4HPOH

Crystal structure of rv144-elicited antibody ch58 in complex with v2 peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
226
structure length
217
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYRFTSYWIVWVRQMPGKGLEWMGIIYPGDFDTKYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARLGGRYYHDSSGYYYLDYWGQGTLVTVSSTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CH58 Fab heavy chain
publication title Vaccine Induction of Antibodies against a Structurally Heterogeneous Site of Immune Pressure within HIV-1 Envelope Protein Variable Regions 1 and 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 37
structure length 217
sequence length 226
ec nomenclature
pdb deposition date 2012-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hpoH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hpoH01
4MXVF 1BQSA 2ARJB 2DQDL 1RAMA 3MRDA 4WHYH 1T21B 3GHEL 3B8SA 2WIIA 2BNQB 1JTOA 4XVJH 3E6FB 4IEFB 4BQBA 4M1DH 3WS6A 2HVJB 1S9WB 4JY5L 1CLOL 4HUWA 1F02I 5E0QA 1I7ZB 2YMXH 1Z5LA 4JN2B 1RZ8A 5CINL 4U2YA 3ZSSA 4YPGB 3L5HA 3QBTB 4PJ8C 1HXMA 5C0ND 4NYLB 4KMQA 4I9WD 4RGOL 2VDOH 5FKPB 1PYWA 3L3IB 1KJMB 3ZDYF 2BVTA 5JXED 4OZIA 1EFXD 4NZDA 4K7PH 2AJZA 4Y4HD 3VDAA 2E9BA 1DANT 5F7NC 5T5FH 1W0VB 2B0SH 4UT9L 4PJ5B 4APQC 4D2NA 3GJFB 4AQ1B 3EYSH 1JZ5A 3ZMRA 2VDML 3KYMA 3KVQA 4PJ7F 1CDHA 3LIZL 5IJVA 2HKFL 3BH9A 3L5WB 5IFJB 5IMMA 2ESVA 3GFUA 3QWRD 4G8GE 2CGRH 3ZE1E 3BW9A 4OD2A 3LKQA 3I75A 2DQJL 1T7WA 2R56H 4FQQB 3CXHK 3RVUD 1CE6A 5T1LB 1EHLL 3VXPB 2E7CA 5ABDE 4PV8B 5DMJB 3M17A 4JG1L 5B3JE 4C56D 2DTML 4HMDA 4P5MB 3ECBB 3O4LD 4GBXA 1XF1A 4E41E 3S7GA 1QSZA 3SY0A 1CFQB 3OF6D 2XZAH 2YUXA 4HXBL 4QWWD 4IBLT 4DZBA 2DI7A 3IU3B 4Q0XL 3T4AB 3WJLC 3ARXA 4K23H 1UJ3A 2Z8VC 3UDWC 2C1OA 2GW5A 1IZKA 2X41A 3HPJB 3FO9A 3N1GC 5AD0A 4FFVC 1NDGA 4LRIC 3DXAE 3QQ3A 1JGUH 2QKIB 3MGOA 3FB7B 4YDVB 5KTEL 4X6BB 4HDIB 1PQZB 5JPMB 3S37X 1QKZH 4D9LL 4YHKL 5I6XB 3U9PL 3IDYB 1BEYL 3NCYS 3TC9A 2OTPA 3D85A 3OHXA 2Q1EA 4MDIA 2XRAL 2X4PA 4DJMA 4YNYB 5CCKL 3JV4B 1VPOL 3K2UL 3ZL4L 3ULUH 4R97C 4Q58C 5IFAL 1RZGB 2YRLA 4OQTH 1RIVL 2HT2D 3MRLA 1CIDA 1T7ZA 4XPHL 4QXGH 4DFIA 4PJFE 1X6LA 5F3HA 3U0PA 4U1KA 3UZQA 1S8DB 1HE7A 1WC7A 4JLRA 3U46B 5FA3B 5C0GB 5DC9B 1OSPH 3VXUD 4L8SC 3NIDE 2IEPA 1TVBB 5KS9B 4GAJL 1S9XB 4P3DB 1RHFA 4XXCA 3G5ZA 3MLWH 4LSDA 1YEIL 5LCVH 1NGWB 3QIUD 3BWAA 4L3ED 1GOGA 5HD8C 5AG8A 3HE7C 2R39A 3G5XA 3BZEA 4M93C 2WINA 4Y1AE 2EIDA 4ODUA 5FA4B 1U58B 2OI9C 4S1QH 5BS0B 5GGVY 5J11B 4PJ7A 3GK8H 2HWZL 1UCBH 5FM8A 5D1XA 4GMTL 4U0QB 3LRSB 2GTZA 3RX5A 1P9MC 3KPSD 4LSVH 3LPWA 1TVHA 2ITCA 1IT9L 2EEDA 3PWUB 5DJZB 3ZDXE 1IE5A 4BSWA 4OF6A 3VWKC 3U2SA 3CCHA 2B39A 4HIIB 1JNJA 4MJ5B 4H1LH 5HHVL 4U31A 1MH5A 3KYNB 2I60H 2CDEB 2W9EL 3VH8A 3U4BH 3Q6FB 4YHLH 4ODWA 4ODTL 4P2RB 3W9DA 3TZVA 1HSAB 4BYHA 2I9TB 3RTQA 4GLRI 1KCSH 1UACH 1JV5A 5DFWH 3MV7E 1J0IA 2PN5A 2VDRL 3MA7A 3MREB 4RGND 1D6EB 2MQCA 3ARVA 3SDCB 5HI4D 1AD9B 3V6OE 5DLMH 1CGSL 1EBAA 1C08B 3TNNA 3BZ4B 3W39B 1CZ8H 2ERJC 2JJTA 5CJOH 3E6HA 2VR5A 3CJJA 3DARA 4XAWH 3V4VL 4XNMA 2BJML 3ILQC 5FYJE 2Y06H 4O2EB 5IMKB 4U33A 1PJ9A 2R2BB 3LZFH 3MRJB 2J88L 3VMNA 4YDJB 4RA0C 2VDLL 1A9EA 3K4ZA 1U91A 2IANA 1TJHL 4HKJB 3K46A 3W2DH 5F7YC 1XCQB 2IG2H 3F12B 4MD0B 4KZEH 3MLSL 1NAKL 3IJHB 4RAUB 1ZHLA 4H25B 1FJ1B 3CUPB 3CH8A 3JWDC 1FCGA 4Z7NE 1INDL 5KANI 3MLYH 4R4FH 1BX2B 5BZWB 1G9MH 2GJ6B 2NY4C 4HEME 2XT1B 2GEEA 4OFIA 3ZDZE 2PKDA 2ZUVA 1N6QL 4LCCA 3LV3B 5DEFA 1F4YL 1D5BA 3IRZA 1MF2H 3L5IA 1LE5A 1T3FA 1GC1C 4TVPD 3KYKL 3T77A 3KWWB 1XCTB 4P4KD 4OCXH 3P3YA 5D1ZA 4WIQA 1SBBA 1LDPL 5HVHB 3BD5A 2WWMD 5DJXB 2WWKO 1TIUA 4DWHA 2P5WB 1MFNA 4IJ3B 2DQEH 2F5AH 4HMCA 1U3HD 5JW4N 3ILPA 3RGVA 3UJTH 5GGUB 1OT2A 5EO9B 1UVQA 3NFSH 1ZLWH 1D9KA 2BVOA 5GGVL 2L7JA 1IGJA 2QEJA 1EUTA 1U8LA 2AERT 2F74B 1ZWIA 1TFHA 5J6GB 1N5AA 5DTFB 2Q8BL 4F9LC 4XMPH 5EZOH 1FNEA 4LCUB 5DHVA 3CH1A 4RNRA 3WHXA 1PKQE 5KN5A 4FFZH 3QHTC 1KV3A 3HPLA 1A6WH 1CR9H 2F9BT 1AC6A 1ORQA 2W9DH 3T0WA 3CX5J 4HUXB 3QHFL 3WIIH 3VXNB 1EXUB 5I66A 4CJ0A 4IIQA 3HR6A 5FUZL 3DGCR 4LVNB 1UB6B 3V5DA 5DJ2B 2ZUSA 1EEQA 2UWEE 2Z93A 5I1JL 4IRJD 2GY5A 5HYQA 4ODSH 2EXYC 1X3DA 1X5YA 1KEGL 1RIHH 3GRWL 4QNPE 3MRKA 4LP5A 4L9LB 2XZZA 3GMLB 2Q6WB 3VGAC 2VE6B 2QADD 1VEMA 3EIFA 1HNGA 3KDMB 1MLBA 4DFHA 5LWYL 1WT5A 4KFZC 1VFAA 4M7LL 4XVUD 4MDJA 4KV5F 4ZD3L 4UB0H 4I0CC 2DYPB 4ONFL 3HA0A 1T6WA 3AU1A 1LO2H 2Y7QB 4KDTA 4RFNC 3TLRA 1AFVH 2A0LC 4OAWB 5IHBA 3DI2B 4KZDH 3TO2A 3S34L 2NY6D 2VKXA 5E95B 4G8IA 5DEGA 4ZG1A 3B2UC 3BQUC 4LLDA 1RZKH 5AZ2H 4L8BA 5I2IA 5IG7A 1E6JL 2HVJA 4JFEB 3I3EA 3B5GA 5EORL 3KPRA 5GJSL 3ETBF 4HC1H 1GZPA 1EAJA 1CGUA 2ARWA 4YPGA 2Z0BA 2JIXD 2VLRA 3ARSA 3LS5L 4NYLA 4KQ4L 4H26A 4OLWL 2I24N 3TIEB 1KPRA 5FKPA 1C5CL 3L3IA 4IOFC 1S7WA 3UROR 4Z95L 4G43A 3C60D 3MACL 2R2HA 2YPVL 1X5XA 1K5NB 3CFBB 4KKCC 5H2BA 4GRLC 1X5JA 3ULVD 1HEZA 1CTOA 1IMHC 1J1PH 4PB0H 4PJ5A 3IFOA 1REIA 4JZNB 3SDAC 5J1SC 1INEL 3QRFM 5B3NA 4YHNA 5FF6B 1MJ7H 3RBGA 4WTXA 3DYOA 1FIGL 1NGPH 1OPGL 3OKEB 4MHHI 3RL1B 2R4RL 5EU3B 3VWJB 1D5XB 2GSIB 3PP3K 3FO1A 4J23A 2DD8H 3JWNC 1JP5A 1CBVL 3GMRA 1NBVL 1ZANH 