4HPOH

Crystal structure of rv144-elicited antibody ch58 in complex with v2 peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
226
structure length
217
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYRFTSYWIVWVRQMPGKGLEWMGIIYPGDFDTKYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARLGGRYYHDSSGYYYLDYWGQGTLVTVSSTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords CH58 Fab heavy chain
publication title Vaccine Induction of Antibodies against a Structurally Heterogeneous Site of Immune Pressure within HIV-1 Envelope Protein Variable Regions 1 and 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 217
sequence length 226
ec nomenclature
pdb deposition date 2012-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hpoH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hpoH01
1HIMH 2I26N 1S9XB 3VXOB 3HAEB 1G9NH 4WFGD 3GSWA 5D70H 1MCIA 2A6JB 2FSEA 2J8UF 5CEZE 2A77L 4Z95H 3ULVC 4HS3A 4NO5B 5IWLC 2CUHA 2X9XA 2CMRL 2WINA 3KJ4B 3GHEH 4G7VL 3I75A 4CDHA 4ZFGH 4RMRA 4N8CH 2GFBA 1TCRA 3MXWH 4HKBB 1T89A 2PW1A 3WV0A 3ARQA 2EC9U 5CLWA 5IMLA 2DQEL 4FFVC 1ZANH 1GGIL 3RTQB 5CS7A 4IOFD 5ANME 1KFAH 3SDYH 3VXTA 2HMID 43CAA 4DZBA 3TN0B 3EOTL 3I6GA 3R8QA 1T03H 1ORSA 2Y07L 1BVZA 3BFOA 3OF6D 4HJ0D 3TJHC 5LJYH 4OCRL 5C09B 2OSLA 3SO3B 4BFGA 4X6BA 4TSBH 4X99A 1UXWB 1DQLH 1KCRH 3BYTA 3HE7D 4LVNB 5JHDE 1ZHBA 4PJ9A 5C6TL 4ODWB 3GB7B 3ZE0E 2IANB 3CFIC 4KJWD 2APTA 3BP7A 1A14H 4MA1C 4EUPB 4U0QB 1BFTA 4XAWH 3RX7A 5CIPB 1J1PH 3CDCA 2FGWL 5DS8B 4MDJB 5A2JH 5IESH 1G84A 5B38G 3VWJA 4NNXB 1QKZH 3A6BL 3VXNB 1R24A 3KPOB 3W9DA 4KJPC 1OQOA 1H0DA 4LKCB 5TE6H 4FTVD 5E2TL 4WI8A 5EOCJ 3OGOE 2AEPH 1FSKC 3OKDB 4CDGC 3QEUB 4FABH 5EA0L 3IJYA 3RWJB 4OF0A 4G6JH 3RL2A 2PN5A 5KS9A 1KEMH 2XKNB 4FFYL 4YWGH 1MRDL 2LVCA 5DDHB 1K2DA 1BECA 3UTQA 3FFDB 4DVRL 2F5AH 3V52H 1IAMA 2XA3A 2PXYA 1GGCL 2X4SB 5DSCA 1HILA 15C8L 1N7ML 4L3EB 4X0KA 1RZJC 1NL0H 2XWBB 3QH3B 1QSEE 1A6UL 2NR6D 2W59A 4O2FB 5HYQA 2MKWA 2P42B 5I1AA 1UWGL 4ZTPH 1XIWA 2QSCH 3QUML 2YUXA 1SYVA 2M26A 3GBML 3MA9H 4OM1L 3TO4A 1WWAX 3K2UH 1UJ3C 2VC2L 3NFPA 4JAMB 1MLCB 5DLML 2R0LH 3WIFB 4Y1AB 2IAMA 2KZWA 3OKOA 1EZVY 3OB0K 4F9LA 3DX6B 1IGYB 1PFCA 4UTAH 4GO6B 3DUSB 3IJSA 5HHNB 3ESVF 4HXAL 4TNWK 1JGEA 4UT7L 1YQVL 4PRAA 3U7YH 1CVRA 4OIIL 4HWBL 4EI5A 5C0DB 4KXZH 4A6YB 2O61A 3QXWA 1QBLL 4F7EB 4F33B 4ETQB 3KLAA 4H20L 1BOGB 1J0HA 4MNQB 4I77L 4UV4L 3WJJA 2R23B 3FMGH 4OZFB 4M5ZL 5JW3L 1RAMA 4YBLC 5F9OH 2NY3B 1W8OA 4X98A 4E5XB 2J5LB 3WHE1 1A1OB 4M3JA 4JVWA 4PJHA 2MKLC 1QG3A 3MNZB 1AR1D 1JTOA 3SDAB 1EHNA 4YE4L 2VUYA 5I6XB 3KPSA 2FJHA 1PX4A 3B2VH 4K94L 1HXYA 3GRWA 1TLKA 3RP1A 4I0CC 5KOVC 5TQ0L 4WGWB 4JQVC 4B7IA 1JHTA 1I7ZB 4YX2H 1T83C 2ZPKH 4DFHA 5K9KA 4PRBB 3SKMA 4XXDB 4BKLB 1AD0A 1ZT4B 2HA1A 1NFDA 5BS0B 1U36A 5H35B 4H5SA 5F3BA 3GIZL 3AS3A 3CMOL 3DOSA 4LSTL 4Z6AT 2FRGP 4R9HA 2NY5H 2AJVH 1P6AB 3BHBA 3CFEA 1OSZB 2CRMA 5ICZA 5D1XB 2X4RA 5JDJA 4K3HA 5HYEA 2XQYG 5FA4B 1EV2E 2L0DA 1BGXL 1IRAY 2FL5B 3BN9C 3MLZL 4X6DF 3WE6B 2FO4B 2W9LA 1CFQA 4I3SH 4V1DE 1YNLL 3FOMA 4XPBH 4R97C 2R8SL 3IKCB 3PXJA 3A67H 3VFTB 1TITA 4AQ1B 1YZZA 1QD0A 3AM8C 3EOBB 4V1DD 2D03H 4D8PA 2P8MB 5GJSH 3CUPA 2E27L 1X4YA 1EBPA 3QO0A 3SDDD 4WWKB 5D2NB 5EO1A 5FGCE 3KLSA 2LABA 3MRIA 1RZIB 1TJHH 2R4RH 2E6QA 4PBWD 1G7JA 1OTUC 3HC3H 5C2BL 3SPVB 1MQKH 1YY9C 4QRRB 1JYXA 5FM5O 1U3YA 1YPZE 3P4OA 4MQ7A 5T1LB 3RL1A 2VL5B 2RHEA 3OKNA 4NQCD 1UFUA 4PB0L 3RUGA 1DN2A 4KQ3L 1MUJB 1IGFH 2F74B 4PYHA 1FO0H 2JB6A 1MSPA 2LTQB 3WD5L 4AMKH 5IMMA 3QUYD 5FECA 3JWOC 4JFEB 1XZ0B 4UQ3A 4N0CD 4GG8B 3CSPA 4I18C 2YK1L 3FO9B 1OOAA 4UIKL 4Y4FA 1OAQH 2KDGA 5E9DB 3GSWB 4NRYA 5FYKU 3LRGA 1I1CA 4ONHA 3CC5A 2FSEB 2O5ZL 4OCWH 4ODHL 3VFGL 3QPXL 4HS3B 4UT9L 3SDCA 1FL6A 4WW2F 3MREB 2WINB 2WW8A 4CN4A 3GEWB 3OKMA 1BIIA 4YHKH 5F1NA 5EZJA 5DJ8A 4WEBH 4XNZB 3SKUD 4E41D 4HDIB 5IMLB 4PJAE 1NUFA 3BT2H 4NJ9L 3OHXB 3QAZB 4RISL 5E2WL 2ITCB 2BX5A 3T4AB 4DZBB 1F4YL 3I6GB 1W72B 2WWMC 1ORSB 5EU7C 2EYRA 2ZSWA 3U0PB 1OAXH 3RWHB 4P2OC 1FVEA 5HHOA 2OSLB 4M6OH 3VD3A 4X6BB 4AEEA 1MCKA 1JGUH 3DETC 1DSFH 2P24B 3ARTA 3MUJA 2B4CH 3L6FB 2NZ9C 4YJZL 2JB5H 2DI9A 3HMXL 3BP7B 1UYWL 3VGFA 4FA8A 2IFFH 4ZTOH 1A7QH 1KLFA 2IF7A 5EU3A 1E4XL 4RBPH 4Q9RH 2EH7L 3BEVA 2EDTA 4LCWE 3X13A 3O2VL 4NZRH 4HKZB 4KKAD 5LAXB 5TE4L 3ULVF 5CP7A 2HFFA 2H2PC 1U8MA 5IT2H 4U1IB 4LCWD 1A9EA 1R24B 2IWGA 3W9DB 4PP1C 4APQD 3ARFC 4P99A 1FYTA 3BN3B 1T22A 1B90A 2GKIA 3V5KA 4LSRH 3GMPA 5E8OB 2NYYC 1WBXB 1PGRB 3T04D 3IJYB 1G7MA 4XPFL 1EMTH 4TQEL 5KS9B 4FQXB 1K2DB 3UTQB 4H8WH 4K8RL 1GSMA 2E7HA 1I1AA 3D39E 3ZHKA 5DSCB 1HILB 4LAQH 1OSPH 3KPMA 4X0KB 3RX8A 4AZ8A 3EOYG 3PHOA 3NIGE 4IMKA 4OZGB 1IC7L 2IQ9H 3EYOB 1EZVX 3KDMB 1FFOB 2EC9T 2AQ1A 1DBAL 4JFXA 3U2SB 3F65A 3KXFB 5I1AB 3VDBA 1XIWB 5IEKB 6CGTA 5I76A 1SYVB 5D1QC 1W0WA 3BEWA 5SV3A 5K9JH 3TO4B 4U1HA 4HBCL 2X9YA 1DBKL 4HS8L 2IAMB 4JGMA 5DHVA 4OZFG 4WHYG 3OKOB 5CBEA 4ZXBB 5AYQA 1EFXD 1RUKH 5T1DH 3WIHL 2J8OA 3DYOA 3QEQA 2BFVH 3IJSB 2JTDA 5K93A 5DURB 4HUUA 4JFHE 4JB9H 4PRAB 3TIEA 3G6JF 3RKPA 3RQ3A 1K6QL 4EI5B 4L5FL 2LU7A 1UM6H 1IEHA 4JFHD 2O61B 4MAUH 3EFFA 