2VQ1B

Anti trimeric lewis x fab54-5c10-a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
218
structure length
213
Chain Sequence
QITLEESGPGILQPSQTLSLTCSFSGFSLSSSAMSVGWIRQPSGKGLEWLAHIWWNDDKYYNPALKSRLTVSKDSSDNQVFLKIASVVTADTATYYCARIPGFGFDYWGQGTTLTVSSATTTAPSVYPLVPGCSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IGKV1-117 PROTEIN
publication title Characterization of a Diagnostic Fab Fragment Binding Trimeric Lewis X.
pubmed doi rcsb
total genus 36
structure length 213
sequence length 218
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vq1B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vq1B01
1CICD 5DDHB 4XP1H 1MCLA 3MBXH 4PJ5E 3E1F1 3ARBD 1A6VH 3RUGB 2VXUL 3O3AA 4NKOB 5D7IB 4KPHL 3WS3B 2HTKD 4XNXL 3VXSB 3B5GA 4V1DB 4K94L 4GRWE 3STLA 5HJ3B 5HYQB 2EECA 3ULUC 1R24B 3K1KC 3MRDB 1TJGL 4S1DD 4ELMB 3KXFA 5EIVA 2FZ3B 1RUMH 1FYTE 3FB5B 2GQHA 1KF9B 4LKCA 4WW2A 2GJ6B 5GSVA 4ZS7L 3DGCR 3HNTL 1ZHLA 4DOHE 1L6XA 4KDTC 5FUCE 2B2XH 4XVTH 4PJDA 2PTTA 3C5ZB 5JOFA 1WIPA 1JGDB 1IEAA 4PGDB 3O3BB 4P5TB 1MVFA 3F7PC 5D1QB 5DC0A 3P30L 5ILTL 1MPAL 4HIHA 2VKWA 1GRWA 4Z76B 5I1DA 1DBBL 5IB5B 2ITCB 4FFVD 3TIDA 1TVBB 3MYJA 4HJ0C 5C0NC 5CCKL 4NHUB 5I8EB 4TUJB 5HVFB 3WIIL 4WO4A 2EYRA 3HR6A 2XACC 4F33B 3LMJL 4K3EH 1T1YB 5EWIH 4M7KL 2VDLH 5L8JB 4YJZL 3ARQA 3EYQD 4O9HL 2A73A 4XCFL 1KB5L 5D72L 5J56B 1EO5A 2Q8BH 2QV2A 1AGDB 3UTTB 4G6KH 1CFTA 2Q3AA 2H8PB 3FFDA 3MREB 1VENA 2DM7A 2C1OA 4NRYB 5CD5C 2Z31D 1L7TH 1F3JB 4YHKL 5IMKA 3QDGB 3NA9L 2D7NA 4D0CA 5DJ0A 3WO4B 4RIRB 2IG2H 5SWZD 3BQUB 2I25N 3CCHA 1YZZA 3HE6D 4JHZA 2CUHA 3DMMA 3O8XC 4OZFH 1IAOA 1X6NA 4ZFGH 3LPGA 2QKIA 2E3VA 2QBWA 4RBPK 1Z2KA 2FYYA 4NM4L 4ZS6D 4MLSA 4N0YL 1FVDB 2FJHB 5CEZE 4YDJA 2XN9B 3HAEH 4X80L 4ZTPH 1BIHA 3HFMH 1U3HD 4GW5B 4LSDA 2XZCH 1KJVB 2MPAL 1R5WA 4R96A 4JDZB 3SDDD 9CGTA 1YEJL 1BVLB 1NBZA 1I9RL 1WFTA 1A0QH 1RIUL 1JUFA 4P23A 2ZSVA 4F9LC 3F7RA 1N4XL 4I8DA 4WI8A 5FCUL 3RPIA 1MCBA 4M1CC 4PFEA 3MRPB 4XBGA 4FFYL 4KK9D 1MRCL 5KAQG 4GRWB 4KTEL 2N7BA 4U6HA 3MGOB 4AH2B 1QFPA 2X6MA 1K8IA 3CGTA 4DJMA 1BOGB 5EZOH 4IRJA 4N5ED 1FYTB 3BI9X 1DUZA 3BIAX 3LRGA 3ABZA 1MFAL 4F7MB 5CEYA 4DOHB 3ZZ1A 5IQ7H 4EIGB 3BD4A 5JW5A 2ZKHH 4DGIL 4ZYKA 3U0WH 3IU4L 4BKLA 1C12A 1FC2D 2JJTC 5LKNA 1OT2A 4N8VG 3V6OC 5JORB 4XCCL 4ZUUB 3VJ6A 1KB5A 3GSUB 4PJBE 3CLEH 2CDFB 3O6FC 2ZCHL 1S3KH 2W0KA 2X4QB 4N8CH 2NY0B 4UINH 4ZUVA 5GGUA 1QFWM 1ETZB 3FHQA 4KI1A 3W82A 3RAJH 5C0CA 2GCYA 4Q58C 4QTHB 1T6WA 3O41B 5DMKA 5J13C 3DSNA 5HPMA 4FG6C 3MC0A 4R26H 1YECL 1U92B 4GW4A 3UTPE 4H1LA 3HCVA 4GBXD 1LDPH 4PJ8D 4QHNB 4ODTL 2ZWLT 3HRZA 2VDPL 5EN2A 1H8SA 3P73B 4FQHB 3KJ6H 1KEGH 1CLCA 43C9B 2NR6D 4JKMA 1YEHH 4OZGE 2YPLD 1BECA 1LVEA 1BZ7B 2XY1A 5FA3A 3V0WL 5JHLL 4JZJC 1F8TH 2AV7A 3M17B 2FRGP 1RZIA 5H94A 5FKAA 5D2LE 4BK5A 4MAUL 4EUPH 4G8EB 1NC2A 3QNXA 4C55A 2OJEB 3NCBB 4Z78A 4TNVF 2Z91B 4NNYB 4K23H 5F7NC 4RNRA 2EIEA 2FL5B 2HT4D 1UFUA 2HN7B 1Q94A 3K0WA 3WJLC 2HFGL 4C4KT 3S3PA 5GRXG 3FN9A 4XP5H 4HWZA 3MNZA 3VI3F 3ISWA 4WCYL 1J05B 4NQUA 1XGRA 4JGUA 5C0DB 4P5KA 1T2QH 1M7IA 2OR7A 1X5AA 1ED3B 2BCKA 1QQDB 5GRUL 1F3DH 5DYOB 2HKHL 3GHBL 2X40A 1IL1A 4TOYL 4NO2B 4XHJD 5KN5A 1BD2D 4HH9A 1P84K 3LD8B 3TA3A 3G6JF 4X99B 3KPMB 1XGTB 1QFWH 2BSED 4ODWA 5HBBA 3FO9B 2GAZA 4XP1L 3MBXL 3T0DA 2Q20A 2XKNA 1A6VL 1X5XA 1P4LB 1ZTXH 5CSBA 4JY5H 2R29H 3TT3H 1QLEH 4NOFA 4OCMC 4QRPD 4PJIA 5EBLA 2PW1B 4QXTB 4BSVB 3OG4B 1NJ9B 1JFQH 5DLMH 5F7KC 4QRUB 1QPXA 3KNBB 1RUML 1A6UH 4PJBB 1DANT 2ED9A 3DXAD 1B0WA 1NDGB 1ACZA 1NANI 4YHOH 4JB9H 3Q1SH 2B2XL 4XVTL 3SKJH 2W65A 1OTSD 4YH6A 4XPHH 4GKNA 4HKXA 4RFOH 3RIAF 1BP3B 1NL0H 3TO4D 3IXTB 2MOVA 4FTVD 3QNZA 4YWGH 1F90H 4AIZB 5GIRA 4N0CC 1UACL 5DJAA 4LARH 3F7VA 4QRSB 5ICYA 1S9XB 1C5DA 1WSST 5CIPA 5E6IA 4OZGB 3RGVA 4K3EL 1K9TA 1G7JA 2WM0A 5E5UB 2BFVH 5EWIL 5JTWA 4FQXA 2A1WH 1NAKH 3ZKNC 3Q2CA 4PP1C 4J1UB 1AGBB 2Q8BL 3BUTA 3FOMB 2QHLA 3MRIB 4G6KL 4Z7QE 4Z7OF 2EDNA 1L7TL 2HVJB 3NMEA 1LEIB 1UJ3C 3KPQA 1KTLA 1FLRH 1JF1B 4J8RB 4WGVB 3TH4T 1H3UA 5L2KD 2IG2L 2UUDH 1J12A 2ZUWA 5JOPE 2X4OA 3QT2A 1AP2B 4QYOA 1Y0LB 3GJFA 4UZGA 3VFUA 3OKEA 1S7XA 4XB8A 4ZFGL 2AV1B 1G7LA 1F6AA 3QFDB 2ITDA 1LP9B 5FECB 2XWTB 2AW2A 2XWJB 2ZUYA 4U7SA 4F2MB 1D5BA 1J0KA 3QI9C 4UNUA 4RMQA 5BRZD 5MENA 2IAND 5BS0A 2XI9A 4ZTPL 1B6UA 4MDJA 3HFML 5EC2B 2VE6A 2XZCL 4H0IA 5CGMA 3MJ7B 1WTLA 2IPTH 3PHQB 4PJGF 2RIKA 2CRYA 2HFEB 4ZDHB 1TFHA 2CK2A 3BXNA 5FDWA 3OKOA 3QCVH 4KJYA 1A0QL 3IDYB 5B39G 2DS4A 2QJDA 1HXMB 2B0SH 5HDQH 3VXPA 2NY6C 5KBNC 2V2WA 5HXMA 1I3RB 3D39A 4P2RA 3UTQA 1F11B 4ODHH 4PRAB 3G9AB 2DQIH 4E5XB 3KJ4C 4TRPH 5EZOL 5TDPB 1TZIB 2VXQH 4KRMB 5GGRA 4KQ3H 3IVKB 1I8KB 4Y2DC 4J23A 5IQ7L 4DKEH 4I48A 3RY4A 3ZHLA 2ZKHL 4HIJB 2IAMD 4YBQD 3U0WL 2NPLX 4PLJC 3O3DB 2VAAB 3QEUB 2VLJE 1ES0A 3ULSA 3LY6A 4I0PC 2H3NB 3SDAB 4H5SA 3BP6A 3ARGB 3EDJA 2EIDA 3OJDA 1MLBA 3CLEL 3I6GA 3L3GA 3QUMA 1S3KL 4N8CL 4UINL 5T3XE 5DUBB 3NIGF 5ECJE 5IB1A 2DTMH 2OR8A 5ICZA 4D0BB 4W6XB 5F7LB 3RAJL 3KPOA 2DLGA 3RJDA 4YQXH 5HI5D 3LKPB 2XQBL 1KJ2H 4R26L 2EDJA 4KAQH 2ESVD 3M8OH 2FGZA 4WW2C 1EEZA 4Q9CA 1LDPL 2VNCA 4LCYA 5D9SB 