2E3VA 5ENWB 3HI1B 1WICA 3G08B 5I76B 1I3GH 2JELH 4JDVB 3IDUA 1Q0YL 3IS0X 1MJUL 3P9LA 2X4OA 5K9JH 5KZCD 2VITB 1IGYA 4Z7OE 3WE6B 1KJ3H 3QZWA 4QY8B 3DMMC 3LH2L 3A67H 2A6JB 1HHGA 2XWTA 2EEBA 5FYLH 1SJHB 4XXDB 3VFVA 1VB9A 5DUBA 1S3KH 3LQAL 5DD6A 1A3LL 1IBGH 3T4AA 4CW1B 3NIFE 3VA6A 5D93C 3MRFA 4LCWB 2EDQA 1IAII 3SCMB 3WIHL 5C3TA 5GSRB 1K8IA 1RZJH 3NIGF 4OD1L 4F7PB 1JRHI 2BY1A 1CDIA 1E6OL 1FZJA 1K2DA 2RIKA 4H8WC 4MLIA 3IAQA 2JJVA 2B2XH 4PGDA 1E4XH 1N7ML 2BP3A 4HF5H 4X6BA 1JHKH 1PQZA 3X14B 5JDSB 1NFIB 4TNVK 2VLJD 3GRWA 2EDLA 2QQQA 4UAOC 1HILB 1CGXA 1Q8MA 5CS7A 5D7JA 5DZNA 2ATPB 2GIYA 2NY3B 3QHZH 1W72L 3NZHH 4RGMC 2JE8A 3E2HC 1P7QB 2FIRT 4WFGD 3BEVA 1FIEA 1FYTA 1LO0H 3E3QC 2LFGA 3SBWA 1QTYT 5TH2B 4OF5A 1S7QA 4HPOH 3IXTB 5SWZD 2FATH 3DV6A 3A6BH 1UQSA 4UNTA 2J6EL 1YECH 3NAAL 4AENB 3ZO0A 4NQEA 5FA3A 3RWCA 2VUYA 5E9DB 4P9HC 3CFJA 2LTQB 3DIFB 3ARBB 3V5HB 3TN0B 4I2XE 4OIAA 5BMFL 3UO1H 4F8TA 2D7TH 4J1UB 1Q9OB 1RK1A 1OGTA 1OOAA 3RNKA 7FABL 1QFOA 5CSZB 4H20L 2YKLL 1K6QL 3DSFH 4RMSA 3ES6B 3BAEH 2APTA 3MRBB 1G1YA 1IM3B 1KTLB 5DMIH 3GSUB 4GXVL 4QXUH 2XIDA 1JFQH 1PEZA 4M7LT 1MUJB 4FP8H 3RY4A 1CLCA 1A1MA 4Z8FL 5JQ6H 1AE6H 3LDBC 3VFUB 1MAMH 4P57B 4C57C 2QSQA 4HIIA 3WFBH 1CT8B 3QEHA 2F19L 5FUOL 2V7NA 2ICWJ 2AXGA 1G7QA 3IFLH 1PG7X 1HSAA 2C3XA 3FZUC 3OAUH 3EYOB 5HYJD 1BQLL 4L9DA 1JYVA 2AXHA 4PJIA 5GRJH 1G7IA 1NJ9B 1EFQA 4MX7B 1KSRA 1FNGA 1JGDA 2XI9A 4LKXB 4LK4A 3REVA 4AM0A 5J3HD 3WBDA 4FNLH 3KG5A 3OKNA 4A6YH 4LCIH 5D7SL 1I1RA 4W4NA 5KVEH 1RUAL 4CU7A 4L3CB 1W0YT 4FQJL 1B4RA 3W39A 2ORBH 2ENSA 2V2WA 1ZK9A 4FFYL 3TP4A 4M6NL 4JFOB 1CTNA 3FRPA 5GGTH 1TJIL 2N4IA 4EIZC 1XF3B 2CJUH 3PF2A 1FZKB 2P8LA 2V5RA 3LRGA 1OWWA 3V0WL 3BDYL 1HKLH 4EKXA 4KUCD 4S11A 2Z31C 4MVBC 4O2CA 4YDJA 4N90E 5BQ7B 4LLWB 4WUUE 2HVKB 3CZFB 3KXFE 4LCYA 3O45B 4HKJA 1EAPA 1BVKA 3DGGA 3FRPG 4OCMC 4MB5A 3HNTH 2X2YA 4NQXA 2Q7YB 5SV3A 2MWCA 1HZHH 3CFCL 1A7NH 1LQSR 4KI5F 5INDB 1J11A 4FQXC 4RIRA 1ZT4A 3MYJB 4LVOC 3PDDA 4JO3H 3U0TB 1RFDL 3WIHA 5GS0L 5HVWA 1NFKA 4P2OA 3AAZB 4DN4L 3MLRL 3H2WA 1YJDC 4MJIB 2FLBT 1ZHKA 4AQOA 1QG3A 4Z0XB 3L3JB 3S4SG 2ICWA 1CL7I 4NO0A 4NOBA 3ALPA 4L1DA 1MCSA 5J1TC 2BCKB 3UTQA 1MCNA 3GKWH 1M05B 4G9FA 3QCTH 1I9JL 2BSED 3D3VE 4KKBC 4QRRE 3MJ7A 2X1WL 3P9MB 4LLQB 2X4RB 3BE1H 2WSKA 4C83A 3P0YH 5I1IL 2BNRD 1F42A 3MLZH 4FTVD 4LHQB 5IB4A 2YEZB 1DANU 1NUNB 1W72A 1OGAE 4EEEA 5IJKC 3H3PH 3SJVD 3REWB 5GGUA 2E9IA 4YGAB 1MJJB 5D1QB 3IJSB 4BQ8A 4MAUL 1MLCB 3NABH 1A47A 4PP1C 1AGDB 2OS7A 2FHFA 3VFMB 3UBXB 1T4KA 1CCZA 1ZHNB 2HTLD 2FBJL 3WUWA 5J6GA 3O9WB 5KAQF 1F3JA 5I19L 4RAVB 3D69A 3NFNA 5LAXA 1YYML 2J6EA 3H8NA 4DGIH 4PY7B 4U1NA 1GAFH 4YR6B 1W8NA 5SWQA 1X7QB 5HVFB 3LKPB 4K7PY 3VGDA 3NCBB 4U7KA 1QEWA 5GRWA 1FP5A 2BSTB 5GRZA 4JCLA 3P77B 5A2IH 4WU5A 4A2MA 3TFKC 3WUWG 1IAKB 1NAML 3RZCD 3KPLA 5CEXB 2PCPB 1J1OL 2Y5TB 4LQFH 1UB6A 4FXGA 2KZ1B 1WFNA 5DJ2A 1F4XH 2P44B 2ZOKA 5C2UB 5ICZA 5JOFB 1DFBH 3LEYH 2SEBB 4D94A 4Q9QL 1QSEE 4YBQD 5EN2B 4M48H 4CL7A 1ITCA 4YX2L 2JJSA 2F8XC 1JUFA 2Y36L 4JFZH 4Y5YB 2AJSH 2BRRL 3U7WL 1OY3B 1T1XB 3TJHC 3X3FH 4O02H 1TXKA 1A4JA 2Q6WA 2YPLD 2HFFA 2VE6A 3Q1SH 1XR8B 4ZAKD 2PF6A 3C8KA 3P0GB 3HMXL 3OTTA 5F1SA 3QUYB 4UNUA 1YEHH 3O6FA 4PYGA 3G6JE 4JDTH 5L9DL 1MREH 3BOVA 4KHTH 3MODL 2J5LB 3C6LD 4U0RC 5BV7H 5KVDH 4XMLH 3HUJB 2DKMA 1KB5H 1KN2H 1U8QB 4ODVH 4Y8DC 5GPRA 4D0DB 4KUZL 1LP9E 4V1DA 3SKJL 1CLYL 4X0KB 2DM7A 1ACYL 5CMAA 4OFDA 5LQBL 2WUBL 4QTHA 3QDJD 4G5ZH 3WNMA 1F2XK 4LKCA 3WNNA 3OXSB 1PZ5A 2JCCB 3QXAA 1QFPA 4JQVA 1T7YA 4HZAA 5JLZA 3GHBH 4BSVB 3RVUC 2GAZA 3CNKA 3SKMB 1E28A 1I4FB 1X5AA 3NZ8A 4XZUB 5H37G 3ZKND 2XTJE 4KC3B 3I9GH 2R0ZL 4EI6B 4JM2A 3PDOB 3HZVB 1EEZB 3NTCH 1LWRA 1HHJB 1YMME 3ALWA 1XH3B 4JZJC 4XVJL 4DK6A 3U6RB 2N7BA 2AK4D 1ZA3B 4M1DL 5T3XD 3TIEA 3MBED 4BH8B 3LKNA 2WP3T 5JW4Q 4Y19D 1NBQA 5JPNA 5HHQA 4LPXA 3LKOB 2PUQT 2YMXL 3FFCB 3F6LA 2XN9E 5JHDB 4JZNA 5GGRB 5L8LB 5IEHA 3MLXL 2VDOL 3IFPB 4QOKA 3LSOB 3SKNA 3PL6B 3S8WA 4XPFH 1JF1B 3F5WA 3RL1A 4F9PC 3EGSB 4PJEE 4MQ7B 3OKMA 5EU3A 3WNLA 2GSIA 4NRZB 4Y16D 5EZIH 1G6RB 4K7PL 3CZJA 4RCAA 2H32B 1MI5D 1QO3A 5DVNA 5T5FL 2HP4A 1A7QH 2VJXA 3MCLH 2B0SL 3VXSE 3EDEA 6CGTA 3EYSL 1NMCB 3WUZA 1S7XB 3OKKA 2P46B 4P49A 4TNWK 4OKDA 2DMKA 2A6DA 4QY8A 5TQ2H 1CDCA 3KPMB 3W0WA 3VG0H 2A9MH 1FN4B 2CGRL 4JRYD 3L1OH 1K85A 1EVTC 2EKJA 5DJDA 2EEAA 3V7AE 2R56L 4JQXC 3V52H 4S2SB 4K7FB 5C6PB 1S7RA 3Q3GB 1OW0A 2NXZD 1X4ZA 2X1OA 5FYJH 1XGPB 4IRSC 3SCMA 5ALCH 2ADJB 5GSRA 3S5LB 3T8XB 3T0ED 5EOQH 4PD4J 4E0RB 3PHOB 2R69H 1NAMA 3SQOH 2VH5H 1IJ9A 2AJVH 3C2AH 4EQ3A 4AK1A 4NCC1 3GSQB 5D96C 1F58H 2XZAL 3H9SA 3QIUC 3VD4A 3HE7B 4N0YH 4M93B 4HUUB 2F53D 3PP3H 5DRNB 5DZOA 3AGVA 1G7JB 4HH9B 4IHOB 4K23L 4WWKC 3PWPA 4HWZB 2HJLB 1HILA 1U8PB 2BVPB 4OCWH 3UP1A 1LD9A 1VESA 5IB3B 1PEWA 4EN3C 1FV1B 2RFXB 1JGUL 3ULSB 3GZKA 3MRPA 3HMXA 1FL6B 3GMMB 4WFHD 3HMWH 1QKZL 5TH2A 2O5XH 1FG2A 3IXTA 4N5EC 1C16B 2A2QT 3D39A 5GGRY 1I9RH 4P2QD 5HPOA 3KNBA 2CR6A 3ULUL 4R7NB 3H42H 4RGNC 2JB6A 4U6HA 4OQTL 4EI5D 2HLAB 2Q7NA 1EEUA 4HIJB 3L3OA 4QXGL 5HI4C 4J1UA 3FN0H 3HI5H 4X9FA 8FABB 5T3ZD 3O8XA 2RCSH 2D9CA 2ERJB 3JUYA 3VRJA 5CSZA 5IVZB 