4P5KA

Structural basis of chronic beryllium disease: bridging the gap between allergy and autoimmunity
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
181
structure length
181
Chain Sequence
IKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 181
sequence length 181
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p5kA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p5kA01
1J10A 1S9XA 3EYOA 4JZNB 3RWJB 3LKNB 4BSWA 2XTJC 5CP3A 2VQ1A 4CBPA 1KCVH 2WUBL 3FQUA 2K7QA 1QR1B 4DTGL 3BMWA 2EDQA 4GAFB 5JUEL 1ZA3A 3DRTA 1ADQL 2NYYC 3I6KB 4LAQH 3V52H 5D72L 4P2OD 4G5ZL 3V0VB 3S4SB 3ARBA 3C60D 1A6VH 1LDSA 4L4VD 4ZUWA 2IAMC 1WZKA 4F7EA 4NZUH 4KXZH 5MI0C 4PJ5A 1P5UA 3EOAB 4Z7UF 4WW2B 5FHAL 1CDUA 2WM0A 4OAWB 1BBDH 4BFIB 1IC5H 1HH9A 3EO0A 1N7MH 4TSCH 1UM4H 1ZWIB 2AK4B 3H0TB 4KJWC 2XNAB 5E6ID 1O7SA 3DX9A 3NH7L 3QXAA 3T1WA 1RZIB 2DIAA 3BP7A 2YHGA 4BQ9A 1X5YA 2PO6D 4BYHA 4DKAA 1LO2H 4Q9BA 3ZDYF 1NSNH 4UQ2A 3QAZC 1QZ1A 4OIIH 4XP4L 4WGVB 3GMMB 3NZHH 3VI3F 3DXAA 1J1OL 2V9RA 1HNFA 3BN9C 1GZPB 3TA3C 5E5RB 2OI9C 1JYNA 4PJGA 4YHMH 3F7RA 4FQ1L 4MD5A 4NFCA 5FECB 3W39B 3RI5F 2VE6A 1BZQK 1KN4H 2DIBA 1ED3B 4Z7QE 5ALCH 1GGCH 3T1FB 1MJJB 5T1LD 4U6TA 3QQ9D 1UYWH 5E00B 3VD5A 5HVFB 3BP6B 2GSIB 2NW3A 3B9AA 3IAQA 1RY7B 1SJVA 2A1WH 3WNOA 3LV3A 1GAFL 5I1GH 5A40E 3CUPA 3L7EA 3UTSD 1J8HD 4PJBE 1S9YA 4HWBA 3DHMA 4ESKA 1DEDA 1LK3L 3WS6C 1PSKL 3H9YA 4YDLB 1A6PA 4IS6B 4U1JB 4Z76A 4OCXH 4XNZB 1G7LA 1R5IA 2I5YH 1GOHA 4RAUB 3AFLA 3MR9A 1QSEE 2ICEB 2Q7YB 2GCYB 4OFIA 4AENB 4JZJC 3GEWB 5DQJA 2WWKT 4DCQA 3TO4C 1P7KB 3WFCH 3CAFA 3FRUA 2CGRL 2RQ8A 1FFPA 4MYWB 3DGGA 4WW1B 5CD5C 5FV1L 1GIGH 3FJTA 3WHE1 4KUCF 5J3HC 1I3GL 3PGFL 4JR9L 3BGFC 4JN1H 3FB6A 1DQML 3GMRA 4X6FA 4XAKD 1INQB 5C07B 5BRZA 2Q86A 4G9FA 2BSRA 1IEAB 3KXFD 1F58L 3MV7D 5KBNC 5L88L 1TQBC 4J6RL 3F5WA 2RFXA 1K4CA 1OF2A 1Q1JH 1RIHL 1MHPH 2SEBB 5LGJA 4LLMB 4Y5XB 2VXTH 5GS0H 2BY0A 5T1MB 4Y16D 4MAUL 4WEBH 4F57H 3WKNA 3WS3A 1A0QL 2G2RB 5KZCD 4Z18A 4OD3L 1U36A 2VLLB 2FR4A 3V6OA 4P4KD 4G9DB 2ITCB 3RTQB 3MRIA 3FN3A 5ABDE 5ETUB 4TVPL 2AEIT 3RUGE 5D6CA 1P6FA 5K9KA 4U6HA 5E8EA 3KPOB 2A38A 4MA8H 2DQTH 2VYRE 4PPTA 1PEZA 4XWOD 2VL5B 4LDLB 5A2JH 2Y9RT 3O6FC 2Y36L 3G08B 1LDPL 3MV01 3B2UC 4EQ2A 3QHFH 1KJMB 3RA7L 3UYOD 3WE6A 5CAYB 1UJ3A 1NL0L 4DGVL 2IANE 5L2KA 5L8JB 1U3HB 4JRWA 4B5EA 1CG9B 3SOBH 1WAAF 2FO4B 4Z7VB 3QG6B 2P8LB 4HS6B 4BZ2L 2C1PA 3MJ9L 5HI4C 4ODUA 1NAMA 3AS0A 4PFEA 5FKPA 5CIPB 4LPCA 3RX5A 3HRZA 2XYCA 3FO0H 2J2ZA 3QNZB 3PWUB 3U48A 4NQEB 4JFEE 1ETZB 4PJXA 5E95B 3HPLB 5D70H 3V7MA 4X6EB 1U8QA 1L0XA 2ZKHH 3VE0B 4PR5B 2WBKA 4Y5YA 3MCKB 3UTQA 1IGCL 1ORSA 4NNYB 3ROOA 3U9PL 1E6OL 1AI1L 2NTSP 2XG5A 5E99H 4WV1B 5IR1B 3WSQL 2EC9U 1F97A 5MP6L 2QQQA 4PRBB 1I7UB 1VFAB 1MQKL 3RWDA 2R0LH 5KSBB 3SGJA 1EEUA 2A83A 2IQ9L 2Y5TA 3MRNA 3CSPA 5TE4H 4YHYC 2VZ3A 5CEZL 4Q6IA 1QFWM 2BXYA 5C2BL 4KJQD 4EIZC 2VABA 4LOUC 3EO9H 1DVFA 4FG6C 4HWUA 2YK1H 3MLUL 3VXUE 4M02A 4MCYB 2VNCA 4GOSA 32C2B 1GVIA 5D2NB 4PJ9D 4TTDC 4BH7B 4F7CA 1A1NB 1FVDA 3HKFA 1HQ4B 3STLB 4KQ3H 3RGHA 4L8CB 4XCYB 2J6EA 4GLRH 4RDQF 5DA4A 3B9KB 4PGEB 2DD8H 4WU7A 3GBLA 4FXKB 4HLZH 3BD5A 2P44B 2F74A 1IZKA 4WENB 4QRTA 4CJ1A 1FZJB 3TVMC 1TFHA 1YY8B 1W72L 4KWUA 3QIUC 1S9VA 1V3LA 4ZS6D 2ARJA 1EEZA 2VWEE 1OTUC 1UKTA 4N0UE 4J7RA 4X9BA 3ULSA 3LOWA 4JRYE 5IW6B 3L3GA 3MREB 3VCLB 1A7RH 2D7TL 1YEEH 4XB8A 4OM0H 5BQ7A 1FE8L 5JHDB 1BD2A 2ATKA 4PBWD 4WFHE 1TZGH 2VDRL 3RWEB 5HGBA 4ZSOA 5I75C 2FJFB 2CXGA 3P0VL 4CVZA 1QLFA 3BKMH 1JK8B 1FZOA 4P4RA 3TV3H 3O6KH 4OZIA 3O2DH 2DTMH 5GGRA 4OI9A 5B4MC 1KOAA 4OIBA 4OFVA 1X5IA 3V2AR 1L9NA 3FO1A 4UIMA 2JIXA 4GAGH 4HHAA 5IROA 2EDHA 