3WIFA 3IETB 3KJ6L 2FX9H 1KEGL 3MUGB 3C6LB 1YEHL 5MEQB 4DEPC 5E7FA 1EHNA 4LLUB 4E9LA 1F8TL 1D5IH 2GTWA 1IQWH 1EH9A 3GK8H 4Z7VE 4HS8H 1DUYA 4NQTA 1JWUB 1RJYA 1G7HA 1JMXA 4BH7A 1N59B 3QQ3A 1I9IH 4WO4C 5HI3D 3BP7A 1LHZA 3S34H 4HMDA 3QA3A 3ROLA 2DLTA 4K23L 4LLMA 3SCMD 4JZNB 4GKZB 1CGVA 1QHOA 4U2YA 3D18A 1FAKT 3FQUB 3RQ3A 3PL6A 4XP5L 5DWUH 1MI5E 1TDQA 3R06A 4F7CB 3RVTC 1M7DB 3TBSB 4L8CB 4GUPB 1ORSA 4LVNC 2HLFC 5T1KD 3VGFA 1ZVYA 5JNYB 5C0ND 1T2QL 1BZQK 1FE8H 2ARJB 1KT2A 4JDVA 1BZ9B 3KLHC 5DK2B 4KFZC 3DMMC 5GGTH 2CIKA 1IEBA 3LEXB 1RZKH 3W0WD 5IB4B 4OZIA 2X4PB 4JGMA 4PGCB 3MLZH 3DSFH 1V3JA 1OPGH 3MGTA 5EUOF 1UYWH 4HCRH 2P8PA 1WVZA 1QFWL 1BFOB 4NO3A 4XWOC 4FOMA 2YC1B 2D31B 5KVDH 3MO1B 1IKNA 1FGNH 2ZUTA 4OM1H 4LSQH 4NKMB 1ZTXL 2VLJB 4K94C 1BQHG 4JY5L 2DJ4A 2R29L 4LKXA 1QLEL 3TT3L 4DUVA 4KRPC 4URTB 2EDHA 1JFQL 5DLML 3OJMB 2IPKB 3Q0HA 1A6UL 1GL4B 4U33A 2AJXH 4P23C 3RVVC 4BUHA 2WP3T 3S36H 2PXYA 4YHZH 2H32H 1QSFD 1UB5A 4P57A 4YHOL 5E8DH 3S97C 4JB9L 4YO0A 1Z5LB 3Q1SL 4Z18A 3SKJL 1IRAY 5CLTA 3QIWD 4G8FA 4PR5A 4OQ1A 2R2EB 4IRJC 2VITA 4XPHL 4Z8FH 3IJYA 3IKCA 4RFOL 2BSTA 3GMMA 5JIKA 1NL0L 5HSFA 1XIWA 4YWGL 1A6TA 1F90L 4JM2D 1NANH 5E1AA 3T2PA 4LARL 2GEEA 4RMRA 4JFYB 3U7WH 5I8OH 1WAAF 1S7QA 3GSVA 2FNBA 1DANU 1CN4A 1WC7A 3O9WD 1G0YR 4LQ1A 2APBA 1SYVA 3G5YB 5IB2A 2BFVL 4PJHE 2A1WL 4Q6IA 3H9SD 1NAKL 4Z7VB 4M5ZH 2ORBH 1VDGA 4G6FB 5BVJB 2PTVA 5DK0A 3DV6A 2N1KA 4W4NA 3ES6A 1RUKH 3Q3GA 2YEZB 2QLVB 1JWSA 3LIZH 1RJZA 4MXVF 1FNEA 1AGCB 3X14B 4MQXD 5EU5A 4GAYB 1FRGL 3QH3B 4UV4H 1NMCC 1FLRL 1Q9LB 4I2XE 2MQCA 1A2YA 2FEEI 4LHJB 5E7BA 1JNJA 2BMKB 3GB7A 2FR4B 1MI5B 5D1XB 1S7SA 1TTGA 3HS0B 2DI8A 1H5BA 3HZKB 4M93C 3NFNB 4OLXH 1BVKB 2XRAH 5EORH 4NO5B 2X5PA 2E6QA 1I9JH 5ID1A 1XH3A 2A9NH 4AEIH 1SJHB 5EU4A 3WEXB 1KYOK 1XF2B 4ELKB 3RWCA 5EBGA 1CI5A 1DQJB 1MF2H 2IPTL 2NY3B 4PJCF 1DLHA 3QCVL 3ZYIA 2IBGA 2B0SL 1K5NB 4LDEB 5HDQL 1P5VA 1OTUC 3LN5B 3ET9F 3SO5A 2BSSA 1CDIA 5F1IB 1FG2A 3T3ME 1S7TA 3OG6B 1R3IH 1KXQE 4BFBD 2DQIL 2QSCH 4I4WA 4TRPL 4AIXA 1AGFB 1GZPB 4XRCA 2O5YH 2VXQL 5KSVA 5DJ6B 4KQ3L 1JMZA 4F7PB 4DKEL 3AFLA 1CR9H 1UGNA 3QDJD 1BQLH 2EZ0C 4L4TE 4UU9A 3KPRD 1KG0A 3LKOB 5I75C 3V7AG 3K2MC 3TA3C 5ETUB 1W0YT 2YXMA 3VI4F 4JDTH 1UM6H 2V2TA 4OD2A 4UIKH 3TBVB 1R3KA 3FB8A 5HYEA 2DTML 1IM3B 4M3KB 2VR9A 3OKDB 3EO1B 1ZVHA 1BAFH 1C08B 4GO6B 3PGFH 1C16B 2WIIA 7FABH 2APWA 3BMVA 2A6JA 4Y4KB 2DM4A 2VL5A 2BXYA 4YQXL 1KJ2L 1ND0A 4PJHB 4KAQL 4MHHG 3U0PA 3N1GC 4CJ1A 1D5XA 3M8OL 1O5DT 1UEMA 2OTWA 3ZSSA 1XF4B 1TENA 3G5VB 2VABA 4NT6B 1N8ZB 5EPMA 2BRQA 2FX9L 5F6HJ 3RWJB 3H42H 4QGTA 4I2XB 4ETYA 3O4LE 2EYTB 1KUMA 2R2BB 4LEOA 1D5IL 1A6AA 1IQWL 2JCCA 4X8JB 4KROD 3GK8L 4HS8L 3EFFA 3O11B 4PV8A 2W60A 1VEOA 1IKFH 2R0WH 5DJCB 2CIIB 5C71A 5E6IC 1I9IL 3RGVC 3P0VH 3S34L 3OZ9H 1FP5A 3B6SA 4GKOA 4HDIB 3ARVA 1QLRB 2QHRH 3FRUB 2D7MA 4PTUB 3IDUA 3GKWH 1J8HE 5DWUL 3CUPA 5KG9B 4QNPE 1FJ1A 3MA9H 4WWKD 3LSOB 2ZJSH 1FE8L 5F9JB 4BQ9A 3E0GA 1UWXH 4ORGB 5LAXB 4KK5D 2R9HD 2WLYA 4P4RB 1CG9B 3EYFB 3RL2A 3SHSA 4HG4K 3RWDB 4PGBA 1U95B 3FQNA 1PGRB 1RZKL 1S9YB 2FD6H 4M9PA 2RBLA 3MLZL 3DSFL 4G8IB 4HAFA 3MLVH 1OPGL 1TIUA 4N8VB 1UYWL 4HCRL 1H0DA 3BSZH 3ARDD 4P99A 5DQ9B 2MKWA 3B9EA 1S9WB 5KVDL 4GFTB 3BGFC 2K7PA 5D6DC 4M6MH 4OM1L 4LSQL 4L4TB 5EU6E 4JZOB 4N68A 5BXFA 3QHFH 3QEQD 4BZ1H 1BHGA 5B3JE 1EK3A 1ULVA 4KI5F 4W4OA 5FM4A 2AJXL 4F8TA 5SX5K 3VMNA 1X5GA 3HUJA 4WJ5B 4XCNB 4XVJH 3RDTB 3KPSA 1N3NB 3S36L 3L3OB 1TLKA 3TYFA 4YFLI 3F62A 4YHZL 5HVWA 5E8DL 5AWNH 3VXME 5E03A 3C5SA 4U1HA 1UXWA 5GRZA 3QI9D 5ISZE 4Z8FL 4QT5B 3THMH 3DGGA 2CLVB 4WUUA 2E9WA 4XH2B 2X4UA 3VD7A 3ZKMD 2FIKB 1XAUA 1A64A 4ONOA 2CRMA 1OGTA 5HHOA 5H37G 2APVA 3GSOB 3RU8H 3U7WL 5I8OL 3EYVB 3O4LB 4PYHA 1F4YH 5KSAA 5I1CH 1SEBA 3V5HA 4TUOA 3I6KA 1VGKB 4G6AC 4M5ZL 2ORBL 3Q5TA 4JN1H 3K80A 1RUKL 3LIZL 3NIDE 5E6YA 4WDIB 1HIMH 5GS0H 3BPLB 3AS0A 4UV4L 5K9OB 4PJXE 4TSBH 3MV9B 2CDEB 3VXQB 2R0KH 2Y72A 1KFAH 3HC0B 5GS2D 1T7VA 5EOTB 1A9EA 1J8HB 1OW0A 4YIQB 3DBXB 3SE3A 2VSDA 4E42B 4PJAA 2HKFH 3TIEA 5HVHC 4OLXL 5IGXH 3B9VA 3DUSA 4YGVB 2XRAL 5EORL 2X7LA 4HUXB 1I9JL 3IS1X 4XNQB 2A9NL 5B3NA 4AEIL 5EC1B 4GRWH 2A6IA 1FV1A 4WFED 5FA4A 3KXFD 3P9MA 4D3CH 3SJVA 1MF2L 1VFOA 2R23A 4R9HA 4XPBH 4PJ7F 4H25A 4RAVA 1G0XA 1ZT1A 4NQDE 5BW7A 4L4VA 5JZ7C 5EU6B 5SWQB 4NNXA 1N2RB 4OCSH 2FBOJ 2CLRA 1R3IL 3B2UC 3CFBA 3QWQB 3MRBB 4L3EA 2Q6WA 2G5BA 5L8KB 4GT7A 5ESAB 1T22A 2Z93A 1LE5B 2O5YL 1DQQA 3D2UD 3QAZB 4NO0A 4RWYH 1MAML 3PUCA 3FMGH 1VFBB 2A2QT 1A7RH 1T4KB 4UNTA 3VXMB 1CR9L 4P4KB 1GGUA 1BQLL 5ISZB 1V3MA 4LVHC 3BN3B 3GSXA 4NNPH 1X4XA 2EIZB 1Z9SA 4CN6A 3FOLA 4QGYA 5IV2B 3DECA 4JDTL 4AQ1B 2OL3B 1UM6L 1EAPA 1MLCB 5L8LB 4UIKL 4ZPTA 1IKNC 1KPVB 2B20A 2IMMA 5I2IB 5EUKB 3RZWA 4X83A 2HLFD 1BAFL 1J87A 2FHFA 4YFEA 3PGFL 2HA1A 3QPXH 7FABL 3QXDA 1EJOH 3RBGA 3RKDC 5EO9B 2DM2A 4WU5A 4AZ8A 3RZCA 2PXYC 3D25A 3MX0A 3AC0A 4XWOD 2GW5A 4DVBB 4KKLC 4OFYA 3H42L 3V6ZA 5I9QC 5A2KH 3QZWA 4PJXB 4WI9A 1EIBA 3T0VA 3VRJB 3UXFA 1GGBH 3PABB 4YPJA 5J6HB 5CEZH 1FL6A 1ZA6B 2KH2B 1XIWC 4MCZB 4LLYB 3NOIA 4FQIH 3AREB 1K4CB 1ZE3C 5J7CC 1QNZH 4HUUB 1OD7A 