4MHHG 3KLAB 3OTTA 4QRTA 4EKXA 4L8SA 4ELMA 3GMRA 3RKDD 2B0SH 4XNYH 3QZWA 4PGJA 1EHLH 3NIFE 3ARBB 1NMCC 1CFVL 2BHUA 4OZHF 4PY7A 3N85H 3LEYL 1G9MC 3NCJL 2OJZH 2DQHL 4X98B 3GSNH 5SX5K 2W9DH 3LN9A 4PJHB 1JGDA 3RTQD 1LGVA 2BMKB 2YEZA 4YUEH 4XMLL 3ULUH 1KT2A 4CJ0A 2Q3AA 2YKLL 3K81A 2VISA 3ZDYF 4Z7OF 3KPSB 2FJHB 4XHQA 5C09E 1HXYB 2ADIA 3CX5K 3TN0D 5DK3A 1TDQA 5GS3A 4WTZA 4Q0XH 4FQJL 4JO1H 1JHTB 1KELH 3KPTA 3V4PL 5KANG 3I9GH 1F4WL 5C09D 1KPRA 1VB9A 2HYMA 2ARJA 5SWQA 1QHOA 5AWNL 3I2CL 4HH9A 3SKMB 1NC4D 5J9PB 3HG1A 4NBYB 1NFKA 2IANE 2UWEF 1BFSA 2V2TB 5F3BB 1UEMA 1MRCH 4GFTB 2IAND 3BHBB 3MFGB 3MRDA 4XVTL 5ICZB 4M9PA 3QUMA 1UT9A 4X6CF 2YD7A 3OJ2C 5I66B 2VDNH 3GMQA 3NFSL 2F9BT 3F12A 5A3IC 2J1KA 1E4WH 1CFQB 5DJZB 5A16A 2VDRH 3NOIA 4FQIH 2ZG1A 4QHLA 1EVTC 4LLYA 3TVMD 1Z0NA 3VGDA 3PGCA 5LG1A 4D8PB 3EDDA 5I8OH 1SM3H 4WU7A 3QO0B 4X4XB 5FM5M 5EO1B 3MRIB 2CGRL 4HWBA 1G7JB 3MRRA 4JR9H 5D1ZD 2VXVH 4L3EE 1PX3A 4JREB 1KN4H 1CFNB 1ULVA 2H8PA 5JXEC 4XCFH 2ENSA 3VXSA 1HKFA 4Y4KC 3HLAA 3OJDB 4NCDA 4MQ7B 4L3ED 3HE6A 4JM2A 3O3EA 3OKNB 3V0WL 1YEFL 1I8KB 4XCYB 4LK4A 5GS2D 2L4OA 5HHVH 2JB6B 1DQML 1SMOA 4X80L 2R2HA 3SJVD 4B50A 4BZYA 1I1RA 3MXVH 4OM0H 4UQ3B 3RPIB 2ZUTA 4Y1AE 4HPOL 4MS8D 2R0WL 1NCCH 4Y4FB 5HHMB 2WUCL 1LO3H 4PJGB 2X9WA 2Q3ZA 1ND0A 4ONHB 3CC5B 4U05A 2OXHA 4Y1AD 4WI6A 4EBQL 4QLRA 5BVPL 1YNKL 3SDCB 1FL6B 4L4JA 1LDPH 4N0UA 3S9DB 4HQQH 1WBYA 1B4RA 5EZLA 1U8KA 4OD1L 3BD5A 1BF8A 3OKMB 2R1YA 1IFHH 2MPAH 5DJ8B 3HTLX 5FYJH 5FO8A 1X5IA 4K9EH 4RGND 5J1TC 2Q86B 4LLAA 4MNQE 1HOCB 1C5DA 4QXTB 2I27N 3BW9A 4KTYA 3D87B 1IGMH 3GMMB 4MD0A 4X8JA 2EYRB 4MNQD 4WI2A 2ZSWB 5EUKA 2APFA 4JFYA 4N5EC 5HHOB 1FVEB 2R29L 3WMSA 3ZTJG 1U93A 1FCGA 4MGXA 3CZFA 2EDDA 2NY3D 3FQNB 3K46A 1IAOB 3K7UA 3ILQD 3C8KB 4L29A 1GGYA 3MBEA 5HGDA 2Q76B 1RZ8A 1Q72H 3JV0A 1ORQA 3FFCB 3D85A 1T7YA 2KH2B 4U3CA 3SDAD 4GG6A 1WFUA 2FBJL 3BD4A 3ARSA 3BO8A 2OTUA 3KYOA 3K8LA 1NQBA 2MTPA 1J9CT 1RI8A 4HC1L 1O7SA 4X5XA 4NUGH 3BEVB 3X13B 5ESQB 4YDJA 4F9PA 5BS0E 4LASH 4Z18A 2PYEB 2IMMA 5CP7B 5ISZA 2C4XA 1ZLVH 3DHJA 4DKFH 1U8MB 4S0SD 4GQ9L 4WI4A 1A9EB 1NCWH 3RVTC 4TSCL 1NCUA 4U6TA 5BS0D 1XR9B 3BUYB 2GY7B 1A64A 2GSIA 3QG7H 4PTTB 5DZLA 3GO1H 3MJGX 4M1DL 5CJOH 1J87A 3GIVA 3GMPB 2HKFL 2G5RA 4WNQB 3S88H 5ILTL 3IU3A 1ETZA 1MFAL 1G7MB 2J6EL 2FECI 1K8DA 3GHBL 3W5MA 4F2MA 4NN6C 1GPOL 2WQRA 3OKKA 3V95A 4Q9CA 2HRPH 3HB3C 4LLUA 2MQ0A 3FO2A 1A6AB 4LQFH 1KOAA 1JN6A 3VXUB 3X3GL 3KPMB 5GZOD 5D2NE 4YPJA 5KZCB 3QEGH 2DQJL 2XKUA 1T7WA 4FN0A 1CGYA 4NWTL 1FPTH 5C0RH 1FNGA 5DHYA 1H8NA 4U1LB 4WWKD 3ZL4L 4WFED 1Q0YH 4QRRE 4GLRI 5I76B 3IVKA 4YDIL 1L6ZA 5A2LH 1W0WB 3BEWB 4UTBL 1AKJB 1RZ7L 3SE3A 1PG7W 4QRRD 3QHZL 2JF1A 5HHPA 4MNGA 4TOYL 3RWEA 4X8XA 5T1LD 4YEFA 3FN0L 1RMFL 3QEHA 3VD7A 4Y16A 4XP1L 4JFEE 3K4DA 1PLGL 2QR0B 1TQCB 2KPNA 4QTIL 1FFRA 1FFQA 3QEQB 2EDJA 5I71C 5CZVH 5E9DE 4JFED 2ZCKL 3BRGC 4M43L 1A02N 3TIEB 2UVEA 3HMXA 1JZ6A 4R4NC 5E9DD 4RFNC 3ZKQD 3LD8C 4NNYA 3UC0H 2EYTA 4QRTB 1OAUH 3UO1L 3KHQA 4IBLT 4L8SB 2JELH 4W4OA 2GI7A 3BUTA 2HP4A 4PY7B 5HHXH 4LOUC 5FGRA 4JHBA 1AO7D 5H37G 1HCFX 4EDWL 2Z8SA 5J57B 1JGDB 4OZ4B 4YXKH 2YEZB 3MOBL 4BQ9A 3RZCA 5MENB 1AJ7L 2VISB 1FC1A 3TFKD 2ADIB 2OZ4L 2E9JA 4MVBC 1XGQA 5ID1A 1X3DA 5DUMH 4KKNA 5BV7L 1I9EA 1T3FA 1KPRB 1N64H 2VQ1A 2ARJB 5SWQB 5JIKA 4GAYA 4HH9B 4XVUD 3HG1B 4L4VA 2EO9A 1FQ9C 3C5ZA 1ZOXA 1IAII 1FJ1A 3N1MC 4JFFA 5ACZA 3JV6A 3ZT7A 3M17B 1CL7H 3MTRA 1JMXA 1DCLA 2LVEA 3MRDB 1BZ7A 3QDJD 3E8UL 3QUMB 2QV2A 1URLA 3BKYL 3D25A 1T7VA 2HJFA 3GMQB 4OKVA 3F12B 3IDGA 3BPLC 5A16B 1YC8A 2BNRA 3SDXB 1VDGA 3MLXL 4ZS6C 1CI5A 5KS9E 3WIHA 3PGCB 4UDUB 4F80A 1ONQA 4YHNB 1AXSB 3NN8B 4F7PA 4R8WH 1N5YL 4N0RA 3MBXH 5CCKL 5KSBB 5IHUL 3FN9A 4QGYA 3Q3GA 3QJHB 4FQXD 4XTRC 1NBVL 3O8XA 5IHBA 3MRRB 3OPZL 4ZSOA 1NC2B 3P73A 2D7MA 5AG8A 1YEKL 2B39A 4OZGE 3WNOA 3Q5OA 2H8PB 3VXSB 4HHAA 3KXFE 3O3EB 3S4SA 5IJVA 4OFVA 3E6FB 3VXQA 2G9HA 5FDYA 3CX2A 2CRYA 4MAYC 1MCWW 3P30L 1R3JA 1TFHA 3KXFD 4Y89A 3W2DH 3KR3H 2W07A 2R2HB 1XIWD 2DWDA 1RURL 4JG1L 4G8GA 1DR9A 4XNMA 5BVJB 1C5CH 1B4JL 3O6KL 5FA3A 2PW2A 4KZDL 3MLSH 1IAKB 1LO4L 2GSGA 3CLFH 4LSVL 4J2XA 3TO4D 3OZ9L 4DJMA 2Z92A 1ND0B 2BVYA 2IAMD 4I1NB 3HS0A 5C70A 3DPBA 2FX8H 3IFLH 4ZXBD 1V5JA 3UROR 5JORB 2YSSA 3HC4H 1T1YA 4N0UB 3X11A 4PUBL 1WWWX 1WBYB 1D5MA 4YDKL 5EZLB 1M4KA 4BFEA 4CU6A 1XF3A 2R1YB 3OR6A 5I9QC 1SJEA 3QQ4A 1C7SA 4O2CB 5FO8B 5DURD 1YYLL 1U3HA 5D7JC 3SGKA 5GJTL 2IPTL 1I9IL 1M1SA 2AXFB 2CRZA 5F6IB 1C12A 3A0OA 1C5DB 3MLUL 3QDMA 5FYKD 5CHNA 1JV5B 1XGTA 3UTTA 3BW9B 3EJZD 4WWID 2UZYB 3ME0A 4MD0B 2EDNA 4X8JB 1NH6A 4XPAL 2N56A 1FLRH 3Q6GL 4UU9B 4K7PX 4DOHB 1WT5A 4FQCH 5EUKB 1KSRA 4PJHE 1U93B 2N7AA 1AGBB 3ARBD 4ENED 1CD1A 3CZFB 5DD5H 3LZFL 2R4SH 1UC6A 1XFPA 5EDXA 3KPSE 3QA3A 4L29B 3MBEB 5HGDB 1SYSA 3GBNL 5IVOA 3D48R 3B83A 1RZ8B 5LCVH 3ZKXC 2E9IA 2K7PA 1ORQB 1A7BA 3HC0A 5C07D 4GG6B 5ICYB 3MODH 1TVHA 5E00A 2Q7YA 1N6QL 1N8ZA 3KPSD 1MPAL 4HV8A 4LDEB 2OTUB 3KYOB 4DZ8A 4U0RB 1V8HA 4DCQA 4X5XB 5TH2A 4O5LH 5HYJA 5CD5D 4YDJB 3EYFA 2BRQA 3VMOA 1OCWH 2D7PA 1QSFA 3S36H 5ISZB 5FGBA 3T8XA 4PP2A 5CJ5A 3WFEL 2VZ3A 1MCEA 5CGYD 5I1KL 2GSIB 