1R3IH 1XF5B 4NUJA 4F2MB 3NCFB 1PX4A 2F8OA 3MRBA 1OSPL 4UTBH 4M00A 4X7EC 5DJ8A 2VZVA 1FNFA 3HS0A 4HWEH 3MLWL 4X6DA 5DHYA 5LCVL 4IOIB 2WK2A 3ULUF 1N59B 1PG7W 1LNUA 3MCKB 2VNCA 4J4PA 5F9OH 5AEAA 2YPKB 1XIWA 5SX4I 4S1QL 2ZOLA 4G3YH 1ZEAH 3GK8L 1UCBL 5F96H 1QFWH 4CN1A 5KVFH 2NY4B 2VOTA 5FM4A 3EYOA 5SWSA 3NA9H 4JKMA 4LSVL 2FGZA 3GBLA 4MX7A 2OCFD 3GSWA 4LKXA 3RVXD 5GRVL 2HN7B 5K93A 3BPLC 2I60L 4OCYL 3U4BL 5GS1C 3VFRA 3CLEH 4YHLL 4Y5VB 1M4KA 1P84J 1JWSA 2DLHA 1K4DB 3RX8A 4N8PA 1C12A 5E24E 2WWMC 4HAFA 1KCSL 3MRGA 1QLFB 1UACL 4BK5A 1U3HC 5D1XD 1MHPH 3ARDC 1RHHA 5E8EB 4X5LA 4Z5RA 3F7RA 4OSUH 5HGAB 2LAGB 2VLME 3FTGA 1AXSA 3SDXB 3DX6A 5DLML 1DQJB 2E5EA 1G9NC 4Z6AT 4LLWA 1WVZA 3CZFA 3LPFA 4NNYB 5EU6D 1RJYA 4X8XA 1CZ8L 4PRPD 1WISA 2OK0H 4HBQA 3HUJF 3MOAH 4AIXA 5CJOL 3LRHA 4EUPH 4ZUVA 4XAWL 2Y06L 4R96B 5FUCE 5BW7A 3GO1H 3U0TA 4OGZA 3LZFL 1P69B 5J06A 2FLRT 2JCCF 5ID0A 2PYEB 2YSSB 4OZHE 1NGYB 4HHAA 3EHBD 3HC4H 4LOUD 3MLPA 3W2DL 4HIHB 3QO1A 2IG2L 4KZEL 5I16A 1B0RA 3MUGB 3ARGA 1N2RB 1M05A 1JRHH 4NIKB 4GG6A 4WHTB 2VL5B 3MLYL 1P7HL 4R4FL 4ZPTA 1ZXQA 4PRHA 1G9ML 2VABB 3U7AA 1G7PA 1JHLH 3MJ8A 3REWA 1UZ8B 1FDLH 3RQ3A 1MF2L 4MA3A 2QADC 4OCXL 1N0XL 3UBXA 2H3NA 3K74B 4HKZA 1G0YR 1ZMYA 5B38A 2KH2B 2DQEL 1AIFA 2F5AL 3P0VH 4HPYH 4OZIE 1WCBA 4PY7A 3UJTL 3FOLA 4QXWA 3C8HA 3JWOC 3O81A 1PKOA 4OQTA 1R3LA 4RFNB 2X4NA 2X7LA 2VQ1B 3EZ8A 3LKPA 3SE3A 5ERWA 5DC4B 2R0WH 5C0CB 2P5EA 3MLTB 4OZFH 1IAKA 5F7LB 5D1ZD 5D2LB 4XMPL 5J0BA 5EZOL 2PCPA 4DOHE 1BZ7B 2B5IB 2Y5TA 4JREC 4FABH 3HCVA 1DUZA 4FFZL 4PYHA 5L2KB 1A6WL 1CR9L 1GCFA 4WO4A 1J0YA 1A64A 2HLFC 1OCWH 1JE6A 2W9DL 4D0CA 3HZKB 5I71B 3WIIL 2C1PA 4L4VB 1EJOH 4JFFA 2CSPA 5GHWH 3QUZC 1Q9LB 3OJ2C 4BUHA 1D9KD 4TSAH 3V6ZB 1QSFB 2V9TA 4GW4B 3PWNA 4KTEH 1KEMH 2VISA 1ZA6A 4U1LA 3ARED 3C60C 1KG0B 3DVNB 4NBZB 2EIZB 4GRLB 4R9HA 5DS8B 4JY4B 4ODSL 3ULVC 1NCBH 4MA7H 4P3WA 1U3JA 4P23B 1NMAH 4TN9A 1RIHL 3MV8B 3EW3B 2VXQH 4UU9B 4Z7VB 5I17B 4K9EH 3IVKA 2O61A 3BKYH 3SE4A 4D0DA 4H1LA 4M9PA 4V2BA 4OV6F 3OXSA 4KRNA 1JF6A 4PG2A 5DQJB 4UB0L 2A6IA 3TH4T 1KPVA 1VADB 3SDDB 1F3RB 1TZGH 4G6AD 1LO2L 2Q87A 3SKMA 5E08H 1I8IB 1IZJA 4XZUA 4ZO8A 1C5DB 1AFVL 3RVVD 1JTPA 1BAFH 2F54D 2ILLA 3DMMB 1RSFA 1BFTA 1XH3A 4KZDL 1GL4B 1Y6KR 5B8CC 3FQWA 2WM0A 2HJKB 5EULV 4AYFA 4PJ9A 1RZKL 1YY9D 4BH8A 2ZCKH 3DX7B 5AZ2L 2V5TA 4HJJH 3EJZD 3ZTJH 1F13A 3TH3T 3FB6B 2X44D 5T1KB 3LKOA 1BGXH 2BNUA 4FZEH 4JGUA 3GSRB 3RWDB 1FCCA 3RKDD 4HC1L 5IBTH 3WD5L 4NQVA 3RWEA 2QR0A 3R1GH 4E5XB 5JHDA 2D2OA 5C0BD 1MFCH 1OAQH 4JHAH 1R3JB 1HHKB 4OCNC 3LSOA 4FFWD 3I50H 2BNQD 3PL6A 1NKRA 3WJJC 1FE8L 2XA8H 3WKNA 3OG4B 4LVHC 3EYFB 4C4KT 4WFFD 1ZVYA 4TUJA 5EIVA 1A7OH 1J1PL 4PB0L 2D7PA 4HWUA 2BSRA 1U8JB 1I1YA 4YJZL 4KK6C 4W6XB 4J2XA 3L6FB 3R06A 1N6UA 1MJ7L 4RGMB 1Z0NA 5F3BB 1S7XA 3KPQB 1NUFA 1NGPL 2FL5A 4TTDD 4BUGA 3C5JB 5A2JH 1N8ZB 2C9AA 2WBWB 4BFBD 4NP4H 4PJCE 4P5TA 3FO2B 4X7CC 4QHKJ 3U30B 2DD8L 2VZOA 5CBEA 4U1HA 1ZANL 4W6WB 2BMKA 3L7EB 2EDJA 1I3GL 2A6KA 2JELL 3P4OB 1IAOB 4S2SA 4K7FA 1M1SA 2GUOB 3Q3GA 1A1OB 4PJ5D 4LLMB 1UZ6E 4NO2B 5K9JL 3G6AB 3AS3A 1MHEB 1CFSA 1KJ3L 4Z7WF 1FVCB 2Y9RT 3D25A 5IMLA 3EYVB 4E0RA 3QQ9C 5HDOA 3A67L 4NN6C 3BP6B 3INUH 4ONHB 1LO3H 1H9VA 5FYLL 2FEEL 3GSQA 4NNPH 1DLFH 4NKDA 1EA9C 2YD1A 4N0UB 1S3KL 3GEWB 2XZQL 3UTTB 5JW4M 4YK4B 1SYVA 1IBGL 4HLZG 5T1LD 1CN4A 4IHOA 2N1KA 3CMOH 3VG9C 2HJLA 5I1CH 1RZJL 1X9QA 1BLNB 3NCYP 3DVGB 5HTSA 3S96B 3S37L 4OUUA 1IEBA 1TQBC 3GGWA 4R90H 4RDQG 3GM8A 4PJBE 4MNQB 2RFXA 5IEKB 2B2XL 3CVIH 1E4XL 4HF5L 4LDLB 1JHKL 4FQIH 4WVRA 2O93L 4L8CA 3GMMA 1T22A 1Y18A 3M45A 1M71B 1ORSB 3AC0A 1U42A 3BIAX 3C5SA 5CBAA 1P6FA 3IDIA 4M61B 3QHZL 3TCLA 3NZHL 2CRZA 4YHPB 1PY4A 1QBMH 1QUNA 1JYNA 1QOKA 2RAMA 3S35H 4N8CH 2A83B 1LO0L 3BH8B 1AD0B 4G8FB 4QF1B 3DO7B 4KRPC 4P59H 8FABA 3EO0A 1I9EA 4HPOL 4FXLA 2FATL 1WSST 3A6BL 5C0IA 1XF4A 2P7TA 5M7QA 2VRAA 1FL5A 3QH3B 4JANB 1YECL 3QWQB 3U0WH 3TYGH 4EDXB 2FBOJ 4ODHH 5E4IA 1EVUA 1P4IH 2P24B 2OQJA 3DBXA 5IIEB 4PJFB 3UO1L 1CXEA 2D7TL 2IH3B 3PABB 5DR5H 4C56E 4P5KB 5HGBA 1CICB 4ORGB 5EO0B 2BK8A 2P49B 1N59A 1IEHA 3BN9D 4WFED 1T6VN 3MLUH 2EDRA 2Y5EA 1JL8A 2NW3A 3DSFL 3BAEL 4X4YA 5DVKA 1IGCH 5FECB 1DL7H 1JNHB 1P4BH 4FQXB 4HC1A 2DM4A 5DMIL 1K8DB 1Y6NR 1IL1A 4QXUL 3FOMB 3F7YA 1GYAA 4M4PA 1JFQL 4OF7A 2WV3A 1AR1D 5D2LF 3DRQA 4IMKA 4FP8L 1V8HA 3RHWK 5JQ6L 1AE6L 4NNXB 2F5BH 2EH7H 4DUXA 4TOYH 4M3KB 2FYYB 1MAML 2CLVB 3BHBA 4J8RB 5D2NA 3WFBL 2HN7A 1J18A 4UV4H 3STLA 1G7HB 1YA5A 3HG1A 1HOCA 2BHYA 4Z7WA 3IFLL 1VFBB 4Z0BH 3OAUL 4LLVA 1EX0A 5BS0D 2OTUA 5L8JB 4HSQA 4URTB 5C0DB 1N6VA 5IB5A 2BSSA 5GRJL 4JPVH 3QDGA 5CD3B 2NY2B 5E8EA 4ZUSB 3TVMC 5FGSA 4XI5D 1FYHB 4Q6IC 4I0PA 2CK0H 4PJAF 3VFSA 3DVFA 3PV6A 3CXHJ 3TBWB 4A6YL 3MV9A 4LCIL 1U8MB 4DUWA 3VCLB 5KVEL 5I8KH 2HTLC 2YOCA 4BJLA 2PETA 3U48A 2ORBL 4PLJD 1RZIA 2QV2A 4Z7VF 4P2RD 2VKWA 5E00B 5GGTL 1OHQA 3MV7B 1KF9B 2CJUL 1MHCA 2IQAB 1HKLL 1T04A 4NSKB 2EDFA 4QHMA 3SDCD 2J3SA 3OR6B 2PTVA 4Z9KB 2CLZB 4ELMB 2DWEA 5CP3A 2C3VB 2KQNA 3HNTL 1LK2B 1HZHL 3F65A 1A7NL 1A2YA 1HSBB 4WDIB 3JWDH 3S9DB 1WIUA 3KGRA 4JO3L 3G9VA 3FRUB 5ACZA 5E8OB 5DZLA 4PR5A 2B4CC 