1NFAA

Human transcription factor nfatc dna binding domain, nmr, 10 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
178
structure length
178
Chain Sequence
MKDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords HUMAN TRANSCRIPTION FACTOR NFATC1
publication title Unusual Rel-like architecture in the DNA-binding domain of the transcription factor NFATc.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 1997-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00554 RHD_DNA_bind Rel homology DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 1nfaA00
1S9KC 1A3QA 1IKNA 3DO7A 1LEIB 1SVCP 2O61A 1LE9A 2V2TA 1GJIA 2I9TB 1VKXB 2O93L 1A02N 1OWRM 3GUTA 1UURA 1LE5A 3QRFM 2O61B 1P7HL 3DO7B 2RAMA 1LE9B 2V2TB 1RAMA 1OOAA 1NFAA 1LEIA 1BVOA 1UUSA 1A66A 1PZUB 3GUTB 1VKXA 2AS5M 2I9TA 1LE5B 1NFIA 1IMHC 1NFKA
chains in the Genus database with same CATH superfamily
1MFBH 1VACA 4BBWA 2ZE0A 3NSFA 3KYOB 3IKKA 3D4GA 3HVNA 3QUGA 4BK4A 3U1QA 2YS4A 1WBYA 3ECBB 4M7LH 2FL5A 2UZXA 3G5VB 4OLWH 4ZQKB 3EJYD 1KV7A 1U8QB 2FJFA 3GM0A 4K8RH 3X2QB 3QDME 4HEME 4MKMA 2ENYA 1JN6B 4POYA 5J6GA 1U8CA 3DVFA 5T5NF 4AV0A 2FX7H 4KNUA 5KANG 4ZAKB 4LEBA 5E6IA 3JWNG 2HX7A 3TIDB 5DZVA 1MHCB 2YQBA 3MRGA 3VGGA 4TS6A 5KVGL 2R23A 2Z0BA 2PXYD 1A4JA 5BV7L 4Z8FL 4R90L 1U33A 4OJDH 5EOCH 2BY3A 5T5FH 1C5BL 5DS1A 2XPZA 1UEYA 3DVNA 3M17B 2VXQA 2OR9L 1JJUA 1PZDA 3QPQD 4ZMOA 1KTKE 3BZFB 5EOCJ 1M7IA 2IH8A 3CVHB 4W9JC 5F88B 3VXME 3QUYB 4GEIA 2UVFA 2EINB 2PYED 2OMNA 3JTTB 4F2FA 4F7MA 5I15L 5L4IA 5A2IH 1TYJA 4URTB 1ZTXL 4IOSA 2YMXL 5GZNA 3WS6C 3WU1A 4X9FA 1A6TA 2EDHA 4BZ1A 3CJJA 1XSIA 5C0EB 3GHBL 1T1YA 3PIQB 4KDTC 4P2OC 3ENEA 5H35A 3HKZA 2WINB 3SZ6A 4PV1C 1E9PB 5H37G 4CILA 5BW7A 1E5YA 3LH2H 4ALAC 1U4FA 4UZUA 3RDTC 1J8HD 1VACB 3FQ2A 3SBRA 3V7AE 4BIKA 5JQ6H 2DBLL 4RDQG 1J5CA 2ZUQB 3TVMC 1I1AD 5KVDE 2BWDA 4GIAA 2Q87A 1WBYB 2OTUA 2FL5B 3OMIB 2UZXB 2FJFB 3FTGA 1IVLA 2F54D 1JI2A 1KIQA 3NZ8A 3OR6A 3T8XA 4GI8A 1J1OL 1NBCA 1RZKC 1U8CB 2V9QA 4KKCC 5J6GB 1Z66A 2MQGA 3NDZE 3QUML 4MAYC 4S1RH 5E6IB 4I0CC 2NSMA 1W8EA 5FEBA 1MCWM 3B37A 3MRGB 4Y2DC 3S37H 3TC9A 2N7BA 2OZ4H 1UKTA 2R23B 1A4JB 2W38A 2WQXA 3F8UB 3JYCA 3PJLA 1YC7A 1YPZA 5FWQA 3S7GA 4AK2A 5D7LD 3NFSH 1Q1PA 3DVNB 1B4RA 4XC3L 4WWOA 3V0JA 3TV8A 4CVUA 2OK0H 3FKUS 3MRFA 4AVJA 1AHWC 1OT1A 3IJSA 5J06A 5E2WH 3HZ3A 5IW1A 1M7IB 4POUB 3RJDA 4WI3A 1S5IL 3ZKQD 2PABA 5L2KA 4F7MB 1MDAA 1WEJH 2GHZA 2QSTA 4Y8AA 2VKXA 3RVUC 5L9DH 4XNBA 1HINL 2Y1AA 4FLRA 4HT1H 1FNGA 1A6TB 2MSPA 3PUCA 4FNRA 3V6OC 2DI9A 4HS8H 1T1YB 2A73A 5H35B 4ACPA 3LNGA 5FV1L 1FNHA 4KK5C 3PDOB 1CTNA 2VL4A 2XY2A 3NJLA 4G7YH 4XI5D 5JQHC 4MNHA 5TF1H 1KB3A 1Z3RA 5KS9E 4IGBA 3EF7A 4LL1A 4XMKL 3M1OA 3HC4H 4JDEA 1KN4H 1GRWA 3CTTA 2Z7WA 3UAEA 4Y4KA 4U1JA 4DPCX 4UQCA 1USZA 3O8XC 3WG7B 1JYNA 3H9SA 2OTUB 2PP9A 5IQOA 4QT5A 3FTGB 1KIQB 3NZ8B 3OR6B 5JO5A 4HXAH 3T8XB 2K6ZA 3IJ8A 2WJ7A 5H4ZA 5M94B 3EUDA 5I1EL 5L4FA 2X09A 5HHQA 3MNVA 2WXQA 1IV8A 1MCPH 3DTXA 3O0LA 4Y7OC 3ULVL 1YPZB 4S10A 4FQXA 4PJCF 2XPYA 3VI3A 3S0PA 4C55A 1TQVA 3PL6C 3BVNA 5C9KA 4LQ1A 4X7TA 1J12A 2ADJA 2AJXH 3WJJC 1UH3A 3MRFB 5LGKA 4GQQA 3C9NA 3IJSB 3U7YL 5JIDA 4Y4FA 1R4XA 5IW1B 1KB5H 2ICCA 3IS1X 1KELL 2V8MA 5L2KB 1QZ1A 2BWQA 2HJLA 4XPBL 1CMOA 4IJ3C 3WTSA 2CA4A 5BRZD 1XX9C 2DTML 3NMEA 4KK9D 1ZHBA 4NN5C 2G3NA 5CJ8A 1LMIA 1EVTC 1CLZH 2WY3B 4G59C 5JHLH 4FQIL 1FNGB 3WNOA 2A73B 3C5JA 4H0HB 1A5FL 1QFOA 2IGFH 3M45A 5AZUA 3V9FA 3VD3A 2W8CA 2Q2LA 1I9RL 2X9YA 2NR6C 2XSKA 2Y72A 3ARFD 3QUZD 4ZMYA 5IVXA 1L9OA 4MNHB 4BFRA 1DVFA 4P06A 4IGBB 2PO6C 4OLVL 2V7HA 4HIQA 1RK1B 1NANH 2D8KA 4JDEB 4U0QB 1C7TA 1NAMH 4M93C 5SV3A 4Y4KB 4LSPH 4U1JB 4Y9BA 3ZMEA 4RWYH 1UACH 4TUUA 2E7HA 4KK6C 2HX9A 3H9SB 4LFHD 3V79C 3P02A 2ZIDA 3DX2A 4QT5B 2FHFA 1JTPA 2VXUL 5LHDA 1GMIA 1QI4A 2UUDK 1KULA 2LAGB 3GSVA 5JO5B 2MOVA 3V52L 3EBHA 5JDSA 5DWUL 1TSRA 1GCFA 2V2WA 3ZZSA 3UTSD 3X13A 4DTGL 4YE4L 5IQNA 3QPXH 3RKPA 4M5SA 2Q20A 1SEQH 5C0BD 5E8DH 3MNVB 2XXGA 3VXSD 3DPBA 5HHQB 3U0PA 4J3BA 3DTXB 1NKGA 2OXHA 4BUGA 2CK2A 4FQXB 3E8VA 3IE4A 3OSVA 3VI3B 3ZDXB 1KXTA 3BVNB 5BQ7A 3MACL 2NYZA 4X7TB 2ADJB 1F4XL 1NFDF 3C6LA 3C9NB 4KPHL 4Y4FB 4BE6A 2VXSL 1FHNA 3RTQD 2EE3A 5E6YA 2CM6A 5ELIA 2HJLB 3FBQA 4G1MA 4EUPG 1L9SA 1IE4A 3K7UA 1ZHBB 2Y7SA 2FD6L 3LVTA 4N2LA 3TFKC 3V0HA 4U6YA 2ZX5A 4LLVA 1TVBA 2QGEA 3Q13A 4JO2L 3C5JB 3RVTC 3FFCE 3ZKXB 3D18A 1U8PA 5AEAA 4CA4A 4E41D 2CUHA 3HG0A 5GGSY 1YRKA 1PIFA 4NCC1 3RY6C 1QD0A 4U05A 2BJML 1SHMA 5IVXB 3WN5A 3TO4A 4AQ1C 1DVFB 2OJZL 4NERA 4XE0A 4P57A 3ESUF 1DJXA 2V7HB 1NOAA 3WEMA 4K07A 4KKRA 2WLYA 1FCCA 1MFEH 1C1EL 1NCHA 2KZBA 5IESL 3D2UA 1M9WA 4HIXL 1OM9A 2PWEA 3UPRA 1PD1A 3KLDA 1JZ8A 1XCXA 3QIBA 1JF5A 1EXHA 2A5UA 3GSVB 2E6QA 4XP5H 1M4KA 3LEXA 1MFCH 1EFXD 4NC2B 4NWUL 5C08A 3WNLA 1WISA 2EXSA 2V2WB 2W94A 5I6LA 5JDSB 3GO1H 3X13B 2AQQA 3SPJA 1JNNL 3BT2H 4NQCA 3R06A 2FHCA 2DKMA 5I28A 1ADQL 1IC0A 1YJDH 3U0PB 3C5ZA 3DPBB 2G5BA 2X4QA 4PRHA 2OXHB 3T2NL 3JZYA 3GXMA 1BZDA 4MZIA 1KXTB 3SIKA 1I3RA 5BQ7B 4R26H 4AQ8A 1TETL 1RMFH 1CDYA 1OWWA 3C6LB 5EA0L 3V5HA 2YSTA 1DQQA 3L9EA 1PU0A 2XVKA 