2VQ1B

Anti trimeric lewis x fab54-5c10-a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
218
structure length
213
Chain Sequence
QITLEESGPGILQPSQTLSLTCSFSGFSLSSSAMSVGWIRQPSGKGLEWLAHIWWNDDKYYNPALKSRLTVSKDSSDNQVFLKIASVVTADTATYYCARIPGFGFDYWGQGTTLTVSSATTTAPSVYPLVPGCSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGKV1-117 PROTEIN
publication title Characterization of a Diagnostic Fab Fragment Binding Trimeric Lewis X.
pubmed doi rcsb
molecule tags Immune system
total genus 36
structure length 213
sequence length 218
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vq1B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vq1B01
3TO4A 1CTOA 5DEFA 1UJTA 5KVFH 4YR6A 5JQHC 4NZUH 1R5IB 5BZDB 5C9JA 1P7QB 1F4AA 4GQPH 1XGQB 3BZFA 1GGYA 3V0VA 3QHZH 2HVKA 1NMBL 1S9VB 2R23B 5HGAB 4KTEH 5J3HC 4HIHB 3L3DA 1IKFL 3IETA 2WBWB 1GSMA 3EZJB 5ENWB 4D2NA 3DX8A 3DI2B 2A73A 2DTML 5DURB 5CUSL 3NGBC 5I0DA 2PCPB 4A2MA 4OCWH 3VGBA 4LHJB 4JJHA 5A2LH 5HGBB 1PVHA 1MCQA 1MRDL 4LHQB 2F19H 3HC3H 4TUKL 4PGEA 2VISB 4NRYA 5DWUH 1KEMH 1I85A 2J5LC 4R26H 1ITBB 1GIGH 5EC1B 4HF5L 4X7TA 1XEDA 1R3HA 2BVPA 2OL3B 3HFMH 2Z9TA 2OJZH 5GRWA 3GDBA 2NTSP 4U1MA 5CEYB 3RPIB 3RA7L 2HAZA 4HBCH 5BVJB 1DVFA 4YE4H 1S7RA 2X4RA 4F7MB 4TVPD 4LRIC 5T5NF 1VKXB 2YK1H 4FQLH 5D7IB 4RCAA 1E4XL 2IALB 3AXLB 2P46B 2E9BA 5GHWH 4M7JL 1GGBL 5D7IF 4JG1H 1EAPA 1I1AB 5HVHC 2WMPA 3ABZA 4TVPL 1WWWX 3K2MC 4L9LB 5J3HD 4NQCD 5EORL 3O3DA 4NZJA 4PJHA 2HN7A 3ZL4H 4ZG1A 5IIEA 2VLRA 1FNAA 4DQOL 2NR6C 4HXAH 1HSBB 2MCG1 4ZTOH 5HY9B 2OCFD 3F5WB 5J12C 2APXA 3EDEA 4WO4A 4NWTH 3ECBB 5FYKL 5I8EB 4HWBH 3ARFC 1J5OL 1U0QA 4OGYL 1DE4A 3I75B 4FQ1H 5MEOB 3GJFB 1RHFA 4PBWD 4ODTH 4OM1L 1MJUL 3MGTA 4HKZB 1RY7B 3SQOL 3EO0B 1P7KB 5JOEA 3GI9H 5LJYH 4EKXA 3ZT7A 4NNYB 4Z95L 4HJJH 5BJTA 1LO2H 3PNWB 1YEEH 3WUWA 2IANA 4U1HA 4MDIB 4RDQG 5AZEL 4WFED 3WDIA 2QQKL 4M48H 3QBTB 3DSFH 3VXME 1GGCH 4PGJA 4JFYB 5C0JB 2YXMA 2VKWA 1FNHA 4LHUG 5K9KB 1EIBA 4KI5C 2A6IB 3QPXL 3W2DL 3SJVA 4IRSB 3TC9A 3ZKXC 1KPRB 1J05B 1T03L 4MA7L 1LEGB 1NMCB 4DN3L 1MAJA 5I66A 4BFEA 4OGZA 3ZE2E 4HUWA 3UTZB 2ICES 1CGUA 4TRPL 5DJDA 5IVZA 5H37G 2V9TA 4QLRA 3UYRH 3I3DA 2QQLH 2VABA 5J9PB 2NR6D 4N68A 3IF1A 1UQSB 3HI1A 4NM4L 1RUML 3CCHA 2Z8VC 3MRDA 5E5MB 3QXAB 1BZ7B 3ARFD 1CGVA 5F9DC 3QDJD 3LKOB 4U1KA 4HJGB 4LPUA 3ZDXF 3CFBA 2PYED 2QL1A 3PWPD 4YBLB 3REVB 2LTQB 4QHNB 3PWNA 4U6VL 3PHQB 1N6QL 4G80B 1CLZH 5FYLL 5J1SC 5KSBA 3ULSA 3RZWA 1JZ5A 1F4YL 4P5TA 4LLDA 5IFAH 3VGFA 2GJ6D 4OKDA 4UIKL 3D39B 2H45A 3H3KA 5I1KH 5FYJE 3L95A 2YRZA 3GMQB 2H6PB 4LSSL 4PLKC 3WXWH 4DGYL 4X5XB 3EOYG 4R4NC 4KI5D 1NGWA 1U8NA 4LIQE 1IAOB 3V6ZA 4ZMAT 4YJZL 4U6XA 5FKAB 3RX7A 3DPBA 3CDGA 1U8IA 4NN7C 3ET9F 1HHKB 4CUCA 4GG6E 2F54B 2GITA 3V5DB 3KDMA 4I0PA 4KQ3L 2HH0L 1VGEH 1VB9A 4Z0BH 5DK2B 1FQ9C 1XGUB 2GAZB 3OJ2C 3K80A 4R96A 4I3RH 1ZWIB 4PJIB 1I7ZA 3T4AA 2ESVA 1BFOA 4Y2OA 3SDXE 1LK3L 2V6HA 4KK6C 4HMCA 4WHYH 5DD3L 3L3JA 3NFSH 1IAIH 1MCPL 2YPLE 3B4NA 2K3TA 3PDGA 4PJIF 4YHZH 5I76B 2VR5A 1UWEL 3P77B 1I8MB 3LOWA 1CQYA 3BVNB 5IP4A 1P7QA 1EO8L 3ULVC 1XGQA 3PL6C 2IPUK 4Z7VB 5ERWB 5CBEB 2R23A 2R4SH 1CLOH 5HGAA 2E7HA 4ZAKC 1AQKH 4LLQB 1FORH 2H26B 3IJSB 3QEQD 1D9KC 2R69L 1RJYB 4Z7VF 4XNZC 4LDLB 5ENWA 4PLKD 4OI7A 1CXEA 4YQXH 1IGYB 3BUYA 2QSCH 4R4ND 3C2SA 4HXBL 2GFBA 5FKPB 3JWOH 2PCPA 4WI6A 5JDSB 5HPMB 4RMWA 4BZ2H 5EBLB 1H8SA 4OM0H 5HGBA 1L6XA 1B4JL 4RQQB 1RVFH 2A6DA 4KVNH 3VG0L 3AB0B 3JV6B 3WMSA 1GH7A 5TQ2L 1G9NH 4AQOA 5EO1B 5I15H 4KROB 2EDYA 2OL3A 2VXQL 4X4XA 3U2SB 4U3XA 4OQTH 4QNPF 5F9OH 3RZCC 4RAHA 4J6RH 3MLSH 4KK6D 1OAUH 4P2OC 4HUXA 1LE9B 1ZT1A 5CILH 4F7MA 5F6HI 1QSVA 3SDAB 1KIPA 1VKXA 5D7IA 5EOQL 3FT2A 4YZFE 2X4OB 2IALA 3ZMRA 5EWIH 2J88L 3AXLA 3MUGB 2NY1B 3HZVB 3UJIL 4QY8A 5DJ8B 3ULVD 1KELL 2D31B 3G08B 3HZYA 1I1AA 3IDYC 1YEKL 2XTJE 1FNGB 3B9EA 3PL6D 5C2BH 1BGXL 3D0VA 4JPVH 2FNBA 4ZAKD 1DDHB 4KZEL 5HYSG 1R5VA 3NCMA 5C09E 3KPLB 1D9KD 5ABDE 3C2AL 1UEYA 5ESAB 4ZO6A 1G9MC 3REWA 4LVOC 4RMUA 1P5VA 1F3JB 4NRZB 3JWDL 5DJ2B 2AXFB 2FCBA 2YN3A 1MJ8L 5B22A 4PJ8A 3HNTH 4Z7UB 5JOFA 1SMOA 2DWEB 2V2XA 3E3QC 5DUML 1UM4H 3I75A 1Q1JL 3GJFA 3NA9L 4Z7UF 1GHFH 2COQA 4PGDB 4ZUWA 5LGHH 7CGTA 5HHMD 1DEEB 4HKZA 1Y0LB 5CZKA 3EO0A 1P7KA 3VFMB 3LRSB 4P2QA 1XIWB 1KGCE 4NNYA 5I1EH 4ZO7A 3KVQA 1NL0L 3WIFA 3RZCD 4KU1A 4Z7WE 4OV5B 3OGOE 5IW6A 4PRPB 1UA6H 4P2OD 2CKBA 1UWXK 5FYJH 2E5EA 4L5FH 5L7XH 4XPHH 4WGWB 1NGXB 5T3XD 3O81A 2XN9D 2VLKA 3RWFB 1CE1H 5IBTL 5IB3B 1FZJB 1MCCA 2BOCB 1BHGA 1J05A 1KPRA 2GEEA 4LIQH 1EZVY 1LEGA 5J0BA 3C5ZC 5T3XL 4DKFH 1T3FB 4JY4A 3UTZA 4NC2B 2YMXL 3VCLB 4JM2D 3ZYOA 5BW7C 5ITFB 3K2UH 3GJEB 4XVJH 5DA0B 3M45A 1UQSA 3B8YA 2DD8L 3PABA 5E5MA 3SO3B 4WDIB 2Q8AL 3ORJA 3QXAA 5C08A 3O8XC 1BZ7A 4N1HB 2DQDL 3MJ9A 3LKOA 4KAQH 1QKZH 2A1WH 3QIUC 4QHNA 5ILTL 2A77H 4LK4A 2IAMC 1CG9B 3PHQA 1GPOH 2EH7L 4CMMA 2XKNA 3KXFA 1IAMA 1G0YR 1VADB 2APWA 3IT8D 3CX5J 5KSAC 2ZSWB 3P4LA 4WV1C 3D39A 3FMGL 4GAGH 5A40E 1UM6H 5EU5A 4OFIA 3QIWA 1TJHH 4X5XA 4HAFA 5FUZH 3MACL 1WIUA 4KH2A 1OF2B 3CZJA 4H88L 3V5KA 1IAOA 4P5MB 5DEZA 1BF2A 6FABH 4D0BB 2WZPD 5FKAA 1E27B 4K23L 