3MZTA 5F7EH 1U3ZA 4OJFH 4PGDA 3UDWC 3QHFH 4EOWH 1Q0YH 1YDPA 2FJFA 5L8LB 1DEDA 1INQB 1NPUA 5D2LA 1D3CA 3UX9B 3D0LA 1AXIB 4JQIL 5GGVY 3CDCA 3G5VB 2GW5A 3P11L 3W11D 2YPLE 3AMKA 4KJWC 1MJ8H 1F00I 3QEGH 4ZFFA 4WI5A 5C0EA 4KUCD 1IAIL 4WU5A 1FL6A 3RIFK 2M26A 4GW1A 4W4OA 5D70L 5DQDH 4HZLA 4QRPA 3TNMB 2AERT 1VGKA 5FA3A 5HHMB 5FECB 2NTFA 3TYGL 4XPTL 1IMHC 5C0BB 1IAKA 2YHGA 3TVMD 4OKDA 4D9QE 2IALA 4GUPB 4O2EB 1AI1H 1N64L 1RIUH 3C6SA 3NAAL 1NAMH 1QBMH 3PF2A 2DQCH 3ULVE 3QPQC 4IMKC 4LLVB 3JV4B 4JEGB 2VL5A 3PHQA 5J12C 1YN6B 5D7KE 3MGOB 4FQCL 2MKWA 4RNRB 3V4PH 4F9LC 1MFBH 3W0WB 1WIUA 4OGYL 3UDWA 4ZODA 1AJ7H 3X11A 3HG1A 1UFUA 3IDNB 4HWBH 3Q5YA 4XVUD 3ARBD 2OTUB 4GKOA 4ZPTB 1FIEA 3AM8C 1S7VA 3CFJB 1LNUB 3UJIH 3C5JB 1E4WL 5SX4H 2H2SC 5BS0A 1OCWH 2I9LB 4TVPH 1IGFL 1VEOA 2DLHA 2EO1A 3GSNL 1S7WB 4RDQG 5EUOA 2EZ0C 4JFPA 3S96B 1R6VA 1YNKH 4JZJA 5CJBA 5D7LB 1SJHB 2CD0A 2V5MA 4NNPH 2A38A 3C5ZD 1P4BL 3I3EA 4L8SC 1KTDA 3BFOA 3I6LD 5AAWA 1P1ZA 2HMID 4TOYL 5DVMA 2PXYD 1M4KA 4YC2B 1Q0XH 1EDQA 3EO1B 4KTEL 3UJJH 4JPWL 4GW5A 1MJ7L 2NCMA 1CGYA 1KLGA 2MSPA 3T4AA 2QHRL 5ENWA 2Q8BL 5TQ0L 5T1LB 5GJSH 1A6WL 2P48B 4YZFF 5B3JF 4XZUA 4GRLD 2W9DH 2JELL 4IMKA 1Y0LB 4G8IA 3QHTC 1SHMA 1C5CL 3B2VL 3RNQA 4F9LA 1N5AB 2FBJL 4XAWL 5SWZD 3LQMA 2B8OT 2BSSB 3TV3L 4ZAKD 4JDZB 2FB4H 2ADJA 1NCWL 4U1JB 3AM8A 4DZ8A 1Q8MA 1I4FB 4AL8H 2ICWJ 4H0HB 4LVOB 4P5MB 1EEZB 4JFDE 2J8UE 5GHWH 5C07B 1W72B 3WUWB 4LCIH 4KK6D 2AXFA 2EDFA 1WIOA 1KJ2B 3QXVA 3L6FA 1RJCA 3HI6L 4PJCB 2AXHA 3QEUB 2FH6A 3RDTC 1QSFE 2XWTA 4PGCA 5ELIA 3EW3B 3LKRB 5CMAA 4Y1AD 5IVXA 1DLFH 35C8L 4U1LA 5GRVK 3STLA 4JJ5A 5C09B 4H25B 4F15B 5IFAH 2DLIA 3MYJB 4M48L 4JN2B 1GGYA 1IGTB 4RDQF 5DLMH 4FG6D 3FO2A 5FO8B 3QP3A 1NBVL 1CFVH 5F97E 5IW6B 3DX6B 3D18B 5CD3B 1X7QB 3CLFH 4C56E 1UYWL 4Z77B 4UIMA 4DZBB 2DTSA 4G9FD 3ZT7A 3VFNA 4ODHH 4AENA 4NQTA 5D2NB 1BFVL 4U6YA 5CFHA 4EDXB 4Z7UE 3DVGB 4HK3N 4YBLB 1LVEA 4F33B 2R56L 1MLCB 5IJVA 1PG7X 2ZWLT 2XKUA 3EUUA 4LLUA 3REVA 3MRIB 1TZIB 5ILTL 3TFKD 3V79C 3RDTA 1G7LA 1BAFH 2XY1A 4MNGA 4N0UA 3OKNB 4NNYB 3C8KA 1B4RA 1QR4A 3V5DA 4XAKD 3T2NL 2NY4B 5EOCL 3TBVB 2BRRH 2X4PB 4OZGF 4XNQB 1ZANL 1OQOA 4ODUA 5SX5K 1OSZA 4EN3D 2GITA 3LKOA 3IDUA 4XGZA 1F4WH 5JNYA 2W38A 4IRJC 3FTGA 1X4ZA 4QLRA 5DURB 3DVFA 1T0NB 1UWEH 5FGBC 2EXWD 5IWLC 3UTTE 5IMMB 4LEOB 5HYJE 1JYNA 3WKML 1ED3B 3DYPA 5JQ6H 2IPTL 1NSNH 5D71H 3DV4A 4OTXH 2WLYA 4JY4A 5DQJB 2VLRE 3QDMD 4Y5XA 4PGZA 1NQBA 4PY8I 3PXJA 4YQXL 4WFED 4JRXE 1I8KB 2VZUA 2X4SB 4OCXL 4E0RA 4KXZI 3ZKND 1TJIH 3IDIA 4OFPA 4QRUB 1GIGH 1H3UA 2A77H 1ZA6A 2B2XH 2D7MA 3D2UA 4GXVL 2VDPH 2W59A 3GSUA 1KPUA 1CLOL 3WFZA 3QUZA 1FFOA 2GUOB 2L0DA 1MWAB 1GHFH 4ZFOB 3IU3A 1U58B 3V8OA 4YAQA 1KCUH 2JJTC 4IOIA 1A1OA 4HEME 1TMCB 2W9EL 3VFUA 5C70A 4OLWH 3CSBA 1YNTB 2V9TA 2YPKA 1INDH 2XN9B 1S9XA 3P30L 1FL3B 3FKUS 4IRJA 2IG2H 4N8CH 4WCYL 3UTSD 3MXWH 3KPSB 4M61B 3I6GB 4UQ2A 5FGBA 5IWLA 4LHUB 3QDGE 2RBLA 3D5OF 1XIWB 3BZEA 2NR6C 4MHHI 3LKQB 1F45A 5DRWA 5BVPL 5IB3A 3GSQB 1EX0A 3A67L 5CCKL 1F4HA 5F9AC 3QRGH 3KLAB 3CZFB 2DIJA 3LQAC 4NN6B 2FWOB 5MEOB 5LGJA 1UENA 1KXTB 1B90A 4N90E 2ED8A 2A6DB 2BCKA 3A6CH 2C3VA 2H32A 1L7IL 5TH2B 3VFSA 5C9JB 2BFVL 3QAZB 5FAAA 1U8KA 4HGWA 5JA8B 4JDTH 1I9JH 3MFFB 1GRWA 4KJPD 1AIFB 5DD0L 2PW2B 2QQLL 4F37F 2BOBB 1P7QA 2D0HA 1ZWIB 2JIXD 1TJHH 4MSWB 5JPNA 4CJ1A 4QOKA 2JJTA 2NNAA 5K9QG 5MHSE 3O11A 3VG0L 1NDGB 3JSSA 3ZHKA 4XPBH 2CIIA 5DD6B 1MNUL 4H1LB 5I1JH 2PKDA 4PLKC 1IM9D 1HWHB 1G7JB 3DUHA 1IJ9A 2A6JA 1INQA 3MLZH 5EIVA 5J9PB 3FN3A 1F4YL 2CKNA 2P8MB 4TNWK 5HI4C 5EBGA 5B8CA 3G5VA 2DD8H 1OW0C 4CN1A 4DKAA 5JZ7D 4JQVC 2I07B 3O3DB 3KS0J 4R3SB 2ZUXA 5HJ3B 4P2QB 3VU2A 1U8IA 3F7RA 4LHJB 4WHDA 4Y4FB 1IT9L 1OGAE 3ARFD 4I8DA 3TNMA 2HFGH 2EEBA 2Z92B 4K3EL 4P2OD 4YC2C 3PGFH 4QO1A 1YQVH 4MQTB 5C0BA 3BAEH 1BVLB 3OKEB 5DJZA 1Q72L 5E2UH 5CEZE 4O2EA 5FV2A 2VZOA 3BE1L 3KXFE 2P8PA 4Y19D 5FHBL 3RHWF 1NAMB 5AG9A 4LLVA 1B88A 2YWYA 3JV4A 2QQKH 2YA1A 3SGDH 3VXTB 4YR6B 5GRJL 2YN3A 1RUPH 1YN6A 4RNRA 4RFEA 2WP3T 4PPTA 3W0WA 1P84K 1S7UB 4JZNB 5FYJD 3VXSD 4HBCH 1UH2A 2Q76B 3IDNA 1M71B 2OTUA 4ZPTA 5EFIB 4RQQB 3RJDA 3CFJA 1LNUA 3C5JA 3Q48A 4LVOC 4PJAB 1OW0A 3I3DA 2I9LA 4LPWA 3OGOE 3TJEL 1S7WA 4ZXBD 4JQVA 2BY1A 4NZTH 5D7LA 4I0PD 1SJHA 1AO7E 2BNRE 2VLJE 4BZ1H 3QDJB 3BIBX 3EYUH 3UJTL 2GJ6B 2VXTH 2UZIH 2JF1A 3DARA 4MNHB 1MPAL 5FCSH 3BPOB 2AI0L 5AUMA 4BZYA 5T1LA 5ITBH 1RUML 32C2B 3G6JE 4F15C 1YMME 1Y0LA 4FZ8H 1BFSA 3BZFB 4JHAH 4KAQL 2NY1D 1N5AA 1CIDA 2EE2A 3HZYB 4YXHL 3SDYH 1DL7L 5L8JB 2X1PA 1I9RH 5JR1H 3T0ED 4DKEL 4JDZA 4AMKH 5J1AB 5EU6B 4K23L 4U1JA 3SDDD 1I4FA 1S5HB 3MV11 3O9WA 4P5MA 1S9WB 1EEZA 5C07A 2WANA 5D2NC 1W72A 3WUWA 5GS0L 1BLNB 3GO1L 4YO0B 3VGBA 2IJ0C 1PQZB 4YBLC 1CGXA 1KJ2A 5EO0B 3S5LB 4Z6AT 1SEBB 4PJCA 4JY6B 4ZO9A 2GTZB 1JYXA 3O4OB 