1DJYA 4L3CA 5HY9A 1FHGA 4G1MB 5GRUH 5LBVA 4U0RC 1VEMA 5KBNC 2ZXQA 3V0DA 2AAVA 2YD4A 3NIDF 2D7OA 1BFVL 4HMEA 2H8PA 3EO1A 1DJZA 4K2UH 4U6YB 4DOHB 2VXTH 1IKOP 4LLVB 1TVBB 5TD4A 1E50A 2JTDA 2BSDA 5IEKA 3D18B 1U8PB 4TLKA 4M48L 1LO2H 4HBQA 4RGNB 4AXWA 4WFFE 3WN5B 2WQRA 3TO4B 2OMUA 3HA0A 4P57B 4WNQA 2WO3B 3R1GL 1NSNL 3AG1B 4FXGA 4Z7NF 3ARGA 4UDUA 3VFOA 5JYMA 4PJ7A 2X6AA 4M6AA 1QW9A 2JF1A 3D2UB 2XFGB 1DSWA 4OZIF 4OBRA 2XX0A 3QIBB 2GK2A 3QDHA 4GUCA 4ZUVA 3WXWH 5B3SB 4K5PA 3LEXB 5C08B 2OMXB 4ZMZA 4X4ME 1FFNA 3SDDD 4LFHG 4LEXL 4NQCB 1IC5H 3KDMA 3HMXH 3R06B 4M29A 3AFLA 1C5CH 2DQJH 2CUMA 1O7DE 3C5ZB 2G5BB 2X4QB 3TEWA 2Y3AA 3Q8AA 4LU5H 4PRHB 3SBWC 1BCIA 3N40F 4BM7A 4L3FA 1I3RB 2ENSA 4JZJC 3ELAT 1V05A 4NZJA 4E9RA 3V5HB 1WFJA 1FC1A 1DQQB 3N5AA 4JFTA 2JJVA 4B9CA 4AJYV 5DURB 2H1PL 4L3CB 4S1SL 5FOJA 1UXSA 5HY9B 3UAAA 3IFOA 2X3BA 3AT9A 5DK0A 3SO3C 5HYJE 1NDGA 4OGQC 4DO6A 2H8PB 3EO1B 3ULUE 4AYGA 4DW2H 1U8NA 1PLAA 1AS7A 1MCBA 4H7VA 1WZ1H 3A67H 4L3EE 1QLEL 4F5CA 1D7FA 5CF3A 3I50L 5IEKB 1CGUA 1KTBA 1Z32X 2Y7NA 3NCJL 3NJMA 1U8LB 3DA0A 4AXWB 2ZUTA 2E46A 3IGKA 5D1ZD 2OMUB 2P8LA 2QHRL 4M62H 2WO4A 1MFMA 3B56A 2GC7C 4FXGB 3GBNH 4GSRA 4WNQB 4ZS6C 2HG0A 1FIGH 1H3VA 3ARGB 2CHXA 1X9LA 4UDUB 4PJ7B 3NZHH 4UT6A 4XCFH 3VFOB 5G4OA 2DDQL 2EDMA 5TDOA 3LZPA 3PP3H 4ACTA 2IG2H 4GI9A 4IOFD 5ACLA 4ZUVB 2APFA 3BSZL 1LHZA 1XCQA 3OC5A 3O6KL 4NKMA 1FFNB 2O6DA 3SGJA 2GKIA 2ZX8A 2WSKA 1QFWL 3ARRA 1WK0A 3RI5K 3NT0A 5C97A 4NLAA 2YOAA 3LIZH 2I26N 1M6OA 3O0RH 3WYRA 3PDGA 3KPMA 5LCVL 2Q76A 3HRZC 4WHTA 1ZHNA 4N0CD 4FS0A 1AQKL 4GXVH 3FQTA 1FBIH 1V7NH 1DHKA 1AKJA 2WQAA 1DO5A 3ESOA 2EXWD 2FAUA 5L0QC 3M1CA 1UXSB 2W59A 4LIQL 3IFOB 4ZT1A 4U1IA 4IIQA 3IM1A 1NDGB 1J5IA 5I5JA 4P5TD 1U8NB 2XKNA 2VDRL 2MWCA 2K9UA 2ROYA 4FCAA 4JE4B 1DSFL 2WUCH 3NCYP 4UTBH 1BYOA 1CD0A 1QSEA 1UHVA 3RIFK 3LEYH 1OOAA 1WP6A 2E8YA 5IBLD 2AI0L 5ETUA 2Z7UA 3N85H 1I85C 1IBBA 2P8LB 5EORL 4Z7WF 1PNDA 1TZ8A 2FATL 3RZCA 3DNKA 5CJ5A 5CJQH 2Y1VA 2QJDA 2B5IB 4I4WA 2DM4A 3NAAH 5TDOB 1A6WL 1KGWA 2PP8A 4J39A 2YN5A 4FZEL 5D1QD 1T22A 5FGCB 5T1KA 1XCQB 5L88H 4MDRA 3NN8A 4NKMB 1BVNT 2VYRE 4NRZA 1I1YA 1AQHA 5FA4A 5L7XH 3GYRA 2WCGA 3VSVA 2NW2A 3P0GB 5D71H 3EDKA 1ID5I 4YHPA 4L2LA 3T3ME 2GI7A 3S34H 2HUEA 2OSXA 4X5QA 1UZ6F 3KPMB 4ZNCD 4FXKC 2Q76B 1NA8A 5FGBA 4WHTB 1ZHNB 2VZUA 3DPDA 3UOAB 3FQTB 3TTYA 4W68A 5FLVA 3HLAA 2I5YL 3F6IA 1AKJB 4LSTH 1OAYL 2VUYA 4XVUC 5B22A 3SEPA 3RWHA 4P3DA 5IMMA 1BMWA 1IKFH 4MSWB 4U7MA 1D3CA 3DTUB 4HBCH 1Y07A 1Y7VA 3CHSA 3IFNL 3TCXA 1JZGA 1FRGH 1FYTD 4U1IB 5AB9A 4IIQB 4UILH 2NRDA 3IDMA 4JFZL 4YX2L 1GJUA 3ILQD 3FULA 1I8KA 3W37A 1BYNA 5D1ZI 2XKNB 5EZIH 2MCAA 5B1BB 3VMOA 3ARXA 4XCNA 3ZRCC 1OSYA 4LOFA 5T8IA 1B2YA 4EZLA 4KVCL 1OB0A 1QSEB 4XNXH 5TGBA 1FORH 4RA3A 5CGTA 1ECZA 1F1DA 4A7QA 2X10A 3GMQA 4FFYL 5ETUB 4OGXH 5A43C 4UNUA 3RZCB 3CVHH 4M00A 2C3XA 3GINA 2QADB 1RUAL 1NPUA 4NGHL 2FX9L 2ZP0T 3G08A 2FYVA 4I4WB 1OD9A 4LPXA 3QRLA 1PY0A 3B7RL 3E9UA 4KGLA 4M7KL 1HSAA 1T22B 1BAFL 4JREC 5DHDA 5T1KB 4CKVX 3MBED 3NN8B 3GUFA 2VOTA 4UT7H 2AXHA 1I1YB 4H8PA 4NRZB 5FA4B 2VM3A 2GJ6A 1WVZA 2NW2B 4KNTA 4YHPB 2C9XA 1HIMH 4R5TA 5F7AA 1F4WL 4NC1C 3FU6A 3D39D 1MJUH 2AANA 5FIEA 1EHNA 2TRYA 5E56A 5D2NC 3UERA 1QBMH 1TNMA 5CCKH 3KPRD 1P9MC 4JM2D 1WFOA 3FU5A 4R83A 3KPSE 4MZ2A 3HLAB 4NEHB 3S36H 1KGJA 1XB3A 2WNWA 3RWHB 4P3DB 3UCRA 5IMMB 4AKQA 4WO4C 4U6TA 4A7GA 2CR0A 3OAYK 1JXDA 5D6DA 2EVJA 2FEJA 4B9ZA 4Z3TA 4WFED 3IDMB 5HHNA 2YARA 1I8KB 2X5PA 1I8LC 2Q7NA 2CD0A 4OZFG 4XCNB 5E4AA 1XF3A 2V5RA 3EOYG 4FFWD 4F7PA 5DDHA 1K3IA 2B1OA 5TGBB 3UTOA 3VWKD 2PPDA 4G3YH 5GJSL 1KDJA 1A3RL 1G9ML 3GMQB 2VXQH 1AKPA 1CICC 1FG2A 2J8OA 5LQBH 2QQKL 2Q3AA 1SXCA 2D7NA 4G6JL 4DUXA 4GBXA 4Z7UA 3JVFC 1TO5A 3JQOB 3G08B 2BINA 4P2RE 4YDLC 3ZR5A 5D1XD 1SVCP 5F9DC 1ML0A 1HSAB 4KGJA 4PRIA 4HG4J 2Q3XA 4YHML 2VO8A 1JFQL 3ZE1B 1AC6A 2AVFA 3CN2A 1VHPA 2GJ6B 3BESR 1X4XA 5D7KE 3PABA 4FOMA 3K0WA 2EE6A 2Y6TE 4O5LH 4S11A 2WXNA 3L3KA 3L16A 4JFDA 4N8CH 5F7NC 1TTAA 1F6AA 3HPLA 3H4FA 5J11B 4Y1SA 4JM4H 3IU4H 4GO8A 5FK9A 1JFHA 3T6QC 4YHNA 5AW1B 2EDKA 1ZS8A 4D0CA 2AXFA 2B14A 5DTFA 2DOCA 4Y5XC 1MW1A 1R5WA 1BQUA 1FIEA 3EKCA 1NCCL 5GS1C 1WO2A 4ZXBD 1A7NH 1H19A 4JRYD 4Y4HD 1QSZA 1XH1A 3BISA 3MJ9A 4NOFA 4YUEL 5HHNB 3TA3D 5DWPA 4ATTA 3LZNA 5E2UL 4AJWA 1F56A 4HUXA 4AUUA 1XF3B 4ZFOL 3SPCA 4CDGC 1G9EA 4F7PB 5DDHB 3A22A 3QDGE 2XZCH 4GT7A 4FQ1L 1ZTXE 1DVXA 3FN9A 2DJSA 1FG2B 1X5ZA 3ALWA 4XOBA 4JR9H 3AXHA 1JV2A 4GBXB 4S1DC 4Z7UB 2J73A 2Z92B 4V11A 4XVJL 4WLCA 5HJDA 4JFXA 4N2NA 3II3A 1QEXA 3B7TA 4NP4H 4OCLC 4JN1L 2NW3A 3QBTB 3I3DA 2C26A 3MA9L 3VG9B 4PRIB 1ORSA 4WY7H 1P84J 3S88L 3PV6A 4HK3J 2CZNA 4HLEA 4FNLL 1DQLL 3H54A 3OBAA 3FHAA 1MCOL 3V5KB 1M2OA 5C6TH 1BEYH 5KYUA 4P23D 3PABB 4JDVA 4PI2A 1UB6A 1N18A 2JELL 3HBPA 3L3KB 3NJXA 4JFDB 1AOHA 2JIXA 4LRNH 1G9NC 1F6AB 3HPLB 1NCBL 3VG0L 4JFED 2XX1A 2CCWA 2ICWI 4NJAL 5FK9B 3V4PA 1GTFA 3H0TB 4WW2F 3JWOH 1GGBL 4YHNB 2O5ZL 1G87A 3G6JF 4UQBA 3WO3B 3L3GA 1ITCA 1LDPL 2CGRL 1ZS8B 3EDDA 1Q0XL 4D0CB 2AXFB 1FYHB 1NUNB 3CSPA 5DTFB 3SKNA 3U2SA 4FLQA 4ES9A 1R5WB 4FZ8H 4JPKL 4JHZA 2YD7A 4JRXA 