3LAFA 3PP4L 3E1F1 5CJQH 5CJXC 4XC3H 4OCSH 3T77A 3ZT6A 3RZCA 1CE1H 4LCWE 3QH3B 1VACB 3HC3L 3QIWD 1SJEB 1TENA 5C0BE 5ACZB 4XVTH 1M71A 1U8JB 5DC9B 5T5NF 3DSNA 3I50L 5EIQA 5HGAB 2D7OA 1GHFL 1OGTA 1EMTL 1E4WH 2X41A 2Q6WB 3BRGC 1JYVA 4S1SH 3L3KB 5C0GA 3QXDA 3RFZC 1J5OL 3EZ8A 5IMMB 3VH8G 2JJSA 4LPWA 2GY5A 3ARGA 1VKXA 2WZPD 3MA7B 3WJLC 1RUMH 2FX7H 4LHJB 2Z92A 1I1RA 1Q0YL 4X5XB 1Y6KR 4ZUTB 5IFJA 1PVHA 2R0ZL 4PG9B 3FT3A 2HMIC 3K81A 2D2OA 3GMNA 1OCWH 1HHJA 3MV9A 4JANA 3X17A 1HXMB 2YBRB 5EIVA 5HHNA 3CVHA 1BMGA 2AV7A 3QEGH 4OGAC 2NXYB 4PJDE 4F3FB 4RFEA 5J12B 1JZ8A 5C0ND 5I8CB 4ELMB 1K6QL 4C56B 3EYUH 3LSOB 4ZOAA 3TLRA 1W72B 4ZAKC 1ORQA 1INEL 1KELH 3CVIH 2NY0C 3THMH 4ETYA 1CDGA 3IJSA 4X9FA 3MROB 3MV8B 4OZHE 2XA8H 5I1AA 5FK9A 1E6JL 2Z4QA 3BRDA 3TN0D 1Q8MA 4MD4B 1JUFB 5DEFB 1I1AA 1JNJA 5DUBA 3V4VL 1DN0B 4Y88A 1GPOL 4BQ8A 1I8MA 4WI2A 3HR6A 4MJ5A 4M7LL 5FDWB 5FKAA 1S7TB 1CDJA 1CFNA 1SQ2N 4PJFA 1DQJB 5KSVA 4BSWB 4TNVK 4K71C 1AP2A 3DHJA 3A67H 2IAND 3FFDB 4HJGA 3QO1A 1QFUH 4RMSA 3WIFA 1YN7A 4P2RE 2ADGB 2W60A 2HJLB 2G60L 4V2CB 3U7YH 1P84J 1AGDA 4APQA 4RMWA 3LN5A 3D85D 1C5CH 1HINH 4WO4C 3U30C 3VWJA 1QACA 1WBXB 2WBJD 4RX4D 4M8QB 1CXIA 4DN3H 1LEGB 4JFED 1WICA 2ARJQ 3EYVA 4HUNB 4BH8B 3D1MC 1ACYH 3K7UA 4LAQL 4HX1B 5E4EC 3V52L 4PTTA 1HNGA 2WQRA 3VXQB 1A6VL 4XC1H 1MI5B 3S9DB 5EDXA 4NZUL 3ARDA 3O3AA 1ZKAA 4Z7UA 5D96B 4NQDE 1T5WA 1YNKH 4JDTH 3KG5A 1BBDL 3PHQA 2B2XH 4OF8A 4J3UA 1IC5L 2ZG1A 3QI9B 5IWLC 2GY7B 1N7ML 2YR3A 4TSCL 1P4BL 1UM4L 4JQVC 4CN1A 3MUHL 4MAYA 1S7VB 2AJZA 4GBXD 3QDJB 4YUEH 2D7NA 5JW4N 4MNQB 5CUSL 2PUQT 3VXNA 3VXUD 4U1NB 1L7TL 2OZ4H 4XH2B 5FGRA 4PJCF 5EZOL 1A7NH 1NKRA 3QDMB 1WT5C 3SDCD 1NSNL 1DEEB 3PDOA 3PDDA 3TT1H 2UWEE 1G7IB 4OIIL 4KK9C 4DGYH 2X09A 1AKJD 3V6BR 1F5WA 4IOFD 4HXAH 3DRQA 3WIIH 1M7XA 2OXGA 3MO1B 2Z31B 4YHML 4MXWH 5D1ZA 3H8NA 5EU3B 4WI7A 1YEDA 5IBTH 4OCWH 3X14B 4U3HA 1A6AA 1JGUH 3X11B 5HHOB 4NO3A 3L6FB 2BNRD 4JRYD 1KN4L 4XNYH 4NQUA 5DUPH 5ALCL 1GGCL 4FMKA 1MCOH 4JCMA 1HHKB 1MCKA 2X1QA 1UYWL 4PJ8B 4WFHD 4KKCD 4S1QH 5KJRH 3VXMA 1JL8A 4K94C 3AXLA 4OZFA 1Q9OB 3UBXB 5CGYC 2A6JB 3ZKXB 2F53E 4LCYA 4LLQA 5I1GL 3MR9B 1IGIH 4ETQB 1RULH 1HOCA 1ZA6B 5D5MA 4U6VH 3BP5B 5DGQA 3MZGB 2WANA 4LCWD 4PJIF 3UP1A 5BJTA 2J5LB 4J3XA 4DVRL 4IOIB 3MLVL 5C0BD 3QUZA 5FO9B 1C5BH 1DBMH 5EFIA 4OCXL 4FTVE 3N1MC 2I5YL 5F88A 5KSAC 5F3HA 3C5JB 5TGBB 2WV3A 1KG0B 4RAVB 1MCDA 2C9AA 3MFFB 3SJVE 1IAII 4G7YH 3WFCL 1NQBA 1IVLA 1FNFA 1F00I 3F5WB 4UQ3B 4Z0BH 2D4DA 3QRGL 1B90A 2AK1H 2BOBB 3WNMA 2ZCHH 1J05A 2FGWL 3PJSB 2X4NA 4GXVH 1YEGH 4L3CB 2Y72A 3MCG1 5ANMB 5BZWB 4YX2H 3P4OB 1RURH 3FB8B 2P24A 4HT1H 3O3EA 1OTTD 4FXGB 4W6YB 1J0IA 2OP4H 1MHPL 5E5UB 4LLYB 2VXTL 3E3QE 5GS0L 2DL9A 2A0LD 4F57L 4U6YB 4WEBL 1MUJB 2JCCB 2GK0A 2FL5B 4J8RA 4I4WB 3GHBL 3IDXH 1DLFH 4Y7MA 4MNGE 2P8MA 2VERN 4HUXB 5AG9A 4DWHA 3SDDA 5E03A 1N3NA 5FOJA 3PQYA 1I85A 1JNLH 5JNYA 1C16B 1YEHH 1SJXA 4F9PC 5IHZB 3QHFL 3MLSH 4YGVB 3RL1B 1O7VA 5I76B 4WUUD 4OGZA 4LF3B 1WAAA 4PRNB 3SOBL 1VA9A 3SDXE 4P9MH 4WI6A 1U8QB 3OF6D 4OZGA 5ERWA 4QYOB 4KGLA 5A3IC 1VDGA 1CDHA 2X4RB 3IDIA 1QFWI 1TQCC 3CH1B 3FO0L 2DQEH 4GUPB 1S7RB 3OKYA 4GG6F 4JAMB 4QY8A 1HHIB 1T66D 3VFUB 4X8XA 3IAPA 4P2RD 4O2EA 1WJ3A 4XVUC 2D0FA 4NN7C 3HI5H 3LKQB 1A6TB 2ZKHL 5K9QI 1IEHA 5DD0H 3SE4A 2JTDA 1J9CT 3O11A 3U6RB 4U2YA 4DOHB 2A2QT 4QHKJ 3GSRA 4HBCH 4PJ7B 2Y5TB 3B3IA 4XXCC 3DX8A 5T3ZH 5T33H 5E7FA 3BD3A 5E99L 2ZSWA 4UT6H 3CPLB 1DVFB 4POZD 4F15B 5K33A 1S8DA 5ADOH 4CU6A 1HIMH 2D7MA 2R0LL 4U3CA 1FL3A 1V7MH 3WDIA 5TE4L 2B1HH 3DX7A 5MENE 5FA4A 4CVXB 1KCKA 3PWPB 4NQDD 2AXHA 1LHZA 3UPAA 2QSTA 3EO9L 1K5NB 3EOBA 3MJ7B 3RNKA 2YK1L 4WU7B 1FJ1A 2ZG3A 