2GCYB 2PYED 5GZNC 3LKRA 1A3RH 1KB9J 3RWJB 1KCRH 5ECJE 2B5IB 2NY4C 4EDWH 2OQJB 2DQGL 2YS4A 3HN3A 2LFGA 3NVQA 5C09A 5CJQL 3MYJA 1ADQA 5EOCJ 1Z3GL 4JN2A 1IGTA 3FFDB 1PFCA 4OZFH 2G2RB 3DLQR 4NQUA 2UWEF 3HCVA 2VXQH 3QQ4B 4X5LA 4X99B 3MV7E 3S34L 1JGDB 4LSRH 5FO8A 2WP3O 1XAUA 2FGWL 3MJ9H 5DD3H 2DYPD 5BQ7A 5IW6A 4JQIH 3DX6A 4D3CL 3LH2H 4IDJL 4ZFZB 5CD3A 1M7DB 1X7QA 4Z77A 4AG4L 4DZBA 5LWYH 4KU1A 1EEUA 1G7PB 3R06B 2IH3B 5D2NA 5D1QB 2GSIB 4U0RB 2FD6L 3TH2T 3BESR 5D7JD 3H9SD 3F65A 4K8RH 4EDXA 3TZVB 5D70H 2X10A 3VD5A 5FYKL 2ZUTA 1WWCA 4F33A 3OB0K 1MLCA 1TZIA 1LK2B 2WWKO 4P3WA 4OFIA 3UTPE 3OKNA 3MA7B 4NNYA 1NLDL 3U7AA 3RWHB 4ODVH 2NX5E 3NAAH 4PJEB 3TBVA 3TJHC 2X4PA 4PTTB 4XNQA 1MHHB 1H5BA 4PREB 3VDBA 4J1UA 4HK3J 3MRJB 1CL7L 5B21A 1T0NA 5D7IE 5E2VL 4LEOA 4I9WD 1XIWC 3KG5A 1ED3A 1QSEE 3KS0H 4QF1A 3JUYA 1Z9LA 2JJWA 1Q9KA 5LBSH 1FZOB 3MCLL 1IGFH 5DQJA 4NN6C 5A16B 1WAAA 3CXDL 3O3EB 5LCVL 1I8KA 2X4SA 3EKCA 5ACZB 1P4BH 2MHAB 4TOYH 3ARGD 3MUHL 1UCBL 4QRUA 3QAZC 1MJ7H 3OAUL 1Y6KR 4ZO7A 2HVKA 2L7JA 1A1NB 5E94B 2QHRH 2Q8BH 3K8LA 2GUOA 1A6WH 1N3NB 1QBLH 2NZIA 3K2UL 3X3FH 3VD9A 1MWAA 4MJ5A 5TDOB 4ZFOA 2BERA 1G9NH 1U58A 5A3IC 5K59F 2JELH 2Y07H 1NFDE 4A2LA 2E7LC 2GEEA 5CZVL 1HSBA 4YH6A 1YNTA 3B2VH 3U46B 1MY5A 1KIUA 1T2QL 4XAWH 3ARDD 4ZSOA 2XN9A 2VLME 1OPGL 3TV3H 3DETD 1FL3A 5HYFA 1FAIL 3V5KB 2M2DA 3L3KA 3KPSA 4X4ME 1FP5A 4M61A 1KPVB 3I6GA 4LHUA 2WW8A 5D2LE 1NCWH 1CR9L 3KGRA 1YPZB 4JZOA 3LKQA 1J1OH 1S7XB 3GSQA 4S11A 3VFOB 2OR7A 1UEYA 4LNVA 5MEOA 3CZFA 2FWOA 3MLWL 2HKHH 2P45B 4AEIH 4Y4FC 2XQBL 3MNZB 4Y4KA 3V95A 3HI6H 4QRPE 1RY7B 2CLVA 5HVGB 3FT3A 5C9JA 5DF0A 3FQWB 3TN0B 3BP5B 5IHZB 4OLYL 3FB6A 3N1MC 1NCAL 1FE8H 2PW2A 2BOBA 1EO5A 35C8H 1ZWIA 4LQFL 4EVNA 4NN5B 4MSWA 2BC4B 3IXTB 2E7LA 3KVQA 5IB5B 4M48H 3H2WA 4V2CB 5ICXB 4LSTL 3P73B 4YHKL 5DD6A 4H1LA 3FZUC 4X0KB 2WBKA 1G7JA 1YY8A 5J9PA 3TEUA 1JHLL 5HI5C 1SY6H 5EUOE 3DRQB 3FQNB 4WEUD 2I07A 3O3DA 4LLQB 4XH2B 5HJ3A 1I7TB 1DVFD 1JPGB 4Y4FA 1HK6A 3K3QA 1FHGA 1BJ8A 2R56H 3THML 4NJAL 1IE5A 1KENL 3FQXB 1W0VB 5SWSE 1GAFL 2Y5EA 3RWEB 5ANME 2X7LA 3WXWH 3CSYB 3M45A 3T2NH 3BPOC 5EOCH 3D69A 3HUJF 5J56B 1ZANH 4TNWF 5ALCH 4YHLH 4GSDL 1NAMA 1UWXK 4O4YH 2O5ZH 1KCKA 3VXTA 1SMAA 4YR6A 4TSCL 3L3DB 5B4MD 4JZNA 3S88L 1UQSB 1V3JA 4NT6A 3IAGC 3WKMH 2Q76A 5I15L 4K3DH 4NQEA 1M71A 3CLEL 5EFIA 1IBGL 3QI9B 4MNQD 4RQQA 3ABZA 1YEJH 5FGCB 2HAZA 