4IJ3C 3C5ZD 1JGUL 3GIVB 5LAXB 4Y2DB 1J87A 1HHKA 2DI7A 1Q9LA 1E6OL 4N8VG 3PUCA 4MWFB 3V5DA 1DLFL 1FYTD 3DMMB 3KYNB 3H2WA 1GGUA 2GAZA 1UCBH 1PDKA 3WO4C 3BRDA 2YBRB 3QUXC 2FHCA 3DV4B 4OFKA 4PJIA 1DBKH 5ITBH 5FFLA 2DM4A 5D93B 2D0GA 5JW5A 5I8KL 2QTEA 5I76A 1KJVB 3R1GL 4M02A 4A6YB 1QA9B 3P77A 1A2YB 3QIUD 3SKNA 3F12A 2IAMD 1KTLB 2CRYA 5IMLB 1JPTH 1RULL 5CP7B 1G6RH 2HTLD 4M03A 1WITA 3QCVH 4OLXL 3U46A 3S36L 4R4BB 4UNTA 4WEMB 4Z7VA 4U1NA 5KSAD 3UTSE 3VFVB 3LIZL 4LLQA 1T2QH 3MR9B 4P46B 1B0RA 4M62L 5LCVH 2VXTL 3FRUB 4N5EC 2DMBA 2NY4C 3OJVC 1RJYA 1EUTA 4O58H 4IOIB 3UJTH 2DS4A 2GYSA 3W39A 1IGYA 1N6VA 5E5UB 1MCRA 3TM6A 2X4UB 4DFIA 3UTOA 5FKPA 3HNVH 4UAOC 5JDSA 5FGCE 1U9KA 4HWUA 1EHLH 3ZKSD 2DM3A 1NKOA 3BZEB 1IT9H 4JEGB 4RQQA 5E2JA 3PWUB 4TSAH 1S7VB 2VZSA 1PYWB 1X3DA 1YN7B 4HWBA 3G6JE 1ITCA 3O6ML 2MJWA 1PLGH 1N5AB 5HHXH 5HVGB 1HHIB 5EO1A 3OG6B 1V3KA 1CFSB 3LMJH 4NQSB 12E8H 4RSVA 4NHUB 1I7RB 2B1AL 3HI6L 4PBXA 4F3FB 3KPSD 2OLDA 3C60C 4OZFA 1KPVB 3QI9B 4IMKC 3TJEL 3WUZA 5B4MC 2X4OA 5JLZA 4GMTL 5HHVH 1O7SA 1L7IL 1RHHB 4O02L 2VAAB 3MUGA 2BRQA 2BY0A 2KH2B 2NY6B 5SX5K 4CKVX 3MRRB 4DW2H 3UXFA 4HMDA 2OBGA 2D31A 3G08A 1FNGA 3MA7B 3CLFH 5BXFB 1OW0C 4RRPG 1N64L 1DDHA 4DGIH 4DGVH 4P3DA 4N5ED 3KPLA 2NY4D 4XHJC 3WHXB 5ESAA 4NRZA 1MFEL 1NC4B 4NQDE 4XI5C 5JQ6H 4GG6B 4Z7UA 4MAYA 5BMFH 1QSFB 2DWEA 1DBJL 3CDFA 5HJ3A 4R6UA 4N0YL 4NM8H 1BD2D 1T6WA 1Y0LA 4G43A 3SDXB 3LRSA 2Z4QB 1XIWA 4JCLA 2YPLB 4DUWA 2W9EH 5I18H 4RGMB 4MZ2A 1K6QL 3P73A 4LBEA 1UM5L 4XPTL 4OV5A 4K3DH 2P43B 4BSVA 4PRPA 1KXVC 4KV5F 3C60D 5E8DL 1MCHA 3TBTB 5B4MD 4LLMB 3W0WD 4TULL 1EHAA 1CDBA 4JGJA 4ALAL 1FZJA 3NIDE 3P0YH 2BOCA 4YHOL 3NZHH 1I85C 4ODXB 3IXTA 3X3GL 1QBAA 1X5IA 2YKLL 3QRFM 2ZUVA 4WNQB 1BREA 1T3FA 2YRPA 5MENE 3ARDB 4XHJD 3WHE0 5ITFA 3GJEA 3QT2A 4X6FA 4FMKA 4XI5D 3TZVB 5JXEC 1DVFC 2CK0L 4JN1H 2DLFH 1D6VL 3M8OL 2HKFH 2NYYC 3MFGB 4FNLL 1PW3A 4Z18A 3RVUC 5EPMA 2QSTA 5CHNA 2OZ4A 3PWVB 1CD1B 3MNZB 1RZKC 2NY5C 1YDPB 1KC5L 3VWJA 3K8KA 1K8IA 3OF6D 4M61B 5EU6E 1J8HB 4AH2A 5FDYA 3UBXG 2UZIL 2F53A 5I1HH 1SQ2N 3FB6B 4O5LH 1W0YT 1VADA 2VAJA 2WUBH 2ZSWA 5F1OB 1G6RB 5LKNA 4F7CB 3FO2B 1ZVSA 2NY2B 1F4HA 1CIUA 4F9PA 1E0OB 2XTJB 4WO4C 3T8XB 2CK2A 4Y7MA 5EOTA 5D1XB 2FEDC 4LQFH 2DRUA 2XTLA 1U42A 5C09B 3SO5A 3FB5A 2MQ0A 3CFKB 4TPRH 2O26U 4BFIB 5FGRA 1IGTB 3DO7B 2J4WL 3VRLE 4FN0A 3GIVA 4Z78B 3KLDA 5LAXA 4Y2DA 5EBMB 3U30C 1WFUA 4YIQA 1SJHB 2AEWA 2VXUH 1UH4A 5GGVL 3BN3B 3MODH 3DMMA 3KYNA 5JXED 4Y5VC 1DVFD 2Q7YB 1G7MB 2BY3A 4J8RA 5IMKA 3WIIH 2CSPA 2WBKA 2IGFH 3MLXH 2NYYD 2R2HB 3DV4A 4PD4J 1QFWM 3RVUD 1GZQB 5L2KB 4N9GB 1HNGA 4AL8H 1YPZE 1RIVL 3L9RB 4OQTA 3S4SG 1KJVA 4A6YA 3T3PF 3Q6FB 4Z7WB 1KACB 1A2YA 3FN3A 4M5YH 1UZ6F 2Q3ZA 4RDQF 5IMLA 1CVSC 5MERB 2RB8A 2XPGB 4MA3B 4LHUB 1J0HA 3VFGL 1LILA 1RZKL 1NCAL 3HRZA 2VLRD 3CMGA 1FBIH 4QHMA 3FRUA 4ZTPH 4XNMB 3L7FA 4WO4D 2VSCA 5D7SH 4IOIA 3UMTA 2FEDD 1HSAA 4D0CA 2FJFB 3AU1B 1P4LB 3I6KA 3UTTD 2FDBP 2X4UA 4J2XA 1T5XB 4S1DD 4WCYL 3VDAA 5I75C 1KB9K 3CSYB 3VXQB 3LKNB 4HCRL 2JB5L 3E8UL 3PXHA 5A2IH 3BZEA 1V7NL 2ZUTA 1HE7A 1UCTA 1YN7A 5GRUL 5GGRB 2IAND 1U8LA 3B9AA 1EBAA 4K7FA 5D6DA 5CIPA 3MV7E 3ULUF 1HHIA 4P5TC 5GRJH 3X11B 3RY6A 2VDML 3VE0B 1FGVH 1CFSA 1FE8H 2AQ3A 4NHUA 1I7RA 2OYPA 4U1IB 4F3FA 2W65A 1DCLA 1CU4H 5EA0H 3NH7L 1KPVA 1KJ3H 4NIKB 5I1CH 3SJVD 4Q0XH 2B5IB 1DL7H 3VW3H 2VAAA 5DS8A 4BH7B 3MRRA 4X83A 5HHOD 4NOBA 1JJUA 1B0WA 4EUPH 2VXSH 2E7BA 2H41A 3BKCL 5E8NB 4I0PC 1DUZB 1CT8B 3VXRE 4EZMA 2IFFL 1FVEB 2OJEA 3WHXA 1KTDB 3FKUS 1KB5H 1ZOXA 1MUJB 1J86A 2NZIA 1RZIB 5LVEA 3N1QC 3MC0A 3QNYB 3A6BL 3L5XL 1QSFA 3QQ9C 4YHLH 5DVLA 4FMFA 4NN6B 4PJDB 4BZ1L 2P47B 4PLNC 1A1OB 5A43C 5CJ8A 1D5IL 1F4WH 2APFA 2LAGB 4PJDF 1AH1A 2V7NA 5DGQA 4P5TD 4FFVC 1ND0B 2Z4QA 4JG0L 2YPLA 3LSOB 3HMWL 2X7LB 4H26B 5I8CB 1GOGA 3ARRA 1KYOJ 3B9KA 2X4NB 2YD2A 3MRQB 5IVOA 4MQTB 4OCYH 3BDYH 4FQPA 3TBTA 1QYGL 2H2SC 5F97E 4DKDC 3G5VB 3UTSB 2WAHA 4LLMA 1VFAA 4DN4H 1KSRA 1LDSA 2PTTB 4KHXL 4DKAA 1YYLH 3PP3K 1FFOB 3MRBB 1P1ZB 2UVEA 4OV6F 1OP5H 4ODXA 4AENB 1IC7L 1R24B 4I0PD 4Z7NF 2HWZH 1A0QL 2FECI 3ARDA 5FGCB 4PRNB 4AZ8A 1QFWL 5DVKA 5SWSD 1MFAL 2CXKA 2ESVD 5ICZB 1JTOA 1UVQB 3G6JB 1A7PL 3BKYL 3QQ9D 4MJ6B 3IJYB 3CXDL 2AAVA 4CL7A 5I6XB 4Y1AE 1GJIA 1YDPA 1EXUB 2A83B 1P7QD 4LRNH 1G7IA 2ZCHH 4Z7OF 1I1AC 2YD6A 3WNNA 3IU4L 1V7MH 1J8HA 1KTKE 1DN0A 4R97B 4FZEH 1SEBB 2I27N 4GXVH 1U95A 3V7MA 1Z9OA 3FB6A 3WIHA 1QFHA 4H5SB 4UQ2B 3MJ8B 3ALXA 4XBEL 1C1EH 1G7HB 4MMXC 5FO7A 5DURD 4F7CA 2OM5A 4IHOB 3D69B 1R0AH 4PJ8C 1ZHLB 2H2SD 2IPKB 5DK0B 1SY6A 3VFSB 1PZ5B 4U7KA 3BSZL 3E6FB 2AJYL 5D1XA 5F7WC 1NAKH 4LKXA 5C09A 2I5YL 1KCVL 2AS5M 4BFIA 1EK3A 1WZLA 4X9GA 5J11B 3QRGH 4NQDB 4Z78A 5EBMA 5DUPH 5CSZA 3ZSTA 5JW3H 4JFEA 1UACL 1EGJA 2E6JA 5GS1B 3MZTA 4LVEA 1NFDB 4GKNB 5E2WL 1IRAY 4M3KB 2Q7YA 4S11A 1NFDF 2OL3L 3RHWK 4ODSH 1TJGL 5L2KA 4N9GA 2Q3AA 3L9RA 3CSPA 5F96H 3Q6FA 1X5FA 1I1AD 4OAWB 4Y19E 4UOW1 4B41A 1BEYL 2FO4B 2OTPA 1NMCC 4LPYA 4GAJH 4MA3A 4LHUA 1Q9OA 2BVYA 5I73B 4OLWL 2GSIA 1A8JH 2EH8H 2GW5A 3KR3L 4EUPB 1BLNB 4XNMA 2Z92B 4FXGB 5T33L 4ZS7H 4PJAF 4KKCC 1BBDH 2FJFA 3RIAF 