3TFKD

42f3-p4b10/h2-ld
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
239
structure length
239
Chain Sequence
AVTQSPRNKVTVTGGNVTLSCRQTNSHNYMYWYRQDTGHGLRLIHYSYGAGNLQIGDVPDGYKATRTTQEDFFLLLELASPSQTSLYFCASSDAPGQLYFGEGSKLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H2-Ld SBM2
publication title T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
pubmed doi rcsb
source organism Mus musculus
total genus 54
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tfkD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tfkD02
1Z0MA 1MVUA 2WAHA 4NKDB 5E2UH 3BP7A 3L5XL 3MLSL 2E9JA 1QSVA 3UMTA 2W65A 4KRPD 4E5XA 4N1CA 4M61B 3KYKH 2XWJA 3BRDA 1G7PA 1KLUB 5JO5B 1JCKA 1LQSR 5CGYC 3MACL 3L5JA 2J88L 1KOAA 3IDYC 1S78D 3QQ3A 1UM6H 5D2NB 3MO1B 1OTUC 3QG7H 5CEYB 2AK1L 5FA4B 5IEHB 1FNSL 4NQEE 3LKPB 3TCLB 2DS4A 2F9BT 5I1EL 3D3VE 1CG9B 1CF8H 3CZFA 2I24N 1IM3A 1F4XH 3V4PL 4L9LB 4NQXA 5D96B 2MCPL 3JWDL 5HGHA 5IVXE 4AK1A 4QWWC 2X40A 4Z7WF 2C7UB 1LP9F 4NM4L 4I9WD 2WIIA 1JGVL 3KPOA 4J4PA 5EZOL 1A6AA 1XF1A 3QIWD 4UINL 4PJBA 3VXSD 1X5XA 4FQ2H 4WWID 1G7MB 2ARJQ 1A2YA 2GSGA 4XCNA 5EZIH 4LHUG 1BD2A 4ZPTA 1Q9WB 1RD6A 4JFEA 2CPCA 3M17A 5E2TH 3JTSB 5J3HC 4M4PA 4R96B 5D2LA 1YUHA 4CAGA 2B5IB 1EHLH 5HVGB 3EYOB 1YEJH 3I6KB 4NZDA 1I3GL 3R06B 2P5WD 5BOZG 2R1YB 1TJGL 2VZ3A 2X4OB 3OKNA 2Y25A 3WUWG 4HK0B 1DDHB 3EO0A 4ORGA 5JOFA 1HHGB 3HCVB 2O61A 4GQ9L 3KPSB 4U05A 4M43L 3IDNA 1A4JA 3CK0L 4ZQKB 5HDOA 1UJ3A 1EGJL 3NPSC 5FM5O 1C7TA 4PJ8C 3TNMA 3M07A 5TE7L 2CR6A 2J8UA 1M1SA 2X4SA 4YHIA 5FECB 3ARWA 3HRZA 3GSVB 1RJLB 1INDL 2GT9A 4KQ3H 5J1AA 1Y0LA 4GKSA 1IGML 1CVRA 4UU9B 3GK8L 1S7VB 3MLXL 3F5WA 5F7KC 5EUOF 3E3QC 3O8XB 2VDNH 2EYTA 5L2KD 4M6AA 3QNYA 1R3LA 3NZ8B 2QADD 2BVQB 1BX2A 2NQCA 4EI5C 2FWOB 5IB3A 4G5ZL 3ULUC 1FLTX 3KPRA 4Z7QF 5E5MA 4LCWA 5GGSA 4ENED 1XGQB 3O3EA 2DIJA 1N5YH 3CVHH 2WLZA 2DQDH 3RI5F 2XN9B 1OPGL 3FRUA 3KR3H 3RWJB 4XVUC 5J6GA 3HMWL 3RHWK 1G84A 2VWEC 4PRNA 1UWGL 4YC2B 3T8XA 1U8OB 1G9MC 5IJVB 4MAYB 1XFPA 4UDUA 3H9SD 2MSPA 4OF3A 3PWLB 5I71C 2VUYA 1OP3K 1HINH 1I8MB 4LKXB 4F33B 4WJ5B 4U1KB 5IQ9B 1EH9A 5KVFH 4ERSL 2EZ0C 2DQIH 3EFFB 5FO7A 3A6BH 1FO0H 1J7VR 3V6ZB 3AXLA 4K71B 3SKMB 1O7SA 2XZQL 1SJHB 3SBWA 4BQ6A 4D9LL 3EJYD 4YE4L 1KJVA 2PYEB 4DAGL 4P0DA 3N06B 1J5OH 4P2OC 4WNQB 5GIRA 2HT3C 3DVNB 4KJPD 3ULVE 2ZNXA 1K5NA 2R23B 5DR5H 1G6VK 4R2GC 1OGTB 2V5SA 4ODWB 1IGYB 4ALAL 4N0UA 3QXVA 4AJ0A 1QRKA 2QSVA 4Q6YA 4ODSH 4QXWA 4ONGL 3EOAB 5DK2B 1B88A 3JV6A 3WSQL 3FQXA 1R5IB 3FRPA 5C7XL 2F74B 2D31B 3EOBA 3ZYOA 3MCLH 3B4NA 4ZFZA 4WI6A 4D9QE 5E5UB 5BRZE 3BKMH 3OXRB 1QSEB 2CDFB 3D18A 1Q38A 2E7BA 3CU7A 3VXMB 4P46D 4D0BB 4NKOB 5CSGA 4PRIB 2Q20A 5E2WL 1U3HA 1WBZB 2A77H 2VL5A 2WINA 1GIGL 4P48A 5D4QA 3IXTA 4NHCL 4BKLB 1JHTB 3VWJC 3QQ4B 4ZUTA 1VACB 3LRGA 4WTWA 3BZEA 1A7OH 4L5FL 3OPZL 2E7LC 3V2AR 5F89B 4O00A 3HFMH 5EH1A 5L8JB 2VXSH 4LEXL 4ZTOH 3QUMA 2VDOL 2QR0B 1RZIA 1IAMA 2ITDB 1H0DA 1NAKL 2J3SA 4OZIA 3Q6GL 5DK0B 3T65B 4FOMA 4HS8L 5F9JA 2D4DA 4X83A 4PD4K 1RURL 3DMMD 4O51B 4DK3A 2YPLB 2CLRA 2X4RB 1CGWA 3GRWA 1S5IL 4OF5A 5FYJH 3D0VA 3TBTA 1QFWL 4LHUB 4KMTL 1S9WA 4WU5B 2VDMH 4P2RA 4XPAH 3HNVH 1RU9L 2JB5L 4I4WB 3OKMB 4FFYH 3TEUA 1JWSB 3MRPA 3C8KB 3G6JA 5CSZA 2AJYH 3FT3B 1FV1B 3V6OA 2H9GA 3WUWB 1CDBA 2V2WB 3B6SB 1FG9C 4Y4KB 4KU1A 4WEBL 4EJ1C 5MHSD 1RZKH 5HYJA 2DQCH 1DQTA 4NHUA 4HT1L 2W07A 1KCRH 3KPPA 3UBXI 3BQUA 3UTSD 3TIEB 4GRMA 5IVXB 1D5BB 4U4BA 2H6PA 5GGRB 2AXGB 1O0VA 4OLYL 2O5ZH 4A6YL 4PJCA 1I8KB 3ARTA 3UO1L 3ESVF 1AGEB 1G0YR 4NQCB 3MNVA 3DUSB 2AJXL 4GSDL 5F7NC 4YDVB 3FOLA 4RSVA 5IMMB 2NXYC 1G6RL 4O02L 1HHHB 1HKLL 2X4PA 5MERB 3MV7A 5ITBH 4OM1H 5DFVD 3TBVB 2JTDA 4Q7DA 3MTRA 1BBJA 1N6VA 4OD2A 5CBEB 3TO4D 4KQ4H 3WFDH 5KSUB 3MRDB 4L4VE 3BO8B 3K1KC 2DQEL 3JV4B 2KDGA 3WCYA 4HIEB 2YN3A 1T3FA 1CGVA 1A6VH 5BW7A 1GRWA 1DQDH 1HN1A 1W0WB 4DGIL 1OAQL 2YRLA 4P4KB 4QRQA 4QT5A 1T03L 2I9TB 5KVDL 5T1LA 3BE1L 3D9AH 3EDJA 2OL3A 4ZSOE 5GGVL 3BD5A 2ICES 2V2XB 2W9DH 3ELAT 3ES6B 1QNZH 1X9QA 2LV4A 3QULA 2JJTA 2BVOB 3AS2A 3KYMB 1UC6A 4BQ8A 2IANA 3MODL 1D5ZA 1QLFA 1I9RL 4OFYD 2A6DA 3IFOA 3TA3D 5EC1B 1EVUA 5DJ2B 2FATH 3MACH 1HE7A 2IAMB 3Q3GA 2H3NB 3DV6A 2ADGB 2O93L 2XY1A 4XBGB 4XPHL 4TOYL 2GY5A 4QXTB 4F15B 1FNSH 1N0XL 3NH7H 5I1EH 3BVNB 2BRRL 2LE9A 3H9HB 3MRHA 4N9GA 4RCAA 3FZUC 5KANI 3JWDH 5FIEA 1QYGH 4TUOB 5DUML 1KTRL 4OCRL 2YPKB 5ACMA 5F7FA 3W9DB 4U1NA 1NLBL 1JGVH 4Y16C 3GBML 2IADB 3HI5L 4NC1E 1F97A 4ELKA 5DURB 3GI8L 2OI9C 4NQTA 3DRTB 4LLUA 2Q8AH 1G7LB 4V2CB 3RVTD 2Z8WC 1BVLA 4OLVH 4AG4L 3O4LD 4N0YH 4F9PA 1B6UA 3SKJL 5CD3B 1DBBH 1FFQA 4BK4A 4YGVB 2VR5A 1DQMH 4KJYA 4NQVA 5CAYB 4LSTL 2QQLL 4JQVA 1AHWC 3CD4A 1J10A 1FFPB 5IEKB 2GI7A 5JHLL 2AEIT 1J86A 1AKJB 4JRXD 4C56A 3UTPD 4H1LG 3QCUL 4EBQH 1YEFH 3MJ6A 3MBEB 4MQXD 2M1KA 3ZDZE 4PJDF 1A3QA 4KY1L 1M7DB 5MENE 1JPFB 3CK0H 3DSFH 2YOCA 4QTHA 3LZFH 4X0KB 3HZMA 1GGBL 4LLDB 1FG2A 4O58L 4RRPG 3TJHD 2DIAA 3LS5L 5ALCL 3RWCB 3KYNA 2NY0B 1EEZA 2AI0L 1Z6JT 1MCEA 4U1MB 4YHYC 4MXWH 2VLJE 3FO0H 3QIUD 3TN0C 2NX5A 3T0WA 3NCJH 4PJBF 3LPWA 3I9GH 4ONFH 1P9MA 4QXGH 2CKBA 3FO9B 1MJJB 