The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
37
|
sequence length |
226
|
structure length |
217
|
Chain Sequence |
EVQLVQSGAEVKKPGESLKISCKGSGYRFTSYWIVWVRQMPGKGLEWMGIIYPGDFDTKYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARLGGRYYHDSSGYYYLDYWGQGTLVTVSSTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Immune system/viral protein
|
source organism |
Homo sapiens
|
publication title |
Vaccine Induction of Antibodies against a Structurally Heterogeneous Site of Immune Pressure within HIV-1 Envelope Protein Variable Regions 1 and 2.
pubmed doi rcsb |
molecule keywords |
CH58 Fab heavy chain
|
total genus |
37
|
structure length |
217
|
sequence length |
226
|
ec nomenclature | |
pdb deposition date | 2012-10-24 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |