3TFKD

42f3-p4b10/h2-ld
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
239
structure length
239
Chain Sequence
AVTQSPRNKVTVTGGNVTLSCRQTNSHNYMYWYRQDTGHGLRLIHYSYGAGNLQIGDVPDGYKATRTTQEDFFLLLELASPSQTSLYFCASSDAPGQLYFGEGSKLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H2-Ld SBM2
publication title T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 54
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tfkD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tfkD02
5EU6B 1YEEL 3WFHA 3O11A 1CGSH 4HT1L 3FL7A 5I16A 1A1MB 4LSTL 1B2WL 1U8OB 4HIHA 3I75B 1U8LA 1M71A 3ULVF 2EZ0C 4WHTA 3QUKA 2BOCA 3P40A 5IJKC 2FX7L 5MEPB 4WFGD 3NCEB 2X4RA 5HPOA 4KKCD 1HKLH 1AXSB 2BVTA 1OT2A 1QFWH 4JFFB 1NAMA 4X9BA 4GKZB 1AE6L 1T5WB 2F54E 4YZFE 5E4EB 3N9GL 1CXKA 2NW3B 1A3LH 2X70A 3UROR 4G8EB 1OWWA 2BRRL 5DJ8A 4AMKL 2A6IA 4DVRL 4JY6B 2I07B 5E9DD 4K7PX 1RK0B 4X6FB 1JZ5A 3VGDA 2BXYA 2LE9A 1NCBL 5HHOD 2P8MB 5ACZB 2VXTH 5HI3C 4DUVA 2PYEA 1FGNH 5HYJE 3R8BB 2EC9T 5FK9B 3RKDC 1ETZB 4XX1E 3GMNA 2VDRH 1G7JB 4JZOA 3BH9A 4GW1A 1OTSD 1D5XA 1YEEH 2H32A 4HT1H 3QDJB 4HH9A 4LSTH 1JMXA 4KJQD 3LOWA 4NKQB 4PJ8D 3BZ4A 5DJCA 3MR9B 3BVNA 3RRQA 3VMOA 2CQVA 4IJ3C 2V7HA 2FX7H 1VESA 3VXSA 3HAEG 4ODVL 1MHCA 3MRLA 5D6CA 4P2RD 4HWEL 3SE3A 2LV4A 1A21A 2NY3B 4HC1A 1AE6H 2HT2C 2PNDA 3ZHKA 3N9GH 3EDFA 1BQUA 4RBPK 5I1AB 4UQ2A 2HFFB 1T66D 1F58L 2BRRH 3REVB 2CGRL 3ROOA 4DVRH 4HUNB 2A9NL 4N8VB 1RJYB 5GRWA 5FFLA 5LKNA 3OQ3B 1ZA3A 5JHDB 2P5EE 5CJ5A 2OL3A 3WUWA 5I1LB 3GMOA 3K8KA 4K7FB 2XZQH 3OR7B 2DMCA 3H0TA 3IFPB 4TVPE 2ATPA 4AYFA 3VG0L 3NGBB 2E27L 2P43B 2LQRA 4FXGA 1KEML 2X1QA 3VXRB 1OQXA 3RIAK 5AD0B 1C12A 4G80A 2DMBA 1BJ1J 2VNCA 2YEZA 1NCAL 5DC0A 4ZFZA 5EFIA 2YC1B 1KPRA 3FQTB 2L4OA 3K81A 2NX5A 1U2CA 2IAMA 3BUYA 4KRMB 3KXFA 4ODVH 4X98B 4DKDC 1FVCA 5KSAC 4L3CA 4HWEH 4MXQC 3HI6L 3T0EB 2IBZY 3LAFA 5JXED 3GIZH 3BMVA 1P5UA 5SWSD 2Z31D 2J2ZA 1GGUA 4GRLA 4F8QA 2P44B 3UBXA 3GMLA 3K8LA 1FYHB 2CGRH 1NC2D 4RGND 1FO0H 1OGTB 3WFHB 2A9NH 4LSQL 4EJ1C 3F7YA 3U6RB 3O4LD 5MEQB 5BW7A 3KNBB 4RRPG 3RWIA 4Y5VA 2HVJB 1PKQB 2AJZA 1X44A 5HYQB 3SDXA 5ID1A 3ZSSA 4C56A 4P46B 4R4BA 1QG3A 1L0XA 4KRPC 2C4XA 4OGYH 2AJ3A 1KIRA 3HE6D 1TTFA 2E27H 4U6XB 5FKAA 1NAMB 3BQUA 3QIBD 3C60A 3TZVA 2HJFA 1KEMH 4NO0D 3KPRB 5C0AE 1KCVH 5I75B 4FQCL 3LQMA 2V9TA 2X70B 1BOGB 1FVDA 5DJ8B 3CCHB 1NCAH 4F9PA 7FABL 2ZCHL 1JYVA 3UTPD 3SDXF 1I7RB 1MFCL 1ACYH 2Z8RA 5FYLL 2D7NA 1BBDL 2BY0A 5IB3B 5CS7A 1JPSL 3HI6H 5F1OB 3BPCA 4WENB 4HUMB 2VUOA 2YOCA 2LAGB 1GYAA 2HJLA 3CFEA 5EUOE 2C3GA 1S7UB 3CSBA 1F90L 4PJDE 4M02A 5J13B 1CXHA 3BH9B 5D6DA 2OJEA 1QFOA 1RUQL 4LSQH 2VDLL 3MJ9A 2VSCA 1D6EA 4XTRD 1BQHA 3MYZA 1CGYA 1G0YR 5TQ0H 3RDTC 5SWQA 4LHJB 4U1GC 2NY0C 3JV5A 2X4TA 2VZVA 4YHZH 4ZXBC 1XGQB 1LE5B 3U82B 1Q72H 3IFOB 4PJIF 3VXSB 1MHCB 4RGMB 4Y4HB 1JCKA 2EDDA 3K7UA 3CZFB 4N1EA 4R97C 1L0YA 3VA6A 3PWUA 1RURL 1NFDA 5ESQB 4OCLC 2EZ0D 3CJJA 4FQCH 3RWJA 1GH7A 4KUZH 1L6ZA 3QDMD 4GKSA 1DQDL 1KB5A 7FABH 3BSZL 2ZCHH 1WCBB 3V2AR 1LP9E 4BSVA 4OQTA 4GRMB 3ILPB 5DUBA 4V2BA 4O2FA 1AGEA 4MQTB 5FYLH 3RZCC 4ERSL 4YIQA 1G7HB 3G5VA 1JPSH 2FEEI 2FX8L 5HGBA 5J11B 4RFOL 3MLTA 2ATPB 3DBXA 1K3IA 5E56A 2FIKB 4WDIA 1U8IA 1F90H 5DRXA 2C3XA 1T2XA 4JHAL 1CXIA 2IPUK 4XPAL 3H2WA 1RUQH 1UM4L 4TUKL 2VDLH 4H26A 1C12B 5LXGL 2IPTL 1XGPA 2J88L 1SBBA 4PJ9A 5HI3D 1C16A 3MNWA 4WW2C 4N8CL 3IJYB 3M1BA 3RKDD 4ZSOE 2EH8L 5GGVY 1UB5B 4LCUA 4X8JB 2VZ3A 3ZT7A 1F2XK 2YPVL 4L3CB 4ONFL 1IAOA 3MRGB 3WS6C 5LGKA 1RURH 4MD0A 4YHPA 4ZD3L 4ODWB 4LCCB 2XPGB 3EIFA 1TCRA 5I9QC 5IIEB 1QSFE 3ARQA 1DQDH 3I50H 3FQNB 2VH5H 2WIMA 3QEQD 3BSZH 4FXKA 4KJWC 2HKHL 5I30L 3F7YB 4N9OB 1BJMA 1UJTA 2HT2D 5CEZL 2VISB 4Z0XA 3RWIB 4PJCE 4OZIF 2AJZB 4EN3B 2FX8H 2ICEA 1R3JB 2C3WA 4TUJB 1MFDL 3MFGB 1W2KT 2RHEA 5DD3L 1XGTA 2AJ3B 1KIRB 1DUYB 4PB0L 1ZA6B 5EC1A 5E8OA 3MRPA 4HIXH 3S3SA 3BQUB 4MLSA 2O26U 3C60B 4JHAH 1PG7X 4XPAH 3KLSA 1UM4H 2EKSA 3NFNB 1Y18B 4O58L 4XAWL 3GJEB 2IPTH 5LXGH 3S3JA 5C08A 2NLJA 3OKMB 3BPOB 1KJ2B 3EOBB 3INUL 3P0YH 1FVDB 1WWCA 1A7QL 4N8CH 1KPVB 2ZCKL 5FKPB 3DXAE 2EH8H 5C07E 3SOBH 5HBBA 1SYSB 5F7UA 4JRXA 1DP0A 2YPVH 3DI3B 2CRZA 2IEPA 2FECL 1BM3L 1P7QB 4PJIB 4JKMA 4ZD3H 5L2JB 4FQLL 2HJLB 3X14B 1W72A 1YNTA 3CFEB 1C5DB 3BPLC 4PP1C 4Y4KA 3PQYA 2AK4B 2OS7A 5KSAD 4NM8H 2OJEB 5I30H 1H3WM 4MXQD 4Y16A 4MJIE 5CSZB 1D6EB 4HGKC 5DQDL 5CEZH 3AUVA 4HKZA 5CSBA 3BKCH 2APVA 4H1LH 4IMKA 4DKEL 2ZP0T 4D9RD 5I71B 3VG9C 2W1NA 2Z35A 5D7LE 4CKVX 2BVQA 2GHWB 5A40E 2BVOA 4NWTL 3EJJX 3BI9X 1QRNA 3TJEL 3U46A 4U2ZA 1MFDH 3GSOA 1XGYL 5DD3H 4G6FB 4PB0H 4Q7DA 1NCUA 4UTBH 3PWUB 1ZVHA 1B0RB 4O58H 4OUUB 3P73B 2OTWA 1F45A 4C55A 3VXMB 1TVDA 5B8CB 2F54D 4KRPD 2R4RL 1A7QH 2L7UA 1FQ9C 2ZCKH 3MV01 3UTTE 4RWYL 4X5LA 4TNVK 4NQEE 3ME0A 4GAYA 1CBVL 4KI5F 3ZDXF 4FS0A 4YIQB 3HAEB 1IZKA 1CGUA 3D25B 3AS1A 5EWIL 1BM3H 5GGTA 3SE9L 3GEWB 4JE4B 5ITFB 4RAUA 2VLRB 4PLNC 3P3YA 2FR4A 4FQLH 4JPIB 5DT1L 5C0DA 5GSVB 3MLTB 4NRYA 1TJGH 3TBTA 3DBXB 4I4WB 4XCYA 1NKOA 4NCC1 5HDLA 5DRXB 5GISL 4ZDHA 3D1MC 1KACB 4IBLT 1UB6A 3HRZB 4H26B 1KULA 5DQDH 3LKQA 1U3ZA 5DJ0B 4H5SB 