2IPUK 4K8RC 3OAZK 3CSYA 1F3DH 3H42L 3NESA 2MQCA 4HUXB 4F1ZA 5DYOA 4LAJH 4OFYA 1F3DJ 4LOUC 1YEEH 4LCWD 1E7UA 1FE8L 4Q6KA 5IW6A 1CWVA 1Y0LA 5E4EB 3OXSA 4Y9FA 3SYQA 1EMTL 3C60D 4JUTA 4E2OA 1JV2B 4JPVH 4JPQA 1O0VA 3WKMH 4KUCF 3H9ZA 5C0ND 2D3VA 1CXHA 3AUVA 4JFXB 4G7SB 2LVCA 4J3OH 1GPOL 2NW3B 2HG5B 4J6RL 1ORSB 2JK5A 3PV6B 2EUWA 3N41B 2XJKA 1QUNA 3P73A 3TN0D 1OQXA 5KYUB 1X6NA 1B90A 3VD4A 4GAYA 3HKFA 3KG5A 2HJKA 3P4NA 1JZ6A 3FT2A 4JDVB 1GAFH 3GLDA 1UB6B 2X40A 4FHKA 4XN9A 4RVBA 2JIXB 5F96H 1HCFX 2J6EL 3P9MA 3V4PB 1CFVH 4QRTA 2CLZA 2J88H 2XLLA 2FTAA 1TO4A 3EH5B 2ISDA 3L3GB 4X0NA 3MCLL 1JK8A 3RWIA 5C3LD 3FSAA 4U3XA 3SKNB 3U2SB 3W0WE 1PD6A 4IMKA 3SD2A 1T1XA 1OGSA 1WS7A 3NOIA 4JRXB 4YHLH 3B2DC 1TJGL 5ICXA 2ZWZA 3GMRA 3PU7A 3ZRSA 3CSYB 4YSSA 2PKDA 2EDEA 3QO0A 1CC3A 2AFNA 2L4OA 2WAHA 5EN2A 5DYOB 3QZWG 3X14A 5CILH 1AHKA 1H6UA 2Y6SC 5IW6B 1NCAL 1Y0LB 3OXSB 4CC4C 1GMEA 5L2KE 1FFRA 2ZKHL 4BQBA 4BKSC 2QTEA 3H2PA 1SBSH 1INEL 3SOBH 3MUY1 4F91B 2FEDD 3A4AA 3BWUC 1X5AA 2M83A 4PJXA 2JK5B 1O6SA 2APSA 4K94H 5CEZD 2QMJA 1QUNB 3P73B 4UIKH 2NY6B 4N8VG 2CRZA 4GAYB 4YHKH 2HJKB 3P4NB 5HGAA 3FT2B 3WTTA 2YPVL 1RXLA 5EDSA 1SBBA 2WO2B 3JTBA 4RFNC 3JT0A 4BFEA 3WMQA 1N70A 3M07A 3P9MB 4AG4H 3HE6A 3PAYA 5E2VL 3KWUA 1UFUA 4QRTB 2CLZB 4UV7H 1QKZH 4WFGD 5KBPA 2WBJD 1JK8B 5E70A 2VABA 2FO4A 3RWIB 3TXAA 2Y07H 5C0CD 4MJIA 1XV8A 1FLTX 1T1XB 3CQQA 4JZOA 5EOQH 2D4DA 3HCVA 4ODSL 1AFVH 3IXAA 2AQSA 3OB0H 4HQQH 4XO9A 5ICXB 3GMRB 4EEEA 2UZYA 2VZTA 3WGUB 4WHYG 1JGVL 2TRHA 4HOMA 3QO0B 3LD8C 2R0ZH 1TQTA 3S8GB 1UENA 2MIZA 1MSPA 5EN2B 3NJHA 4FFZL 3UBXG 3H9HA 4M7LT 3X14B 3T8MA 1HYSC 2HYMA 4IM8A 2DQMA 2VH5L 5KVFL 1RUQL 2BSEA 5GRVL 3Q8EA 1QBLH 3PHQA 1SXBA 2GI0A 2PCPA 4P4KD 2VSKB 2DMGA 4TNGA 4XZ4A 1I53A 1CR9H 1B4LA 4U33A 4FQ2H 4G8GA 3IT8D 4XAWL 5DRWA 1EZLA 2HH0H 1RPUA 5E9NA 4PJXB 1IVTA 1Z5HA 2EC8A 1O6SB 4G43A 4KTEL 3CHRA 2JI1A 3UGEA 1N12A 5I1CL 1YEIH 4AITA 2PYFA 3HR5A 4OB5H 2VLKD 5HGAB 2XU9A 5EBGA 4RRPM 3VFTA 2AQPA 3UC0L 1JTOA 3SBPA 3SDXA 3RWFB 3HC3L 4PGDA 5AOMA 4LK4A 4QHKI 3R8QA 3CZJA 3FB8A 1DJIA 1JNLH 5JOPE 3HE6B 3MRIA 4XP4L 5HJ3A 4FI8A 5C7XL 4F58H 4N3TA 4UNIA 4DVBA 2VABB 2FO4B 5DS2A 1DQJA 2VRAA 4MA3A 3MV8D 2XG4A 4MJIB 4R5XA 1FL6A 1MRFH 1NIFA 2LOEA 4B27A 1IGFL 2DD8L 3QR0A 4I0PA 1BMGA 1QI3A 1ZPUA 4JZOB 3QRFM 3HCVB 5JXEC 3IXAB 1YNTA 2NY2D 3LS5H 4N0RA 2UZYB 4KJYA 1IFGA 2D7PA 4GRWB 3N42F 5D96B 4KWUA 4ANUA 5B3JF 4FNSA 4FCHA 1S9YA 1X6LA 2Z6FA 3D3VA 4WSKA 3H9HB 2V0AA 4JCMA 3IDJA 1SM3H 3OV6A 3RIKA 5LBGA 3UJIH 5KW9H 5HDQL 1HXKA 1DCEA 5A40E 4A55A 1BM7A 2DQUL 3PHQB 1FFQA 5I0ZA 1E4XL 1O7DC 3FSZA 3U6RA 3BT0A 4W9DC 2WTPA 2PCPB 4HH8A 4WUUD 5IVOA 4PY7A 4OFVA 4ZMQA 2LLGA 1KXVA 5EFIA 1GGCL 1JYWA 1BLIA 4XPFL 5J3HC 4ZTOL 4IBZA 4G8GB 5DRWB 4EZMA 2AITA 4YXKL 4FKHA 1NMBH 3MZGB 4G43B 1EZUA 5KSAC 5D7JA 4P48A 2AJSL 2TSAA 4F2EA 3B9KA 4G8IA 3WFDL 2PYFB 1MHEA 3HR5B 3KVDD 3N55A 4GIOA 1Q8MA 4DERA 4BSJA 3OMAB 1WE5A 1QSFD 4XOEA 3VFTB 3VSUA 4UINL 3VX1A 3MQIA 4OCRH 3ULUC 3SDXB 4K9EH 3H9YA 4PGDB 3U30B 2JQMA 3SDCC 3FB8B 5K39A 5DQJA 3INUH 32C2B 5HJ3B 4EAEA 1OSPH 4JRFA 4NQTA 1EZVX 1BVNP 4C54A 1KBVA 3ETBJ 3HZVA 5AVWB 4Z7AA 3DUHA 3P3YA 1HHHA 4DVBB 4YFDB 1MI5D 4M6MH 1DQJB 1GHFL 4MA3B 3O6FA 2XG4B 4R8WH 5IJKA 1FL6B 2KZKA 5E1GA 1NBYA 3ELQA 1KBWA 1ACYL 4I0PB 4NZRL 5IFHH 1YNTB 5KSUA 5IK3A 3A6CH 4KJYB 3PWNA 1UA7A 2W80C 2C5DC 5I23A 1JNHA 1RIVH 1S9YB 1KTLA 1UXMA 2EDLA 3D3VB 3QXWA 2QFRA 3MNMA 5GGVY 2Y5TA 1YJDC 3IDJB 1CE1L 1JXJA 2P48B 3CZKA 4HV8A 4LT7A 3QDAA 1QNZH 5BVPH 4TPRH 2QKSA 4WEUD 4HJIA 4MS8D 2WVUA 3U6RB 4KZEL 4WWKA 1A1OA 3DXAD 4N24A 1V3KA 4GO9A 1UJ3A 3VXRD 1JGIA 4HMCA 2IOOA 4GQRA 4JBSA 4PY7B 4AMXA 3KPOA 3DMMD 1WS8A 2B0SL 5EFIB 3IAGC 2CBMA 1DBBH 1TEFA 2QVKA 4JO3H 2DAVA 3FL7A 3ZXAC 4FP8L 5GHWH 4R2GD 5D7JB 4L4TD 3F6JA 2MKLC 3B9KB 4I18A 4G8IB 1YMME 1MHEB 4QYAA 1X5XA 5I75C 3UFIA 3X1FA 1AVAA 1L5GA 4AIEA 2FWOA 1WAPA 2MPAH 2EIKB 5LAPA 4D8OA 2ZOTA 1K5NA 1TQBC 4K3JL 4PJ7E 1J9RA 3RY4A 4DEPC 5K39B 1KGCE 4GP8B 5DQJB 4HIIA 4EMZA 4YAQA 1ZHKA 2L7EA 3AT8A 3DJTA 4Q9CA 4FX5A 5HGGS 3HZVB 3TGXA 1HHHB 3O6FB 1NBYB 1KN2H 1I3UA 2OMYA 1H3GA 1N64L 3ZL4H 1H0DA 1PZBA 5KSUB 5CKGA 3RG1C 3GLZA 5IK3B 4L0YA 4GAJH 1PG7L 3ZYOA 2EH7L 2AQ2A 3PWNB 4YVUA 5C09A 4WTZA 3UJJH 1JNHB 3VXTB 5FW6A 1KTLB 4LIQE 3N0AA 3QIUC 4Y1TA 2Y5TB 1UOLA 3S35X 4NO0D 2PN5A 1ERNA 2A0LC 4HV8B 3TU6A 2NY4C 5GGQL 4MCZA 5GGTH 1ND0A 4MHHI 1TJHL 3RVXC 3V0FA 1PJWA 1A1OB 4WWKB 1T7YA 5D72H 1UJ3B 1ETJA 2SEBA 1U3HD 4OD3H 2CRIA 5EULV 3KPOB 1I1CA 3RFRA 1OD7A 4WV1C 4K5OA 5FYLH 4QHUA 3AB0B 3VGDA 1S4IA 2IDSA 5ABDE 1Q1JH 1FGNL 2W81C 3GRBA 4LCUA 5B1JA 5I8KL 3BQUD 1KLUA 4H13C 5GZOD 2ITCA 4I18B 1BZ7B 4WWPA 1L5GB 2FWOB 2BDNH 4NNPL 4Z7WB 2VR3A 1ZLSL 3G5ZA 2EO7A 1K5NB 2C4FU 4HIIB 5IWLC 1XWVA 1ZHKB 4YAQB 1CK0L 1D7BA 1U30A 4ERSH 3U9WA 4CRPA 3RX8A 5KZCD 4MCMA 4F9PA 2J1WA 5J9PA 5AOZA 1KCSL 1QHPA 2I69A 4XO3A 3IS0X 1E65A 1E5BA 4JEGB 4TQIA 2OMYB 3ZX1A 2XIIA 1H0DB 3JWNE 5E0QA 4MQ7A 5C0AD 5C09B 4XP9H 1JD9A 3HB3C 5HVWA 4NKIH 2C9UA 2NY1D 4RGMC 2NY3B 4MDJA 4X6CA 3B2PA 4K71B 4XCCH 3QG7H 3CFNA 4MCZB 1ND0B 1YC8A 5IIEA 1KCVH 3DHJA 3VU1A 3EZJB 