1P4LA 1WWBX 1I3RA 1T5XA 2GTZA 1I9JH 1MCNA 3MV8B 3UDWC 1KB5B 3CSYA 4YBLC 3VXQA 2LTQC 4OCRL 2Z91B 4OUUB 1CL7L 1HXYB 3UTPD 1YNTB 1TNMA 1HQ4A 5GGRA 1DQTA 2F15A 4O2CB 3X11A 1C5CH 2X4SB 3S5LG 4NNPL 1LNUA 4G7VH 5EU6B 1B2WH 3PGDA 4K55A 3ZE1E 1PY4A 3EOBB 2VLKD 3OX8B 4U1IA 1T83A 3RVXC 5GS3A 2DQHL 2GSGB 3MV11 4JFQB 4IRSD 4UT7L 2CKBL 4ZNCD 4POUB 2W9DH 4E5XA 2HLFC 3FCTA 5CZXD 4AIXA 2UY6A 2YWZA 1N4XL 1H15A 2QQNH 1UEMA 1YEIL 1CT8A 1YZZA 1A6AB 5CJOH 2RCSH 2VDNH 5E2TH 2Y36L 3ZKQD 3IYLW 3DVNA 4KKCD 2RFXB 1FDLH 2XRAH 2V5MA 1RZIA 3QNYA 2DDQH 5DMYA 3MLUL 3OAZK 1VENA 4IIQB 1EV2E 3NCJL 4PJDA 3MLZL 4FZ8L 4U1LA 3LRGA 2R8SH 1A1OA 1UKSA 4PG9B 1WUNT 3MJ9L 1NANH 1X5JA 1YPZB 3SE9L 1E4KA 4C83B 3I6LD 4LCWA 3D39D 2X7LA 1YMHB 4UU9B 1YPZF 3SKJH 3FFDA 4ZOEA 4U0QB 2DQUL 2R0LH 3MRQA 2YPVH 1FRGL 1WBXB 4XAKE 2VL4A 4Q9BA 3QHZL 2HLFD 2PTTA 4HIXH 1FFOA 3MRBA 2CLZB 4P23B 1P1ZA 4LAJH 2VR4A 3RUGF 4AENA 2F54D 3NPSB 4MB5A 3FJTA 1R24A 4H20H 3VD9A 2QBWA 4K7PH 4KROC 2PETA 5E00B 4HUVA 2CDGA 1BFVL 4FQXB 5I8OL 2P5WE 4JPKH 5EZIH 4EDXB 3VFPA 1BQUA 1CGWA 2VL5A 1EUUA 3W9DB 1YJDC 5DWUL 4KZDH 4AT6B 4MJ6A 3MV7B 4H1LG 1HHHB 3IJYA 3SGEH 3BRFA 3HUJE 5IOPB 4Y4FB 3GKWH 1A1NB 4PJFB 2NY1C 4Q9RH 1EXUA 1FIEA 4B5EA 4E0RB 3QDAA 3DV6B 1SBBA 4PJFF 3I9GL 1E4XI 3WKMH 1PX3A 1SEBA 5D5MF 2ZKHL 2VXVH 5FYKU 1N8ZA 4OF3A 1JP5A 3MJ8A 2VZ1A 1G7HA 1JWSB 1J1XL 4OZ4B 3D69A 4QGTA 1T5WB 4MAYC 1NCCH 5HYSA 2X4QB 5EFIA 3Q0HA 2O5XH 4FQHB 5EU7C 4Z8FH 5C0CA 3FQWB 3QULB 1JHKH 3U1SL 4N1CA 3D9AH 3ZL4L 2E6PA 2R0ZL 1XIWC 4KROD 5I2IB 1R3IH 1INDH 5GS1A 1JZ4A 1MH5A 1NFDA 4PJ5E 5GIRB 5K93A 4CN4A 5L88H 4FQ1L 2VDOH 3GJFK 3HE6B 4KHTL 3G5ZA 2NY1D 5D70H 3K1KC 4YH6A 1MJ7H 1SBSL 3QNXB 4OAWA 2FIRT 4Z7QE 3TIDB 1NCDL 1YJDL 2FO4A 3ARVA 3QEHB 2WBJB 3MA9L 5ICXB 2XY1A 3QG7H 3ZKMC 3FZUC 2YUWA 3QP3A 2O5YH 3LH2L 3D3VA 1GXEA 2Q1EA 4QRPA 5EZJA 4PJAA 2ZZUT 3BPCA 4U0RB 4YHKL 3H0TB 2N56A 1BLNA 2WNGA 5EO9B 4FXGA 2IBZX 4YDVB 5EN2B 2KKQA 3WD5L 4ZFGL 1LP9E 1BVKB 5DRNB 4FQCH 2AP2A 3SOBL 3V7AE 3NCFB 1TIUA 3GMLB 1T1YB 2NY7H 5L2JB 5DO2C 1V3LA 1MCFA 2XWBB 1OTSC 3MV8A 3TBYA 3VWJC 1TETH 3L1OL 1M6OA 2IPUG 3C6SA 2Z91A 3O41B 4OUUA 2X9YA 1YNTA 1GRWA 3OXSB 1XIWD 1IGIH 4U1GB 4UQ3B 5LQBH 4KVCL 3BZ4A 1OAZH 4QXUL 1OWWA 3QH3B 3KPTA 4NHCL 3FQXB 3QXDB 4Y1AB 4MA8H 2VLJE 4G8GE 1FP5A 4OLVH 3RU8H 4PRPD 5I19L 5KS9B 4NPYA 2WP3T 3D48R 5EU6A 4F9PC 5CLWA 3S35L 3CH1A 3ZYZA 3EOBA 2D3VA 1MCSA 4YGVB 3X13B 5KS9F 4P9MH 2GSGA 3MCLH 5IWLA 2YD5A 5GJTH 1CGTA 3BP6B 3SKMB 4ZDHB 3EFDL 2HKHH 4Y2DC 3RTQB 3ZKMD 3FZUD 5EZOL 3ZHDA 4XVTL 4NJAH 2YUZA 1WTLA 5JPNB 4JR9H 3DMMC 1FNLA 5FV2A 4UTAH 1BF8A 1EA9C 2ED8A 2RFXA 3NAAL 1R3JB 1G9NC 4MNGE 4N8VA 4JZNA 4B7IA 1DSFL 5D93C 1IGML 2Q8BH 5DO2D 1OTSD 4NKIH 2Y06L 4IIQA 2EO1A 4LNRA 4K94H 1A7OH 1RIUL 3RKDC 4P0DA 4M6NL 2OZ4L 4PG9A 3HKFA 1RURL 1KUMA 3DOSA 1TLKA 1YPZA 1MIML 3S4SB 5DTFB 1TQBC 3IDXL 3GSOA 4P46C 4YDKL 3BIBX 3MOQA 4Y19B 2PW2B 4V2CB 1AC0A 2E27L 4I1NB 3GSQB 5DC4B 4HPYH 4L8BB 3L3GB 1IEHA 1U3ZA 3T04D 1TMCB 1WBXA 3JV4B 4APQA 3RJQB 5DHVB 4U3CA 4N8CH 5EU4B 1J1OH 1UB6B 4Y2DD 2R4SL 3GMOB 3TPKA 4MCYB 3MRPB 2BNUB 1FORL 3FFCE 3N1PC 5DC0A 1IAII 5D6DC 2AEQL 1MIEL 1T7VA 1ZA3B 3DMMD 4XRCB 1IC1A 3RY6C 4ONGL 5E00A 4PG2A 4FXLA 3RQ3A 3QAZB 4ZYKB 4FQXA 1KPUA 3N1MC 1U3HA 3TWCH 4UV4H 2Y25A 1JYNA 2O93L 1SEQH 1UKTA 2BFVH 5CJ5A 4O2FA 2CQVA 3W9DA 4P2RE 3QI9C 3CH8A 4AT6A 4CJ1A 2MCPH 3EGSB 4PP2B 5HHQB 4D0DB 1SMAA 2I9LA 5IOPA 1VFOA 2NY6C 1A1NA 1NPUA 4PJFA 3RKDD 4ZOAA 4HZLB 1K8DB 2GUOB 1G1CA 5D5MA 5ETUA 4H25A 4ZO9A 2D7PA 4OQTL 4R3SA 1PZUB 3ESVF 3QFJE 3S34H 4A6YL 2MWCA 4MJIA 4P46D 3E6HB 4LPWA 3HNSH 3MYJA 2W92A 5GRZA 3FQRB 4JO1H 3WKNA 1BVZA 4K2UH 3FT4B 5KSVB 5FIEA 3H9SA 1NGPL 1OARH 1FAKT 1REIA 2PR4H 1MFDH 3GK8L 4RRPA 1ED3A 1GCFA 1IC5L 3OKEA 1MHPH 4F2MA 3DVGB 5C2BL 5F7LB 3BZDA 1HKLH 4NGHL 3QULA 2OI9B 3AGVA 4QWWC 2VZTA 1CBVH 3O45B 3BE1H 1KCLA 4ZS6C 3MNVB 1BWMA 1I4FB 4O00A 1IGFH 3V8CA 2YEZB 3F7VB 3SGDI 4MNQE 3GMNA 1RUAL 4DWHA 3QWRA 5AAMA 3B9KC 4LFHD 1MPAL 3QI9D 2Z8WC 5E4EB 4OLZH 3KYOB 3V0WL 3VI3E 2NY6D 4U4BA 4AEEA 3KPRE 4U05A 5CMAA 5I1EL 2AXJA 4N0CC 3H9ZA 1A21A 1NLDH 3TIDA 2XXMB 2AABL 4PRIE 3ARDC 3PDOB 4QOKE 4JQVA 3GIZL 4WI8A 1O5DT 3CFIC 2X1XR 3JTSB 1CFNB 5ANME 1L6ZA 1CE1L 1NC4D 2BMKB 4CW1B 4LLVB 2R56L 4LSUL 3VI4E 1QSFD 1BVKA 2V5RA 2DICA 3SDCB 5ALCH 3BAEH 5L2JA 1MQKL 4DKFL 3P9MA 1CVRA 4QWWD 4XC3H 4XNUL 3DRQB 3HE7A 3TP4A 3OXSA 3ESUF 1F2QA 2AI0H 1NEZG 4ZS6D 2YPLD 1OAQL 3ZHKA 4W6XB 4UQ3A 5I1AB 4NFDA 4XVUC 4B50A 3S3SA 3FQXA 5EOCH 3B9KD 4KRLB 5FM8A 5KS9A 2NY2C 2BSED 3UBXA 4CVWA 4FTVE 2XTJC 1QKZL 3KNBA 4CGTA 3IFPA 5D1XC 4YGVA 5DJ0A 3X13A 4XCEB 4N0CD 3HRPA 4UILH 4EOWH 1BPVA 3X3FH 4YFLI 2CIKA 5JIKA 1YN6B 4Q9QL 3BP6A 3SKMA 4ZDHA 3Q1SH 3RTQA 1I9RH 5D71H 3ARDD 1EEYB 1X4ZA 3SE3A 4UINH 1FZKB 5IHUL 1WCBA 5JPNA 1DBBH 4N0RA 1HOCB 4BSWB 4XAWH 3VH8B 4P9HH 4GAFB 3GSWA 5EUKA 3IDIA 3TZVD 5FUZL 4WTZG 1KFAH 3G5YB 2H1PL 3RAJH 4HD9A 1R3JA 2ATPA 4LSVL 5DJXA 3FQNA 5DJAB 2BNRE 1T20A 3HZKB 4PJ5B 2X70A 1MY7A 1CLCA 2ED9A 2X9WA 5DEGB 1J8HD 4JRXE 4OCSH 1WICA 3OHXB 2FX8L 5E2UL 1UCBL 3C6LB 4OSUL 4XVUD 5TFSL 4R7DA 5I1GH 3LVEA 1SM3L 