4DKEH 1NCDL 5F6HI 1C16B 4TPRL 1LMKA 2VLLA 4Z7UA 2DB8A 4WWID 4NWTH 1EIBA 2FBOJ 5F44A 4PV9B 1MFBL 3TJEH 3ZTNL 4DJMA 5KAQG 1FL5B 1XGYH 1WWAX 2DD8L 2Y5EA 1IC1A 1UH3A 2E7HA 4OZIB 1DN0B 4CU8A 1J0IA 3VFWB 3RDTD 1C5CL 4MD0B 3KPLB 2DJ4A 3ZLQC 4ALAL 4ZXBD 2NY5L 2BNQA 3LS4L 2MCPL 1M4KA 1A2YA 4PRNA 4L4TA 3QDGA 3T77B 4PJGE 2R4RH 4D0BA 2HFEB 1KJVB 3K4AA 4GBXB 5BOZG 3NCCB 4UV7H 1GGTA 5INDB 4M7ZB 5L7XL 3S36X 2EIZB 4Z7UF 1KGCE 1CBVH 5BVJA 1HE7A 1NJ9B 4NM4L 3BP7B 5HVWA 3QNXA 1SJHA 4Z0XB 3VXOA 3CNKA 2V5RA 3BP6A 5EWIH 4ZUTB 3SE9H 4EOWL 4BZ2H 2P5ED 3FFDA 5DT1H 2X9YA 2YA2A 5E8EA 1XGTB 1J0YA 5SX4H 5IR1B 1S7WA 2P5WB 2Q7YA 4EUPH 1X5IA 2XA8L 3MRPB 1JHLL 5DSCB 3RZCD 5GISH 1Z5LA 3WXVL 2PYFB 5JQ6L 5ANMA 4MJ6A 1F42A 3H9SA 1ULVA 2X4SB 3MRRA 2NY2B 1FP5A 5EDXA 1NCDH 4Z76A 3QXUA 5IVNA 4WUUD 4LCIL 5E9DA 2W0FA 3ZTNH 4W4OA 1EBAA 5FM4A 1MCWW 5E8DH 2CDFA 3VFGL 5C6PB 2VTFA 3LS5L 1C5CH 3GSVB 1LO0L 1KC5L 3TVMC 4WFEE 4XWOC 5GRVL 1J87A 4ALAH 2NY5H 5KSBF 3UCRA 3DV4A 1YNTB 3LS4H 2MCPH 1OGAE 2W38A 1H3GA 3G5XA 1T1WB 3PQYB 5D7KE 2FHFA 2VDPL 4G9DB 3GB7B 5L7XH 4Y5YB 4JFXB 3MRHB 4Y16B 4PJ8A 2WM0A 4XPTL 4NM4H 3OAUL 5DVLA 1MAMH 1JPFA 2HH0L 4LMQE 2A2QT 4XXDA 4EOWH 4NKDA 2D2OA 3E2HB 2BVOB 1U8QA 3RI5F 4Q74A 4PJXE 1QRNB 4E5XA 4KJWD 4AEFA 1AO7A 1CFVL 2E7LA 4P2RA 3CMGA 2XA8H 4IMLB 1QFUL 1JHLH 4P3CL 4CL7A 3S8WA 3ZTJG 3WXVH 4PRPA 5HVHC 4UT6L 5JQ6H 4ZUVB 5H35A 3Q6FA 3FB6A 3U7YH 1UM6L 5H37G 1K8IB 2VLKA 5C0AD 1CS6A 5E95B 1OLZA 1PQZB 5DEZA 5FUCE 1S8DA 4LCIH 2X09A 4YFDB 4PJAA 2KKQA 3G6JA 2CRIA 2X40A 3QG6A 5I19L 5I8CA 1N4XH 4XPHL 3VFGH 3LS5H 3WJJC 5I1DB 2F8VA 1T7YA 1EZVY 1LO0H 1WFNA 5F9AC 4DZBA 1KC5H 4ODTH 3LSOA 4XNXL 5C0DB 3FQRA 4QRQA 1MJ7L 1Q9KB 1S3KL 5F89A 2BY2A 2FWOA 5DD0H 5AAMA 2B20A 3H9HA 1Q94B 3QXAB 2VDPH 3D39A 2AV7A 3OAUH 4F15B 1JE6A 4X6CE 4PJAF 1DQML 3B9VA 4Y19A 2YR3A 4LGPB 5K9JL 2JJTA 4PP1D 3QA3A 4YLQT 1IAIL 2CR3A 4Y1AE 4HMCA 1CFVH 4IRJB 4V1DB 4PJ7F 3BKYH 1QFUH 4J12A 1S5HB 3WIFB 2Q76A 1ZK9A 4G9FB 5JXEA 4UT6H 5SWSA 2Z31A 1VEPA 3NTCL 4LLQA 1MOEA 2HLAA 4JRYB 2Y36L 1A2YB 1UM6H 4U1IA 1NGXA 3VXPA 1RFDL 5DK2A 5E2TL 2UYLA 1G9MC 2BJML 3O4LA 2WLZA 2YK1L 5I19H 3IDYB 3TA3B 5SX5H 3GI9L 4PBXA 1PBYA 4G8FB 4CBPA 2DQDL 4AENB 3HE7C 3FFDB 4XNXH 3HE6A 1WFTA 1S3KH 4YHLL 5ITBL 4OZGE 3SKOB 2LVEA 2IG2L 4PY8J 3QIBA 5IEHB 4JJ5A 4UMGA 5FV2A 2LVCA 1J88A 5KSBB 2G5RA 2B8OT 5ECJE 5ANMB 1KIUA 1FZJB 1UZ8A 4YHOL 1DQMH 4DN3L 4OI9A 4Z76B 5KAQF 3GSXA 2KPNA 5K9JH 3NAAL 1AKJA 4MZ3A 3HCVA 4XP5L 3I6KA 3UJJL 1ZT7A 1IAIH 2W0FB 4NZJA 5E9DB 5B3JF 2KQNA 3MGAA 3CUPA 4W68A 2VE6A 3MRFB 4OLWL 4TTDC 4P5KA 4J3UA 2W65A 5HHOB 4DEPC 1X5JA 4O5LH 3U9UB 3NTCH 4BUHA 3DV4B 5E2WL 2Y36H 4U1LA 3G5XB 2XI9A 4L8SA 2DLFH 3BWAB 1RFDH 4GW5A 5E2TH 1GSMA 2BJMH 1QSFD 3UYOD 2FHCA 2PO6A 1TZIB 2APFA 1GHFL 3CGTA 1FGVL 1JPFB 3A6OA 3NCYP 3GI9H 1TJHL 1N2RA 3EJYC 2DQDH 3JTTA 3EO0B 1NEZA 1QLFA 4YHLH 1IM9A 2IG2H 1YPZE 4P2RB 4U49A 1KB9J 3CDCA 1PYWA 1HCVA 3PJSA 4F7TA 2VL5A 3JBG7 1FNEB 2YSSB 4ETQB 1ZE3C 4JN2A 3QDMA 2ZUUA 5H35B 3QIUC 4YHOH 4DN3H 3FB6B 2OL3L 1NKRA 3G04A 1J11A 5IB2B 4XP5H 4XNYL 3UJJH 1CE1L 3TEUA 5JW4R 5SWZE 4PJAB 1P84K 3QG6B 5I8CB 2CO6B 2R0ZL 3DXAD 4OLWH 4WWKA 2Z93B 1IGTA 2H32H 1IFHL 2XT1B 4DGIL 3M17B 1TIUA 3LSOB 4PJ7B 3FQRB 4KHXL 4QRQB 5E2WH 4RX4D 1A1NA 4PJ5A 5E8PA 3DJ9A 2H6PA 3P9LA 5JUEL 1L7TL 2AV7B 1GHFH 5EBMA 1K4CB 1HKFA 3TVMD 4XWOD 1FGVH 4HIJA 4QT5A 1TJHH 4MJID 2GJJA 1A02N 1NAKL 1MCHA 3DROA 3QA3B 4L3AA 4ELME 5T3XL 4D3CL 3M07A 2XTLA 3FQWB 5MERA 2XWJB 1I9JL 4L29A 1RMFL 1RZJH 2Q76B 4Y7MA 3PG2A 5SWSB 3WNOA 2K1MA 2F74B 3L5WB 3OMZA 1DFBL 2OL3H 1A6TB 2IANE 4JM4H 1NC2B 1V3MA 4RGNB 3QEQA 3WSQL 4M61A 1R6VA 5FM5O 5DK2B 1KLUB 2UYLB 1UKTA 4XNYH 5D2LA 1CE1H 3O4LB 1Y6KR 1R5WA 2XWTA 3QUYB 4PRAA 1YEKL 5DUML 2R0ZH 1WWWX 4FFZL 5EB9A 1G7IB 3GBLA 4JVUA 3UTTD 5BS0E 4NQED 2DQTL 4L8DB 4E9LA 5E24E 1IFHH 1FFNA 3B9KA 2F58L 3J7HA 3RGVA 3H3BC 3HE6B 3I85A 4KHXH 4KK5C 1B6UA 2EDHA 4YHMH 4WEBL 3VGHA 1KPUA 1RULL 3C6LC 1LEIA 4D0DA 4X6DA 4QEGA 5DC4B 3LD8C 1AGCA 4JJ5B 3VFOA 4NO0B 1RSFA 2SEBB 4CVZA 5JUEH 1L7TH 1U36A 4GUPA 4L4VA 1UZ8B 5D2LF 3NA4A 1WIPA 1E4WH 1NAKH 1YEFL 2ZUQC 3MLRL 4QHNB 4WNQA 1TTUA 5T3XH 1ZT7B 4D3CH 3SBWC 5EU4A 2WQRA 2X2YA 4JGMA 3OKNB 1I9JH 3GSUA 2RFXA 5DJDB 1WC7A 3MJ8B 1PEWA 2AQ2A 3I6GB 4M1DH 1DFBH 3MJ7B 1RV6X 5L8LB 4OZFG 1F6AB 3MRNB 1MHEB 3WSQH 2X6MA 3LKOB 3UAJC 5JOPE 1QSVA 3DI2B 2GJZB 3N1QC 1EA9C 1MFAL 3UJIL 4WTZG 3VFRB 3EJZC 1YEKH 5DUMH 4LF3B 4FFZH 2AV1A 3H42L 4NQTA 2DQTH 1KGCD 1NC4B 3WHE1 2F58H 4J8RA 1NEZB 1QLFB 5H2BB 1IEAA 4IOIA 2DDQL 1PYWB 3GO1L 5EZJA 4F7TB 1XGUA 3LQAC 3QDMB 4GSDL 3HE7D 5HDBF 2F54A 3SKNB 3QIWC 1OQOA 5DHVB 1YEFH 3MLRH 1DUZA 2K7PA 2I24N 2OK0H 1T1ZA 2XV6B 2GK0A 3DGGB 4P9ML 4ZPTB 3VFSA 3X3FL 4NKOA 4HMDA 5I1KL 3QWOA 1IZJA 5I17A 2V5MA 2EYRA 1HSAB 4KJPC 4B41A 3KYAA 1A1NB 4K8RL 4WFED 3UTZB 3GSWA 1H5BA 3MROA 5DTFB 2IH3A 4YZFF 1LHZA 4OSUH 5HYJA 4TTDD 1OGAD 4JB9L 4ORZC 3ZE1E 1CFNB 2DRUA 1MFAH 1CZ8L 3UJIH 3SDAA 1W0YT 3H42H 2APBA 1N5YL 2V5SA 1JZ8A 2AJYL 4R96B 3TBVA 1QR1A 4S1SL 4P2OD 2ARWA 4F7EB 3MV7E 1KB5H 3GO1H 4WW1A 3RDTA 5IBUG 5DYOA 1HDMB 4OCSL 