1U58B 3IF1A 1AIFB 3O3UN 3HZYA 3QISA 4MNQB 1FH5H 2AV7A 3MJ7B 1FCGA 1OAXH 4KKAD 2DLEA 5LQBL 5EN2A 3T2NH 1WAAF 1Z9OA 5J11C 5BJTA 3T77B 1A3LL 1U8NA 2NZ9C 2VDRH 3BIKA 4P5KB 2GTZB 3MV9A 1MFCH 2R56H 3H3PL 3QJFB 3I84A 5J9PB 4JGMA 5DD3L 2NZIA 5GRUH 1KV3A 4HIXL 3OAZH 2PETA 2IGFL 4ZUWA 1ONQB 3UAJC 3X12B 1A9EB 5C0FA 3EYQC 3RZCB 3ARQA 4KI5C 2ESVA 2OP4L 5DQDH 4QRRD 1I9JL 3LRSB 2AQ3A 3MRFB 2DIBA 3P4LA 5LG1A 3GJFH 5I1LA 2ZPKL 4KKCD 5JW4Q 2WMPA 2F5BL 2ZSVA 4NDMA 5DUBA 1RUKL 5J13B 2DKMA 2E3VA 3CGTA 2XPGA 1W0VB 3MCG1 2Q1EA 3DLQR 3SKNA 3PQYA 4LLVB 1BLNA 4UTBH 2BNRA 4WHTA 2AJZB 5GXBB 4DGVL 2PW2A 1I3RA 4FFVD 4UNTA 2ICEA 1MJ8L 4QRTA 1CU4H 3IS1X 4L9DA 1RVFL 4MAUH 1V7ML 2MFNA 2V5MA 5IKCB 3TH4T 1PYWA 1DBKH 4GRLD 4MZ2A 2WP3O 3S5LB 3K74B 2ICWB 2Q87A 1PG7X 3GKZA 4UIKH 1X5LA 3LY6A 1L9NA 1PLGL 3P4NA 1NBQA 3FHAA 5FA3B 3SKOB 4RISL 1JGEB 1J0HA 4KVCL 3JXAA 1P7KB 3SDDB 1KB5A 4KDWA 5C0DA 3MR9B 3FB5A 4G8IA 3PHOB 5HI4C 5C0ND 3MRIB 4D9RE 4NHCH 4QRUA 1EBAA 5TDOB 1TJIL 3O2DA 1JNLL 5HHPA 4E0RB 2NNAB 4PJGE 4ZD3L 4WFHE 1LO3H 2JJSA 1CXIA 5JPNA 3EO9L 3H2WA 1AGBA 3FB7A 1PY4A 5H8DA 5TQ2H 2ZP0T 4GKNA 1WT5C 1E27B 5C0IB 4G8GD 3LH2L 4L4VB 4X5LA 1J0YA 3W9EB 1YECL 2YUVA 4PS4L 4HKXA 5CKGA 2GJ6A 2H2SC 3VG0H 1UGNA 3PWVB 3RDTC 1JPST 3KLDA 3ZE1F 3QXAB 1JIBA 1F6AB 2YD9A 5E9DE 5KS9F 1RZKC 1H3WM 2ORBL 2W60B 4G6AC 4PRDB 5SWZE 5T5NF 4PGCB 1J0KA 3G5VA 1YMME 4J3VA 5EB9A 1BGXL 5A40E 1B0WA 1CGTA 4JFYB 1CFSB 5JIPA 2XIDA 4P23C 5DJAA 4S1DC 2HFFB 5D9SB 3GSWA 3BKYH 1TITA 4JLRA 1HH6B 3MCKA 4QNPE 4WW2A 3PIQA 15C8L 2X44D 5EFIA 5IBLD 2YKLL 3WHXA 5HHNB 4XVSH 4IEFB 3CZJA 5SX5H 3VXUA 1AI1L 1MRFH 3VFWA 4ZNCD 5DT1H 2ZKHH 3C8HA 4MDJA 4I0PA 4AENA 3V52H 2R2BA 3QEQA 3SE4A 1FORH 3SQOL 1AQKL 3ZDXF 4DCQA 1VPOL 3THML 4GT7A 3SJVD 3D25A 3UO1H 5D71H 3MREB 1OM3H 1ORQA 2OR9L 3SDAB 5F9OL 1A02N 3VFRB 4DEPB 1A7NH 4NRYA 4QF1B 2P24B 1V3LA 2DAVA 2V9RA 2NY3D 3RWEA 2VMFA 3VA6A 1QRND 4PJFA 4JAMB 4L1DA 1KIRA 4PRPA 4G6FD 3UBXG 3WYRA 1UH3A 5SWQB 2CLVB 1HQRA 3TPKA 7CGTA 3CFJB 4XBEH 1C16B 1LEGB 2VXQL 1GGUA 4EDXB 1BIIB 3VFTB 1TZIA 1X5HA 4XPBH 2DOCA 5A1AA 3LKOB 4X6DB 5IFHL 4J6RL 5FYLE 3RIFK 5MENB 2ATKA 4I48A 1CFNA 1IEAA 2WWMC 1PZUB 3AREA 5IMOA 5DSCB 1QSFA 3JWDC 1HHIA 3CX5J 5DD6B 1I9RH 4OF0A 5D7SL 4CMHB 3QJHA 3KLHD 4JO4H 1A7QH 2PTUA 2VLJB 5BS0D 1PVHA 1YMHA 2XWBB 1KJ2L 3IGAB 5EDXA 1AGDB 1K2DA 43CAA 5EOCJ 2FCBA 3ARGA 2X4QA 3O6MH 32C2B 3MFFB 3HMXL 3BSZL 3SPVA 3QUKB 1KYOK 3E6FB 4TYUA 4MLSA 5EBLB 2A6IB 1WUNT 3HAEH 3NACL 5EBWB 4YR6A 5FCSH 4TN9A 3MRKB 3HC4H 1ZK9A 2BOBA 3KPLA 3R8BB 4QYOB 3NMEA 4GRWH 5DUMH 2MNUA 2BHUA 3L9RB 1ZLVH 2BHZA 5FGBC 1OVZA 3JWNC 5CCKL 1D5XA 2H8PA 5F7DA 2AS5M 1IE5A 3SO5A 2X4TB 1KIUA 1ZLWK 2GFBA 3U4EA 3MGTB 4Y2OA 2E5EA 4YDLB 1E28B 4ZAKC 2PYFA 3UPCA 4JHAH 3C60D 4HK3N 4AG4H 3KPRE 1NJ9A 3NTCL 5BV7B 2EC9U 1JZ4A 5KANG 3V5KB 2QQLH 4L8SA 1NGZA 1FFNA 4Q9RL 3O6FC 5C2BH 4E42A 1HHKA 4HXAL 4HLZH 3D0LA 3HKFA 1Q0XH 3E2HB 3QXUA 4FABH 1SYVA 3U2SA 2Q3ZA 4JPKH 1OAZL 1T6WA 2VC2H 1U8KA 4UQ3A 5C09E 3HG1E 3HR5A 2PF6A 4XPGH 3S4SA 1YN7B 4UOW0 3LEYH 4NWTH 5JDSB 2NYYC 2YSSA 3FQTB 3BEVB 1LO4H 1FZJB 1YNLL 4YFLI 1U95A 1WITA 3QQ9C 2DICA 6FABL 4QHMA 5GISH 5I75C 3MRRB 4PJHA 5TJWK 4RA0C 5F7HA 3E6HB 2F58L 4Y2DB 4LASH 3BN9C 3V6BR 2HVKA 5IWLA 3OWEA 1RJCA 5E8DL 3KS0J 3ZHDA 2P8LA 3P0VH 1PKQA 3VFGL 2W0LA 5GHWL 1AXSA 4LRNL 2DDQH 2FLRT 5DXWA 4KK8D 2EXYC 3OJDA 1Q9OA 5GZOD 3WE6A 2XI9A 5I66A 3HUJF 4JM2F 5IW1B 1B0GB 3C2AH 3S96B 4DTGL 3BISA 3BUTA 1XCQA 1LO0L 3MZGB 3BWUC 2GYSA 5FFLA 3CSYB 4PJGB 3JVGC 1IM9A 3MRQB 1VA9A 4M1CD 1JZ3A 3AB0C 1U93B 2Y36L 2O5YH 5HVHB 1VSCA 1CK0H 1S7SA 4PJEE 4PRHE 1RUAH 4ODBD 1XF3B 3R4DA 3QO1B 2ZPKH 1ND0B 1UZ6F 3QA3A 3D85B 2BHYA 2CUHA 3CSBA 1N59B 4LHQB 4RA3A 1KSRA 1L9MA 2EIDA 3B3IB 5MI0C 1ORSB 4HIHB 5SWZB 2XG4A 1YMMB 3BDYH 3QAZB 1RK1B 4O2FB 4EOWH 3D39B 4JANB 4LKCA 1B0RA 5TH2A 4GG6A 4X7TB 5EBMB 3BGMB 5GRVK 3RTQB 1NGXA 1XEDA 3UBXB 3PHQA 4X4ZA 4POUB 5F21B 4JFQA 2HTKC 4DGVH 4YBQD 5DDHB 4NWUH 2EYRB 1AP2A 4Z95L 4Y5YC 1LO2L 3BP4A 5CHNA 3CFBB 4GW5A 5HBBA 1H3XA 4R4BA 2E6PA 5I73B 4TNVF 4N68A 5IESL 1M05A 1MVUB 3BP7B 3CDGB 4KROB 2X70A 3OMZA 4N90D 3G5ZA 3IFNL 5GGVY 4EXPX 4LSRH 4YDJA 2W65B 1NKRA 1C7SA 4E5XB 4P9HH 1BZ9B 4RISH 3NFNA 2AJVH 4WUKH 3X11A 4P2RE 2XWJB 4J2XA 3VW3L 1S5HA 1G7PB 3VH8A 3WO3B 5J12B 4NN6B 1QPXA 3RKPA 1MH5B 3BPCA 5E08L 1CFVH 3V4UH 1AE6H 3QQ3B 4PJ8A 1F3DJ 4TTDC 4D0DA 1T0MA 1BZQK 5ISZA 3PJSA 5IHZA 2HTLC 3CZFB 4GFTB 5K9KA 2NY1C 5H2BA 5IVZA 1IM3B 1H5BC 2YA1A 4NQXB 4QO1A 3IDGA 5HGHB 4RGNC 2GUOA 3JWOL 4LSDA 1ZT4A 4EI5A 2VE6A 4PJCE 1A0QL 4W6WB 1IAIL 2WIIB 4LPXA 3KPOB 1FL6B 2X1OA 1A6AB 4OGAD 3NCYS 5DQJA 1MWAH 2DM2A 3KYOA 5C71A 5IK3A 3RVVC 5HTSA 2GSGB 1A2YB 1QQDA 3MV7E 1BGXH 4OV5A 1BD2B 4ZPTB 4JFEB 4PTTA 4UAOC 3RVWC 3M17B 2QLVB 3WNOA 5HPMA 5D2LB 1BIHA 1JTPA 5KZCD 1YUHB 1CQYA 1A64A 1TJHL 1P84J 1NMAL 4UQ2A 3T4AA 4KZDH 2WBJC 4Z77A 3OKNB 3UTQA 5T1MA 3WFHA 1I3UA 3DUUA 5DC4B 3CMOH 3EO0B 4ORGB 5JOFB 2O61B 3PGCA 5JORA 3QWRA 2A9NH 3IDNB 4P59L 1DL7L 1A4JB 4JHZA 4KRPC 2Q6WA 3C5ZD 1QBMH 3F65A 1UJ3B 4JN2A 2F54D 3Q1SL 5TDNB 3HS0A 3TNMB 4UT6H 2X4SB 4YHIB 2R0WL 