3L3OA 4FMFA 1F4AA 4RIRA 4PRIA 3F7VA 4L8SA 2EDBA 4IRJB 3O41A 4KQ3L 1MNUL 3S34H 2Z91B 1NLBH 2ARJB 3ZTJH 1XCQB 2BY3A 4Q0XL 3VMOA 5SWSB 4BQBA 1H0DA 5I74B 5FF6A 1LEKA 1NDMB 2X7LA 4WHCA 4KZEL 2NNAA 2C3VA 1BFOA 3PGDA 3ZE1E 1F6FB 3TP4A 1GZQB 1JNNH 4ODWA 2C1OA 3VXTA 1FGVH 4X4XA 3BRFA 5TE7H 4GSDH 1P84K 1FAIH 4Y2DB 2JLLA 1S7XB 1I7RA 4AIZA 1A7RL 1FAKT 3P9MB 1YEEL 4OM0L 4R26H 3VI4F 1MOEA 4D0BA 3MXWH 1TZGL 1RUQL 1GGUA 5DO2D 1NFDF 2GT9A 3BKML 4HKBB 3TV3L 4X0KB 3O6KL 3ZHKA 3O2DL 2DTML 5DJ0A 1ZHNB 5D7JD 2WBWB 3DVGA 3PWJB 2V5SA 4JM2F 1IL1A 2V5RA 1NFKA 2DMCA 4WFFD 5KS9B 4YDJB 1J11A 2YEZB 1I9JH 3TCLA 5CJQL 1TITA 4OCSL 1PG7W 1ZVYA 4XC3L 3I3BA 4K3EH 1CE1L 1OAQH 1C1EH 3CC5A 1D9KC 2YN5A 2EDDA 3SCMB 3L3HA 2F53D 4XVTL 2YPLB 4M4RA 3LN4A 3MJ6A 1VKXB 5TDNB 4LSDA 2XKSA 3PHOA 4XMPH 1JMXA 3MBEA 1XR9B 1KPVA 4R3SB 2JE8A 4V1DB 1E4WL 5F3BB 4R96A 2DJSA 4HJJH 4P5TB 2I27N 5HTSA 2P45B 3P4MB 4R4FH 1NEZA 2R0KH 1JPST 1NMCB 4FTVD 3QDAA 4EOWL 1MREH 4UILH 2ITDA 4LVOB 1RUML 1WBYA 1OSPH 4OFDA 5F7DB 3MUGA 5LG1A 2NY4B 2BCKA 1R0AH 5BS0E 1OCWL 5FGCB 3KPSE 4X99B 2HJFA 1JPFB 1ZVSA 2FX9H 4ZUUB 3U2SA 2XTJB 1AGBB 4IHOA 3KPLA 3QEGL 3K8KA 1QHPA 4YFLF 4K94H 2B1AH 5JW4M 4KRPB 1Y18A 1D5XB 3TJHD 4XNXH 4Y4FC 4YHNA 3W9EA 3QUYA 3EYUL 3ILPA 2VDKL 4D0CA 1RIUH 1J0JA 5IKCB 3HLAB 1KELL 1FL6A 3WFHA 3THML 2IPTH 4R0LC 1K4DA 4ZYKB 2BJMH 2IAMB 3Q6GH 4YXLH 5MI0B 3WO4C 5FYJH 4Y4HD 3JV6A 3KGRA 3LEYH 2AAVA 4JFFE 3WXVH 3RIAK 3EOTH 2FECI 1EDQA 3DI3B 5L8KB 4PBXA 1N0LA 3GDBA 2X4OA 4I13B 3BVNB 5IBLC 2JJUA 5DD6A 2VZSA 2W65B 4YFLI 2G75B 5EULV 4MXQD 3D39B 4YIQA 4CNIA 3UZQA 5GQBA 5J9PB 3ILQC 1KBGH 1R3LB 5ILTH 4W68A 3A67L 1EEYA 1G6RH 1QFUL 1BM3L 4KVNH 1U8IA 5HVHC 3EYVB 4KK8D 4XP1L 1QYGH 4KRLB 5EBWA 4HIHA 3VFTA 3RWHB 4KK5C 2EH8H 3QNXB 1C5CL 1HINL 4MJ6B 4P3DB 4PTTB 4G8GA 3TA3B 1AGEB 2OI9B 4DN3L 5GIRB 4LPYA 4EI5B 4RWYH 5IJKC 4P3CH 1XIWA 1ZLSH 1ACYL 3PHQB 4XAWH 5KVDH 3S7GA 3RVUC 2CO7B 3QRFM 3T0EB 1UQSA 1CFBA 4LSTH 1CGYA 4NUJB 5GS3A 1PBYA 1PX4A 5I71B 4NSKA 1YUHB 2J8UF 5DRXA 3UZEA 4MHHG 4XC1L 4HFWA 3ARPA 4NNXB 1YNKL 1A5FH 2FJHA 1QO3A 1V3MA 1OSZB 2B2XL 4P46A 5IB3A 1VHPA 2DS4A 1EUUA 2NR6C 2X44D 1U58A 3IFLH 5T3XE 3CU1A 1FNGA 1OP5K 1B4JH 4YUEL 1DANT 5INCB 4NO5B 2OZ4L 1XGUA 1KPRB 3ETBF 3O2WH 1A7NL 1QFWH 3REVA 2B4CL 1ONQA 5H37G 3TT1L 4LSPL 4JZJB 2WWMC 4DGYL 1WCQA 3TO4B 5JDSB 5T1KD 3CX5J 4QRRB 2BC4B 4HXAL 4RBPH 4NT6A 2HN7B 3V6FB 5B3JF 2H2SC 3WIIL 5EOQL 3WLWC 1KGCD 4MXWL 2AGJH 5DS8B 1UB5A 3OKOA 1V8HA 3K2MC 2XFXB 5HGDB 3BGFB 5IBTL 35C8H 4OCWL 3VFSA 3CFBA 3CMGA 1G7QA 1JGUL 1JWSB 3DXAE 4DZBB 2NY2D 4XNYL 5DDHB 5DUPL 5H35B 1TQBB 1MCOL 3QQ4A 4XXDB 3H3PH 5IVXE 3IDNA 3BAEL 2XZAH 4S1QL 1NGYA 2GAZB 5KJRL 1QRKA 2A9MH 1II4E 4UDUB 5ADPH 2YD3A 4ZUSA 1OAZH 1UEMA 3BDXA 4LK4A 5DD1H 3BHBB 1RULL 1T89C 5FO7B 2AEWA 2BRQA 4IMLB 5TPWH 3LVEA 3FCTB 4XZUA 2JK5A 1ZHBA 4G8EA 3TZVA 3S36H 1C5BL 1DBML 4N0CC 3FN9A 2GK2A 2VITB 2VLKB 3O6FB 3EYFA 2MCPH 1WFNA 3ELAT 1KJVA 3DWTA 5ESVA 2H3NB 5IT2H 1T83A 1OP3H 3BJLA 1C12A 3QEQA 1EFXA 1HYSC 4BKLA 4G7YL 2Q3AA 5BOZG 3OR6B 5DR5H 4Z0BL 1UA6H 4CVWA 1LEIB 2AK1L 1QBMH 3S4SG 4KI1A 1AQDA 4GXVL 1YEGL 3CMOH 4YX2L 3UYRH 3C6LA 4RGNC 4P23D 1N5YH 4OF3A 4Z7WF 4HT1L 5BS0D 5BCAA 3KPSD 3JTTB 1NUGA 4Z77B 1DBAH 3NZ8B 2OP4L 5SWZB 1V3JA 4J4PC 2I26N 3QDGE 4HWZB 2EXYC 1A1MB 1HKLH 3W81A 3WO3B 1KUMA 3FO9A 5I19L 3IDXL 4G9FE 2DYPD 3BPOC 3D2UD 1DLFL 2KKQA 3V5HB 5DZNA 1NJ9B 4X9HA 2FEDC 2VAAB 4UU9A 4F37K 4G6FD 4YHYB 1GSMA 4JFFD 5AEAA 4MJ4A 1JNLL 3C8HA 3L9RA 1JNHA 2GW5A 3AREA 1H5BA 1SMOA 1YEHL 2EDWA 2QJDA 3V6OE 4FFWD 3OKMA 4OQTA 1FIGH 4F33B 3BH9A 2AABL 2CR6A 2X4UA 4PGCA 1PYWA 3EHBD 2IMMA 1JHLH 1RJZA 2J1KA 5F9DC 3U0WH 5ESAB 