2SEBB 1F90L 3I9GH 1HE8A 3VH8A 3OLGA 3WEBA 5CEYA 1FVEA 1EJ6A 3QCVL 4MMZA 1OPGL 4QHUB 1SXZA 4X80H 1OCOB 2BIPA 1EO8H 3K4AA 3N1MC 2VMCA 4LCUB 2DQIH 1P6AB 5J5EA 4UOW1 5DJ8A 1AO7A 3KS0H 1QSEE 3S35L 4WGVB 3U9PL 2Q2EB 1KLUB 3CLFH 2D7TH 2ITCB 4IBLT 3Q48A 2R69L 1CIDA 3GI8L 4OGAC 2O4EA 2A2QT 3KS0J 3MAWA 4EI5C 3W56A 2WXJA 3K4DA 3G5ZB 2NX5D 4KXCA 2OP4L 1AQ8A 1G7MA 4F7KA 2XJLA 3K2IA 1OCRB 4ODVL 1BM3H 4M03A 4N2EA 4AK1A 4XMTA 2J2ZA 4M5ZL 4M6NH 5BV7B 5J9PB 3IPFA 5E9DA 2WXOA 1UWXH 3WENA 3V4UL 2E9WA 1G6VK 1RJZA 2V5SA 4YHOL 6FABH 4P2OD 4U2YA 5LXGH 1KTJA 4HSCX 5DR5L 3WJMA 4MQ7B 2OQJA 3D30A 3HG1A 4JG1L 1TEGA 5AW7B 3RDTD 2DWEA 3BAYA 3CFIC 4MDJB 4X6CB 2BXYA 4DGYL 5I6XC 5E5RB 5FO2A 3TVMD 4W9LC 1DQIA 2R0WL 1RVFH 4NAMA 1JD7A 3CE1A 1T2QL 1COBA 2VLRD 5IIEB 1WAAF 2CE6A 5I66B 4HG4K 4DHLA 2FO8A 3WEOA 4KVNL 2E7CA 3VH8B 2NY0B 2FT6A 2QPSA 1FVEB 3CFTA 3QVAA 2X89D 4KKCD 4ODHH 2Y36L 5CEYB 3J7HA 4MAYD 4MMZB 1ZVNA 2YGQA 5BJTA 4UV4L 4Y2DD 3IGUA 2Y06L 5DJ8B 1AO7B 3CMGA 2DQCL 4ZAKC 1T83C 4XH2A 3FTSA 5G4MA 1A7PH 4LHUA 2P9RA 4LBAA 3QAZB 1GW6A 1YECL 3UJTL 4UAOC 5EUOE 3EH4B 4A37A 2R2BA 3QC5X 3PHSA 2E7LC 3JV4A 1DQDL 3F58H 3QQ4A 4MRCA 1OP3K 5DHMC 1G7MB 4PCKA 4YGVA 2MKWA 4PJ5A 2X87A 5ICYA 1ZAGA 4GO6B 2A9MH 2J2ZB 4LQFH 1OLLA 4K3HA 3RVUD 4U1GC 1GYVA 4AC4A 5E9DB 4D3CH 3E7JA 4LGRB 2AJUL 4K7PL 3FSOA 1SMDA 4J28A 1RJZB 1QX1A 1P5UC 4GLRH 1NCOA 1TFHA 1YY8A 1SGKA 2F53E 1HVXA 3P30L 5DJZA 4ADGA 2LU7A 4X5WA 4KK5D 4Y1AA 5TK2A 4JFHE 4R6UA 3WJMB 2XI9A 2OQJB 2ORBH 3HG1B 2WLKA 4I5BA 2DWEB 4XZUA 3WMPA 4ONOA 3SODB 3O8XD 2GY7B 5BS0A 4OJFL 1XMEB 3OKKA 2FECI 3OHMB 3V4PH 1KFGA 3S5ZA 2F7QA 1CGSH 2R59A 3OJMB 4RSYA 1HL5A 2JKWA 1CLYH 3O3AA 3MOAL 3F62A 2CO7A 5D2LF 5I1GL 2Z8SA 1ILUA 1G94A 2CO2A 4RGOH 1TVDA 4I3SH 2CM5A 2ZOUA 1MJ8L 5BJTB 1OB1A 1OSEA 1QTYT 2OZNA 3BPLB 2F74A 2Q0ZX 5IMKA 1CE6A 2OR8A 1V7ML 4KHXH 3SKJL 4WI9A 4PS7A 4FHJA 4XH2B 2GK0A 5T33H 5I5IA 3CHPA 3NIGB 1DBJH 3L17A 2EIDA 2R2BB 3ZHKA 1AG0A 4M8VA 3JV4B 4DKEH 3VW3H 3QQ4B 5I6NA 1JUFA 9PCYA 4YGVB 2B8OT 2I85A 4PJ5B 3OM3B 2DQTH 3GJFK 8CGTA 1MFNA 1SXAA 5ICYB 1NKOA 3O11A 1IRAY 5EG6C 1F1GA 1GIGL 4AZUA 4QNPF 3OKDA 3N1GC 4A7VA 4NYLA 1YY8B 5DJZB 4BCZA 1Q90A 1WGOA 2KBGA 2YZ1A 4JFDE 4OCMC 4X5WB 4Y1AB 2NDFA 3LN5B 1XGYH 4KY1L 2NR6D 4PIBA 5F6IC 2WLMA 1T0NA 3VD2A 4NXKA 1K4DA 2PO6D 4I5BB 1OTUC 2EKJA 3NEEA 4M1CC 4ETYA 2F58H 4J3XA 2IQ9L 3L5IA 3CFEA 4WW2B 1LGVA 1CTMA 3MI6A 3OKKB 4KOCA 3V6BR 3C09B 3BN9C 4KK6D 5BS0B 2NXYB 4GUPA 4EIZC 2V3EA 3G7TA 3OKEA 2B77A 4PLKC 4UQ3A 1E30A 3MJ6A 4KNQA 5CSGA 4P49A 1G1CA 1ZTMA 2RD0A 1RULH 3EFDL 4BELD 5MEND 4HUVA 5FYJE 2CO7B 1D9KA 1BGXH 3MRPA 5DEFA 5AG8A 4YQXL 1IC1A 2XWRA 3AACA 4LSRL 1AXSA 1BQLH 1MWOA 1LWHA 1OB1B 3GSQA 4JHUA 2F74B 5IMKB 1BQHA 1CE6B 3SQOH 3U1SH 3KXFE 1EPFA 2GK0B 3DIDA 2JKNA 4JQIL 4LLAA 3AXIA 3NK3A 5FFGA 3RPBA 2HLFC 2IPKA 4W9ZA 1JUFB 1S78C 1IARB 1YEWA 3FTXA 4J8QA 4DN3L 4Z7OB 4XB8A 5EO1A 1RZ7L 2DQEL 4CAGA 1OZTG 5D8JH 2QV2A 4BH7A 1E5CA 2CIIA 2VERA 1CF1A 3O11B 3BZ5A 3X1GA 3TFKD 2Z8WC 5L4MA 5J12B 2XV2A 2VLJD 2JCCF 1JRHL 3T0DA 3OKDB 1PQZA 4N68A 3QFJD 4NYLB 1ZLWK 5F9JA 3RVTD 4C4BA 2Y5QA 2E8ZA 4F57H 4RIRA 2ZT9C 2WYHA 43CAA 4TKWA 3P9WB 4A66A 2JFCA 3GFUA 3BZ4A 3CVDA 3GJEA 3D1MC 1KCRL 3RWDA 2FX8H 1RP9A 3HE7A 1T0NB 4U3CA 4UZSA 5CS7A 2O61B 1K4DB 4W4OA 2YQGA 4YC2B 1WWAX 3CU1A 3CN1A 4ZUSA 3BP7A 2P26A 1UWGH 3B2VH 3LV3A 1BZEA 3CFEB 1JHLH 5C0RL 2WNXA 2XG5A 4GUPB 4IGBC 4ONHA 1BVLA 3OKEB 3LS4L 1JPTH 3EOBA 3EYQD 4UQ3B 4TNEA 4JCLA 3SYOA 1EK3A 2UXFA 3PHAA 5FYJU 3JWOC 4F7TA 4DPRA 2HPTA 5CFAA 4HUVB 4HIPA 3MBXL 1D9KB 4KNSA 5DEFB 3MRPB 2O5YL 1MOEA 4XMWA 4N2KA 3STZA 5IBTH 4HS3A 1AXSB 4L4VD 3GSQB 4PJCE 3JBG7 4F37K 1QBAA 2GFBA 4NKOA 3WD5L 1BQHB 5DU7A 4BFKA 1JAEA 1UOKA 4FYQA 2X70A 5E1IA 4CMHB 4YSRA 3LZOA 1RUML 4FADA 4N9OB 4HEPG 3LY6A 2CG9X 2YA0A 3WELA 1RPKA 2IPKB 1ZA6A 4B96A 4F15B 4A1RA 3C8HA 2UXGA 1NCWL 1T5XA 4NP9A 4ODTH 1NCDH 5AVTB 4XCEA 4BFBD 5AG9A 1F3JA 4DVRL 4BH7B 3PP4L 2CIIB 4BZ2L 3FSWA 2XWTA 2F68X 3GHPA 4PJBA 1J8SA 5CZVH 5CEZL 5IJDC 1ZDQA 3TA4D 2H1LM 1PQZB 3GBEA 5F9JB 2MPVA 2WWMC 4I0KA 2E7MA 3CHQA 4FG6C 4LLMA 4RIRB 4NQDD 4AYFB 43CAB 3TEYA 3EXJA 3DX0A 4V2BA 1KXQA 3BZ4B 1OV8A 3GJEB 3RWDB 1YYML 3HE7B 2HMIC 3QUXC 4MJ5A 5IBUB 3ZKXC 1GGIL 4JDTL 1FH5L 4ZUSB 3ZL2A 3BP7B 3LQMA 1XTLA 3VAEA 3LV3B 1NGQL 3HHRB 5IHUL 1N4XL 3FOLA 3ISWA 4K73A 4KTDH 1BAGA 2XG5B 3SGDH 4ONHB 4IK6A 5DLLA 1BVLB 1BWWA 3QZNA 4MASA 3EOBB 3FT9A 4FDWA 4O9HH 1OF0A 1INDH 5FCSH 5ID1A 1YZZA 4PFEA 4F7TB 4MXQC 1PFCA 1E6JL 2ZCHL 3STZB 1IX2A 2I9TA 4HS3B 2D3NA 25C8H 2D9CA 2O6FA 4U2ZA 2GFBB 1QRND 1TTRA 4NKOB 5F89A 4BZYA 2H0EA 2QQNH 1N8ZB 1DBMH 2A99A 2JJWA 5E24E 1IC7L 1NFDE 1NM9A 1E2WA 2O93L 2X70B 4HJEA 3SQBA 5L6YL 2K45A 1NLDH 1NCJA 5LG1A 1XF2A 3EYSH 5BZXA 1ZA6B 4GXFA 1CL7L 1JG9A 1DJSA 1DVYA 1D6EA 1T5XB 4L05A 3D9AH 1UA6H 4XCEB 2F5BH 1F3JB 2G75A 2IFGA 4PJBB 2XWTB 3LH8A 3IJ7A 4POZC 3TT3L 5LCVA 4ZOCA 1CPUA 2O5XH 2IGTA 1G4RA 2OS7A 1IKNA 2W9EH 3GZOA 4HKXA 4JG5A 4EKJA 3MRLA 1QO3A 2HT2C 1NGPL 1R19A 4LLMB 4K3GA 2CH8A 5DJ2A 1ADWA 3LZFL 3OR7A 2RGSA 3BZDA 4YHZH 4MJ5B 4NBYB 2DLEA 4QGTA 3ZQ9A 4BGLA 1WA0X 2F61A 4ZS6D 