5J1AB 1TPXB 2GT9B 4TULL 5IVOA 1J87A 2YK1H 1A6WH 3F5WB 4P2OA 1S78C 2IPUG 2EYTB 5CJ8A 4PLNC 3QNYB 1R3LB 1A6UH 1YQ2A 3W2DH 1BX2B 4DW2L 3B9EA 1HDMA 5IB3B 2FLBT 4LSQL 3LQAL 1IC5H 4N1EA 3KPRB 3B5GA 4L8DB 5E5MB 4HJGA 4LCWB 3MLTA 2VR9A 3N9GL 5GGSB 1E4WH 2BERA 4KK6D 3O3EB 4JR9L 5FYKD 4S1QL 1YY8A 4YXLH 5DD1L 5J6GB 3X13A 2YUWA 3MV11 2XT1B 1AR1D 1N0LA 4HC1H 1PBYA 1ZT1A 4PRNB 1Q94A 5C6WH 2VXQH 4WHCA 3QIWC 2ENSA 4UDUB 2MMXA 1UKSA 1PDKA 5EC2A 3GHBH 4HG4J 3DVIA 2OTWA 5D7JD 4Y5XC 5EBGA 5E2JA 1OARH 2PUQT 2VYRE 5IUSA 5AUMA 4R7DA 4RGOL 2NY5H 4ELMF 5IFJA 2YD3A 5FO7B 1U8PA 3VWJA 4PB0L 1UA6H 5DEFA 2NXZB 4OCXL 3LQZA 5KSBA 1KJ2H 5ESVA 1N64L 2E7LA 2V5YA 4C56E 4X80L 4X9IA 5IR1A 3B83A 5IT2H 1LK3L 3HMXH 4OBSA 5I74C 4UT9H 1G9EA 1MRCL 3CSPA 4EUPH 3HHRB 5GIRB 2D7NA 5KVEL 1K5NB 5C07D 1E4JA 3INUH 3WLBA 4IRSD 4HS3A 5DRXA 5ID0A 1FPTL 1NCCL 1TVBA 1P7QB 4N0UB 4QY8A 3MLWL 5L88H 1JHKL 2QADC 1T5WA 3F12A 3JV6B 4FNLL 4WI5A 1CD0A 3FQXB 4GW1A 1CT8A 4U3XA 3EOBB 4ENEC 4JZNA 4EZMA 4NSKA 3VXNB 1KLGB 3MOBL 4G6JL 4NNPH 4JKKA 3ARBD 2PXYD 4M7KL 3D18B 4Z9KB 4TPRL 5I1KL 3ARSA 3LEVH 4NZRH 4S10A 1PEZA 3QT2A 4MQ7A 3MV9E 4PJ7E 3U0WL 1U3HB 4JVUA 4M6NL 2VL5B 2DYPA 3IXTB 2CK0H 4ZUTB 1BZ7A 1UT9A 1II4E 4AY0A 3VMOA 3BZEB 1RUPL 5L0QC 3VWKD 5LVEA 2HFEA 5J6HA 2ESVE 3QUMB 3KPTA 1RZIB 2UZXB 3MFGB 5I19L 1H0DB 1E6OL 4OZIB 1YNLH 2DTMH 1OT1A 2X4NA 1Q72L 3LHPH 3K8KA 3P2TA 1AQDA 4OSUL 3OB0H 5F9JB 5DI8A 2NCMA 3X3FL 4GAJL 1R5WA 3EJYC 4YHLH 4JFFA 2CLRB 4XNYH 5D7KD 4ZUUA 3D0VB 3L5WA 1WV7T 2HT2D 4UIMA 4KJPC 3TBTB 1S9WB 2J6EL 2BNRE 5I1IH 4MCYA 5EULV 4P2RB 4MJIA 2Q3AA 1S7XA 3ZDYE 3VG9B 5E7BA 3MRPB 3G6JB 4HKJA 1J12A 5CSZB 2HH0H 2H9GB 1JPTL 3AFLA 4P3CH 3H9ZA 4J3OC 1VFMA 3FCTA 3ROLA 1IZJA 3F8UB 4JHBA 5HDBF 3K81A 2A9ML 2FJGA 4PYHA 5HYJB 4NHUB 3O3DA 1KNOB 1KN4L 1DN2A 3BQUB 5A3ID 4GRMB 1FSKB 3P9MA 2H6PB 4LU5H 3MRBB 4P46C 5SX4I 2AK4D 4PJCB 2C4FU 4YHPA 2VDLH 2XKUA 2DQHL 1NCUA 1NH6A 1MHEA 1AC0A 3MNVB 4XC1H 2EH8H 3FOLB 2H26A 1PSKL 2HJLA 4P9MH 4G9FA 4K94L 4JPIB 1N6UA 4YQXL 1NCBL 1D6VH 2X4PB 2NY7H 2I60H 5EU7E 1HHJA 2GCYA 3MV7B 5KAQG 4IOIA 1AGFA 2VXTL 1ZHBA 4S1RH 1BBJB 2EIZA 4OD2B 4LL9A 1YEKH 4J7RA 4QLRA 4Y16A 3OAUL 4NBXB 4LVNB 5BQ7A 2NY2D 4OLEA 1UENA 3UPRA 4BSVA 4HW6A 2PW1A 2GW5A 3I2CH 2R39A 1T3FB 2GJ6E 3DMMC 5IESH 1AJ7H 3PV6A 5CD5D 4QRQB 4QT5B 4IRZH 5T1LB 5FCUH 4CDHA 4OI7A 3AU1B 1AHWA 1YYLL 1NMBH 3VXQB 4F8TA 5F1IB 4F2MA 1FC1A 3QULB 4ODUA 5D72L 2YN5A 2IANB 1XGPA 1D5ZB 5DWUL 1LD9A 3IFOB 3CLFL 2H41A 2W91A 1XR9A 1Z9LA 3WFEL 1J8HD 1QBBA 4M9PA 5ALBH 1P5UA 1EVTC 1E4KC 1IJ9A 3DV6B 3PWPD 3RGVD 3EZ8A 1J1OH 1PJ9A 1KULA 2UUDH 4FQCH 2ERJC 4KGLA 5EU4A 4GG6F 4CVZA 3OQ3B 4MAYD 3VXUE 4G9DA 5FGCE 3TN0A 1J0IA 1LWRA 4JHWH 4RX4D 1S7QA 1VERA 3O9WD 3MRHB 4N9GB 3GI9L 4G6MH 5E1AA 4CRPA 4K2UH 4M93C 3QUZC 2BNQA 4XRCA 1GYAA 1SBSH 4LNRA 1FGNL 4MMZC 1IAIH 4U1NB 3DTXA 2D7TH 3EW3B 5C0CD 1R0AL 1FO0A 3LCYA 4ELKB 4KUZL 4H26A 1GSMA 2BJMH 4LLUB 4RDQG 2BP3A 5INDA 5DFVC 5BZWA 1BVLB 2DRUA 4G6KH 4L3ED 1SJEB 4JFHE 3L7EA 1CXKA 1XAUA 5E6IB 3TO4C 4KJYB 4NQVB 3VMPA 2R0ZL 1MQ8A 1U3YA 3V4VH 3DUHA 1RZFH 3MLVL 1JNHA 4N9OB 1NMAH 1JK8B 5IM7B 1ZWIA 1J18A 4C56B 4LGPB 1CTNA 2K3TA 3MV8A 5L7XL 4WY7L 5GS0L 2E27H 2Z8VC 4OD3L 4U0RC 2BSRA 4QTHB 5C0RL 1JHLL 3HZMB 1NBYA 1FG2B 1A1MA 2QSCH 3TA3C 3WO4C 4F80A 4WO4D 4OD1L 3KYNB 4RMUA 1EEZB 3T0ED 1IZKA 1QSED 4K3HA 2NX5B 5T5FL 1QFPA 3KPNB 1F11A 1C12A 4PRAB 4DGYH 2CKBB 2OZ4H 4LSSL 3O11A 1T2JA 3HZYB 4OZFH 4U1GC 3BJLA 3OJMB 4LSQH 3MLYL 3E8UL 3WD5L 2AV7B 4WVRA 1MAML 3A0OA 1CIDA 5EN2B 2HFTA 2CRZA 5DD0H 5BJTB 5F7YC 1M7XA 2IH1A 1U8NB 3BIKB 3MV9B 2VZOA 4KHTH 4JM2D 4LIQH 2DLFH 2XZAL 5I6XB 1G0DA 3RVTC 1LK2B 5T3ZE 1CE1H 1NAML 2YUZA 1JGUL 5K9QI 3GO1H 1HXMA 1H3PH 5BVPH 1W0YT 5C0FB 4LCCC 2ESVB 2X41A 3LKNB 3ET9F 4P2QA 1F90L 2HVJA 2HN7A 4ODTH 4P3DA 1GOFA 1NCDH 3UJIH 4JN1L 5I1LB 3NA4A 3U83A 1L6XA 3PDDA 2FD6L 2ZSVB 5SV3A 4NDMB 5DUBB 5FEBA 3MRJA 4MQXC 1AO7E 2XPGB 4Y5VB 1WT5A 2VXUH 4K23L 3IJYB 1U41A 1CFBA 4XMKL 3SKNB 3PQYB 1BLNB 4BA8A 2BNRB 4WHTB 4ZG1A 4NQED 1XGUB 3RDTA 3UJJL 4MB4A 5DC9B 5J4MA 3D3VD 4PUBH 1I3RB 2IPUK 5HGAA 2ICEB 4QRTB 4HH9A 5FUZH 1OCWH 4FMKA 4IRJC 3MLWH 5JZ7D 3MV01 1U91A 3TJEL 4AEIL 5DFWH 2RR3A 4M7ZB 1CGUA 1TENA 4PJHE 4LVOB 2Q86A 4AT6A 1YEGH 4P23A 3S34L 1GHFH 1QG3A 3P4NB 4UV7L 2QBWA 1IBGL 4ZOCA 1KT2A 1PKQE 3VXPB 5FDWA 3G6DL 1HYSD 2QQNL 1F58H 5JXAH 1KB5B 3UTOA 1WEJL 2COQA 2WP3T 4PBWD 5C0DB 4WI3A 3FB5B 2CIKA 5MEQA 4G8IB 1OP5H 4QRUB 1AD9A 4X7SH 3VMNA 3LKRA 5T1KA 2MQCA 1J1PH 4G80B 3UZQA 5FAAA 2R8SH 1AGBB 3FB7B 4OF8A 4CDGC 5I8KH 2B8OT 1N4XL 4GKNB 4J8RA 5ENWA 4KKCC 1Q72H 5D93C 2ZZUT 3BT2H 4HKXB 2GJ6B 3HTLX 3IXAA 1L0YA 4NUGL 1RIUH 3WDJA 4K3DL 4TSCL 5JIHA 3G5VB 1JMZA 3VFUA 3RA7H 5E03A 1OSZA 3QIBD 3QHZH 4FFVC 4GOSA 1WWBX 4UZGA 4UV4L 5DJAB 3GSWB 4YAQA 4JLRB 1HI6A 3MCKB 3GBNL 4WW2B 3PIQB 4GRLC 3GRWL 3D6GA 4JZOA 5CBAA 5EFIB 4RWYH 3SE9L 3VGAC 1X5KA 2Y1VA 3WHXB 2R2CA 1T7ZA 3L6FA 3VXUB 2HKHL 3VFWB 5DURD 4MDJB 1FLRH 1ZHLA 4I0PB 4AENB 3RZWA 1WCBA 5J1TC 1FFRA 5ESAA 2UZYB 5CEZD 2R2BB 3QEQB 1LNUA 3QH3B 5L9DH 4DCQB 1OGAA 4A2MA 3D25B 5GRWA 3LSOA 5C0NC 3DO7A 1AFVL 