5BMFH 4ZXBA 1U91B 4IJ3B 1P69B 3EJYD 1T3FA 4KMTL 4ZOAA 5DQJB 1WBZB 3PGCA 2OR8A 3GSNA 4CMHC 3DARA 4M61B 4OF6A 2E7CA 5ABDE 1U9KA 2GSGA 1ZVSA 2ZOKA 5D2LB 3GMPB 1CD8A 3WO4C 1R5WB 4PBWD 2WZPD 4P9MH 3CXDH 3QIUD 4QRRB 5D1XC 5I1KH 4WGWB 2P5EA 3U4AA 5DO2C 3BJLA 3HZMA 1FFNB 1MCWM 3PGDA 3ULUC 3JTSA 1WCQA 4K8RH 5FB8A 4DOHE 3EOAA 2BSSB 1HOCB 1LEIB 4MX7A 4XAKE 3WFCL 5JDSA 4JB9H 4CVZB 4U1HB 5C9JB 1CZ8H 2VSDA 4YO0B 1G7LA 3KPQA 4S0TD 4IHOA 1YZZA 1SVZA 4OV6F 1N5YH 1U92A 3AM8C 4GKOA 4WNQB 2DI7A 1PG7W 4GQ9L 1KIPA 2AJYH 1T89A 1W72L 5EU4B 1SHMA 4IIQC 1Z9MA 4S1SH 2X4NA 3QI9C 1KV3A 2X4OA 4ODUB 3ZE0E 3HLAA 5AYUH 4OCSH 4RMQA 2EDQA 5FO7A 3D18A 4KMTH 1P2CB 5F9DC 4KHTL 4NPYB 4JY4B 3BPNB 5KSAB 1A7RL 1BIIB 3WS6A 4XXCC 4S2SB 1KTLB 4AEIH 2XZCL 2ESVE 3VXQA 5DR5H 5DJ2A 4L8CB 3CH1A 2D0FA 4YUEL 4RBPH 4WW2F 2PW2A 3LRSB 3MRBA 4FQQA 4AIZB 7CGTA 1IEAB 2DYPA 3T0WA 2E8ZA 4LSSL 3WFCH 3Q6GL 3SN6N 3D85D 5SV3A 1XGUB 1VGEL 4HIEA 2FLBT 4KRPB 5C0AA 1OAUL 3K80A 3C5JB 1AGBA 4AT6B 1TDQA 3CSPA 4WHCA 3C6LD 2Q6WB 2AXGB 3FT4A 4PJHE 4GQ9H 1W72H 3HC0B 4RNRA 2J8UE 4X7DC 4ZUSA 1ED3B 2WUCH 1DVFA 1N26A 3TV3L 2ICWA 3HPLB 4OF7A 5I17B 5FGBC 3S96B 5B39A 1LK2A 4HS3B 5F1SA 4KHTH 5MHSE 1BFTA 3WN5C 3GSWB 3MROB 4R4FL 1A7RH 2YUZA 1MCKA 1J1XL 1R3IL 5E94B 2IMNA 1OP5K 4PJDA 4M48L 4LLYB 1GGIL 2BSRA 4OLZH 5BV7C 2XZCH 1J5OL 3MV11 3T0AA 5D7JA 5HY9A 4QF1A 5F3BA 3OKEB 4YUEH 3TWCL 1BF2A 3UAJD 5GZOD 4LAJH 1HXMB 1F4YL 1OPGL 2EIDA 1QR1B 2GITB 3L95A 4TSCL 1DBML 3RDTB 1QHOA 3EJZD 3PDOA 4LSSH 4PJBE 4U1GB 2NY0B 3Q6GH 1AHWC 5EUOF 3MC0A 4ZXBB 3QUZC 2X9WA 3FQXA 3AREC 1M05B 5DDHA 1VGEH 3X11B 4ZYKA 4UIKL 4XPFL 5HI5C 1OAUH 1I3RB 1X4XA 3JWNC 1EVUA 1ZVSB 4R97B 3P4MA 2ZOKB 4JPVL 4LLDB 3P0VL 1FCCA 3O2DA 2O5YL 2FECI 3BIKA 1LP9A 3N1FC 1A4KA 4NUGH 4J3WA 3EO1B 3RWCA 4EIZC 4B50A 5HHQA 3OZ9L 1JNJA 3IAQA 4KK6C 4XNZC 3TV3H 5SWZD 3K1KC 3GI8L 4NHUA 2P5EB 4Z6AT 1C1EL 4XCNB 1WSST 2IMMA 3FFCD 1U8PA 5BXFA 2WNGA 2N7AA 4GMSL 2VO5A 4H25A 4F37K 3DETC 1J1PL 2ITCA 3RZCB 2W9LA 4R4FH 1NCNA 3V0AC 1R3IH 4XC1L 3VFUA 5JDSB 4W6YB 5A16B 1GGIH 3VW3L 1BVKB 1NBZB 1G7LB 5GQBA 1J5OH 3KPQB 3G6DL 4KJPD 3IVKA 1CFBA 1LP9F 1IC5L 1F4AA 4WUUB 5JLZB 2HYMA 3MV9E 3AS0A 3MXVL 4HAFA 1RPQA 5CBEA 3TWCH 1Y0LB 3RX8A 1OPGH 1F4YH 4OLVL 5I6XC 4Q9BA 2X4NB 4ZSOA 3O6FC 4H8WC 3ZYIA 3B9AA 5IMLA 1J12A 4HDIA 4WW2B 4ZUWA 3UYRH 1P9MA 4Z7OE 1J7VR 1T5XB 5FO7B 4WTWA 4UIKH 4POYA 4XPFH 2VDNL 3U48A 3KPNA 3X17A 2QEJA 4JM2A 4FQPA 1QSFA 4U1MA 2ADGB 1XF5A 4ONOA 4GAGL 4JPVH 3AXLB 4HFUL 3P0VH 2O5YH 1K2DB 5C0CD 3B83A 5I9QB 3OZ9H 1QEWB 5HVGB 4HV8A 4XPGL 3WS3A 1AR1C 1EGJL 3GI8H 4JR9L 1C1EH 1JGDA 2UWEE 4PJCA 5ID0A 4JO4L 1RZGA 2AABL 5CZKA 5BS0D 4YK4C 3MRCA 3BJ91 4GMSH 2IGFL 4I48B 1J1PH 2XWBA 3RAJL 5TDOA 2YPKB 4F3FA 4E0RB 2YUVA 4NDMB 4OZFB 3T09A 4XC1H 2V9RA 1QQDB 1FFPB 3OHXB 5D1XD 5FDWB 1RUAL 4NSKA 5DO2D 1S9YA 4NO2A 4HIEB 1EFXA 1PAMA 5D7IE 3WEXB 3PF2A 1WZLA 1R3KB 4XRCA 1IC5H 3BYTA 1AGBB 4BSWA 4XGZB 3RIFK 3MXVH 2GTWB 4LGRB 1KN4H 1I7UB 4XVSL 2AQ3A 1JNLH 2HLFC 3LIZL 4OLVH 3DXAA 1A9EA 2E9IA 5C07A 4X4YA 5KN5B 1I7TB 3ARXA 4I9WE 25C8L 1KF9B 3CC5B 5IG7A 3JZ7A 2VDNH 3DTXA 2V9QA 2O61B 5EUOB 1BD2E 2BP3A 2Q8AL 3OKKA 1PZ5A 1I4FA 3PE9A 3QI9D 4GAGH 1AJ7H 5E7FA 4HFUH 4M7LT 2VZUA 2BSRB 1D5MB 3TM6A 4ZFGL 4MJIA 4GXVL 3BPLB 4XPGH 1ZHLA 4JO4H 4A2LA 2AABH 5D7LA 4C54A 4MSWA 4F33A 2IGFH 4UDUA 2WP3O 1KXQE 2ADFH 4RA0C 1T04B 3GRWL 2LAAA 1AD9A 3MYJB 4P5TC 3OKDB 5IVOA 3OJVC 4U6TA 1YNKL 3FQXB 3O41A 4JVWA 1HHGB 4X4XB 5DDHB 4PB9L 4NRXB 2IQAA 4Q6YA 4ZYKB 2VXQH 3FO1A 3BP5A 1IGML 4P9HC 4YBLC 1N8ZA 4K9EL 3RHWK 3DVNA 2IBZX 2VAAB 4H0IA 4XVSH 5K33A 5DJZA 5EA0H 4G3YH 4AH2B 2XN9B 4JO3L 3LIZH 4DFIA 5FO9B 1LP9B 4PGBB 4MXWL 3UTTA 3GJFA 4NQEA 3S97C 5JDJA 1YY8A 2OLDA 25C8H 5IBUB 3BZEA 5J12B 1MHPH 2ICWJ 3ARFC 3EYFA 2H8PA 4LFHD 1HNFA 5FGCE 5CD3A 2WBJD 4GLRI 1UH4A 5B38A 4D0CA 2Q8AH 2ZUTA 2X9XA 2X1OA 3WJJA 1BFOB 5LAXB 1N59A 1NL0L 2WV3A 4NQCE 4LSDA 5FEBA 3UZVB 3FMGL 3E8UL 3LKPA 1UQSA 4ZFGH 4GXVH 4Y2DC 2J4WL 2OQJA 3PABB 4JFEE 1WBXB 4FG6C 1NBYA 1IEBB 3TFKC 4MHHI 3W0WB 1F13A 1ZANL 4W70A 1MNUL 5TE6L 2AEPL 5CJQH 1D5ZA 4HDIB 2QKIA 1MH5B 1XAUA 5E8NB 4DGVL 5C0NC 4PD4K 3EHBC 1TJIL 3MV7D 4PB9H 2RIKA 1K8DA 4Z95L 5J06A 1ITBB 1IGMH 4HZLA 4P23C 3VFPA 5DJXA 4NC1E 4J3SA 4K9EH 1UADC 1XF5B 3TN0A 4PJGA 2KBGA 3S5LA 3ZDYE 4YHNB 3E3QC 3N0PB 1VKXA 3KDMA 3QUZD 3ET9F 4MXWH 1HYSC 3ARED 3ARBC 5CFHA 4LIQL 4CDHA 3BRDA 2ICCA 1VSCA 5HI5D 1F2QA 4CN4A 1F4XL 1JGDB 2YPLD 3LVEA 4F7MA 2E6PA 3T1WA 3PHOB 1VENA 2XWBB 4UNTA 5TDOB 1U8NB 5F7EL 1UFUA 2FO4A 4JFDE 3ULUL 1G6RB 4C4KO 3N06B 3O9WC 4QCIB 5DJAA 4KK6D 5E5MA 3FO9A 3GMRA 4J3XA 1JGLL 4NSKB 4N0YH 1S9YB 4PJGF 3FMGH 3TF7C 2ZJSH 3E8UH 2IC2A 2UV3A 4XAKD 1A14L 2P46B 2J4WH 5F7KC 1IAII 3GSRA 4PS4L 5C1MB 2Z4QA 1O0VA 5FIEA 3VWKD 1ZANH 3QUMA 1MNUH 1I1AA 1VFMA 3DXAB 5TE6H 1A9EB 1OB1B 1JZ7A 5CGMA 4MA8L 4FNLL 4M1GL 2AEPH 1EFQA 2R23A 3VFNB 3MFFA 5FYKE 5IWLC 4RFNC 4DGVH 1IT9H 5E6ZA 1EVTC 3G6AB 2WBKA 3Q0HA 4Z95H 3VXUD 1X5HA 4E42B 5D2NC 5EU6E 1OGAA 1CXEA 3O6FD 3OKKB 2DLEA 5ELIA 4LRIC 3EYQC 4OZ4A 4QHLB 3R1GL 3AAZA 3TVMB 4HJGA 4XBGB 4MJIB 4LIQH 3QO1A 1I8IB 