1HCZA 1IM3D 4AE1A 2GTQA 2JJTA 3BLKA 3FOLB 4PIRF 5AUMA 4MJIE 4I9XA 5IOKA 1QLEB 2MFNA 1LWJA 1P7QA 5EN3A 3D05A 1B9ZA 5ID1B 4U1HA 1XZ0A 3GI9H 2F18A 5AOIA 5IFJA 3MFGB 4XPHL 4JFFA 4TM9A 4LVHB 2XQBL 4M7JH 2D9QB 3BKJL 1TZIA 3QCTH 3P4LA 2DYSB 2FGZA 3QORA 4PJHF 2I9TB 4KKQA 1P4IL 2F0CA 1MREL 1XFPA 1F42A 4WIQA 1EBPA 5F89B 1V10A 5B7MA 1L4IA 4TOYL 2WQVA 3BAXA 2V5MA 4F27A 4G11A 5LNDA 4PW4A 4WQOA 3SQBB 4WFHE 2P5WD 1N0XH 2X0VA 3NH7H 3TT1L 1XF2B 3RFZA 5SV4A 4LSUH 2N0MA 2VO5A 1D6EB 2DQGH 1N2RA 3NIDE 1U9KA 3IN2A 3MV7A 5DZAA 1MFDL 3S8FB 2HFTA 2G75B 3X3FL 1Q9WA 4AEHH 4MZ3A 4GRLC 2VUOA 1LQBC 3ABMB 4EIBA 4HXBL 1JI1A 5KUKA 4BFIA 3O2DA 4PJ6A 4HKXB 3DO3A 3MRLB 4IS6A 1QO3B 4RRPA 3Q5TA 3RUGF 5BOJA 3SDXE 3PAZA 1AIFA 3OR7B 4J7RA 4PJIA 4XNZB 4Z7NE 3P3UA 1E0OB 3VD5A 4HWUA 3BKCL 4PB0H 4WDIA 3WIAA 3HNVH 4KRPB 4LPTA 1S9KC 1X5KA 4KUZH 4KDWA 4OZIE 4N2FA 2W0KA 5AUMB 3UAJD 2VDRB 1UCBL 4AYEC 1SXSA 3B9DA 3CUPB 4JGUA 1P7QB 4KXZI 5IROD 15C8H 4N2IA 3RP1A 4A04A 1PZ5A 1AE6L 4U1HB 1XSOA 1XZ0B 3S9DB 4UM9D 1QZNA 5IFJB 2XQYG 3VGFA 4JFFB 1J5OH 4FFYA 2R0KH 1TZIB 1ZK9A 5CIPA 5ES4B 2BIHA 3QORB 2IPTL 4JPWL 2IANA 4MAZA 4TLSA 5FM4A 2DMKA 5DO2C 1T04B 1J1XH 2XDHA 3JXAA 4OCYH 4JKWA 5DUML 3QEGH 1NCGA 3BYTA 3GRWL 1LO0L 3Q6FA 2ZUXA 4WENB 5GJTH 1WIPA 2MCPL 4HF5L 3QZPA 4OR1A 2BLFA 4XVUD 5SWSE 4Y16A 1KCUL 3RFZB 4W9IC 2WBXA 2W0LA 3SJVA 1VLXA 1EAQA 1K8DA 5F7YC 1N2RB 4XN4A 3MV7B 4WJG3 1RUKH 4FQLH 1BG1A 2XWCA 1Q9WB 2C8NA 3D07A 4HSQA 1ZANL 4JJ5A 4PJGF 4BFIB 4U49A 2I27N 4GFXA 4PTTA 4O4YL 2OI9C 3BVDB 1GYWA 4IS6B 5F9OH 2VDNL 2ZUYA 2YWZA 2J1YA 3RIAF 2B7DT 2XPGA 3Q6GL 2J1KA 1AIFB 1FFTB 3DX3A 4DKDC 1TPXB 2GYSA 4OD1L 4PJIB 3VFGL 1B4JH 4WDIB 4CC1A 5I1KL 2WZAA 1MAMH 3UX9B 1N6UA 5E00A 4QWWC 3WLWC 5IOPA 1DL7L 3KDPB 5JOFA 3UZEA 2JI3A 5AYQA 2VZVA 5BV7H 3BI9X 5B8CA 2DKSA 1PZ5B 2XCMC 2AK1H 5AZEH 3KL5A 1C5BH 3EH3B 1CQKA 4L1HA 5CIPB 4G6MH 3FO0H 4JO4H 3X17A 3HNTH 3S3BB 5J1AA 1UT2A 3OGCA 2IANB 3FB5A 2ZXCA 3OF6D 4X6DF 5T3XD 2VDKL 4X7SH 1NOLA 1A4BA 1S7UA 1UURA 2IV9A 3CN0A 3ESNA 5BUPA 3FH7A 3Q6FB 3JWNC 3LRHA 1R24A 3WFZA 2P43B 3SKMA 4MA7L 1FNLA 3GHBH 1A6UL 1OT4A 3MLUH 1WZAA 3SJVB 4WO4D 1K8DB 2IGLA 3PG2A 3Q1SH 4RMRA 5IGXL 1SPDA 5C0FA 3D50A 1HNGA 1MG3C 4FG2A 4J2QA 3X3GH 2XZQH 5JPMC 3AG4B 3IFLL 4JJ5B 5JOEA 4X4KA 1UADC 3GSUA 5IHLB 2QGCA 2DBLH 3QDMD 2P5PA 5DD5L 3SDAC 1SY6L 3T0WA 3ARDA 5EBWA 3MJWA 3U82B 4Z7WE 1EH9A 3FCBA 3CN4A 2XPGB 2O6EA 1JP5A 2FUTA 2WV3A 5B1CA 1ZLVH 2OYPA 4HULB 1GTNA 1CICD 5A2JH 4HK0A 4UQ2A 4N26A 4GS7B 4ZO9A 3BRGC 3CXDL 5F9WB 4BH8A 1A3LL 3MRMA 3N50A 1Y6KR 5E00B 5IOPB 5I5RA 2G5RA 2PXYA 3ECQA 4HCFA 5JOFB 1SJEA 1ID2A 4YK4C 5J57B 3GTTA 2X2HA 2AQ3A 1RL1A 5B8CB 1DQVA 2FUQA 3VXMD 3O81A 2AEPL 1VGKA 4RCAA 5BUAA 4XC3H 2Y7OA 4LCIL 4DP0X 2QVTA 1UZ6E 5J1AB 2ADIA 3OGCB 4XB3A 4YDJA 3FB5B 4GPVA 4HAGA 1A7QL 1L7TL 1HX0A 3U2IA 1OQOA 2WLLA 1DJHA 1S7UB 1T4KA 4XP6L 3QZBA 2VDQL 2C4FT 3J27A 1R24B 1GGTA 4M56A 4QYOA 1DFBH 1WAAA 5B1KA 3SKMB 5HI3C 1P69B 1D5MA 1CUOA 5I30H 4MLSA 3CFDA 4TVUA 1G5GA 4U7SA 4JNXA 2VXVL 5I1LA 1J8HA 2V7NA 4W9KC 4Q9QH 3FPYA 2Q8AL 1SOSA 4QXGH 1KY7A 5CINH 1R0AL 4B9IA 2QVMA 2EO9A 3GSUB 4NZUL 1WFTA 2FK9A 2FBJL 2VKWA 1MAJA 1MWAL 3M6DA 2ZWYA 1M3IA 2YEQA 1UFGA 3ARDB 5GRJL 5EBWB 3L13A 1QRKA 2FJGA 2OW6A 1OARL 4W6YB 1J0HA 4HK0B 4UQ2B 2ZP9A 1WCQA 5GQBA 4S1DD 4I87A 4MMXA 4KX7A 4BH8B 5I1EH 1T03L 1N7MH 3ZK0A 2QPDB 3KGRA 3QAQA 2PXYB 3BGFC 1SJEB 2DYPD 3MCKA 3FU9A 3MKKA 1OP9A 5D7LA 3EJZD 2C7FA 4YSAA 3ULVH 5AFAA 3OQRA 1VGKB 1NOFA 2ATKA 3QK0A 2AQNA 2GB2A 1F58L 5E03A 2R0LL 3UTTE 3WNNA 4ELMF 3P3RA 2UWEA 5K33A 4ALAL 1HQRA 2ADIB 3AABA 3VCLA 4YDJB 2WSDA 3M46A 3RA7H 1E9QA 4XPBH 3CZEA 2WLLB 2V37A 4MZRA 4AVHA 1ZLEA 2ZG3A 5E08H 2DTMH 2UV3A 1T4KB 2XA3A 3LHPH 2B1AH 1RY7B 1CU4L 2BS9A 3B34A 3GXDA 3O3BA 3Q7JA 4HA1A 4IRZA 2HCZX 4QYOB 4OFQA 2KQNA 3NCMA 4PWIA 5EO0A 1D5MB 4JVWA 3LMJH 2IO5A 1OAQL 3AG3B 2XN1A 3CFDB 1RZKL 4O58L 3OLEA 1YEDA 5E0FA 2DQHH 2YD5A 4BRVA 1WA2X 3LEVL 3B9AA 5I1LB 5CLXA 1MCSA 1CLVA 1J8HB 2ZUWA 4K8RD 4KKZA 3IAPA 4G80A 1J87A 1I8AA 4W1TA 4YNYA 4EJ1C 1J9TA 5B7FA 1KB9J 35C8L 5D6DC 2LFEA 3TBYA 1SOXA 3OZKA 4MNGE 1KPRA 4B7IA 1AR1C 2OL3L 2PPCA 4LOUD 1KJ2A 2FJGB 3GK8H 4TL4A 1XH2A 4W9CC 3II1A 1L9PA 1QPPA 2BVQB 4B6ZA 4EOWH 4HPOH 4WGWB 5JMRA 4JFPA 4JY4A 2ICEA 4MMXB 5JZ7C 3K0YA 3OMNB 4JFWA 1OGAA 4YSUA 3ECUA 1MCQA 3K80A 2ZOOA 2BP5M 4LP8A 2DPKA 2XKUA 4G8AC 3CVIL 4MVBC 3MCKB 4ZYKA 5C3TA 1EZSA 4Y7MA 3GZKA 3N06B 4WTXA 2ATKB 2VWEE 2UWEB 2VXSH 1HQRB 2P80D 5DEGA 1KWKA 1CXFA 3HUJA 5BRZA 2BNQA 3TYGL 1E9QB 1IGCL 1IAOA 1WZMA 2EDNA 2AGJL 1FGVL 2AEQH 2AJVH 3LVEA 3OJDA 1TXKA 4NUQA 2O26U 3O3BB 4Y19A 4OI7A 1V27A 2CBOA 2GITA 1M42A 5EO0B 2FEEI 1MAKA 2JKLA 1G1OA 1WRFA 2HUHA 3B43A 3ARFA 1SN5A 1YEDB 5I71B 3QUZA 2YPVA 2WLJA 2EYTA 2HFGH 1G1KA 4ONGH 3BN3B 5JHMA 5KTEL 4JKLA 4G80B 2OJZH 4YNYB 3JWDL 4K7FA 4ZSOE 5F70A 5GS2H 5FUZL 3K81A 5HHVH 3MLSL 3TBYB 3JVGA 3V7AG 2VMFA 5I74B 3ZDZB 4O02A 3D8MA 2PW1A 1KPRB 5HJGA 1X4YA 3BMVA 1L0XA 1KJ2B 2Y6SD 3VXNA 5J7CC 4GH7B 1ZPLA 2HB0A 3UTSA 1RU9H 3CBRA 1JZ3A 1OP5H 2FDBP 4NPKA 4PJ5E 4JFPB 4G9FA 4JY5L 4JY4B 2ICEB 3CMOL 5C0BA 3WXVL 4APQC 3VXSA 