1IKFL 5E9DD 2R0WL 4MNGE 3SDCA 4N9GA 3ULUE 4B0MM 1QD0A 3OZ9L 1IC4H 4Q6IC 5EB9A 2QHRL 5CZKA 1KLGB 3JZ7A 2IJ0C 4NCDA 5FGSA 4IRJD 1LE9B 3LKNA 3BIBX 1Q72H 4J3XA 4OB5H 2WUBH 3GKWL 2XY2A 4G7VH 4Y4HC 5JPMA 5ENWB 2ZOKB 3VGBA 1BLNB 3EO0B 4H0HB 4NQDB 1EGJH 1OGAE 2Z35B 1P1ZB 3MA9L 1CFSB 5J9PB 1YJDC 3X13A 2ZJSL 5GS3A 4Y5XB 4X9HA 5D2NA 2CUMA 1UKSA 1FZKA 4D8PA 1ZT4A 4IOIA 2MKLC 4ZAKD 1YY9C 2EO9A 5JHDD 2VZVA 4U6YA 4O2CA 2DQTH 1H5BC 2Y6SC 3MLVL 3P9LB 2UWEE 3BSZL 3Q5YA 1A7QH 4ONHA 3ILPB 5J06A 3JWOH 5IJKA 1XEDA 4PREB 1AO7A 3VXRA 1XR9B 5H8DA 4M6ML 2LTQB 1Z6JT 1CGXA 1NGYA 5KS9A 4XZUB 1AD0A 4XNMA 3QHFL 1NCDH 4CVXB 3S35H 1DVFB 3CDGA 5DMGD 4BZ1L 5C07A 2F53D 4CL7A 3K2UH 1YQ2A 1PY4A 4R6UA 3C6SA 3O2DH 4ODUB 3FT2B 3KWWA 4XVJL 4NDMB 3JTSB 3QQ9C 3MBEA 5AEAA 4OCRH 2P5EE 1EUTA 3WFDH 5AWNL 4I3GA 4OFVA 4BUGA 2FX7H 1TNNA 4Z7NF 4PG9A 1MH5A 4HBCH 4NQEA 3WYRA 4PJ9A 3F6LA 4U1IB 2DWDB 4P2OD 4J6RH 4I9WE 3RWIB 4XBPA 2V5RA 5C6TH 4NYLB 2ATKA 2OM5A 1Y6MR 5HDBE 1U8PB 2LAAA 1YPZE 3B5TA 4YBLC 2JE8A 5D71H 2C3VA 1U9KA 1BM3H 2EKSA 3RU8L 1A1NA 4U1NA 2VLKA 2PUQT 3DLQR 1F4YL 1OTUD 5I1CL 3VFOB 1KPRB 2Q1EA 4NQXA 2JTDA 4WU7B 4RX4D 3PGCB 1RFDH 5DRNB 2FCBA 3LN4B 3HZVA 4JN1L 1T2JA 3MRRB 2EDKA 1T04B 5J1AB 5GSRA 4MNGB 1YY8B 1JHLH 1HIML 5GS0L 1I75A 1AKJA 3DVNA 4APQA 4GG6F 4TSBL 3EDDA 1A3QA 2EZ0D 2R0KL 2NW2B 1KFAL 1MCIA 4WEUD 3EO9H 3FB7A 5AUMB 3WS3A 1OSZA 5E4EC 5CFHA 2DTSA 2CLZA 4V2CB 1M7XA 4S2SA 1OGAB 2HKFL 2PTUA 4Z0XB 3DUUA 5AD0A 2ZCKL 1KNOA 3EYOB 5IGXL 1FORH 4HS3A 3RHWF 3BKJH 4IM8A 1DCLA 5DEFB 2FEEL 1N26A 2AXGB 2XPGB 4X6DF 2EXWD 3PDOB 4PRHE 2KZWA 4JFZH 4OLWH 4D3CL 4FA8A 1BQHB 3CDFA 5IMLB 2FDBP 1FL3A 1QTYT 2UWEB 3L6FB 4XPBL 3RWEA 2DBLH 3DUHA 4NUJA 4P46D 4D9QE 1K4DB 3P4NB 3CU1A 4OCSL 3SGKA 3V0AC 4BA8A 1MRFH 2O26U 4P3DA 3RGHA 2BNUB 3DYOA 3ZYOA 1G7QA 3DRTB 1MFCH 2E9IA 4KC3B 3V7AE 4TNWK 4RWYL 5FGCE 2P5EB 3FMGL 5H35A 1A7RL 1ONQA 1NCCH 5HGAA 2X4NA 3UTTA 3O8XB 3FQTB 4ZUSB 2LAGB 4M8QB 5E6ID 4N1HB 1FZMB 3BRFA 1P7QA 2BK8A 4NNPL 1RMFH 5D93C 1F3JA 2YD3A 2AJZA 2I9LB 4PIRF 4JG1H 4PRBA 3QWOA 3KVQA 4U1JA 4J3OC 1YPZB 1HKFA 1AGEA 4QF1A 4K7PY 3WNOA 2MJWA 5LQBH 3MV7D 2VZOA 1FG9C 2D3VA 5GGSA 5DURB 5E99H 2EDTA 1DBKH 5IHUH 1VADB 5C0IB 2Z0BA 3VRLE 1EJOL 4GH7B 4N1CA 1JP5A 4W4OC 1JYVA 3AS1A 2NLJA 5MEPA 4G9FE 4JRXA 4JFPA 2XTLA 4OSUH 4PD4J 3WN5C 4MJIE 2LQRA 5IHZB 5C08A 1HSAA 3H3PH 3WKNA 2AK4D 3WLBA 2GSIA 1DQTA 3L9RB 5GZOC 1UB6B 4OLZH 4XAWH 4PJ5A 3EOBA 2Z4QA 1GH7A 1GGBL 3H9HB 5BS0D 4EDWH 1Q1JH 4YHMH 2J12B 2NZ9C 4JRYD 5CEZL 1VB9A 1T0PB 3IDXH 2JB6A 3CIQA 3RTQC 3ZE2E 4M4PA 4HUVB 1INDH 1HDMB 3RVXC 4FQIL 4G9DA 2APFA 1MIEH 1UKTA 4UDTA 1HHGA 3H7BB 5JA9A 1QNZL 5DTFA 1RVFH 4PV9B 5F70A 2J8UE 2X89D 2XKUA 5HYJD 5KSAC 5SWSA 5IR1A 1WBYB 3O6FB 1IC4L 4CVWA 1UWEH 2Y7QB 2VISA 1CFQB 4PRHB 1YYMH 1GIGH 2Q86A 2UY6A 1Q72L 4OB5L 2WUBL 4BELD 4G7VL 5J13B 1IGIH 4LPTA 1A7OH 4K71C 1EGJL 3WFZA 5C3TA 3G9VA 4X5LA 2VQ1B 2Z92A 3DX7B 3TPUA 1RV6X 1S9KC 3GM0A 1RZKC 2C4XA 3GMRA 2BY3A 2HJFB 2EE2A 1I7RB 1W0WA 2DQTL 2Q7NA 4G6AD 4HLZG 1VHPA 1KPUA 5FGCB 2XQYK 1A7QL 3C60C 1XF3B 1U93A 4MWFB 4JZJB 3JWOL 5T3XH 4DZBB 4NOBA 1Q38A 5CD3B 2E8ZA 3TVMB 4BSJA 1J0IA 5F9DC 3S3SA 5C0AE 2D0HA 4XI5C 1NCDL 4K9EC 3S35L 3IDIA 4ZOAA 3K2UL 3O2DL 3VWKA 3OKYA 5C09D 5BW7C 4RGMC 4OCRL 2P5WA 3EFDL 1JV5A 3WFDL 3RIFF 3DO7B 3HKFA 4PRDA 2FX7L 1T66D 1FNGA 4HBCL 1NKOA 5HHME 4YBHA 4A6YB 5DS8A 2EDBA 4JHWH 2AP2A 4J6RL 4L8DB 3RVWD 2BVOB 1CT8B 4G9FB 1F5WA 1N6VA 1U8NA 4MJIB 1QLFB 4PP2A 3MRLA 1K2DB 4R3SA 2JIXB 4WHYH 1WWAX 5EBWA 4MNQE 2XV6B 3VXUE 5D71L 4AG4H 1BM3L 5BMFH 2F15A 2ZP0T 5FDYA 3H6JA 1W72A 4JY4A 4Z7UF 3D85B 1VACA 1XT5A 5C2BH 1ED3A 1QO3B 2K9UA 3REWB 3B2UD 1RFDL 1YMMD 1YN6B 3A6OA 4YX2H 3NN8A 1JGEB 4TVPE 4ZXBA 1HWHB 2CDGB 4X6CF 1NBYA 1KIRA 2J8UB 4ZNEA 1M05B 1JHLL 2HJKB 1XGTA 3OR6B 2XXCB 4KH2A 1MJUH 2IQAB 1DN0A 2BNRE 1D6EB 2HTLC 2NY4D 5FO8B 3RZCC 3EO9L 4TSCH 3HE7B 3QQNA 5K59F 3QO0B 5CMAB 1SJXA 4EI5D 2CKNA 4YXKH 1OQXA 2A6KA 2IPUK 3G6JA 2NMSA 5IM7A 1FORL 2H6PA 3ARFC 3BKJL 4PTTA 2X70A 2A0LC 5BV7C 3HA0A 5JDSA 5CWSA 2E5EA 3AU1A 3JV0A 4WI4A 5MHSD 4GSDH 3C5JB 5LWYH 4JFZL 1HQ4A 4OLWL 3PG2A 2FATH 2OXHA 2DIAA 2DBLL 3FQRB 1SJEA 3SDCC 2BXZA 3TO2A 4JO4H 4U6TA 4AIZA 4PLOB 4LGPB 4XGZB 1HK6A 2GK0B 1QR4A 4KKLD 1MRFL 2ICWJ 2ZSWB 1ZLVH 1MHPH 5JPNA 3X12B 1IM9D 1I7UA 2IMNA 1UJ3B 4FQ1H 3UJJH 5HI4D 3E6FA 1JHTA 2ARWA 2CKBB 5FO9A 2GT9A 4J1UA 5D2LA 4HWBH 1FAIH 2PF6A 5D2NC 3U6RA 1NCCL 2R8SH 2XT1B 2DRUA 5HY9B 5C0BA 5HHMB 1RMFL 1BBJB 1NGZB 4JHBA 1JF1A 2H41A 4JG1L 2BC4B 1QEWA 3QI9B 1S7VB 3LPWA 5IQ9A 3ALPA 4MNQB 2APXA 5IJKC 4UQ3A 4Y4HD 5LQBL 3BE1H 1UWXK 2A74B 5E99L 4U6VH 1DBKL 2H2PD 2IC2A 1XGUB 5IHUL 3V6BR 5MEOB 3GMPA 3TBTA 4HFWB 5FV1L 3VGHA 3WUZA 4FQJH 2NY6B 2VDQH 2XTJE 5E1HB 2YSSA 3MMEB 3MBEC 4OSUL 1JPST 3H3PL 1N0LA 3FZUC 4ORZC 2Y6SD 5CJQH 1MCKA 3Q6GH 1X9QA 4LBEA 4U1LB 1LK2A 1NFKA 4PJ9C 4NSKA 4XAWL 1M6OB 4MX7B 2BNRB 1NAMH 1PD6A 4Y2DB 4OUUB 4EDWL 1Q1JL 4YHML 1OP5H 1I3RA 1NUNB 4RDQG 2IWGA 3IDXL 3TP4A 1OVZA 1W8OA 1XGQB 1INDL 5ACLA 3RNQB 1OARH 3I75B 3OB0H 4NJAH 4PRPD 1MIEL 5HD8D 4I0PB 4PJGA 1RVFL 4K7PX 1JI2A 4HZLA 3VFVB 4X6BA 3VFRA 