1WWCA 2EE2A 3VD3A 3B2UC 5ITBL 3G04B 2NY2D 3QCTL 4GKZB 2DQFA 5F1SA 2XTJD 4V1DE 5F8QC 1CS6A 4FABH 4HKBB 5D1XD 3WIHL 3BXNA 1IMHC 1TTGA 4MXVE 3PJSB 5C09D 4WI3A 3K4DA 3L3GA 5CEZE 5IKCA 4PJ7E 1UJ3B 5DHVA 3BH8B 1KV3A 5DFVC 1MWAL 4XCFH 5E9DE 1PG7X 3BQUB 1SY6L 5EU4A 1UB6A 3C8KA 3RWIB 3KJ4B 4XP1H 5EZLB 3GMOA 1CF8L 5K59E 1FFNB 3ULUC 1KOAA 4U2ZA 4PRHE 1LP9B 1FH5L 3MRPA 5F3HB 3QCUH 2WLYA 2WQRA 4RFNB 4XP4L 3UJTL 4XRCA 3OGCB 4M7LT 4M6OL 4ZUSA 3GO1H 4XB8A 1RK1A 4MQ7B 4ZYKA 1MCOL 4GRWE 3DURA 1EGJL 1KGCD 5GGRY 4C56A 5L2KD 1OHQA 1T83C 1HHGB 2B5IC 2VLJB 5D4QA 4G8GB 4D0DA 4JGUA 1TVDA 4NKDB 3AY4A 4HV8A 5IJVB 3ZZ1A 1M4KA 3QG6A 4UB0H 5JIIA 2BNQB 2YD9A 1K8DA 1JWUB 4LHUD 3LMJL 1F02I 4D9LH 2HJFB 4YXHL 1BZ9B 4Y8DC 3B2UD 4BQ8A 4R0LB 3E6HA 1OCWH 2A9NH 4G6ML 3T65B 5KSVA 1GVIA 2W0KA 3QZWG 5IF0B 3GB7B 2BVQB 1I9EA 4YAQB 2ADGB 3TV3L 5B3JE 3P4NB 1IEBA 2GY7B 4QKXB 1NBVH 4J3OC 1RUQL 4XXCA 2NX5E 1UG9A 3CLFL 4NN6C 1RJLB 3ULUD 3CK0H 3WEXB 3V52L 3WN5B 2HT4D 3HTLX 4HSQA 5HYJB 4LSQH 3O45A 3MNVA 3MOAH 1L0YA 1JNJA 1I4FA 1LEKB 3G9AB 2FRGP 3CFCH 3ULUL 4OJFH 3F7VA 2VDQH 3PGCA 1D5ZA 3QHFH 4XP6L 2YA1A 1YYMH 3SHSA 1OTUC 5C0BA 4J23A 3IKCA 4CJ0A 4L8DA 3KYOA 2VO5A 4QCIA 1J12A 4XZUB 4XTRC 1HYRC 1AGFB 1PQZA 2F5BH 4JHWH 3T3MF 5C7XH 3FQUB 3MLVH 3OZ9L 4XMKH 4XP9L 2EIZB 4GSDL 2QKIB 2XNAA 4LCIH 1TNNA 2VDPH 3I84A 3BYTA 2VZOA 2E7MA 1RZJL 4ZXBB 2EDBA 3M17A 5F7DB 3U0TA 5TDPB 4PS4H 1WEJH 2BMKA 4CW1A 4LLVA 5K9JL 3FFCB 2FHBA 3QB7C 1RZGB 2EEAA 4N0FA 3GSVA 4ODUA 3SDCA 1VEPA 4LEOB 3VGGA 3FO0H 1LE5B 2YD8A 5I6XC 4JANA 4MZ3A 2FJHB 1FZOB 4Y4HA 1W0WA 2FD6L 3DRQA 4DCQA 4R97C 1AP2A 3IFLL 3OKNA 4DEPB 25C8L 2F9BT 5DMIL 2DLFL 1JMZA 4D9RE 3VXNB 4I2XB 5JPMB 3ZDYE 1OTUD 2ICWB 1H9VA 2Y5EA 3A0OA 2AEIT 3BDXA 3HR5B 5F9WB 3T4YB 4QRRE 2RQ8A 3QFJB 3UTSD 3OBAA 5IM7A 4QHLB 4XTRD 4NC1C 1I3GL 5CEZH 1PSKH 4XCEA 2ZSVA 1OTTC 1RZFL 2H32H 4CNIA 3P4OA 2GK0B 5J11C 3JTTB 4K9EC 3GRWA 1A14L 2PO6A 4KMTL 4HC1H 4AQ1B 3CDCA 2BCKA 1AR2A 2MHAB 1FZKA 4O51A 4R4FH 3V6OA 1LO0H 5GS1C 1PJ9A 3NPZB 4XH2B 3UYPA 4BSWA 2XQYG 3MX0A 4JM4H 4I3SL 1GL4B 3B2VL 2C3XA 3G5YA 3U4BL 4GRWH 1EBPA 4QTIL 4FFYL 2DQJH 4IDJH 1EO5A 5JHDE 5DJAA 5TH2B 3RL1A 4JRYE 5AAWA 3GSNH 3HC0B 3E2HC 4N1EA 4PY7A 3PP4H 4PJBF 3VD5A 1KJ2A 1DLHB 1SVCP 1NC2A 3OHXA 1ONQB 4JFHE 3IFNH 1OGAB 2FIKB 5DR5H 2VZUA 1BOGA 4KQ4H 1RJCA 5I73C 2ICEB 1AD9A 3NIGE 4G6JH 4GW5B 4S1QH 4NQEE 1QO3B 5AD0B 4P57B 2Q20A 4JZOB 4GKZA 4GG8B 4BFBD 1JFQL 2FJGA 3NZ8B 4HKBA 4X7CC 1A3RH 5LXGH 2ZCLH 3PJSA 4PRIB 4AIZB 4JY6A 1ZA6B 4QOKB 3P4MB 3UX9B 3DRTA 4X4YB 1OTTD 1J11A 3BH8A 5L8LB 1VPOH 3BQUA 4NQDD 3LN5B 4DJMA 3CMOH 7FABL 1IFHH 5EZLA 1FFNA 4DVRL 2OR9L 4JZJB 2LFGA 5F3HA 4GLRI 4ODHH 5GGQL 3SE4A 4RGNC 1FFQA 2XG5A 4JQIH 1N5YL 3OGCA 1FFPB 1TPXB 5TDOA 1M7XA 4R8WH 5M7QA 4K9EL 3DXAA 2Q6WB 2JK5B 4Q9CA 4HH8A 2D0FA 2GKIA 3DIFB 3KJ6H 4ZFOA 5BS0A 2FH6A 5IWLC 5D8JH 1ZHBB 3S5LA 2VLJA 1KCSL 4YEFA 4G8GA 2DLIA 4XWGL 2BXYA 3EYUL 5B21A 3DJ9A 3F65A 5GGTL 3DUSB 2EKSB 2BNQA 4FTVB 1CYGA 3MUY1 4K8RH 1FGVL 2JTDA 5AEAA 4M5ZH 2N7BA 2EDRA 4X6DE 2HJFA 4HK3J 5M95B 1C7SA 5C0AA 4HUNB 4R0LA 1G7JB 2RJMA 1NBZB 3T65A 2OTWB 3AMLA 1S7QA 3GB7A 4YAQA 3T0EE 2ADGA 1XMWA 1TENA 1AO7B 3P4NA 1DBAL 3VXPB 3CVIH 3MV8D 2XICA 4IIQC 3U9PL 2HFFB 4YXKH 3ARBB 1RJLA 3WEXA 2Q7NA 3KHOA 3GGWB 3WN5A 5HYJA 3LKSB 1U6AL 1QLRB 3ZO0A 1K4DB 3PQYA 4IRZH 1QHOA 4HH9A 1JNHA 1HH6B 3QDGE 1LEKA 5IHZA 2BY1A 2AJVL 4UV7L 1NCUA 5EU6D 4JRXB 4CDHA 1J8KA 3VGAB 4X0KB 4NKMB 3LZFH 2MSPA 2FX7L 2GT9A 4LVNC 5F1IB 4LKCB 4APQC 3KPQA 3UPRA 5I1JH 1F4WL 3MUJA 1BQLL 1YNKH 3V4UL 2XZQL 4Y16B 1KN2H 1BAFL 3TBSB 1HILA 4PB0L 4V1DB 5BVPH 4P23C 5SX4H 1KJMB 5HDOA 3L3HB 1RFDH 2XFXB 3DYOA 3S35X 4XCNA 2CDFB 1AKJB 1BM3L 2QKIA 4PG2C 3MREB 1IM3A 3GHEH 4FQXC 2H32B 4OLUL 3U0PB 4LGSB 1CDJA 1U3HC 3AREB 4ZXBA 2E8YA 4PRHB 3LN9A 5TDPA 2B1HL 4M6ML 5T5FL 1YYLL 4YHMH 3FFCA 3LEVL 4O2EB 1QFOA 3BWAB 4LEOA 5F3BB 1LE5A 1A1MB 4Y4FC 3CZFB 4UDUB 2BVUA 4GRWB 2FJHA 3C9NB 1FZOA 2BSTB 4IS6B 5HI3C 3HPJB 2X41A 1CE6B 3GSNB 4H1LA 1KCRL 3WFHB 3QJHB 2JCCE 1AQDB 2E3VA 2DLGA 2J2ZA 1G7QB 2RIKA 4I2XA 5JPMA 2RAMA 2ICWA 3R4DA 4CBPA 5FEBA 4HK3N 3G9VA 1JYXA 3FAXA 2J8UB 4JFZH 5AUMA 2IBBA 1JGEB 4EIZC 1A5FH 5DQJA 2J8UF 4P23D 3H3PH 4GXVL 1S7SB 5HDQH 3RNKB 1EERB 5JA8B 4RMVA 4KI5F 2GK0A 2GCYB 4B7LA 5KVEL 1QRNB 35C8H 5E0QA 2MHAA 4JO3H 2R4RL 4FQXD 2W0FB 5EUOB 5C0IB 3SE8H 2NX5B 5D7KE 4DTGH 3OPZH 4XH2A 4NYLB 1ZGLB 4E42B 3BP7B 1OPGL 2UZYB 1QLFA 2R0WH 2XZAH 5EUOF 2VNCA 4WHCA 3S6CA 4NKOA 2FB4H 2QSVA 3MV7D 4GFTB 2E8ZA 4PJBA 1U91B 3HE6C 2FZ3B 4N0UE 3ARSA 4Y4FD 3KS0J 2XOTA 4NUGH 4XMLL 3HC0A 1A64A 1S5IL 3RDTB 1UZ8B 4FG6C 4PJGF 5JW3L 1DLHA 5HI3D 5J8OA 2F74B 1FVCB 4HK0A 1OSZB 2WBJC 5DF0A 1VSCA 4MJID 3UTQB 4IM8A 4DVBA 1FPTL 1OGAA 3SN6N 4LAQL 5EG6C 4BELD 2ICEA 4U0RC 1U8KB 2I60H 5HGDB 4GW5A 5KJRL 3CLEH 1QO3A 3H9SD 4P57A 4R7NB 5IFHH 5JR1H 3I2CH 1RPQA 2DIAA 2X10A 3NZ8A 4JHAL 2FBJH 5MEPB 2YSSA 3OJDB 1PKQE 2EDTA 3O4LE 4G7YL 4RIRB 1OT1A 4GUPB 1AIFB 2H8PB 5KZCB 4PRIA 3VRJA 2H3NB 3P4MA 5DQDL 1FNFA 2HJKA 3VU2A 1F3DJ 1AGEB 5IESH 3HE7C 1AD0A 5D7JB 1L0XA 1FGNH 3MRJA 4JZJA 2EH8L 4U1GC 1T2JA 4YHIB 5TPWL 1HIML 