1AZZC 3THML 3F65A 1OGAB 2VB5A 3FO9A 2VQUA 4ZYKB 5LGHL 2JCCA 3T2NH 1PLCA 2X4SA 3EJTA 1P7HL 3CK0L 4GMTH 4CVZA 1G84A 4Y1AE 1T1ZA 3FZUC 3U6XS 1PSKH 1U6AL 3ECWA 1TETH 2H32A 3KW8A 1VFMA 3Q2CA 3RTQA 4M3HA 2O1AA 3NTCL 4NQXA 3TIEA 3ATAA 2X12A 3HUJB 5BRZB 2BNQB 1BXVA 1IAOB 4DH2A 1F2XK 3V8OA 3DURA 5BS0E 3G6JE 3OJDB 2JV6A 4Y19B 1UGKA 1K85A 1L9QA 1RUPL 4I77L 4BKLA 2AABH 2GITB 2HPOA 1YN6A 3O6LL 5AVZB 5GRWA 4YSEA 4N3UA 1QVOA 5DZOA 3K2UH 2ZYRA 3WY1A 4E41A 5I0XA 2JKJA 2XRAL 2GJJA 2XETA 3ARFB 3QR1A 4ZS7H 4Z0BL 3QUZB 4LVOC 3ARVA 4PWEA 3UO1L 1MCWW 2EYTB 2HWZL 1KCKA 1IAMA 4AY0A 4CNIA 3MJ7A 3D48R 3MRDA 3E8UH 4JDZA 2J4WH 4K7FB 1NSNH 5SX5H 5GS3A 1LILA 1TZHA 1K8IA 1M7XA 4O02B 2PW1B 4KBPA 1HYSD 3F00A 8FABA 2IAMA 4HFUH 3EJCA 4TSBL 5HVFB 3VXNB 2BFVH 3FXIC 4H88H 1EFXA 4XHJD 3V9CA 3T2LA 3B3IA 2I60H 3UTSB 3X11A 1FDLH 1B3IA 4G9FB 4D2NA 1UVQA 4CBZA 4LEXH 5C0BB 3VXSB 2FIKA 4KJWC 3FO9B 1IIKA 3SDYH 2WYZA 2CMRH 2RFXA 1RIHH 2JCCB 4EXPX 2X4SB 1KCBA 2DKUA 4WHDA 4CVZB 1T1ZB 4OLZH 3NACL 2H32B 3RTQB 1G0YR 1KC5L 4Q0XL 4YPGA 4NQXB 4FTVE 4DAGL 3TIEB 2UXVA 3VNZA 5JHDA 1XVSA 4JB9L 3GHEH 4JL2A 2WGNB 4YO0A 2K70A 5EH1A 5CD5C 3DURB 3MFFA 3K6OA 3WUZA 2ZZUT 3AUWB 2EDJA 2Z3FA 1URIA 4KDVA 5CR8A 3TCTA 2EP6A 4BKLB 2OX5A 1E5ZA 1YN6B 1WG3A 2R2CA 4WFFD 5LBSA 1QVOB 3HS9A 4LP5A 5AB1A 5GGRA 4E41B 1O5DT 2CWRA 3I50H 3BOVA 4GIPD 3SKOA 5I0VA 3WFCH 5DJCA 4GLRI 4P9HL 1QEWB 3ZPDA 3QHZL 2ERJB 5JXED 1SLXA 4NZTH 3EZ8A 3MJ7B 2BSCA 3MRDB 1DUYA 4JDZB 1D7CA 4XO5A 5T1MA 3UTPE 4H4NA 1OAZH 5JR1L 5B39A 3HRPA 4M3KB 3ZBMA 1TZHB 1K8IB 2WZ5A 3LXAA 2VJ8A 2DL9A 8FABB 2IAMB 1OHZA 1H6EA 1GCYA 4OFDA 5G5DA 1EQWA 2AK4E 4XC1H 1SHSA 2B1HL 1EFXB 1OAUH 4JRLA 4Y0GA 3B3IB 1KPVA 3X11B 3SDDA 5DLML 4NKDA 2DM3A 1UVQB 3I02A 2YFOA 2FIKB 1SFHA 1VEOA 4PTUA 4UT9H 1NAKH 4XCYA 5J3HD 3WDJA 5FUOL 4Z5RA 3H4HA 5DUBA 2RFXB 5LCVH 1A14H 4IKKA 1OAKL 5KSAD 2P42B 4R7DA 3UZQA 4DGIH 1VGEH 1A6VH 2ATPA 3A24A 3LIUA 1RFDL 5HYJD 3MA7A 4OGZA 1IGMH 2WXGA 1YYLH 4YPGB 5K93A 4AMKL 5JHDB 5C0CE 3ULUD 2VLME 2BERA 3FTWA 2ZXGA 4DGVH 4YO0B 2EILB 5CAYB 4L3ED 3SDCD 3WJLA 1CFSA 3EAKA 2XKSA 3GMOB 1CGYA 1OW0C 2OX5B 5IV2A 2O72A 1U41A 2W91A 1E42A 2WP3O 5GGRB 2XVGA 1BZOA 3VB8A 3SKOB 3UDWA 4QEGA 1IEBA 1BJ1H 4W6XB 1DLHA 5DJCB 1BFOB 3AY4C 5D1ZA 3CFUA 4N5UA 4YXLH 5LWYL 2AI0H 3L4CA 4GEJA 5BXFA 3VM5A 1L7IH 1J5DA 5T1MB 1DUYB 4KRNA 4YSOA 1BJ1J 3L8QA 5E95B 5B39B 1FNAA 3I6SA 4XNUL 3GWJA 4PMFA 5EHFA 5D96C 5G5DB 3RL1A 3CLEL 4K5NA 1KPVB 3B6SA 3MXWH 3NCBB 5FHAL 5FV2A 3E2HB 3SDDB 1X5LA 4YJZL 4NKDB 5JNYA 4R7VA 2VLLA 3I02B 1X9UA 4QPEA 4PTUB 2A1WL 3C12A 1AQMA 2JB5L 4TVPH 4XCYB 1MCEA 1UUNA 4Z5RB 4UANA 1VENA 2VJ0A 5DUBB 1LEIA 4BXVA 5JHBA 2F5AL 1WDAA 1BVZA 4K3DL 4DN4L 4R7DB 3UZQB 1QFHA 3O2DH 2ATPB 5IZ7A 3TLRA 1KXQE 1MCCA 4LMQE 3MA7B 1T66C 4H44C 4P5RA 3QGVA 2Y5EA 3DETC 4FNQA 4OZFA 4AV5A 4PGEA 3SPIA 5E8PA 5FUCC 4PS4H 4EN2A 5IQ7H 1CB4A 3WHE1 2VAAA 4P5TA 1DBKH 1CFSB 3QRGL 1L0QA 2Z31A 2NNXA 2X1XR 4N87A 4NI3A 4W9FC 5EIQA 3U30C 2IDFA 1TITA 1MRDL 4NI6A 4XPTL 3IMSA 1Q94A 1P53A 4KQ4L 2V17H 3W38A 2ODIA 1IEBB 4Z3JA 1DLHB 2AJYL 2VSMB 2DQFA 5D1ZB 1H15A 5BXFB 5CIPH 5B3JE 4QXUH 1TZAA 2XA8H 3GQFA 4PWJA 1KJMA 4G8FA 4GSDH 1R3JA 2R2HA 2Q86A 3IKCA 1RUAH 1Q72L 3V0WL 2EAEA 3QIUD 2FX9H 2HKFH 2CA3A 3KM2A 2W07A 2WXHA 3DVIA 2A0LD 2M8XA 1VEPA 4KJPC 4NM4L 1XIWA 2EABA 4A6YL 3CX5J 3U6XA 2LU4A 2NY4D 3RL1B 5EDXA 3ZTEA 4OZGA 3B6SB 4H8VA 5JNYB 1Z5YD 3L1OL 1NIAA 3BDXA 3BEWB 1IGJA 2VLLB 3QQXA 5DO8A 3T8VA 4D9QD 5H4YA 1QSFE 3SCMC 1E67A 3G6DH 3MLYL 2IC2A 4E9WA 4X83A 1EWHA 1LEIB 2WXKA 4PJGA 5MEQA 5T3ZE 1UKSA 2FO1A 1F4YH 1TCRA 3GBDA 5MERA 4G82A 4MAUH 3WKNA 4R84A 4OZFB 4PGEB 4XPGL 2F8XC 5E8PB 5K9JH 3B9KC 4P0DA 2P52A 2VAAB 2PCFA 4P5TB 4HAKA 1CD9B 2GBAA 2KPNA 2X7LA 4H26A 4YDKL 5DC0A 1GXEA 5A6LA 2Z31B 4PRPE 4CGTA 2X9WA 2XTSA 2W88A 4ZW7A 4L5FL 3OZ9H 3VYPA 1Q94B 2R69A 3K8KA 2B15A 4N4YB 5T1LD 3T77A 3BAEH 5EBMA 2DQFB 1BIHA 1G9MH 1H15B 1P4LB 1LO3H 5EEVA 1KJMB 4G8FB 5JIMA 3HB3D 1R3JB 2R2HB 3CC5A 3LKOA 1ZV9A 3IKCB 2Q86B 5CLZA 4MB3A 1U4EA 2W07B 3SB3A 4P5SA 3OHXA 1XIWB 3MBEA 5D7IF 4BWUA 2VR4A 1G6RA 3AITA 3SGDI 4OZGB 4LKCA 3MV11 2WJ5A 1IGJB 2J5LC 1UM6L 4UI2A 1AZCA 3KPSD 3WS3A 1NJ9A 3GSNL 4IBVA 1ULVA 2Q7YA 3BC9A 3KL3A 1FAKT 4J3WA 4NKQB 1AXTH 5ANMA 2CBQA 5I8OH 3QFDA 4JM2A 1MXDA 4M6OH 4PJGB 1HWGB 1U0QA 5MEQB 1TFPA 3QJFA 2VR7A 4G72B 4FXLA 4KFZC 3WNMA 1TCRB 2BS71 1ZS2A 4XNQA 4D9LL 5MERB 1G7JA 5B38A 3BD4A 4OGAD 4PJIE 5IY5B 4EI5D 1Q9LA 2EDWA 1LO4L 3U7WH 3J07A 2PCFB 1QYGL 2X7LB 4H26B 3WMSA 4URKA 2BCMA 4HIEA 4U7KA 1I8UA 1SHWA 1EHLL 3KLAA 5H2BA 1W15A 3MGAA 1X5JA 1OCZB 2NTFA 5DZPA 1JVLA 3VWKA 1MIMH 1S8DB 5M7QA 2MH4A 3EJUA 3QS3A 2BC4A 3T77B 7TAAA 2F6AA 3BMWA 2ZXEB 5EBMB 1FUNA 2DM7A 3SZKC 3VXUA 5DHVA 3O2WH 4HWBL 4P2RD 5FGSA 1LD9A 1LEGB 4J27A 5T3XL 2UX6A 3CC5B 4XVJH 4ETQA 2XBDA 5D55A 5D1XA 2JNZA 4G6FD 3VU2A 1T21A 3BPNC 3AQXA 3FQNA 3DJRA 3OHXB 3ZQXA 1RZIA 5DD0L 5FW7A 1CD1A 1U8JA 3AWFA 3C5SA 3MBEB 5D7KD 4PI0A 5FPIA 1G6RB 3SJVE 1Y18A 5CR1A 2G30A 1SDAB 4OUOA 1XSKA 2YD1A 2W0PA 1A6PA 3ZU8A 5DT1L 3TPUA 3WS3B 1NJ9B 2Q7YB 5ANMB 1S7RA 1NMCC 3QFDB 4JM2B 3UMTA 5I1JL 3IEAA 1QABA 