2W1NA 4Y19E 5EU6D 1ORQB 4TSAL 1FNGA 3IJSA 4NRYB 3EO1A 4D0CA 2PTTA 1XIWC 1CICD 4YEFA 3EIFA 1TVHA 1JV5A 3CDFA 3DIFA 5EIQA 3RWEB 5CZVL 2YZ8A 5FGBA 1QLRA 4M62L 4M8QA 2QEJA 3MBED 4XC3L 1KIRB 1YEIH 2P5EA 3O2VL 3AY4C 5D5ME 2A1WH 1CDGA 4TRPL 2GEEA 3U48A 2Y7QA 2DKSA 1HQRB 3LRHA 1R3JA 3CUPA 1BQLL 4IOSD 1N5AA 4ZPVB 4XNQB 4ZAKA 1YJDL 3BPOC 3U9PH 4GW4A 1FBIH 5D1ZD 2DJUA 2VZTA 1TZIB 2LTQC 1IAOB 1WSST 1JBJA 2ATKB 4TNWK 1RULL 4I48B 1CFNB 1IEAB 1NFDA 1UEMA 1YPZA 3HI1A 3O6FA 3AREB 5IMOB 1DLHA 2VDQH 5TE4L 1HHIB 3RVUC 2G2RA 2R29H 3V7AE 4BSWA 5BRZD 4D9QD 1TQCB 2E7CA 3QJHB 3VH8G 2XYCA 4LQFL 3VD7A 4GLRI 1KCVH 1K2DB 1JP5A 3FN0L 43CAB 1MEXH 2X4QB 3ARGB 1A3RL 2OL3L 3GMNB 4M5YH 3SPVB 4FQ1L 4OUOA 1DE4A 2ID5A 3CH8A 25C8H 2X05A 3BJ91 4FQXB 4YR6B 4OKVA 5EA0H 4CJ1A 2AP2A 2NY4B 2BOBB 1EO7A 2WUCH 3KPLB 4G3YH 1P4IL 5I1JL 4WI9A 1KACB 4IMKC 2LAAA 2GY7B 5E8NA 1D5XB 2H8PB 3R1GL 4X6CA 1OAYL 5GRYA 5A2IH 4U2ZA 1KFAL 2W0FA 5I17A 1J05A 2NY3C 2APXA 4G43A 2GFBB 3U4EB 5CMAA 2PYFB 4QRPA 1UCBH 1NJ9B 5SWSE 2I07A 4JB9H 4PLOB 2IFFH 3V7AG 1JRHI 5F6HI 4L8SB 1MHPL 1NGZB 2PO6D 1FFNB 3PXJA 3LIZH 1RJZA 4HMCA 3JVGA 1NSNH 3D0LB 3QRGL 1SYVB 3MROB 3U2SB 4B53A 2QHLA 1U8KB 4UQ3B 1BOGA 3WIHH 4X6BA 2BVEA 1KEMH 3HR5B 1B2WL 1MLCA 3S4SB 2V2TA 5C0RH 4YHKH 4ETQA 2YSSB 4FP8L 4PRBA 2HKFH 3MUZ1 2EDDA 5L8KB 4OD1H 3KLHC 2R0KH 5DQ9A 5FYKH 4PG2C 1DBJL 1CXLA 4OBRA 4QRSA 4OGZA 3H42H 4PJEF 5KSBE 5T5FH 3T1FA 4M5ZL 2X1PA 1TZGL 1WJ3A 4KHXH 4QHMB 1IGJA 2AAVA 4PJHB 5GJSL 1KXQE 3ZLQC 3P11H 3NIDE 4HX1A 2R69L 5B22A 2HVKB 3ZE0E 1TLKA 3E8UH 2JLLA 35C8L 3CNKA 4Y5YA 5KVGL 3L3IA 2P8LB 1PKQB 1UEYA 3MLRH 1KTDA 1JI2A 1SEQL 2Y72A 3U82B 1NBVH 1AXSB 1OSPH 3SGKC 4AEHH 4V1DE 3RU8H 1NGQL 2XNAA 4PGBA 3OJDB 1Q9OB 3VI4F 2Q76A 2WSKA 3WE6B 1OP3H 1DSFH 5KTEL 2VJXA 5I66B 3QDGA 4GMSH 4UILH 3NCEB 4L4VD 1P5VA 2DJ4A 1XCQB 2FZ3B 5HHOE 2RFXB 5T33L 5KOVC 4PGJA 2XZAH 2YBRA 4XPFL 3H3KA 3C60C 3QCTH 1IM9B 4I3GA 1CBVH 2XA8H 1RIVL 3NAAH 3IDYB 3S35L 3D2UA 1RSFA 1C08A 3T0DA 4YDIH 3SGDH 2VSDA 1BAFH 5ICXA 3QA3B 5DHVH 4KC3B 1RZJL 2B1HL 4MA3A 1T1YA 5IJKC 1H5BA 4L1HA 3I02B 4LP5A 4F7CA 3HC0A 4DQOH 5HHVL 1VDGA 3OTTA 4OIIL 5K9QG 1WZKA 4XP9L 2IH3B 4LKCB 1B0RB 1JNNH 5K59E 5TH2B 2FBJL 1NGXB 2HP4A 3KXFE 5BMFL 4JFQB 1XF2A 1SMAA 3TZVC 1TETH 5HHME 1AP2B 4R8WH 3BP4B 5CHNB 2IC2A 1X7QA 2VZVA 4R4BB 4EDWH 1FIGH 3TVMD 1V8HA 3PE9A 3UYRL 4LAJH 1T1WA 1M05B 2FBOJ 3QEHA 1MI5A 2X70B 5IHUL 3S36L 1NBZA 3G5ZB 1A6TA 2VOTA 4CNIA 1ROWA 4YDJB 2WBJA 3TT3L 3NFNB 3HE7D 1G6RA 2OCFD 3X11B 4U33A 1J11A 3EYSH 1S5HB 2PKDA 5GZOC 2JCCE 3VH8B 5DMGD 1A5FL 1WEJH 3DXAE 1NLDL 3BPCB 3NPSB 3BIAX 4PJ8B 4PJXF 3MRMA 2K7PA 4M1CC 3RUGE 4DOHB 1T0MB 1RUQH 5IHZB 3PJSB 5K9KB 2OSLA 5H2BB 1KENL 1ES0A 1T0PB 4UTAL 2CUMA 3MUGA 4YWGL 2CDEA 4M7LH 1KB5L 3BD3A 3IDGB 4I3SH 1I8IA 1ZT4B 2N56A 4DKDC 5DJDA 5HGDA 3GKWH 4APQD 5T3XE 1PG7W 3O2DL 4HFWA 5C92A 1N26A 2EDLA 4OCLC 1I1RA 1AXTL 5DQJB 3UZVB 2VLJD 5BZDA 1KIQA 3KYOB 5IK3B 3O6KH 5F72S 3GB7A 1QQDB 4Z0XA 4OV5B 4JRYD 5KSAD 2UWEE 1JWMA 4PTTB 3DRQA 4N0CD 4YBQC 1OF2A 3QIWA 5HPMB 2NMSA 3VXSA 2FIRT 3ZYJA 5CEZL 3SCMC 4UV4H 1IARB 5I71B 4TVPL 4L4TE 4UQ2B 3T4AB 4Y5XA 1TDQA 4HJJL 4WEMB 4Z77B 1DUYA 5GRJL 2XQYG 5T1MB 3UTQB 4K94C 3WFHB 3DUUB 3NABL 3GBNH 1CXEA 5IP4A 1FAIL 3FQUA 4Z8FH 4K8RL 2P5WA 3TBWA 2Q6WB 2XKSA 4JN2B 2D2OA 1NCAL 2DQGL 3HS0B 4MYWB 1MCPL 3L3HA 4AZ8A 1MCOL 5IMLA 4N8PA 1I9IL 4U0QB 1F4WH 2FJFA 4XI5D 5CJQH 5DMIL 2DQTH 4FQLL 4WGVB 4MA1C 5CJXC 3BPNC 4R2GB 1HDMB 1KJ3L 1EEYA 1FYTE 1T1XB 5JOPD 4KV5E 4HJGB 3MLTB 5SWSB 2X89D 3O6LL 2GSIB 5L2KA 4FXLA 1DQJA 3CFDA 3OKOA 2KZ1B 1YY8B 3AAZB 3CDCA 3X13B 4F7TA 5AWNH 3JV5A 1BQLH 1OD7A 1ZT1B 4YJZL 1Q94B 3HNTL 4J3WA 4Q9BA 4OGAC 1QFUH 1MCNA 4XCCH 3CXDH 1EJ6A 2B2XL 4EVNA 3U7YH 1K8IA 3O41A 5EC2B 5C6PB 2OTWB 2APBA 1DANT 4B50A 4G7VH 4XT1C 4Y2DD 4R7DB 5AUMB 3IDIA 3LPGA 1D6EA 1OW0C 4OGXH 1C5BH 4PJ5E 3H9SA 4CUCA 5IFJB 1U8PB 3VWJB 3VU2A 4MD4A 3BX7C 4M03A 5DEFB 4D94A 2QL1A 5K9JL 5KSBB 3QPXH 5ESVB 4G7YH 1M4KA 2KQMA 2DQUL 3RNQA 3C87A 4CL7A 3C6LD 5IR1B 4KI5E 3U4BH 4PJ7F 1LVEA 3GSXA 1OWWA 3OG6B 4FQ1H 1N7MH 3C5ZC 4G8FA 2G60L 4FZ8H 4D9RD 4HZLA 3VXOA 3FONA 4LGRB 4M6ML 2RCSL 5DGRA 1I3VA 3HZVB 4HS3B 4PG9A 4FZEH 5DRXB 4V1DB 5F96L 1VCAA 4F7MA 5ID0B 4S1SH 4YXKH 1TVBB 2OQJA 1B4JL 3LMJL 4M6OL 4QY8B 1LEIA 3RWHA 3ALWA 4X7CC 1QHPA 2AJ3A 3GMRA 1GH7A 1T5WB 3F12B 1F4YH 1CVSC 4GW1B 1ADQH 5H37G 3V79C 2IBZY 1A6PA 2DLGA 3A67H 4RMWA 5DLMH 3CX5K 4KK6C 4JZNB 2NTFA 4NSKB 1IQWH 4AM0A 2DM7A 5E9DD 2R2EA 2XRAL 1R3IL 1IGCH 3N50A 3L3JA 2D0GA 5CUSL 4RMRA 3GSNL 5KAQF 4R90L 2EEDA 1AR1C 1MHPH 4MSWB 4MQ7B 3RBGA 3ZDYF 1PD6A 4H88H 3RVXD 2DYPB 1EEUA 1ED3A 1BZ7B 3PG2A 1BBDL 4H0HB 5D7JC 4P46A 2X4UA 4LVHC 1JF5A 4OF7A 3TWCL 1CLYL 4FQIH 4HXBL 1D9KD 2HFEB 2VXVL 5EG6C 5FUCC 1G9NL 4M7JL 3L7FB 4P2QE 5HHMB 2NXYB 4I0KA 4NZUH 5CJBA 5FYJE 3VRJA 1QEWA 1AQDB 4XP5H 5DI8B 3ARFC 4XH2A 2QQKL 1R5WB 1INQA 3VXRE 1FZMA 2D7OA 4TQEH 1B4RA 2B1AH 4JFFB 3RBSA 5HJ3A 1RIHH 2J4WH 4ZUUB 3MX0A 3L5WB 4UIMB 2H2PD 2X7LA 5CWSA 3RL2A 4LOUD 3OGCB 4IRSC 5J06A 1NC2A 4ONHB 5F7EH 1SEQH 3DMMA 4YHZL 4MJIB 2F8XC 3VRIA 1S7XB 1ZANH 4PB9H 