4PRDB 3RIAK 3WLWC 5E6IB 4JVUA 1A7QL 2J8OA 3QWRD 2JIXB 3OKMB 1CL7I 1OB1B 2AXGB 2EDXA 3GNMH 5E4IA 2Q6WA 1A6VL 4GBXB 1NEZB 2JK5A 1I9JL 3HE6D 3DIFA 1CCZA 3CU1A 1S7XA 3F58L 3IRPX 4HS3B 1H3WM 4KRPB 1J0IA 4FG6D 1X5ZA 2HRPH 1NKRA 4OT1L 1IAKA 2WBJD 4KDWA 1AJ7H 2XWTA 2EKSA 2ZCKH 3DUSA 3WFEL 2HYMA 3RTQC 4QRRB 1K4CB 5BRZE 3LS4H 3ZDYF 3SE3C 5IB1B 1QSEB 2YA0A 2EEBA 5INCB 4HFWB 3TCLB 3UC0L 3ULVF 4NQCA 4PTUB 1TITA 1KLUA 1NGYB 3L3OB 5FOJA 2NNAB 4XCCH 3QJFA 2OTWA 5D96B 3S3PA 3A67H 4FP8H 3EZ8A 3CVHA 1AO7A 3HMXA 4ZPVA 3VXPA 1ETZB 2APTA 4TOYH 1ZANL 2V17H 1E4WH 2HFFA 4ORZC 3ARBA 1T1XB 5I1LA 3LKQB 1KN4L 3BIAX 3GGWA 4AM0B 4K7PY 2RCSL 4M43L 5E2TL 1ZT4A 4H0IA 1QD0A 5JHDB 1OP5K 3WLWD 4Y1AD 3BJLA 4YHYB 1YMMA 1FDLL 1HH6A 4YUEL 1Z9MA 1M7DB 1K5NB 2WK2A 4HLZG 4WVRA 1QR4A 5I9QC 4NKMA 1KEGH 4L4TE 5C6TL 1MF2H 2C7UB 4G8EB 5F1IA 2OXGA 4LKCA 4PTTA 5BZWA 1JNLH 2YWYA 1EMTH 4NQEB 3H9HB 4Y16A 3RTQD 5HVFB 5CEXA 2AJZA 3L3HA 2LVCA 4JDVA 3UEZA 1QBLH 1DANT 2XFXA 5IB2B 2JJWA 2CDFA 1IGCL 3SKJL 2VUOA 1ULVA 4QRSB 4U7MA 1I8KB 4BQBA 5I71B 2V2WB 3QAZC 2AW2A 2VH5L 1OAXL 2YPVL 3U0PA 2BRRL 4Q6IB 3LPFA 4PRHA 1NANI 4WUUE 4JM2F 4TYUA 4HIXL 3TT3L 4O2EA 4OD1L 2A0LC 3D1MC 3WJLC 4HLJA 5TDNB 3SCMB 1KLGB 1A1MA 2ZJSL 3CZFA 1C5BL 4UDUA 4DZBB 4FQQA 1QNZH 1Q9WA 3HG1E 3WNOA 5I1IH 4NO5B 5DUBA 1F00I 3HPJA 4OCMC 1J1PH 5F7NC 1CE6A 4JPKL 3WFHA 3BPLB 1AQDA 4M7LH 1NDMB 5CGTA 1G7QA 1QFUL 5DT1L 3DUUB 1HXMB 4QO1A 1D6EA 1P4BH 2GJ6A 3BT2H 1OL0A 3IDMB 3GKWL 2J8UA 2Y7QB 4CVXB 1HI6B 3N9GH 1F8TH 4X6DB 1C5DB 1JGEA 4PUBH 4XXCC 2YHGA 3GZKA 4GRLB 1YEGH 4PJXB 1I8LA 2YD7A 5H94A 2EDJA 5E8EB 3LN4B 2OI9C 3RNKA 1RJZA 2BJMH 5SWZE 1S3KL 2VYRE 4PJXF 2C1PB 5D9SB 2GCYA 1QRNA 4PJ9B 3BH9B 4KJQC 5C0IA 2W0FA 5EUOA 5DMKA 1QZ1A 1JTTA 2NX5A 1PEWA 3CIQA 3TT1H 3C87A 4NYLA 1ZGLA 4E42A 2NLJA 4K71B 3GMPB 5FUOL 1NMAH 2A0LD 4PJGA 3BD5A 1U91A 2DM2A 2VB5A 4UT6L 2FZ3A 3QDGB 5ACZB 2DI8A 4XGZA 1ROWA 3F6IA 3O11B 2FWOB 4P2YA 1IM9B 3P9WB 2AK1L 3FOLB 2F74A 3HS0B 1FVCA 1OSZA 4JB9L 1RZ7H 3MXWL 3UTQA 3UYOD 2XWJA 5FA3A 1N26A 1QG3A 2A6KA 2WLZA 3C08L 4QXGH 1SHMA 4MVBC 1JE6A 1R3LB 3QHTC 2Q86A 4R7NA 3HPLB 1AGCB 1WZ1H 5MEPA 2AK4E 4RIRA 4FFWD 3SDCC 3TEUA 4GUPA 2H8PA 4RMRA 1FO0A 2H3NA 1MEXH 1CXLA 2VE6B 4ZUVB 1D5BA 3PV7A 3VG9B 3E0GA 1GAFH 4YXLH 1AGEA 5D7JA 3A6CH 2EE3A 4KJQD 3MRIB 5CP3H 1VEOA 1XF2B 2J6EH 1ADQL 4K94C 4XPBL 1P5UA 4JDZA 3SGKA 1IGJA 4NO3A 5IW1A 1YY8A 3CPLB 2AXGA 1OB1A 2ZUXA 3OKMA 2PTUA 4DZ8B 4GBXA 1NEZA 3IDNB 5F7KC 3IKKA 5E94B 1W72H 2JCCB 1G7LB 3B3IA 4WJ5B 3S88L 5GJSH 4E41E 1GC1C 3BKMH 4ZD3L 3GI8H 3OR7B 2DQIL 4MA8L 2I9TB 4GXUN 2PO6C 1K4CA 4QRRA 3GBML 4YDIL 1EHXA 5CD5C 4NO2B 4D3CL 3V6OC 2CKNA 4LSPH 1OLLA 1QSEA 4MVBD 5INCA 4O4YL 4ZAKA 3WFCH 2BDNL 4G5ZH 1QPPA 2NTFB 4AG4L 5IT2H 2VQUA 3QXWA 4S10A 3L3OA 1NGYA 1EH9A 5IMMB 3DTXB 2NNAA 3X14B 5ISZE 3SDCD 3D0LA 4WI5A 3P30L 4WHTB 1A7BA 1OP3K 1BQHG 5HYQB 2IG2H 2ZOKB 4WTZA 2BVOB 4PV9B 4O9HL 4QRQA 4MXWH 5L9DL 4AM0A 4UTAL 4N8PA 4JQXA 3O2VH 4I18B 5JHDA 3C6LC 2AJUL 4N0UB 1R5WB 2OS7A 3INUL 2AVGA 3F7YB 4LU5H 2O5ZL 4RX4D 3RGHA 1UXSA 1A7NL 2GI7A 3QR2A 1C16A 3K46A 5D6CB 3CDYA 3JV5A 3MMEA 3B8SA 2P4AB 3BHBB 5ALBL 2BOBA 4K94L 4BK5A 4UDTA 5KANI 3GSXB 4M00A 2C7UA 3BEVB 4ERSL 3FB8B 5T3ZE 1LHZA 4G9FE 3BQUC 4KK8C 3KJ4C 5DD6B 1A6WH 5CD5D 1PKQB 4OD3L 3SE4C 2CIIB 5IB5A 1AHWB 1GC1L 3WSQH 2IWGA 1FZMB 1GGIL 4HFUH 2DMKA 2V2WA 2MKWA 4JM2A 3TN0B 3GRWL 4RNRA 4Q6IA 1AI1H 4YDJA 1P4IH 1NFIB 1IL1A 3O2WL 4PJ5D 4F57H 5TDNA 3SCMA 4NQXB 1KLGA 4XHQA 2CLRB 4JO4L 2DQEL 1ZSDB 4HHAB 4OBRA 4X7DC 3C6LD 4NO5A 4I9WE 3LDBB 5C07E 5CWSA 2W1NA 4ONFH 1KJ2L 2EICA 4R0LC 1ZLSL 2UWEE 1HXMA 4GT7A 4NC0B 5J6GB 4J3WA 5D7LB 2NMSA 3AS3A 5BRZB 1JV5B 1T1WB 3IDMA 1DQLL 5AG8A 4QYOA 1OAKL 3S97C 2DYPB 2R29L 3BQUD 4KK8D 4PY8J 1YQVH 1D7FA 1WTGT 4PJXA 1AE6H 3QZWA 4ODVH 2X1QA 2FL5B 1CWVA 2I26N 5E8EA 3LN4A 4P4RB 3WN5C 2WQ8A 1KTRL 3WNMA 2ZUYA 2ENSA 3STZB 5D9SA 1DQDL 4P4KB 3I85A 3L7EA 2CGRL 2A74B 5CJQH 4OB5H 1WBYB 2G5RA 3DXAD 1FYTA 2M8XA 5T1DH 3L5WA 3VXOB 2CJUH 5BS0D 3O0RL 4WHYG 2MQCA 1NBYB 5CGMA 2VLJD 4G8GD 5DD5L 4ODBD 5ACZA 1ZS8A 3I3EA 3O11A 4HS8L 4CRPA 2BNQD 4ELMF 4H8WH 1FHGA 5JTWA 1IGFL 1NCWH 3W81A 4ZFOL 3FOLA 3HS0A 1W72B 1YEJL 4L4TB 3GSRB 4IMLB 3FB7A 4M7KH 1FLRH 5AZ2H 4LSRH 5C6WH 1N0XH 3TLRA 4TSCH 3QPQC 2BK8A 3KGRA 4ZXBC 3V95A 2R1XB 1D5MB 4F33A 3HPLA 1AGCA 3QEUB 1T7WA 5JORB 1ZEAH 4G8FB 1A4JB 2JJTA 2VWEE 3PWJB 2VE6A 4ZUVA 4P59H 5IBUG 4M1GL 5HYJD 4U31A 4TVPE 1OY3B 5TF1L 5E99L 3MRMB 3PQYD 4M7ZB 3MLYH 3HN3A 5DI8B 4DEPC 4PB9L 3NCBB 3G6DL 1XF2A 5DRWB 5E2VH 3BPNB 4OKVB 5DLMH 5D1ZB 4EI5B 3CC5B 1JL8A 1JPGB 1MCDA 3BAEL 4YX2H 3HG1B 5FYKE 4C57C 4HLZH 4DZ8A 5F9WC 1XGYH 2P24A 3EYVA 3P0GB 1JGLL 4NQVA 2G2RB 3JUYA 4I77H 5E94A 3KPSA 3QEGH 4CU6A 1NGZA 3VFUB 2JCCA 4NWUH 5E08H 2AJSH 4WJ5A 3S37H 3SKUD 3IDJB 1HDMA 4XP5H 5DD1L 1T2XA 1CQKA 1G0DA 5T3ZH 1T4KB 3D18B 2KQNA 2PYFB 1IZKA 2A9ML 2I9TA 1U92B 3MV9B 5CBAB 2ZPKH 3LEYH 3QIBB 3QNZA 4YEEA 3QPQD 2CD0A 4W68A 3WLBB 4ZXBD 3KG5A 3IFOB 4WUKL 5IMMA 3DTXA 3FFCD 3QDME 3X14A 5CZVH 3QISA 2A6JB 43CAB 3X3FL 1CI5A 2YXFA 3LQAH 4WFEE 4GW4A 4FQJH 5FB8B 5I0ZA 3O3EA 4KUZH 4PGCA 5GRXG 