3QJFB 1T89C 4ZAKD 1KBGH 4XNQB 5IUCA 3QWRD 1QMUA 2C1OA 2G60H 4F9LA 1YAIA 4EZKA 1G7JB 3OKNA 5E5LA 5B38B 1URZA 1TVHA 1LDPH 1NC4D 2GSMB 1E4HA 1Q9LB 1VCBC 4UTAA 4NUGH 1SXNA 3WTYA 2LAAA 5EU6E 2DZEA 4JRYA 5D4QA 5E94A 3TA3A 4P59H 2X1QA 2DB8A 2LFGA 4HIEB 1ZA3A 4XN8A 1VB9A 3QDGD 3BAWA 3VYOA 3KLAB 5H2BB 4X9BA 4ZTEA 3ZDYB 1D5BA 2NTFB 5E1QA 3OWRA 4ZMXA 3VWKB 4TSAH 3LHAA 5JDJA 4J1UA 2GVYA 1BQSA 2BC4B 4WW1A 3D34A 3PXLA 3GSRA 3SGKC 2MNWA 3VXUB 5DHVB 1XSJA 1IQWL 2BSBA 3K74B 4ELMA 1BX2A 1LD9B 1WFMA 2RTTA 3R7QA 3WAKA 5EWIL 4MQXC 4ETQB 1UEMA 4EQ3A 5D1XB 3W2DH 3ISRA 2ADYA 3FCTA 1H5BC 5CO1A 1T21B 2VN3A 3FQNB 1RZIB 1CD1B 1U8JB 5DD3H 2VZ1A 3C5SB 3DKHA 3AQZA 2Q1EA 4DP9X 1MEXH 3AADB 1Y18B 1CG9A 4IRZH 1L3WA 4P3WA 1AJ7L 2KHAA 2OXGA 2NY7H 4LE8A 5KVDL 1R3HA 3TPUB 4OKDA 1X9RA 1JWMA 2PR4L 4JFEA 1S7RB 1KG0A 2A9NL 4LCYA 1YUHB 5F0MB 3WEXA 4HCIA 4LHJB 1BJMA 4FERA 2C1OB 3EOTL 3OKNB 2K7QA 4HWEL 3O6ML 1TVHB 1KJ2H 3KYNA 1YNKH 3KAAA 1J1PL 2Q8BL 4LNVA 1H8LA 3I9AA 1E4KA 4JRYB 1D5IH 3B5HA 3DHMA 4KVPA 5E94B 3TA3B 5AW0B 4CBPA 1GGYA 1IGIL 1ZA3B 1XZWA 3PPEA 4XX5A 4ONFL 4TRPH 4U31A 5DQDH 4LLUA 4WSGA 3D52A 4ANKA 1D5BB 1KB9K 4W9EC 5BOZG 4J1UB 2VMJA 4WW1B 1ZHLA 3GSRB 1JPSH 1UQSA 2N3JA 2WKOF 3HHMA 1NCAH 4HDIA 5SWZE 1BX2B 4ELMB 1MQ8A 4IOSD 3C2AL 4NS0A 1X3DA 3ETSA 3ZGHA 4UB0H 2ZOWA 3EJQA 5EF3A 1OTUD 3WV0A 1MN4A 3FCTB 3U4AA 4Q2ZA 2VWEC 4DGUA 1WAAE 1MFBL 1SMOA 2IBBA 3GNMH 3BN9D 5DSCA 1CG9B 4PLKD 1J48A 1O9VA 4XXWA 4HGKC 2ZTBA 3OJVC 5EIIA 5I0YA 4F8NA 1FQ9C 2OXGB 1LP9A 4OLWL 4PUBH 3BQVA 4Z6AT 1R3HB 2YPVH 4K8RL 3U9UA 3SYAA 3F84A 1JWMB 2IWGA 4TULH 4PG9A 2EE0A 4JFEB 3CSBA 1JZDC 2RR3A 2FX7L 5FWRA 1HH6A 1KG0B 4LCYB 1GSKA 1YPZF 5EZOL 1AC0A 5ERWA 3W0WD 3WEXB 3IB4A 4O02H 2M2DA 2B16A 2ZG1A 3CH1A 3DHPA 3LKSA 1PKOA 3BPLC 3KYNB 4QRPE 5EOCL 1O9WA 2ZWSA 5T5FL 1BHGA 1U93A 5DYFA 1HL8A 1S78D 1W72A 2NUTA 3SD5A 3HBGA 4ODSH 3SHSA 3VGEA 5PCYA 1JGVH 2E0PA 3APNA 2JQAA 4K23H 2LR4A 4LLUB 1E5UI 3L1FA 1R34A 3ARBC 3P54A 5TQ2H 3EBAA 1A1NA 4H20H 5L2KD 4HX1A 2YRLA 3RPKA 2DLFH 3K6DA 4Q14A 1ZHLB 1UQSB 4HDIB 1MW0A 2WQ8A 2H32H 2AKRA 1QUPA 5HGDA 4OM1H 1RIUH 3BP6A 5EV7A 1AZNA 1YN7A 2XN9E 3FQ4A 3MUZ1 4FA6A 3L1GA 4Q2ZB 3EJRA 3QARA 4Z3FA 5JQ6L 1NEZA 4IBYA 4IGBD 3T71A 1VCAA 5DSCB 2LTQB 3QJVB 1RH8A 4KJQC 4Z7VA 4PYGA 3GZQA 5D2LE 3B5TA 5EIIB 4WK2B 4WW2C 1W0WA 2J25A 5EF0A 4AGQA 4I3GA 1LP9B 3EDEA 3H9SD 4FLOA 1JCKA 2X6UA 3DI3B 4HETA 3U9UB 1SOKA 3ZDZE 4PG9B 5LB1A 5L8KB 3PJSA 1HH6B 2YUXA 4S1RL 2VRQA 5ERWB 3VI3F 1B6DA 4NJ9H 2WBJA 3ZDXF 3WO4C 3S37L 2OZ4L 3CH1B 2ZD0A 4RDBA 2GC4C 1MIEH 2H2PD 3LKSB 4ICXA 5CMAA 3NFSL 4HWNA 2VRKA 1IGFH 1U93B 3HJEA 2OK0L 1W72B 2FLRT 2NUTB 2UUDH 3DOIA 4X8CA 2NSQA 4J3OF 5E2WL 1F1AA 2W92A 4QNPE 2G2PA 4J23A 4BUHA 2D0GA 1WEJL 2P3YA 2YR3A 1A1NB 1ZRUA 1WWWX 4HX1B 5L9DL 2VZSA 1BD2E 2K4WA 1GZPA 2WWMD 2DQUH 5IVXF 4FG6D 1QPKA 2G0KA 4K0OA 2AKRB 2CO6A 3QR2A 4HS8L 4P4KA 2BNQE 5HGDB 1YAZA 1FO0H 3BP6B 4LLWA 3BH8A 5DHYA 1NFIA 3L54A 3QUXD 2YD8A 1YN7B 1TYRA 4ZW8A 4R7NA 1AGCA 4G7YL 4Y19E 1F5WA 2Z8VC 1DN0A 2FVNA 4U3HA 2CJUL 3HC4L 4DP6X 4ENZA 1KN4L 1DVFD 1NEZB 1AI1H 2YKKA 4XTRC 4Z7VB 1V55B 1UOWA 2XVLA 5HDBB 5LBSH 1BMZA 2VLKA 3NPZB 5F7KC 1W0WB 4D94A 5JOPD 1N6QH 4ZNEA 4R3SA 1T20A 4HXAL 4KZCA 4WKZA 3MRNA 4ANXA 3IFPA 3PJSB 4B97A 1Q9OA 4FFTA 1Z9OA 3R7RA 4E9YA 2WBJB 2DRUA 1EVUA 4ZW3A 4RQQA 5HDRA 3ZKSD 1LDSA 1MCPL 3MV8A 4M1GH 1EO5A 5CMAB 4Y9EA 3EFFA 2J5WA 4G9FE 3QFJE 1U2YA 2NY5H 1TTFA 2AJXL 4DQOH 3KPLA 3QXUA 4Y5VA 1FA4A 3VD7A 3QJUB 1TQWA 2FEDC 1QHOA 2B39A 4XE5B 1KB5L 1GJWA 4JVPA 2JCCE 4QAWA 4F15C 5T1DH 4POZD 3TFBA 2YWYA 3V10A 4YLQT 2CBTA 2IXQA 5HHME 2UX7A 4OCWH 4UMSA 1CLZL 1KEMH 2B3RA 5H94A 4BWWA 4OBSA 4ZFGH 5FECA 1GZPB 4B53A 2X1WL 2HT2D 5JHLL 3ZGIA 2CO6B 4LVNC 4BK5A 3MLRL 3IPEA 2EDXA 2IGFL 3LRKA 1Y1UA 3BH8B 4LLWB 4N20A 5DHYB 1NFIB 2ADGA 3L5XH 2WSPA 4R7NB 1AGCB 2WXLA 3ZTCC 2B0SH 1DN0B 2Z35A 4EIUA 3NSJA 3KBHE 4AQOA 4E5XA 4A7TA 3QCUH 5DC9B 4F80A 4FP8H 4W4OC 1NAML 1JF6A 1SDDA 2DLIA 2ZKYA 3RWEA 5HDOA 3TOPA 1BVOA 4RWYL 1UACL 2EC9U 5DGQA 4G83A 2VLKB 2RCSH 3VMNA 1H9VA 3SE8H 5KVMC 3D2UD 3D7PA 1LYQA 1IQDA 5CCGE 4R3SB 1T20B 1S3KH 3AU1A 4WKZB 1G43A 3MRNB 3D08A 3IFPB 5B21A 4BINA 2ZCKH 4K3JH 5C08D 3QPXL 3VTTA 1ASPA 1Q9OB 4ZX3A 4AYID 4LDLB 1MI5A 4RQQB 3ALPA 4EDXA 3MV8B 3C5ZD 3MREA 3EFFB 2XZAH 4LPYA 2VJXA 4C56E 3KPLB 2NY2B 4Y5VB 2IFFH 5DMYA 4BA0A 1PZAA 1BQ5A 1ZXQA 1MCIA 5TJWK 4E9QA 5EIVA 1W0VA 2EH7H 3FOMA 4GRLD 5BCAA 5DURD 3K72A 1GJIA 1KYUA 2QPUA 1WUZA 4P2QA 2LU5A 4AEIH 3GRWA 2BXZA 2IXQB 5ADPL 5MHSE 5FECB 3CDZA 5H94B 5JHDE 1M57B 1RI8A 5GGQH 1IL1A 4Q9BA 3GDCA 3DMMA 1DZ0A 2ADGB 4J3OG 3SE3A 4PJ7F 3MXVH 3RX5A 3LKNB 2Z35B 1YMMD 4E5XB 4E0RA 2YIHA 1ORQA 1QRNE 3ABGA 1SDDB 1PLGH 4IKLA 3RWEB 1JGUH 1MFEL 3AT0A 4YFLI 5KJ7E 1R6VA 4KAQH 3KWTA 3ARGD 3MOQA 3N44F 1QSVA 3VGAB 1KGCD 4X5LA 1IQDB 5AW8B 3FO2A 4LPUA 4I85A 4XP5L 2Z7YA 1MFCL 3AU1B 2QMKA 3LPGA 3VM7A 5E7BA 3GO1L 2ED9A 2DQ6A 3AY2A 3FC8A 4PB9H 3AM8C 3TPKA 4M7ZB 3ZOAA 1U58A 1YJDL 5DO2D 1F45A 3BRFA 4HPHA 1MI5B 3NDYE 5D5MA 1XGUA 2Z1PA 4BQ9A 4EDXB 5GRXG 3GSWA 5HYFA 4M43H 1KCSH 3MREB 4EBQH 1WITA 4R26L 1E28A 3GMPA 4PVNA 1RMFL 