3D39B 4YQXH 4MVBD 4PJAA 3F8UB 1YZZA 3IJHB 1A4JB 3GMOA 4HD9A 4OCXH 4X4YB 3HE6B 1K3ZA 3QISA 3L5JA 3QDJA 1UZ6E 1U3YA 4FQHB 3ZZ1A 4GXVH 1I3UA 2EDJA 2GJ6A 5F93C 1JYVA 3O4OC 4N1CA 1AKJB 4MNHA 4M7JL 4HULB 2QLVB 3PL6A 3ARXA 1SBBA 4MQSB 2B5IC 3OJDB 3SGEI 32C2A 2XZQL 1IFHL 3FOMB 3TO4D 4PJ7B 5DR5L 3BZFA 4OZHB 3HZYA 1JTTA 1KB5L 1M1SA 3GBLA 2Q86B 3KJ6H 4QYOB 4G7YL 4OLZL 2IGFL 5J1AA 5BVPH 5CCKH 1S5HA 5T1KD 5CD5C 4RMSA 5D1QC 1EIBA 4F7PB 4U0RC 2HRLA 1BLNA 3TZVC 1PQZA 5HYQB 4G8GD 1L7IH 5EO0A 4MQ7B 1BEYH 3S5LA 5E6ID 1MREL 4J3WA 2J5LB 4JY6A 4EUPH 4Z5RB 4N0UE 2GTZA 5DD0H 2GCYA 2QQLH 2NY7L 4P9ML 3S97C 4JO2L 4AYFA 4PYGA 3RWJA 3NFNB 5MENE 2OQJA 4NWTL 4P9HL 3V7AG 1CE1L 5AYUH 3VG0H 1TVHB 3CIQA 1YEHH 1FCGA 3QCTL 2R0ZH 4L29A 3FFDA 1MNUH 5E5MB 2AW2A 4H8WL 2NXYB 2G2RA 4OZFB 3O4LA 4WI3A 1PKQB 4HIXL 4RGND 1JGDA 3HI5L 4Q9CA 2BVUA 1LE9B 4CBPA 1DQDL 1DQJB 2H2PD 3ULUE 3F6IA 3Q1SL 2DMCA 2R4RL 1CDHA 1JYWA 1DFBH 3R06A 2IH3A 2V5YA 1YY9D 1RZJL 3F5WB 5D1QA 1EEQA 4HJGB 5E1AB 4G6AD 2DB8A 3DOSA 5GGQL 2OJEB 3MX0A 3WLWC 3TZVA 3S35L 4K3EH 2VYRE 1ZTXL 4LAJH 4KJQD 5I76B 5INDB 4OFKA 5I1AB 3GMNB 4KKLC 1FCCA 4Y5VB 5FHBH 4PJEA 4LVNB 2KL6A 4NC1C 3QXDB 1D5IL 1UM6L 3B9VA 4LU5H 4PTTA 3KYOB 4N9OB 1MHHA 4RIRB 5GRJH 3NIGF 2CUIA 4PREA 1E4JA 1RVFL 2BVQB 2A9MH 2WBJD 2G60H 2FCBA 3PDDA 3MRMB 4AZ8A 2AEWA 2LVCA 1WAAF 5GIRB 1MFCL 3C2AL 4N0RA 2HT4D 1FZOA 3TJEH 5A16A 4X4XB 1DBBH 3IU4H 4NQDB 2HH0L 3GSRB 4NRZB 5ACZA 5JHDD 2MHAA 3SPVB 4WFGD 4OIIH 4F8QA 5J6HB 4M8QB 2YUVA 2FZ3B 3TN0C 3V2AR 1A1NA 5E94A 1XF4B 3ILPA 3TBTB 2AI0H 4R4FH 2D31B 5GISH 4K7PL 1N3NA 4QOKE 3WFCL 4NN5C 1RUMH 2G5RA 4RX4D 5TDOA 3I84A 4WW2B 1O7SA 4KHTL 3STZA 5A2LH 2GK0B 4OT1L 4KAQH 2YC1B 3U46A 4PJBB 2BDNH 4YXHH 4Z78B 1KGCD 4P4KB 3IB4A 5AAMA 1DBKL 3HMWL 2EDNA 4FQ2L 2JE8A 4DKEH 1KPVA 3HMXA 1BZ9B 2OMNA 2BX5A 1I1YB 4HV8B 3ULVL 5AYQA 2DWDB 3MGAA 3VFOA 5GS0H 4QHKI 3GO1H 1LO5B 3HE7B 3MRQA 1TETH 5F3HB 1DANT 5T1DL 3OKYA 1AHWB 3GKWH 3X3GL 1TVDA 3MNZA 1A6TB 4EKXA 1B9ZA 4EQ2A 1LP9E 5I8KH 3LKNB 4MDJB 3NBNA 3FQWA 1DBAL 5IHZA 2FL5A 5TE6L 2VQ1A 1OAZH 1VB9A 2VZ3A 1AGDA 3BKMH 4BK4A 3RY6C 3JTTB 1FNSL 5GS2D 5CJQH 3IXTA 3VRIB 4FQLH 5IB5A 3VRJA 5C0DB 1J5OL 4XVSH 1IGCH 2DM4A 3P73A 3RVVC 2FECI 4LVHB 4NM8H 3S34H 4YLQT 4POUB 5E9DB 4G7VL 4X0KA 2GTWB 2FGWH 1FAKT 3CUPB 3FAWA 4CKVX 1KFAL 2QHLA 2BVTA 3QI9C 1KC5H 3N9GL 1FL5B 4KDTC 1G7MB 3WJJC 4X4ZA 3FQNA 4FFWD 3FRPG 