3EOAB 3H42L 4WHTA 4X9IA 5D71L 5JW4Q 5GISH 4XNXL 5KW9H 2ZOKA 3QWOA 5CCKH 4M8QB 1Z5LB 2BVOA 4PV9A 1MLCB 4EXPX 1QP1A 3MOBH 5DJ6B 1BD2A 4ESKA 2DL2A 3BOVA 3I50H 1FL6B 4LDOB 3RAJL 3F7YA 5EC2B 2D9CA 4ZFFB 2IPTH 1LD9B 1RSFA 3NACL 3R06B 1ORQB 3QFJD 5ELIA 1MRCH 6CGTA 4N90E 3BHBA 5ID1A 2XA8H 5ECJE 1Q94B 2Y6SC 2OXHA 5GGUA 5MP6L 2B2XL 5D72L 3BEVA 3KYMA 2L4OA 2V5YA 2F58L 3E1F1 5CGYC 1OD9A 5FYLE 5DD6A 4XCYB 4JZJC 2AK4B 4OGXL 4QHKJ 1XF3A 3ZYJA 1NMBH 2CIIA 3RGVB 5IGXL 4LASL 3KWWB 3QFDB 1M1SA 8CGTA 1IC4L 1IKFH 1TPXC 2I07B 4NP4L 4MB4A 4C59B 2OK0L 1IKNA 2F8VA 1QFPA 1OT2A 5CUSH 2C3GA 3RL2B 1NFIA 1ZKAA 4XP1L 3ZDZE 1FIGL 3ROLB 4OIBA 1MRDH 5EIIB 4BQ9A 5E56A 1NGQH 4TUKH 4P49A 2R1YA 5HHNA 3OF6A 2V7HB 1OGAD 1ZSDA 4HF5H 5C0DA 4NFCA 1L9NA 1UWGL 4C4KO 1M71B 1LWRA 1JZ8A 1AGDB 1T0MA 1YEFL 1WBZA 1H3VA 4E41B 1RUPH 1AY1L 3RA7H 3U4EB 1U58B 5D7LA 3GUTA 4PYGA 1ZXQA 2Y6SD 5DZLA 3MO1B 1NUGA 4PRID 1JV5A 1T1WA 4QOKD 1E4XH 3PV6B 4G8IB 4EBQL 3OKLB 4YPJA 1DBML 3NIFE 5E6ZA 4M7JH 5CGYD 1GGBH 3ARBC 3IDGA 4XBGB 1LO3L 4KPHL 1HCFX 4EQ2A 2FL5A 1SJVA 5I74B 5ISZB 4P4RA 1KNOA 4WTXA 4TVPH 3JSSA 4NCC1 5ADPL 4OZGE 2VERN 4ZSOE 4ISVB 5EORH 2R0KL 4JDTL 5GQBA 3D5OF 2A74A 2BZDA 1WBYA 2UZXB 5DJZB 1MHCB 4DQOH 3MGOA 3WE6B 4CMHB 5C0RH 4TSBH 4UUJA 3VGAC 4F7TA 1MFCL 5JXEA 3L6FB 1IJ9A 5CP3A 2C4XA 5FYKH 4JY5L 4DK6A 1YC8A 2J6EA 4ELMA 3QEQE 4KMLB 1NBYA 1J5OH 2WUCL 4OGYH 2DL9A 4PJEB 1I7TB 5LWYL 4Y16C 1ZGLM 5F7EL 1B9ZA 1OAYL 4OM1H 1MJUH 5MI0B 1KIRA 3SQOH 3U36B 4QGYA 1FNSL 4PJEF 4OJFL 1W72A 4L4TA 4Z95H 4HGWB 3GSRA 3OKOA 3QHFL 4IMLA 1YYML 3QUYB 1TZGL 5AZEH 3SKOB 3T0VA 2QQKH 4G9FB 3AREC 4X4MA 2Q87A 4DKEL 1TZIB 1NCBH 4BYHA 1AO7D 1D5MA 1YUHA 2F5BL 4F7EA 1ZMYA 2JKXA 2NPLX 5KVDL 4ODWB 3QEUA 5JORA 1JPSL 1KENL 4HX1B 3H7LA 4G8FA 4UOW0 2R2CA 4U1SA 5A2FA 3UTTA 3QPXH 3ARBD 3PWJA 1T03H 1NH6A 4UT9H 4MA7H 4QHUB 4X80L 3CVHL 3DROB 4DN3H 3HMXL 2EYSA 2M2DA 3MRMA 4AK1A 4PY8I 4TRPH 1YMMD 3STLB 5DRWA 4JRXD 5GS0C 4JJ5A 4OKVA 5D1ZA 4NM4H 4G42B 1RUMH 2Q76A 3CC5A 4WI2A 4Y5VA 1ODAA 3TNNB 2QADB 4L4VE 5C07B 3G6AB 3VFUA 5E1AB 3BP5B 3ME0A 4Y16D 3BI9X 1DQQB 2UWEB 4V1DD 3KPPA 1I8LC 3LHPL 5DD0L 1KCUL 1JGVL 4U6VH 3D18A 4LARL 1UWXH 1AKJD 5CEZD 5J4MA 5KTEL 1OQXA 5HHOA 5FYLH 2IMMA 1U92A 2QLVB 4OTXL 3MV9A 2QSQA 4AMKH 3DBXA 4OCXL 4PREA 5J13B 3ARED 1HINL 1MI5E 3TYGL 4UIKH 1XF5B 1FL5B 4PRHD 3BP4B 3IFOA 1Z9SA 5E7BA 5IHLB 4M9PA 1FVDB 4G9DB 4LSSH 4AEHL 4DGYH 4EN3B 43CAA 4RFOL 4JPIA 2ARJQ 3DECA 1JF6A 1M7IA 1MCWM 2XQBL 3IVKA 3MXVL 1N0LA 4M8QA 1Z5LA 3EBAA 5T3XE 1MLCA 4PYHA 2XN9E 1C8PA 1GOFA 5DJ6A 4CVZB 2P5EE 1FL6A 4U2YA 2E9JA 1F90L 1N2RB 2UYLA 4KQ3H 2HH0H 4RMTA 5GS0D 3O2DA 3QUML 1TZHA 4OZIE 4WW2B 4ZFFA 3H7BB 3QQ3B 1KIQB 1LD9A 3MLTB 4K8RC 5TQ0L 4K7PX 2DLTA 1ORQA 3WDHA 3PP4L 1E28B 1LK3H 1NBQA 2AGJL 3GFUA 3MRHB 2EXWC 2FATL 4ZUTA 5DD3H 4L8CB 3MRLB 1MLBB 5GS0L 5JDJA 5HDBE 2MOVA 1UYWL 1WJ3A 3WFBL 4MB3A 5SWQB 1UWEH 3IFNL 1X6LA 4D9QD 3LB6C 3ARGA 3U7YL 4TQEL 2IQAA 3BD3A 5D1QB 5D7JC 1EO8H 1QRND 5DJYB 1G7PA 4S1QL 1N7ML 2AK4A 3BGAA 5JUEL 4WFHE 1VDGA 3RGVA 2EDQA 2NX5D 4JVPA 2Z93B 4L3EB 4G3YL 5KOVC 4MAUL 3SGKC 2APVA 2R69H 3HI5L 4KFZC 3LQZB 2O61B 1T89A 3SY0A 3EIFA 4GS7B 4LCYB 3BKJL 4GBXC 3G5XA 5SWSA 2B4CC 4MX7B 1ZVYA 3W5MA 4HXBH 1WAAF 2ZNXA 3RL2A 4X4ZA 1IFHL 2XY2A 4KK5C 4KRPC 4UMGA 4OFDA 1B4JH 4RGOL 5HPOA 3O6FB 3HCVB 4JFFE 1R5IA 5BZDA 1RV6X 3VG0H 4P3CL 1YY9C 2AQ1A 1LO5B 1M71A 1S9VA 4NNXB 2VXQH 1AGDA 5C0EB 5IVXE 4HIHA 3NTCL 4E41A 5TE7L 1RUKL 3KJ6L 4K8RD 3EYOB 3U4EA 2WINB 1U58A 2EXWD 5D96C 5KZCD 1U93B 4OZHE 3P11L 2K9UA 1HKFA 3PV6A 2J88H 4G8IA 4K8RL 3LB6D 4HKJB 3UJIH 2CMRL 4PRBB 2WIIB 5D7JD 1KELH 2VISA 3QDMB 4KWUA 1LEIB 1YEKH 1FO0L 5EC1A 4JQXC 3L5HA 4ISVA 5E6ID 4KZEH 1NUFA 1BQHB 4YHYC 2N7AA 2JIXD 3C2AH 3ARZA 3PIQB 2Y5TB 4GBXD 5CEYA 4QHKI 3RPIA 3JWDH 2QHRL 4R90L 5BVJA 1W0VB 1MJ8H 3VFRB 3L6FA 4YXKL 4KK5D 1HH9B 4KRPD 2N4IA 5DUMH 1Q1JH 4PJEA 1I7TA 2WWKO 3NA9H 2B4CL 3SGDH 2G5BB 1BFSA 1CZ8L 4QRRD 1YY9D 3U36A 3WS6A 2W91A 1G84A 2DIBA 1QSED 1QUNA 4HGWA 4L9LA 3WFDL 5MEQB 1NL0H 2OSLB 5I71C 2NW3B 4UBDC 4JM2C 5JHLL 3VXSE 1U8MB 3ULVL 3CD4A 4Q6IC 4U7SA 1HSBA 1TZIA 4KKAC 5HY9A 3CXHK 3F5WA 1KN2L 3WCYA 2SEBB 3ECBA 5I8EA 2Z35B 4ODWA 4HX1A 5IBTH 1JVKA 3OKKB 2XG4A 3SCMC 2R1WB 4U6HB 3RRQA 5MEOA 3VXUE 4NRXB 1VA9A 3T2QA 1ZT7B 4OCNC 4XNYL 4DAGL 5T3XH 5JHDD 1R3KB 2VC2H 4QRUB 1JRHI 1N3NB 2YMXH 2UUDK 3BPLC 3PNWA 4UTBL 3JWNC 4MDIA 1T21B 4OLYL 4YHML 4HQQH 2YR3A 5SX4I 2DTSA 3NABL 4L3AA 5B38G 4OBSA 2DD8H 1JNNL 4JFYA 5C0JA 2Q8AH 3ZKXB 5GRVL 4P3WA 2VITB 5K9KA 2DQDH 5E1AA 4HUUB 3VDCA 1DQQA 4GRLC 2A6IA 1XR8B 1FLTX 4IRSA 5ILTH 4EUPG 2OP4L 5IROC 3BGMB 1OLZA 4OFVA 3O6LL 1IBGL 2EH7H 1BJMA 1L7TH 3TYFB 3FN9A 4PJ9C 4UBDD 1S7UB 4XBPB 3VMPA 1BIIB 1ZVHA 5J9PA 3PWLB 3W9EB 1JGDB 1VFMA 4KKAD 5GZNC 1FL5A 2VR9A 3FMGH 3HZMB 4WU5B 1A5FL 3BP4A 4K71C 2XZCH 5C2UB 1FVDA 1ZTXL 4EN3A 1YECL 4ZSOB 1Z0MA 1OOAA 1INQB 3X12B 2F5AL 3TGXA 1JI1A 3MACH 3SCMD 1N6UA 3NCYP 2GIYA 1G9ML 4HJGA 4JHZA 4H88H 1HHJB 2RGSA 3UDWA 4HPOL 4EDWL 4K23H 3REVA 3U6RB 1JGUH 2G9HB 3W0WE 4S2SB 4W70A 4CVZA 2YD1A 1E6OH 4G80A 3V4PL 2HTLC 1DLFH 1N2RA 3MRKB 4JKPL 4NO0B 