2CLVA 5ISZA 4P9ML 4F8QA 1I1YB 2AXFA 4FQ2H 2VLRB 1N4XH 4OLXH 2UZXB 3MRGA 3MBXH 5HVGB 3LKOA 1IAMA 4GRLA 4HIEA 2DQEL 3QNYA 2XZQH 4M6OH 3N50A 4DKFH 1WITA 2X4QB 3FQWA 4K7PY 3TVMB 1NGXB 4K3GA 3VWKC 3QIUB 1P5VA 3X12B 2GSGB 5DD0L 4YHLL 5DRNA 1UCBH 4P5MA 5ICZB 5HYQA 2IBZY 1BFTA 2Z9TA 4HBCL 5ICXA 4QXTA 2O5XH 1MCWM 5T33L 5KOVC 3PHSA 2YXFA 4N8CH 2RCSH 2ED8A 1A14H 5I1EH 5KSUB 3EOBB 1IARB 4NPYA 5ADOL 2JB6B 4RGMC 5JIKA 5ID0A 1QR4A 1FFNB 1HIML 3F7VB 4IDLA 4J1UA 4X80L 3LZFH 4E0RB 3LN9A 4G43A 4K8RD 5DK2B 4AYFA 3QDHA 4G6KH 1I4FA 5AUMA 1KCSH 2DBLH 3QA3A 1RU9H 3IJYA 5T3XD 4XMLH 3ZHLA 5GSRB 3ZHDA 4PJ5D 4DEPB 3S34L 1NLBL 4MDJA 2EYTB 3VGBA 3WHXA 3MRFB 12E8H 2H8PB 1V3KA 4NN5C 3VXSB 3HB3D 3TF7C 2G9HA 4D0BB 3QZWB 2J4WH 1AO7A 1JNNL 5F1NB 3TBTA 1DQQB 5FO8B 5KVMC 4JRXE 1FGVL 1IQDB 5TE7L 4GSDL 1FAIL 1IL1B 4EN3A 4R26L 3UXFA 3R0MA 4FQHB 3FFCA 1NGZB 1U8NA 3ULUC 4ZFFA 1ERNA 2CSPA 2VLMD 4FS0A 4OLYH 3DXAD 3MLXL 1F8TH 4KJYB 4U1IA 1FL5A 4F2MA 4H0GA 4JM2A 3GJEA 5E94A 1IZJA 1MVUA 3OKNB 1BD2E 1OOAA 1G9MC 1I9JL 4PRDA 4EBQH 4K3EL 3TCXA 1ODAA 2A74A 3KPPB 1OAQL 1C1EL 1EAPA 2K1MA 3HAEH 4OZIE 1IT9H 3TO2A 3FQRA 5C09A 3LMJH 2IALA 3C87A 1ES0B 3M17B 2G5RA 2ITDB 4NP4L 2QSCH 2NY6D 5C7XH 1NC4B 5B39A 1VERA 4HJJL 3UDWA 3ARYA 3VRLF 1X6LA 4QOKE 5IJVA 3PNWA 5J6HB 2R0KL 1S78D 3L3JA 3ARZA 4E42A 3MRQB 4K71B 2X40A 4PRPE 1BZ9A 5C9JA 4HCRH 4IRSA 4UILL 4P59H 3BZEA 5DZOA 5JZ7C 3BIBX 4ZUVA 5ECJE 3QUYB 1BREA 2FO1A 1R0AL 3IVKB 2V5MA 2DI7A 3NN8B 1NBYA 1R5VB 3QFJE 3D25B 3QSKB 2OTWA 3HI1B 3GMPA 3U30B 2P5EB 3Q2CA 1U8HA 2B1AL 4K94L 4OM1H 1PDKA 4K3JH 5JXAL 2DL2A 3KDMA 5EOCJ 1K8DA 1Q9LA 3D18A 2P7TB 4O58H 4UAOB 5BVJA 2WUCH 4NQVB 4XPTH 4Q2ZB 2QSQA 3MV9E 1KPUA 1WEJH 4X7CC 1S7WB 1EPFA 1QPPA 1AC6A 4TSBH 2IPTL 4RNRB 4P2QB 2BJML 3Q6GL 4XWGH 4YXLL 4S1DD 1D5ZA 4EIGB 3B43A 4LNRB 5F6IC 5FYJL 1URLA 4HMCA 5BRZD 3WXVL 4G9FD 3EOTL 1I9EA 2YC1A 2X1PA 4WU5A 4HKJB 5DEGB 1R3JB 1T4KA 3ZZ1A 1FC1A 4Z5RA 5CEXA 1XF2B 1DUYA 2CR3A 4KDWA 1CD1B 1NBVH 1MY5A 4X6CA 3P9WB 1YEKH 3GSVB 1A1OB 2RGSA 4XRCB 2EEDA 5E8NB 1KBGL 3BYTA 1KFAH 4HXBH 1IAIL 4ZPTA 5F7MC 5FYKH 4N5ED 1CFSB 1G6RL 3HMXH 4OZ4A 4RWHA 1QYGL 1XIWB 3PUCA 4HIJA 4PJFE 3HUJE 4HV8B 1YYLH 2EH8L 3JWDL 3IFOB 4Y1AB 3DO7A 3GGWA 4I2XB 5D71H 2FZ3B 5L2KD 3O4LA 4PLKD 4RBPK 1JHKH 1UENA 3I6LE 2BVUA 3RWIA 3DECA 4RWYL 4P3CL 2O5ZH 1ZLSL 2E6QA 1QFOA 4YBHA 4XP9H 1VPOH 4LSTL 4Y19E 3O0RH 2J8UA 2VUOA 3RDTB 3JUZA 1FNGB 4X4ZA 4H88L 4M5YH 4GW1B 5CHNB 4ZFZA 1X7QA 4PJCB 5CBAB 1JPTL 1A7PH 1N6VA 4KKLD 4BJLA 5DFVC 5JORB 1B4JL 2E7LA 4HZLB 4O51A 1G7PA 3FZUC 2VDNH 1IM9A 4GKZA 3RKDD 5AYUH 4HUUB 4HH8A 2PTUA 3INUH 3TPUB 5I1HH 2LFGA 3O2WL 2A6IA 3EDKA 3NIFE 2GJ6E 5KSAB 3I02A 1QFWL 1Q94B 5F7YC 3GI9H 1ZGLA 1NCBH 5ICYB 1OARH 1WC7A 3P0GB 1OP3K 3O45A 4MQXD 4LRNH 4MNHB 1HEZA 1YMMB 3HZYA 4MD0B 2ZCLH 1MIMH 2OXHA 2AGJL 1WGOA 3QIBA 1I1FA 4OFKA 35C8L 1F90H 3BPCB 4NWTH 4NQCA 1G6RB 4JRXD 3MRJB 3HHRB 3T4AB 1JZ4A 4ZTOH 1A4KA 3X13A 1JZ6A 3UTTB 4I1NB 1F6AA 2DJ4A 3IS0X 1LD9A 3H3PL 3ALWA 4RSVA 2XZAL 3HS0A 4PJIB 2I9LB 5A16B 1BGXH 1NFIA 2A9ML 4R4BB 4I77H 1MFAH 4Z7QF 4PJ9C 2XQYK 3JTSB 1A6ZB 1OAZL 1Q72H 2JB5L 5DD1L 1VB9A 2PYFA 3BT2H 2DRUA 1VFMA 1BD2D 2E5EA 3K74B 3O8XA 5TPWL 5EUOE 4OFYA 3BKYL 3K8LA 3RPKA 3WFBH 2V9TA 3OQ3B 4Z78A 2OS7A 2MCPL 2UY7A 4PJBF 2JIXD 5IT2L 4HEPG 5D5ME 3RZCD 1OAXH 4A6YH 3G5VA 5IQ9B 3CXDH 1KB5A 3DMMA 3NA9H 1IGYA 4YDVB 1UA6L 4KC3B 1TQCB 3EUUA 3ULUH 4PRPD 3RGVA 5DVLA 1QBML 1RJYB 5CEYA 3VMNA 3CMOL 2BSTB 3BSZL 3QPQC 1NDGB 4HJ0C 1ZLUK 3UYRL 1AD9A 4NN7B 4M6AA 4H0IA 1N5YL 4UBDC 1AE6H 4Z7WA 2O61B 1KIRA 3GKWH 3QFJD 3NFNA 4FXLA 4X8JA 3DROA 3QWRA 4MWFA 1G9MH 4QRQA 3UJTH 3GSUA 5BW7A 5KANG 3HE6A 3ARGD 