4XH2A 4HIJB 1P4IL 3HE6C 4KI5D 3WIHL 1JPGA 5FYKH 4Q6IB 1WC7B 5CINH 3DJ9A 2ORBH 4M43L 1PW3A 3EHBC 3TT1L 3FQXA 3ULUD 1W0VA 2J8OA 1OTTD 2WIMA 3C5SB 3RWEA 1NLDH 5I1CH 3CSYA 4UBDC 4HIIB 4CW1B 1MCNA 3RY6A 1VSCA 2H1PL 5F7LB 2HT2D 1BD2B 4OFYA 3KLSA 2WUCH 4KK8D 3WV0A 1NCBL 5CGYD 1X4YA 1B2WH 3QJHB 2Z8VC 1CL7H 3L3DA 1XR9B 5DEGB 2W1NA 5KVGH 1UQSA 3E3QC 4MAUL 5C0NC 5C08D 2QADD 2VL4A 4M3KB 1XCQB 4MZ2A 3OKMB 5F7NC 1Q9OB 5IG7B 1ZSDB 5HGDB 1IVLA 3MCLH 4M7LT 5IB1B 4J4PC 3D39A 1F8TL 3MRCB 4KDTA 3WJJA 4I3RL 3CXDH 2R23B 4M7KL 1KIQB 5DJAB 3IJHA 1CFBA 1A4JA 4HZAA 5EULV 4M00A 4X4YA 1PY9A 3HE6A 4Z7WE 3VWKB 5F6HJ 1DQMH 4PJCE 1KV3A 1ZV5A 3KYKL 2J5LC 4FQHA 3DUUB 1FC1A 3OAUH 4O9HH 4RZCB 1GGBL 3PDGA 3LN5A 1B0GB 1X5HA 25C8L 4OV6F 3MNVB 4PRID 3VH8G 1BVKA 1Q9LB 1MH5B 3BP4B 3LSOB 1J0HA 2XTJB 1YUHB 3VXUE 1JFQL 3CDYA 1OPGH 1REIA 3FT2A 1NAKH 3GNML 4OZHA 1ZVYA 2NXYC 2YD8A 4L4TD 1MJJB 3OKKB 2Q86A 4X6CB 4DUVA 1CR9H 2G75A 2ID5A 4PJ5D 1JZ6A 4QYOA 1NC2A 3V0VB 3LEXB 1A6AB 3PDOB 2AQ2A 4ZS7H 1OB1A 2VZSA 4J4PA 5D2NE 4OUUB 3BZ4B 1OLZA 3DXAB 4JFHE 3MLWH 1F6AB 1EJ6A 1OT1A 5IQ7L 2PTTB 4QXTB 4K8RC 1NCDL 5BVJA 3AFLA 5HYQA 4PJGB 1N6UA 3IS0X 2MWCA 4MQ7A 4FN0A 4AM0B 4XPFH 1X3DA 1EUTA 1NCAH 4EUPB 1YEDB 3VXMB 1EUUA 4B41A 4F2MB 1P6FA 2CH8A 1EVUA 2E7MA 4CGTA 1ES0B 4HH9A 1AGBB 3MBED 4E9LA 2CPCA 4KK9C 4KQ4L 5I66B 4XP5H 3NFNA 4Y5VC 4L4VA 2FJHB 4LVNC 4ZUVA 4UB0L 4K07A 1TVHA 4Q0XH 4LSTH 2I25N 2H45A 1FIGL 1MI5D 3QNYA 4YHKH 5E5MA 2AGJL 1Q9WA 4OZFA 3VI3E 1WITA 3TNNB 4PB0L 5ICZA 4GQPH 4GG6B 2P5ED 2CXKA 1LE9A 1DQJA 4BFIB 5FDYA 2DQUL 4S1SL 4D9LH 3M1BA 3VFTB 4MB3A 2EIZA 3K0WA 1HOCB 1RZKL 5I9QB 2LABA 2DBLH 2E3VA 1TQCB 3HZKB 1EH9A 4HJGA 2OJEA 5ISZB 2CR6A 3THMH 1BF2A 4MLSA 2P4AB 4Y16A 1GAFH 3QNZB 3QQ9C 1WBXB 4PJEF 1N26A 5I76A 5INDA 3GMNA 2C1PB 3NCYS 1M6OB 4PP1C 2GHWB 4Y5VA 1A5FH 4WW2C 2PO6B 1H0DB 1MIEL 3QXDA 3KYOA 5DDHB 4RIRA 2GJZB 4ZSOE 3DX8A 2XN9E 4PJ9D 3G5YB 3GJFH 3N85H 2BVQA 1PG7W 4NZUH 4P4KC 3S88H 1CDYA 4L9DA 4KMLB 1OARL 4KK5C 2Q1EA 3VXRD 1FLRH 3MRMA 1H8SA 2ZCKL 3KJ4B 3LKSB 5T3XD 4Y2OA 4HS8L 1IBGH 5IF0B 1INEL 2ZUQB 2BNQB 2YBRB 2X44D 2DICA 5EA0L 4JFOB 4XHJD 4DK6A 2EDRA 4KKBC 4BYHA 3HB3D 3HE7C 4YBQD 1QFOA 4QTIH 1T66C 4FQPA 1AHWC 5DS8B 4HKXB 3GSRA 4NRZA 3IKCB 4XMKL 5D9SB 4Z7QF 3SPVA 2BXZA 1FYTD 3PHOB 2R2EB 2X6MA 4M8QA 4IOFD 2FZ3A 4UT6L 4X8JB 1HKLH 4YJZL 1XF4A 2EC8A 3TBTA 3H9YA 3KPRD 2D31A 2IH1B 1R0AL 