3KAAA 3AM8C 3KPRE 3KPSE 3DURB 1S9VB 1FO0H 4XCNA 1FZOA 4D9QE 3GKWL 1GC1H 1BIIA 1M7XA 3H7BB 2ZSVA 1AHWB 3QCTL 1QA9A 3V8CA 4NO3B 4ZAKC 1PDKA 3BE1L 1J1XH 3P0YL 4QRQA 3MLZL 1YPZB 3H3KA 4YXHH 4X99A 4X6CB 1NLBH 3MUJA 3TT3H 1X5HA 3OV6A 2EDEA 3H3PL 2GJ6D 5E5MB 3T0XA 1TCRB 4R3SA 3NABL 5F1IA 5T1MB 3DUSA 3HR5B 1U8HA 4G42B 3D1MC 2E9WA 5D2LA 5IP4A 2PXYA 4DN3H 1NGZB 3T2PA 4DGIL 1KXQE 2P5WD 2VO5A 1GAFL 4JPWH 3QUMH 3ZKNC 2BERA 5C0AB 2QHLA 5FM5O 3K8KA 4L4TA 1OTSD 3HN3A 1BBJA 2NTSP 5DDHA 1PLGH 3UTPD 4KWUA 1Q9LA 4MWFA 1CDBA 1W0WB 2BVEA 4LQFL 1PKQB 3MBEC 1FAKT 1F4XL 4LPWA 1MY5A 4ZDHB 4WU7B 1DFBL 1T5WA 3LEYL 2AEQH 3WFHA 5M94B 4PJAA 4M48L 3SPVA 3QEUA 4W4OC 5A2LH 4UT7H 3ZE1F 2C26A 1SVZA 2VZ1A 3MV01 5D72H 2AJSL 4KDWA 3NPSC 5SX4H 4R7DA 4Z7VA 3V0VB 3QFDA 5GS2D 2EE9A 3X3FL 1BFOA 4MAYB 4O02L 3OL2A 2UWEB 5ALBH 2AKRA 3Q1SL 1XFPA 1SJEB 5FO7B 4F7CB 1LEIB 5B3JF 2ZJSH 3C6SA 3LKRB 1FVEA 1KPUB 4Y16C 5J1AB 3IDNA 1YEHL 4KY1H 5IVXB 1J8HB 4JDTL 1MREL 3ELAT 4XWOD 3SDDA 3JTTB 1NUGA 4OFYA 5MP6H 5BV7L 5KVDL 4XMLL 3DETD 1KB5L 2XKSA 1KN2L 4M7ZC 4ODVL 1BJ8A 4MCZA 4A6YA 1VKXB 3ZYOA 1P7KB 1ROWA 3P4NB 4G5ZL 1DBKH 5JOPD 2E7LA 4LNRB 5I8OH 1XGQA 4WEBH 3GSOB 3GHBL 2YZ1A 3CFKA 3MJGX 3FB6A 1A22B 2DYPD 2V2XA 1UYWL 2NXZC 1GZQA 3GSRA 4IRSB 3I9GL 2JB5H 5D9SB 3VD9A 1B90A 4Y0GA 3NTCL 3HE6B 2MHAB 3BKJH 4E5XA 1R3JA 4KI5D 1HHKA 4MSWA 2UYLA 4UIMB 5D96B 1MHHB 4LPTA 5J13C 4OGAC 4PV9B 4G80A 1HXYA 4AH2A 5HHPB 4J3TA 5MEOA 4JFED 5T5NF 4WWKB 3DX8B 3NCEB 4Q7DA 1KIPB 4NC2B 2A73B 3JXAA 4EN3B 5CGYD 3N1QC 1AKJA 4XPFL 2CRMA 2FSEA 3NIDF 3VGHA 1TPXC 5EZIL 4C58B 3WFDH 4NKOA 2FWOB 3TA3B 3QIWD 1A7QL 3MCLL 2OR8A 5KVGH 3L3KB 4Q74A 3BPCB 3T08A 5E4EC 1A6VH 4RZCB 5EBGA 1P2CA 4GOSA 3G6AA 4HFUH 1IQWH 4O2FB 5CJXA 4PJIE 4EI5C 5TQ2L 1T7XA 4G8GA 3VG0L 2A9ML 3OJDB 4LARH 4ONHA 3VXQA 3VWJD 3L1OL 2H9GB 3QPXH 3ZDXF 5EOTA 3OB0K 2IH1B 3KHQA 3QJFB 4PJGE 3V52L 3QI9B 2A38A 5DFVD 1WFUA 1GRWA 4Z76B 4HIEB 3TPUB 5FYJL 5HJ3A 1KELH 5ALCL 1ZE3C 2O5YH 3HC0A 2OTWB 4OZFB 1BLNA 2HFGH 4E41A 5EOQL 5J8OA 3DVGA 1F6AB 2R69L 4ZUTA 3SQOL 2VH5L 4XCYB 3ZKMC 7CGTA 3C2AL 4OF0A 3O4OC 3BPOC 4QRUB 1F58L 4MJ2A 3WDJA 3WS3B 1DZBA 4EDWH 3QFJD 4N0YL 3VJ6B 5HYSA 2CUMA 1A9BB 4WW1B 3MRQB 4I5BA 2DM3A 3B9KA 3FB5B 2QHRH 2C7UA 5D6CA 1ZVSA 5BJTB 3RWGA 4U6YB 4LCWD 1KCKA 3SCMD 4OCWL 3DXAA 5GISL 1NDMB 1MPAH 1T5XA 4XNYH 1G7MB 3U9UA 4XBPA 3TWCH 3RY6A 1EJ6A 3BPLB 1AD0A 5GS1B 4X9HA 1U9KA 3HMWL 4IS6B 2O5XL 5CWSB 1J05A 2EDXA 3ARYA 4G9FE 4R6UA 2YRZA 1I9RL 1KB5A 3NFPB 3TYFA 3ARDB 5D1XC 3MRRA 1V3MA 3PQYB 2XWJA 4Z7NF 3H42L 4BZYA 2OJEB 2APXA 1P7QD 4HK3N 5LVEA 1UM4H 1MCDA 3FN0L 3HI5L 3ZDZF 1CICA 3I6KB 4NZJA 5I15L 1YNTB 4PP2A 3ARRA 2RCSL 1AQDA 2HA1A 4L1HA 1K3IA 1R3IL 3T0VA 4DKEH 5HY9B 2CR3A 2EC9U 3TZVC 4XNZC 1AGCB 2Z4QA 1H5BA 4U1IA 4NGHH 1HWHB 2X6MA 3M8OH 4UTBL 1NC2A 1GOFA 3RDTB 4E42A 5I74C 4YO0B 5E9DD 5TFSH 3CSPA 4RX4D 4TPRH 3ARBD 2R29H 5TE4H 4HWEL 3TN0D 1IGMH 4OLVH 3MROB 1RQ5A 2XKNB 4LOUC 1J7VR 3PGCB 4NNXA 3ZKXC 5F9OL 3GIVB 2UVFA 2VN4A 1CFNA 4NC1C 4Y1AA 1DQLH 4J8RA 3DHJA 1Z9LA 4G3YL 1ZEAL 2JJTC 3CAFA 4OBSA 3BP5B 5F96L 1LEGB 1QFWL 4U1JA 5KVFL 1ADQL 1CWVA 3NA9L 1LDSA 1ODAA 5GZOD 3Q5OA 5JR1H 4UV7H 2WWKT 4ZUSA 4MQXD 5IK3B 3TO4A 4QHUB 3EO9H 4TNVF 5E94B 1TETH 3BKMH 3IFNH 1RU9H 5JA9A 3PWLB 3CLEL 1MRDH 3LN9A 3FT2A 3T4YA 5DEZA 1EUUA 5HGHA 5SWZE 1GXEA 2MNUA 5IESH 5JMRA 1UH2A 4NN5C 2UWEF 1MHPL 1U41A 4OBRA 1F4HA 4YDKH 4OSUL 3O3DA 3OZ9H 5F89A 5DFTA 3V6OA 4LCCC 3D48R 5IV2A 2FIKA 5CLWA 4WI4A 5EC2B 3KPOA 4LAQH 4QNPF 1O0VA 1QFWM 5C0FB 1MIEH 4V1DE 5ISZB 4Q2ZB 3BUYB 3L9RB 3DHMA 1OTTC 4L29B 5D1ZC 2OK0L 5F88B 4JREB 3MOAL 1T1YA 1WF5A 2C3VA 2J1KA 5EZJB 5H94B 1FFOB 1IC7L 1HSBA 4WDIA 3GO1L 4IMLA 1EO5A 5CZXD 2CKNA 3GMNB 1RJZB 4NWTH 4WUUB 1D3CA 3ORJA 4QT5A 3KXFB 5GXBB 2DOCA 3KYOA 3HC4L 3AY4C 1D9KC 5IHLB 4KJQD 3ARWA 5IB2B 2M1KA 1UXWB 4S1RH 2Q86B 4AT6B 3GUTB 1JRHL 4I77H 3AREC 1JPFB 2IPKA 5FV2A 2GITA 3S88H 2BHUA 1DUYB 2MQ0A 1JHLL 1TCRA 4MJID 4OT1H 1RJLA 1FDLL 1FORL 3D3VB 1YN6B 5DRXB 3OKDA 5EO1B 2HTKC 4QOKE 1EMTH 3O2VH 3HR5A 3CGTA 4G6JH 5FYKD 3DROB 3FQXA 5DJYB 1OGAB 2MJWA 1U95B 1NGZA 4HPYL 3P0VL 4NRYB 2WZPD 4S10A 4OFVA 2APFA 5EUOA 5I8EB 2YN5A 1M7DB 1VEPA 1TCMA 1IAIM 2CUHA 4NDMA 3TNMB 5MERA 1ND0B 3MNZB 3RVVC 2QTEA 5D1QD 2R0WL 2V7HA 1CK0H 3I02A 4HK0B 2EC8A 3BGFB 3LQZA 4PTTB 5B8CB 3VFPA 3DRTB 1WT5C 3MRMA 5GGSY 1YY9C 3O9WD 4FABL 1P4LA 4ZDHA 4QHLB 3L3HB 1SEBA 5E8DH 5ITBH 3AB0C 3ULUD 1H3PH 1LEKA 3SO3B 2W0PA 1J0JA 2Z8WC 4KDTC 1EJOL 1FFNA 3TGXA 5GHWL 3GSNH 1YMHB 4TSAL 3V0VA 3D0LB 4PBVC 1IGFH 3LOWA 2XXCB 2CD0A 2UWEA 3N1MC 4FFWC 2DBLH 4YIQB 4KTEL 5SX5K 1KEML 4Z7OF 3UPAA 4LVHB 2JJUA 2PW2B 2HG5A 4OCLC 2G2RB 4MYWB 4ETQA 4LHUB 3CDYA 1OP5K 1MVUB 1ADQA 4JFDE 1NCBL 4MA7L 3LB6D 4Y2DA 5DI8B 1NMAL 5IWLC 4FTVE 1WWAX 3UYOD 1B2WH 2OSLA 3D9AH 2VXQL 1A02N 4NQDA 5K9KB 4K9EL 3QNYB 3RX7A 3SJVE 2VAAA 3BKYL 2A74B 2BHZA 4ZUUA 3NIFF 1HN1A 5HXMA 5F70A 1IC4H 2NNAB 4TTDC 1I7RB 5L0QC 1U92A 5DUPL 2UY6A 4ESKA 3QEQA 1L0YA 3PWVB 4PJHE 1PD6A 3G6JB 4FS0A 4G8EA 4KKNA 3IDXH 5E7FA 1M7IA 5F9WC 3GSOA 2QQNH 3LS4H 4NT6B 3QUYD 1TZGL 2GK0A 4J12A 2HMIC 2AP2A 5E08L 1BEYH 5IM7A 1LP9B 4NFBA 4X9IA 