4S1SL 3H7BA 2AV7B 3QQ3A 1KIQA 3B83A 3MLTA 2V5TA 1XAUA 3GMQA 2H6PA 3LPWA 1U8PB 1CDYA 1E28A 1NSNL 1OP9A 2ARJB 3MRHA 4L8CA 4NN7B 5I8KH 4GRLD 2JJTC 3OAYK 3VG9C 1S5HB 3R1GH 5SV3A 5SWQA 1IQWL 4JFPB 2PNDA 4WENB 3MRNB 1Y6KR 3MUZ1 3C5JB 1RULH 1FC1A 4OF8A 4X6EB 1C12B 3FN0L 4BFGA 5FGSA 4PJ9D 3S36H 4GQ9L 2F54A 4CADB 5IBUB 3LIZH 3CFDB 4L3EA 1WIOA 2HRLA 4M62H 4DOHE 5GZND 2VXTH 2KBGA 5DK2A 1XGUA 1WAAA 3LQZA 2OQJB 4MGXA 1ZWIA 5FHAL 1T6VN 1QBML 1WC7B 4MX7A 3QDGD 1CGSL 3B6SB 1VEMA 2D7OA 1IM9D 3VXMB 1UENA 1INEL 3O6FA 1I8MA 3HCVA 1CIDA 3DHMA 3BVNA 3O6MH 4L4VB 2BHZA 4WY7L 3T2NL 3GNML 3QWQB 1LO5A 1HCVA 2B0SL 5ERWA 5CBEA 5DFWH 3W5NA 4NNXA 2DJSA 5C0EA 5JXAL 1CR9L 2H26A 3IJSA 5DFTA 4LSTL 3EYOA 2B1AH 4QF1B 1MHEB 3HI6H 2WINA 3OG4B 2VDLL 1MELA 3TJEH 2D2OA 4HWEL 4GMTH 5HPMA 5DQ9B 2G60L 3ZE2F 4O02H 1L7IH 5EBLA 4PGBB 1MI5B 4HKJA 2CLVB 4PRBA 2WIIA 3GHBL 3MBEB 1OGTB 5CSBA 4S1RL 2IC2A 2ARWA 4IRJB 1BIHA 4X99B 1AXIB 3QDHA 3PXJA 4PPTA 3JV6A 3BW9B 1FN4B 1EJOL 1N64H 3F6LA 3ARTA 1BQHA 2K7PA 3U2SA 3A67L 1BJ1J 1QEWB 2Y5TA 3PIQA 3EYFB 1MFEH 3SQBA 3ZT5A 4X7SH 3VFRA 4TOYL 2P5EB 2VLRE 2XT1B 3EDDA 5IB4B 1LE9A 2J1KA 3SDAA 1HH9A 1DBJH 3W82A 5IEKB 3VFWB 1U41A 4ZQKB 1LO4L 4OZIB 4N0YH 3B9DA 2E6QA 4XC1L 3HZVA 2HFGL 4POZC 1RU9L 4LCCB 2G5BA 5DJ8A 4XPGL 3V9FA 1HZHL 5E03A 5GRVK 1A6ZB 5F9JB 1AHWC 4HEME 3LV3B 4OFPA 3U83A 2ZUSA 2NW3A 1K6QH 4ZNEA 1UM5H 4XPTH 1IKNC 2IANE 5HDBF 1F3JA 4XNQB 5DJ2A 2AXFA 1DTUA 5E8DH 4GKOA 1FAIL 5IFJB 2SEBA 1MFNA 2Z35A 4TULH 4MDJB 2Z0BA 1MFBH 1CLYL 4DK3A 1QBLL 2R1WA 4GG6F 4OIIL 4YHOH 3SDDB 3WS3B 1AC6A 1YQ2A 4PGDA 5ADOH 4K3JL 1QSZA 2G75B 2IJ0C 1U2HA 2XIDA 1DEEA 1SJEB 3TBVB 5FHBL 2YKLH 4YFLF 3SJVE 4GKSB 3VFMA 4YWGL 4NQUA 1DP0A 1N3NA 1OQOA 5GS2D 2FX9L 3SDXF 4JFFB 1Z2KA 4MD4B 2R2EB 2CK0H 1D6VH 4FNLH 2ZOLB 1NGXA 3VFNB 4F8QA 2VITA 3RWFA 5IVXB 2QEJA 5IB3A 4HIIB 4POZD 5FA4B 1KC5H 2AJXL 3VJ6B 2P49B 4NOFA 1EEUA 4F37K 1TTFA 5IVXF 3BGMA 4NFBA 1Z6JT 3KLAB 4OZHB 2YUVA 3VCLA 3BT2L 1OSPL 3ARQA 4HBQA 1S7UA 4MHHI 3O8XB 3TN0D 1Q72L 1WF5A 1BIIA 5IK3B 5KSBE 3PP3H 3PWLA 3N9GL 4OZHF 1X5HA 2P1YA 5BO1L 1JUFB 1J88A 4WU5A 4YLQT 3RWEB 2WANA 3D2UB 2W0PA 2W07A 1I9IL 1QLEL 1WT5A 2EIEA 4WDIA 4ZSOA 3N85L 1W8OA 1INQA 1LK2B 1WFOA 4XPFL 1HHJA 2J4WH 4NDMB 4AYFA 3U6RA 4OGAC 5FGBA 3GMRB 4ONHB 1CG9A 3KAAA 4S2SA 4EVNB 1HEZB 4W4OA 1U8HB 5GGVH 5CFHA 1I75A 3MRKA 4NO0A 1WFTA 1LGVA 1V5JA 5D7LD 4KRNA 4HJ0C 1VACB 2BP3A 4YZFF 5BRZD 3GBNL 3IB4A 1S9XB 1B0GB 2DYPD 4YBHA 4IJ3B 3P9LB 3OAUL 1RIVH 2PUQT 1B6UA 2AKRB 2ESVE 4Y8AA 2DF3A 4S1DC 5TE6L 1OF2A 3VXSB 5LBSL 1IVLA 4JFPA 4P5MA 4D0BA 3QQ4B 3MRNA 1E27A 4XXDB 3C5JA 3CFEB 4X6EA 1C12A 3VFGH 2XA3A 1RZKH 3WO4B 1RMFH 3QUXB 1EO7A 4MWFA 2VLME 1NCAH 4PFEA 4Z0XB 1LDPL 4LEXL 3CFDA 3BPNC 4MJ4A 2IADB 3VXUB 5D1ZC 4EI5C 1AFVL 5F7UA 3HHRB 2EC8A 3MPCA 2AERT 2YBRA 2ADJB 1A3LH 1E6JL 4YHPB 1MSPA 2C5DC 3MLWL 4GLRH 2EYTB 2YRLA 4WCYH 3B6SA 1F11B 4M1DL 2ICWJ 4XVSL 4HCRH 2JB5H 4OGAD 1QA9A 2DOCA 3QUKB 3VXMA 3ARPA 15C8L 1KTLA 1V7NH 2J6EL 4L4TD 2AEPL 5CP7A 5GRUH 4Z7WF 2NY5L 4R4BA 2CRMA 1FNEB 2C9AA 1BX2B 3VFVA 5HD8D 4KDTA 2VDMH 3MR9A 4HJ0D 4P46A 3TH2T 1Q0YL 1W72L 2ENYA 4KJYB 4PRAB 1P6FA 5EIVA 4UAOB 1MHEA 4WTWA 1PD6A 3TA3B 2MPAL 5H35B 4FFZL 3L3KB 4BH8B 3I02B 5DQ9A 4PGBA 1MI5A 3V4VL 2AJ3B 4OZFG 5D7IE 5IMOB 2CLVA 3PWUA 3MBEA 1OGTA 1S7VA 4KDVA 1PYWA 4ZUUB 4X99A 1CK0L 3MFFB 3MRGB 5I30L 3R0NA 3BKCH 3WV0A 3P0VL 1N5AA 1FN4A 2WSKA 1X7QB 5FF6B 5D1ZD 4EI5D 3OB0H 2C3HA 3HG1D 4LCUB 4NQSA 1QEWA 3K7UA 4P2CG 2Z8RA 3HA0A 2DBLH 3WNKA 4RZCB 2VDKH 2UY7A 1YC7A 5IB4A 2XQYK 3A6BH 3EO9H 3L5XH 3QI9A 4XPAL 3NVQA 1PFCA 3VFWA 4ZQKA 1RHHA 3DGGB 4BZ1H 1CXKA 3ARGC 1JF5A 4ZOCA 4I8DA 3BEWB 3LS5L 1D5IH 3MRFB 3MV9D 3MA7A 3RGVC 5BXFA 1A6ZA 4JG0H 4I48B 3HMWH 3NFPB 4P2QE 3TO4B 1NLBL 1DR9A 3K1DA 1T89C 1RIHL 3WXVH 3U79A 4XNQA 4YR6B 5C6PB 1NC4A 4TVSa 1KBGL 5KVGL 1QYGH 2ZG2A 4GG6A 5IFJA 1WISA 2ADFL 2ED7A 4MSWB 3V0VB 4DOHB 1A22B 3EOTL 5IQ7L 2D7TL 4KHXH 2HMIC 1HYSC 3LKRB 2VLKE 1F58H 3CAFA 1TJIL 3IETB 1IC7H 2EC9U 2CH8A 1MNUL 4HZAA 2Y07L 4NQTA 3SDXA 3DX8B 4GKSA 5IQ9B 3R8QA 1A0QH 2A73B 3MNWB 3OAZH 4H8WC 1P4IL 4CAGA 3KPNB 1MFAH 2R2EA 3NBNA 1CFVL 2DQGL 1A7PH 3O2DL 3BKYH 4J4PA 3QYCA 4JO2L 5FUCE 4JREB 3CXDH 5B8CB 5IVXA 3ZDXE 3ARGD 5C08E 1R3HB 3UZVB 3VJ6A 2D03L 4ONFL 4MA1B 5I74C 2AK4D 3IU4H 1FFRA 2GJJA 4U1MB 3RGVD 2FLBT 2P45B 3IAQA 4J3SA 3KLAA 4WNQA 5HXMA 4OZHA 4KRMB 1T7XA 4KTDL 3RWGB 5TE4L 2DQCH 1S7RB 2X4RB 4YC2B 4F80A 2KDGA 1EHNA 1TTUA 4XBEH 5IK3A 4CMHC 3KXFE 1TCMA 2LQRA 2ORBL 3TZVA 5ESQB 2B7DT 4MJ2A 1F3RB 1WQVT 3BSZH 4TNWK 1EAPB 3D39E 2HMID 2I5YH 1KCVH 1LK2A 3G6JF 2C4FU 1HYSD 3PWVA 4LPXA 1Q0XH 1CD1A 3MNZA 4FQIL 1NAMH 3O3DB 2NQCA 4NDMA 5MI0C 4M61A 5IIEB 3J8F7 3WS6C 3CSGA 3GMRA 1RK0B 4JFDE 4ONHA 4G6KH 4EVNA 1U8HA 1WCQA 4L9LC 1UACH 5DK3A 3CXHJ 3QUYC 4M4PA 5T1DL 4E41D 1A6UL 4HUKB 2HT3D 1PG7L 5E2WH 3CX5K 1G6RA 1VACA 3FO2A 2IMNA 2VRAA 1YEHH 3THML 2JJVA 4GW1B 3T8XA 1TJGH 1B0GA 2DQTL 3NCYS 4D94A 3CJJA 3MGTB 4JKLA 1NCWL 2VDRH 5JW4N 1L0QA 3CFKA 1UKQA 5BJTB 3VXSA 2IANB 3VH8G 4U1HB 1IGTA 1C08B 4DFHA 3DO7A 3QQ4A 3T1FB 4XXDA 1N0XL 3CFEA 2H2PC 1VHPA 4LMQE 4NZTL 1SJHA 