1L0YA 2NY5L 3WHE0 4W6WB 4LDEB 4WW2A 1IFHH 4Z18A 3IRPX 3GUTB 3TBWB 5DR5H 5JA9A 2GK0A 2AJZB 2YC1A 4KRPD 4W6YB 5BZWB 4PJBA 4Z95H 4Z78A 1KB5H 3PQYD 4P4KA 4LVHC 1NGYB 2O5YL 4MXVE 4K3HA 1YPZF 3GSVB 4XVJH 43CAB 1YECL 3TH3T 4G7YH 5CEZL 5JIHA 2IGFH 5BRZE 1BZ9A 4WU7B 1P2CB 4XCCL 4HV8A 4LLMB 4PRPB 2X70B 3U30B 5EIIB 3PHSA 4P46D 4ZMAT 2XT1B 5HHOB 1UA6H 1LO5A 3HE7A 2LQRA 4WY7H 5F3HA 1AHWA 5KTEH 3IS1X 4Q6IC 1A6TA 4QRRD 2V7NB 1U6AL 3T65B 5C2BL 4MDJA 5KJRH 5GZOC 4P9MH 4JO2H 4V1DB 3ZKQD 3CPLA 1FRGL 1A0QH 4LIQL 3JTTA 2VITB 4QRQB 1IC4H 3WHE1 3IJYA 1CE1H 4GFTB 1XGYL 1KB9K 3NFSL 3VRIA 4GAYA 5DHYB 5TQ2L 4XCNB 3ZE2F 4HF5L 2ITCA 5DXWA 5C0DA 3KWWA 4NJ9L 4QNPF 2YK1L 2XYCA 1K6QH 5IMKB 1N7MH 2VLKD 4O2CB 3HI5H 5TGBB 3SJVE 2DLGA 5E9DA 2GTWA 4NQEE 1BFOB 1Q94B 1DQDH 5J1TC 3Q1SH 1OWWA 1W0WB 2X4OB 4M7LH 2R4RH 4PY7B 3MV8D 4PJAE 1FL5A 3GRWL 1G7MA 1RZJH 3GBML 1SY6A 3QT2A 3A6BH 2OZ4H 1NFKA 2J7LA 1L6ZA 4JR9H 4O58H 4HIJA 2ZNWA 3VWKC 4LSQH 3S35H 1LEIB 1GH7A 1WC7A 4QXGH 3MRFB 1ZTXH 4NBXB 5E00B 1TCRB 1BQHA 1QSVA 1H3PL 3C5SA 2FO4B 1UXWB 1QUNA 4TNVK 1ZMYA 3FFCE 3I02B 2WWMD 4HIIA 4MJ6A 4ZD3L 4CW1A 1AGEB 4KXZH 1UM6H 6CGTA 4OI9A 1BD2A 5C6PB 2NXZB 1TNNA 2XTJC 4M6ML 3PWPA 4AEEA 2C3HA 3QJHA 3G6DL 2AK4D 2JJUA 5F88B 4DTGH 5I1LB 1RUQL 1XR9A 3T0WA 1JNHA 3D3VD 1KLFA 3ARWA 3H3PL 4YHIB 5CILL 4MB5A 3HNTH 2X9WA 2FIKB 3C2AH 3O6FB 5IG7A 1ZSDA 5HGDA 5DQ9B 4N0CD 5IB1A 1TTUA 5EO9A 1AGFA 1EGJL 2R23A 1KIQA 5DJAA 3B9DA 3VWKA 2J88H 5C0RL 3LIZH 1CN4A 3B2UD 4LL9A 3DUUA 4DN3L 5LGHL 4XNZB 4R7NB 1B0GA 4G9DA 5F96L 3WFCH 4Y4HB 4UT7L 4PJ7F 3MNVA 4KHTH 4YXKL 1Q9LA 1MH5A 3C87A 3SE8L 4OZHF 3LSOA 4MA1B 4R90L 1Y6MR 1YUHA 1DBKH 3HMWH 3TC9A 3O4LE 4FQ2H 5LAXB 2YMXH 1MAML 2LV4A 1DQLL 1MJJA 3BDXA 3OKKA 4X6CA 4GBXA 5T5FL 5DFTA 2GT9B 3ULVH 3LEXA 1A6AA 4WWKD 1OTUD 4WEMB 2VE6B 1ZHKB 3P0VL 4KPHL 4LCWD 4R9HA 4OUUA 3BZ4A 5I9QC 3DXAA 1MQKL 4MAYD 1F6AA 4JFED 3SKJL 5T1DH 1TQCC 2PTTA 5DD5L 3X3GH 1J9CT 4QXTA 3QA3B 1WVZA 3BO8A 3IFNL 2ED7A 4PJGA 3UYRL 2ERJB 1UH4A 3GJEB 2WSKA 4AM0A 1D9KB 4XXCC 2KUTA 5FM5M 4CNIB 5GS1B 5TE6H 4Z7OF 4EUPA 3V5HB 1YEDA 4P3DB 3VXMA 4ZUUB 4BKLB 3UAJD 2IQAB 1ES0A 3V6OA 2R2BA 3SY0B 1AGBA 1FNSH 2F54B 1TJGH 5I66A 5AD0B 3TWCL 2PO6C 4L4JA 2DQTL 1J5OH 1ONQB 4LARL 3CD4A 4URTB 4I13B 4TTDD 1WIPA 4X7CC 2CQVA 5GRZA 3MRBB 4PG9B 4G7VH 5EZOL 3W2DL 4OZIE 1KFAH 3KJ4C 4YXLH 5AWNL 4AJ0A 1HQ4B 1I7RB 2ZUQC 1HINL 4BFIA 