5C71A 1F4XH 4HKBA 3IDJA 1AD0A 2ESVD 1MCPL 3CX5J 4JFFE 4NN5B 5MP6L 4YPGA 4F33B 4P2OA 1INQB 4CUCA 1YQVL 4PJXA 4OZHF 1EJ6A 5F7EH 1DLHB 1G9NH 5IK3A 5JOFB 4RAHA 1AR1D 1JGLH 2VDQL 4YAQA 1LEGA 1LO4H 4NKMB 5FYJL 3VFTA 1IGJA 4PBVC 5CEYA 1N8ZB 1TITA 4OCMC 3DVNB 1KSRA 3C8HA 4PS4H 2EO1A 1CI5A 3IDIA 2GY7B 3QQ4A 5HVHB 3ARPA 1X3DA 1VFAA 4R4NC 3UTTB 1JGVL 4MA8H 4NQEB 4FNLH 4M1GH 5IQ9A 1S7RB 4PJXF 1BFSA 5IB5A 3B3IA 2O5XL 5DJ6A 1CQYA 5I76A 5TFSL 1HINL 3HI1A 5GJSL 5D1QC 2HLFD 3A67L 1FG9C 1T1YB 3CD4A 3T2QA 1N59B 3CFBB 3FONB 4KH2A 4OV5B 4H0HB 3QEHB 3GMQA 3VD3A 3B5GA 3AVEA 1HEZB 3IDXL 5IUSA 1UQSB 1OY3B 3MREA 1KJ3L 2OQJB 3WNNA 4X6CA 2NW2A 2CDEA 5IMKA 1IGYB 1MCPH 3F6LA 1FJ1B 1L9MA 3IDGB 5MP6H 4OB5H 4MA7L 4NNYA 1ACZA 4KRNA 5ENWB 4Y1AA 3LV3B 3MRDA 1XF2B 2ATKA 3T0DA 2FJHB 1SQ2N 1U8JA 1WTLA 3DO7A 4B0MM 3QNYB 3F12A 4KK9C 1T2JA 2XY2A 5FYJH 1KUMA 1TFHA 1MJ8L 3D2UD 3V7AE 5JQHC 5A2KH 2IFFL 4PJGB 5JHDE 4X6CF 5IT2L 4P5TD 1VKXB 2H26B 1JGVH 3FB8B 1K4DB 5H8DA 3QP3A 5I1JL 3L6FA 1EUUA 3BMWA 3PNWA 9CGTA 1QP1A 2J5LC 1FL6B 3TPUB 3UDWC 3QFJE 3S4SG 2OSLA 1GAFL 1HINH 2Q8BL 3O45A 1RHHB 4P3DA 3FKUS 1HSBB 5GJSH 1I3UA 3VXRE 1H3PL 4OZGA 1MCQA 2FO4B 2VZ1A 1NDGB 3D85A 5DJAB 2BZDA 4KU1A 1N6QL 1HILA 3HE7B 3RL1A 3BH8A 2IALA 3IDXH 3PHQA 1QOKA 3ARFD 1JYWA 1KJ3H 4UBDC 1Q9WB 4WIQA 3ULVE 4N1CA 3T0XA 4KK8C 4MA7H 3ECBA 2JLLA 3T0EE 4N0UB 4HZAA 3O6KL 4Y2DD 2RBLA 4LSVL 4FG6D 4IRSC 2ZZUT 2AGJL 4OZHB 3TFKD 1EJOL 3B43A 3UTQA 3LB6C 3K0WA 3S98A 1MJ8H 1OGAB 4BQ6A 4IOFC 3U9PL 2W60B 2IFFH 3F5WB 3OTTA 4DEPB 2PUQT 4L9LB 4OZ4B 3H3KA 1FSKB 2DQFB 1Y6NR 5IT2H 2PCPA 1PKQE 4OD2A 5C0ND 3QXWA 3EHBD 4HJGB 3P4NA 4H20L 5CD5D 3QO1B 4P23D 1JPTL 4HKBB 2W91A 1ZOXA 4Y5XC 1YEGL 5T3ZE 3O3UN 5CJBA 4P2CG 1GAFH 1N6UA 3GSNL 2CXKA 2Q8BH 4YWGH 3OF6D 4JRWA 1RJLA 3VD7A 1H3PH 3KPRE 1HYSD 1YPZA 4TSAL 5GS1A 3ARBD 4PLKC 3P4OA 4LFHG 1N6QH 3WD5H 5T1MB 4LPXA 1EHLL 1O7SA 3RU8L 1RK1A 1X7QB 2F53E 5A3IC 2FSEA 3IDIB 3T4YA 3BZFA 4CJ0A 3CDFA 3O9WD 4CW1A 4TVPL 3QIUB 5SWZA 5J6HB 1RIHL 3I3EA 3MMEA 3P9MA 3O6KH 5IB5B 4LSVH 3B3IB 4PGEA 3BW9A 1W8NA 4WV1A 1G0XA 1YECL 5C0FA 2AGJH 3HPJB 4X7TA 2YN3A 1D5IL 3SPVA 5DMKB 1U3JA 1IKNA 3U9PH 3VXNB 5HHPB 4X8XA 5CMAA 3V5HA 1VERA 1YC8A 5TDPA 3SDCC 5DEGA 1BD2D 5EO9A 4EVNA 3K74B 2A77H 1UJ3A 4H20H 3KYMA 2NY3C 4U6HB 5E5UB 1TVBB 4X6CB 5FM5M 5TGBB 1YEGH 2PETA 2V2TA 3GSNH 3PP3H 4ELMA 4JFHD 4R3SA 5DRWB 1ZHNA 4I5BA 3HKFA 2ATKB 4TSAH 3A6CH 1UWGL 5FOBA 2VLJE 1EHLH 2XXMB 5C0IB 2VZSA 2D0HA 3RU8H 2AEWA 2IANA 3C5SB 2I9TB 1CXLA 4YDKL 5F7YC 4TVPH 2YRZA 3NGBC 1GC1L 1EHNA 2MNUA 1CN4A 1RIHH 4ELMF 1V5JA 5FA3A 1S7TA 2XOTA 3L6FB 3PNWB 5BS0A 5GGUA 5BO1L 1YECH 5C2BL 4BQ9A 1TXKA 3FRPG 3O45B 1D5IH 3DX7B 2Z92A 4R4ND 1RZ8B 1UACH 4OFKA 1E4KC 1QFWM 1FAIH 3RL1B 1CR9L 2IALB 4X4ME 5E00A 5ALBL 2IFGA 5DHYB 5I8EA 3BESR 3T0EC 3C6LB 3LD8B 2KL6A 5D1QD 1N3NA 1MFEL 2NXYC 3DLQR 5CEXA 3TCXA 3BRFA 4DVBA 1H0DA 3RPIA 4M8VA 4TUOA 3WNPA 2ORBL 5BJTA 2VQ1A 2ZUQB 1UWGH 3AM8A 2MJWA 1UGNA 4FRWA 4MCYB 2XG5A 1HHIA 4UNVA 2LU7A 3MNVB 2VYRE 5KG9B 4JFQB 4O9HL 3REWB 4F57L 4XT1C 4YDKH 3AC0A 3RVTC 1Z2KA 2E9BA 4OD2B 1GC1H 4YC2C 1AIFB 4U7KA 4KK9D 4OF5A 5IEKA 8FABB 2CK2A 4TSBL 3L7FA 4LOUC 4XMKL 1RJLB 3V0VA 3UTSE 4J3OC 1A64A 2VMFA 4DQOL 4Q6IA 3P4OB 2VXSL 3O2DL 1MEXL 1CR9H 4JFDD 1S7SB 4OUOA 1E6OL 3PGFL 2R2HB 32C2B 5C7XH 2GSIA 1ZLSL 1MFEH 2IPKA 1P6FA 1M7DA 1CG9A 4EXPX 4MA3A 1YNLL 2AXFA 5SWZB 4PJIE 5IFHH 2ORBH 3MMEB 3QIWB 4XI5C 2LU3A 3TO4A 2JJVA 3IDUA 1QKZL 3FFCB 4UBDD 1V3JA 4GRWB 2V7NA 2FO1A 3TH3T 2WBJA 2AK4E 4ODHL 3I6LD 3PWPB 3TO2A 3W9DB 3JUYA 4X7TB 4KK8D 2H2SC 1RJZB 1DQJB 5J56B 3ARDC 5EBWA 1FZMB 1ZGLA 3MODH 4F57H 5CMAB 1VB9A 3V5HB 5CBAB 4RGMC 4I0PA 5DEGB 5MEOB 4IRSD 1CXFA 1MCNA 3GUTA 2ED8A 3QXDB 3MRMB 3SKMA 3WN5A 2N1KA 3OKOB 3AU1B 4TSBH 1KCSL 4D2NA 5EBLB 4IOFD 1P53A 4ELMB 3GMMB 4NN6C 3SGJC 4I5BB 4AK1A 4QRPE 5J1SC 4JFFD 5JNYA 4FMFA 4JANB 4DQOH 5CIPB 2VXSH 2J8HA 4QXTB 3O2DH 3VXME 5AUMA 5FOBB 1AQDB 1MEXH 2VR5A 1I1YA 3QCUL 1E6OH 3PGFH 3WIHA 4ZFOB 3OAZK 2YBRA 5EOTB 3ZE1F 4JREC 3VU2A 5F1NB 4HS6B 1ZLSH 5FHBL 4BH7B 3BEVA 3QUZA 4PLKD 5C0CB 1URLA 1YNLH 4OTXL 1NFKA 3G5YA 2VLRE 4KV5F 2BNUA 5GHWL 3DWTA 5F1IA 4CMHB 1S7TB 4KUCD 3SE4A 2P24A 1QKZH 5GGQH 2BERA 3HC4L 3U30C 5A3ID 2X7LB 5E70A 5C0BE 4XP6L 1KCUL 2FLRT 2VB5A 2PTVA 2EXWC 3UMTA 3WO4B 4EI5C 2CJUL 4K7PL 2Z92B 1I1CA 3ES6B 4HUKB 1CGWA 1I1FB 5D1XB 3T1FA 3OWEA 1JF6A 5J1AB 1BREA 4Z5RA 5D71L 4UAOC 4JPKL 5E00B 5F93C 2PXYC 3RFZC 3EFFB 5I8EB 2Z8VC 3GGWA 4Y4FA 5C0RL 1JUFB 3VWKA 1KCSH 2APXA 4OZIE 1XCTB 3SGEH 1JN6A 2VIRA 1H0DB 3NBNA 3MLVL 4HWBA 1E28A 5IBTL 3S4SB 3SDCD 3D3VD 1VA9A 1XF3A 4S10A 3DIFA 2NY3D 3GKWL 1JTPA 3LKNA 1ZXQA 1SJEB 4QY8A 3DRQA 3QCUH 4IIQB 1A6WL 3PIQA 3QI9B 5EIVA 1F3DH 4DFHA 1NGPL 2EIBA 4MLIA 4MWFB 5FHBH 2XG4A 3BYYA 3IJSA 1J0ZA 2AI0L 5DQ9A 1ADQA 3OSKA 3QRGL 4OTXH 4WHYG 1NFIB 3IKKA 4MDJA 1N5AA 4G6JH 5IEKB 2ESVA 4K94C 1PJ9A 3HC4H 1OSPL 3CFJA 2P5WE 2P49B 3L7FB 3U4EA 1OP3K 3ZE0F 3MLYL 1ZWIB 3RY6C 1RIUL 1QVOA 2BCKA 4IDJL 4Z7VF 2CJUH 2NTFB 4PGDB 4YBQC 3QFJD 4KFZC 4B53A 3VXRD 5D71H 1YN6A 4JPKH 3MRJA 5JIPA 3BT2H 43CAA 1TCMA 4WO4C 1JNHB 5E6IA 3RX7A 5C0RH 4WFHE 5GS2H 2CK0L 2GSIB 2OMBA 2QQKL 2IPKB 4U3HA 4BQBA 4XNMA 1F5WA 5FHAL 3LEXA 2ZSWA 4PJHA 1CG9B 3QUXB 4YHYC 4MA3B 1XCQA 5IBTH 2XNAA 3WMSA 3U0TB 2NNAA 2J8UA 1JWMB 3T0ED 3GKWH 2V7NB 3ZKNC 1XFPA 4WJ5B 3RWGA 3PWVA 4OM0L 4HG4J 1RUPL 5D7SH 5GRZA 2DQCL 2NXYD 1A6WH 1UH2A 4NP4H 3ZDZE 1U6AL 5EBWB 4MQ7A 1EBPA 1YYLL 5CZVL 1NGPH 1ZGLB 3W2DL 4AY0A 1CD0A 3FTGB 3V4PL 2EE6A 3BD5A 2AI0H 3QRGH 3NIGF 2Y1VA 1KLFA 2PTUA 1HH9A 4L8BA 1YN7A 4HWZB 5BZWA 3P4LA 4KI5E 3MRQB 3SKMB 3WN5B 4PY7A 5F9JA 1ZT1B 1JGEA 1KIQA 5DRNA 1XIWB 3WFDL 1OSPH 5HHNA 1CICA 2R8SL 1A1OA 3MLYH 1RIUH 3W81A 4IDJH 3RVTD 3NCFB 1BX2B 2R1YA 3FB5A 5BV7B 4KY1L 5T3ZD 2YD2A 2G75B 5EZIL 5JR1L 1I7ZA 3MV7B 4PJBA 1JK8A 3HUJE 1CF8L 1ES0B 1XR8B 4RMTA 3GJFH 1GGYA 3U36A 1TPXC 3ARZA 2Q87A 2ZOLA 3U83A 4LOUD 5GGRA 1X6LA 3I02B 4JZJC 1H8NA 4NT6B 1Z3GL 2JIXD 2CK0H 5D96C 5EU5B 4LDOB 3S3PA 2QQKH 1AHWB 4P5TA 1IC7H 5FHAH 2F53D 1NH6A 3AREB 4X9GA 1X5AA 1TNMA 4JFOA 1FNGA 3HNVL 2ZCLL 2D03L 5F1IB 3MRKB 2W92A 3QPQC 5GJTL 1MI5E 2YPLB 3OR6A 3RQ3A 1DBJL 5CP7B 1KG0A 4OM0H 1RUPH 3CSYA 5E2VL 3IT8D 2DQCH 4OFYD 3KR3H 1U6AH 2GY5A 4FQXB 1I85A 1MQKL 3VH8G 4XNZB 1YYLH 5CZVH 4J6RL 1J9CT 1P1ZA 2XKUA 4XI5D 3QUML 5CGTA 5GRYA 2GFBA 3ARFA 2Y5TB 4JPWL 2VDKL 2CKBA 5D70L 1KT2A 2H2SD 3EYVB 3WFDH 3ARDD 1DQLL 4V1DE 4MB3A 5IB1B 1F00I 3MV9A 2HG5A 1V7NH 1WVZA 2WP3T 1BVLA 1HI6A 1RUML 4NQDE 1X5XA 4UIMA 4G9FE 4GBXC 5IROC 3DURA 4G42B 4Y2DA 1OP5H 1XF3B 5JR1H 2WMPA 2FL5A 4JRYE 3DIFB 5JW4Q 1XR9A 1J0KA 4WI9A 4D9LL 1CF8H 4Z7VB 3VXUB 3DRQB 5KSVB 4ESKA 4N8PA 4UU9B 5DI8B 1AGFB 2EYTA 5I6XB 2OR9H 2Q3AA 3O6FB 2VLJD 2R2BA 4X9IA 1Z3GH 4I0CC 5EIIA 5M7QA 3TNMA 3LQZB 4DZ8A 1A3RL 1OAQL 4NC0B 3CVHL 3O3EA 2ZCLH 1NGWA 2D03H 4WFGE 5GJTH 1N5AB 1CL7I 2BVPB 3F58H 2ESVB 1DBJH 3SQOH 5IW1B 3U4EB 3OF6A 3IGAB 2UWEA 2APTA 3D0VA 3OAYK 4Q0XL 5KSBE 4KDTC 3ARBA 5HPMB 5IJVB 3UZEA 1IVLA 3VRJB 3QUMH 4P2YA 1YN6B 4YK4B 3VWJA 1R5IA 5HYSA 2VDKH 4QTHA 4U6VL 1WV7T 2EXWD 4RZCB 4EI5D 4JEGB 5D7IA 4ZMAT 4O02L 1W0VA 1DQLH 3O9WA 3KPMA 3RNKB 5L6YL 5HHOE 1IL1B 1RUMH 5FGSA 2XNAB 1CVSC 2FH8A 5FYLE 4IRZL 1NUFA 4Y5YC 3MQIA 5JOEA 1JRHL 3VFVB 3PWVB 4JCMA 3T8XA 3HZYA 2VZTA 3OV6A 3AB0B 5CZXC 2DWDB 5C0EA 4KGLA 4LBEA 2VDMH 5IWLA 1BD2A 2HN7A 1A3RH 1OAQH 1MLBA 2F5AL 4GXUN 5BZWB 3DHJA 4PY7B 2CIKA 2EYSA 4TNWF 4AEEA 5F9JB 4U6YA 5DRNB 1LEKA 5HHNB 2E6QA 3T2OA 1HHKA 4NNPL 1RUKL 4P59L 2BMKA 1HHJB 4Q0XH 5INCB 1UKSA 4C4KT 2R1YB 3UPRA 1RU9L 1CDIA 3VXTA 1T1XA 1YEHH 5KVFL 4YX2L 1JK8B 3UTSD 4DK3A 3C8KA 5C9KA 4MD4B 3D2UB 3NN8A 4OKDA 4U6VH 5I8KH 3ORJA 2X89A 3HC3H 4YDIL 4YBQD 4YHKL 2YZ8A 1ODAA 4P5TB 3FB7A 2XRAL 1PG7L 2HWZL 2AEIT 1T6WA 5JA9A 1SY6L 4JKPH 3FHAA 4IRZH 4YBLB 1P4LA 3FOMA 4PJ7E 5HGAB 3BEWB 1L7IL 4WO4D 3CFKB 4NNXB 3O8XB 2PW1A 5T1KA 1A5FL 1JRHH 3FO0H 1A9BA 1DBKL 4NZRL 3VE0B 1I8MB 4FFWC 2Y9RT 4P4RB 4PJEE 4PGCA 5LG1A 4NQCA 4YDVA 3ZKND 4J2XA 3BKML 4MCZB 4NUJA 4ZPVA 2QQNL 3C2SA 1AXTL 2CKBB 3FO2B 1YEDB 4LLWB 3ROLA 4M7JL 4JFEA 4Q97A 5I18L 3GM8A 1J18A 2EH7L 2D7TH 1BVLB 4NNPH 1HI6B 4P59H 1XMWA 2B0SH 2GCYB 4LSRL 4O2EA 3PP4L 1RU9H 5IMMA 4Y2DB 1JPGA 1Q9LA 5JPNA 1B0GA 3V6ZB 1DL7L 5KVFH 4YX2H 1WFUA 3ARGA 1MJJA 4QRPD 3TBYA 1JF1A 1KTRL 3PL6C 1CFQA 1IM3A 1D5BA 4YDIH 2HFGL 3L5HA 1HIMH 3K46A 5D5ME 3SDDC 4YHKH 5CJ8A 4LLUA 5EIIB 5CINL 4G6AC 1FE8L 1PG7H 5FECB 2HWZH 1OAXL 2M1KA 2IJ0C 4ODSL 4HHAB 4P23B 4LPYA 1L7IH 2WAHA 4JHZA 1DDHA 1A5FH 1T21B 3HR5A 2VLRD 2FDBP 3E6HB 4BK5A 1FPTL 1ND0B 2BSTB 5ADOL 4M62L 4LPVA 1DBKH 3ARBB 4NZRH 3W39A 1DSFL 5DMYA 5C0BD 2CR6A 1T2QL 2MKWA 1M6OB 1OL0A 2GYSA 4JFDA 3CVIL 3O3BB 2EC8A 2OCFD 5IHZB 2G9HA 3BKMH 3UTPE 2DMKA 3ZDYF 2QQNH 1AXTH 3MTRA 4M7JH 3O9WB 5I18H 1BZ9B 2EH7H 3HR6A 4PTUA 1NQBA 5KW9L 4LSRH 3PP4H 4MAYA 3O2WL 4CNIB 1DL7H 1Z9LA 1TQBC 1NANH 1YY9C 2UZIL 3T8XB 4FQIL 5GGSB 4GS7C 2CO7B 5GRJL 2HFGH 5C0EB 4LBEB 2EDKA 1FN4A 3I2CL 1C7TA 3B6SB 4F7CA 4GBXD 5FOJA 5EU6A 2E6JA 2R29L 4QTIL 4RFNB 5CINH 1A1MA 2L0DA 1JI1A 2HN7B 4HJJL 4IRSA 1ZLWK 1JYXA 1U8OA 1OAXH 5EZLB 1IGIL 1WZKA 3I75A 3RY4A 4CU7A 4ODSH 5D2NB 3X12A 2CIKB 4Z77B 3MOBH 3OXSB 1HH6B 5MEPA 5MEND 3VDBA 3S36L 1DR9A 1AXSA 1Q0XL 2IQ9H 3WLWC 4NO5B 5ADOH 3BD3A 4OCWL 4M62H 4JFFA 2VR9A 2BFVH 3UPRB 1DSFH 1T1XB 4GKZA 1T2QH 1T5WA 4K7PY 3CVIH 5DWUL 1ZT4B 4QGTA 1RIVL 2BNRD 4LVEA 4G8EA 3NN8B 2C1PA 4LSUH 1B9ZA 1MPAH 4JY6A 5EIQA 2I07A 4P4KC 3MSPA 4QYOB 1KEGL 1RK0A 5KW9H 4WFHD 5I1GH 4K3DL 4X7EC 1RVFL 1SVCP 4AG4L 3EOYG 4J3VA 4D8PB 3O2WH 4X0KB 4MJ4A 2P8MA 1WF5A 5ACZA 4BUGA 3T04D 1A9BB 4FQIH 4NBZB 5GRJH 1ETZA 5FGCB 3I2CH 1G7JA 5IF0A 2Y25A 2R29H 4QTIH 3VA2C 4HJJH 4YDVB 3P11L 1IGIH 3BDYH 3EBAA 3MR9A 3S9DB 2X4QB 5D1QB 5LGJB 5CZXD 1GIGL 3ROLB 3QXTA 4KUCF 1ZSDA 1MIEL 2YRPA 1O5DT 2R56H 4XCFL 5K9KB 3S36H 1Q0XH 3SDCA 4OCWH 3DUUB 5L0QC 1NBVL 4O2EB 1JPGB 3JWDL 5I1CL 1B0GB 3VH8B 4AEHL 3EGSB 5DWUH 4OQ1A 1RIVH 1V7ML 1WFOA 3DUSB 3TBYB 1R24B 4F2MA 5I1AA 2HFFA 2OTPA 3REVA 1CT8A 5F8QC 1OARL 3W9EB 4LLUB 1CGSL 1RJYA 4OLYL 2EDTA 3MJGX 4QRRE 1KEGH 5JHDA 5BRZE 4JGJA 1EEQA 2QQLL 3BUTA 3NZ8B 3QPXL 1RVFH 4K3DH 3O0RL 3QQ3B 2UUDK 4AG4H 5I1LA 4K7FA 3OR7A 1MSPA 3IFPA 4G5ZL 