4M3KB 4PP2A 4HKJB 1QFWI 2R4RL 4FQHA 2VAAA 4H8WH 5EIIA 4MVBD 1EFXD 4YDKL 3ZKND 2P8MA 5BO1H 4XAKD 3BGAA 3ROLB 2BY1A 4YHMH 1N3NA 4NQDE 2KH2B 3BP6A 2HG5A 2FJGB 4ZXBD 5AZ2H 2PXYC 1E4KA 2VNCA 5FYLD 2C3VA 2XACC 1K4CA 1IKFL 3AGVA 3P9MB 4PREA 3MLUH 1TQBC 1U8MB 5B38A 5TPWL 4YHPB 4OZHA 1MFDL 1MHEB 3WNMA 1IILE 4WU7A 2H26B 3EGSA 2HJLB 4G9FB 2E7MA 3GHEL 4LDLB 3QUZA 1HHJB 2GCYB 3VWKC 1AGFB 4XP9H 4MJ5A 1ZHBB 3MRLA 4HH8A 3WLWD 2EIZB 3PHSA 3TFKD 1E4XL 3TLRA 4KPHH 3DV4B 3UPRB 4BSVB 3OXSA 2OI9B 2PW1B 5D70L 4PJ9B 5FOBA 3B9DA 5IG7B 4KI1A 3REWA 4R26L 3LN5A 4H20L 3PV6B 3TO4A 2FX7L 3S36H 2HT2C 3O0RH 1UXWA 1AHWB 1JZ5A 5F9WC 4F2MB 3C08L 4ODUB 4F3FA 1XGPB 1LD9B 2F53D 5CILH 4QGYA 2FHFA 1XR9B 2IPTL 5GRZA 4JDTH 2PR4H 5LCVL 2L0DA 4XAWH 1XMWA 2WBWB 5ABDE 2PNDA 2BNUB 4OM0L 2FGZA 2YPVL 1T2QL 4ZOAA 2P8PA 4OFYA 1A7PL 2AVGA 3TA3A 1IFHL 1T20A 1V7NH 4J3TA 5EU4B 4RMTA 4CVZB 3V0AC 1KCSL 3MYJA 1IKNC 4YHYB 2JELL 4G9DB 3TN0B 2HJFB 5A3IC 5C09D 1S7QB 1GPOH 3HG1D 5E1AB 3QUXC 5D1XD 1IC7H 2BNQB 4XRCB 4LNRB 1Z5LA 2VN7A 1IQDA 2VH5H 4BZ1L 5JDJA 2OK0H 1YC8A 2NXZD 2NW2A 1FO0B 5J11B 5EZLA 2AEPH 4UUJA 4H26B 3MBXH 3H0TA 4QGTA 5INDB 5BZWB 2I9LA 1KJ2A 1FVDA 1IGIL 3CVIH 3L7EB 2NY2C 3HMXA 4GKZA 3EKCA 5CEZH 3ULUL 3L3KB 4FQQA 4HFUL 4MQSB 3SOBL 1JNHB 3U36A 5C08E 3KNBA 4EUPA 3O4LA 1ZWIB 5E6YA 3S88L 3M1BA 5GRJH 2BMKA 5TF1H 5CD5C 4LCCA 1P7QD 3MV8B 1S7RA 4YZFF 2EEAA 3SGEH 4HIIA 2UZIH 2X1QA 2P4AB 5CZXC 5JUEH 2BSRB 2BFVH 1YPZE 8CGTA 1G9ML 4JRXA 1EMTL 1OAKL 3K46A 1NCAH 1A1MB 4XNMA 1NANH 4OCSH 4YUEH 1YN6A 3BESR 1YJDC 3N0PB 3ULVH 4PRHD 1UWEH 3RGVC 5HYIA 1F11B 1WF5A 4HPYH 3OAYK 3QI9D 1I7TA 4YC2C 3O11B 1U3HD 1WICA 2AJUL 3Q6FA 3X17A 4MAYC 1JJUA 1UACH 2ZUUA 1F5WA 1JVKA 1CI5A 3O9WC 4OGYL 1Q0YH 3CLEL 4IRJA 1ZGLM 4K3EH 1P84K 1I9EA 3A6CL 3QO0A 4KRMB 1ZLSH 1KELH 1FVCA 2IH1B 3BAEH 3W81A 1YYMH 3QUYB 4I8DA 1H8NA 4DKEH 2HRLA 1M6OB 1K3ZA 1CE6A 3MRNA 1UCTA 3CU1A 3U1SL 4Q9QL 5DMYA 3S6CA 4JGUA 4F58H 4RGMC 4LLQA 3U9UA 4OQ1A 3WFBL 1RI8A 5D7IE 1YEHL 4NUJA 4RNRA 7FABL 1HXMB 3B2VL 4YX2L 4NKMA 4P2QB 2HVJB 3ZKXC 2HN7B 4WFFD 4YBLB 3U7WH 4MA7L 4FMFA 3GNML 1B3JA 4DN3L 2XQYK 3BW9B 2C26A 2YRPA 4DVRL 3LPFA 3BKCH 2G75A 3QFJD 5ANMA 3MRJB 3VXRB 2CXGA 4QRRA 3WNLA 1IL1A 4IS6A 3ZYZA 1T0NA 4LCYA 3HI6H 1EK3A 3UTTD 1H3TA 4Z7OE 4HUKB 4WO4C 4LEOA 2V7HB 3RDTB 3U0PA 3I6GB 4OLZH 5DD5H 1EERB 3T0EC 1BFVL 2CMRL 2CDGA 5HGAB 2VLRD 4HH9B 4KAQL 2FGWL 5ICZA 1F02I 3PL6C 4KZEL 2Z91A 4MXVF 4HG4K 1U91B 1A14H 1EX0A 1UM5H 4FRWA 1L7IL 1X6NA 4ZO8A 5FDYA 4AT6B 5M94B 4AIXA 2HWZH 1D7FA 1S3KL 3L5IA 1KT2B 3L95A 2APFA 5FDWB 4KTEH 3MV7D 4GRLA 1NCWH 1INEH 1WBXA 2Y07L 1OLZA 3GUTA 3EOTL 1MJ7L 5E6ZA 4PIRF 4DK6A 4JM2C 2MHAA 2FHCA 2CIKB 1Q1JL 5MEQB 3SE8L 4XHJD 4OV6F 4PR5A 3TYGL 5GRXG 1X5YA 1LGVA 2M2DA 1ZVSB 3WN5B 1AD9B 2DD8H 1QBLH 3LKRB 5T1KB 1X5ZA 4XVTL 4KXZH 1FFOA 2ED7A 1LDSA 5D8JH 3RWFA 4M7JH 3CXHJ 2BXYA 5IGXL 1I1YA 4S0SD 1XIWA 4J8RB 5ENWB 3LAFA 3CFIC 1JWUA 4CN1A 1OB1A 2DB8A 3IVKB 1NDGA 3IXAB 1SVCP 2UY7A 4OTXL 1BQSA 5I1CH 2K1MA 3AY4A 4Z7WA 4G8GA 3P30H 3PF2A 5EPMA 1LP9A 3VFUB 2JIXD 3TV3L 3NIFE 4U6VH 5E2UL 3CCHA 5KOMC 5F3BA 1OSZB 4X4YA 2ZUYA 3G5XA 3RX8A 5A16A 4L8CA 1SM3H 1I85C 3R0MA 4MB5A 1RZJC 4NKIH 4YHOH 4YAQB 5D5MF 5JZ7C 2R4RH 1HI6B 4XMLH 3IKKA 4U6TA 1RK0A 3CH1A 4JZOB 5CBAB 5F7WC 3L6FB 4MQTB 1VFAA 5KN5A 1UM6L 1MPAL 3QG7L 3CJJA 4XXDA 4Q58C 4H1LH 1HYSC 1ZHLB 3B9KD 1WCBB 5ESAB 1CF8L 1EO5A 2AXFA 4Z7VF 4PP1D 1A21A 1F8TH 3LSOB 5E6ID 2LAGB 3FQWA 3PDGA 3BXNA 5EZJA 1DBAH 4LQ1A 3IJSB 4D0CB 3EO1B 2PTTB 3BZFB 4LPCA 3TGXA 1KEGH 4NYLA 3MGOA 3SJVA 1Z0NA 3TYFA 4NPYA 1JV5B 3DIFB 4IMKA 5EUOA 1QLRB 2DBJA 4M8QB 5E2VH 4FQ2L 4Y8AA 2FJHA 2P5EB 3DX7A 5EZIL 1E4XH 1N8ZA 2Y7QB 5E2TL 4X7FC 3CUPB 1HCVA 1N5AB 4ZAKB 4BFBD 1QRNA 3Q48A 4GW4B 1EHLL 1JF1A 4E41A 1XGRB 1CGYA 3Q5OA 2J5LC 1NFDB 1YPZB 1DFBH 3HI1B 3O6FB 5FV2A 5DJ6B 1DLHB 5HSFA 1FP5A 3QIBC 2G2RB 3DO3A 4JG0H 2ATPA 4MDIA 4XWGH 2OZ4A 1G7QA 4OZFA 4BSWB 2QV2A 1TZHB 4QTIH 1P4LB 4KVNL 3I50H 2WK2A 3BD4A 4RFEA 4JJHA 1V3MA 2C3XA 3P9LA 2ZSWA 2VDNL 1MF2L 1MREL 4C58B 4PG2A 1DE4B 5BS0A 3TIDA 2P5WE 3BP5A 5ADOL 5D2NE 4OKVB 1F6LL 2AEWA 3MLZL 2FIKA 5I75B 4GG8A 4O9HH 1N5YL 3CVHL 2DQDL 2ESVD 5E8NB 5IB1A 4X6CB 5DA0B 1QPPA 3VGHA 3OF6D 1UADC 1Q8MA 1YC7A 2W0FB 4K8RC 5I17B 1CICC 3ESUF 3BKJH 4G43B 1VB9A 3SGKA 4BZ2H 2ZJSH 5CMAB 3H8NA 1XT5A 1MJUH 5IFAH 3MBEC 5CLTA 3L3DA 1WVZA 4GS7C 2I07B 5K93A 5L2KE 3GM0A 3ZE0F 1HINL 2ZUSA 4L29A 3S37H 3V9FA 3SOBH 5KVFL 3NCFB 2ILLA 3C60A 1MRDH 1RJZB 1T7XA 5BV7H 5D1ZC 2DQIL 4OB5H 3A6BL 3AB0B 1ZOXA 3Q5TA 5F6IC 1FO0L 5B39A 2ZUQC 1EZVY 5JW4M 3BDBA 4MCZA 1BOGB 5JA9A 3DX8A 1MLCB 2XQBH 5IVNA 4HLJA 1PGRB 2V2TB 4ETQB 5IJKA 4PRBB 1J5OL 5DQ9B 3FB6B 2JKXA 3ALPA 5MI0B 1P6AB 2H32H 4QRSB 2W9EH 3T1FB 5DVLA 1IGJB 5E4EC 4ODSL 2ZCKH 2NPLX 4HX1B 3RNKA 1WZ1H 3TZVA 4XP4H 4HLZG 4YXHH 4Y5YB 3Q2CA 3L3IB 5A43C 1S9KC 2FEEL 4PY7A 5GS1C 3MCLL 2I25N 3A6CH 3BKML 5K59F 4HUVB 2XNAB 4PGBB 5C0AD 2DMKA 3BWAA 2Q76B 3FOMA 3Q0HA 3OJ2C 1CQKA 4H25A 5I0DA 2XN9E 3IRPX 3QDGB 3U1SH 3S3SA 4WUUD 1HCFX 1LDPH 4LLMA 3RX5A 1HSBA 2A77L 2HRPH 2UVFA 2YBRB 2GJ6D 2Z31D 1WC7A 5E24E 3PNWA 4PJIF 