4DGYH 4QOKA 5DJ2A 1QR1A 1EEQA 1UWEL 4HXAH 4FQQA 3O3AB 1YYML 1OTTC 3O3DA 1GIGL 2I9TA 3G04B 3T3PF 3STLB 4LSPH 2WK2A 1IGIL 4Q0XH 1A7OL 3PWNA 1L9NA 4F3FA 3CFJA 4LKCB 3B9KD 4WW2B 5GSVB 1JPTH 3CDCA 1YEEH 1ZHLB 1UADC 4M48H 4EXKA 4F80A 3QUYA 1M4KA 2W59A 2NXZB 4LLVA 4PJDB 5JOFB 4F9PA 3P4MA 2IH1A 1CLYH 1QACA 4DEPB 4HIHB 5IB3A 3VMOA 4YAQA 5I1DB 5T3XL 3TIDB 3MYJB 1YNLH 3OKKA 4KK6C 2B8OT 3TZVB 3K8MA 3D0LA 3IDMA 4KQ4H 5C0CE 4WO4B 2EYRB 1M71A 2VL4A 2DYPA 1OCWH 2HT2C 5ANMA 1QOKA 3AGVA 1YQVH 2A73B 5HYSA 2GYSA 1VSCA 3PWUA 4X5XA 3SGKC 4BH8A 1ZA3A 3GUTA 1QPPA 2VKXA 1CFTB 4LOUD 1Q9KA 3FFDB 2C1OB 4X6EA 1TPXC 4E41D 4LVNB 4JHWL 1AY1H 2XTJB 2QQKH 5IMKB 3I6LD 2KQNA 3MLTA 4NN6C 4D0CB 5DJ0B 1DBJH 4Y7MA 3CCHB 2EDFA 3SGJA 4J2XA 3FO1A 3DMMB 1IAOB 5D6CA 3V4VH 4AG4L 5BMFL 2QKIB 2OTPA 4HKZA 2BVQA 2FYYB 2B5IC 5CJ5A 4G5ZH 5C2BL 2E7LC 2HFTA 4LRIA 3WHE1 2Q8AH 4YDJB 4YX2L 4LQFH 4AY0A 3PQYD 4KRPB 1OF2B 1R5WB 4R96B 2JJSA 3GRWH 5GS0C 1NBZB 3PP3H 4NC1C 2DBJA 1JUFB 4P23B 1MJUL 5BO1H 5C2UB 4ERSH 3RWFA 4ZFOL 5F1NA 2B1AH 1VKXA 3RPIB 4XPFH 4XBGB 3U79A 3OXRA 1KCSH 4TSCL 4S0SD 4U6HB 2OLDA 2OXGA 1CL7I 1K8IB 3ZDYE 1CQKA 4IRJB 4YXKL 3UPCA 1DUZB 2IPKA 4JRWA 5EOQH 5EUOA 5F9OH 1IC1A 2AVGA 5CEYB 2B39A 4A2MA 5JW5B 4LLWA 5I1KH 4ZYKB 4GSDL 1IC7H 1X44A 1T1XA 2R2EA 1NLDH 4XNYH 2FATL 3D3VE 2P42B 4PJIE 3HLAA 1FZJA 4R4BA 5ID0A 3KPSD 1CDJA 3JTTA 3TFKC 3WDHA 3ZE1E 3VJ6B 3NIFF 1KB5B 4JO4L 4OF3A 2BOCA 1T5XA 4ZUVB 1FNFA 5FUCC 5GGUB 2BDNH 5DI8A 3O4OC 4AT6A 3WFHB 1CE1H 5E4IA 4ZOCA 5C0CB 1MHPL 2GCYB 4EI6A 3MJ6A 4FQ1L 4PBXA 5FGBA 5HPMB 3UJJL 3U30C 1NMCB 1HHIA 5F9WC 3RTQD 3K3QA 2OL3H 5TDOA 4Z7VA 3ULVD 2ADGA 4GW4B 3RVXD 1CTNA 1Q9OA 2QR0A 4HWBL 2NY0C 4H1LB 5HHOD 1FAIL 1NMAH 3HCVB 4BZYA 2R8SL 3HRZB 5EN2B 3P11H 3MRGA 1KACB 1U3JA 3LCYA 3LQAC 4I0KA 4QLRA 3W9DA 1Y6NR 1EX0A 1NC4A 1P2CA 4NC0B 3BP5A 5FA3B 2AV7B 3TWCH 3QDHA 1RZIB 5H94B 5FKAB 4JFED 2YUWA 3BE1L 5ACMA 4Y16A 2YS4A 8FABA 4XPAH 1NC2B 2ICEA 2IBBA 3QNXB 4LHUA 2J6EH 4U6VL 5DF0A 3ZT7A 1F58H 5GRVK 4ZFOA 1UENA 3QJFA 4FQJL 4FS0A 4OGXL 2BVUA 2VDQL 3VWKC 4X7FC 4RNRB 1Q94B 1PKQA 1BGXH 5CJQL 5IVXE 3Q6GL 1HCVA 1N0XH 1AC0A 3MNZB 2Y36H 3C60D 3D1MC 4JFFA 1BWMA 5DMYA 2VZ1A 2WBJA 4MAYD 3IFLH 2DIJA 1HE7A 1XGRB 5KSBF 4HJGA 5KVFH 1NAML 4XNZC 4P5KB 1M7IB 2VLRA 1BJ1J 4H8WH 3CAFA 3FO0H 3INUH 2AGJH 2BCKB 3E6HA 5J11C 3SJVD 1OARL 3EHBC 5MENE 4U1MA 3CSYA 2JK5A 4NJAL 1LEGA 4QWWD 5IHLB 5KN5B 1GZPA 3TA3B 4QCIA 1GAFH 4PJCA 4IOFD 4NRZA 1F4AA 4ODWB 4DGYL 2GAZB 5CUSH 5D7JA 2XKNB 4HK0A 1J18A 4HXAL 3K7UA 1PZ5A 4N8PA 1UM4H 1QVOA 1CXIA 3D39E 5INDA 3D3VB 4ZXBC 3LKOA 4PJIB 5EBLB 4LMQE 2J88H 2O5ZH 1PEZA 2H1PH 4LSPL 3P9WB 4Q0XL 1EXUA 4GKSA 4WGWB 5DVNA 4HWBA 3QCTH 1U8QB 1RUAH 4MHHI 1JPTL 3ILQC 4YZFE 1TQCC 4ZPVA 2G60H 1YEEL 4M48L 3DURA 4CMHC 3WD5H 4JJ5B 2OP4H 1A1MB 2W65B 3V2AR 4G8GD 4QHKJ 1E0OB 1CLYL 2EDEA 4GKNB 4HKXB 4C58B 2FBJH 3T4YA 2OMBA 5A2LH 3JWOC 2CUIA 1TQBB 4R90H 2DL2A 5E8NA 3QNZB 1PBYA 1YNLL 3LKRA 1XF4A 5GIRB 1FNAA 2I26N 3F7VB 4MD5A 4J4PA 5DJAB 5ICYB 1C5DB 3RWJA 5DRZA 2FO1A 5CIPB 4KQ4L 1WWBX 3RGVB 1BMGA 3RI5F 5I1GH 5JR1H 1OCWL 2EYTA 2NY1D 4QRPE 1G7JB 4PS4H 1DBAH 4FQXB 2WV3A 1YQVL 2VXVH 3VWJD 5IVXF 1IAII 3S96A 4RQQA 3VCLA 3H2WA 5E2WH 1FSKC 5DJCA 3ARFD 1NAMA 3KPQB 1X5KA 1KTLB 1FVCA 1AY1L 2QQKL 1HH9A 4WFGD 4PJEF 1QSED 1KOAA 5T5NF 1DBJL 4CDHA 3EBAA 5INCA 1N5AB 5IKCB 4IRSA 1I8IA 3C8KA 2X4OB 4Y89A 2Z8WC 3GJFB 4RAHA 3V4VL 3VFUB 1PLGH 3OKEB 1S7XB 1MVUA 1G7LB 1F6AB 3QZWG 4YDVA 2ITDB 5EZLA 4ONFH 4J3WA 4PRIA 4NJ9H 5I1LA 1D5BB 5KOMC 3IB4A 2VLME 3M1BA 4G5ZL 4QXGH 4JFDD 4ZOBA 3BGFB 1RY7B 3QUZA 2DLHA 2Q8AL 5MENB 1I1AA 5FOJA 4MDJB 3PV7A 2DI7A 4LQFL 3VXTA 4D0DA 3GFUA 2J4WH 4LPUA 3GRWL 2AJUH 2XZQL 4G8IA 1WTGT 1V7NH 3BXNB 5FDWB 3OKOB 4KJYB 4KVNH 2CK0L 3ARSA 5BO1L 4MA1C 2VZ3A 4ERSL 1NDMA 2B1AL 3VXPB 2V2WB 4XPFL 3D39B 2VDOH 4P2RB 3X3GH 3UTQB 4Q74A 3EJZC 1KCSL 4F37F 3FFCA 1RAMA 4X7TA 3BH8A 3C08H 3TNNA 3VA6A 4OZIE 1QUNA 3D87B 5EOQL 1WFNA 5GGRB 1CD8A 5FKPA 4XAKE 3MRHA 3VXRD 3ZTJG 5I1EL 1ORQB 1CGTA 2F19H 5IVOA 4DFIA 4GMSH 1BF2A 4I48B 2EDOA 5I1KL 2AXFA 5L2JA 1IC7L 1CL7H 5BRZE 1TETH 1MFEH 1NLDL 4UOW0 4XNYL 5I19H 3QDMD 1ES0B 4OZ4A 3ULSB 1L7IH 5GRYA 4H5SB 4MZ3A 4GMTH 4UB0H 1MLBB 3OJDB 3L3GB 3QUMB 2O61B 5IB1B 4TULH 2BDNL 1CE1L 4PJ9D 1CXLA 1TNMA 5LGKA 1PX3A 2VDRH 3KPOB 3MV8D 4FXGA 1DLFH 1NH6A 4PB0H 4X4XA 1XGYH 5GRWA 4Y19A 5L6YH 1MWAA 3C87A 3LOWA 2OL3L 4X6FA 4RRPG 1EEZB 1U2HA 1NMAL 2VDKH 4FNLH 3TN0A 1KIUA 3QUYC 3P11L 4LCYB 4NFDA 3WIFB 4WDIA 4MB5A 2IEPA 4F9PC 2GUOA 5HVHB 4BJLA 1R6VA 1XFPA 3QIBA 5F6IC 1CIDA 1MCJA 3AXLA 3HC0A 4GS7C 3TV3H 1SJVA 1G6VK 3TWCL 1RSFA 2GTWB 1J8HA 1FCGA 4KY1H 4L29A 1DUYB 3FO2B 5FF6A 3GRWA 1RJYB 1G7HB 4P49A 4XPAL 4BH7B 2J6EL 4HUWB 3WHXA 1F58L 3QQ3B 4RMSA 3ROOA 4M7LT 3BP7B 4HUXA 3FJTA 3QA3B 3ROLB 2MWCA 3VXSD 4V1DD 1U8IA 4LLMB 4LPWA 1BGXL 1JJUA 3ZKXB 3D18B 3PL6B 1N0XL 1X4YA 4KMQA 2Y36L 2GJ6D 3R06B 4OAWA 1ORSB 3IFLL 1NCUA 1A7PH 1FZOA 4I3RH 5E8PA 1EHAA 2X1QA 5KVFL 1KELH 3LKSA 1KT2B 4H8WL 3C5ZD 4JDVB 4U3HA 3FO0L 3INUL 2AGJL 1I8MA 1HHHA 4P5TD 5AG8A 3SGJC 3DPBA 3ETBF 1WZLA 2AXJA 5D1QD 1LNUA 2CIKB 4LVHB 1IEBB 4OZIB 4P9ML 2HG5A 4PJ7A 3W9EA 1GAFL 3MGTB 2P8PB 4NO3B 4XXDA 4QXUH 4MJ6B 3NCCB 3MLUH 1VFBA 5JXEA 5F7MC 1PVHA 3QBTB 2YK1H 2M1KA 4LRIC 1UM4L 3KLDA 4JPIB 3O3UN 4LKXB 3VD5A 1KTDA 2J88L 2O5ZL 2EIZA 2H1PL 4OGYL 2JJSC 5EH1A 4CMMA 1IE5A 1RZGA 3JWNC 2OL3A 4CN1A 3MRQA 4GAGH 3QCTL 3UTTD 4UILH 1RUAL 1KPVA 5GS1A 1FFRA 2G60L 2PXYB 4FXKA 2F8XC 1P7HL 2VZSA 1UB5B 32C2A 3WD5L 4BFGA 4G3YH 2OP4L 5J89A 4YO0B 3QDGD 4JFQB 2AABH 4G8FB 4PR5B 2VITB 2F74A 1P6AB 3IJYB 3IKCB 3BQUD 2BSTB 2FBJL 5M7QA 4LCWA 4Y1AA 3GMMB 3NTCH 4R90L 2CR3A 3S5LG 4KRNA 3BYYA 1XIWB 1A6TB 4OJFH 3E3QE 5GS0D 1MCNA 2WBKA 4XP4H 3QPQD 5E1AB 1KB9J 3K74B 2HJLA 4QRTB 3NCYS 3T77A 2ICWA 4KV5F 4NWTH 1S7QB 4PJXA 3G08A 3KYNA 3GSVB 4A6YH 1WC7B 3PABA 5I1GL 2BP3A 2XN9D 5JR1L 4PS4L 3LEVH 1SYVB 5IB2B 1S5IH 1DBAL 3PWPA 5C08D 4JAMA 4Q6IB 2VXVL 2RJMA 5DK0B 2BERA 3OPZH 4ETQA 3DV6B 1K4CA 3ES6B 3Q3GB 4K8RC 4PJ5D 5E2WL 4XNUH 1JWSB 5HGHB 1RJZB 4X7EC 4U2ZA 1FNEB 5EU5B 2GITA 4M03A 4OF5A 5FGBC 1IGFH 1X5HA 4WENB 5B39A 1A2YB 4KGLA 3G5XA 1RZJH 1JPGA 3GB7B 5JUEH 2EDDA 3B9DA 1FYTD 1IAIH 2YRZA 4NKQB 2JCCE 2YA2A 3VFTA 1PLGL 1S7SB 1H5BB 1ZLVK 1EO7A 4L8SA 4U1GB 4ONFL 2ED8A 4NJ9L 3QUXA 3DIFA 2OYPA 4QXGL 2ZNWA 5I71C 5ID1B 4ZTOH 1XH3B 2M2DA 5IK3B 5EU4B 3STBA 1FIGH 4Y16C 5B21A 3RWCB 1SYSA 2LVEA 1UEYA 2J4WL 3BHBA 4R2GC 2AJUL 1P6FA 1VPOH 3T04D 3TM6A 1V7NL 1JF5A 2NY0D 3CH1B 4KVNL 1OM3L 1IFHH 1QBBA 4CAGA 1WZ1H 1WLHA 3IKKA 2HMID 5E8EA 2OZ4H 2BZDA 1IGTA 4PGEA 4BQ8A 1FG2B 2VDOL 3X3GL 3CZJA 1S7TB 1H3GA 1HSBA 3G6AB 1YYLH 4I4WB 5DD6A 4QHUA 4OCNC 3QSKB 3C08L 4CKVX 1WITA 3AB0C 4XRCB 3VXOA 5KSVB 1UH4A 3GZKA 3N85H 3P2TA 2F19L 3KS0H 4GMSL 2JF1A 4YBLB 5A1AA 3VMPA 4UU9B 5DHYB 1CL7L 3MV01 1KG0B 1O0VA 1TETL 1MFEL 5I1IH 5I19L 4JEGB 4I77H 5EU3A 1L7IL 2P43B 5E2TH 4X98A 2AQ3A 3BDXA 1WWCA 2CKBH 4GMTL 4UB0L 5AAWA 4LAJH 4EDXA 1U8PA 4OD2B 5D7JC 5C0RH 3QB7C 1R3KB 3FB8B 3HUJE 4TULL 2BSRA 1FNHA 1Z3GH 1JTTA 2VJXA 3LDBC 2VDRL 3NZ8A 3F8UB 4WHCA 1KCUH 3CFKA 5CEZD 1DLFL 5H37H 4ZFZA 1XGYL 2A6JB 3CJJA 2VL5B 1G7IA 3UCRA 1ND0B 2BHZA 5L6YL 3U0PB 3GMOA 1D5XB 3GMLA 3HMWH 4K3HA 3CD4A 5DRNA 3EHBD 4WUUE 4WFHE 5IBTH 3BEWA 1F42A 2OTWB 4JFHE 2VDKL 4FNLL 3WIHA 4JM2F 3BP4A 2A9MH 2VABB 1YDPA 5EPMB 4JPVH 4L1HA 1IAMA 4Y4KC 2V17H 4MQSB 3HI5H 1P7KA 3IGAA 3TGXA 5DFVD 2YN5A 4LEOB 3TV3L 5T1MA 5AUMA 1NEZA 1J11A 3DETC 1A6AB 1F13A 4TVPH 2JCCB 5GHWH 4U3XA 3EFFB 4KY1L 4PV8B 2W60B 5DHVA 3L3DA 1MFBH 3IJHA 1EDQA 1R5IB 5SV3A 4LLQA 2PYFA 5CJOH 5JXAH 1VCAA 4GG6A 3B6SB 5CBAA 5IFAH 4OKDA 2F54A 3B83A 2C7UA 2C5DC 1AR1C 1ODAA 5IMLA 3CUPB 2BRRH 4PJAE 5E24E 2ZOLB 1JZ3A 4JQIH 1FJ1B 1A7PL 4I3RL 3BPCB 3UBXA 4L8BA 4ZUWA 1KELL 3DOSA 3IAGC 1MOEA 3G6DH 4OFIA 3C2AH 4X6DA 2YD2A 4IRSC 3RL2B 1NPUA 4PGBB 3FQNB 5TF1H 5FFLA 1B9ZA 5D93B 2W0FA 3UTPD 5ESQA 1S8DA 1H8OA 4QRRA 2V5MA 5FYKU 1E4JA 1H0DB 1EVUA 3FTGA 4QXUL 5C0JA 2AS5M 2ENSA 4OCXH 2YK1L 3VGGA 3QUZC 1MJ7H 3LVEA 5BXFB 4LHQB 1HQRA 4L3EE 4N9OB 4WRLA 3T8XA 3C9NA 1J10A 4GAGL 1A3RH 3HUJB 4C56A 4UILL 2IF7A 4X9IA 4P59H 4NQSA 3TYFB 2PN5A 2DKMA 4G3YL 3QYCA 3C5SB 4U1HB 1UXWB 4NKIH 1KCRH 2AABL 2WANA 4YHLH 3DGGB 4WUUB 3NTCL 3PP3K 1E6OH 2DQFA 2X4UB 4KKCC 3QWRD 3MZTA 4OJFL 4U1SA 4XP4L 3TCLB 1OGTB 1A02N 3CVHH 3L9RA 4NWTL 3AS2A 3JVGA 2LU3A 4YNYA 1ITCA 2AK1H 4A6YL 1HZHH 4J3UA 5KSAB 5GPRA 5DGRA 3H3BC 4KI5C 3EJZD 3LEVL 1S5IL 4TUOB 3I6KB 4OZHF 3OPZL 1S9VA 4KUCD 5H2BA 1QFHA 4XNUL 4K71B 1XMWA 1KCLA 4RGNE 3DWTA 3HC4H 3QXTA 1ZLWK 3QFJA 1IGFL 5CGTA 4POZC 1RZJL 2ZG1A 5JUEL 1F4HA 1JVKA 1A9EB 1IAIL 4LMQI 3TN0C 2D7QA 3QNYA 3BUYB 1DQDL 1INEH 2A6DA 4KKBD 4PJAB 1DSFH 3TIEB 5F89A 4F7EA 2OX5A 3UYRL 2YD1A 3L5XH 3DUSB 4KJWC 3QIBC 2FECI 2X7LB 3DX7A 2BVPA 4ZTOL 3SDYH 2A6IB 3SDAD 4OM0H 1FIGL 1FV1B 4P9HH 5FA4B 3P9MB 1MQKH 3ARGD 5DEGA 2R23B 1K6QH 1VPOL 4LGRB 3QIUA 4RAVB 4DZ8B 1ZT1B 1IFHL 3AROA 2AI0H 4HQQL 1WZ1L 4RGMB 4L4VB 1OOAA 1TTFA 2OZ4L 4LSSH 3TVMA 5IW6A 2C26A 2CLRB 5D2NE 4Y4FA 1YYLL 3CFBB 4L3EB 2Q6WB 2G5BB 1T22B 3HC3H 4O2EA 4BQCA 1WGOA 2WAHA 3KDMA 1S7UA 2B4CH 1DQQB 2ERJB 5DO2D 5HGGS 3N85L 4NO0B 5GZND 4MLIA 1I1FA 4FABH 2UZIH 2I07A 2X41A 5I16A 1AO7E 5E2UH 2KQMA 3C6LD 3FAWA 5KS9E 1FNLA 3GSXB 5I1IL 4JCMA 3I84A 5JOPD 4I77L 3FOLB 3VD9A 5E2TL 3FT3B 5C07E 4WFFE 2CKBL 1EAPB 2RGSA 5C0RL 5C7XH 4ZPTB 1MSPA 2VIRA 5BZDB 4HIIA 1Z3GL 3OL2A 1KCUL 5BOZG 2MMXA 3QP3A 4NM4H 2KUTA 4NQEE 1CVRA 3QXDB 4I18A 3ZYZA 4YGAB 1Q8MA 1AI1H 3HMWL 5HYSG 5J1TC 4WU5B 5IBTL 3RZCB 5GS1C 1JZ4A 3D25B 2G2RA 4MB4A 3I85A 2A9ML 4RGNB 4JPVL 3FCTA 2YOCA 4AENB 3V6ZB 5I15H 2V17L 3QZWB 3HI5L 2VLKE 4Z7UA 3K81A 1GC1H 2CMRH 1XGPB 4EUPG 1FL6B 5BV7B 4GJTB 5F7EH 5GHWL 4DFHA 4TVPL 3SKMA 1CIUA 3JUYA 1MFBL 4U6XA 1G9EA 2W9LA 3L7EB 5EO0A 4DK6A 1EFXA 2HVKA 2OR9H 2QADC 3SDCB 5CJOL 5JXAL 5GGVY 3VFNA 2VLJD 2A38A 1NCNA 5IFAL 1NEUA 5T1LA 4JN2B 3LKNB 4LFHD 2PO6A 5T3XD 4N0UA 5JPMB 2BRRL 3T2NH 4JQIL 1S7RA 2VZUA 2NNAA 3R0NA 4H8WC 1ZK9A 5DFTA 2GFBA 5D2NB 2VR5A 3G6DL 1D9KA 3C2AL 3MCKA 4OT1H 4XVSH 1FZKB 5C0AA 2XZZA 4D8PB 2QEJA 1ZT4B 4IOIB 4LSVH 4A2LA 3X12A 5K9QI 4KKAC 5TF1L 3C8DA 4Y0GA 1UWGH 4U6YB 4O2CB 2HT3C 2NW3A 5KJRH 4L8SC 4EKXA 4ONHB 4GAFB 4XB7A 3QUXC 5J6GA 1I7ZA 5FM8A 