1RHFA 1MI5D 2MFNA 3MOAL 3LEVL 4MD5A 3QFJA 5DVMA 1CLOL 1F4WH 2P1YA 4DTGL 2DN7A 3RX5A 2ARJA 3VXRA 2Z8SA 2J5LB 4ZAKC 5TE7H 4RSVA 2JE8A 4XBPA 2BOBB 2P48B 4P0DA 5FYJU 3IETB 4U2YA 1CE6B 1MIEH 3FQTA 4PV8B 4XCFH 4FFWD 4X98A 5TF1L 4G6ML 4B5EA 4N68A 2NMSA 4IRJD 5AZ2L 1NBVH 1ZHBB 3CFCH 2DQJL 3JWDH 3T0EA 5I1CH 1A7BA 4AEHH 2QHRL 5DK3A 2X1WL 4NQDD 4G9FD 3KVQA 1V7MH 3KWWB 4M9OA 3STZB 4JRYD 1FFRA 4KQ3L 1T20B 1HZHL 1MRFL 1OARH 3L3JB 3RWDA 5JXAL 1OGTA 4D9RE 4OLYH 3IJHB 3U6RA 4JQVC 4IRSB 3NCYS 5ESVB 5MEQA 3KNBA 3DX8B 4WVRA 4JG0L 3IRZA 1JV5B 2QQLH 3TA3D 3QPXH 2HVJA 3O0RH 1PKQA 1EPFA 3X12B 3PL6D 4AIXA 2P4AB 5HYQA 1NGYB 3IKCB 4P46A 3DHMA 4G5ZH 4UV4L 3SDDD 2GTZA 3MOAH 3LEVH 4G6AD 4YXHL 1CLOH 4U6XA 2HAZA 4DTGH 4PREA 5BQ7B 1Q9OA 1CVRA 3VD4A 3KPRA 3T4AB 4Y5XB 4QO1A 4X99A 1BOGA 2C1PB 2XFXB 3CCHA 4DCQB 4LCYB 4EQ3A 4N0FB 4WI7A 3NPSC 4LKXB 5LBSL 1I7RA 2V2WB 5TF1H 5IGXL 1MVUB 4G6MH 4EDWL 1RD6A 3QCVL 4MXVE 5AZ2H 8CGTA 5GS0L 5IB3A 3HTLX 2DQJH 4C83B 4TRPL 2QHRH 2XZQL 4M8QA 5KVMC 4M6OL 5IHUH 3BP4B 4UI2A 1QO3A 5FYLD 4OFYA 5K9QG 4NBXB 1S7UA 4KQ3H 1HZHH 1MRFH 1AXIB 3RVWD 3S7GA 5JXAH 1IEHA 5IF0B 3EAKA 5KOVC 1PX3A 4HWBL 4NOBA 4A6YA 4JG0H 4NRZB 4PJFF 1BGXL 1MCBA 3WNKA 4AM0B 5E4IA 2LFGA 1U2HA 2FNBA 3ARDA 1XGQA 1ZSDB 1LE5A 2ZPKH 2AS5M 1LD9B 3IFOA 4OAWB 4UV4H 4JFYB 3ILQC 1DE4B 3F7VB 4M5ZL 5CP3A 3SDCB 4Y4HA 4YXHH 3D3VB 4LKCB 2NY5C 3CZFA 5ESQA 1WT5C 1JZ2A 1OT1A 3GIZL 3RVVC 4F2MB 2JCCE 1WJ3A 2VLJA 2YWYA 1CT8B 4RAVB 3WLWD 4FHBD 1WCBA 2MHAA 1FO0L 1LE9B 4GRMA 3ILPA 4JQIL 2WANA 5LBSH 4KKLC 5IGXH 4BFBD 4EDWH 1G7HA 2WLYA 3QCVH 5GS0H 4K2UL 5DK0B 4TRPH 2FGWL 3HZKB 4M6OH 3CVHB 5CCKL 4OGYL 4MS8C 1FG2B 2FIKA 4MD5B 3QFJB 4P4KD 4U1SB 4M03A 4QXGL 2ARJB 4LHUD 2R39A 1KCVL 4GO6B 4UINL 4HWBH 4WUUE 4XBPB 5LGHH 4EI5A 1BGXH 4Y88A 2EE9A 2E9JA 3SGEI 2KH2B 4X4MA 3IJYA 3VGAC 2ZUSA 4M5ZH 5EOCJ 1UB5A 1YJDL 1ACYL 3FRUB 3QULB 4X8JA 2J1KA 4FTVB 1D9KC 2PYEE 3BPNC 4XHQA 2BY3A 3MRGA 1MLCB 4LRNL 5IFJA 1CGXA 4HULB 4ODWA 4LCCA 2XPGA 3G9AB 4PTTB 1ADQH 1T0MB 4ODXB 2NXYB 4ORGB 5IIEA 1T83C 4MA1C 5CUSL 2YD5A 1FYTB 4X6EB 3FQNA 2WIIA 3RWDB 1OD9A 1WEJL 4JQIH 3G08B 3V6FB 1V8HA 4POUB 2VISA 3OG4B 1U8MB 3QUYD 5TQ0L 3UP1A 3MLXH 4K2UH 3J8F7 4KXZI 4YHZL 4PG9B 4EN3A 2FGWH 2X1PA 1R3JA 4TUJA 1B0WA 1YC7A 1Q72L 5CCKH 5CEZD 3OPZL 2GTZB 2ENSA 2OP4L 1DUYA 1ZA6A 2CXGA 3MNZA 4YC2B 4QXGH 4PREB 1Q9OB 3UTSA 3NFNA 1Y18A 1F3JB 1FDLH 5J9PB 4UINH 3P0GB 3GJEA 4I18C 2FJFB 4KUZL 1PGRB 4X99B 3OKMA 3TH4T 1KJ2A 3EOBA 2JIXB 3WDIA 1OF2B 3QDHA 5ICYB 1KPVA 4JDVB 3QEGL 5FKPA 4J4PC 2F53B 3L3DA 4OFVA 3DOSA 1YJDH 4PJFB 1SYSA 4ZAKD 1E4XI 4LRNH 3L3IB 1P7QA 2DBLL 4PJIA 4M8QB 3X13B 5L2JA 1KFAH 4MAUH 4QRSB 4LLAA 5BZDA 1BHGA 3EFDL 3X14A 1QO3B 2D7QA 1C5DA 1JJUA 5DC9B 5CUSH 2AK4A 1WEJH 5JW3L 1IBGL 1H15B 3NPZB 3ZKQD 5CSZA 2JJSC 4A6YB 2BVYA 3ARDB 1NC4D 1ZS8B 4RQQB 3BIAX 1KB9K 1AR2A 3TBSA 3OPZH 2OP4H 3IU3A 5T3XE 1IJ9A 1R3LA 2ADJB 3T3ME 4EBQL 5HGDB 3NMEA 1B0RA 1VADB 4OUUA 4QRPA 3MOQA 2UZYB 3P73A 3MLZL 5F6HJ 5HVFB 1G7QB 3VXMA 2VLJB 3I50L 5B8CA 2R1XB 2VH5L 4NN6B 2XN9E 2MHAB 3QEGH 2RR3A 1NGZB 2GT9B 1J1OL 4R8WL 2NY6C 2MCG1 3HAEA 4KKBC 1HNGA 4LVOC 3D25A 4PUBL 4RISH 4HUWB 4MNHA 1E6JL 3TYGL 3RI5K 5ITFA 2H1PH 2DBLH 2VLRA 4JREB 3TIEA 4JPIA 3EFDH 5GSVA 1BQLH 4I4WA 4X5WB 4EQ2A 1JHKL 1TZGH 2Q1EA 2CKBH 4H0GA 1Z6JT 5C0BA 5FV1L 4HIXL 4CJ1A 4QLRA 5JW3H 1IBGH 3BGMB 2OTUB 1B4RA 3HRZA 5DVOA 3U30B 2NQCA 2B39A 5DJ0A 4H5SA 1LNUB 4BFGA 4EI5B 1ZV5A 2A38A 2AXJA 3P0YL 4H88L 3W0WE 3S34H 1NDMB 4X7CC 3NFPB 5A43C 3VRLF 4PV9A 3SOBL 3WYRA 1FL5A 2CRYA 4X6BB 4LPTA 4OZIA 1DN0A 4UAOB 1INDL 2D3VA 2YXMA 4EBQH 3C6SA 2YA1A 4I13B 3WLBB 2PXYB 3VFWA 5IFJB 1BLNB 5ISZD 3KPLA 3MLZH 3PWJA 1KYOJ 4HLJA 1FBIL 1FZKB 3T77A 3ILQD 4I1NB 3C87A 2WIIB 2HFEA 1KJVA 4GBXA 5INDA 2P8LA 3K8MA 4NM8L 5D4QA 2H9GB 2Q3ZA 2EIZA 4GG8B 1NJ9A 3GZKA 1J1OH 4R8WH 4N5EC 3BP7A 3BKCL 3RVVD 4MJ5B 4JDTL 4PUBH 4ZUTA 1E6JH 2IBBA 3TYGH 4QRRD 5KS9B 1Z9SA 2YD1A 5E08L 5BRZD 1JZ4A 2GUOB 1QFPA 1RZJC 1JHKH 2ED7A 3OAZH 5IR1A 2P5WA 1U41A 3MNZB 5DSCA 1U8HA 4UTBL 4R9HA 3UTSB 2PYFA 1BP3B 2X4SA 4H88H 2MOVA 4RRPA 1VFBA 4Z8FL 2C4FU 4MS8D 3CK0L 4YNYB 4RMSA 3UJTL 2EICA 1U58B 3RY5A 3KHQA 3L3DB 2YUXA 4J7RA 1INDH 2QTEA 4Q2ZB 5DS8B 2FYYA 1L0QA 4WO4B 3SCMC 3GSVA 4WGVB 4HLZH 3GBNL 2Y06H 3KYOB 5BZDB 1YMHA 2AJSL 1FBIH 1TJGL 4BQ8A 1I3GL 1FV1A 4YHYB 1T1WA 12E8L 2HVKB 2IAMC 4HKXB 1P7KB 1D9KD 3RP1A 4PRHB 1JWUB 3GB7A 4G9DA 4Y5YA 4JFXA 3HFMH 3MRHA 4LAQL 1PY4A 2HJKB 4QNPE 3QAZC 3HRPA 4P57B 3MLSL 3KGRA 4JDTH 2ZUXA 3SO3C 5C2UB 4GRLC 3A0OA 3SGKA 5E08H 4P99A 4U1NB 2DM4A 5FXCH 3TBSB 2Q20A 3IU3B 1R3LB 3T65B 4BFEA 1G7PB 4IMLA 4WU7B 4GKNA 3V95A 5FUOL 4Y5VC 5DFVC 4ZUVA 4HX1A 4QRPB 1MQ8A 3QCTL 3ZDZF 1E4JA 1F6FB 4LCWB 1K8IA 1T0PB 4LHUG 2I26N 4Z8FH 5DF0A 5C70A 1PQZA 3CK0H 3BGAA 4UV7L 5J12C 2DWEB 2F9BT 5CHNB 4P2QD 3UJTH 1OP3H 1A4JB 4XMPH 2GQHA 3TZVC 5ESAB 1EAPB 1TPXB 4PYHA 5I1DA 1X5YA 4MNHB 2XKNB 4K71C 4URTB 4JZJB 5KVGH 4BZ2L 5HTSA 3GBNH 3TIEB 1MI5A 5D96B 2AJSH 3ZKXC 4F9PC 2C3HA 1JWSA 1Q9KA 4QXUL 3WV0A 1I3GH 4J4PD 5EO0B 3B2UC 3KPSD 12E8H 5C0BB 1Q94A 3QXAA 3HUJF 3RZWA 4PP2B 4LAQH 5F7MC 1RI8A 2V17H 1DEEB 1XH3B 3MLSH 4Z18A 3LPFA 3D87B 1MWAL 3FOLB 2BC4B 5FYKL 4IRJA 5D6DC 5E8DL 4V1DA 3MUGB 4ZUUB 3C6SB 1S5HA 3WIFA 1IKFL 3RPKA 2FEEL 5FUOH 4G9FA 4H1LG 2NY0D 2HRLA 3QCTH 2VDRL 3ARYA 3PWJB 4APQC 1DZBA 5ERWB 4JRYA 1IQDB 4UUJB 1U95B 3BZDA 5EC2B 4BKLB 5IKCA 2P8LB 2B4CL 3BGFC 4GW4B 4CVUA 2Y07L 1TZHA 3TA3A 1MAML 3UYPA 3MCLL 4G8FA 3IFNL 3OKYA 5MENB 1EEZB 4XH2B 4AENA 1CLZL 4NOFA 3SDDA 4HXAH 4BZYA 4BK4A 4QXUH 5SV4A 3SKOA 2YD8A 3OBAA 3P30L 3PWLB 5IVZB 1NMBH 1XZ0B 5IEHA 2K3TA 3GKZA 1X5FA 1U8HB 3L9RB 4KKBD 4DN4H 5I0DA 5KSBA 4XVJL 3BX7C 1IC4L 4OBSA 1FZJA 4QHUA 2BNRB 3U7YL 1VFBB 2A0LC 3GNML 3HZVB 1MWAH 2XQYG 3UX9B 4GQPH 4PRDA 4XCEA 5FYKH 5IV2B 1QUNA 1E0OB 5J4MA 2ENYA 4N0UE 2QR0A 5D1ZC 3QFDB 1N4XL 3MRFA 2FYYB 1YEIL 1ZGLP 1IKFH 5HHOA 4BFIB 1CD1A 4XP9L 1CGTA 2E7BA 4K8RC 4OZHE 4PJ9C 4ODTL 2PYED 2BDNH 3U9UA 1YMHB 3VFMA 1QBAA 3ZYJA 1FV1B 5DD0L 3BWAA 2GKIA 2FZ3B 4I8DA 5LQBH 2B4CH 3U0PB 4NN5C 2Y07H 1TZIA 4RA3A 4X5XB 2X4UA 3ZE2F 2V2XB 4MB5A 4YHIB 3MCLH 3L3OB 3KLAB 3IFNH 2QHLA 2YMXL 4M3KB 1CLZH 3Q5OA 3EO0A 3JVGC 3P30H 4FABH 1IAKB 1GVIA 1R3HB 3LN4A 4CVWA 4EZMA 3BKYL 4N5ED 3WFBL 3TYFA 4GKNB 1FNEA 1UVQA 3F62A 5E7BA 2D7PA 2YSSA 1BBJA 5HJ3B 4XVJH 3WHXB 4ETQA 2ZSVB 4HX1B 4EKXA 1IC4H 2HMIC 5F88B 1P6AB 3HUJB 5IM7A 2QV2A 4JFPB 5IB2A 2CH8A 3GNMH 1G7MB 3U0WL 2CIIB 4EUPG 3OAYH 3O3AB 2Z93A 1FO0B 1YEIH 4HF5H 3E6FB 3QRFM 2DQGL 4XP9H 2YD4A 3M17A 1BJ1H 4FFVC 3D0LB 4CADB 3A6BL 1MI5B 4PJ7A 2EE2A 1JWSB 3U2SA 1KXVC 1ROWA 4P4KA 5C09B 4WUKL 2GEEA 4HK0A 3JXAA 3EYOB 4IS6B 1CCZA 4HIIB 3SCMD 5F6IC 1K4CA 3ULVL 5B3NA 2F8XC 4PJEA 4ZQKB 1ORSB 2OJZL 2NX5D 2YMXH 2OM5A 5L9DL 3PUCA 1RJCA 2IAMD 4Y4KC 3KXFD 3KJ4C 3FQUB 1MY5A 2GI7A 2AW2A 3FQWA 1QSEB 2XWJA 3WFBH 4NQDB 4IMKC 4O5LL 5T3XD 3WXWL 4QHMA 3DPBA 4OD3L 4GRLD 2F74A 3L5WA 4HBQA 4NKIL 5EN2B 5C6TL 3ARVA 1A6TA 1HWGB 1NC2A 3O3DB 1QYGH 2DLFL 2A6DB 2EDFA 5IKCB 4XPBL 5TJWK 4PJEF 3OJDB 1KLUA 3T3PF 3U0WH 4HKJB 1TZHB 3QUYA 1EEYB 4QRUB 5DFVD 1G6VK 2XN9D 3WIIL 2NY1C 1G7IA 4U3CA 3PL6B 1NAML 4L8DA 4C56D 3W82A 5KZCD 2DQGH 2QSTA 3SDDB 4RWHA 3A6BH 4PRPE 3N1PC 3V4VL 4WI5A 2XTJC 2G60H 3EOTH 4WUKH 3TZVD 4PRBB 4ENEC 5F71A 4NO0A 5T1LD 2SEBA 3L5IA 1S9XB 3ULVH 5K9QI 4QHUB 4YJZL 3G6JE 5D5MF 2OJZH 4XP1L 1JIBA 2DBJA 3B2UD 5L9DH 4QHNA 1NCWL 1FVEB 4PRDB 4XCEB 3W0WD 4OCNC 2QR0B 4LASL 3OKNA 3OB8A 5E6YA 2DTML 5DJDA 1CD1B 1JMZA 4L9LC 3WXWH 2R0KH 1FSKC 5JPMA 4OD3H 2DLTA 3MJ8A 2XA3A 3VFMB 3I6GA 3VRIB 1GZPA 5I0ZA 4NKIH 5C6TH 3MJ7A 2B5IC 3ALWA 3PP3K 5GRXG 1F6AA 3MRNA 1MHEA 4XPBH 3LKOA 2CLRB 3CH8A 3PHSA 4MHHG 5GS3A 2GJZA 1TQBB 4O51A 3CDGB 3VFRA 5IVXF 3WIIH 2X4UB 3PV6B 4LF3A 4APQD 1NAMH 5GSRB 4GS7B 4HC1L 4F9LA 1GZQB 4ETYA 1WZMA 1NC4A 1C8PA 5KOMC 1SYVA 2YRLA 1YMME 4IDLA 1QFWI 3BIBX 3V4VH 1OP9A 3L7EB 5H2BA 1T0NA 3LN4B 1PVHA 2NY4B 3TYFB 1RZJL 2YN5A 4JAMB 1UVQB 1BBJB 4R0LC 5IJKA 5LWYL 3LN9A 5ICXB 1X4ZA 3SKNA 5BOPA 4JM4L 4KKCC 5IESL 3FAXA 5DHVA 1RZKL 4XP1H 5IM7B 1VCAA 2HKFL 4MJ2A 1NCWH 2G2RB 3CLEL 3RNQA 1EXUB 2DF3A 3IDMB 2BK8A 2UZXB 3DGGA 4LASH 3FFCE 4ZPTA 4GRWE 2DTMH 1MCCA 3HA0A 4TQEL 3PWPE 2A0LD 3ZKSD 4YGVB 1HSAA 2Z0BA 3U2SB 4YHML 1QPPA 4P4KB 1B88A 2Y4SA 4W4OC 3UTZA 2GJ6E 5DTFA 2DM7A 4HK0B 3KLDA 4LHUB 5D1ZD 1CLYL 5EPMB 2R2EB 4LU5L 1CFNA 3LKSA 1OCWL 5CP3H 1JFQL 4K8RD 4PJ9D 4KQ4H 4PJEB 5FF6B 5CKGA 4HC1H 1E4WL 3TC9A 4K3EH 4R96A 3CU1A 3BXNB 3IFLL 4F7EA 2CLZA 3NCJL 4HUXB 1HDMA 3BO8B 4QHMB 1U91A 5LWYH 1ZLWH 3FHQA 3DVGA 1EMTL 4WRLA 4KTDL 1JVKA 1MVFA 5DQJA 1WBZA 4M1DL 4E41E 1FNHA 2ICES 5IESH 2E7LC 1RZKH 5L0QB 4ONGL 2HKFH 4J3TA 5C0CE 3CLEH 3GMPA 5D5MB 3DV6A 4XNUH 2CLVB 3IXAA 2ED9A 4QRRA 2HMID 1DQTA 5BRZA 4TQEH 3ZYOA 2O5ZL 2EDWA 5E03A 4H1LB 3QJFB 5FO8B 1KJ2L 1HOCA 2BSSA 2HRPL 1EX0A 1KTDA 5IP4A 4KVCL 5EUKA 1CLYH 4WU5A 2CDGA 4LU5H 3VI4E 3ULUE 4U1HA 5HYFA 4ZTOH 1OCWH 3OX8B 4ZOEA 5C9JA 1JFQH 1A6ZB 4YO0A 1AC6A 4FFVD 3V4UL 1ZKAA 3MO1A 2EO9A 1OAYL 3ZHDA 3AROA 5K9OB 5IVXB 4NQSB 1ZTXL 2OK0L 4HAGA 4ZAKB 3DYOA 5IOPB 2FRGP 4EI6B 1OOAA 4IOSD 3IFLH 4ODUA 3P9WB 3NCJH 1YA5A 4W81A 1ONQB 2GIYA 1I9EA 3TPKA 1FLTX 5AG8A 5JPMB 6FABL 1RQ5A 3MJ9L 1EMTH 5E1AA 4KTDH 2DKUA 1P2CA 1GZPB 5KVDL 4NPYA 1FH5L 3MCKB 5I2IB 4JY4A 5KSAA 2H3NB 4ONGH 4JHBA 4OSUL 2MPAL 1BIIA 2ZNXA 2WSKA 2X1XR 3OGCB 4K55A 5JO5B 4S2SA 4O51B 1KTLA 5JXEC 5GGVH 1SJVA 1CK0L 2Z31C 2DI8A 1ITCA 1BMGA 4HPYL 4L8CA 1EO8H 1SYVB 2O5ZH 4XVTL 3WUWG 3LRSA 3MUHL 4AIZA 3B5HA 4ZOBA 4YDJB 1T0NB 4WI8A 5DA4A 5EO1B 1G84A 1KJ2H 2HRPH 4KVCH 1KB5L 3UO1L 1FL3B 3ZSTA 2DQUH 2NY1D 3DX6B 5D72L 4OQTL 5BMFL 3THML 1QA9B 1OLLA 5ETUB 2D31B 4K9EC 4MMXC 2IADA 3AMLA 4HFWB 5EBGA 3WNLA 1MCJA 3V4UH 2UUDH 3RWHB 1OHQA 3C5JA 3SE8H 5FYJE 4AT6A 1OAYH 1K85A 3MXWL 3ZMRA 2Q6WA 2AXGA 3QIBC 4ENED 3RNQB 3C5ZC 2VN7A 1ZTXH 4U3XA 3HC0A 1BQSA 1U93B 5I74C 1ED3A 3CXDL 4HUVB 3RUGF 3HPLA 4HGWB 2E7MA 5KSUB 6FABH 4BYHA 3MJ9H 3NPSB 3S96A 4NFBA 4FQ1L 1NCTA 1EO7A 5KVDH 3QYCA 4HS3A 5TE4L 1I3VA 1FH5H 4HUUA 4XZUA 2MPAH 5E94A 2N56A 3UBXG 1FHGA 2P7TB 3LKSB 5T5NG 3M45A 4LLYA 5KVEL 4EUPB 1WBYA 1CK0H 3C08L 1T4KA 3FJTA 4HPYH 2DKSA 2F19L 1QHPA 2A83B 4U1KB 3CX5K 4KV5E 4OLXL 4L8SC 2EDYA 3OKEA 4DGYH 