5GRZA 2Y5TA 1R5WA 4KKBC 5AD0A 3GIVB 4H0GA 5M94B 3IU3B 1ETZB 1A3LH 1KG0A 1KC5H 4C55A 3W11C 4DFIA 5E99H 3H9ZA 4F2MB 2NY4D 1YEDA 3OKKB 5GRUL 1MAML 5E56A 1ZGLM 4Q6YA 1NCBL 1R3HA 3AXLA 1DFBH 3BQUA 3JVGC 4AEHH 4O51A 4XNXH 3QFDA 3GSOA 5KVEL 5DHVH 4UNUA 1QFWM 4PBVC 4ODXA 1JGVL 2EDQA 4FS0A 3QB7C 2EE3A 3VFWB 4PREA 1IZKA 1FNGB 5DHYB 4MQXD 5D2LF 2B2XL 4U49A 2AXGA 4L3CB 5IFHH 3IVKB 1TJIL 2YS4A 5C6TH 5I1EH 5F9AC 4CVZA 5F1OB 5KSUA 5CSZA 1DE4B 3TA3B 5F9WC 2CK0H 5JMOC 5HHPB 5JA9A 1XAUA 4MNGB 4KAQL 3VFVB 3RWEB 1R0AH 1FNFA 2FGWH 1DVFC 1CU4L 2YMXL 4OI9A 2GAZA 4TTDC 4MA7L 4W68A 4Y16B 3C8HA 1P4IL 1C08A 2W91A 3MV7D 5FYLH 3EYUL 3WXVL 2EIZA 4U2ZA 4WW2A 5HHME 3O4LA 4PRID 4XWOC 4C57C 4PLOB 4YFLF 2R1XA 2YZ8A 3KPQB 5EA0H 3VWKC 4Y4FD 3LQAH 2UZIL 2OR9L 4HC1A 2K7QA 2EYTB 2JJUA 1I3RB 4D9QE 3IFOA 4TVSa 4CVUA 1N4XL 3TM6A 2QQQA 1INEL 5CINH 2MWCA 1EO8L 4I0PC 1ZLUK 4D9QD 2AJXL 4KDTC 1LP9F 1KENL 3UPRB 3TJEH 3OR7A 5SWSA 5CKAA 1Q9KA 1V7NH 1T0MB 4Z76B 2ICES 4RIRB 3ZO0A 3P0VL 1SEBA 2EO1A 3TP4A 2J6EA 5IBLD 5J6GA 1JRHL 4JM4H 5HHOE 1F3DJ 1DLFL 1UWGH 3H3KA 3OAYH 3BE1L 3GZKA 1C1EH 1XGQB 5ID1B 2ERJC 5D7LB 5HI4D 1YEJL 1N59B 3JTTA 4YPGA 3EO0A 1J05B 2GTWA 3QWQB 5HHOD 4M7KH 1D5IL 4Z7UF 2VQ1B 4X4MA 4OM1H 4FZEH 4QKXB 4GAYB 3QCVH 5HDQH 5EZIL 1YYMH 3BESR 2DMBA 4KROB 1YECH 4BM7A 1FJ1B 3MQIA 5ACZB 4JFFB 3JV6B 1EFQA 4U1NA 3JXAA 5EBGA 5I0ZA 1IGJA 3FFCD 2MFNA 4GSDH 3ZYZA 2Y36L 4OLXL 3BWAB 5KAQG 4FOMA 1XGRA 4GKNB 1UWEH 2PTVA 4LPTA 3BP4A 4KI5E 3D25B 2HJFB 5ADPL 3N1QC 2O5XL 5C2UB 1GHFL 3IDGB 1VGEL 2OP4H 2PYED 1DBJH 1MIEL 1RUAL 4TN9A 2V7HA 5D72L 1OP3H 1MLBB 5AZEL 5CEYA 3RWIA 5HGBB 3TT3H 4UV4H 2W0FA 4OTXH 1K4DA 4F7PB 3U0WL 3VXRA 3MRKA 3HMWH 4UV7H 3Q3GB 3VXUE 3VGHA 2CO7B 3O8XB 4P3CH 2HLFD 1MF2L 2ESVA 4ZSOB 1X6LA 1YUHA 3P73B 1CLYH 4G80A 1CD9B 3DGGA 4JE4B 3GDBA 3VXUD 4JANA 3MRHA 4HHAB 1HCVA 3VG0H 1WQVT 1WZ1H 3MLVL 5KZCD 1S7XA 2GJZA 1QR1A 1FZJA 1KJ2H 3MJ7A 1G1CA 1RUPL 3K0WA 4HK3J 5I1JL 4HUMB 5HDBE 4BZ1H 3AB0C 3B5TA 1Y18A 4LSTH 4KRPC 1T1ZB 2B20A 1AKJD 3UTSA 2GSGB 1KXTB 4Z7WB 2Z92B 1IC5H 4CMHC 5DD1L 4M1GL 3BPCA 3QEQE 1JYVA 1GZPB 1FL3A 2XQBH 3STLA 5D9SB 2YSSB 5E5MB 1T1YB 4ORGB 1TNMA 4Y19D 1JF6A 3NCCB 3QEQD 1S7UA 1XF3B 4HF5H 5EWIL 3QCUH 1S3KL 2C4FU 1U3HB 5ADOH 5LGHH 4IJ3C 2YN5A 4PGEA 4ELME 1C12B 1QNZH 3QDMB 5CHNB 1S7VB 2YD5A 3ARDD 3ESUF 3VFPA 1HI6B 5DD3L 4DKEH 5C0ND 5E8NB 2YOCA 3QI9C 5C2BH 3AGVA 5E08H 2V9RA 1I9JL 4F7CA 1CD1B 3BAEH 2CIKB 4J6RH 5F72S 5MENE 1QFWH 4IRZL 4LSSL 1MEXL 4RMQA 3ZE0F 2BRRL 3ALPA 3O9WC 4PB0H 5IFAL 2AJZA 3G5YA 4ODVL 5MEND 3HC0B 2UWEA 1KPUA 2Q7YB 3V5HA 3C6LA 5GZNC 3L3DB 2QHLA 4DZ8B 1MH5B 4I0KA 1H5BC 4JHZA 4DCQB 3HG1E 3U0TA 1NSNL 4NQVA 5HYJB 3GSNB 5GISH 1WV7T 3VW3H 1QSFB 1J12A 3QUXA 3NGBC 3HNVL 3HG1D 4PP2B 2V7NA 3PABA 4RZCB 3MRJB 2X6MA 3DHMA 3F7VA 3NA9H 4UT9H 2Y5TB 2CIIA 4J3WA 1R5WB 4Y5XA 4YHPB 2QTEA 1KTDA 1VFBA 1IQWH 2FATL 1MFCH 1KG0B 1B6DA 4WJ5A 3SDXE 5BZDB 3KLHD 3P0YL 5GRYA 1YEDB 3EFDL 4JZNB 3ES6B 4F57H 5JOPD 3RVXC 3QIWA 1T2XA 4V2BA 1R3HB 3QHFL 1PD6A 2BHYA 3BQUB 4HAGA 5FCUL 4O51B 3SGDH 4I2XA 3GSOB 3K8MA 4OLVL 3LIZH 5KSBE 3IFNL 2DJSA 2H26B 3HZKB 4ODXB 1PZ5B 2E7LA 3S97C 1UM4L 3MRPA 4AQOA 1TTGA 4NZUH 2OMBA 2AXGB 1EAPA 2HH0L 5JQHC 3SO3C 1ED3B 3VXSE 1IGCL 1WEJL 4CVZB 1MCOL 1NC2D 3IXTA 3PP4L 2ATKA 5CSZB 5KSUB 3HMXH 1UYWH 4NCC2 4XCCL 3VFUA 1P7KA 2FJFA 1E4XH 1RQ5A 3VXSD 4JZJB 1FC2D 5JHLL 5KSVA 1XF1A 4ZAKC 3MX0A 4AM0B 4RFEB 5E1HB 2X4QA 1C08B 2H1PH 1ZXQA 3GJFH 3IAPA 4P5KB 4AG4H 2EIZB 3PWVA 2AEQL 3C60A 1T2QH 1T4KA 4BA8A 3O4LB 5EFIA 5CJBA 2R1XB 1ZV5A 1Q9WA 2B4CC 2KQMA 1U91B 4J7RA 4XWGL 3HI1A 1FIGL 2M2DA 3FZUD 3NZHH 4N0UE 4ZDHA 2WBJA 4LCIL 1HN1A 2E9BA 1FN4A 3IFOB 4YZFE 3SN6N 4O2EA 4YHOH 2X1PA 3OAUL 3L1OL 4J3TA 3TBWA 2EH8H 3O2DL 3U83A 3I3EA 4JO4L 3OR7B 1Q9OB 4XPGH 4R26H 2ICWA 2X1WL 1CXIA 1SEBB 5HVWA 4DOHE 4HIHA 1OPGH 3O4OC 3ROLA 5I8CA 5J6GB 1VADA 2VXSL 1JPTL 1VENA 3MOAL 2M1KA 1KCUH 4HIXH 4OF6A 4YPGB 3EO0B 1GC1L 1MCRA 1A9BA 4FMKA 2ZOKA 5CUSH 3JWNC 4HBCH 4YK4B 5CWSA 5EIQA 4H8WC 4GG6E 4BSVB 1Z3GL 2XG5A 1QQDB 4P5MA 3MBED 1NGXA 4XC3L 4MJIA 1IGJB 4EN3A 5D71L 2Q8AH 2QHRL 4U1JA 4YHYB 4ZD3L 4OCXL 1XGRB 1YMHA 5FKAA 1BD2D 3IDNA 5ISZE 2DQTH 3BP4B 1SBSL 2EE2A 1DP0A 3EZ8A 1E28A 4OQTL 5F7YC 1IEAB 1U2CA 2VLKA 4BH8A 2XKSA 3FT4A 1K6QH 1EEYA 5LGJA 5ISZD 2V7HB 1MCJA 4NQXA 5FHBH 3RU8H 1W2KT 2OR8A 3LDBB 1OM3H 5CEYB 2HFEB 4IRSA 3CFCL 1A6TA 2W0FB 4GRLC 3KJ6L 1IBGH 1OW0A 1CFVH 1K4DB 2YD3A 3LEYH 3NCJH 3LKNA 3H3PL 4G7YL 3UPAA 3VXRB 1NJ9A 4PJ5D 2R39A 1IQDA 1X5FA 4F15C 3MRKB 3Q2CA 1CXHA 3EYSL 3OJMB 2MHAB 4OIBA 3MLYL 2NY3C 1YPZF 5DYOA 2ESVB 2J5LC 1YUHB 4G80B 2O93L 2A9NH 4KRMB 2EDXA 4NIKB 3ZZ1A 3MRHB 3TPKA 1NCTA 4J3SA 3V4PH 4QGTA 5T1MA 1S7XB 2VQTA 2EIBA 2GJZB 3JWDL 1FZJB 1PSKH 3PUCA 3I2CH 3MJ7B 3X17A 5T33L 2YD6A 1F00I 2L7JA 4MXWH 4XPHH 4LVHB 3P4NA 2AJSH 3FT2A 1Y18B 4MNGE 3RWDB 1B6UA 3QCTH 5DRNA 3VJ6A 3SE8H 2LE9A 3TA3D 1OB1B 4NN7B 3ULUC 1WSST 1BEYL 3SQBA 2DAVA 3RVWC 2RFXB 4UNVA 1HSAA 3NFSH 4QXGH 5BV7B 2VE6A 4Y16D 3STLB 4DN3H 3DUHA 5D1XC 1QLEL 4OT1L 3NACH 4PJAF 1MJ7L 1S7UB 1FZMA 1MRFL 4TYUA 4OAWA 1ZTXL 4I3RL 1CLZL 4GT7A 4M6MH 3C08L 4L8DA 4F8QA 5IMKA 2WIIA 