5IB5A 4GKNA 2OSLA 1W0VB 3FOMB 3U0WL 4LARH 4P9MH 1CYGA 5FKPA 2JTYA 5GRUL 3BYYA 3K72B 2BH0A 4U6VH 3IRPX 5A2KH 1UB5A 3MJGX 4P2QB 2R8SH 1KIRB 2PF6A 4PY8J 2YGVA 3CDZB 4K2UL 3KMDA 2VXTL 3T08A 1SQ2N 1IL1B 3F7VA 4N0UA 3CX5K 3D51A 3TV3H 4QRSB 4LLQA 2HKHH 3ETBF 2F7PA 3DMMB 3SPVA 1LO2L 1USQA 2KT6A 3BUTA 4PJ8A 4PRNA 4JE0A 4E0RB 2FQFA 4MJ4A 3RGVC 4R2GB 4QWWD 5E6RB 3LDBB 1ORQB 5BMFH 4YLCA 3BQUA 5D70H 3ZKNC 5GZOA 2DQDH 4UQ9A 4MJ6A 1H9DA 1SY6A 1VDGA 5IVZA 1KFAH 2JJTC 2R69H 2QSQA 4PJHE 4KQ3H 4X6EA 3RL2A 1THCA 3X1BA 3WXWL 3FO2B 1MNUH 2LQRA 2BRRH 3KWXA 4NHUA 1RK7A 4KU1A 3NPSB 1YNLH 5LNEA 1K9TA 1IC5L 3LNEA 3NIFB 3HMXL 1U58B 1C5CL 2DQJL 4LEOA 1CS6A 4CSSA 5D5MB 1HJBC 1WQVT 1XGUB 2C3HA 5TTRA 5I0WA 4LU5L 1UZGA 4RAUA 3GSWB 1I7UA 1FP5A 3VTAA 2VSCA 2H3NA 1OPOA 3KLLA 1G6RH 4DEUA 4ZMAT 1E28B 3GMPB 4KRLB 4P04A 5IB5B 5C0AA 3OB8A 1PZUB 1TZGL 1SFDA 4GKNB 3WNPA 2OSLB 5C0DA 3VGBA 2YLKA 5INCA 2YD9A 5FKPB 4Y8DC 1FSKB 5IQ9A 4DPAX 4F92B 1UB5B 1I9IH 5DK2A 1ACZA 2IWKA 4I2XA 4DGYH 1ODAA 4HZLA 3SDAD 4DW2L 2R0WH 1J05A 2F9BT 3F7VB 1M71A 1WZ1L 2A6KA 3A67L 3KW7A 4N0UB 1OTTC 4L5FE 5JIKA 4LLQB 4FHBD 4ZZFA 3TEXA 3BKMH 5CFHA 1SLUA 3SPVB 4OJEH 1QSED 2B4CC 2GABA 4PJ8B 4LB8A 4PRNB 1OZUA 1QFWI 2VZOA 1U2CA 1X7TA 3GBNL 1FIGL 4NXSA 3BQUB 4B50A 1GH7A 1UM5H 4GKSA 5CU5A 3LNFA 4MJ6B 3RU8H 2D03L 4XCFL 3NZHL 2W95A 3NSDA 3PFUA 5MI0B 5HP5A 1NUGA 3L3DA 3EFOA 5IVZB 2NOYA 3ZYZA 2IG2L 4X6EB 1JPEA 3RL2B 2BSTA 4OIIL 3N43F 1AZBA 2NX5A 1T7VA 2H41A 2ZYIA 3TCLA 3ZRFC 4FLHA 2ITFA 4PSRA 2C3GA 4A2GA 1DQDH 1UXLA 1JGLH 2UVEA 4NHUB 4TNWF 5T1KD 2GHWB 1HAUA 2F15A 5MEPA 3FCUB 3CXFA 3O4OC 4KOBA 5KZCB 2EXYC 3LIZL 4LEOB 3O0RL 3WS6A 3C8DA 4RAUB 1I7UB 4PCYA 4QDGA 3L4WA 5CZXC 3ZSTA 1M9SA 3P3SA 2H3NB 4HCRA 1GZHC 4P2OA 4PGZA 5JW3H 5HHOA 4GXVL 5HI3D 4X8JA 1FBIL 3MUHL 3QI9C 4PG2C 4KKAC 5C0AB 4S2SA 5DD6A 4AEEA 1JWUA 4WSJA 5C0DB 3RB7A 5I1DA 2NY1B 5INCB 3RDTA 4PJGE 1DN2A 4YFEA 4HSAC 3VE0A 3IJHA 3ORJA 5IQ9B 1U91A 1E8YA 5DK2B 1P0SE 5DD1L 1IGYA 4I2XB 3CHXA 4HZLB 5A2FA 1J05B 1GYAA 1M71B 2A6KB 2WUCL 5K9KA 2EEDA 1OHQA 4UTBL 4OQTA 3QHTC 5IUSA 4JHWH 3LEYL 1HHIA 4HUUB 4UTAH 1EA9C 2D7QA 4JG9A 3TF7C 2BZ7A 1WTGT 3MOAH 4MAYA 5DUPH 3ARWA 3N85L 4I89A 4IRSC 3OAYH 4Y2DA 1PX3A 1WUNT 2ZNWA 4AGLA 5T3XE 3S3PA 4GKSB 4UF7C 2I7SA 5CJQL 3D12B 5ECGA 5F9WC 1X7SA 2MJWA 3ZE1F 5KJRH 2OL3A 3SKJH 2BY0A 3NAAL 3L3DB 3EFOB 5E8EA 3CZNA 1FG9C 4TNFA 3AMKA 1AHWA 2WLHA 2BSTB 2EDBA 5TQ0H 3S36X 4XVTH 3SN6N 3VFVA 3TCLB 5L88L 5B8CC 5JPNB 1A8ZA 2H6UA 5L7XL 3FH5A 4RFOH 3SGEI 1HXMA 1OSZA 3FUDA 5D71L 5MEPB 1E4JA 2QLVB 3QJTB 4OD2A 4F7CB 3S34L 2F53D 3LQAH 4FI7A 1BBJA 1O7SA 4JFHD 3V6OA 2V6HA 4P2OB 1JOIA 1I82A 4P07A 2XV3A 5TFSH 3MV9E 1ED3A 2ZPKL 4MB5A 4X8JB 4A7GF 5HHOB 1CDJA 4TLUA 3ZL1A 1DEDA 2VDOB 4LSTL 2J72A 4S2SB 3MTRA 5DD6B 1JWUB 2C1PA 5F21B 5I1DB 5KYXA 2OM5A 1YEKH 4WHCA 2JKIS 5A6IA 1FRGL 3VQMA 3VE0B 3IJHB 5J6HB 3TF4A 4UILL 1U91B 1IAIM 4FQCL 1IGYB 4B9YA 4EIGB 1E27A 3ARQA 1ZIAA 1AR1D 3EO9L 3WDIA 5EZIL 5K9KB 4WHYH 3SE6A 1E8XA 3H2WA 4XNXL 4Z7UF 3F5WA 1FORL 1HHIB 3ZSSA 3EFDH 3ARDC 4MAYB 3O45A 4OGXL 2VR6A 2RMNA 5JZ7D 4Y2DB 1A22B 1NWPA 3CVHL 5ALBH 4UAHA 3Q2NA 4MVBD 1E9OA 4FKKA 3H7BA 3PL6A 2OL3B 5E8EB 2K4AA 2WXFA 3VXUE 3WJJA 3LNIA 3BKYH 3BHBA 4RZKA 4UOJA 5KSBF 2WKOA 3RB5A 3VFVB 1GOHA 1MJ7H 5AWNH 3B8YA 4UT7L 4R97B 1AQDA 3VVWA 3P0YH 4YDNA 3EDJA 4YWGH 1HXMB 1OSZB 5J1SC 4QRFA 1TJIH 1ZEAH 2XV6B 1HIML 4OD2B 4XXCC 3GIZH 3MDJA 1DZBA 2GW5A 1MJUL 3VNYA 1WLHA 2HRHA 1UD4A 1BBJB 2L7UA 3HI6H 4JFDD 4UTCA 5A7BA 4L9DA 1C12A 1K3ZA 2PPEA 1ED3B 2GT9A 3LX9A 4B3EA 1TIUA 3KYKH 4HPYH 1C5DA 1PMYA 3S36L 2BK8A 2C1PB 5KYXB 3HHSA 2NZ1A 3H3BC 2PO6A 4NLHA 3ETTA 3FQUA 3APDA 3L9RA 2WC7A 3H85A 1E27B 2QBWA 3VD9A 4L4JA 4OQ1A 4MBOA 5FYJD 2CHWA 6TAAA 3SY6A 2YEVB 2XWJA 3OLIA 3F5WB 4GB9A 4AYSA 3IVKA 4DKTA 3GT6A 2ZOKA 5AYTA 3BVVA 2VXQL 3O45B 5HSFA 1W72H 2O5YH 3KXFD 4QHKJ 4APQD 5ADOH 2V9RA 3QFGA 2QZQA 2OLDA 3H7LA 2G3MA 1JZ7A 3OAZH 5EMYA 1E9OB 3WOVA 1KJVA 3H7BB 3N41F 3PL6B 3S4SA 1PZSA 2YKLH 4R96A 4I9WE 3L5WA 4ELME 3BHBB 3FZUD 4FAAB 1KMGA 2WZPD 4XBMA 4X4XA 5I19H 4GSUA 3REWA 1AQDB 4IJ3B 4K7PY 1P4UA 3QC6X 5GGUA 5HYSA 1EUTA 1Z0MA 4N8CL 1KTRL 3V9EA 3GJFA 4DWHA 4OT1H 4K4KA 4AT6A 4YMPA 2JIXD 1HZHH 2N0KA 1B2WH 1C12B 4JM4L 3IU4L 3QO1A 2GT9B 1ACXA 1C5DB 4N85A 3RY6A 3T3PF 4HKBA 4AQ1A 2P5EE 3HHSB 3AREC 2PO6B 2J55A 3JWDC 3JZ7A 4GQ9H 3WGVB 2CCLA 3FQUB 1S9VA 5GRVK 5I71C 1A7NL 4M1DH 3CQPA 1KTCA 3L9RB 4OZHA 1E2VA 1M53A 4YSCA 1DP0A 5IHUH 3H1ZA 1KYDA 2EE2A 1CDUA 1Z9LA 3CFKA 4CVXA 2XWJB 4KX8A 5T5NG 3C5XA 3IVKB 3DJSA 1OK0A 3QQNA 2XZCL 2ZOKB 3CHOA 4PAZA 4EDWH 1E6JH 3DX1A 4HLZH 1EAJA 2CDEA 4L4VA 4MJ2A 4JR9L 4RNRA 1VSCA 2WB1A 4TUKH 3D85D 3RURA 1SLWA 2GSIA 2YD2A 4KJWD 1FFPA 5E8OA 1MCJA 1AXIB 5FW8A 2ICEC 1KJVB 5FOBA 3S4SB 2E4FA 3WDHA 1UH4A 4R96B 2V4LA 3PWVA 1OY3B 1I3GH 3L5WB 1F6FB 4WY7L 3A0OA 3WFBH 4X4XB 4ZUWA 3BJ91 2Z1KA 3IWVA 3REWB 4CSPA 5CKAA 1BEYL 1CL7H 2YGNA 2XQ0A 5GGUB 3BO8A 5HYSB 1LE5A 3DI2B 3NSCA 5CD5D 2Q5BA 1PDKA 4J3TA 4NUMA 3GJFB 4LRNL 3ILPA 4BSWA 2PUQT 4AT6B 1MJJA 5A6MA 2CHZA 3AXLA 2IDQA 3B4NA 4PJFA 3DO4A 1XGQA 3QO1B 3L9BA 1MELA 3NA4A 3UYOD