4XVTH 4MXVF 1CFSA 4HK3J 4OJFL 4G6KL 1HXMA 4I2XB 2GITA 2PO6C 3QHZL 2JJSA 2CLZB 3UO1H 3S35X 5ISZB 5AYUL 1U3YA 5D72H 4DW2L 1TTGA 5TDNB 3LN5A 4IM8A 4OQTH 3THMH 2BNQD 3IU4L 3DVGB 1M05A 4JKKA 1VFOA 3QDGD 3X11A 3HHRB 2OI9C 4X83A 3HAEH 2B1AL 5DRZB 4AL8L 1B90A 2DKMA 1A6UL 1I3RA 2W07A 1U8KB 2JCCA 2YS4A 3MXWH 4FXLA 1KNOB 1CGVA 5J6GB 1OAZL 4LLDA 1A7NL 4WEMB 3DV6B 2YPLE 4AEIL 3EO1A 4M43L 1HXYA 1YDPB 2AKRB 5DR5L 1FFOA 1QNZH 3IXAB 5BRZB 4ZS7H 4XCNA 3VMNA 1KJMA 4FQ1H 1G9NC 5TE4H 3RZCA 1KTDB 5EUKB 2PR4L 4HPOL 1CD9B 4LP4A 2EECA 2CDGB 3H9SD 4WU5B 4WWKC 2JCCF 3QJHB 5A16A 2EEBA 5KVEH 4RFEA 4BM7A 1BVKA 2DIBA 1NBZA 3STLB 3QNZA 3MO1B 3C08H 4U7SA 3FT3B 1BQHG 1CIDA 2F19H 5HXMA 4WUUA 5JLZA 4OLXH 4LDEB 5K59F 2ITDA 3V52L 3MCG1 1AY1H 3LMJL 4OJFH 1Y0LA 4G6KH 1KXTB 1NSNL 3QHZH 4TOYL 1FFQA 3K3QA 3DECA 4BH8B 2WUCL 3EZJB 4DW2H 4Z7VE 1F4HA 1MAKA 4WW2A 3VXUE 4Y8DC 3IU4H 3WUZA 1T5XA 2LTQC 5E1AB 3VGAB 2B1AH 4AL8H 1A6UH 1D9KB 2BSED 1B2WH 2VWEC 2ADGA 2Z8WC 2CUHA 1OAZH 3AXLA 1A7NH 3OKLA 2IF7A 1ZAGA 1K2DA 4OLZL 4OBRA 3TIDB 3S37X 4M43H 1QEWA 3GJFK 5C0JA 4MA1B 4ZODA 3E0GA 2OZ4A 1AO7D 4P48A 4I48A 3RUGB 4BZ1L 2YPKA 4PRPD 2PR4H 4HPOH 2C4FT 4NDMA 4OZFA 4XNQB 4E0RA 1GXEA 1QQDA 1FFPA 3OHXA 5FDWA 3QUXC 4AMKH 2IADB 1INEL 2VLKD 2XIDA 3B9KC 3WEXA 1A8JH 4KDVA 5M94B 1R3KA 4WTZA 3RGVC 1MUJA 4KK5D 5GGTL 3NIGE 1M7IB 1GRWA 4Q9RL 4P2QB 4XGZA 1SMOA 1P4IL 3V52H 2GTWA 3LMJH 1I7UA 4WHDA 2CRMA 4RMRA 5IHBA 4M3JA 1NCBH 4I18B 4NUGL 1NSNH 4TOYH 5KN5A 3GSQA 1I7TA 1T03L 4P3WA 4ISVB 1ORQB 3CC5A 4JLRB 4CVXB 1C08B 4YEEA 1WZ1L 2WWMC 3IF1A 5F72S 4MNGE 3KPSB 5I15L 1FNFA 4HUUB 4XZUB 2O61A 4Z7QF 1KLGB 5EUOA 1B6DA 3D39D 1XIWC 1CDJA 2VC2L 43C9B 3TNNB 3SCMA 4JKWA 5F3HB 3MGTB 2QSVA 4Y19D 1WBYB 1D5MA 4N1HB 1T4KB 5CILL 5TF0A 1H3XA 4OM1L 1HYRC 3P77A 4I3RL 2CPCA 1CU4L 1CFSB 3CX2A 2ZKHL 3TCLA 4OGAC 4BZ1H 1YMMD 4LLMB 1T04A 3QBTB 3MYJA 3LN5B 3OKDA 3UYRL 2VAJA 2BXZA 3SY0B 3W11C 2A6JB 1F58H 4X4XA 2R2CA 1HHGA 1UXSB 5HGHA 1JBJA 4NRXA 1INEH 3U4BL 2I25N 4C59B 5EG6C 1EDQA 3O11B 5GGTH 4JFZL 5CWSA 3V6OE 5I16B 2JCCB 4M7KL 4Q9RH 4CDGC 2VAAA 3GDBA 1P4IH 4HIHB 1S5IL 1FORL 5DZNA 1U8LB 1M71B 4AH2A 1MELA 2XN9A 4WHTB 5FO9A 3QUKB 4PGBA 2E8YA 2BOCB 4FQXC 2CUIA 1HXYB 1FFOB 1EHAA 1T03H 2HA1A 2X4RB 3QIWD 2JF1A 3VG0H 1WZ1H 2JK5A 4M4PA 3BDBA 3QDAA 3T3MF 1KJMB 4DKFL 4GG6E 5I15H 3C5ZD 5FCSH 1OAKL 1X5LA 2NY6B 3PWPD 5EORL 5T1LA 5T5NF 4YFEA 4LVOB 2VC2H 1BFOA 5LAXA 5F97E 1N7ML 3IYLW 2GJ6D 3JWOL 4RFEB 2A6IB 2RB8A 4F7PA 3QNZB 4JVPA 5CILH 1NUNB 5EULV 3PABA 1AKJD 1WBXA 4OM1H 4M4RA 3EYUL 1IEBA 4I3RH 2ITDB 1H5BC 1CU4H 1KN4L 4YFLI 5CLTA 3W0WA 2ZKHH 2EDOA 1JNLL 5F70A 5DEFA 2YXFA 3ELAT 1ERNA 1VHPA 3SDAC 1J05A 1A3QA 1MH5A 2PYEB 5E8NA 3SGDH 3V9FA 4WEUD 2VABA 3GMNB 3U4BH 4JZOB 3CXHK 4GW1B 2H32B 1D5XB 3H9YA 4JFZH 4HH9B 4M7KH 1A22B 2PO6D 1S5IH 4YHNA 3BZ4B 5DJCB 1FORH 4E41D 1AGDA 1AJ7L 3BVNB 3OKLB 3TT3L 1AFVL 4NZUL 3B9EA 2YA0A 5FAAA 4APQA 2V7HB 5C0JB 5I73C 2ZNWA 1DN2A 3HN3A 4J1UA 3VCLA 2DL2A 4WCYL 2WBWB 3MRLB 3E3QE 4NBYB 1IM9D 5D6CB 5SX4I 5GPRA 3T2NL 3PV7A 4DKFH 2AJUL 1ZLUK 3PHOA 1EO5A 1OAKH 5EORH 4Y89A 1U8NA 2ADFL 1G6RA 4QCIA 3CZJA 4UQ2B 1N7MH 1K6QL 3JWOH 2VXQL 3ROOB 1OSZA 3ULUD 1MUJB 4YBHA 3QT2A 1B4JL 1WTGT 1MFCH 3WJLC 3EYUH 1TLKA 1X6NA 1ZA3B 2X10A 2I5YL 1BBDH 2OL3B 5EA0L 4U05A 3AB0C 4G3YL 5AEAA 4WWKD 5DZLA 3WUWB 3GMOB 1OB1A 4PLOB 4NWUL 3H0TB 3GSQB 1MRDL 3HMWL 3VFNA 1NFDF 5HHMB 1F6LL 4WI6A 3BN9C 1MHPL 4PJ5D 4RX4A 3IF1B 2C1OA 3QH3A 3G6AA 3UEZA 4FXGB 4E42A 1T89C 5D1ZA 4UDTA 1LWRA 4G8GE 3UXFA 5CGYC 4G80B 3SCMB 4QHLA 2YEZB 3TT3H 1AFVH 3TVMA 4NZUH 2M8XA 4U31A 5D2NE 4ZFZB 5EFIB 1KPRB 4XBGA 2NX5B 1I8IA 2IAMB 3BUYB 3KXFB 3P77B 4JFHE 4WCYH 3T2NH 1FVCB 4GXUM 2P42B 2AJUH 3QISA 4WFFD 3TCLB 1INQA 3BKJL 1WISA 5CSGA 3QAZB 5CJQL 1DLHA 2AJVL 3ZL4L 3SO3B 3WO3B 3V6OC 5L2KE 4GRLB 4BJLA 5JOFA 1K6QH 3UBXB 3GMLB 5HGHB 4JQXC 4NKMA 3JVGA 2DTSA 5HD8C 4LDLB 1B4JH 5CWSB 3H7BA 5GXBB 3O8XC 4ERSH 4QNPF 1GC1C 2JELL 2I5YH 4Y5VB 5FYJD 4OF8A 2PKDA 3SDXB 5ID1B 3QUXD 4NWUH 4C56B 4F58L 2VXUL 1MRDH 3HMWH 4R4BB 1S7RA 3B9KD 4RFOH 5KZCB 3RGVD 3NOIA 3ARRA 2JK5B 5FKAB 3U79A 4X7SL 3TZVB 2HJFB 4TUKH 5T1LB 1T1YA 2RCSL 3CFBA 4K71B 2J88H 3FONA 2RQ8A 4L4VD 1UWXK 4NC2B 1DVFC 4OV5A 2RAMA 4UQ3A 3QEHA 4N0YL 2IPUG 3ZKXB 2ZJSL 3V6BR 1HEZA 4F7PB 5CJOL 2WWMD 2YZ1A 1FLRL 1IGYA 1FJ1A 1XIWD 1FC2D 3IDGA 3BOVA 4ONFH 3BKJH 2EXYC 3BPCB 4L9DA 5DEFB 5ENWA 1WGOA 3LV3A 1XF2A 2AJVH 3UC0L 3ZL4H 1J05B 2FJHA 5D7JC 5JW4M 1IT9L 3QNYA 3VMPA 1VGKA 2M2DA 2VABB 2HKHH 4OGAD 1BQHB 5T5FL 1FNLA 2JELH 1AGDB 5SWQB 4ZO7A 3AY4C 2X4TB 2H26A 5ILTL 3W11D 4APQB 5MI0C 4QHKJ 3FB8A 3VGFA 1F02I 1K4DA 5ACMA 4F58H 2VXUH 4J1UB 3SEPA 3V8CA 3VCLB 1FL6A 3BGFB 3TPUA 1Q8MA 2V5YA 4X7SH 1RHHA 1HSBA 1NFDB 4XAWH 2RCSH 3RWJB 1NDGA 1G9NL 4FQXD 3RIAF 4GKSB 4Q58C 3INUH 1X5GA 3HE7A 4LPUA 4XB7A 1LO4L 1KB5B 1YEJL 1OSZB 4ZO9A 5CJOH 1FLRH 4BSVB 3DYMA 5J3HC 1Q9WA 5DUBB 3DETD 2AP2A 4O2FB 1AGEB 3T0BA 1XF1A 3G5VB 5HGBB 1IMHC 4N0UA 4NCC2 3UC0H 1ZLVH 3I6LE 2ID5A 2D0GA 4WDIB 1U8IB 2C1OB 5IW6A 3QH3B 4OZHA 5D1ZB 4UDTB 5HYJD 4GAJL 2F15A 2Q7NA 2W60A 5T5FH 1XGPB 3F5WA 1A7OL