2FZ3A 4HS3B 1NCAH 4YBLB 1R24B 1BAFL 4LGSB 3RIFK 4NN6B 4TRPH 1B0GB 1BVLB 4PRIB 1SBSH 1JN6B 2B20A 2ICEB 32C2A 1EHXA 4MHHG 4EUPA 1NBZB 2ZCKL 4HJJL 2VLKB 4I3RL 3RWFB 4JFXA 1QR1B 2XTJB 3G04A 3T65A 4EVNB 1BGXL 2NX5D 3NN8B 4FZEL 1KCRH 4JPIB 4X4ZA 2Q3AA 1AC0A 3DX8A 2WBJB 5IBTL 1YEGH 4YE4H 3TT1H 1NEZA 4N9GB 3R1GL 3WSQH 1MFCL 1OAQL 4JHAL 4FQLH 4HKXB 4OV5A 5B39B 3IDJB 3TBSB 3I50L 1IKNA 3V4PH 4ZXBB 2XA8L 2YPLE 4X6DE 4EBQH 1A8JH 2BOCA 3U83A 1XMWA 3BYYA 3FAXA 1ZT7B 2FWOA 4NQCB 5HHME 4OIBA 1A7OL 1NEZG 1OQOA 1KENH 2ATKB 1XGUB 3PP4L 5GIRB 4DVRH 3FFCD 3DYMA 1FO0B 2UY7A 4GMTH 1JMXA 2ED8A 4PJEB 3RI5K 1OP3H 2E7MA 5ESAA 2EYSA 3GB7B 3WHE1 4NP4L 4KRPB 2W07A 1M6OB 3QDJE 2AS5M 4M62H 2H9GA 3ZKSD 4G6MH 3VXSB 2FECL 4R4BB 1ZLSH 3QJFA 5INCB 5BXFB 3QI9A 4JY6A 5JO5B 5I6XC 2I9LB 2LQRA 3IDYC 2PO6B 1DVFA 2X4UB 2RB8A 1S7UA 3NCJH 5D7JC 2CKBB 3P4MB 4FQHB 4Z7UA 4OZFA 1A6UH 3INUL 5E5UB 4Y4KB 2E6QA 2EKSA 1LO3L 2PTTA 3X12B 1DBMH 4JVPA 4QRUA 3IRPX 1A6AA 4R0LB 4NNPL 1DLFL 3G5YA 3BN9C 3SBWC 5HI3D 1AGFA 4HV8A 2OL3H 4Y19E 3STZB 12E8H 1BVZA 3QUMB 1CD1B 1T1ZA 4P4RA 4PGEA 2FB4H 3CMOL 4WNQA 2VWEC 1XGRA 5EBMB 5I1CL 4UNVA 2XY2A 3MR9B 3TBYA 2DWDA 3F58H 3P30H 5IHZB 4R90L 2IAMB 1KIQB 2RQ8A 3W5NA 3CVIL 1D5MA 1T83C 5HD8D 5DJ0A 4FQIL 3HE7D 5CHNA 3IETA 1LO5B 1S7TB 5DGRA 2GJZA 4G6KH 5CWSA 1U93B 2XFXB 3V4UH 3QCVH 1MI5E 2X9XA 2BVQB 3OB0H 5IBLD 4PRBA 4JJ5B 5J11C 4GG6E 4XGZB 3TVMB 3C5ZA 5BZDA 4PRHE 4JFQB 2I07A 4Q6IB 5HPMA 4XI5C 5GSVA 3QCUH 3S35L 4N8CL 1CYGA 4NHUA 5K9QI 3V9FA 4P59L 3PNWB 4AIOA 3EJJX 5IFHH 5A2KH 4JRYE 4PLJC 3RWHB 4X9BA 5C09E 2OZ4H 3QG6A 3U0WL 3TYGL 4ODHL 2P43B 1AGCA 1UADC 4I2XA 3QRGH 1P4IL 1NEUA 2P8MB 4LSSL 5DR5L 3BT2H 1MFDH 3T0EE 4J3OC 3VFTA 3F7VB 3SDCC 3KPPA 2CXGA 3MLUL 2DLFH 4ELKA 4G7VH 3MZTA 4X83A 1NGXB 5L2JA 2F53E 1IGCL 3VMOA 1DL7L 1P4BL 5F93C 3ARTA 3MNWA 3BIKB 1KLUA 1IM9B 3KR3H 35C8H 4G6FB 4GXUN 1CG9A 3OXRB 2C5DC 4PJ8A 1RD6A 2D7QA 1NL0H 1QZ1A 3EYQD 1WJ3A 1XR9A 4XC1H 3MRHB 2F5BL 2EH7L 2GI7A 1BZ9B 3MBXH 4TOYL 5DRWB 5JHLH 2HT3D 5I1LB 3CDFA 3A6CH 2AXFA 5TDNA 4YLQT 2DQFA 4UV4L 4ZPVA 1EIBA 5E6IA 1OLZA 2ZG3A 4U1MB 4GAYB 1QR4A 2MPAH 2AAVA 4Z0BL 2VERN 1A7RH 2CIIB 4QYOB 2BRQA 3HRPA 5GGSA 4X7SH 1ONQB 2NY4D 4JPVL 2ED9A 4P2QE 5KSVB 1TQCC 3E0GA 1EK3A 2DMCA 5FB8B 2CK0L 2J7LA 2VR9A 4XBGA 2VXTH 3QUXB 4U05A 3ROLB 4N0CD 4I48A 1QRNA 5I8KL 4X6FA 4AMKH 5BRZB 3WLBB 3T1FB 3VXRA 5F7HA 5T3ZE 1WZMA 1Q9WA 4QKXB 5F88A 4XAKD 1T0MA 2X4QB 5HVHC 4N1CA 2PR4H 1A6TA 3F8UB 5EH1A 4AY0A 5FKAB 5EZJA 5H94A 3UTSA 3RP1A 4JHBA 3IDMB 4FXKB 5KSAA 4F80A 3G6JF 5DSCB 4RFEB 1WV7T 3THMH 1I8KB 3S98A 1KJ2A 3QO0A 2O26U 1LP9F 1QBAA 1TZHB 3K0WA 5DJAB 4BFGA 5AYQA 2DQHH 3WJLA 2EDHA 3JWDL 4X98B 4OGYH 3UDWA 5C07B 2DQCH 3I6LE 1H3TA 4OZHB 3V5KA 3HNVH 1XZ0B 3O3EB 2K9UA 2PYED 3MRDB 1FO0L 3DPBA 4FRWA 2YD9A 1GC1L 4QRRA 1U8IA 4RSVA 4LVNC 1BJMA 1J1XL 1MCJA 4HUWB 3O41A 5JORA 1Z0MA 3N9GH 4YXHL 3PDGA 1OGAA 1NLBL 1U95A 3ZLQC 4NRYA 3TT3L 2NY0B 1Z5LB 3U36A 4XWOC 1RZ8B 2JJSC 1M7DA 3SGEI 4M7ZB 3DETC 2BOBA 5HHNA 1QPXA 1HXMB 5DK0B 2DJUA 3MNZA 4L9LC 1YYLH 1BQHA 4HK0A 3IAPA 5J12C 1FAIH 4OZIB 3VMPA 4DN3L 2AJZB 4JGMA 1NCDH 4PRPE 4HH8A 5JW5A 3T0DA 3O6FC 4PJEF 2XKUA 4LLYB 2FD6H 4JPWL 3QUML 4L8SA 5IGXH 3FT4A 4NBXB 3WL9A 4BZ2H 1TVDA 1I1AB 1PLGL 3FONB 3OGCA 2ED7A 3C8DA 2R15A 5C0CD 3KYMB 4KI5C 3D0LA 1BM3H 5IJVB 3LH2H 3BH9B 2L7UA 5ICXA 4ZO9A 5IMMB 3TESA 5F1OB 5FV1L 1QSEA 5GRXG 3RWJA 2AEQL 2V5YA 3BW9B 4OD2B 3LKQB 3I75B 5DA0B 3QYCA 2G2RA 3CDCA 1CE6B 3WFEH 5L2KD 4UT7L 3QG7H 5D72L 3D18A 1I7TA 3M17B 4L4VD 3QT2A 3VWKA 4GBXB 5CGYC 4CGTA 5ALBL 2DN7A 2NNAA 1QSFD 2FX9H 4P48A 2ZJSL 3SY0B 1BPVA 1BBDH 4PJXE 3OKOA 3G6JA 1ZGLP 4KY1L 5GS0C 1I1CA 4GRLD 4IOSD 4ZTOH 4NT6A 3T3ME 3BD4A 3LN5A 5MP6L 1KCUH 4P23D 1UJ3B 2C1OB 3MV8D 3SDAD 4HS3A 4N8VG 2ZNXA 5DO2D 3FO9B 2K3TA 5AD0B 1E4KA 3QQ3B 4JAMA 4ONOA 5E70A 1DBKL 3K7UA 3QIBA 9CGTA 4K55A 5I8OL 3MGOB 4WEBL 3HZMA 5ADPH 3VFNA 5CLTA 2AJYH 5SX5H 1U6AH 3MRIA 3D85B 2LU3A 4MDIB 4XHQA 5HGGS 2X4PB 2D31A 1JTTA 2JB5L 2ADFH 3HZYA 5GQBA 3U4AA 1YMMA 4QGTA 5HI5C 1YQVH 3FHQA 3BKJL 4LSRH 2V2TA 2WUCL 3DMMD 3BPOB 3O4OB 3MRLB 2D4DA 2Y23A 5B39A 5AUMB 5HSFA 3U0PB 4U1KB 1YQ2A 2BFVH 1WC7B 4YDLC 1B88A 3IKKA 3TPKA 3JUZA 1WUNT 1JF5A 1MAKA 1SMOA 5T1KD 2XN9A 4JLRB 3KLHD 1S9YB 1S5HA 1GGIH 1XGUA 1FO0A 5CZVH 4BK4A 3SCMC 1NANH 3D2UA 4UQ3A 1QYGH 2W59A 3G5ZB 1B3JA 3BWAB 3O6LH 3WFDL 3G5XB 3BZEB 3BRGC 1K3ZA 1S78C 2WINB 2D03H 4ODUB 5D2NE 4DZ8A 3RL2A 5I73B 5KVGL 4XCEA 4PLKD 2R1XA 3HG1E 1A6VL 1V7MH 2ZUQB 4WRLA 4HFUL 1IQWL 2DB8A 3P4MA 1TVHB 2NY3C 2ITCB 2F54E 4OLYH 5D7LA 3HLAA 4BSWB 4WI7A 2YR3A 5H37H 3U2SB 1ED3A 4LARL 3CCHB 3CPLA 4F9LA 3QPXL 1ZOXA 3B8YA 4K3GA 3MV9E 4ODWB 3W9DB 4WI9A 3TZVB 1MCKA 3STZA 4XNZB 3RTQB 4XPBH 4JZOA 4V2CB 3RNQA 3CDGA 1RMFL 2ZUXA 1KELL 2YA2A 2O5YL 4LEXH 5I74B 1BD2A 2HFGL 2XICA 4ZYKB 3HTLX 4X7TA 1H3VA 1CVSC 2LTQC 3P9WB 3VXMA 5F9JA 3TN0C 3ZKXB 5H35A 4EDWL 1KIQA 5TDPB 3TNNB 1F11A 1LVEA 4RMTA 5F8QC 5LG1A 4F7MA 4KI1A 3AXLA 1XF2B 2V9RA 3UTTD 2QHRL 4R26H 1VGEH 3E6HB 3VI3E 3R0MA 4XNMB 4JJ5A 4OFPA 1ITBB 5GZOC 2X89A 1T89C 1MPAL 5FGBC 2E6JA 2X4SA 4MQXC 4XNYL 5EU7E 1A9EB 2R23A 3Q5TA 1U91B 1OP9A 2IANB 4ISVA 3TWCL 3MYZA 4MNQD 1HI6A 4Y4HB 1I1FA 4OZHF 1ZHLB 5FYJU 3ESUF 3CFDA 1FPTH 3RWHA 4HGWA 5I1IH 4OFKA 3MCG1 4O58H 4L3AA 5DEFB 1T03H 1UM4L 3EZJB 1MRFH 1YZZA 1LE5B 1T3FB 3T77B 4YDIH 1JK8A 1UKSA 2EO1A 3BQUA 3F7VA 4QRTA 1CGWA 2HKHH 1NGXA 1KN4H 2W0KA 4NGHL 5FEBA 3M8OL 3ILPB 3RGVB 5E2UH 1IM9A 4C56B 4F57H 3B43A 5CZXC 4JVWA 5TFSL 4OZIF 4TPRL 1ZGLB 2R29L 5TE4L 1IGML 1H0DA 4OLVL 2W38A 1HK6A 4PRDB 4YEFA 4WUKH 2BVOB 1BZ9A 5DRWA 1IGJB 2G9HA 4KJQC 1U8LB 1ZWIB 2KBGA 1DQLL 2EH8H 4P0DA 1N5AB 1R5WA 1FNEB 3QXDB 3WEXA 5DHVB 3CH1B 4HUMB 4OJFH 4RNRB 3WHXB 2CDGA 3HPLB 4FQXD 5ESQA 5GJTH 1ORQB 5JR1L 1IKFH 3DTXB 4UV7L 4PB9H 4LMQI 4UBDC 3VXOA 5I66B 4JHWH 2OBGA 3EO9L 3ZT7A 3JV6B 1T7VA 1TETL 3BKML 4IIQB 3U7WH 3IFNL 1RU9L 4RRPA 3S3JA 1MRDL 3LEVH 3QQ4A 3V5DB 4I18B 4LSQH 2Z93B 4KKBD 2GFBA 1E4JA 4WJ5A 5HYQB 1RI8A 3NPZB 5IESL 1AO7A 3AS0A 1IC5H 4YDKL 4GO6B 4LIQE 2APVA 2M2DA 2NY2D 3MRKB 3HHRB 2CXKA 4MXQC 5KSBE 2CIKA 5D1QC 4YQXH 4PP1D 1MIEL 1B6DA 3KPTA 1MLBB 1VFAB 3MGTA 4JKLA 4WFEE 5I1HH 1JYXA 3FT3A 3O9WC 4O9HH 1H8SA 4LHJB 1JIBA 2WIMA 3MV7D 3AU1B 3FN9A 1FNLA 4M3JA 3ULUC 1X6NA 4OZHA 4NWTL 4AEIH 1PVHA 4HUVA 1XZ0A 2Q76A 5DYOA 1N4XH 2B4CH 3SE3C 4LEOA 2DICA 1TJGH 2OL3B 2R9HD 4L8DA 3TFKD 3TO2B 5F9AC 2D4FA 4G8IB 4S1RL 1WFOA 4XNUH 2VDQH 2W0FA 5DEGB 4LLDB 4I77L 2D3VA 5IG7B 4L8BB 5I2IB 3RHWF 1P6AB 5FYJD 4XBEH 3S88L 4Z7QE 3LB6C 5BS0E 3KPRB 2Z92A 1GZPB 4OT1L 4HKBA 2VLRB 4Y5YC 1VHPA 5DK0A 5FGCE 1JPGA 3NVQA 3QDME 3TJHD 3MLXH 4O5LH 5L0QB 4H26B 1KPRB 1T20A 4XP9H 1S7WB 1EMTL 3O2VL 4G6JL 4HZLA 1X5ZA 1EHNA 4G43B 1JGLH 2R2HB 4YH6A 4KJPD 5F9WB 5H2BB 4YHIA 3QUYC 1HEZB 2CO6B 4NCDA 5JZ7C 2NY5H 4LLYA 2KQMA 3IFOB 2J5LC 4PGZA 3T2OA 3IGAB 5E6ZA 2XQBH 4YHNB 1CK0L 1I1AA 3FONA 2CK2A 1R3HA 5I1AA 1FLRH 5MEQA 3FO1B 5T3XH 4YFLF 3FMGH 3GMRB 4PG2C 4GAFB 1T66C 5E8DL 5ITBL 4PJCF 1H3PL 5I1KH 4N0RA 5A16B 5C0AD 1QFUH 5HDQH 3P9LB 2X4OB 2UZXB 4MJ6A 3GSNL 2ZSWA 5DJCA 3CSBA 1IGYB 3QZWB 1IGFL 1UZ6F 2DBLL 1HHGB 5EA0H 4QCIB 4GW1A 2XWTB 4X7FC 4OM0H 5I30H 4PJ9C 3RKPA 3VFVB 5DUBB 5DD6B 2IADB 4YXKH 2NYYD 4X6EA 2BC4B 1B2WL 3D9AL 3MRFB 3QULB 3OAYK 5I9QB 1H3UA 1K8IB 2GJ6E 1BF2A 3VW3H 5LGJA 2G60H 1IC4L 2AEIT 1OTUC 1FZJB 4Z18A 1K2DB 3VGEA 4MAYD 3PL6C 4JJHA 1JZ7A 4PGDB 3CVHH 3IDXL 4JRXD 2QQNL 3LS4L 4PJBF 3IS1X 1G9MC 1II4E 2IPTL 1J8HD 4MNGA 4HK3J 5I18H 2P5WE 1NCAL 5D7JB 1KGCE 2Z31A 4NRXB 3PGDA 1MCWW 1NMCC 4TRPL 1IVLA 4MA8H 4DUVA 2J8OA 1SBSL 5CUSH 1NC4A 3BEVB 1FYTB 3U4EA 3IDGA 2QQKH 5AUMA 3OAZK 1I85A 1S7QB 1FGNH 5HI3C 4EIGB 3O6KH 3S36H 3DV6B 1AQKH 1UQSB 1KCRL 3MFFA 3U82B 5DD3H 2NMSA 1YEGL 4YE4L 3TT1L 4NQEB 1S9YA 1IARB 3RWCB 3WSQL 4IRSD 5F7WC 5AZEH 4E9LA 3CFJB 4POZD 4FQLL 2R1WA 1N64H 4YHZH 3HE6D 1CXHA 4ZTPH 3V4PL 4POUB 1RK1B 1V3KA 1WQVT 1OGTB 4B7LA 5I0ZA 4TYUA 2EICA 4OI9A 1HH9A 2AVGA 3RNKB 4EBQL 4GT7A 4CKVX 4HGMA 4PRAA 1KENL 5IBLC 4WWKD 4DVRL 1YC7A 1ZGLM 2B8OT 4LF3A 1X44A 4JG0H 1A1MB 4EN3D 4PJCA 4AG4H 1TNMA 1C1EH 1UA6H 1IC1A 3ISWA 4UT6H 5FM5M 1IRAY 1JWMA 3SGEH 5JOPE 4M62L 4A2LA 3QEHB 4G6ML 5T3ZH 4OCYH 1FNHA 3SGKA 2V7NB 3FQTB 1ZLSL 1CXKA 2AXGB 1G7QB 3TA3D 1JI1A 1L9MA 1MCRA 4N5ED 4J6RH 1N26A 3NCJL 4PJIB 3CLFH 1G7IB 2CRIA 2AQ2A 4TULH 5J9PA 1Z2KA 5DD1H 3QNZA 1A6UL 4WV1A 4ZYKA 1FNGB 2W60A 1JGDB 3FHAA 1KNOA 3X13A 3REVB 5IW1A 4AM0B 4GKSA 4PREA 3QNXB 1DBML 2COQA 4P3CH 3OKNB 2R0LH 4PJGB 1WTLA 4Q97A 5TDPA 1QBLH 5JIIA 2OL3L 12E8L 2V2WB 4GQ9H 4N1HB 4RWHA 1GVIA 1QNZH 1XF2A 2FB4L 1I3VA 2EDKA 1F5WA 1L9NA 4JFEE 5FCSH 5ETUA 3GSNA 4I8DA 3O6MH 2P8LB 3HKFA 2D7NA 3JSSA 4GKZA 3F58L 1HNFA 4PJBA 3EYQC 3P30L 5MEND 1FZMB 4O2CB 5EU5A 4OTXH 4LFHD 1OF2A 1IGIH 2HT3C 1CD9B 1PW3A 4LCYB 5C8JA 5JXEA 1RZKC 3FQRB 1EFXA 1EAPB 1BVKB 4Y4HA 4KXZH 3DGGB 4G6KL 1KFAH 3V4UL 3QCVL 4NQXB 5LBSH 5TGBB 5E2WH 4RIRB 1ZT4B 4P2OB 3EYUH 1TQCB 1ZHKB 4IMKC 3QCUL 2ICWB 4NO0B 4N0CC 1FC2D 1NGQH 3UTQB 3QWRA 3T04D 5IFHL 4F7EA 1GGBH 4G9FB 3WIFA 3MJ7B 1N0XH 3BJ91 4C83B 4Y5VC 5IKCA 2YA1A 2OZ4L 3WKMH 3MGAA 5IB4B 3RY5A 1W72B 3GDBA 3QRGL 3MO1A 4L4JA 2MCG1 3ARDD 5ESVB 3PQYD 5EUOE 4C56A 3O4LA 4P2CG 3Q6GH 3BT2L 4I0PC 1MFDL 3VE0A 4Y5XA 1ZGLA 4HLZH 1VGKB 4OQ1A 5L88H 4PRDA 2VLLA 3OF6A 1OM3H 2DLFL 1T4KB 4G7VL 4NO5B 3WUWB 1F3JB 3QFJE 3RUGA 3D69B 3NFNB 5LAXB 1GOHA 1ZSDA 4PGBA 3QXDA 1T1WA 4ZODA 4TVSa 5DA4A 4DCQA 3KR3L 35C8L 4U1NB 1T2JA 5SWQB 1NL0L 3RDTD 3C2SA 4XC1L 3DTXA 1BECA 1QEWB 2AV1A 5C92A 5IF0A 3B6SA 3MBXL 5JHLL 2J8UA 3A6CL 4WU5B 3JV6A 4D0BA 3WNOA 5D6DA 4X5XA 3KPLB 3K81A 5LKNA 4FXGB 2MPAL 4HBCH 4I18A 2ZOKB 5ICZB 4BQ6A 4PS4H 3ZHDA 1A7RL 2GCYA 4XTRC 2BZDA 3RJQB 2HT4C 3W9EA 4X7SL 1IAMA 1RZJC 4MD5A 5T33H 1CFVH 1JUFB 3LN4A 4KJYA 2VXTL 5D5MA 1R3KB 3OX8A 1A4KA 4NQDE 5CD5C 1KCVH 1A4JB 2HFFB 1Z6JT 2R2EA 4AMKL 5J12B 4BQCA 2EE3A 3X17A 3C8KB 5ANME 2PR4L 3BESR 4QXTA 3QEQE 3O6FB 4XNQA 3RPKA 1JZ2A 3VXUA 2FJFB 5LJYH 5LGKA 4ZUWA 1TZIB 5DQ9A 4V1DB 5E9DE 5DHXB 5CMAB 3THML 3QISA 3QIUA 4HS8H 1GIGH 4L3EA 4QTHB 2EYRA 2OL3A 4HEPG 3UTZA 2NLJA 4U6XA 4LKCB 5ISZD 1E0OB 1PZ5B 3QXAB 4ZFZA 1QSVA 2DQHL 2PXYC 2B5IC 2Y07H 5JLZB 4OGYL 1GPOH 3KPNA 2DQCL 2GAZB 1FQ9C 4UUJA 1FRGH 1E28B 2HLFD 3NZ8B 1IILE 3HNVL 1OARH 3KPSA 3O11A 1CF8H 3WD5H 4JM2B 2LE9A 4WUUD 3IT8D 