1AH1A 1AO7B 4C57C 3D69A 4OCXL 4AIOA 1NGYB 5KS9B 1MJ7L 1AD0B 4KJQC 4XNMB 4LCCA 4EN3A 5F7DA 3WO3B 1ZXQA 3CDGB 5CP3A 5C07B 3UZEA 3L5HA 1EEYB 4G6FD 5A16A 1S7VA 3C6SB 4ZUTA 3KWWB 1A3RL 3VXUA 1RZFH 3MBEB 1B0GA 4P59L 2L7JA 4X4ZA 1SHMA 1DJSA 3VD4A 3QJHA 4FFWD 4XXCA 4PG9B 4NKIL 4NQEB 1KCRL 5CIPH 4Z0BH 3V6FA 4XTRC 4YHLL 4MXQC 5F7UA 4XBPB 1GGYA 2UVFA 1MI5D 5D1XD 1E6OL 4P2QA 5IVNA 2ATKB 1L0YA 3T0EA 1S78D 2FGWH 2O93L 1Z0NA 1HHKA 3LKQA 4GAJH 2C3VB 3CVHL 1SVZA 5D1ZA 2EKSB 1A1NB 4U1NB 4UDUA 2VLKB 1ZS8A 1M6OA 3IFPB 2BNQA 2AK1L 3BZ4A 1HZHL 2EC8A 4NC1E 4NQXB 4OI8A 1T80A 2DLEA 3V52H 4JO1H 5D7LA 2VWEC 3HZVB 2HKHH 2NY3D 4JRXE 4LHUG 1H3XA 1ZWIA 2WMPA 5GSRB 2G9HA 3GJFH 2YZ1A 5MI0C 4EVNA 3VFVA 3S9DB 3HC4L 1AKJB 3DVNB 2G75A 3U0TA 2Z8VC 4APQB 2P49B 5GISH 3FB7B 1OSZB 3BESR 3G04A 2CLZB 2ID5A 4S2SB 1INEL 1DSFL 4MS8C 1AJ7H 3MSPA 4X8XA 3DUUB 5DVOA 5AD0B 4EBQH 1KNOB 2R15A 3L5XL 4HS3B 1ZT7A 1D5ZA 5SWSE 1ZHKA 4GRLA 3MXWH 1QBAA 3SDYL 4OM0L 4P9HL 4MZ2A 1MQKL 4QEGA 43CAA 1FL3B 1K6QL 3HMXA 3WS6A 3RWEB 4OQTA 3T2QA 5HHVH 2GJZA 2AI0L 4NUJB 1FHGA 4DAGH 4HLZH 4LSSL 1UACH 3QULA 2SEBA 2NX5A 1T1WA 3L5WA 4KXZI 2DQEH 4Y4KD 4YDKH 3TZVA 4ZFFA 4P3DB 2ZG3A 2EXYC 1TPXB 3O6KH 3BGMB 3HC3L 1G7QB 1F45A 2B4CL 2R1WB 3DETD 1WIUA 4NN6B 5H35B 3QUMH 4FABL 2UZIL 1ONQB 5HGAB 2DKSA 2X4NB 3CVHA 4H20H 1NGPH 1YNKH 5E2UL 1TZGH 1P7QB 5DC4B 3UDWA 1YEDB 3V79C 2AJZB 1K3IA 4PRBB 2B5IB 4D9RE 3QWOB 4U1JB 1AGEB 1D5MA 2L4OA 4QF1B 5FUOL 1I1YA 3MCLH 5C7XL 2ICES 3PE9A 2PYEA 3WNPA 5BOPA 1F00I 1RZ8A 3VH8G 4ALAH 1GJIA 5GGSB 1QRNA 2P5WE 5EZIH 4NQVB 3IFNH 4ZO8A 3KGRA 5F21B 1BQUA 1AI1L 2NLJB 5MEPB 4JRXB 4JFPB 3LEYH 5C08B 1HSAB 4IMLB 3IJSA 4C54A 1OF2A 3WLBB 3S8WA 3OJVC 2X1PA 2GSIB 1MNUH 3T1WA 5TDNA 5I15L 1YEGH 4S11A 4PJ5B 4K3JH 3EOBB 2Z4QB 3ECBA 1GC1L 4UUJA 2CMRL 3WNMA 2JB6B 5F7EL 5ITFA 1J1PH 5ADOH 4OLVH 3UPAA 4G9DB 1FPTH 3DX6A 4UDTB 1HHGB 4MVBD 5DTFB 3JVGC 4ZNEE 4YXLH 2OR9L 1B4JH 3VI3E 3GSNA 2I27N 4L4TD 1HEZB 5SWSB 5IR1B 4R4NC 4PJFF 3VW3H 4KK8D 1T83C 2R2HA 2VISB 2CGRH 3O4OB 1QBMH 4F15B 2Q86B 3REVA 2YUXA 1MIMH 3W5MA 3RDTD 3U30B 3QQ4A 4NQCA 3T2NL 5F9WB 1CICA 3G6JE 3V7MA 3WJJA 8CGTA 3KPNA 3WFHA 2Z92B 3ARBA 3TPUB 1FL5B 4XVSL 2NYYC 4OT1L 5IIEA 1T3FB 4OFPA 3WFBH 2NCMA 3MUJA 4LSVL 3UO1H 3GMRB 1UWGL 2XQBH 1OL0A 2IFGA 1W0WB 5KJRL 1KULA 2PCPA 1KPUB 1RI8A 1XZ0A 1U93B 1A6ZB 3EOTH 3V95A 2EKJA 4LSTH 3O4LD 1LD9B 3T0XA 3D6GA 3GSQA 3MGAA 1PW3A 3OB8A 3IDIB 3QIUC 5GGQH 2YD4A 3WFEH 3DO3A 3VWKB 4G42A 2V9RA 1RZFL 2YPVH 4R8WH 3TVMC 2EE6A 2VN4A 4OFDA 2P5WB 1JV5B 4Y4FC 4PRDB 3DV4A 2QL1A 4LCUA 2AXHA 1FNGB 2DL9A 5C0BE 4PG2A 3MV9D 4Z0BL 1QFOA 3WE6A 1ZGLP 4W68A 5DS8B 4XNZB 2X4RA 1J8HD 2HYMA 3K8KA 1U8NB 4PUBH 4PP2B 3MRLB 4R3SB 1RHHA 2FGWL 5J11B 3BJLA 5I76A 3MUHL 5EBWB 4X4YB 1GVIA 1MHHA 1UT9A 2FEDD 4GAJL 2AEIT 4M6AA 1O7VA 4WI2A 3PDGA 1MFDH 2WWMC 1W72B 4Z7OE 2Z31A 4JY4B 3BO8A 4LAQH 4H88H 1YJDH 1VACB 2J5LC 5HGDA 3V52L 4JO1L 2HRPH 5EIIA 1TXKA 3NN8B 5SWZA 1JGLH 4KTYA 5DSCA 4ZXBB 3HE6A 3WKMH 1CGUA 1NBYB 1KIRB 2VLLA 1A9BA 4OKVA 3V4UH 5EU6D 5KSBA 3FB6A 1ZOXA 3O45B 1ZHNA 4I18C 3SY0A 2QQLH 1RZJC 5FYLE 1DN0B 1TQCB 3SBWA 4CMHB 1G0DA 2DMKA 5GISL 2FH6A 5IUSA 3D3VA 3OKMA 1P4BH 4UT6H 1U3HA 3BZEA 4RFNC 1AJ7L 3BMWA 2A6KB 3SDDA 3ZE0F 3G6JB 3MPCA 1NFDF 4EBQL 3S36X 4PJGE 3VXMD 1JZ8A 5IM7B 2H6PB 1U8QA 4P4KD 1P84J 3TBWA 4PTTB 2IBZX 2X70B 5F7HA 4XBEH 4UQ2A 5ISZD 4QOKE 3RVUC 1Q9WA 5C0EA 3GM8A 4JJ5A 5JDSB 4YEEA 4QKXB 3HE7C 4J3SA 1A1MA 3AU1B 3MXWL 5CWSB 1HQ4B 1YMME 5IWLA 1SBSH 4IMKA 4IJ3C 1ZMYA 3BW9A 1SJEB 4LSRH 5HHVL 1RULH 1BF8A 5EU7C 2YWYA 3TO2B 1PFCA 2FECL 4DAGL 4HULB 1SBBA 1IGYA 3OWEA 2DQEL 4YDKL 4O51A 4OCWH 3FT4A 4QRQA 1FSKB 5JPNB 2PO6C 3BFOA 3O6KL 1I7UB 4KTDH 1KN4H 4PB9H 5I0ZA 3P4OA 1XCQA 3H7LA 3E6FB 1JHTB 2MCG1 4WI6A 2GT9B 5FO9B 5F8QC 3OF6D 5D2LB 3QUML 5D8JL 3HZYA 3U6RB 5IMMA 1D9KC 4KXZH 4H20L 4MD0A 3NIGE 1NGPL 1YNKL 4TVSa 1TZGL 1R3JA 5C0BB 4TTDD 4GW1A 3TH3T 1JYWA 2X1XR 5T3ZE 5JW4R 5IROA 1UVQA 1FRGH 3HPJA 1QEWB 1UZ6F 1U91A 1DEDA 2IPUG 5IQ9B 4MB3A 3UMTA 1N5AA 3ARED 5B4MC 5ANME 5IKCA 5IVXA 3MCLL 4UQ3B 4GBXA 3ZMRA 4PJ8A 1KIPA 5IEHA 4ALAL 3PJSB 1UXSA 4LCCC 4EN3C 5EZIL 2OQJA 3GMPB 3TBTB 5FYKE 5CGYC 3IFNL 4MA1B 3I50H 2FIRT 1MCQA 1OAZH 4PJEA 1FFNA 2QSVA 2YPLA 5FEBA 2YSSB 2MCPH 1KJMA 3LEYL 3SEPA 3EOAB 4NQDD 2DLIA 2WQ8A 4LBEB 4UV7H 4XXCC 1MNUL 4OV5B 5FAAA 2R1YA 2Q76B 1LK2B 2F8OA 2H45A 4HBQA 1YEGL 4NSKB 4YHPA 1IEHA 1AXIB 4K3JL 3F65A 2LU4A 5HGBA 2MHAA 5TQ2H 3DVIA 4YC2B 4RCAA 3T0EC 1J1PL 1GGTA 3TJHC 4OLVL 4XC1H 5ADOL 1Z9MA 1FPTL 4HJJH 5D1ZC 5CKAA 4EEEA 4PJGB 4EQ2A 4KJPC 4HZLB 4YXLL 1B4JL 1ORQA 1BIIA 4X6BB 3IDJA 3VFRB 1EVTC 4QOKB 5DJ2B 1QR1B 2EH7H 3VW3L 4FQQB 2VQTA 2CGRL 3MUZ1 1DVFD 1KTKE 1QBML 4MXQD 1TZHA 2I9TB 1ITBB 1MIML 1GZQA 4JJHA 1BD2A 3PWNB 4F3FB 3CFJB 4PLKD 5E2JA 4PY7B 3CPLA 2E6PA 5EUOE 5FYJU 3STZA 1NBQA 2YRLA 1ZVSA 4LP5A 2K3TA 3QUYB 5J8OA 4RBPH 3U4EA 3WFBL 4LLVB 1CD9B 3UO1L 3P3YA 4QRPA 1FC1A 1MCRA 3P4MB 2IH1B 4I3SH 4Y88A 1GGCH 3LH2H 3NPZB 5F6IB 4YPGA 5A3ID 5IB3B 4YAQB 2YD7A 4GS7B 3EOTL 1D7FA 3DXAA 1JZ7A 3EJYC 3OKKB 4LSTL 4CJ0A 4NZTH 2NXZC 3U2SA 4GRLC 1LO2H 1MY5A 3D0LB 3AAZB 3IDMB 