5LKNA 3MA9H 5F3HA 3DROA 3V0WH 3D2UB 1A7OL 2PO6C 4JCMA 1BQHA 1C08B 4XHQA 2OR7A 3HFML 2VXSL 4ZTOL 5ICXB 4KJWD 4Q6IC 4MA3B 1T1YB 3M8OH 4DVRH 1H5BB 2JCCF 2WNGA 4F7CB 1ETZA 3HC0B 3QB7C 1QFHA 3GMMB 4RGNB 2EDHA 3U4AA 5AAWA 4C4KO 5E8PA 1C5CH 1MOEA 5JIIA 5F97E 2BX5A 2YR3A 3RUGF 1NMCC 2PYEE 1IMHC 4LMQI 4G8EA 4FHBD 5LGJA 2VDML 4DZBA 2FGWH 1X7QB 4XPAL 3HNVL 1GGTA 5FKPA 4FFYL 1T1WB 1F00I 3QEHB 1I7UB 2AJYL 2EE9A 4R97C 1MI5B 3SCMA 1I8LC 1NBZB 1A6TB 4CNIB 5IB4A 3P4OA 1G9NC 5I8OH 2WBJB 4JCLA 1G6RB 1RZKL 2DQCL 4X99A 5EOQH 1BEYH 2Y07H 4IM8A 2UWEF 5ETUA 1OY3B 5DVOA 1KCRL 4JFOA 1J1XH 2X2YA 3U0TA 3GSRB 3VI3F 4GBXD 3N1FC 2AJSH 2MTPA 4X9FA 4FQJH 4Z5RA 4PRIE 1BJ8A 3BMVA 3MRMB 2EH7H 5H94A 4LARH 2OSLB 3QDJD 1ES0B 2HJKB 5I1GL 3MUGB 5ITBL 2CDEB 4J3XA 4OM1L 1HQ4A 4GAYB 5CJXA 3ARED 1I8IB 5DUPH 3STLA 2VABA 1YDPA 3SDCD 4OZHE 5MHSE 5DJDB 5HGDB 1EJOH 1YA5A 3WFDL 2F5AH 4HFWB 4OTXH 5BZDB 1H3VA 1K8DB 1KIQB 3WFZA 5FO8A 5FOJA 1A1OA 1A6VL 3GB7B 1DQDL 4M4RA 4Z0XB 1IAII 3O3AA 3QHFL 4LPWA 1JWMB 3DRQB 3D9AL 2YPLE 5FYLH 1OF2B 2EDJA 2W9DL 2H1PL 4FFZH 3VXSB 1QNZL 5JW4N 4FQXD 3HA0A 2R4SH 3TVMC 4Y5XB 1DUYB 3H3BC 1OW0A 2FATL 3KGRA 3FQUB 4GRWB 3R0NA 2BY3A 3T3PF 2P5WB 3TBWB 1J9CT 2P7TA 4P2CG 1MPAH 5T3ZD 3HE7C 5J57B 4JY4A 4A2LA 3NH7L 3L3HB 3SN6N 5HD8D 3W39A 1I1AD 5B38G 4PJDA 5IMLB 5DMGC 5I74B 3C5ZA 2FJFB 2CK2A 1QYGL 2F54A 3IKCA 1X5FA 2JB6A 3RWDA 3LN4A 1U8QA 1GXEA 4NFBA 4NQCE 1EEYB 1DQQA 1UQSA 5FM4A 4XNUH 1F13A 5GZND 3D48R 4PPTA 1AO7D 5L2KB 2Q8AL 4RAHA 4XX1E 3I3BA 1DQJB 1NUGA 4OLVL 3CFDB 4WCYH 2QADB 1OAUH 2VLME 4ZFFA 3OKOB 4N0YL 3WIHA 5DEZA 4U3CA 4WV1C 1DBBL 4APQC 1DQML 2IG2H 5F1NA 3MC0A 1P1ZA 4CMHC 1CDJA 1GC1H 4EVNB 4BH8A 1WAAA 1K8IB 5B4MC 3MJGX 4MNHA 3T2OA 3UJTH 5I9QC 1Z3GL 4Q97A 1TNNA 5KSAC 1KIPA 1YEFL 4EBQL 5GQBA 3K3QA 4P5MA 4GXVH 3PWJA 3IDIB 4EXKA 1D6EB 4FTVD 4WWKD 3H9SB 4X6FB 1G7IA 3DSFL 3UYOD 3LZFL 1I1FA 4MD4B 5D7JA 3DYOA 5HYFA 5L0QB 3H6JA 1PX4A 4KVNH 4MXWL 3FO0L 4O2CB 5EORH 3TO2A 3K80A 3NCJL 1JL8A 1CGSL 1XR8B 4PJAF 4ZMAT 1MF2H 1MREH 4N8CL 3NBNA 2XKNA 3I9GL 4G8FB 4ONFL 2CLZA 4HZLB 4U31A 4QXGL 3FONB 3ARPA 5ADOH 4XX1G 3ARFA 5LAXA 1RZ7H 1FH5L 3MLZH 4PG9B 4F7MB 1OAXL 2F8VA 5CGYD 4RFNC 1NAMA 3T2NL 4XI5C 5FO9A 2OQJB 3MXWH 1JI1A 1KCUH 4HUMB 1EO8H 1MCWM 2VITA 4JVWA 3RWHB 1OQXA 1CXHA 2AJ3B 5HGBA 2VDRL 5C07A 1R5VA 4IRSA 3HPLA 3QDHA 4WTXA 1MFCL 2R56L 2J12B 4QOKA 1T66D 3QFDA 5C3TA 1PEWA 4DKFH 3GSOA 5ILTL 4TSBH 2BC4A 1NPUA 2NTFB 3K8LA 4AM0B 2R2EB 4U1IA 5GRUL 1E6JL 2MOVA 1GGCH 2YA2A 1BMGA 1HNFA 1OL0A 5DQDL 3OKEA 4CVUA 1URLA 2PXYA 1KPUA 1ED3B 1I7RA 5D1QC 3STBA 4P46B 2FX8H 3TF7C 1K9TA 4Y2DC 4JDVA 1L0XA 4U6HA 3CPLA 1CGXA 3IETA 1ODAA 4JO2H 4UTBL 1MLBB 3QG6A 5F8RC 3VFSA 3VRJB 1I1CA 1QEWB 1DP0A 3VWKA 3HE6D 3QUMH 1U8IA 3C6LC 4IJ3C 4XH2B 4GJTB 1CU4L 4X9BA 1INQB 1FZMB 4MAUL 4QRRE 4Y19D 4JFZH 3B9VA 4M61A 1DBKL 4EN3D 2X7LB 5CWSB 2X10A 3EUUA 1KLUA 1NC2B 1Z9SA 4UIKL 4MNQE 3VRIB 5KS9A 2V17H 4PP2B 1R24A 5FA4A 4FQHB 2VAAB 5EIIB 1UG9A 2F15A 1CG9A 5LGHH 4NCC2 3G5YA 1X5GA 1N3NB 4YPGA 5C9JA 3BP6B 1KPRA 1QVOA 4Z7UF 1DQLH 5JOEA 2C3VB 2C7UA 4ZOBA 1LO3L 5JHDA 5DEGA 4PREB 5EO9A 1IC4H 4LMQE 5B38B 2ERJB 4OZHB 3TH3T 3K2MC 5TQ2L 5SV4A 1NCTA 3RVXC 1IKNA 1QD0A 1ZLVK 3GMLA 5AZEH 4WU7B 3EGSB 3QUXA 2AK4A 3VG0L 5T1DH 1D9KC 4HGKC 3QUZB 3UPAA 1J88A 3G6AB 2EKJA 1KXVC 1NEUA 3MRLB 3LKQB 2IQ9H 4OKDA 2DTSA 3OXSB 4IHOB 4HK0A 5FOBB 2ZCLH 1HHGA 3HCVA 1YQVH 3REWB 3LN5B 4X7EC 3TO4B 3BKYL 1EV2E 5A2LH 4Z7WE 2N7AA 4UMGA 1NFIA 1UXWB 2H2PC 2HT3D 1JNJA 3DYMA 4LOUC 1LP9E 2OYPA 2Y06H 1GZPA 3GSVA 3WXWH 4UT7L 1R3HB 4XVSL 3WV0A 4F3FB 1MRFL 4JFPA 5C6TH 1ZTXH 2BRQA 4Y4FD 5DT1L 5SWSD 2ZKHL 2VISA 5DHYA 5AYUH 3V52L 4Y7MA 3WNPA 4MVBC 1FORL 3EHBD 2FWOA 5TQ0H 3RAJH 2P8PB 2FNBA 5D71L 5HXMA 3TA3B 3WO4B 1OM3L 1T20B 2EDWA 1J8HA 3OV6A 2WWKT 1A7NL 4ZXBC 4X6EA 3MYJB 3PP4H 3P0GB 1Z9MA 3PWPA 2MCG1 3RGVA 1MFBH 5I1GH 3MNWA 1I7ZA 5IBTH 5ECJE 4OZGE 2OJEA 3T3MF 4XXCC 1U8OA 4U1GB 4MAYA 5LXGH 1ZEAH 1Z5LB 2VLKD 1IQDB 2V9TA 4RX4A 4WTZA 3O9WA 4MWFA 5IV2A 4XBEL 2NW2B 5EZLB 4UUJB 3UC0H 1DVFD 5D7LE 3H0TB 2A83B 2SEBA 1TCRB 1KJ2B 2I9LB 1LEKA 4XPBL 4Z78A 1D5IH 1CWVA 1FVDB 3QHFH 3WLWC 1FC2D 3S5LG 4WI7A 3TFKC 5C0CA 5IB2A 3TNNA 2H1PH 4GKZB 2EE6A 4FQQB 3U36B 2V7NA 3KNBB 4EUPB 4KFZC 4LSVH 3DI3B 2VB5A 4L3EA 2HYMA 3RIAK 1TPXC 4V1DD 2RQ8A 3M1BB 4E41E 4NFCA 4JO4L 1A7QL 1F3RB 1S7RB 4JE4B 4HIIB 3N1GC 2CRMA 3O6ML 1A6ZA 4RWHA 3ZKQD 5HHOD 4JRXB 1ERNA 2AXJA 5D7IF 1IGYA 4XNMB 4W4NA 1ADQA 3SDXE 3MLPA 1W72H 4I2XA 1YN6B 3EOAA 3HC4L 1FE8H 4WW1A 3EZJB 3ZZ1A 2QHRH 1HKFA 1OP9A 4WO4A 3NCYP 1I7TB 5GGTH 4BYHA 3T0EA 3Q6FB 1QSEA 1SYSA 1MIEH 3K7UA 2DYPD 5HDQH 1EAJA 2BSTA 1NGWA 2BSSA 4HK3J 5I18H 2CKBH 3PL6A 4IRJB 5D1XC 5I30H 4JHAL 4J1UA 5I1DA 1X4ZA 3QO0B 2DWDA 4Z7OF 4CMMA 3KXFD 1JHTA 3MRNB 1CE6B 5HHMD 3NA9H 3JBG7 5C2BL 3OKYA 2LU4A 1UFUA 2UVEA 3U9UB 4LLQB 2ZOLB 2F19L 4UB0H 1Q0XL 1FL3A 4FABL 4ONOA 3ZTNH 4NUJB 4JPKL 1Z3GH 4RNRB 5JW4R 4XCFH 2VC2L 5C0GA 4ZNEA 3HUJA 4JM2A 3WS6C 4X6DE 2EDFA 4NKMB 5DK0A 4CW1A 2P48B 4XPGL 4BUHA 4OZFG 4X4XA 3LEYL 1KBGH 4NWTL 4JY6A 3E0GA 2Q7NA 1KTKE 4WHYG 1LO4L 4PBVC 3FMGH 2C3WA 