5I71C 1AI1H 3KXFD 3QUZD 4KROB 2YS4A 2CDFB 1UG9A 4M7KH 4U1SA 4ZOAA 1E27A 3LKNB 1N5YH 2ENYA 1X4YA 5FHBH 1FE8H 2I27N 5JPNB 5EBWA 4DKFH 5HHQB 3N9GL 3PXHA 2R8SH 1U2CA 5CEYA 4P23C 5IR1A 4MCYA 3W82A 3GSXA 1YEDB 2H26B 5J4MA 5DO2C 3IGAA 5IEHB 4PGJA 2XACC 4QOKB 3SKNB 1YYLL 3L95A 2H6PA 4HX1A 5DQDH 1KIRB 3D3VD 1ACZA 3F5WB 4BH7B 3RA7H 1FAIL 3OKMB 3CMGA 1BQUA 4LDOB 2OZ4A 4M5ZH 1NCDL 2HFEA 2C3WA 3EDDA 1QO3B 4M9OA 4NZTH 2FD6L 3MJ6A 3BJLA 3SDDC 4DKDC 1WZLA 1VFMA 5IGXL 4BZ2L 5A16A 2OJZH 1VACA 4JDZB 5EC1A 1V5JA 3OKKB 2H2SC 4KPHH 1KTDA 4ZFFA 5FOBA 2MSPA 2A6DB 3ME0A 3SGDI 4ETYA 4MMZC 1BM3L 4ZQKA 3I6GA 3W0WB 2AK1H 4Z7UE 3T0AA 4PJIF 4K8RH 1OD7A 4QCIA 2XXMB 4YDLB 5A1AA 5DJDB 4KQ3H 3WFEL 4H5SA 2XZQH 2LU4A 4QRPE 1S7RB 2IADA 5CP3H 5HDBE 2EXWD 3KLHC 2BC4A 3QG7L 3QULA 2YA0A 4PJGF 5CKAA 4QHNA 1DP0A 1AGBA 4Q9CA 1UT9A 4HS6A 1KOAA 1NAMB 3EAKA 1KT2A 3TBTB 3S37H 2FX9L 4P4KA 2AJXH 2DS4A 4G9DA 1PZUB 4WY7H 3H9SB 1CD0A 1BBDL 1Q1JH 4JFDB 2RR3A 4KGJA 5EPMB 1G6VK 5FYKE 4ZTOL 4LHUD 4GXUM 5FO8A 1ZS8A 1MY7A 1RUKH 1KCUL 3PWPB 3SJVB 3VRIA 2PW1A 4PLKC 3CFEA 4KK6D 4EQ2A 1F90H 5DJ6A 1LD9B 3KS0H 4NRXA 1L7IH 3RRQA 2R0KH 4YGVA 5GGQH 4F8QA 3MRPB 1PGRB 1F3DJ 1EZVY 2ADIA 5TDOB 3VA2C 1NKOA 5ADPL 1WAAE 2AJYL 3U30C 1WBXB 1CGTA 1FG2B 1KTKE 1U6AL 5F6HJ 2X5PA 3D39B 4NZUH 4O4YH 3KNBB 1KB9K 2ADFL 4J3VA 5FK9A 4D3CH 2FHCA 1YQVL 5D8JH 1AJ7H 4LSRL 1R5IA 2JB6B 4U6HB 5CJXC 4HW6A 1MCCA 3OAYH 3QQ9D 5C1MB 3L3OB 4PRID 5C9KA 3O8XB 4BA8A 4MA1B 4RMQA 2OR7A 4IRJA 2BFVL 2VLKD 3VRJB 4HJGB 4NUJB 2ZCLH 4JRWA 2XTJD 5DRZA 5C08E 4YK4C 1A3QA 4H0IA 1GGIL 2WBJD 5CZVL 5DJ8B 2F15A 2NPLX 3HS0B 3FB8A 1QYGL 4X6DB 5DHYB 3SDYH 1LNUB 3EOTH 5CEZD 3O6LL 4NM4H 4ZXBD 3ROOA 3QUKA 5HHMB 2D03L 3GIZH 1XIWB 1FBIH 3OAZH 5FAAA 2ZOLB 3FQTA 3C6LB 3QJHA 3B9KC 4MD4A 4NQCD 1NBYA 1V7ML 1YUHA 5SWSB 4LIQH 3UBXI 1VEOA 3BGMA 5GZNC 4OLYL 5AAWA 3GSWB 4Y4FB 3WLWC 3QNXA 1MCQA 4XB8A 2I26N 1Q94A 4PJGA 4KRPD 3VFRB 2IBZY 1JWSB 1QRNE 2VUOA 4KHXH 1AXTH 3VXSD 3QQNA 1C12B 3VXRE 5BV7C 3MRGB 4XPBL 25C8H 2NX5E 1EERB 2PO6D 4LEXL 1RHHB 1RPQA 4ORZC 4Z5RB 2W65A 2JIXA 1TTFA 1DBJH 3UTSE 3FTGB 5DVOA 1WIPA 1AXSB 1WWCA 5L8KB 4KVNH 4AEHH 3DX6B 4M6MH 1FZMA 5JXAL 2EYTA 1UM5H 3P73A 4LLAA 4Y4KD 3V79C 3S4SA 1ZHBA 1L7TH 1CICC 3FQRA 4FOMA 1RJYB 1RY7B 3AROA 3VDBA 3EFFB 5D7KE 1KCLA 1UM6H 1U8NA 1VGEL 4R26L 3K8LA 4ZUVB 5ITFB 3DO3A 5TGBA 1QQDA 1H15A 3GMPA 5C0EA 1E4WH 3FFCE 3EFDH 5ID0B 5HHXL 2OMNA 3UJJH 1DN0A 1L0XA 4JFHD 1AXIB 4HHAB 3GMOA 3QO1B 2IAMD 2DRUA 5I16B 1B0RB 2R1YA 4U1GB 3ARGB 2VXUH 4JM2F 1FPTL 4GG6B 3RI5F 5JQHC 1CXIA 4ZPTB 3HAEA 4PRHB 5JUEH 3EO1A 5J6HB 4ZOBA 1KIUA 2XWBA 2LAAA 4O58L 1G7PB 2RJMA 5ESVA 3TVMD 1U8KB 3MJ8B 2NY2C 4FQPA 1T03L 3WHE0 3TO4C 1MRFL 4MA3B 4YDIL 4JRYB 3BXNA 1VGKA 3UYPA 4XNXH 1Q9KA 5C09B 2H3NB 4NO5A 4HKZB 2WMPA 2HKHL 2XNAA 3HAEG 5B38B 1KN4L 1AIFB 4UDTA 1WCBB 4C59B 5E2UL 4K7PX 3FOLB 1RURH 1RZFH 4F57L 1P84K 1EEYA 1R3LB 5HHOE 2X4NB 3VD5A 2X7LB 4M6AA 3V6OC 1VFUA 5ERWB 4YEEA 4WUKL 4U3HA 2P5EB 2WANA 2R9HC 1EH9A 4BFIA 2EH8L 2XQYG 4I4WA 3HCVB 1DUZB 3QPQC 4OJFL 2VLJA 2AJ3A 5F1NA 4WO4B 5CFHA 1Y0LA 4FA8A 5GJTL 3G5VA 1IQDA 4D0CB 1IM9D 1IKFL 4G6FD 4PB9L 1Z9MA 5D71H 4NKMA 2C1PB 4JFFB 4JHWL 1IGTB 1R3KA 5K59E 4LHUG 3LEVL 5E1AB 1QLEH 3PWNB 4LSQL 43C9A 5SWZA 2VISB 1WZKA 1ZA6B 4H0GA 1AHWC 2Z91A 4U1LB 2IFFH 5CP7A 4KJPC 3UXFA 2YRPA 4LASH 1NQBA 3BISA 1ZLUK 2DKUA 1EPFA 2GK2A 4MQTB 1ES0A 1IC5L 2Z8SA 3HNSH 4K71C 4MS8C 2X1XR 1OAUL 5BVPH 2H8PA 2FJFA 4OZGA 2OXHA 3IVKB 4OI7A 2O61B 1TZIA 2BY2A 4YQXL 4H1LB 2B1AH 3QUXD 3SKOA 2F8VA 4GLRH 4U6TA 4OUOA 1DQQA 2V6HA 3AFLA 2B1HL 2DMBA 5BRZD 5I1HL 4O9HL 4QRSA 2A6IB 4Z78A 1KPVB 3MOBL 3FQNA 4GRWE 4IDLA 3OBAA 4PJHF 2VLMD 3ARQA 4AEIL 1T2QH 1UYWH 5E6YA 5ILTH 2FEDD 1N4XL 2B4CL 1QACA 2W92A 1MCEA 1ZT1A 4PY8I 3O2WH 1TJGL 4JM4H 5EUKA 4XNUL 2VDQL 2CDFA 4UOW1 3FQWB 2DIJA 4O51B 3C9NA 3OB8A 4PJ9B 2CO7B 1QVOA 2G5BA 5DURB 4DAGH 5K9OA 1X5IA 1MCBA 4W6YB 4XBEL 1GH7A 5IBUB 2CLRA 2NYYC 1QPPA 2BNUB 4I3SH 5C0JA 5C07D 2VZSA 4NQVB 3RWEB 2QR0B 1VDGA 5CJ8A 1YEDA 2WNGA 2H26A 1B6UA 4O5LL 2GTWA 4MAYC 4B5EA 4XP9L 1KIRA 4BH7A 1JGLL 1BOGA 5F9DC 3L7FA 1MCHA 5F7KC 4JHZA 3AMLA 1WBYB 4UILH 2ARJQ 2BVUA 4TUJB 4OM1H 4XAKE 2VZ3A 2NY5L 4Y2DC 4X6DF 2NY0D 4DGVH 2BSRB 4OLUH 1I1YB 2XQBL 3R06B 5C7XH 2APBA 2P42B 4JDZA 1CD8A 3LVEA 2FL5B 4Q9RH 4JEGB 2ZCHH 3SDXE 1FLRL 5E8PA 4P5TB 5T3XL 5D7LE 3FMGL 5CBEB 4B50A 1EDQA 4U1HB 4CADA 1K4CA 2DI9A 4HT1H 2BMKB 1KLGA 3BSZH 2A6KB 4K2UH 5I1KL 1JWUA 3U7YH 1QFUL 3O3BA 5HDQL 4BKLB 3GBNH 4LBEB 1CFSB 4POZC 1YEFH 1D6VH 3D25B 4LP4A 4RFOH 5IMLB 3HE6C 4CMHC 1BD2E 3TBTA 1NFDE 5EA0L 2D0FA 3DJ9A 1KBGH 4OM0L 4X5WA 3VXME 5I30L 4OGAD 1H8OA 2ESVD 4JFDA 4NKDB 4FHBD 4KRLB 2BNRA 1U36A 2YZ8A 4FTVA 4KTDH 2VZTA 4YXKL 1SYVB 4GKNA 5EPMA 4LL9A 2M8XA 3LMJH 1LO4L 3SJVA 4J3SA 1HCVA 3VW3L 3I85A 1INQA 2G60L 3IJYA 1SYSB 4OUUB 5GISH 1IEBB 5HBBA 3GGWB 4GBXD 4PJXB 1IKNC 3UPRA 4PJHA 3CVHL 5TDOA 3RBSA 4L8CB 1FL3B 1T22B 2MCPH 1WBXA 4KK5C 1CVRA 3O3AB 4NUGH 5B21A 3TA3C 1CQYA 4CDHA 1NCNA 1Y18B 2NXYB 5I18L 3C5SB 5CBAB 3IDIB 3TCLB 4M8VA 3QEGH 2IPUK 1PSKH 5CAYB 4MA8L 4GG6F 4GW5A 5CUSL 3RZCA 4PRNB 2QQKL 5C0CE 1CFTA 3EO0B 1FGNL 