4Y5VA 1AQDA 1M71B 3UC0H 2DYPB 5GGQL 3GO1H 5E5RB 5F97E 1WWWX 4N0FA 3WFEL 1JNHA 2CO6B 5ANMB 3TO4A 1L9MA 5IVZA 4FTVA 3JV6A 4R8WL 2DQUH 2YPVL 5HYSB 3ULUD 2GSGA 3PWUB 3FO2A 4X5XB 4BH8B 3NBNA 1ZA3B 3GUTB 3OAZK 3SE9H 3TZVC 2R4RH 1Q9KB 4HUWA 4X6EB 1J0YA 4MQTB 1WAAE 1ZSDA 5E00A 3CSPA 3MLTB 3AY4A 4PUBL 3MRCA 1LGVA 1OGAD 5JIIA 3EDFA 1JCKA 3FO1B 5DQDH 5SX4I 4M3JA 5D6CB 1EMTH 1MFDL 3UDWC 2FLRT 4HJ0D 1AD9A 4B7LA 4MXVE 1E4XI 2XTJC 1U8LA 4HKZB 4LAQL 2BVQB 1HILB 4H88L 1YJDL 4HKBA 1A4KA 1NEZG 2HRPL 1CGYA 5GQBA 5L2KA 2EE9A 4L3CA 1JGLL 1PKQE 3WKML 5IBLC 5GJTH 5K33A 4CDGC 1OP3H 3HPLA 3V4UL 3PXHA 3NFSH 3DJ9A 4JFFE 1FVEA 4MJ6A 1UQSA 3RWFB 5F1NB 2QQLL 1VKXB 3PHOA 2VLRE 5CD5D 4JPIA 5BQ7A 5BRZA 1NGWA 3DROA 3OXRB 3NA4A 4UTAH 3UTZA 4BFEA 3NCYP 1P4BL 1HH6A 4UT6L 1XCTA 2KZ1B 4K9EH 1WBZA 3OR7A 5I74C 3C09B 2P5ED 3UBXG 1RK1A 4WNQA 1R0AH 5EUOB 3I3EA 2K1MA 3O8XD 4FQ2H 4PJCE 1J5OH 4XBEL 4FQCH 4LLWB 4I9WD 4RMTA 5A2FA 4P9HC 4JFQA 4MD4A 1T1XB 3TBYA 4PLNC 1SBSL 1WEJH 5F7FA 3RKPA 4IS6A 2EYSA 3HLAB 3NH7H 1FZJB 1U8MA 4R4BB 5ID0B 3HR5A 2MSPA 3WLWC 4LSRL 3HNVH 4OD1H 1OHQA 1RULL 3JTTB 4G80A 4MSWA 2BOCB 3RY6A 5DURD 1T5XB 1HN1A 5DI8B 4AT6B 5EO1A 4QRTA 5DRWA 4Q9BA 2IAMA 4OCWL 1F6LL 2X10A 3L5JA 4EI6B 2B4CC 4M1CD 3UZQA 1T0NA 4KTDL 1KN4L 4PB9L 2XFXA 1HHIB 1X5ZA 3CFCH 4XCYA 2FB4H 5TDOB 3WJJC 2ADGB 5DZOA 3VI4E 1KBGH 1Q9OB 2QR0B 3JV4A 1L4IA 5CEXA 5JW4Q 2NY2C 3ARBC 3MRGB 1Z9LA 1QG3A 5HGHA 4GRMA 1JI1A 5JIPA 2R39A 4XP6H 3W9DB 1NC4B 1P2CB 2Q3ZA 5FM5M 3BP5B 3VG9C 4IDLA 3VDAA 2ESVA 5I71B 2YPKA 1IAKA 1RHFA 4Y16B 8FABB 5IJVA 5J1SC 2ICEB 4LHUB 4R2GB 1SMAA 3O6FD 4K3GA 4ZFOB 5DFWH 3I50L 4PRHD 3QJFB 2NYYD 2X42A 1OAZL 4NKDB 5BV7H 4OLUH 2MCPL 5IK3A 5AYUH 1PKQB 4HXBH 4FFVC 3WFCH 4FG6D 3NCJH 4D9QD 3AMKA 2PR4H 4UV7L 5E70A 3NPSC 4JFFB 3AB0B 2WBJB 3CH1A 3OKLA 4PG2C 5DC9B 3L5IA 2Y9RT 1C7SA 4HJGB 1GC1C 1F4WH 1JN6A 2D4FA 5TQ2L 2VLRB 1CD1A 3X17A 4PRIE 2R69H 3EIFA 3E6HB 3G6AA 3SCMA 5GXBB 2DKUA 4XC1L 2P44B 1NSNH 1X4ZA 2NXYB 3CSYB 4U1MB 2JK5B 4Z5RA 1LEGB 4HJJL 4JCLA 2GI7A 1KYOJ 1T6VN 2BY1A 3OAUH 4QCIB 4PJCB 2Z31C 4MQ7A 3TVMD 1MAMH 4NRZB 5T1KA 1T89A 2V7NB 3IU3B 5D7JB 3GMQB 2WUCL 3ZTJH 2EH7L 4HK0B 1PZ5B 1LO4H 3J7HA 1QVOB 5GS2H 3LDBB 5DHYA 5INDB 3HE6C 1KC5H 4YLQT 2FSEA 4R0LA 3QCUH 1MAKA 4DUXA 3FFCE 1EUUA 1JPFB 1FNSH 3MA7A 1EXUB 4GKSB 3HZMA 3F12A 4LPXA 4ZS6C 2YWZA 4ZPVB 3SBWC 3G5ZA 3DURB 6FABH 1T5WA 1G1YA 3DVFA 1U3HC 4G9FD 4M6OH 4MJID 2J8HA 4I3SL 3SDDC 2JIXD 1UCBH 1GGCL 3LH2L 3T4YB 4PRNA 5E8NB 4KI5E 7CGTA 2V2XA 3S37H 3LKRB 5CP7A 3MRKA 4ZNCD 4NZTL 2BJMH 4MD5B 1QSFA 4KK9C 1LO2L 2AJYH 4K2UH 1OP9A 4HHAA 1BREA 3D85D 5DRZB 4MA8H 3HRPA 3QIWA 4PGZA 4XP9H 4IMKC 1HOCA 3UC0L 4N5EC 5KANI 3GO1L 1TQBC 3BPOC 4Y19E 1JPSH 3ULVF 1AC6A 1OD9A 2DQUL 1BEYH 3S96B 4JM2A 4TNWF 4RQQB 3VCLB 2EH8H 4MA3A 3SE9L 3UJTH 4MNHA 4WW1A 1QYGH 2R4RL 4GLRI 5CLWA 1R5IA 1QFUH 1NAMB 5IMOA 5F6HI 1FVCB 1PDKA 2F58H 1HH9B 2HRLA 3RNKA 3HE7D 3O9WA 4FQXC 3NCEB 4LIQE 3PNWA 2DQHH 5INCB 3H9SA 4IRSB 1I8IB 3C8KB 5DQDL 5FUZH 1U41A 3F5WB 1MVUB 3R4DA 2ZOLA 4YDVB 1EMTL 5IROC 2X9WA 2RFXA 5EZLB 2ADJA 3BPCA 2X05A 4N0CD 4PRIB 5I1LB 1V3LA 2NTSP 5CZVH 3M1BB 1F02I 2AJ3A 3QUZB 4YHIA 3O6MH 2R4SH 1I1AB 3B8SA 4GBXC 4JY6A 2Y06H 3VXTB 4PJ8C 4D0DB 3U7AA 3V6OA 5GJTL 5SX4H 3ZKND 4PP1D 5BZWA 3NFSL 1E4XH 2NR6C 1W8NA 1SEQH 1NDMB 1H9VA 3WNLA 4DK3A 3WDJA 3S35X 4UTAL 4AK1A 4JVPA 3FFCB 1QSEE 1PYWA 5DZLA 3EOYG 4X7TB 4HG4J 3BH8B 3CU7A 4K9EL 4W70A 3TNNB 1SMOA 3GGWA 1R0AL 5FKPB 4PJ7E 3MRHB 5FHAH 4FQ2L 2YMXH 1IARB 1J5OL 5HHMD 4FQCL 1HHJB 4MXWH 2AXFB 2OMNA 2W9DH 3DI2B 5L2JB 2CXGA 2AQ1A 1MHCA 5TH2A 4OZ4B 1WEJL 4OIBA 4MNQD 3NH7L 3HNVL 4OD1L 1IMHC 3KPPA 2J3SA 4CUCA 1RQ5A 4PY8J 3H9YA 3TCLA 2VAJA 3MNWA 3FN0H 3DHMA 1L6ZA 3TT1H 2CPCA 2ILLA 1J8KA 2NY6D 4FXGB 3KPRA 4X4XB 2UY7A 4XHJC 4Y19B 3CFCL 1MWAB 2FB4L 3VGAB 3TJHD 3CMGA 3ARZA 4X6FB 3WJLA 4LCWE 4Y1AE 3EUUA 1KBGL 3DVGA 4IBLT 3TN0B 1MUJA 3KLAA 4CADA 2BNRD 3PWVA 5C3LD 4Y2DD 2GUOB 5E95B 4XP6L 3V5DA 2DF3A 2R56H 1G1CA 3QIBB 1MELA 2FH8A 2PW2A 3AXLB 4PLJD 1JHKH 4OZHA 3PWPE 2VDNH 4I0PD 4NZRH 4L29B 3BUYA 5FF6B 4XCEA 2CSPA 2ZCKH 3WHXB 4Y5VC 1OTSC 3ROOB 2H26A 3EGSA 2V7HA 6CGTA 3TO4C 1CGWA 5BV7L 3CXHK 4OLUL 1U8IB 1LEKA 5KZCD 5E8OA 1JZ2A 5AYUL 2NTFA 4HXBL 3WFCL 3V8CA 4W6YB 3UTSE 1S7WA 3NCJL 1E28A 1QKZH 3LPFA 2PR4L 1JL8A 3ZL4H 4OAWB 4DZ8A 5TGBA 1IGCH 5DT1H 1FZOB 5E8PB 1F4WL 2DIBA 2P8LA 4CVZA 3LKSB 2NXZD 3CC5A 2XICA 3AY4C 2E7BA 4LLAA 1ADQA 4HX1A 1DQLH 1MCWM 2R69L 1I8MB 3ZKXC 1HHHB 1LNUB 4M61A 1NSNL 3PL6C 5EDXA 5I66A 4WTZG 4CW1A 2HG5B 4PJ7B 3W9EB 3OAUL 3U4AA 4F8QA 4QY8A 4XXDB 4WWKA 5FO7A 3TZVD 3L3KA 1IILE 1LO4L 3H0TA 3N1PC 4WO4D 3ZDZF 5D7KE 1KC5L 1CCZA 3LQAH 3ME0A 1KTDB 3QCUL 3PXJA 1OAXH 5C70A 2E9JA 1FNSL 1NCBH 2P8MA 4CMMB 3FT3A 1RZGB 1WCQA 3MRQB 1JGVH 5EBMA 3IRPX 3ARDA 5FV2A 5GS1B 4FXKB 1CXHA 1VFUA 5D5MF 1IT9H 3RVTD 5BZDA 3WNKA 6FABL 32C2B 2XG4A 3MJ9H 3L3JA 2XTJD 2J8OA 2D03H 3OGCA 5E5MA 5EFIA 4M6OL 4Z7WF 4HUNB 4OGAC 3FQXA 2F74B 3QEQA 5C92A 1UCBL 4LCWB 4Y1AB 3KLHD 4BK4A 3DMMD 5HHPA 5LVEA 5DK3A 3X11B 2E8YA 4MJ5A 3S37L 1MY7A 3F7QA 1RPQA 1W0VA 4JQVA 2VWEE 1PSKH 5DJZB 2BJML 1T20A 