3LV3B 3N50A 1A6UH 5E8OB 5JW4R 1HOCA 1MVUB 3AB0B 2F8VA 2PTUA 2WMPA 3B9AA 4AIXA 3WIHH 2QSCL 3P77B 5ISZA 2K3TA 1QG3A 5C9KA 3LKPA 4M43H 4RAHA 1OAXL 1HZHL 3TT1H 4XB8A 4ZOCA 5JOPD 3QNZA 1IKNC 4KVNH 3VGDA 4XXCA 3MREB 3QFJD 1WBXA 3H7LA 2A83B 2AV1B 3OQ3B 5JOEA 1KG0B 2C1PA 3T8XB 4HLJA 1DR9A 4K71B 1M6OA 2BVPB 1WBYB 4L1DA 4LPTA 5EZIH 1H0DA 3L3HB 3ZDZF 5D4QA 4OUOA 1EO8L 2X40A 3JVGC 3WS6C 4GKSB 2MTPA 2GJZA 3G5YA 1FG2B 3GJFB 3VFMB 3UBXB 4C57C 1KIRB 4HPYH 1JNNL 2HRPL 4WI2A 1KPRB 3C9NA 1TFHA 4NZJA 3RNKB 4BA8A 1CGTA 4AH2B 5IF0A 3L7EB 2OP4L 5IBTL 1HIMH 2BNQA 3VWJD 2YBRA 1F8TH 3U30C 1B6UA 4I3RH 4JFOA 4OD1L 4ODTH 4Q6YA 5GS0C 1ITCA 4MD0B 2R0WL 5DS8A 3U0PB 4HKXA 3IKCA 4JPKL 5D9SA 2OXGA 1J88A 1GGCL 3HNSH 2OJZH 2VXVL 2WLZA 1IKNA 1FC2D 3PHOA 1A3LL 4N5EC 1GGBH 2R2EA 3BN9C 1OSPL 3TVMB 3OKOA 4X8JA 4EBQL 1J1XL 1RUKH 3GFUA 4EQ3A 2LU7A 4WW2F 2Q20A 1NUDA 1CGUA 2IH1A 5JORB 1HHHB 5TE4H 4PJBF 4QHLB 3HC0B 3AS1A 3KHQA 3GUTA 2IAND 3JVGA 3WS6A 4F58H 2AJZA 4F57L 1H8NA 2R0KL 1T1ZA 5BZWA 5H37G 4OKVB 1KB5B 1NGYA 3GSVA 2CUMA 4FTVE 43CAA 4NBYB 2V2TB 4XI5C 3QEQB 1T7ZA 4W81A 4WU7A 3VFRB 3WCYA 4LLMA 4PRPA 2X70A 1G84A 5IQ7H 4WUKL 2FECL 3ZHDA 4JY5H 1NCDH 2NY3D 3RVUD 4PJDB 2XRAL 3RWFB 3ZE1E 3KPPB 2B0SL 2V7NA 4OZ4B 1R3HA 3T65A 1NMBH 2BVYA 2PXYB 4XPAL 2OK0L 5L9DH 4V1DA 2X89D 2K9UA 4MCZB 1FFPB 5IUSA 4WFHE 5BMFL 4H5SB 4P99A 2VITA 4QRQA 4UB0H 3MV9D 4WHYG 4D0CB 4K3JL 4WFFE 5T3ZD 5LVEA 1BFTA 2NXZC 2AK1L 3NABL 4U3CA 5DHYA 4MXQC 4XCNA 2IC2A 4XBEL 1GGUA 2W91A 2VDKL 3B83A 2L4OA 3D85D 3OJVC 4S1QL 5FYLD 4PRHE 1YJDH 4Z7VB 4PB0H 3SE9H 5IMKA 5TGBA 4O2CA 4HFWB 2C9AA 1Q94A 3GSXB 3O6FC 2DQUH 4P2RD 2X4OA 1W0WA 4S1SH 5FGCE 3CJJA 3U9PL 3D39E 1RZKH 1OGTB 4OLEA 1A7BA 1RZFL 4YFEA 3O8XB 1Z5LB 3QQNA 4DFHA 1EK3A 1PSKL 1LEIA 4NQCE 5L2KA 4ODWB 1K8IB 3MRFA 1K4CB 2X9YA 5E00A 4X6FB 1TCRA 3QG7L 5DHVH 1W2KT 1OT2A 4XNZC 3H6JA 4Y1AB 4JHZA 4MA7H 3I02A 5IW1A 2I9TB 4Y4HC 2AQ3A 1AH1A 4HJ0D 1MIEH 1BREA 5DMYA 3EGSB 1L9NA 4R26L 4MA1C 1ORSA 1QFPA 4HKBA 4U2ZA 3QIUB 5F88A 5I1LA 2WM0A 2ZCKH 5ACMA 4FQIL 4HS8H 4YHIA 1INEH 3T3PE 2MOVA 5KSUB 3STBA 2F53B 2FIKA 3O6FA 4NQVB 1RI8A 2FEDD 3MRNB 5EA0H 4G9FB 4TNVF 2JCCF 2R4SL 5F9JB 2H6PB 1IQWH 5B39G 4YUEL 3E6FB 1I1AD 3L9RB 2ERJC 4PP2B 4PLOB 4S2SA 4C58B 3ULUL 5E08L 3L3OB 3HS0B 1D9KC 1FGVH 2YPLB 3LDBB 5GS1C 1WWAX 1K2DB 3QWOB 1MSPA 1T22B 1MFDL 1U8NB 3ELAT 4R7NA 2IAMA 5KANI 1R0AH 2NY5H 4L4VE 