1TTUA 2G75B 4JO3H 3L3GB 5ANMB 5DS8A 3DXAD 4QRRB 1IL1B 1CGSH 4IS6B 4N8CH 5GISL 4LCYB 1RFDH 3BUYA 4LASL 2G9HA 4LEOB 1VFBA 4KKNA 3U0PB 2XOTA 2QQQA 2J2ZA 3P0VL 4ZUVB 1WTLA 2VO5A 4AIZA 5ICZB 1MFAH 4K7PH 2DDQL 4RMSA 2Q8BH 4NQEA 1YNTA 2Z91B 3QI9C 3D3VA 5T3XD 5FGRA 4J12A 1IRAY 3C2AL 1I85A 1T4KB 4HV8A 5ILTH 1Z2KA 4AIOA 2NY6D 3L95B 4HDIA 1RHFA 1E6JH 4LAQH 3RHWF 3SY0A 4GRLB 1CDHA 3IFPA 4RAUA 2O5YL 3GUTB 3VGAB 2IMMA 1CK0L 4JQIL 4WFEE 4XNZC 1RUAL 2MHAB 5B39G 1MAKA 4LNVA 1HHHA 4S2SA 1T89C 4PR5B 1EA9C 4L4TD 4PJ9D 3WIIH 1QTYT 4OJFH 1PFCA 3HLAA 1KYOJ 2GK0A 2JK5A 3DETD 4OCYH 3UEZA 3BI9X 1EPFA 2OX5A 1FFOB 4Z7NF 1BVKA 4P5TB 3BDYL 1GGIH 4EOWL 1GJIA 1I1YB 1XIWB 3NZHH 1HYRC 1JWUB 1B6DA 3ZT7A 1F2XK 2VERN 4IBLT 4NWUL 3LQMA 1NDGB 1V5JA 3QCVL 5J7CC 2V2XA 2AW2A 4ODVL 5JIKA 4Z7WB 4G8GB 2BVOA 3DX9A 5EPMB 1UM4H 1LP9B 4ZYKA 4JFDE 3S7GA 1QKZH 3CCHB 3QRFM 1FYTD 4KKLD 3WNNA 5F3BB 4X4YB 4LFHD 4LSRL 5CJOL 3G5XB 5A16B 4L8CB 4HD9A 4P9HL 1RHHA 4WUKL 2AJVL 3MJ9H 3IDUA 4NQUA 4U6YA 4XBGA 5HVWA 4KDVA 3D69A 1NFKA 1DCLA 3QIBA 1RK0B 5CINH 3CH1B 2ARWA 3HRPA 1VGKA 1CFVL 3V4UL 1AE6L 1JN6B 5KN5B 2IBZX 4XXDB 3DHJA 1QZ1A 4OZGB 1BQHG 3IDMA 3OHXB 4AEFA 2AXFB 3HNSH 3MMEA 5LWYH 4MB3A 3OBAA 4PJ5D 2P1YA 3FQWB 3BXNB 5EZJB 1HILA 1DR9A 2NR6D 4NNXA 1M7IB 2XXMB 5D7LB 4NYLB 3MGOB 1MSPA 3TYFB 4NPYB 1MWAL 2E9WA 2C1PA 1YEEH 1C1EH 5EU6A 5EUOB 1JGDA 3W0WA 4MLIA 4F57H 3P9WB 3EFDH 1WWAX 3CSGA 2FJHB 3O4OC 1KUMA 3DX7B 1FFPA 1CICA 1N8ZB 2NY3B 3D39E 1JPGA 3ARRA 1QRNB 3VD4A 5JNYA 1JF1B 3MBEA 4E41B 1M7DA 1IGTA 4KZDL 2VDKH 4YHNA 2X1WL 2CQVA 1RJYA 5ADPH 3CMOL 5B3JE 5D1ZA 1CL7L 2A9NL 4UT7H 4U1MA 3SDXB 4MDIB 3JUYA 1QBML 1G7QB 4OZFB 5GSVA 1XGYH 1ACZA 4AMKH 1V05A 3KWWA 4UT6L 2MWCA 3LS4H 3BFOA 1K6QH 4RFEB 3QUYD 2BSED 4ELMA 2YK1L 3OB0K 1A6WL 5BRZA 3P9LB 2ZSWB 4XNXH 3IDJA 5BS0B 3TIDB 4NT6A 5E8OA 3W2DL 1A6UL 3BP5B 4QHLA 3B9KC 2GJJA 3S8WA 1NC4D 5FM8A 1IC5L 1RZ8A 2FIKB 3O3BA 4GG8B 4F7PA 1E4WL 4ISVA 3IFLH 4PP1C 3QJFA 5E6IC 2HLAA 1PKOA 4K7PY 4P2QD 4YXLL 3G04A 4HC1L 3H7BA 5GS1A 1NUNB 5ELIA 1KF9B 5MP6H 3C2SA 1F42A 4CU8A 1U36A 2BVUA 4NJ9H 3VXRD 3OZ9H 1MCLA 4PJBE 3GHBL 5T3ZH 3MGAA 5F1KC 1OARL 2B0SH 1Y6NR 1BD2E 5JMRA 1JYVA 2FX9H 4JFEE 3C60B 2NY5L 1OTTD 5ID1B 4Q2ZB 5D2LE 5B39B 4FXGA 1UA6L 2CUIA 4LCIH 4MCZB 2PO6A 1R6VA 4HWEH 2W0PA 3DX8B 5GS2D 3KYAA 5IT2L 12E8H 5EU5A 4U7SA 4CKVX 3V5DA 2LVEA 4Q6IA 4UT9L 1ITCA 4NQDD 3REVA 5DRNA 1JYWA 2Y9RT 1S9YA 1VEMA 3MYZA 1VGEH 4Y4HD 3INUL 3L1OH 4U6XA 2J8UE 3AVEA 4NNYA 3GSNA 3RPIA 3RNKB 5L88L 2VDPH 3TZVB 3IU4H 5I0ZA 4JY5H 1FZOA 4CN6A 4PY7B 5E8EA 5T1KD 4LCWE 4NNPL 4XPTH 3BWAB 4RBPH 1I8LA 3FOMB 5DRZA 3LKSA 5B8CC 3TBSA 4H25B 4E0RA 3LEVL 4NZRL 1X4XA 3DBXA 2KL6A 3GSUB 3PGDA 4LLMB 1HSBB 4KJQD 2F19H 4QOKE 1P53A 1WC7B 5IROC 4K3JH 3PNWB 2CK0L 3TH2T 4Y5VC 5HI5D 1CZ8H 1LMKA 3FFCD 5DJ8A 5HI3D 1L4IA 5F3HB 3PDOA 3KLSA 1BQHB 5JW3H 4HIJA 4KK5D 1JFQH 3IDXH 4OFKA 1CLZH 4Y1AA 1AH1A 3ILPA 4POYA 2VKWA 4LPTA 2DTML 2ED9A 4S11A 2CJUH 4NO5A 4ZSOA 3LHPL 4KDTC 1CR9H 3F62A 1JE6A 4JFDB 3GJEA 1XH3A 5E8PB 4GO6B 4YHLL 2E6JA 1WZMA 3VD3A 4XNYL 3EOYG 3PWUA 1WBYA 5DJYA 4ZO7A 2DI7A 5I1IL 2Z35A 1U3JA 5LGJB 5HGGS 3MRGA 4DZBB 4H1LA 3QZWA 5A2FA 2CXKA 5FKPB 5I15H 4C4KT 2AEQH 4N0UE 4M1DH 1QFOA 1HEZA 2HH0L 3SCMB 4AYFA 4X98A 5IB4B 4P3CL 3MUHL 4K9EL 5EOCH 2BOCA 3P4OB 2YD4A 3O2WH 5EU7C 3TVMA 3ZE1E 2APVA 3UCRA 3MZTA 1C5DA 4RAVA 4DUXA 5ETUB 5E99L 4JFOB 3WJLC 3ARDD 3RI5K 4JQIH 4NZTH 3U0TB 4LU5L 1MVFA 4XVJH 3BZ4A 1L6ZA 2VDLL 3HE7A 5C08D 3ZSSA 3KJ4B 4OFVA 4Z5RB 2Z31C 4XC1L 5H94B 3T0XA 4JAMA 4M8VA 2EH8L 4YNYB 2LVCA 4P9ML 1D6VL 4KTDH 2NY7L 2I60L 2ZG3A 3WJJC 5JHDE 1HQ4B 3FTGB 4MA1B 4OLWH 3S35X 3BPNB 4S1RL 4JZJC 2VABB 3STLB 4KJWC 2X9XA 1YDPB 1YEKL 1QP1A 3VFTA 4PV9A 3RL1A 5F70A 1NDMA 3LKOA 2CGRH 4OZIE 1CCZA 1H15A 1HH9A 1ZHNA 3QCVH 4M7LT 1FZKA 1ZE3C 3I2CL 4ODVH 5IVXF 5K9OA 3L5HA 2AK4E 3WEXA 3ZDXE 5FO8B 4PTUA 1AJ7L 1A1OB 4WV1A 3SO3B 2NYYD 4B41A 4NM8H 4APQA 3O3AB 3ETBF 1XGTA 3FRPG 3MPCA 4IRZL 5FCUL 5E0QA 2EDXA 1NMBL 4L3CA 5CJOH 4RIRA 2D9QB 5T5NG 1LE9A 4B0MM 3RY4A 1G7HA 4JRYA 5KSAA 3QUKA 4MHHI 2DLTA 1U3ZA 5KZCB 5ALBL 2A6IA 3G6JE 2ADIA 4XP1H 3MRKA 3V6OE 1J1OL 2P7TB 5F9DC 1BFOA 3S36X 3SGJC 4FQCL 3CXHK 4WGWB 3SGEI 5DF0A 1YY9C 3H9YA 4F7EA 3W39B 5J1SC 5HYJE 1Y18A 2MQ3A 4JHWL 5FUOH 4NN7C 3KS0H 4G6ML 3C5ZB 3K4ZA 4GBXC 2F54B 4K2UL 2RAMA 3IKCB 3MGTA 2JB6B 3RGHA 2IQAA 1SBSL 3RWDB 1VEOA 2OJZH 3LN4B 2FO4A 5E5RB 4ZS7H 4U1JA 2B4CH 1DTUA 4N0FA 1DQQB 1SY6L 1KTLA 1UQSB 2D7TL 5JXED 2X42A 4PJBB 2D03H 2XTJC 2BJML 1WFOA 2E9BA 4XCNB 3P0YL 4XMPH 4G6KL 3SDCC 4M02A 1CD9B 4U3HA 2GJZA 5F1NB 2X89A 1S9XA 3V4VL 1P1ZB 1RZFL 5TE6H 4BH8B 4DWHA 4MNHB 2H32A 1HZHH 1KIPB 2E27L 3UYPA 3PWJB 1CL7H 3RWGA 5C0CE 4FQXC 1WK0A 2DMBA 1G7IB 1I1FB 1I75A 5D1QA 3EJZD 1FNLA 5D7JB 1H9VA 2QSCL 4LVHB 2FB4H 2IANE 2J8UB 4NN5C 4L3EE 3HRZB 4Y2DA 1MCHA 1VFOA 1Y0LB 1MCBA 4GKSB 3TO2B 3GM8A 2XKNB 1F4AA 2CLZB 5BXFA 4DGYL 4HBCH 2OZ4L 3TT1L 4GH7B 4R4FL 3C6LA 4DFIA 5HD8C 3ARFB 4UNVA 5LAXB 2DL2A 1I1AC 4R0LC 1OTSD 2G5RA 1NAMB 3FO2A 4MX7A 5FO9B 1T7YA 5DD0L 2DL9A 5JQ6H 3D2UD 2VITB 4K3GA 4WTZG 3FRUB 1FL5A 1T1ZA 3NFPA 