1MHEA 4WDIA 1XCQA 1CK0L 4PGEB 1JWSB 4HCRH 5IVXA 1U8JB 4PR5A 1CD0A 1CICB 2OCFD 4GBXD 4X7FC 2CDGA 4TSAH 4NWUL 1IILE 3B9KD 4TRPH 4WWKC 3GKWH 2EZ0D 4KK5D 3RVUD 4F7CB 4HFWA 1CLOH 4PB9H 2AABL 4UBDC 5MHSE 2BVQA 4F58H 3V0WH 4LCYA 5HYSG 1EEQA 2AJZB 5C0EA 1A7PL 2VDPH 3V5HB 2QQNL 2XN9A 5MHSD 3C6LB 4J1UB 1RZKC 3CSGA 4OSUL 5GS0L 1D6EA 1KJMB 5D7LD 5ALBL 3EHBD 4NQVB 4QWWD 4K8RD 4L4VE 3BDYL 2V17L 4LEXL 4JFFE 3W0WD 3HUJA 2RGSA 1DJSA 3L5XL 4WV1A 2FYYB 4LSQH 3UBXA 1WIPA 3D0LA 4JPKL 5CZKA 2V7NB 3PABB 3QNYA 5IVNA 5TJWK 4KROD 5AZ2L 1QVOB 4H25A 1YNKH 3F7VB 4JFFD 1E0OB 4QRQA 4OI8A 2CIIB 2E7CA 5CZXC 4Y5XB 4OD1H 2VYRE 4DK6A 1KTDB 4N0YL 5DA4A 2DQDL 1G7QA 1MCHA 4Z8FH 1MHHA 3FRPA 3WDIA 1S78C 2BNRE 3DROA 3IDYB 1JWUA 1A5FH 1FLTX 5F97E 4AENB 1T89C 3SCMB 5JR1H 4IDJL 2YRPA 1RFDL 3NIGF 3CU1A 3PNWB 3OKLB 1J0JA 4QT5A 4OF3A 4HIIA 3LN4A 4JRXA 2R29H 1JF5A 2NQCA 1E6OH 2V5TA 4KH2A 3MRPB 4DAGL 3N1PC 4ZSOE 3EIFA 5KVFH 2C4FT 3FO0L 1CN4A 2PCPA 1EAPB 4WI5A 4M00A 4LEOB 4C4KO 4CAGA 1XGPA 4CL7A 2FNBA 1IC4L 4J8RA 4LLVA 2AJUL 2FBJH 3VFUB 2BVPA 2YPLD 2FJFB 3UYRL 4PJ9C 2R0KH 3CSYB 4YHIB 4NKQB 5JW5A 5KSVB 4KK8C 4YBQD 3CLEH 1P4LB 2H32H 1ZS8B 1MJ8H 2EXWC 3LMJH 4P4RA 4GQ9H 4PV8A 4R90L 3C60B 1T4KB 4QCIA 1JI1A 3IU4H 3VWJC 4Z7WE 2BDNL 4UQ2B 3QULA 4X9HA 3SE4A 5IGXL 2VDOL 3CVHL 4Y2OA 5ILTH 3NPSB 4JY4A 1DL7H 3HI1B 1OHQA 2UUDK 2ZSVB 2WBJB 2OK0L 1FN4B 4OV5B 3NIFF 4WVRA 1FV1A 3B5GA 4P5TA 3QUZA 1GIGL 5L2JA 3ZSSA 4FXKA 1NEUA 4O2EB 1DQDL 3CH1A 1NGWB 1I8IB 2W9EH 3TBWB 4JFQA 2CXKA 4WHTB 4LNVA 4TVPH 3O3UN 1ZE3C 3QDME 4E42A 2PXYC 5HI5C 3ULVH 1BQHB 4DQOH 1U3HD 4LMQE 2VNCA 3ROLB 3QDMD 4POYA 1VADB 4JO3H 1X5KA 1FVCB 2ZCHH 3PG2A 4YDIH 5I74C 2JLLA 2ZNXA 3OB0H 1WZKA 5SV4A 2P4AB 3MRMA 2NXZB 4LKXB 1S5HB 3OGCA 3P40A 2EDWA 5HBBA 2ZOKB 2XACC 5CWSB 3RY5A 3WLWC 5IB4A 2HFGH 4TOYH 5HJ3A 1ZA3A 3C6SA 5DT1L 1FE8H 3GNML 3FN0H 4P5MB 1UZ8A 1NGXB 1T5XB 4O02L 1G6VK 4XP1H 4OD2A 4MJIB 4OKDA 4EN3B 3PF2A 2DJ4A 4HLZH 3FQUB 3LS5H 4J4PA 4U1JB 1ZGLA 5HYJE 2IMNA 5F3HB 3VCLB 3SE9L 3LRHA 4F9LC 1QSFE 3IDNB 1Q94A 2ZCKH 3KS0H 2HKHH 2I60H 1E28B 2YR3A 5EU6A 1YMMB 3WUWA 4BH8B 1AXTH 1RZFH 1FGVL 4GAJH 2FHFA 1MHCA 3FT4B 3GSVA 1EEYB 1QSFD 4ESKA 5LGJB 4M02A 3KYAA 4NQXB 2JIXB 1KULA 1YEIH 3B43A 2HFTA 4IRSB 1FBIH 3TZVD 1A6TB 2D7TL 5ENWA 2X44D 4EI5C 3BYYA 2JJTA 1X9QA 5ICXA 1EVUA 4QXUL 4OLUH 2NY2D 1AFVH 1NJ9B 1QFUH 3WJJC 2FX9L 3D0VB 2DKMA 4WU5A 2BNQA 5C0FB 1D3CA 3I85A 4JY5H 5DYOB 3GMNA 3F58H 4S1SL 5E2UH 1K8IA 4Q6IA 2HT4C 2OZ4H 3BQUD 5DQDH 1ZHLA 2XZZA 1FH5H 1A47A 2EKSA 4F37K 3C5SA 5T1MB 4AK1A 4N5UA 2DS4A 4OGAD 5EIIB 2VB5A 4PPTA 3O2DA 5DR5H 5I1HH 3TBSA 5EBLA 3SGEI 1PBYA 2FEDD 1RZJH 3J7HA 5DD0L 3FT2B 1J1XL 4NP4H 4WFFD 5EU4A 5DRNB 5E8EA 3NFNB 1JE6A 5GSVA 3VJ6B 3DX8A 1X5GA 1A6VL 5K9QG 2R2CA 2EIEA 2YD1A 4XBGA 2D7QA 2GK2A 5E6ID 1UQSA 3GK8L 2R15A 2OS7A 3CK0L 3S5LA 1FHGA 2NY0D 1HSAB 2B1AH 4LPUA 2VE6B 2JKXA 4POZD 3O4LE 3TT1H 4L1DA 1MI5A 2X5PA 3FHQA 4XXCA 1X4ZA 2R2BB 3RA7L 5K9QI 4FG6D 3NBNA 1FZMB 4I5BA 4RFOH 5T3XH 1MCWM 3O4LD 4OUOA 4PRPA 4L8DB 2CLRB 3T4YA 4GRWB 1MHEB 4WDIB 4QHMA 4PJ8A 3M8OH 5IHZA 4ZNEE 1HINH 1D9KA 1P6FA 4PR5B 1OARH 4X7TA 3LH2H 3ROOA 5CCKH 3AVEA 3DX9A 5IHUH 3RY4A 5GGVH 5DRXA 5F96H 4CRPA 4OQTA 3W81A 3HA0A 5C0IA 4MQXC 4DVBA 4CKVX 3UEZA 3V6OE 1UACL 1V7MH 2P48B 5CD3A 5JPMA 2VLLB 1UADC 3S3SA 3PHSA 3DVFA 2H2SD 4LCYB 4ZO8A 2DLFH 5C0EB 1U8PA 4H88L 4CMMA 2VERN 4X4ME 2DWEA 1I1YB 1RIHH 1YN6B 3AREC 3HUJB 1KGCD 5FYJD 4LSVH 2VDQH 2PF6A 4P49A 3TEUA 5IROC 4LVOB 3QNYB 2XYCA 5AYUL 1BM3H 3EOAA 1G6RL 4H25B 3WLBA 3MJ8B 1CF8L 3OX8A 4U1MA 2ZG2A 1E27A 3X12A 1QP1A 2EICA 3CAFA 3UTPE 4PTUA 5IB2A 3VRJA 3FRUB 4HWUA 1BX2A 2IG2H 4WCYH 3SDCC 3C09C 2JE8A 2XTJB 4NKOA 1YYLH 4D3CL 4G3YH 3Q1SH 2EDOA 3U4AA 3DTXA 5EO0A 3QYCA 1PG7H 4L8CB 3AU1A 3F7PC 4XBEL 4OCMC 2XV6B 4NO2B 3L5JA 3VFOA 1EBAA 4DW2H 4XPAH 3Q6GH 4QT5B 3VXRE 2R56L 5IW6A 5IBLC 3RY6A 2IEPA 3WXWL 3LN4B 4JRXB 4DGYH 5LQBH 2O5YL 5HI4C 2FBOJ 1ZEAH 3NABL 2AI0L 2ESVE 1DEDA 2VXQL 3WKMH 2FLBT 3R0MA 4KZEL 5BO1L 4OBRA 2E6JA 1JK8A 2PCPB 3GBNH 4MZ2A 5KG9B 1CGSL 5MP6H 4WY7H 1XGPB 2V6HA 4J8RB 1MWAH 4MXQD 3LKOA 4FNLL 1RHHA 4HPYL 2ZUVA 4J3OC 5TE7L 1BHGA 2HVJA 4K07A 2YRLA 4ODBD 5JW5B 1GAFL 5FV1L 2OX5A 2AKRA 5T3ZL 1BQHG 5IW1A 5E5RB 2C7UA 4GQPH 1LNUA 4QCIB 5I1KH 4JY6A 5BOPA 3TV3L 1ADQH 4HIEA 4KI5C 1S9VA 2F5BL 4CBPA 3QQ9D 2FHCA 1Q38A 5FUOL 4ONFH 2CKBL 1S7SA 4JY4B 5GGTA 2GQHA 3UAJD 1KJ2B 4G8FA 3BMWA 2ICWI 4P5TB 5I1LB 3QUZB 4LNRA 3HE7A 3U46B 3PP3K 3CH1B 3WJLA 3BKMH 2H45A 3FTGB 3QHTC 4P4KB 4JFQB 5I15H 3D9AL 4KQ4L 1T20A 2Q8BH 4PLJC 1CFBA 4E42B 5BMFH 4KVNH 1JGVH 1I1AC 4LIQH 4NM8L 1QFHA 3ARVA 5J6HA 2VDMH 4RA0C 4LGSB 2B2XH 4Y5VA 2WUBH 1CICD 2V5SA 4FRWA 4IMKC 2DD8H 4HAFA 2AJYL 4QF1A 3F7RA 3B6SB 4Y5YB 3SBWA 3MRMB 1PKQA 4I9WE 2YD4A 1VFOA 3OGCB 5B21A 4FTVA 2BSRA 5I1DB 5DFVD 1CQKA 4QNPE 3C6SB 1JPST 5CP3A 4I9WD 3MZTA 4AL8L 2X05A 4MA7H 5JXAL 4OD2B 5DVNA 3N50A 43C9A 4OZIA 1OAYH 4F37F 1ZGLB 3EYUH 2HWZH 1UB6A 3GGWA 2VR9A 1CCZA 4YXLH 1Q94B 4XB7A 4XNUL 2AQ2A 1Z6JT 5EU6B 1NANI 5F89B 1Z9LA 5JQ6H 5DJAA 1F4AA 3GSVB 2X4NA 2OTPA 5KS9F 1HWGB 3BPOB 5SX5H 1NGQL 3A6CH 1QBAA 4FQ2H 2V9TA 5J0BA 5ENWB 1N4XH 5DGRA 1KB5L 4UAOC 5I30H 1KENH 3JWOL 4L8SC 2WLZA 3O6ML 3JUYA 3ZKND 3FO1B 1T0NB 5ACLA 4IRJA 4OZGF 3CVHA 1ZKAA 4M62L 5HGGS 3SCMD 2X2YA 1JRHH 1HHGA 3WN5A 1DLFH 4Q6IB 1X5JA 1OAZH 1UKSA 1ZHLB 3C8DA 1YEJH 1IZJA 3EZJB 3T2PA 1OTSD 3WS3A 3LQAC 3H3BC 5TQ2L 2EKSB 3VMPA 1KNOA 2OL3H 1CE1L 1ZLWH 3BDBA 2AK1H 1RULH 3WIIL 5IBUB 1WFOA 1X5HA 4WO4C 1MELA 2XICA 3MJ9A 4YO0A 5E8EB 2A9MH 4OLXH 3I50L 2XTLA 3RWGA 4XBGB 2B7DT 2A6DB 1UQSB 1CS6A 4OLEA 3KS0J 1KJ3L 1WTGT 3S5LB 8FABA 2J8UB 4J3XA 4P2RD 1QBMH 2I24N 3O41B 4N8VA 2W0KA 3L3HA 5HD8D 4CU8A 1MI5B 4YFEA 4YC2B 3CSBA 1ES0B 2DF3A 4I5BB 3C60D 4X9FA 5T5FL 4CW1A 3E6HB 1AGFA 4ALAL 5IKCA 4QHMB 4WI3A 4PJ8B 4YIQA 5IHZB 2AXHA 1M7IA 2PO6C 4RA3A 2XY1A 5C0JA 1D9KB 4X7TB 2UVFA 3ROOB 2WBJD 3B9DA 3DX9B 4LLMA 2FB4H 4PJHF 5DRXB 3G5ZA 4UB0L 3GM0A 3UJTH 4DVBB 2DM2A 1MNUL 5CD3B 3VMNA 1JYWA 5JPMB 2WANA 4NKMB 2EEDA 1H15B 3FB8B 5IB3B 3VXMA 2OTWA 3MCLL 4OFYD 3RBGA 3FAWA 4PG2C 1WZLA 3WHE0 4FQLH 1RUQL 1S7QB 3SKJL 4ZG1A 2VOTA 3CNKA 3PWJA 1A21A 1U8PB 1G9MH 3UBXI 1CT8A 3HE6C 3FRPG 4JM2C 3KPPA 4CMMB 2DWEB 4P46B 3DXAA 5TF0A 2FX7H 1MHPH 1JPGA 3DVNA 4ZFZA 2NXZD 5J1AB 1T7ZA 4X7SL 3TBYA 2VIRA 2HG5A 4MJIE 4HJJL 1NGPL 4V1DA 5FUZL 4DN4H 5L0QB 3EOAB 2NY1C 3LHPL 3VGAB 4K94C 3VI4E 5HYFA 4XHJC 4Y0GA 1NAKH 3BVNA 3FZUC 3X12B 1B0WA 4EN3D 4R7DB 4PTUB 1NDMA 1YMME 3VRJB 4YFDB 3H9HB 3QNXA 4M8QA 2BSTB 1BX2B 4MA8L 5DQ9A 2AGJL 4G6ML 4U6XA 4NKOB 4B41A 5B38A 1YMMD 3DTXB 4HUNB 1TZGL 4NQCA 3WFBL 3AU1B 5DJXA 1NDGB 2VN7A 1X5ZA 4M1CD 5B4MD 3VFOB 2JIXD 5DD3H 1FNSL 4MCYA 1JGLL 5BJTB 5F6IC 4IRSD 4RDQG 5IW6B 1AGEA 1F8TL 4K23H 2HN7A 4XB8A 2F19L 2HAZA 3DRQA 1J88A 1R3LA 5KVGL 2Y6SD 1MEXH 1QTYT 1JK8B 1U0QA 4M93B 5GGRB 2VLME 4ODVH 4U6HA 1CR9H 2YC1B 1RHHB 4MA3A 1BQLH 3S37L 2VZSA 4XT1C 2VLMD 2HVJB 3KYNA 4UOJA 1NSNH 1B2WL 4ODSH 1QO3B 4JN2B 3ZKMD 4E41A 4U0RC 3ZSTA 2AKRB 4RGOH 1YJDH 5IK3A 3P77A 5IW1B 1U58A 1UM5H 4FZ8L 4JY6B 1D5XA 4HIEB 3B3IB 1LMKA 1S9VB 2F8XC 4MCZA 4XVJH 3GMLA 2EDFA 4UUJB 3TNMA 4LLQA 1S7TA 1N3NA 4QHKI 4PJEB 4EVNA 3HRZA 4NO3A 1QRKA 4TPRL 3THMH 3HE7B 4MJ6A 5LWYL 3JTSA 3S96A 5L88H 4WTXA 1GGBH 4GRWE 3AAZA 5DUPL 1G6RA 2VXUL 4KRLB 1T20B 5IVXE 4HIJA 1JTPA 3PDGA 1KPVA 2K3TA 2A0LD 4MWFA 1HK6A 2EIDA 1S7RB 4O4YL 3SOBH 3INUL 5J6HB 2JCCA 1BJ1J 3D18A 4Z7VA 5J56B 3H42L 4FXGA 4W6WB 4QF1B 2AV7A 1JVKA 4GS7C 2G60H 3BZFB 5J1SC 4KJQD 3PP4H 5DJYA 1PKQB 4APQA 5FM8A 5C7XL 1BLNA 2XY2A 3QXVA 1IARB 4FTVB 2BSRB 4G9DA 2YD8A 4AEIH 1IGIL 1DDHA 4PJDA 4HUKB 3BGAA 2AQ3A 4M6NH 1OP5K 4WUKL 4X9GA 2QBWA 3SE3C 3ZLQC 43C9B 1W72L 4OZIB 4KI5F 3AS2A 3VG9B 3QIUC 1J11A 3E3QE 1UB6B 3GGWB 1CDCA 2AEQH 3HUJE 2FD6L 4HK0A 2G2RA 2ICWJ 5SWZA 5DJAB 4HG4J 2X4NB 4GRMB 5DJDA 4LSUL 1KTLA 3ARRA 1FFNA 3T1WA 3MRFA 4LCCA 4PGDA 2XTJE 3MA7A 3L1OH 1U92B 5IBUG 2OJEA 3Q6FB 5LXGH 3FONA 4W4OC 1CGVA 1AHWA 2XTJD 2EZ0C 4FFWD 4IRJB 1RJCA 3CVHB 2CKBA 4JQVA 4XGZB 1V3KA 5LBSL 1EO5A 4JRXE 1HHGB 2IH1B 3CXDL 3WN5B 1EFXA 3S5LG 2VXSH 2R9HD 3DMMD 1MFDL 1JPTH 3R1GH 3RZCC 5KTEH 3QPQD 2IPKA 5HPMA 4KVCH 4M9OA 3WS3B 1YEGL 1I4FA 1SJXA 4LGPB 2NY6D 5H94A 5HDBF 1JFQL 1LE5B 4O9HL 4LLWA 5EBWA 3EHBC 3SEPA 1JF1A 4KK9D 3L7FA 4YO0B 5D71H 1C5BL 3GI8L 4KROC 3C5ZC 3VH8G 2FECL 4V2CB 1LO2L 35C8H 1VACB 3BH8A 5EOCH 3T08A 1T2JA 2OI9B 1J5OL 2Z31D 5CJQH 1UZ6E 5F8QC 1IKFL 8FABB 1F6AB 1F13A 4N8VB 1EK3A 3L3HB 3RTQA 2YPKA 3QT2A 4GKSA 4R2GB 1AY1L 4ELMF 4OUUB 4CW1B 4LPWA 2V5MA 1TVBB 1AGFB 4GW5A 5IKCB 3KJ6H 3HFMH 4XI5C 4CNIA 5C0JB 4O58L 3FKUS 4LLMB 4YAQA 1NC4A 4P5TD 3G5ZB 3QUZD 2DN7A 2CLVB 4Q9QL 3MGAA 2Z91A 1A1MA 4OD3H 1KBGL 4P4KD 3O8XC 4LDLB 12E8H 1JZ3A 1MCQA 2IANA 1JP5A 2OTWB 3QDHA 3VXMB 3DIFA 1XMWA 5DJ0B 4Z0BL 4EJ1C 5CSBA 5GGUA 5FYKL 1KB5A 3PWJB 5CIPA 4OJFL 1AC6A 4LRNL 1EEZA 4MDJA 4JRYD 4KK6D 1CT8B 3IDJA 4I18A 5C71A 2CK2A 3DXAB 1F3RB 4HXBL 5SX4I 1WIOA 1JPGB 3DVNB 4ONGL 3UYOD 4YHML 1VSCA 4NQTA 1RIUL 2VIRB 2HG5B 3TVMA 1HZHH 1U8QA 1BAFH 1WJ3A 4HKJA 3L3GA 5GGRY 3TYFA 3QEUA 3RWJA 5I8KL 1QUNA 4DKAA 1UJTA 5IQ7H 3BVNB 2XKNA 1YEHL 5F7WC 4OT1H 1A7NH 1NDMB 1R3IL 5EU6E 3SDXF 1MJ7H 1MAKA 4KKLC 3QNXB 4X83A 5D1ZA 4LAJH 5DQ9B 1HKLL 4U6XB 1IE5A 4ZS7L 3WSQL 5EU6D 3OBAA 1JMZA 4L3EA 4R0LC 1I9RH 4NRXB 4C54A 3O6FD 2QSTA 4NQCB 5DJXB 1HHJA 4B0MM 3IDXL 5KSBF 3QH3A 4OFIA 5KAQF 1ZHKA 2P5EB 3O2WH 4O2FA 4MCYB 3HNSL 2PTTA 1NAMB 4K3EH 4JPIA 5CEZH 1AGEB 4LPYA 5HGHB 2HN7B 3SJVA 4NQSA 4BQ6A 3QDAA 1WGOA 2W60B 1R3LB 1BVKA 1BJMA 2E3VA 2VWEE 4YNYB 3B2UC 1MLCA 3U7AA 4P57B 3WIFA 4Y1AA 1DUYA 1A7PH 3FB7A 1OTTD 1OWRM 3DX6A 2WLYA 4NT6B 4HUVB 2BSED 3GKZA 3KYNB 1G0XA 3QXDA 4NHUB 3EJYC 1WF5A 4LEXH 4E41B 5DVKA 3FQTB 3RI5K 2NW3B 4KY1H 1UCBL 5I1GH 3PL6C 1O5DT 4KMTL 3KNBA 5FAAA 5B3JE 1S9KC 3HPLB 4MQSB 1FSKB 3P77B 3S8WA 1U58B 5C0DA 1D5XB 5CILL 1ZLSH 4JFOB 5FGBC 4F33A 2QQKH 4MCZB 3ULSB 1BOGA 3GMLB 4MNQA 4K2UH 4YZFF 3G6DL 4LLQB 4PLKD 4OZFA 1S7TB 4TUKH 1MI5E 1N3NB 3V4VH 4CADA 4EVNB 3HRZB 4NO3B 4ETYA 2Y25A 2WP3O 2EE6A 5F9JA 4MJ6B 3JTSB 3MNZA 3S96B 3U6RA 1S5IH 3JV4A 1G6RB 4KKCC 3RVVC 4XC1H 4KUZL 3T0EA 4DAGH 1D9KD 1R5IB 2ED8A 4Z7VB 3X3FL 2VSDA 3FT3A 4YDLC 1RIVH 3FO0H 1HYSC 4FXGB 3KGRA 4BKLA 1BZ9A 1HQ4B 1KCVH 1UJ3B 2ZKHL 1ZT4A 2ADJB 4GG6F 4S1DD 5DJYB 5BS0A 1RVFH 3R4DA 3I02A 4G9DB 4JPVH 3UYRH 1DDHB 3N9GL 4PJDB 4XP9L 1JHLH 1LDSA 3MUY1 2BNUA 1JNJA 2XWJB 1MFEL 1OSZA 2BOCA 3IT8D 5J13B 2BY3A 1RV6X 5I17A 1FGNH 1AE6L 1G7IB 1HH9A 1MCCA 4HZAA 2RCSL 4XPTL 5DVOA 3WE6A 4M7LH 4RAVB 3ARXA 2HT3C 4POZC 4P46D 3HI6L 5F7UA 4HK0B 5K9OB 2G2RB 4QHKJ 4YGAB 3H7BA 4H1LB 4JHAH 5SWZB 1ZLUH 4WW2C 2P8PA 3LS4L 3MLWL 1DBML 3V4UH 3UJJL 5DJDB 4XP5L 1KTLB 2OK0H 2E6PA 2P8MA 4G6KL 4PGCB 3B5HA 5FK9B 2BOBA 4YBLB 4HGMA 1DQDH 4HULB 2COQA 4PGDB 3MA7B 4QO1A 3TH2T 5I1IL 2OJEB 4J12A 1G0DA 4M7ZC 3QNZA 3FONB 4KHTL 1AHWB 3O11B 1JZ5A 4P23A 1SY6H 5A2KH 2P46B 2DQFA 4K71C 5T1LA 2H2SC 2DTMH 4R4FH 2F74A 2CDEA 2MQ3A 2IPKB 2QSQA 4N8VG 3ZDXE 1I4FB 1I3GL 2AEWA 3S35X 3DV4A 5H94B 1WWCA 4JFEA 4WFGE 3QIBC 2AP2A 4GG8A 4LLWB 1R6VA 5EBWB 3FO9A 1JF1B 1X7QA 3GNMH 2NY7L 1U6AL 3L7FB 5E9DA 2PR4H 2VQUA 5IVZA 2EXYC 3R06A 5KSAD 4ERSL 5EH1A 3SE9H 3U1SL 3BH8B 3MREA 1TETL 3KAAA 5FCSH 2C3GA 4NGHL 1AO7A 2VLRA 2DRUA 1BF2A 3O81A 4HDIA 2IADA 2R2EA 4DK3A 3OHXA 5I18H 2ITCA 1LHZA 1FAIH 2YPKB 4GKSB 3X14B 3IDMB 3T4AA 4X9IA 5FB8A 5KJRH 5TFSL 4GW5B 1W72A 4PJEE 1KIPA 1H3WM 4DGVL 4C83A 5GS0D 4CNIB 3U0PA 1P1ZA 2MQCA 4XCEB 3RDTD 3RWHA 2DB8A 4ODTH 2IGFL 4YAQB 4UZGA 4NNPH 1NC4B 1S8DA 2P24A 3NH7H 2Z91B 1A1MB 4HK3N 3BP5B 3L6FA 1AQKL 5E1AB 4RWYL 5DC9B 2ICCA 5CGMA 2LV4A 1NMAL 4P9HL 2WIMA 3DIFB 3QDJA 5GGSB 1II4E 3ARUA 3B8SA 1FIEA 5GGUB 1P4BL 1KB5B 3AFLA 1B0RB 1EEZB 4HMEA 5A2IH 5DUBB 3QUKB 3V6ZA 3IDJB 4HKZA 4JKWA 1PKQE 5LAXA 4I18B 4X4YA 5D8JH 4FTVE 5EOQH 3RIFK 2GYSA 3LSOB 2MOVA 4ZFOL 1RUMH 2VH5L 3OG6B 4U3XA 1HNGA 3IXAA 4U1IA 1HIML 3ZHDA 3RGVC 1A6VH 5F7EH 2ATPB 3TVMB 3M45A 1U8QB 4HKJB 4NQDB 3WFDL 3KYKH 4OZIE 1G9NL 3L3GB 3CK0H 5D70L 5E8OA 3TYFB 1WBXA 4Z95L 4FQXA 5J12C 3UAJC 3TIDA 3GHEL 5D1ZB 3RI5F 3HCVB 4N8CL 3MXWL 1IM3B 3A6OA 4NOFA 2OR7A 3O45A 4QHNA 2CQVA 5H2BA 2IH3B 1KFAL 3SDYL 1HHJB 3NAAH 2N1KA 4OZGA 1EHAA 3EDFA 4P2OB 3LB6C 3EYOA 1ZHKB 3KDMA 1FFOA 1T03L 4JKPH 3O0RH 3U2SA 2PTTB 3KXFA 5ITFB 4JPIB 3SJVB 3K1KC 5IEKA 4NQSB 1UACH 2HTKC 1EGJH 1ZWIB 2NXYC 3GM8A 1FNHA 2GY5A 4TSBL 1AGCB 2P44B 3RWFA 5L7XH 2VO5A 1DQLL 1BVKB 1KCRL 4NBXB 5HVGB 5C9KA 2FJGB 5IBTH 4ORZC 4ZODA 3H2WA 2DKSA 4IRJD 1EJOH 3MUHL 2WBKA 1OY3B 1DUYB 4AIZA 4H88H 3FB7B 4QRUB 4ZXBA 1DLHA 1U8OA 5EZOH 2QQLH 3UJIH 2BXZA 1T66D 4XAWL 1PY9A 3QXDB 2XA8L 3C6LC 5IESL 5E03A 3MNWB 4ZQKB 3ARFB 3DO3A 3G6AB 4PGBB 4RGNB 1QKZL 1T5WA 3KNBB 4M4PA 4Z7WF 4E0RA 4HGWB 5AYUH 2EDBA 5HYIA 3QUXC 5TE6L 5E95B 2UV3A 3PQYB 5DEFB 2AEPL 4Z7QE 1QACA 1ZLVK 4FABL 3ORJA 4BUHA 2BJML 3ARBA 2OL3B 3RAJH 4G6JL 4CADB 4D3CH 4Y5XC 1AIFA 1KEML 4R4BB 4KHXH 5GGVY 2BHZA 5C92A 2VDKH 1CDHA 5F9JB 1SMAA 1NKOA 2F5AL 4XBEH 3V52L 2BMKA 3U6RB 3IDYC 3P4LA 4FMFA 5C07A 3JV4B 3DX7B 4R2GD 3WUZA 4NM4H 3QIWC 1HDMA 1Y0LB 4JCMA 3T0EB 2O5YH 2F8VA 2AI0H 2YN3A 4KUCF 4KZEH 5BO1H 3FT3B 5DC4B 5FHAH 2E7LC 4ZTPL 5CLTA 4H1LG 2X41A 5J9PA 1BZ9B 2QSCL 2VAAA 4W70A 3VXME 3ZKSD 4MSWB 2V2TA 2I25N 4HPYH 5MI0C 3I02B 3MA9L 3EDKA 3LPFA 4J23A 3K2UL 4PRDB 3VXMD 2BNUB 2R0LL 2BOCB 3H0TB 3DXAE 5I17B 3L3KB 4ZUTA 1HH9B 4L9LC 5I66A 4UTAL 5DRZA 1BBJA 2W65A 3BPNC 3DXAD 5DJZA 3LKSB 1H8SA 1JHKL 3H7BB 5FUOH 2CKBH 2BY0A 2P8PB 3ULVD 3IFPA 1NMCB 1GOFA 2BOBB 4XVSH 2OBGA 4X4XA 1QOKA 3LKQB 5J8OA 3DVGB 1A4JA 4P3DA 3T3ME 1LVEA 4FFVD 3FMGL 3WYRA 1RJLA 3TH4T 4PD4J 3QNZB 1K3IA 4NQCE 3PHQB 1CFNA 4TUOA 4P23B 3MACL 5F88A 5GRWA 3HAEH 2ZNWA 2P5EE 1IT9H 2DQFB 3OJDA 3QQ3A 2M8XA 1VGKB 1I8KA 4XCYA 3VU2A 3TJHD 3B2VL 2ZWLT 5BW7C 2P5ED 2CDEB 3MV7A 4WUUA 2DLTA 5BQ7A 4OCYH 3DV4B 2VXTH 4PIRF 4PRIA 4YX2L 2ZPKL 3RPIA 4P9ML 3PV7A 3P2TA 1X7QB 1RU9H 1MIMH 2YWZA 4WI9A 3OXSA 5GRJL 3D69B 4HZLA 4PJGA 2HLAA 5IVZB 4Y7MA 2FZ3B 3ZDZE 1A2YA 5IW3A 3R06B 3BIKB 2FLRT 4E41E 2NY5L 2AJVL 2QADC 1MFBL 3GFUA 4ZYKA 5GGSY 5KW9H 4Y4HC 1AO7B 2VLRB 7FABL 2Z9TA 3RIFF 4KJPD 1T04B 2IADB 2R2EB 3CFBA 2EC8A 2Q86A 1NGQH 2VDLH 3U36A 4I3SL 4DGIH 3T65B 1HOCA 4XPBL 1J18A 3A67L 4QXTA 4PJBB 5FB8B 2DYPB 2IALB 2I07B 3MRCA 4MLSA 3GMMA 4M1CC 4EUPH 1B88A 1KIPB 3BZEA 1CXLA 4C83B 4PRNA 1P1ZB 4LDOB 3WEXB 2LQRA 4URTB 1OW0C 1NMBH 3WCYA 1S8DB 3FQNA 3LV3A 2R4RL 1OT2A 1TJHL 1IAOA 1ACZA 3EYQC 3C8KA 4Y4KB 2Q76A 3HC3L 3AS1A 1MQKL 2UY6A 3FFCA 1GXEA 4HWEL 1BBDH 4UILH 4MAYA 2JCCE 2JJSA 4GXVH 2P5WD 4Z7VE 5TQ2H 3QDJB 4E9LA 3EDJA 1IGFL 3ZE2E 1FO0L 3VFNA 3V6ZB 1Q0XL 5ESQA 2KUTA 1DUZA 4X4YB 4AMKL 5D7SH 2PYEA 5HHQA 4PJDE 3N0PB 3IXAB 3Q0HA 4Z77B 2WWKO 2HTLC 5T3XD 1XR9A 3BUYA 4PTTA 4JFZH 2RQ8A 4ZUUA 2JK5B 1G7PA 5GS2H 1C16B 4WNQA 3V6FA 2GK0A 4N9GA 5DD6A 2VAJA 4OCWL 1AGDB 4LU5H 1IM9D 3E1F1 1C7TA 3W5NA 3TIDB 4TNWF 2CD0A 4YHKL 3UXFA 5SWZE 5IQ9B 3V2AR 1A6AA 4HG4K 4WEBL 5A1AA 4LRIA 3VXUA 4DUXA 2VITA 3BT2L 3O45B 4QHNB 3U4EA 4EOWH 1I75A 5H2BB 1VEPA 4ZO6A 5SWZD 4Y2DC 1MCPH 4U6VH 3RBSA 5T3ZE 4JFDD 3ZYOA 4PJ7B 4OLWH 4U1LA 5I16B 1QLFB 1OAXL 1AQDB 5T3ZD 4M6OL 4UINH 1BQUA 5DMGD 3PV6A 1C8PA 3RWFB 4NC1C 1JGUL 1AKJA 1DSFL 5F8RC 1BP3B 4LHUB 4A6YH 4NSKB 4HMDA 1K85A 5CJ8A 4AIZB 1F4XH 1DLHB 1U8OB 3QFJD 2JB5L 5I73B 2QR0A 5BRZB 3WO4B 4Y19A 4OZFH 2IFFL 4ZTOL 1P2CA 3NPZB 4Q9RL 5J3HC 3N1FC 4BELD 4YQXH 3CVIL 4U7MA 4NZRL 5D93C 4HJJH 1T5WB 4E0RB 1GL4B 2HT2C 5HI3C 5C0AD 4XMPL 4WV1C 3ARDA 3LKRB 5C0BA 2YXFA 2P8LB 3HZVB 2YZ1A 4LSRL 4NN6B 3BN9D 1TJGH 2AGJH 4ZFOA 1CZ8H 1EMTL 3SQOL 1AIFB 2PUQT 3WFCH 4H8WL 4MHHI 1TZGH 4OZ4A 3ETBF 5MENA 5C07B 2AAVA 4LAQL 3F7QA 1UENA 1OSPL 3U4BH 1HDMB 1NUNB 1X6NA 2YXMA 4PJXB 2IQ9L 2AS5M 3T2NH 1RPQA 1A0QH 4I4WB 1OTUD 1YY9D 4P2QA 5F7MC 2VAAB 4QNPF 1HWHB 4OIAA 3BKCL 4N9OB 2D0GA 3M17A 3DYMA 5K9JL 5KANI 4TNVK 3RFZC 2DLEA 3T09A 5INCA 1B2WH 4FP8H 5I71B 3U9PH 3LPGA 4M5YL 4ZUTB 5DO2C 1RUKL 5T1DL 3TWCL 2NY4B 3P11H 5DRZB 2B1HH 1BBJB 2BFVL 4JPWH 2W65B 3H9YA 2BVEA 3VWKA 4NQDE 5JZ7C 3SDXA 4RFNB 2MCPH 4JB9L 3LD8B 2WM0A 1EX0A 3VXPB 2ZUUA 3G5XB 5M95B 1RZKH 2VUOA 2ZJSL 1L0QA 3IFPB 1CQYA 4NQDD 4UDUA 4ZOBA 4GKZA 4YHNA 1AXSA 3GSXA 3NN8A 4MAUL 1K4CA 3SE4C 3T2OA 1FZKA 2C9AA 2Y4SA 5KSBA 3CDFA 1BFVH 2B0SL 1A4JB 4XNYL 3QJHA 4P3DB 4JN1H 4L8BA 4HT1L 1RJLB 4P5TC 3BRDA 3N85L 5EU7E 1M7XA 2OJZL 1NC2A 3GSNL 1DBBH 5DMKA 2W9DL 4TUOB 3O3BB 5F88B 2UY7A 1IAIM 4L1HA 3IB4A 1YJDC 4XP6L 5E7FA 2WWMD 2RR3A 4YUEL 3ULUL 3QQ3B 3SJVE 2ADFH 3E6FA 4P2OD 2FHBA 1EERB 1PEZA 1V3LA 3MV7B 4WUUB 3S7GA 3QG6A 4KMLB 5BQ7B 3DETD 4ZFFA 4JO1L 4YH6A 2XPGA 1KELL 5C7XH 4PRIB 2AK4A 4CN6A 3I9GL 3PWUA 5BVJA 2VN4A 3NZ8A 4KPHH 3LQZA 5AAWA 1GGUA 4QY8B 1YA5A 1NCAH 1LEIA 1KEGH 1IAKA 4JQIL 4WUKH 4NPYA 3TBTB 4DKDC 3GI9H 3OXSB 5CGTA 4HZLB 3MJ6A 2HLAB 4YHLH 2PNDA 1A2YB 1SQ2N 1I7UB 3LEXB 4N90D 5JORA 4D9LH 4JO2H 1F90H 4ZYKB 3BPLB 3CPLA 2D4DA 4G6FD 4P48A 4RGNE 2H2PD 4J4PC 1AI1L 3HKFA 2DBJA 2VDNL 4NJAH 4O2CA 4PP1D 4M4RA 3MOQA 3ARFD 4XP4H 1T0PB 3CFBB 2W0PA 1QZ1A 3HNTH 5IG7A 1E4WL 3PQYE 3U36B 2AXFA 4XMKH 1NCDH 5B22A 2J4WH 1L9NA 4FQIL 2NYYD 1JV5A 4K3JH 3MRCB 3PQYD 3BPOC 3BZEB 4RX4A 4UU9A 5GIRA 4GH7B 4HGKC 4PRNB 2XZAL 1FRGL 1SM3L 5I8OL 4UOW1 1CVSC 1AGBA 1INDH 2JJTC 3MNVB 4G5ZH 1OD7A 4DEPB 3LV3B 3RIAK 3ZTJH 1F3JB 2MCG1 3LRSA 4JR9L 4I3GA 3IF1A 2VXVL 3T1FB 4QXWA 5IOPA 2DQUL 1KN4L 5JHDB 3BZ4A 3T0EE 5F7HA 5ICYA 4XCFL 2HJKA 4MD4A 2XI9A 1L7TH 4MAYB 2C3WA 3QXUA 1BD2A 1D6VH 1E4KC 3TESA 1ZVSA 3T0ED 5TDOA 25C8H 3VFNB 5D1QD 5KN5A 1DUZB 4MMXC 1CGUA 4H0IA 2R69H 5HHQB 4M7JH 1X44A 5E8DH 3MXVL 1P9MA 4OM0L 5MEOA 3DJ9A 1C5BH 2UZXB 1J0ZA 4K7PH 3VI4F 4ZUUB 1NLBH 1G7PB 4OB5H 1J5OH 1RY7B 4PYGA 3V6FB 2GK0B 4PJ5A 2V2XB 5I9QB 4N9GB 5DD6B 2NX5A 3W39B 2C1PB 1LDPL 2H3NA 2Z4QA 2LFGA 4HQQL 4NN5B 5D7JB 2EEBA 3OJVC 4FFZH 5IV2B 3KWWA 3J8F7 1GC1C 4LHUG 3DV6A 8CGTA 1IFHL 2MPAL 4NRZA 2DBLH 5FYJL 1TTFA 4XXCC 1S9WB 2P47B 2VITB 3U4EB 4K9EL 3WHXA 4WFEE 1PZUB 3O6LH 4GLRH 4ISVA 1HSBA 5MEPA 1DZBA 3VFWA 2DQIH 1IGML 4PJ8C 3VRIB 4D0DA 1UVQB 4Q9QH 1F3DH 4L3CA 1A6WH 4N0FB 5FUCC 3ZKXB 3PV6B 1DE4A 2CDFA 3TA3A 5T5NG 4P23D 4OLYL 3QRGL 3B9VA 2FR4B 5GGQH 3VFVA 1Q72L 4LRNH 1H5BA 1NLDH 4BQBA 2XXCB 2X1XR 4Y19B 4HXBH 1P2CB 4OFPA 4NUGL 1JCKA 1TPXB 1RD6A 3AS0A 1F58L 4CU7A 1OVZA 4LASL 1ZHNA 4DKFL 3KPQA 4YR6A 4MD5A 2EDKA 1DQQA 5I8KH 1NCWL 1NBZB 3ARDB 5EC2B 4TNVF 5C0BB 3QG7L 4GBXA 3GRWH 1I3RA 1YEHH 1FO0A 2BC4A 4H26B 3GO1L 1AO7E 5CJOL 2VLRE 3S37X 4AEFA 3B9KA 3S88L 1HKLH 1F6FB 3JWDC 4ZFOB 5A3ID 2XNAA 4JJHA 1PKOA 2VLRD 4GRWF 3V7MA 5TF1H 5GS1C 3UPRA 5IVXF 2HRPL 4PJBE 4LQFL 1T0MA 4Z76A 1H3UA 4RIRA 2AVGA 3GBLA 1KCSH 2DYPD 3QEGL 5D7LA 3N06B 1N59A 3PWLA 1FPTL 5BOZG 5C0RL 1IAIH 1J05A 1AP2A 2IJ0C 3W0WA 2Y7QB 1Q0YL 4P2QB 1KYOJ 5F9WB 4LARH 5IP4A 5JXED 4Y4KD 5IMOB 1J0YA 3QDJE 1PQZB 4NKIH 2DM3A 5D7IA 2ADGA 3SGJC 3BWAA 4P2CG 5INCB 3BWUC 4GKNA 4MXVE 2PETA 5JNYA 3HUJF 5IB5A 4A2MA 3F62A 4KMTH 4AIOA 4S1QH 3FJTA 5GHWH 2Q6WA 3LEVL 3ARGA 3K1DA 3AC0A 5CZVL 3VWKB 4U4BA 1IL1A 1MLBA 4IOFC 5HGBA 2HMIC 1VKXA 2D4FA 3NCBB 3G6DH 2IBZY 4GKZB 3GSXB 5TGBA 3ZYJA 1K4CB 4JDTH 4I0PB 3UC0L 1OD9A 3VD5A 1FDLH 1FZKB 1OAUL 1H3VA 1YEEH 4HJ0C 3VI3E 3WS6C 3IKKA 2Y06H 1MJUH 1TENA 4U2YA 1KXQE 5F7LB 4L8BB 4NHCH 5BCAA 4CGTA 5HHXL 4M48H 4PJCA 3MGOA 3HE7C 4ZUSB 2KL6A 5DMKB 2YPLA 2YUWA 4YXKL 1WISA 1GYAA 4KUZH 4PJ7E 2ERJB 4TULL 4KJWC 3K80A 1J0KA 2IBBA 3X3FH 1VA9A 1GZQB 1L7IH 4N5ED 5MEQA 1F11A 1KN2L 3DUUA 2E8YA 1PVHA 1SEQH 3QG6B 4DWHA 5DUML 4ZFFB 2XPGB 4S1RL 1QYGL 4Y5VC 2AK4B 3PWUB 5DJ6A 4WFHE 1N64L 2PYFA 3NZ8B 3L9RB 3BXNB 3N9GH 3LQZB 4GUPA 5GRVL 3RIAF 3SBWC 1T1ZA 1XF2A 2LAGB 1PW3A 1LEIB 1MFEH 2YUVA 4NPYB 5DGQA 5BRZE 4WFHD 4Z7WA 4LHUD 1H3PH 1Y6NR 1DEEA 4RDQF 1WWBX 1UA6H 1CL7L 1UZ6F 5FEBA 1GZPA 2XRAH 5D9SA 5E5MA 4ORGA 5BRZD 3CPLB 5D5MA 3HRPA 1N6VA 3C2AH 3RVTD 3QISA 5FYKE 3LS4H 3MLWH 2CUMA 1DBMH 3GJEA 3HZYA 4OGYH 4FXLA 5IG7B 4GRLA 4PJAB 4G6KH 1MCLA 4AH2A 4HW6A 4OCNC 1S7VA 4GXUN 3MRNA 4IM8A 1HI6A 2QJDA 2NR6C 1WBZB 5E8NA 3VGBA 2IFGA 5GIRB 1EH9A 4KRNA 2ZUQC 4R8WL 2Y9RT 3HB3D 5E5UB 3MBXL 4G8IA 2CIKA 4IIQC 1YC7A 5C07E 1JNLH 4NFCA 3LRSB 4NKDA 3IF1B 3ZMRA 4JJ5B 5IOPB 4PJXE 3REVA 1J86A 3NCYS 1YY8A 3BZ4B 2HJKB 4MD4B 4ZUVA 3PDDA 4M7LT 5E2VH 3L3DA 2HJLB 3WN5C 1MH5A 2WNGA 3WO3B 1BD2B 4UT6H 1FG2A 3AB0B 1T66C 1ZVSB 4EIZC 4F7MA 4RMWA 5TDOB 1OF2A 4KRPB 5KN5B 3GSNA 1KB9J 3W2DL 3KR3L 4ZPTA 5MEOB 5C8JA 4RZCA 1ITBB 1U8NB 3MRJA 4TUJA 1C5CL 4LPVA 5D4QA 3TZVA 2A77H 3MLSL 3TLRA 2CMRH 3CLFL 1TETH 4G7VH 3U30C 5HYSA 4YHPA 2ORBL 3E2HC 2JJWA 4NGHH 3TYGL 4PJ5B 2NNAA 3UCRA 2FX8L 2DQEH 2NX5B 2OI9C 5BZDA 3EDEA 1GGIH 2H3NB 2Z4QB 3HC4L 