2HJLB 4M1GH 2D9QB 3T77B 2ICWB 5B38G 2AJYL 4K2UL 4AM0A 3E8UH 4AENA 4JE4B 4MA8L 3G08B 4XP9L 3KYNB 2QADB 3BIKA 4LRNH 4Z7NE 1PQZA 1WISA 2XWBA 1F3DJ 3S7GA 1XGPA 1A21A 3PWPB 1JPSL 1VEPA 4JAMB 5EULV 4KRPD 5A43C 3MFFA 3RY6C 5I1AA 3SDXF 1URLA 1BEYL 4ETQB 4JREB 5E94A 5CAYB 2AKRA 2VTFA 2IQ9H 2EH8L 4P23D 3UJTL 2IGFH 5B22A 4YBQC 1QYGL 3RVVD 3L7EA 5F1KC 1QFUL 1W72H 2GITB 3QEHA 5FK9A 1YNTB 2F58L 3IFOA 3WDIA 5B39B 4L9DA 3G5XB 4L3AA 4AEFA 1JPGB 1PG7H 2DQHL 3UTSB 4JN2A 4EZMA 1FFOA 1DDHA 1HYSC 4O4YH 2P1YA 3VFTB 5FUZL 1KXVC 2DDQH 1R3LA 2DAVA 1A7BA 4GLRH 5DJ8A 4L8SB 1KGCE 3ZKQD 1G9MC 4EQ3A 3S88H 3RUGF 3QUXB 5HI5C 2HP4A 5CZVL 1CGSH 3DIFB 2EO1A 5D7IF 4KUZH 4U3CA 4GG6E 2C3HA 4KMTH 3P0GB 2F54E 3O6ML 2R4SL 2Y06L 5JOEA 1X6LA 4ELMF 2R0LH 1SYSB 3SKOA 3BHBB 3WV0A 4U1GC 3F58H 3F7YA 1U36A 3O3EA 1E4XL 4RISH 2NY2D 3FRPG 4X7CC 1SEQL 3H3KA 5E8EB 1YN7A 5C0CD 4M4RA 1IGTB 4PGEB 5F3HA 1CFNA 2AEPH 1HSBB 2UUDK 1KIQA 4X6DE 1XF5A 5DD6B 4XC3H 4QHUB 1OB1A 1EEYA 3U48A 3LQMA 3VXOB 5AYQA 4QRRE 5AG9A 5FHAL 5HI3C 1J7VR 2DMBA 2YMXL 4RRPA 3EFDH 4JM4H 4PBWD 3ZDXF 4MXWL 3SCMC 1JYNA 2W9DL 2AEQH 3RJQB 2VZTA 1G7MA 5EU3B 3CFIC 4JFXA 5E0QA 4X98B 1F3RB 3D2UA 3BISA 1T89C 4EDXB 2FJFA 1NC2D 1EFQA 2IALA 4C56E 5C9JA 2BSRB 4HIXH 1EBAA 3FN0L 4S0TD 4BYHA 3TT1L 2C4FT 3NZ8B 1DE4A 1QSZA 5E2VL 1Y18A 5MI0B 5K9JH 3HI1A 3IFPA 3CFKB 4R0LC 3R1GH 4ZFZB 1G7IB 5CZXC 1PY9A 2D9CA 3VFWA 1EJ6A 1I7TB 1E27A 2GIYA 3GMOB 3E3QC 3GMLB 2HH0H 3MLXH 4I0CC 5JO5A 3BEWB 5C0GA 3BP4B 1YDPB 1SM3H 1RJLA 4HLJA 4NZUH 3MRMA 3B8YA 1P7KB 3IGAB 2R56L 3P0YH 5DD5H 3ELAT 3EZ8A 3S3JA 3T08A 2YA1A 5FYJE 1JHKL 5T1MB 4CVUA 1C7TA 1DFBH 1NEZB 1UCTA 5HHNA 2N56A 2VDNL 3TA3D 3KYAA 4NZRL 1G6RA 5DHVB 3L3DB 5SX5H 3IJHB 4MCYA 1AIFA 4OF8A 1CE6A 3QIWC 2CR6A 4LLQB 1B2WH 1H15A 2PYFB 5FYLH 5IW1A 5JQ6H 5CBAB 4GG6B 5DJYA 3QFJE 3D3VD 1BFTA 4GRWF 2F54B 1UJTA 2ZG2A 3L7FA 4JM2C 3DX8B 1QKZL 1TVHA 2C7UB 3HHRB 1DP0A 4RWHA 3ZL4L 1IGCL 2ARJQ 5E9DA 3QXWA 5DT1L 2OK0H 3UBXB 4L8BB 5KW9H 4ZUWB 1SY6H 4EOWH 2WSKA 3Q6FA 2DQDH 4Y5YA 3O9WC 4C4KO 3UYPA 5I17A 1DQLL 2OI9B 2EC9T 4X6DB 4O5LH 5K9KA 2RR3A 3BGAA 3BGMA 2W0FB 2VQUA 5ESQB 1S8DB 4QRRB 2R1WA 5DUPH 4H26A 4BZ2H 4G43A 2YD6A 2DWEA 4CNIB 4MQXC 3FTGB 4RZCA 5C0JB 3S5LA 3ESUF 1K8DA 3RGVD 4ZSOA 1FBIH 3LQAL 1A22B 4AEEA 1YEDA 1HQRB 1OAXL 4FQXD 4R97C 5D70H 4ZAKA 5JHDA 1NCBL 2VXSH 1QZ1A 3RRQA 3VFMA 3T8XB 3C9NB 4MJ2A 3OX8B 1JGVL 3CDYA 4P48A 4C56B 1D6VH 2OSLA 4NQSB 3DHJA 4F7TA 3IS0X 1IT9L 4KGJA 1A6WH 3MJ9L 5K93A 4M7ZC 5T3ZH 4K3DH 1LWRA 2D03L 5TF0A 3H8NA 3GI8H 3MOBH 4NQVA 3OKNA 4P2YA 1OP3K 2F53A 1YA5A 1UM5H 4UIMA 2DQFB 1LO5A 2IH3A 4XWGH 3B5HA 4NBYB 4U1SB 5JLZA 4IMLA 4KZDH 3MLPA 1PSKL 4M1GL 1U8KA 1A4JB 4JKWA 2BHYA 4M7LH 4YHYB 3E8UL 4GXUM 5FYKH 4YNYB 5ERWA 5DD3H 4LRNL 4HV8A 5CJBA 5MEND 4P2OA 3OHXB 4N90E 1BQSA 4N1EA 3K4DA 2HFFA 3SPVA 2COQA 3NFPA 1S9VB 5H2BB 1II4E 2IQ9L 3B43A 1Y6KR 2IGFL 4EJ1C 3JUZA 3QISA 1W72L 1HEZA 3D39D 1XF1A 4P2RD 3QFJB 4O2FA 4ACPA 3V5KA 5T5NG 4Z7UE 4AYFA 1PG7L 4RX4A 1P4IH 3QNYB 4O4YL 1P69B 4UAOC 2A6DB 5B8CA 2DDQL 4X6CE 5F89B 1F2QA 4F7EB 1BX2A 1LP9E 3BWAA 4RAUA 3MRFA 3S88L 1CGSL 4MMZC 3UJIH 2JKXA 5EU7E 4PJFA 1FL5A 4DN4H 4KUZL 1T3FA 2BVPB 1OW0C 4KMTL 1I9EA 3TF7C 3SE3C 1D3CA 5LGHH 4XT1C 2X44D 2R0LL 3LV3A 1KV3A 4XVUC 5FOBA 4PJBF 5K59E 1WZKA 5DEGB 1RIVH 3F58L 1QP1A 3QIUB 5CHNB 1LQSR 4N0UE 1B0RA 1A6ZA 4YR6A 4RISL 3IXAA 3TH2T 4FQLH 1EAJA 4ISVA 1LD9A 3MRJA 5IW6B 3MJ9A 1OWWA 3BJ91 2AEPL 3B3IA 3HG1E 4Y4FB 1HINH 4KROC 4QXWA 4BQBA 1T7ZA 3GIZH 1WBXA 1WF5A 2MNUA 2YXFA 1ERNA 4O2EB 4RA3A 4XC3L 4Z95H 3KDMB 1S7UB 2WZPD 2EDRA 1DEEA 5L7XH 3UPRA 4P46A 1I1FB 2JJVA 2I07B 4JM4L 5DR5H 5I16B 5ICXA 3ORJA 1IGJA 4OZGF 4K8RH 2AEQL 3KG5A 3A0OA 3RBSA 4HGWA 5TFSH 4LDOB 2ERJC 5D2LF 2J5LB 2EEDA 4YFLF 4WWKC 4IDJH 2KPNA 3N1MC 4X4YA 3O2VH 4KK5C 2VIRB 4HIXL 2R9HC 1NUDA 4HIIB 2VLMD 3TNMA 3QHTC 5K9JL 1VFMA 5JZ7D 3R1GL 3L95A 3BDBA 1EHLH 4AL8H 5FCSH 4I18B 2VDLL 1U3YA 5J4MA 3ARDC 5ABDE 2HH0L 5DQJA 3PL6D 3MLXL 1H3TA 4NZJA 4P2QE 2G2RB 3T0EE 5HDLA 3V8OA 1ZGLM 1LP9F 3MV7A 1I1CA 2IFFH 2PETA 4RFNB 1SM3L 4LVEA 3FCTB 4NZUL 4M9OA 3O45A 2P7TA 4Z7UB 3P0YL 5EA0H 5DD5L 3VRIA 4DKDC 2BNQE 2RB8A 3BVNA 1DFBL 1OAUH 2GK2A 4R7DA 3DX9A 3SKMB 4XAKD 5D7LE 2C4FU 4JQVC 1QA9B 1WQVT 4O58H 4X6CB 4RGNC 5LCVH 4KUCF 4E0RA 2AK4A 4U6XB 3KPLA 4IJ3B 5EO0B 1EFXB 2HVKB 2W9EH 1RURH 1B2WL 3IDGA 5FYLL 3VFNB 5D6DA 1FFQA 4WTWA 5JQ6L 5T1LB 3SE4A 4JRYA 5JW3H 3ZKMC 5EOCJ 4OD3H 5F7WC 1K3ZA 4ENEC 2X09A 3PIQA 4OGAD 4DTGH 2R2CA 3BPNC 3RKDD 2PO6B 2CRIA 1DQMH 1MHEA 4N0UB 2WBWB 3UEZA 1NFDA 2PXYD 5J3HC 1S7RB 2NNAB 2OK0L 2X89A 5HYJA 5KW9L 1SY6L 1FN4A 2HAZA 4EOWL 2DQDL 3I9GH 2GFBB 3HG1B 1D9KB 5C0AB 3MCKB 4O5LL 4FRWA 1WFOA 5KVMC 4HEPG 3GBNH 1IZJA 1XIWD 3T3PE 2NW3B 5DUPL 4BZ2L 1WFUA 3PDDA 3LS5H 4NP4H 5J6GB 1I7ZB 1IJ9A 3D69B 4WHTB 1JWMA 2LABA 1VERA 2NX5E 2ICWI 1FBIL 2N4IA 5IFHH 4LCCB 4EN3B 5F7DB 4NUGH 5D70L 5DMIH 2VXSL 3OQ3B 5A16B 3BKMH 4ZUTB 1HYSD 4Z7QF 1D6VL 3VXUB 1B0GB 2EC9U 2X4SA 1A6WL 3PJSA 4HWUA 5T3ZL 4K3DL 2A77H 3QJHB 2IADA 3GI8L 1AHWA 3MOBL 3V6FB 1JNLH 2WP3O 4WV1A 4C83A 4OGXH 1WIOA 3D0VA 2BOBA 1BFVH 3I2CH 1UM5L 5J57B