5HGBB 5C07B 1R5VB 3ULVF 4IRSB 3HPLB 4JO1H 4KHTL 4QOKB 4LSUH 3QFDB 5AAMA 4BFEA 1R3KA 3T0EE 3T8XB 4F8QA 3GSOB 1GOHA 4LIQL 2BC4B 2DLFL 1XF4A 5JPMA 1IGFH 4U1IB 1CE1L 1F3DH 3F6LA 4BFIA 1EFQA 3ZL4H 3FQRA 1EEQA 4FA8A 1M71A 3GO1L 1H3PL 2IEPA 4HWZA 5BVPL 1IVLA 3B8SA 5E9DA 3OKEB 4MD5A 2B39A 4KK9D 4ODTL 1KCLA 5FHBH 2XA3A 4R3SA 3UJIL 1NCDL 1KPUB 1MQKH 3RIFF 4P49A 3AXLB 3RY5A 1I7RB 4GUPA 4X5WA 1TQBB 3UX9B 4HWBL 4WWKC 2VXUL 4M48L 4U6HB 1KJVB 5DZLA 3IETB 3OAYH 3QG6B 1MHCA 4FFWD 1D9KA 2BZDA 3VFSB 4KXZI 3VWKB 2M26A 4PUBL 1U8IB 3CDGA 4L4JA 2IBBA 1U0QA 3T1WA 5FUZL 1L7TH 1OCWL 4U1LA 2Z8SA 2NX5E 3QXTA 1BZ9A 2J7LA 5JQHC 1NGPH 1UZ6E 1DLFH 3OX8A 1NCNA 1YEGL 5FHAH 3MXVH 3T4YA 1GHFL 4ZFZB 2WUBH 5KS9B 4LRIC 1DEEA 1DBMH 4HEME 1MH5A 4BM7A 2W9LA 3MA7A 1UXSA 5F9WB 1R24B 5HHXH 4HKZA 2EEBA 3EAKA 1F58L 5JXAL 1T66C 5CP7A 4ZOEA 4PGDA 2ZCHH 1OD9A 1P69B 3G5YB 2WINB 4YPGB 5C9JB 1VESA 3BYYA 1KPRB 1QVOB 2MPAH 4DUVA 1EFXA 4X7SL 3RP1A 1VFUA 8FABA 5JHDB 5DEGB 1J1PL 2R8SL 5DO2D 5EO9B 2ENYA 5KBNC 3GIZH 2P45B 1FL6A 1ZMYA 3DJ9A 4ZXBA 5I8KL 2OTPA 5E1HB 3GMLB 1HSAA 3BT2L 1EZVX 3QUXB 2O5XH 2AK4B 2APWA 5T3XH 3NGBC 3BEWA 4N8VA 4XXCA 4HGMA 1RIUL 1QO3A 2D0FA 4MJ6A 4I3RH 1I4FA 3DGGA 2D7MA 3RA7L 2AABH 3PQYE 3UDWC 3HE6C 3QHZL 4OZGF 3NCMA 4IDJH 5MEPA 1E4XI 2NY2B 4NKQB 1BREA 4HMDA 4U2YA 5TDNA 5INCA 1NFIB 5CIPH 4EN3C 2YMXH 5ESQA 1S8DA 4K9EH 2BVTA 4RWYL 1GZPB 1AGCA 2IBGA 4Z18A 1ACYH 2DI8A 1OLLA 2XFXA 4JFPB 1GL4B 5E99H 1FLRL 2VISB 5DHYB 4GMTH 3KPPB 5AD0A 4DZ8A 4XWOD 4MXQD 1AY1H 5L9DL 4JPWH 4L8DA 2F53A 4Y8DC 2X9YA 1J8HB 1VHPA 3ZTJG 4X6EB 4O5LH 2UV3A 1PZ5A 4X4MA 3IJHA 5KSVA 3PWPB 3RGVB 3MNWB 4OLXH 1I7ZB 4P9HC 3P4MA 3RWIA 1RPQA 2OJEB 1YEIL 5AYQA 3KPSD 2VZUA 3KPQA 3SDXF 2A1WL 4M1GH 2DF3A 5C09A 3O9WB 4MWFB 3HG1A 3WS3A 5IV2B 4GAGH 5D1XA 4EIGB 5CEZE 3U9PL 4GLRH 1FBIL 1MY5A 2YD8A 2SEBB 4Z78B 1LEKB 4TVPE 4JKPH 5EU6E 4YK4C 3O8XD 3W0WE 5C0CB 5IB2B 2OL3B 5H37H 5KW9H 3TNNB 1PX3A 2BDNH 2VDQL 3AUVA 4Z0BH 4RGMB 2V7NB 4HF5L 1NL0H 1QLFB 2R29L 4L3EB 2A6DB 5I1HH 3OKKA 1ZLUK 3WS6A 2B4CC 1CLOH 1ZA6A 3CVHA 1KCVL 5KJRH 2A6JA 3ZKXB 3Q3GB 2XN9D 1A6ZB 1MEXL 2EYSA 4M5YL 5F8QC 5E00A 1UYWL 5I8EA 4PV8A 1P7QA 4ZFOA 25C8L 3W5NA 3KLAA 4Y4FC 5FK9A 4EIZC 4QHUA 2YEZA 4HULB 5EA0L 4I2XB 4IDLA 3ZDZF 4X6DF 3FFDA 2EDBA 3EHBC 2WUCL 2Z4QA 4G3YL 1KC5H 4HJ0D 1JRHH 4MHHG 3QEQE 4WW1B 3NFSH 4WO4B 5E94A 4ELME 3VXNA 1KLGA 3T0EB 2OS7A 2FH8A 1PQZA 1UH4A 1SY6H 1SYSB 3IRZA 4PJEA 4PRHA 1WFUA 4RZCA 2BSTB 1NGWB 2BSSB 2R0LH 3DPBA 3PL6B 3WKMH 4HAGA 3DARA 3QI9A 4JG1L 4J1UB 3P0YH 5I1DB 1UCBL 2DWDB 4JB9L 1G1CA 5AG8A 5BOPA 4PJFE 4CMMB 4PRPE 2IFFL 2PYED 2E9IA 1LILA 1FIEA 2JJVA 5EUKA 1SHMA 3LIZL 1NSNL 1DVFC 4LSPH 4BUGA 1IT9H 1MY7A 2ED8A 1FL3B 2A0LD 4KKBD 5C0GB 3HUJB 4JM2B 1J0JA 4I1NB 3WIHL 1A47A 1KEML 4CW1B 3F58H 1T89A 4WI8A 4X4XB 3K4DA 2DBLH 1QSFE 4YHKL 4JY6B 2HKFL 4OCWL 3S37X 1BM3H 1NC2D 1N6QH 2R0KL 5FYKL 4KWUA 5DC0A 4N5UA 5EWIH 3H42L 5DS8B 4IIQC 2X5PA 4MJ4A 4KHXL 3DSNA 3VXMD 2DKUA 3PUCA 3P11L 4DN4H 4PRID 3BUYB 3IF1B 4NJAH 3TT1H 2G9HB 3KAAA 3QFJA 4NO0A 4R4FH 1VFBB 2G5BA 4U49A 2NY5C 2IPKA 2XICA 3MLRL 4ZFGH 4QXUH 3UTTA 1NBVL 4AIZB 1OSPL 4AEHL 3HC3L 4NGHH 3RU8L 3ZMRA 4NQEB 1YNTB 2KUTA 4Q0XH 3D3VB 4LHJB 3U30C 1DSFL 1KNOA 4GMSL 4UILL 2VLRA 3X14A 4HV8B 2DWEA 5GS2H 2OTUA 3FT4A 3MRBA 4HDIB 3QCTL 1NUFA 4JPVH 1CBVL 3QUZD 3PXHA 2V6HA 4ZUWB 3SY0B 3TM6A 4AL8H 3MRCA 1DUZA 4NP4H 2XA8L 3DOSA 3IFPB 3K0WA 4RAUB 3NAAL 5F44A 5J0BA 3ALXA 2YPLD 1YNKH 4JPIA 2CIIA 1MNUH 4LHUD 4TUKH 4S2SB 4YDIL 3FB8A 3D1MC 3ZYIA 1BAFL 5D6DC 4R6UA 3G08A 3BMWA 3SDYH 4NZJA 1CLCA 4P3WA 2GK0B 2JK5B 3HLAB 4DQOL 4ESKA 4HWBH 1JZ8A 5LBSH 2R1XA 4M48H 1BVKB 1BP3B 4J3SA 4ZO6A 5FM5M 2ZNWA 3TJHC 4PJXA 1JNNL 3PP3K 1LE5A 3GFUA 4Y4KD 4PJGF 5HDBE 1G1YA 4Y1AE 2PW2B 1TETL 1RY7B 3L5XH 1QACA 3MLSH 3QIUC 3AU1A 4R8WL 3VXQA 5F1IA 5E7FA 4EDWL 1Q9LA 1FIGL 4HEPG 2JJWA 3DX9B 4ZYKB 1PYWB 4NQCD 4XTRD 3ZHLA 1MUJA 4KKAC 2YD7A 4UBDD 5F7MC 1UZ8A 2J88H 2J5LB 1RHHB 2JIXA 2VLMD 4U6YB 3MUY1 1WTGT 3EYSL 3D69B 2AK1H 3QIBB 2DJSA 4PGEA 1KB9J 5ITFA 4EEEA 4C83A 1VGKB 3V4PH 2EE3A 5C0EA 2NY6C 5DZNA 2MCPH 2Y5TA 5HHPB 4QNPF 3V7MA 1RUQL 3S4SG 5B3JF 5JPNB 4NM4H 3EYFA 3IDMB 4P4KD 3MMEB 1UWXH 5EZOH 4N0RA 4M7LL 4UINH 5DTFA 3QDAA 3TC9A 1BF8A 3BHBA 4I3SL 1HILB 4HS6A 3B9KA 4NNXB 4PJ9C 3A6OA 3QNZA 3GKWL 4RMVA 4K7FA 2H45A 1KG0A 3DETC 1SJEA 4K9EC 5E6IA 2C1PB 5EU6B 4KMLB 4PLJD 1JGDB 3W0WB 3O6KL 2IAMD 1I3GH 3T2PA 2WIMA 1JK8A 1CICB 5IM7A 1TJGH 4W4OC 1JPGB 4GG6E 3DECA 5GJTL 3T0AA 3QZWG 5IIEA 5JNYB 4GQ9H 4M43H 4GS7B 1W72A 4W68A 5GSRA 1IGTB 4YHNB 4PFEA 1EGJH 3V0VA 1RJYB 1H3UA 2DLIA 5D1ZB 5TE7H 4KKLC 4Z8FL 2WANA 1ZGLP 1INDH 5F6IB 2Z93A 2ZUQB 3GSQA 2KKQA 5GGTA 1IGMH 3GK8H 1WWWX 3MLXH 4CADA 2P46B 5CJ5A 2KBGA 3KPNA 5GSVB 1U8LA 4IRJD 3RPKA 3VFVA 5A2KH 3KWWB 4PRAA 4JRYE 3NN8A 4G5ZH 4YIQA 3VFMA 1F4WL 5CJQL 4ELMB 5BRZB 2DQTL 5D2LF 2EC9T 3IDJB 4NT6B 5E8OB 3AM8C 3CX2A 4QHLB 1OPGH 1AKJD 2VIRA 3HMWH 4DOHE 2QKIA 1RZ8B 1DJSA 3O3BB 4PJ7A 5E4EB 5TGBA 4F7PB 5ISZE 4ISVB 1UWGH 4PJFB 3KPMA 2HLAB 4PRPB 3E3QE 4HMEA 2A74A 3QDMA 1HK6A 1MHHA 2OMBA 3NPZB 2NR6C 1LK2A 5AWNL 3ULVD 3G04B