4PGZA 4JZNA 3ES6A 2OYPA 3KWWB 32C2A 5C0GA 4IJ3B 3DV6B 4NRZB 4BYHA 4R4ND 3EOTH 1AD9A 3WNPA 1KIRB 2Y07H 1AR1C 2VZOA 4RMVA 3WHXB 3D39B 4OCRH 2DJUA 4NO0B 3QI9B 2H26A 3HZKA 3FL7A 1PZ5A 4ISVB 5L8KB 1HSBB 2D31A 5MEPB 2OLDA 3IGAB 2X4PA 4D0DB 4LOUD 4PD4K 4IHOA 1FLRL 4ELKA 4FQCL 1ED3A 5F44A 4K7FB 3O9WB 3WL9A 1NEZA 2CDFB 4KMQA 5DD5L 2R4SL 1MY5A 3OWEA 5E6IA 2MSPA 3HPJB 4MVBD 5LCVL 3MV7E 4JZJA 4WUUE 1H5BB 3MODL 3NCMA 5ITBL 4PRIE 1SJHA 4RFEA 4AM0A 4P2YA 2RJMA 5B8CA 1JUFB 3A6BH 4WUUD 3NGBB 4P5KA 1A6ZB 5B3JF 4QEGA 4O5LL 4WGVB 1UKQA 5E2TH 1PYWA 1E6JL 1OCWL 4PJGE 3S36L 3WFDH 1ZHNB 4YR6B 4MD5B 4NQUA 1DQQB 1U91A 5I75C 5DMYA 2DTSA 3B9EA 5TDPA 4FFYH 4GBXB 1FO0B 1MRDH 2BC4B 4R6UA 4ZNEA 2NMSA 4DVRH 3SDDC 3B9KB 5CEZD 4HEME 1JBJA 1JPSL 2BCKA 2BVOA 1GGCH 1A3LL 4HSQA 2XNAB 4LHQB 3RHWK 1KC5L 15C8H 2Z93A 1N7MH 5E99L 4ZS6D 3V6OA 4BFIA 1Q9OA 1ZSDB 4QRSA 5E4EC 1CDIA 4GJTB 4LGRB 1A6UH 1DFBL 1NUGA 4AEHL 4XNXL 4K3DL 3BKJL 3REWA 3IRZA 3MV8B 3QUMH 3ILPA 5B39G 3BH9A 2B5IB 3PWLB 4XTRD 4JEGB 1VEMA 2YD9A 3QUYC 3GBMH 1AP2B 3CFJA 3W0WB 1WLHA 2VC2H 3FFCE 5IFHL 5DLMH 4GW4A 4N0CC 4BSVA 4L4TB 4KI1A 5I1EL 1QQDA 3F5WA 5DK0B 4Z78B 7CGTA 4ZAKB 4KTDL 3O3AA 5D7IB 5JHDD 2CK0L 2WMPA 2ADGB 4WEUD 4MAYD 4PS4L 1F97A 2IBZX 2XA8H 3UDWA 1R0AL 2VABA 4N8PA 5TDNA 2PYEE 3VFRB 4HXAH 5JNYB 5ESAB 5IB5B 4UT7H 1I8LA 1YQVH 2NW2A 5HY9A 4LPCA 1IVLA 1IEAA 3MRLA 4OIIH 2Q6WB 4HWBH 5FYLL 1N5AB 3ARGB 2KKQA 1IL1B 1QBLH 2HFEA 4H20H 1OGAA 5DEZA 4I77H 3V9FA 1VKXB 3MV01 5JW3H 2BJMH 4M5ZH 3ZTNL 3LQAL 3WFZA 1D7FA 5TGBB 1UCTA 4MMZC 4D2NA 2MHAA 3B9AA 5CINL 3T0BA 4R7NA 5D7JD 4YE4H 4PJCB 3MGOB 4K94H 1W8NA 2AJ3A 2VZVA 3TJEL 3O4OB 4NC2B 5IR1A 2YPLB 5TQ0H 5IB1B 1IEBB 1V7NL 2AV1B 4G9FB 3ZDXF 3HZMA 2JJVA 4YHZL 5MEQB 4JM4L 4HX1B 5K33A 1F11B 3UTZA 4GAGL 3DUUB 1OP5H 2RAMA 1C1EL 1CGXA 1QSED 3TCLA 3V6BR 1WAAA 2UYLB 1VFUA 4KKAC 1XGUA 3QR2A 3GIZH 5DJ6B 3EW3B 4M7KL 3CMOH 3RWDA 2PYFB 4ZOEA 4GUPB 4FZEL 3QCVL 5HDQL 4NFDA 1YYML 1XF2B 4APQC 1OB1A 1YECL 5D6DA 1X5YA 4Y19E 5A2FA 4C58B 1DEEB 4X7DC 2RFXA 3DURB 3PIQB 3RNKA 1BGXH 4GSDL 1EHXA 3MLZH 2BSSA 5A40E 2A74B 1QRNA 5J13C 2LU4A 1UWEL 5D5MB 1YNLH 3FQWA 5EG6C 3PDOA 2A2QT 1JHKH 1PY4A 2F54A 2R8SH 5IF0A 1V3MA 5HTSA 1B9ZA 3OG4B 4G8EB 1UH4A 5C0BE 2OP4L 2Y5EA 3GJEB 1DBJL 3HZYB 4JRWA 9CGTA 4GRLB 1VHPA 2E27H 1JWSA 4PJEF 1KCKA 4AH2B 4KKBD 3LOWA 5F9DC 1U8JA 2C5DC 1CICA 3TT3L 3MRNB 5C0BD 4F15B 3I3BA 4KXZI 1E4JA 4OGXL 1P53A 4B7LA 4OTXL 3W11D 2GJJA 3C87A 3K74B 4LCCC 1YN7B 3HMWL 4G8IB 3MACH 2BZDA 4UV7L 5FYJU 3BGFC 5GSRA 5DVMA 5DMGC 3P3YA 4P3CL 1RK0A 4NKDB 2IBGA 3UMTA 1FNEB 3EGSA 2X70A 1EXUA 1AHWC 1N0LA 4KQ3H 1CLYL 5CMAA 1UWXK 3REVB 1YY8B 3WD5H 1U8HA 1QLRB 2Z8VC 4ZUVB 4J1UA 3VG0L 3D5OF 1WZ1L 2FIKB 1KJMA 1FG2B 4IOIA 4P2QE 5H8DA 4MDIA 1KJ2L 4F7MB 4P9MH 4XRCA 1OF2B 2YK1H 1CFSA 1M6OA 4UIKH 4U1GC 5E70A 4ZPTB 4BZ1L 2FYYA 1DN0A 5GRJH 2NCMA 4P2QD 1NBYA 5C8JB 2O5ZH 4TUJB 4OZIF 1QVOA 3TZVB 4ODHH 3VFGH 1DVFD 3QPXH 1EIBA 2GCYB 3MYJA 1MFBH 4TTDD 5HYSB 2NY2B 3NCFB 1IC5L 3PGDA 3QWRA 3RKDC 7FABH 5JOPE 2NNAB 4QYOB 1GOGA 2XQBL 5MERA 4XWOD 3KJ4C 4NJ9H 4RISH 5E2WH 1EEUA 2FIRT 1F02I 2CR3A 4AENA 32C2B 3SCMA 5C0GB 3D2UA 4HF5L 5FFLA 4LF3B 3TC9A 1F4YH 3VWKD 1IKNA 5F70A 4BFBD 1AD9B 3PNWA 3QCUL 4NQEA 2XZQL 3OKLA 4GMSL 3RTQC 1ZT1B 4MX7A 4WHCA 5ADOL 5DZNA 5LGHL 2KQNA 1QNZL 3TN0C 2D31B 2H9GA 4I0PD 3V79C 5DJ2B 2X4PB 1QBBA 3CU7A 5E2JA 4DKEL 4IHOB 1X4XA 3ISWA 1CE6A 4Z5RA 4ELKB 3HAEG 4M61B 3RHWF 3ZE1E 3EBAA 4LEOA 5E08L 3WL9B 4MNHA 2ILLA 4FQPA 3MUGB 1NEZB 4LLDB 4HWEH 5JW4N 3BAEL 4D0BA 4J6RL 1QFWL 4LVNC 3V0VA 5E6IB 1LO5A 2EH7H 3CSYA 4YHIA 4F3FA 3M07A 2NY0B 3O2VH 1Q0XH 4P2RA 4MLIA 4UDTA 5TE4H 2A6KA 2AK4E 5GPRA 3AREA 1P4LA 1SJHB 3LQMA 1ZS8A 1LEKA 5B8CB 2YPVL 5DFWH 5IROA 4HUXA 2AK4D 2F53A 5GISL 1PYWB 4X5LA 3VW3L 2PKDA 4UQ2A 4JDZA 4XPFH 4Z7QF 2ZSVA 3TVMC 4TQEH 4K55A 3NA9L 5TDPB 5D96B 2XQYK 4OV5A 3I75B 1N6UA 5KVDL 4K8RH 2GFBB 1TCRB 2BCKB 3L5HA 2BVOB 1IQWL 1NGWA 2PW1B 1I8IA 1MFCL 1JNHA 2Z93B 4WHTA 5D1ZC 4LL9A 4OFYA 3CDYA 4BFIB 3VXTB 4EUPG 4QRSB 1BQHA 4F57L 43CAB 1IC7H 1U42A 2MMXA 1DBAH 2CJUL 3ARZA 1HHKA 1FVCA 3REWB 2MJWA 3LIZL 3KLDA 3ILPB 3BH9B 4RX4D 4LKXA 4X99B 1S5HA 3CFJB 4NZUL 1G1YA 1DBKH 4GW4B 1GH7A 4HS8H 1J0IA 1ZHBB 4PJ9B 1P7QA 4MS8C 3KVQA 1MJJA 1T5XA 3F5WB 4GKOA 1BD2E 3O3AB 1I85A 3WIHH 2DOCA 2BVTA 5CJXC 1JIBA 3FQUA 2OMNA 3VFMA 2WP3T 5JUEL 5F3HA 3VCLA 2VABB 5TDNB 1HXMA 3CVIH 1G7HA 1DQTA 4X5WA 2NW2B 3WNKA 3VWJB 5HY9B 1YMMA 2H1PL 4KRPD 3MRLB 4PJFA 4L5FH 2P45B 4POUB 5EBMA 4AG4L 2GT9A 4QTHA 1H0DB 4XMPH 1T2QL 2JIXA 4NOBA 4RGNC 1OGAB 4PJ5E 3T0AA 2NX5E 3S35L 2GUOA 3NZHL 2ZP0T 2CRIA 3RL2B 3SQOH 3E0GA 3T3MF 2DQHH 3D0VA 1T7XA 4GXUM 4YHOL 2NX5D 5C0FA 2PXYB 4R7NB 4XMLH 4YLQT 2YKLH 1F2QA 2VR4A 4MB4A 3ILQC 2EH8L 4NZTL 2AJ3B 5IR1B 1CD8A 1JPFA 4XPGL 4R26L 2EDEA 3SDAC 3D39D 4FQJH 4BH7A 1XEDA 5I74B 5I6XC 1F4WH 5HYQB 1OWWA 4NO0D 1OPGL 2FH6A 3HZMB 3HHRB 3QI9D 3WDHA 5AWNH 3UTZB 5EIIA 2WBWB 3T0EC 2CKNA 2KZ1B 3TCLB 3ZHLA 1XGUB 3BKCH 3AUVA 1KCUL 4HIXL 4Q74A 3O9WD 1H8OA 2GJ6A 2APXA 3NFNA 5E8PA 5CUSL 3CMGA 3NFPB 3ZDZF 1G7LA 1OL0A 3UPCA 3WBDA 2YUZA 4XVTH 5INDA 4JZOA 5GZND 2R0ZL 4M5YH 1A6PA 3RNKB