3W5NA 4Y4HA 4LPYA 3E0GA 2CSPA 5JIKA 5I8EB 2R1WB 1L9MA 1WTLA 3U4EB 3FT4A 4UV7L 4CVZB 4X6CF 2DTMH 3EFDL 1JI2A 3PGDB 3WNLA 4HUWA 4U1MA 4E41D 3MRHB 3S7GA 5CEZH 1MRCH 3MQIA 2ILLA 4GAJL 2GT9A 4UIKL 2G9HB 4H26B 1QRND 4WRLA 2Y5TA 4PR5A 3QG6B 5F8RC 3UYPA 3QDMB 1ZHKA 3AB0C 4XVTL 3HAEH 4PJGF 4JN1L 2ZCLL 2CDEA 3VJ6A 5K9JL 2A0LC 3IFOA 4I18B 4NPYA 5DVKA 1ZHLB 3QA3A 4BELD 2AS5M 1F2XK 1U6AH 5C2BH 5FXCH 4A6YH 1PKOA 3ME0A 4MJIE 3C2SA 2LTQB 3DVNB 1D9KA 3OGCB 1BM3H 4CNIA 5GS1A 5FK9B 2AJUH 4O02H 1EMTH 3V5HA 4P3DA 4ZUUA 1FRGH 4M1DL 4BKLA 2IQAA 2QBWA 3SY0A 4OI8A 3BX7C 3U83A 4K71C 1PDKA 2F54A 4D2NA 1QD0A 1OF2B 3D1MC 5D7SL 3NFSH 1FFNB 3UC0L 1YC7A 2MQ0A 3AREA 1ONQA 2FSEB 3FO9B 4KUZL 4NJ9H 5A2IH 5I19H 1S7SB 1JV5B 4GG6F 4U1HB 3MRBA 5E2JA 5L88L 4HG4J 1KN4H 3LMJL 1K8DB 3O6ML 3WXVH 2VH5L 1I7RA 1NEZG 1Z9OA 3GRWH 3GBMH 3LV3A 5E8OA 3DPBA 1QP1A 1T0MB 1MVUA 2K7PA 3JWNC 1OAUL 5KSVB 2HA1A 2FIRT 5GRUL 2APXA 3P77A 3KDMB 3PWNA 1XF3B 4JFFD 5A2FA 2PTVA 1YYLL 4S10A 4PJHA 3MCG1 3MOQA 4MX7A 3VXNB 4C54A 3CXHJ 4JFDB 3TVMC 2J8UB 4NRYB 2A83A 2AV1A 1A8JH 3NFPB 1J7VR 5EBLB 2VC2L 1KG0A 3T8XA 5DMGC 4NKMB 1F58L 3Q3GB 2AV7A 2BVPA 1WBYA 3L3HA 3N1GC 2APWA 1QSFB 1A3QA 3NZHH 1RUQH 2CXGA 1FG2A 3GJFA 4KMTL 3VFMA 1KIRA 3H3PH 5CILH 1KPRA 4JPVL 5KS9F 1FBIL 3RNKA 3SGEH 4R8WL 5IEHA 4Z0BH 3L7EA 1RHHB 2P1YA 4JGMA 3GK8L 4PBVC 3DGGB 1HI6B 3C60D 3Q5OA 3HG1D 1MEXH 5C0RH 1KULA 4KQ3L 4MD0A 3U0PA 1D6VL 2RIKA 1CXFA 3ARFB 3VFWB 2HMIC 5L8KB 2PXYC 4C56B 4DN3H 3OJ2C 5DRXA 5LGHH 5BS0D 4KJWD 3RVXC 3TVMA 3ZT5A 4LMQI 2AEQL 4KY1L 1EHNA 3QZWG 2CGRL 2X5PA 4LRNL 4R4BA 3WMSA 1TXKA 4NP4L 3CFIC 5J7CC 5JORA 4Y19B 1HHHA 2I26N 2YD9A 1AQDB 2VSDA 4R90H 4UTAL 3GBNL 4QHLA 3HC0A 3V9FA 5B38B 1CTOA 2YPVL 1MAMH 4H8WC 1DQLH 3RZWA 3OBAA 3K46A 3QUML 1GPOH 1KB5A 3VXSB 5K9KB 1YNLL 5T5FH 1DBML 1LHZA 1KBGL 3IDXH 5DJ2B 1UGNA 2ESVD 4BH8B 2YD6A 3BH8B 3DO7B 3QEQA 5C0AD 5HTSA 3VFRA 1MCIA 3QPQD 3BSZL 3ZL4H 3NCEB 5ESQB 1MQKH 4NWUL 1RZJC 4KK6C 3EYOB 3O8XC 3K4ZA 2Z31D 3IFNH 3LRHA 4Q2ZB 1A22B 3UYRH 3MC0A 1UCTA 4PJDA 5HYJB 3CCHB 3R4DA 3C5ZA 4OZ4A 2PXYA 3F7YB 4RSVA 1QACA 1A6ZB 5CWSA 4FXKB 2EZ0D 4WDIB 5GSRB 3KLHC 1YEKL 3EZJB 4RA3A 4ZUWB 4JRXB 4KKAC 3U9UB 4MCZA 3FN0L 1FFPA 2VDQL 4CDGC 4H5SA 3TWCH 4NO2B 4D0CA 2PN5A 4J6RL 2DQTH 3PG2A 1MCOH 4JO3L 1HKFA 1EZVX 3PWPE 3QUXB 2C26A 5DZLA 5KVEL 3QIUC 5DUBB 1HE7A 2DM3A 3L3IB 4BSJA 4FG6C 4Z7VA 4NZRL 4ZAKA 1A6VH