1R24B 5E6ZA 1HH6A 1UCTA 1T22B 1PW3A 1HKLL 2EDJA 2XN9B 3MRDA 3F58H 3HE7A 1OLLA 3ZDXE 4PP2B 3AU1B 3L9RB 4YK4C 5HDBE 5FV2A 3MV9D 3RVVD 3W11D 5D1XA 1FFOB 3G6JA 4JVUA 4NNPL 3P11L 1MHHA 4QTHA 4XTRD 5LGHL 4ONFL 3MX0A 3W5NA 4JCLA 3RU8H 4L9LA 5KW9L 2HG5B 2XOTA 4GG6B 4FFYH 1FIGL 3D69B 3IDGB 3RUGF 3OKLA 2ZSVB 3FQWB 2BVOA 3LEVH 1JHLL 3U0WL 4FQ2L 1N4XL 3PQYE 4OLXL 2X70B 4ELKB 1TNNA 3MBXL 3NABH 2G5BB 1I1AD 3IETB 1KYOJ 3V4UL 5ESQB 2I07A 4B50A 1CICA 1NGQH 4LASH 4UTAL 5HYSA 2VH5H 2XZQL 4M6OL 4DKFL 4O2CA 5C0NC 1CFTB 1ZGLP 2VXVH 3OG4B 1PG7X 4M9PA 2ESVB 2VL4A 3GSOB 1FNEA 2YXMA 1BQHB 4P49A 2DWDA 5C3TA 2OTUB 1WTGT 3U7WH 4NZTL 3DX6A 1BBJA 3FT2B 4OZGE 1HSAA 4ODHH 4WNQA 3UMTA 3V5DA 4S2SA 2CLZB 1UCBL 3LHPH 3P73A 5GRUH 2CUMA 2CUIA 2O5XL 4FQJH 5FUCC 3I6LD 4ORZC 2NW2B 3VXPB 1YPZA 4I3RH 5EC2A 2RCSL 4ZXBB 1A14L 1KT2A 5I1EL 3ULVE 4APQD 1TJIH 4P2OA 3SHSA 3C60A 4L8BA 1CFQB 3Q1SH 4NJ9L 2FECL 4WTWA 4TULL 4EDXA 2AW2A 5E5MB 1TNMA 2Y5EA 3EJJX 3QJHA 3V0AC 5F44A 2VTFA 2AV1A 3NCEB 3RBGA 1LP9A 3LRHA 5DJAB 1KCSL 1JPGA 1T1XA 2DBLL 2FX8H 4M7KH 4I3SL 1WIOA 4S10A 1RU9L 5GSVA 2GEEA 1FH5H 4LCUA 1CK0H 3PDGA 3V6ZA 4H25B 3ARDD 3SY0A 3MLYH 2AP2A 4F7MB 1SEQH 3VFGH 12E8L 3CFKB 1LILA 5JOPE 2J3SA 3RL2B 3UPRA 2GJ6D 4PRIE 1U8NB 2J4WL 4PLJD 2CXKA 5D7LB 1X5XA 4YHIA 4MAYD 1TJGH 5L7XH 1NFDB 5C0CA 3BW9A 2YPVL 4NKMA 3EFFB 4U1SB 1C08A 1JTPA 4RFNC 3O4OC 3UJIH 4S1RL 2FGZA 1WWBX 3W5MA 1VFBB 3SDAC 4X7TB 3TYFB 2CH8A 4OLWH 1H8NA 1MCPH 4H5SB 1VADA 2B39A 4Y4FB 1HHGA 1EO5A 3MQIA 4RMTA 1F8TL 3Q48A 5F71A 3UROR 2KH2B 4F7PA 3WN5C 4DVBB 3U7AA 2FWOB 5T1LA 4GBXC 5D1ZD 3VXRA 4FA8A 4R0LB 5D1QC 4CN6A 1AGFB 1A4JB 3WO4B 4DN4H 4M1CC 5DHVA 1IT9L 3GSNA 1FRGH 3LMJL 5CMAB 2F8XC 5IV2B 2QSCL 5C7XL 5M94B 3SGEI 4HS8H 3R06A 2APXA 4AT6B 5B8CC 3KPNB 3DBXA 3L95B 4MLIA 5IVZB 1UADC 3ZMRA 3FB7B 4I48A 1BFVH 4U05A 5ID1B 1EVUA 1SVCP 4HCRL 1OB1B 1I7TB 3EOYG 3IU4H 4JPKH 2QKIB 1VENA 1MJ8H 5C07E 5DJXB 4X6DB 5CD3B 4W4OC 2GYSA 4FNLH 3B6SB 4HUVB 1UM5L 3H2WA 1F6LL 3WUWB 3SE8H 4I0PD 5GPRA 1BOGB 5GJTL 4OM1L 3DV4A 4K3JL 3TIDB 4O58L 2WUCL 1JWMB 3MV7A 4XPTL 3ARXA 3WLBB 4MQ7B 1CXEA 1ZV5A 1WEJL 5E8PA 5CJBA 2HYMA 3UTZA 3CK0H 4PJDF 4G3YH 4TSBL 4YBQD 2BNUB 3NCBB 4XWGL 3GJFB 3FO2A 4JFYA 4L29A 3HZMB 43CAA 3GMOA 4U1MA 4QCIB 4JLRB 1J8KA 3C5ZA 2H6PA 4PP1D 2H2PD 3QP3A 2R2EA 2B5IB 4OZHF 1NC2D 5J1SC 3RVWC 3HCVA 3CDYA 2P46B 3ECBA 1NBVL 4LP4A 1BQSA 2R4SH 1YEKL 1EV2E 1XT5A 1KFAL 1DLHB 4HXBL 5E9DB 1G9NC 5TF1H 5FYKL 4P57B 1WIUA 3HAEB 3HMXL 5GGSA 4FZ8L 3IFPA 1EBPA 4NQEE 5D2LA 3A6BL 5E08H 4JN2B 3SDDD 3S37X 1YN6A 3PQYD 4OKVB 1YYLL 2HLFD 1NCNA 5D71L 1HN1A 2J8UB 4GQPH 3P3YA 4S0SD 2P5WA 1JHKL 4OCMC 5DHXB 1RZ8B 4NRZA 3MRBB 1CD0A 5LJYH 2F5AH 2O5ZL 3GI8H 4JM4H 2Q87A 1MWAH 4IIQC 4XP9L 3LB6D 4MCZA 1VPOL 4G80A 5KSBE 1ZVHA 1KLFA 4AEHH 3O0RL 2FH6A 5JQ6H 5TFSH 3CFEA 4ZNCD 2FATH 2AXGB 1RHHB 2V2WA 5IK3B 1TTUA 1I3RA 1MHCB 4M5YL 2CDEA 4D0DA 1F11B 3C2AH 4NDMB 3ULVD 5J11C 2R1XB 3KWWB 2Q8BH 3H42L 4TUKH 4JY4B 4O4YL 4NIKB 3KLHD 2R9HC 1QUNA 4NC2B 3N1PC 5E1AA 4J3WA 1BLNA 4L5FH 3RAJH 2VDNL 2DDQH 4TVPE 3VGAB 5EZIH 1W2KT 4N8VA 3INUL 3HG1A 4JGMA 4YO0B 1YEFH 5I1HL 4KROD 3OJVC 5HBBA 3GNMH 2MPAL 3PL6C 5LWYH 3GI9L 5CZXD 1ZT7A 4HLZG 5C0FA 1NCBL 1E28B 3MMEA 3F12A 5C6TH 4ZAKA 2H32A 4K7FB 1B0GA 1MFCH 1KCLA 4LRNL 4QHUB 5JOPD 2E7CA 5IP4A 2ZCLL 4MSWB 4ZFOL 4PRID 2UWEF 2R1YA 4POZC 5GZND 4YNYB 1JCKA 1F90L 2QL1A 1MRCH 3LKSA 3P9LB 4I18A 3QCUH 3QCVH 1U92B 3GRWH 2GTZB 1LO5A 1AJ7H 3S5LA 3VFMB 1N6QL 3RWGB 5IM7A 3T65A 3MNZB 4YZFE 1BGXL 2YUWA 3BUYB 3TBYA 4I77L 1MFAL 1CE6B 5JLZA 4Z78B 1Q72L 4FFZH 1K8IB 2X05A 3G5YA 3BT2L 4QRPB 4WY7H 5IESH 4ZNEA 5I2IB 5C8JA 2A73A 3BO8B 1B2WH 5EN2B 2DBJA 