4UZGA 1J0KA 2CRIA 4Z0XA 4OLWH 5I16B 3RY4A 5DZNA 3KR3H 4C58B 2IADA 4M1CC 3EYSH 4QT5B 4Z7VE 4IOSD 5T33H 1G7MA 1MREL 5DDHB 2PXYB 5TJWK 2QADC 2R2HA 5CKGA 3BPOB 1GZQA 4YHPA 2IQ9L 3O4OB 1ZLWH 5I66B 2BVTA 2EYTA 1A7RL 1FV1B 1F11A 4IRSC 4Z7WA 5B38B 4OCRH 3QUKA 1CL7H 1UH3A 1ZK9A 5F7MC 4JPWL 3IF1B 4WEBL 5MERA 5CZXC 3QUYD 1UT9A 2XPGA 5FCUH 3MRDB 4G9FD 1FNEA 1BX2A 4NNPH 1AXTL 4U1JB 1H8OA 2VJXA 2WV3A 4PRAA 4U1KB 1MVUB 3CFBB 1OM3L 3NIDF 1MCEA 4EN3C 3ALPA 5MENB 3PGFL 4GMSH 3AU1A 2DQHH 1J0ZA 3V7AG 3TA3A 1XGTB 2WM0A 5HGHB 4UT7H 5H35A 2CKBH 4BH8A 4HT1H 5KSBB 3I02A 2PF6A 3ULSB 2AJ3A 3LKNA 3LEYL 2H2PD 4LLDB 4YFEA 1BFTA 3MFFA 5JOPD 1DQMH 3L95B 3STBA 1YEIH 2LU4A 3SGJC 4M1CD 3LY6A 3KYKL 1K3ZA 4WW2C 2Y36H 3VE0A 1L9MA 1NGWB 1U8NB 5AWNL 4LCUA 2QADD 3K3QA 4KUZL 4I9WD 5C07D 4RZCA 1XGRB 2VTFA 4U6XB 5CCKL 3CDGB 1U8IB 2HA1A 5GPRA 3O6KL 2JE8A 5M94B 2GITB 5C0FB 4Z7UE 3NCJH 2PN5A 3MLZH 4FZ8H 5D1QC 4BH7A 2JELL 5GXBB 5LGJB 3BEWA 5KOMC 3MRFA 3MJ9H 3QSKB 4R96B 5E8NA 1I7ZB 2VWEC 3W11C 1DUZA 5C86A 1FVEA 3NFPA 4LGRB 4X7FC 5GGSB 1KTDA 1K3IA 4GS7C 4EN3D 2DQUH 1MAML 4ONOA 1MUJA 1MRFL 5GZOC 1FRGH 5AYUL 3VRLF 4PRPE 4MSWA 4GAYB 3TH4T 5FM5O 3LKRA 3O6FC 4R2GB 4ENED 3UO1L 2BXZA 3ILQC 3TVMB 3N1FC 2ILLA 1JHLL 3ZE0E 2AXHA 5IQ9A 2EDNA 1ND0A 3LSOA 3BUYB 3OQ3B 1NAMB 3U7WL 3MNWA 3EHBC 1BFVH 2GFBB 5I8OH 3EKCA 4F58L 4AEIL 3KPNA 4H26A 5I8CA 4LLAA 5KVFL 2X4NA 1T04B 3WYRA 1NGQL 4NZUL 2A6DB 4X5LA 1KIUA 4GRMB 3G5VA 1CFBA 3UTSA 4WHDA 5B8CA 5DJCB 5D1QD 3MSPA 4KTEL 4X4XB 4ZODA 3AB0C 1RUPL 3ELAT 3I9GH 4L3ED 3W11D 2ZKHH 2R9HC 3RWGA 4HUXB 4NCDA 1ZT1B 4PRNA 1KIPB 2F53E 3FT2B 3O9WB 1EZVX 5ICZA 1TXKA 3LRHA 4OCWL 4XMPH 1J1XH 1VGKB 5EB9A 1UVQA 3G6JA 3C09B 4QY8B 5ESQA 5FECB 2F19L 5GZOD 2QHLA 3HC3L 3SDAC 3F7RA 1KEML 2KL6A 3HZYB 4R26L 2FSEB 2HFTA 2ZG1A 1GIGL 3D0VB 3P2TA 3O6FD 4M93B 3DARA 5FYKD 2A83A 1R5VB 3U1SH 3ILQD 3HFML 4KUCD 2OJZL 2R0ZH 1RK0A 1Z3GH 2DB8A 3REWB 1XFPA 2EKJA 4PJCE 5C0RL 4TSBL 4HBCL 3EHBD 4PJ8B 4YE4L 1Y6MR 3RWJB 1P9MA 4HCRA 4H5SA 5DVMA 5JOFB 4UQ2A 3HR6A 3V6BR 1P69B 2V2XB 2YK1L 4FQLL 4JCMA 4IHOA 4PBVC 3T0XA 1ZHLA 2IPKA 5DK0A 3VFSA 5GHWL 1IAIM 4GW1A 1PZ5A 4ZUWB 2RBLA 4JG1L 3E6FA 4KHTH 3VXRB 2GK2A 1NEUA 4FQ2H 3ARWA 4P2QB 1Q9KB 1SBSH 1LMKA 3QDMD 4OZFH 3T2PA 1C08A 1NCDH 1YJDH 5FAAA 3WIFB 3T1FA 3MA9H 4NQDA 5IW6B 2R9HD 4ELKB 1H3PH 4HXAL 3LH2H 3EAKA 3NFNB 2CKBB 1NCBL 3CNKA 4C54A 4ZTOL 4NWTL 1AR1C 4YHKH 5I16A 4HWBL 2VLKB 4GKNA 4QT5A 3TJHC 1II4E 1JZ2A 4OUOA 3WD5H 4ZFGH 5DDHA 2PXYA 3SDAD 2HTKC 2N1KA 4ODTL 3OR6B 3Q48A 4MD5B 4PD4K 4UT9L 3SOBH 4LGPB 2CDEB 3HLAB 3DGCR 4JY4B 3GI9L 1FV1A 3OMZA 2X1PA 3L1OH 3LD8B 4HJJL 1LO2L 1K85A 5B38A 4M9OA 1WK0A 1A6PA 1YEEL 4N90D 4M48L 3DSFL 2B8OT 1JCKA 4WI7A 1GGCL 1YNLH 4KVCH 4QXUH 1V05A 3PABB 4I4WB 2DN7A 4NHCH 5C08B 3ZKNC 3V79C 1XCTB 5I19H 5FYLD 2YOCA 4U1JA 4EUPA 2EDEA 2Z92A 1MVUA 2P48B 3S35H 3B9VA 1WT5C 3SO3C 3MLRH 5MENA 3KS0H 2I24N 3PHSA 4QXTB 1XGTA 5HGHA 4CMMB 3DVIA 2XKNB 4KJPC 3KXFB 1KB5A 4AMKL 3EFDH 5FGBC 3UYRL 5DHYB 1HXYA 2QQLL 3TFKC 4W4OC 5EZOH 3ISWA 4XVTH 4OI9A 3Q2CA 3B5TA 4G6FB 4O2CA 2BSRB 5EU5B 1AR1D 5DZOA 3QIWB 5D2NE 1Z9LA 2X4SA 3TJHD 5J7CC 3FQTB 4JFDB 2NY0B 3NAAH 2HTKD 3V5KB 1XGRA 3OX8A 1DSFH 1IGMH 2P7TB 2BHYA 1F3DH 4JFQA 1Q9LB 2Y06H 1CLZL 5C0FA 3FRPG 1VCAA 2B20A 1QSFE 1RIUH 5EH1A 5IFAL 5LGJA 4M6NH 2OZ4H 1BJ8A 3JWOC 1RURH 3EUUA 2EDOA 4JGMA 5I1KL 1MIMH 3ZKND 3IDXH 3WXWL 1A6AA 4YDKH 4MXQC 5F7FA 5JW5B 4Y5XB 5GGSA 2E27H 2BVEA 4KV5E 2NZ9C 3SKNB 3F12B 2MMXA 4GH7B 1Y18B 5F1KC 4KJPD 4GAYA 1CFQB 1U3JA 2J3SA 3JWDC 3U46B 1EFQA 4U1NB 3I3BA 3GKZA 3TFKD 1VGEL 3AC0A 1B0RB 3UCRA 2YD3A 3RPKA 1UADC 3TVMA 4Z0BL 3DVFA 2AEQH 1MIEH 4JVWA 4I3RL 4NO0D 2HFEB 3W39B 4ONGH 1NAMA 4QTHB 4KDTC 4C83A 1KB9J 1YMHA 3NFSL 4UU9A 1IAIL 4YHZL 1KYOK 1T04A 3LAFA 4GRMA 4Y5YB 1ACYH 5DJCA 4AEFA 1LQSR 1CLOL 2CLZA 3MBEC 4P23A 1AQKL 3T0AA 1QR1B 4IRJC 2LU7A 4A6YH 5DHXB 3FONB 4MXQD 4YQXL 1J8HE 2QSCL 4OZFB 3U4AA 3O9WA 5JLZB 3JWOL 1MQ8A 4BZ2L 2NZ9D 5FK9B 4EDXA 1T7ZA 3WFZA 1VGKA 4OM0L 1NGPH 5FECA 1B88A 2X44D 3GK8H 1DJSA 1IC5H 1RVFL 3MV7A 4KVNL 1HHHA 2FSEA 3VXMD 4Y4FA 2X4TB 3UZEA 3EJZC 1G9NL 4LCCC 4NGHH 3ARYA 1UH2A 4L4VD 4P3DB 1ZLVH 5I15L 4E0RA 3DV6A 5F9OL 2R2BB 2EIBA 2LU3A 3F8UB 4J6RL 3ZE1F 1DQJB 4XX1G 3MLSL 1OAUL 3RWJA 4MAYB 5CILL 4NUJB 1RUAH 1A9BB 4JE4B 4JFEE 5HJ3B 4X8JB 1JWSA 4YPGB 1MPAH 5CIPH 4ACPA 5EWIL 3QQNA 1BOYA 4OZ4A 1T5WA 2X4QA 3V0WH 4G43B 3PE9A 4FQHA 1MI5D 3VXRA 1U8OB 2IEPA 3OSKA 4JPVL 1Q9KA 3T3PE 4CU7A 5L2KE 2FO1A 3MBED 3SDDC 2NXYB 3FQWA 1UZ6E 4IRJD 5B39G 1P84K 5I17B 3P73B 4LBEB 4ELKA 4BSVB 3ZTNH 2AABH 5I2IA 3NFNA 3GIZH 3HNTL 4Z9KB 4RGMC 5GIRA 2XKSA 2P5ED 1UM4L 2R56H 3S98A 4LSUH 3VRIB 3VA2C 4J4PC 3DNKA 1GHFL 5LGHL 3IXTB 3OR6A 4MD5A 4MCZB 2CDEA 3HE6A 3HLAA 1MQKH 1IILE 3U7AA 3EJZD 1CXIA 3ZE0F 2VC2L 5FYJD 4XNUH 1NCTA 3QNXA 3D85B 5T1MB 2GTWB 4HQQL 3QEHA 2WBJA 2ADIB 5ICXA 1OAQH 4X6FB 1UA6L 2XZZA 3ULUE 4I4WA 5FYJL 5L7XL 4L5FL 4XPHL 4W4NA 3JVGA 1XCTA 5EPMB 5F21B 5CHNB 3H0TA 5EO9A 3TZVC 4YDVA 2C26A 4WFHD 5EN2A 3VWJB 1K8IB 3WL9B 3TCXA 5DRNA 4LIQL 4H0HB 4KXZH 4N9OB 3GMLA 1F4XH 4AH2B 1T1YA 4QXTA 4NT6B 1S9WB 3SDDD 2XWBA