5I15H 3O6KL 3S36L 1AQKL 3CFIC 5C0IB 1XF4B 2P7TB 4HJGA 5DD3L 1FL5B 5J56B 3QI9C 5I8CB 3D85D 4OLZH 2FEEI 5FXCH 1J8KA 1X4XA 2G5RA 5AZEL 3BMWA 1YDPB 2OQJB 3DBXB 1N64L 4YHZL 4ZTPL 3ZKMD 4DEPB 1FVDA 2EO9A 2YPLA 3J8F7 3MRCA 3VFOA 5HGBB 3ZHLA 5HYFA 1PG7H 4ZAKA 1QSFE 3FCTA 2NW3B 4ZSOE 1MCWM 3BPNB 4X4YB 4ZO6A 3C6LA 1GGCH 1IL1B 4WW2B 1E4XI 3F7YB 4K94H 1YNKH 5D7IA 1ADQH 5EIIA 3DRQB 3MV8E 4JG0L 5DUMH 2A1WH 4AG4L 1C1EL 3QDJA 1UA6L 1ZVHA 5TQ0H 1UCTA 4UT6L 4Y4FA 4PUBL 3BHBB 5D2NB 4XP1H 3STLB 2Y72A 5T3ZL 3B2VH 4OLEA 1A6PA 3DECA 1WEJH 3HG1B 1HOCB 4Z7WB 1UWGH 1DSFH 4J6RL 4LLVB 2OTUB 1HINH 2NR6C 3CLFL 4PTUB 4K9EC 5IB5B 2BSSB 3ZE2E 3B9EA 3QDGB 3NCCB 4TULL 1FFPA 4YHOH 5DD1L 1AO7E 4I0PB 3MMEA 5CJQH 3VFSB 3PV6B 2YD3A 2AK4A 4P3CL 2DLEA 3MV9B 3QA3A 2R0LL 3MBEA 1S7SA 4JGJA 2VL4A 4Y19A 1QBLL 5K9QG 1OAYH 4GQ9L 1RZIB 3H3BC 3EFFA 1QNZL 3DUHA 4OZ4B 2YXMA 3TZVD 5LXGH 3SGDH 2MQ3A 3RTQD 1OB1B 1MFAH 5ITFA 4LVEA 1IC7H 1MHCB 3O6ML 4S1DD 4HUKB 3P4LA 2RBLA 3RDTC 4UINH 1T04B 1RK0A 4N0FA 4OTXL 1DEEA 3WNKA 1IGIL 2JKXA 4JB9H 4QHMB 2VDKH 2IMNA 4Y16A 5F6IB 2P1YA 1IAIH 2DWEB 4GG8A 2J2ZA 1U3ZA 1MI5A 1KFAL 5CKGA 5LBSL 1R6VA 3VGFA 1LGVA 1MFBH 1A2YB 5A3IC 5E2WL 3QSKB 2NY1C 3DOSA 5ACZB 3EYUL 5IROA 1JPTH 2KKQA 5J6HA 3TIDB 4PR5B 5ID1A 5EBLA 4ZFGH 3N1PC 1U8KA 5FO9A 4AEEA 4XCNB 3CVHA 1CFBA 3I2CH 1FZOB 1NGQL 4AEFA 1FORH 2IAND 2G75A 1BIIB 4JRYA 1GGBL 2HRPL 2ZSVB 1QA9B 5I1DA 5ICYA 5E6IC 2BXYA 3E3QE 5C09A 5F7MC 3MUHL 1A6ZA 2CQVA 2FJHA 1CQKA 1IFHH 5IQ9A 4QRQB 3WKML 1HHHA 3MPCA 4X99B 3VI4E 4J3UA 5EZLA 3GJEA 2HRLA 3IXAB 3SKUD 3FKUS 1NMBH 3WN5B 3T0EA 3QP3A 3Q6GL 4ACPA 4R3SB 5F1IB 5L88L 5DMKA 1OM3L 3ZYZA 3DUSB 1B9ZA 4CVUA 1U8HB 2F53A 1OTTD 3MA9H 2QQLH 2VR4A 3B5TA 2PXYB 4P46B 2EC9T 1CS6A 4WEMB 1B0WA 4JVUA 1BREA 4N0UE 4LPCA 3UTTE 2PTUA 3RGVD 4XP6H 1BZQK 3OR7B 4L4TB 5KSAC 1BBJB 1DLHB 1HHIA 5DDHB 3CSGA 5E5RB 4CMMB 1ULVA 3LY6A 4ZOEA 1IGTA 4MWFB 4YHYC 5MHSD 1TLKA 4GS7C 4M1GH 5E1AA 4MNQE 4HBCL 1TDQA 4PS4L 1T5WB 3WFHB 3GNMH 4PJAB 4UQ2A 5B4MD 5FYKH 3SPVB 4P2QA 1UH4A 2XPGA 3QEUB 1I3RA 5T33L 1CFVL 4RDQF 1X5KA 4EI5A 4R7DB 4PBWD 4XRCA 2UVEA 3QFDB 1MAJA 15C8H 1BFOB 4KMLB 1CDYA 1KCVL 3QXVA 4F37F 2AKRB 1SHMA 3NA4A 3NMEA 5DUPH 4NQUA 2HTKD 3C6SB 1FVEB 4TTGA 4X4MA 1L6XA 3IDNB 1I8LA 1AH1A 4PJXF 2WLYA 5KSBB 4GRMA 3ARUA 5JDJA 1H3GA 4MNGE 4J7RA 2CMRH 2GSGA 1HH6A 5DF0A 3GI9H 3T3MF 4MCZB 4A6YB 3MJ9A 5JNYA 4LU5H 4HS8L 2OLDA 1GIGL 4Y89A 1SY6H 1XGQB 2C4FT 3BGFC 1ZKAA 2VIRA 1RUQH 1V7NH 4O51A 4X7DC 2Y07L 4MZ2A 4I3RH 4F33B 1GPOL 3CFKB 3VRLE 1FRGL 2NCMA 3VXTA 1A7PH 3F6IA 2V2XB 2EXWC 1OARL 1GZQB 4MQSB 1ZLUH 1CF8L 3SO3C 5BVJA 4KGLA 1AI1L 2XY1A 4X8JA 4MSWB 2UYLB 1MCFA 4CUCA 3ARFB 2FR4A 4M7KL 1N5YL 3RAJH 5FHBL 4G80B 1HXYB 3O2DH 3UAJD 4DKFL 4AH2B 1WBYA 4HXAH 1CL7H 2AI0H 2XTLA 2YHGA 5MEOB 2R8SL 3WFCH 4POYA 2AW2A 2ZZUT 2GT9A 1YNLH 3KPRD 5FGCB 3EOAA 3QDMB 3PP4H 2DQTH 3W11D 3V2AR 4BZ1H 4D9QD 2VLRD 1AKJB 5DQDL 1A1NA 3TH2T 3RA7L 2OYPA 2FSEB 5EU6A 4WW2F 4PRPA 3NACH 4LSPH 4YAQA 4M5ZL 4NKOB 1XAUA 4IDJH 4NZTL 3RIAK 4K3DH 4DVBA 5D4QA 1F4WH 4TUOB 4WTWA 5D70H 2HMID 4YHMH 2YK1H 3EOBA 3RPIA 2OJZL 1P2CB 4C54A 4BKLA 1PBYA 4KPHL 4YBLC 1Z9SA 4LBEA 1TTGA 3G6DH 1E4KC 5E8NB 3VH8G 2PNDA 2GHWB 1JYWA 4G8GB 1MCOH 2AK1L 1CIUA 1EHAA 3QIBC 4OF8A 3VXQB 4K8RL 1DBAH 5EOTB 2FHBA 2H2PD 4KQ3L 4ELME 1HYSD 4XMKH 1KJ2H 2QJDA 1KJVA 2XTJC 4MMXC 6FABH 3TBVA 5HJ3B 4NPYB 1R5VA 3IKCA 3BX7C 2WBJC 3HC0B 4E41B 4ZUTB 3P11H 5JTWA 1SYSA 1LILA 2AJXL 4PJXA 5FOJA 4U3XA 4WY7L 2HJFA 1Q1JL 4I9WE 5HYSB 5MI0C 4ZXBC 2KL6A 5C9JB 3GSVA 4I5BB 4U49A 1G6RH 3B9KB 1FL3A 1RUKL 2C7UB 3O3AA 2H32H 5D6CB 4ZNEE 1ZVSB 1YPZE 3LKSA 3RWGB 4PJDE 4X6CE 5TF0A 3PHQB 1HKFA 3OWEA 3DXAB 3PIQA 1F90L 4Y8AA 3EOYG 3VI3F 1L7IL 2ID5A 2R0KL 1T5XB 5GGQL 1V05A 3DX9B 3U9UB 4XBPB 4B41A 1KULA 4PRNA 3TV3H 1J05B 3R4DA 4BFEA 3RJDA 4NZUL 5BV7B 1WWWX 4O4YL 1KB5B 3OMZA 4D3CL 5I8CA 3TYFB 2PO6C 1HWGB 1NPUA 3MRRB 3N0PB 2L0DA 2XWJB 3PWJB 5D8JL 5D7JD 1AJ7L 1LK3H 4YBHA 5C0AE 1JI2A 1YDPA 2JF1A 3AY4A 4CJ1A 4LSSH 4RQQA 3O4LE 2QLVB 2VXVH 4X4XA 1FYTD 4Y4KC 4NKIH 4PP2B 1AQDB 3AREA 2YBRB 4KK8C 4R0LC 2O5ZH 1NUDA 5CJBA 2ZCLL 4ODXA 3T2NH 2IQ9H 1IEAA 2N56A 2NZ9D 4KRMB 3EKCA 3RUGE 1D5ZA 2Z4QB 1H5BB 4U1IB 2ADGA 1NC2B 2MKWA 4WW2A 4NQED 4E42B 3BP7A 3VFWA 5EU4A 2V5MA 1XGYH 5C2BH 1VERA 3SDYL 3MXVH 4WI5A 2IAMC 3CC5A 3QDAA 1CFNB 3EOTL 4Y1AB 4NM4L 4Y7MA 2J8UE 1DE4A 3GIZL 3CXDH 5DWUH 1FBIL 4ZS6C 4JRXE 3OKYA 4U1JB 5IVXE 5HDLA 1J8HE 4LIQL 3TEUA 4PTUA 3DUUA 1A14H 2F54A 3SE8H 3MNVA 2NTFA 3JVGA 1F45A 3S97C 3UJIL 3TO4B 1ETZA 4UMGA 5D5ME 4RWYH 3KS0J 3FT2B 3T4YB 4KHXL 2BX5A 1AXTL 1DBBH 5HGHB 4CNIA 4OZ4A 4HIXH 4GRWH 5L7XH 3KJ4B 25C8L 1OB1A 2YC1A 3L3GB 3O3DB 2NW2B 1DBJL 5F89B 2X70A 5C0BA 3L3DA 2WQRA 2ARJA 4KVNL 4AEHL 3VXUE 5IV2B 2FIKB 4M6ML 1T21A 5IVNA 3KPOB 1UM5L 2HH0H 2BNQA 3E6FA 1L7TL 5CILH 5KSBF 5CIPH 1S9WA 1T1YB 4L3EE 4TSBH 4YWGH 4ALAH 1JCKA 1UM6L 3FL7A 5IWLA 1I7ZA 1CE1H 4JN2A 3UPCA 4JO4H 3OKLB 3K4DA 1C7SA 4IMLB 1E4WL 1WIOA 3TIDA 3EFDL 4QT5B 3UJJL 3K2MC 3KYOB 1UKTA 1QFWI 5HYIA 5ACMA 1FFQA 1KJMA 1QBBA 4NWUH 4RMVA 2VXUL 1RV6X 3E1F1 3QIWB 2HYMA 5KS9F 3IB4A 2IPKB 4FQ2H 1W0VA 1MQKH 1JGVH 2GITB 5JU