5TDPB 1OAYH 2YD5A 3QIWA 4EUPA 1QLEH 4K7PH 1IGYB 4WO4A 1U91B 4PJBA 2VAJA 3JUYA 1T04B 3BKJL 4L1HA 1P7QB 4WW2C 3VFPB 4XT1C 4FQPA 2W07A 4NFDA 1U3ZA 5DSCA 4A6YL 1CL7H 3CXDL 1CZ8H 3ZYJA 2EH7L 5HYFA 3NA9L 4DJMA 1QSEA 2EE9A 2XKNB 1EHXA 3ULUL 2XY1A 2ICWI 3TBWA 5JTWA 5HYSG 2EC8A 3MBED 3VRJB 2IGFL 2J8OA 5C07D 1TZHA 2VDOL 1TZIB 5GRVK 1J0HA 3R4DA 3VWKB 4C56E 1AE6L 2OJEB 1SMAA 3GKWL 4A2LA 1RUKH 3UJTL 2PETA 5EBMA 4NC1E 3M07A 2BHUA 2FYYB 3MV8E 4DAGH 4YHPB 4EI6A 5H94A 3F58L 1D6EA 4ZFOB 1NMBL 4KAQH 3FB5B 1TLKA 4G8IA 4PGJA 3GHEH 1MFEH 1QQDA 4B7IA 5ALBH 1EXUB 1GC1C 2XT1B 4EKXA 3V8OA 2IG2H 3OKLB 5IB5B 4JPWH 4MA7H 2VZ1A 3H9HB 2W0FB 4LCIL 3TN0A 3SGEH 4I9WE 1SYVB 3RU8L 2X10A 4Y89A 2Z35B 4UNVA 1W8OA 5DJ8B 3U0TB 4FFYL 4R7NB 3U36A 1W0VA 4LHUB 4C59B 3I9GH 2R23A 3OGCA 1JZ5A 3LEVL 5EU6A 5J13C 2JKXA 3BQUA 5J06A 5J1AA 2XZCL 3BISA 2HJKB 1BAFL 5F70A 4CUCA 3P4NA 5TQ2L 2X9XA 3NABL 1INDH 1NGQL 4LASL 2VH5L 3W9DB 5A2LH 3TJHC 1CGSL 4XNMB 4PRHA 5GJSL 3MRKB 2VXVL 3SDXF 4PREB 5CBEB 4HD9A 4YDLC 3LPGA 2Z93A 1I9IH 2QV2A 3U7WL 4XVJH 4GW5B 1AXIB 2GJZB 4WEUD 4ODHL 3F7YB 4A6YB 3LHPL 4L4VB 2EYRB 5GRUL 4PJHB 3RVTD 4Y4HC 4JFEA 2HFFB 4NOBA 5KN5B 4FQJL 4WEMB 2VZTA 3KYNA 3ZKMC 3QJHB 3H9SA 5CKAA 2XACC 3FTGA 4I3RL 3KYOB 4AEFA 1FBIH 4H1LH 1MCLA 1SYSB 4GO6B 3T8XB 1KCRH 1TJIL 1QA9A 5E8OA 3MPCA 3Q1SL 4Q58C 3C2SA 5DMIH 1OAKH 1LK2A 5E6IB 2Y23A 4MXQC 2Q8AH 2IH3B 1PZ5A 3QDJE 3BP4A 1EJOH 4JY6A 1QKZH 4MNQE 2CIIA 2PO6B 1G9NH 3H6JA 2VLJA 4QHNB 5C0EA 2VC2L 2FX8L 4QWWD 1FH5L 1CK0L 4KK8C 5D7IA 1MIEH 2L7JA 3RNQB 4X4YB 3BGMB 1YNLH 4QRSA 2R56L 4HSQA 3MLYL 2P43B 1SEQL 4TVPD 4WDIB 2VZOA 4Z8FH 1C08B 2QQNH 3VXOB 1A9EB 1RUPL 3SN6N 2EYSA 3KYKH 5FYLE 3AS3A 3U0PA 4Q7DA 3VD9A 1DSFH 1TJGL 2GJJA 3NCMA 5L7XL 2Y25A 5HHOE 1E4KA 3IDMB 1M6OB 1U3HC 2IH1A 5CSBA 5EO1B 2R69H 4FQXC 1OTSC 3ZE1F 1Q9WB 3ES6A 4JGJA 3FQTA 4AEIH 1IGMH 1OT1A 4M48H 4OLWL 1MCPL 4FQQA 4N0UA 5MERA 4RMVA 3J7HA 2EO1A 4JRYA 4HQQH 1BIIB 5I16A 5DHVB 1G6VK 4F9PA 1UXWA 4HUMB 1X9QA 4XMKH 3UTSB 3BIKA 1D5BA 3L1OH 1J8HB 3I75A 4HBQA 3TBSA 2UV3A 2AVGA 3IAGC 4ONHA 4UDTB 3FFCE 2Q3ZA 4OSUH 3VFNB 3LKPB 4DN4L 2NX5A 5GGRY 2CIKA 4R7DB 4JFQB 4LVNC 5K93A 3RY4A 4JO2L 1CDIA 2BVPA 1U95B 2BOCA 3OJMB 4JPVL 3TBVB 5DRZB 5FEBA 4HS8L 4MA3B 1DDHA 5IFAH 2NXZD 3QEHA 3SPVB 1DFBH 5CWSA 4PRAB 3JV5A 1DUZB 2D7QA 1FZKB 5KG9B 3IFNL 3FONB 1BFVL 2WWKO 1UVQA 5C09E 2YPKB 4O2FA 1IKNC 3MCLH 4ISVB 4LIQE 1JVKA 3IU4L 3KLSA 4MQSB 5ANME 1MJ8L 3VFVB 3KXFB 1MH5A 3HI6L 5DRWA 3JV0A 1Q9KA 1K3IA 2PXYC 2XY2A 5LAXB 3TZVD 2K3TA 2NPLX 5D2NC 1FFQA 3SE8L 1MAKA 4Y16B 2H9GB 5KZCB 1G7JB 3FO2B 3IKCA 1UWGH 5HYJA 3O81A 3PGCB 2AQ2A 4C56D 1EFXD 3B9KC 4U1MB 5IFHH 4P4KB 5J57B 4OCYH 5HY9B 3FT4A 2HTKD 4RDQG 1HQRA 4W6XB 2FJGB 2W9DH 3KLAB 3KYAA 3P2TA 5IIEB 3CK0L 4G3YL 4NRYA 3MV8D 4PTUA 2QQLH 5TH2B 5F96H 4M3JA 4ODXA 4G6JH 3C6LD 3CFDA 3EGSB 2IADA 1ZHKB 2VDQL 3L5JA 3P77A 2HVJA 4OZHA 4RCAA 5DJDA 3IXTB 5E2VH 3GUTA 5IMKB 5HI3C 4M61A 3BDBA 2CRYA 1I8KB 2QSVA 3NIGE 4I9WD 4XCNA 5JOFA 1DCLA 4ZOEA 2AXJA 5JW3H 3JVGC 3QUXA 4UOW0 5TF1L 1FN4A 5JPNB 5MEQB 3KYMA 2DWEB 5IB1A 4JQXC 4G7VH 1G7HA 5E08L 3BJ91 3OAUH 2H1PH 2PTTB 5B38B 3OF6A 1L6ZA 5D7KE 5EBLB 1UWXH 2NY3D 2J8HA 1FNHA 4OF6A 4G8FA 3VGHA 5IEKA 3W0WA 5C9KA 3DGCR 5T5NG 2DLFH 1D5MA 2XPGA 1XEDA 3K1KC 1IAOA 4F9LC 3G5ZB 4NOFA 1D9KA 3GI8L 5ISZD 1GC1H 3LY6A 4JM4L 1MWAL 4KKNA 5FM5M 2P42B 3LEXA 1ZLVH 4GRLD 4LP5A 1IKFH 2X4SB 3PIQB 5TFSL 5DHYA 3PWPE 2GIYA 4OCRH 2PN5A 4FFWC 3C2AL 1QLRA 1DN2A 1YY9D 2Q8BL 2XA3A 1A3QA 3D0LA 4TUKL 1AHWB 1KLGA 4PJ9B 1BFSA 2NXYC 2WUBH 3L7FA 4NQDA 4QT5A 4X6BB 4X9GA 4L5FL 3QDJD 5GGTH 4DK3A 3RAJL 3U46A 1GOGA 1KTKE 2DDQL 1WV7T 5EZIL 1NCTA 2H32B 1Y0LB 4LHQB 5H8DA 5HI5D 5SWSE 1WBZB 3GIVA 4NQSA 4R4NC 1YEFL 1PLGL 2DOCA 3ZTJG 4KY1H 4P99A 3GNML 5LWYL 3SE3A 3CZFA 1RK0A 5K9JH 1RQ5A 3RIFF 4JPIB 2ICWJ 5C6TL 3PXHA 4O02H 1FO0A 1QRNA 1MFCL 4X98A 2MJWA 1U93A 2UUDH 2VISB 5FYLD 3WV0A 1H15B 2ORBH 4U1KB 3S5LB 3E6HA 5K59E 2CKBH 2QHRL 4JQIH 2VB5A 4BUGA 1ZK9A 3V0WL 4UOW1 1YC7A 1MRCL 5HHOD 2MWCA 3D3VB 5IMOB 3O3BA 3QCUL 3DURA 3QCVL 2J7LA 4YAQB 4EVNA 3GRWL 5DK0A 2UYLB 2EIZA 1JN6B 3CSGA 1AJ7L 1FG2A 3EZJB 4QTIH 3QFDB 4L4TE 4PJ8D 5KS9E 1T0MA 3HZVA 3OKDB 4LRIA 3DUHA 3MNVB 2NY7H 1UM6H 1H3TA 3OB0H 1U8KA 1AXSB 4N0FA 3M45A 1A8JH 4NQCE 4XP5H 5D7JA 4JVPA 3ARBC 4YK4B 4GKSA 3DPBA 4FFZL 4NQXB 3BPNC 3TESA 3WEXA 4EN3D 3Q6FA 1B0RB 2M8XA 4PJGF 1MWAB 3TNMA 4YPGA 4WTXA 1CD9B 4WY7L 3FFCD 4V1DE 4DFIA 2KZWA 1NLDH 2Q76A 4N9GA 4NKDB 4U7SA 2F53A 4PJEA 1VFOA 2I9TA 1QLEL 1XCTA 4FRWA 4K7PL 3MLTB 3QWQB 1KNOA 2OCFD 2N4IA 3TIEA 5D96C 1MVFA 1EO8H 1FYHB 3U4EB 1T7WA 2V2XB 5IJKA 5IF0B 3I6GB 3MUZ1 3C9NA 1CL7L 3OX8A 1LE5B 1CZ8L 5F7WC 5IBUB 1MF2H 5EU4B 3QI9C 5MEOA 1S7UA 4AM0B 3NAAL 2XTJE 5C09D 3MGTA 2OR9L 1AQKH 5CIPH 3SJVA 3IJHB 1T1WB 1IEBB 4HDIA 1DTUA 1P1ZA 3QUKA 4LEXH 1XR8A 1YMHA 2QHLA 4JFXB 5EUKA 3WL9B 1RUKL 2X2YA 4KMQA 4KMLB 4IRSD 4YHZH 3MLRH 3SKNA 4DAGL 1BVLB 1PZUB 1G84A 4KAQL 1UB6B 4ZPVB 3GHEL 1MFEL 1MFNA 3SBWA 5TDOA 4GAYA 5ALBL 3NA4A 4XPAH 3RUGB 1HYRC 4K3HA 1OD7A 2IG2L 3OGCB 4JPWL 1XGTB 5MEPA 5HJ3A 4NRXA 5DMKB 4MA7L 4KV5E 2H45A 1F42A 1S78C 4HGWB 3WYRA 1BX2B 3QBTB 4HIIB 4HKZB 1AD0B 2IANB 2FIKB 3G6JE 1A64A 4JKKA 4WWKA 1CGXA 3EW3B 5HGHB 2EZ0D 5L2JB 4FQCL 2IBZX 1HSBB 2WINB 3ZKXC 3OB8A 3D85B 1PKQB 3DSFH 2WBJB 1INDL 3OXRA 3OV6A 1X5AA 3QUMA 2D0GA 4RMUA 5HDOA 1GGBH 2KQMA 1BJ1H 3PABB 5FA3B 3RRQA 3VJ6B 1NCAH 2NY1D 4HS3A 3MSPA 5D7KD 5ACMA 3VA2C 1I9IL 5I73C 3JV4A 4JEGB 4O9HH 1AGCA 3TFKC 1LDPH 3OG6B 3I3EA 3RA7H 1JV5A 4RFNB 3O4OB 1MLBA 1T7YA 5BZDB 5K9OA 1T89A 3W2DH 2P8PA 3QXVA 1ZSDB 3OAYK 1FBIL 2ILLA 5L6YH 5ITFB 4HAGA 3TM6A 1KCRL 2DMKA 2VIRB 5BXFB 3WN5B 4JDZB 5DMIL 1OAKL 4KKBC 4U31A 5H2BA 1NANI 4GBXB 4XGZA 2Q8AL 3O4LD 5FIEA 3PWPD 4HWNA 4PJXF 4DUVA 4OV5B 5F1IB 2MFNA 5D1QB 2XWJB 1NBQA 1YPZE 1EJOL 3TEUA 1QKZL 4C4KO 3V6OC 3VXUB 4JZOA 1G9NL 2PYEB 5FM5O 7FABH 4N5EC 1RZGB 4NHUA 4DK6A 4AIXA 1XGPB 3SDCB 1U8PB 4E41A 5MENA 1M05A 4KJPC 1MIEL 1AI1H 4PV9A 3AAZA 1TCMA 3BD4A 3LKRA 1YNLL 4G42A 5IW3A 3S35X 3SKMB 1CXKA 3KPQA 5B8CB 1AKJB 1YDPA 5D4QA 4Z8FL 4QRRE 1S5HA 2QQNL 1UJ3C 4LLDB 2R2HA 4NHCH 1LP9E 4NO2A 5GRZA 3KYKL 5FM4A 1KF9B 3CU7A 3T4YA 3ARTA 4GKNB 1NBZB 4FQIL 1BJ1J 1IAKB 2EDEA 1SEBB 3SQOL 4OJFH 2BNRB 5T1KA 1T03H 1E0OB 5K9QG 5C08B 3TH4T 5I16B 4Y2DD 1BVKB 2C4XA 5GRWA 3DYMA 4OD2B 1N59B 4N8PA 3WIHA 3I75B 2VDMH 5DJ6B 3G9AB 3EYSH 1MRFH 1CXLA 4UNTA 4AEIL 1IGML 4U1HB 2BFVH 4RQQA 5DMYA 4P2YA 5INDA 1ZT4A 4RA0C 4HQQL 4Y5YC 2FHCA 3KR3H 5F6HI 3HC0A 4XMKL 1GRWA 4HPOH 3L1OL 3FHAA 4L4TD 1HKFA 1U2CA 4LCWB 3RKDC 2EICA 4OSUL 3QIBD 3SCMD 5C0BB 1WISA 4NQCD 1UKSA 4QHLB 4ZDHB 3BDYH 2VLKE 1E4XI 1XGQA 4H1LB 4TUOB 1JF6A 3FOLB 4GRWH 3IXAB 4CDGC 3CFJB 4Q6IC 2VDRH 3CJJA 4HH9A 3VXRE 1CVRA 2IPKA 4LKCA 1JHTB 3UAJC 1DVFC 1SY6A 1EBAA 1U8MB 5EPMB 4PYGA 5GS1A 1QSVA 1XZ0A 3IDJA 1DFBL 1BQHG 1QG3A 3TC9A 4OZIF 1F2XK 3N0PB 3T2NH 1K2DB 4ZOCA 3QXTA 5IW1A 4D3CH 1KTDB 3JSSA 2NTFA 2XKUA 3IKCB 5CP3H 4WTZG 3V7AG 3O8XD 2EKSA 1IC1A 1BZ7A 2HT4C 4OFYD 5F7HA 1EH9A 4MJ2A 1HQRB 1G9EA 4U7MA 4K8RH 2XTJD 2NZ9C 4PJDB 3CCHA 4ZS7H 2NY5C 3BESR 4PTUB 5EOTA 2JJTA 3GSWA 4AH2A 2A6KB 4P23A 4ODXB 3S3JA 4C83B 5IFHL 5BS0A 4PV8B 3N85H 4OCYL 2ZWLT 4NCC1 4IIQB 4JFOB 4X7SH 4K3DH 3MFGB 2O5YL 1I7ZA 4L8DB 3QJFB 5L9DH 2W9DL 2XQYG 2HVJB 2J88L 4OZHB 3RGVD 2IAMD 2QQLL 2R0ZH 4XI5C 1ZT1B 5ACLA 5DQ9B 3L3IB 5F96L 4G6JL 2DYPA 5GGQH 3D2UA 5E70A 1N8ZB 2GTWB 4R8WH 1VSCA 5B22A 4F7TA 3U83A 5J11B 3OXSB 2LABA 1X4XA 4FOMA 2BVQA 3QWRD 4WUUB 3EDEA 4X7EC 5J6GB 2BSSB 3HE6D 3RZCC 3I85A 2X4PB 2GUOA 4KJWD 5E2VL 3NACH 2LAGB 1BECA 1XF5B 3HE7D 2KUTA 2VLRE 2R1WA 3AB0C 3HC4H 1UZ6F 1U8LA 3M1BA 5JW3L 1INEH 5I66A 1PEWA 1NEUA 4PJAA 5D1XD 2MHAA 4P2RB 4CADB 3C8KB 3HRPA 3I84A 4G7VL 2CRIA 4YXHH 3MODH 1E6JH 3OAUL 2H1PL 4HC1A 2JJSC 3ARGC 3AY4A 4BZYA 2OLDA 1T2JA 3BN9D 2ADJB 1MCRA 3LQZB 3TA3D 1FZMA 4KPHH 2UVFA 2N1KA 4P5KB 2DLFL 4M7LH 2X4TA 2HT2C 4KDTC 2BMKB 4PJFF 4LBEA 3VH8A 4KRMB 1GC1L 4ZQKB 2HTLD 3RVVC 5I17B 2FRGP 1ND0A 4GG8B 3CDGB 1REIA 1OPGH 3H7BB 1IKFL 5E2JA 1F2QA 4CU7A 3DTXB 2NY4C 2ZP0T 2DF3A 4PUBH 5MHSE 3PWNB 3DV6A 3MRLB 5C1MB 1KJ2A 4X83A 4HWBH 3BXNB 3EO1A 1XH3B 5F7EL 1MLCB 3GIVB 3VRIB 3ZLQC 1LMKA 5BOPA 3WBDA 4S11A 3VFWA 1EERB 4KRPC 1IGJA 5HHQB 2XWBB 5GGTL 4WJ5B 3RWFA 1JYWA 1FO0B 2VRAA 1X44A 1P7HL 4DUXA 3WXWH 3OKKB 4KY1L 3QWOA 2UWEB 1FVEA 3WUWG 4MMZC 2BNQA 2FSEA 1F3RB 4TQEH 5K9JL 5JPMA 4JO4L 3U9UA 3TO4D 4QRRD 5F9JA 4O02L 1QP1A 1FVCA 2HAZA 2ORBL 3NIFF 3HG1E 4JFHE 3RX7A 1P4BH 1KTLA 3RHWF 2CKBL 4JQIL 5CJ8A 5JW5A 5FXCH 1HXYB 5CUSH 5FOBA 4JJ5A 5I8KL 3WNNA 1L7TH 3AM8A 3GBMH 3VWJC 1AIFB 1JGDA 2OYPA 1RJLA 2ICWB 5DJ2A 4WFEE 4U1LA 5ELIA 5EZOH 3O9WA 4NKOA 4QTIL 4FQLL 2Y07H 1JF5A 2NY7L 1UM6L 2OQJB 3G6AB 3WDHA 2XXMB 3LQAC 2Q76B 3C09C 1NANH 1F4HA 5T3ZE 4XP5L 5C0CD 5EZJB 1HDMA 5EO9B 1T5XA 5IVXA 3ARDC 5JXEA 4AQ1B 5DEZA 5DT1L 2VR4A 4PIRF 2GITB 4EI5C 3HAEG 2XV6B 4CL7A 1NLDL 5FGBC 4X5LA 3QEUB 4MB4A 3T0EC 4FTVB 3OSKA 1TIUA 1UZ8A 3O6FD 5I71C 3B2UD 4Z7NE 2YA0A 4LGPB 1T80A 3GSXA 1NAMH 1EO8L 3VXRD 1GL4B 1A2YB 4ZNEE 1QVOB 5I8OL 1WCBB 5J13B 2ZUTA 5DYOA 2HH0H 5HI4D 1MCIA 3PP3H 2AJ3A 1MF2L 2OL3L 2PW2B 1A9BB 3B5GA 5CP7A 4JFPA 2P5EE 3DNKA 3VGDA 5SX5H 1CDCA 1D7FA 1CTOA 5D5MF 4CW1A 4QF1A 3HZKB 1AQKL 1KIPA 3MUY1 3RWCB 4D8PA 2C7UB 3TJEH 4FN0A 5IOPB 3SKOA 4DVRH 2DI8A 3MLVH 4LEXL 3MJ8A 3SGDI 4RZCB 3OAZK 3HR5B 1RZ7H 1DBJH 4MLSA 4MX7A 2CKNA 5D1ZC 1KB9J 4MHHI 3LIZH 3U4BL 4QXWA 3GSQA 2WQ8A 3QULA 4P2QE 4YHZL 3MLRL 3WFDH 4Y4HB 2CDFB 5JO5B 1C5DA 4JHWH 3T3PF 1N2RA 1QOKA 1N5AA 2F58H 4I5BA 3FQXB 2CKBB 1XF3A 3IS1X 5CJ5A 5JW4R 4MNGB 3ZE0F 1R3KA 3QDGA 3QRGH 4XPAL 2FGWH 1R3HB 3WUZA 5IG7B 4LCCA 2X42A 2RIKA 4AK1A 1IC4H 1XF4A 3ZDXF 4UUJB 3L5XH 2VDLH 3MRPB 4U0RC 4LOUD 1T0NA 5HDBF 3CXHJ 4Y0GA 4YLQT 4NZRH 2Z8RA 1ZS8A 2D31A 3VG0H 3FAWA 2J6EH 4H26B 4TTDD 2VN7A 3SDXB 1CGWA 4Y4KA 3VD3A 3DVNA 1D3CA 2GI7A 3GHBH 3QO0A 3QUZC 5IB2B 2VLRD 3T2QA 5E0QA 15C8H 3MYJB 3DSFL 2NY5H 4Y1AE 3C5ZD 1LO0L 2V7NB 4I2XE 1GGBL 1IAIM 5I9QC 3MRRA 3JWNC 3ZTNH 3K8MA 3TVMD 5I8EA 1NCAL 2AKRB 5C0RH 1P4IH 4OF7A 5EU6E 3LD8B 4JG1H 3DUUB 1HHHB 4M6MH 5SWQB 4O9HL 4RGOH 1OTUD 3QXWA 4LKXA 4WHTB 4YBQC 3O3UN 8CGTA 4TYUA 3ZSSA 3L5WB 3RBSA 1ZHLA 4FQXB 1H3PH 1PQZA 3W2DL 2OL3B 4GKOA 4PRHE 3DO3A 2VSDA 1X5FA 1TDQA 1M7IB 4OZGF 4QRUB 3GZKA 5L6YL 5LGKA 1IM3B 5C0IB 2JF1A 2N7BA 4HFUH 5B4MD 2HVKA 3WFEL 3ROLB 4MDIA 1B88A 4JDVA 3AAZB 2P5WD 1OHQA 3UX9B 3H9SE 2B4CC 3ULVF 2V2TB 2MNUA 2FIRT 7FABL 4GW4A 1KIQB 5FYJE 1M7DB 4TNWF 1F3JB 1EJ6A 4LVNB 4LPTA 1RK1B 1JGVL 1LE9A 3AUVA 4HEME 5IEHA 1XGRB 4HIXH 3D9AH 3O3DA 1I85C 1I8IB 2DKUA 5EH1A 5T1KB 3KAAA 4LLVB 3S96A 2VLJE 4NHCL 3BEVA 1YMME 1QEWA 5IQ7H 1JZ3A 1EAJA 1SJHA 3QHZL 5D7IE 4DFHA 1CLOH 2QR0A 2CDGA 3SKUD 1J0ZA 1Z5LA 4OJFL 2CLRB 3PV6B 1T03L 2HMID 5EIIB 3OKEA 5DMGC 4AIOA 2PXYB 5C0AA 3UTTE 2ZUYA 3HG1D 4JFHD 2FHBA 2VDML 3KPMA 4YR6B 5I1DB 3EYSL 1R5WA 1MRFL 2WK2A 1MNUH 2BFVL 4JRXA 1GJIA 3ET9F 3KLHC 4NO0A 2WSKA 4ZAKD 3KR3L 4Q0XH 4WFED 1VGKB 3DIFA 2R8SH 3REWA 1Y6NR 1QFHA 4HPOL 1FHGA 2NY0D 4KZEH 5F72S 1TVHA 4LHUG 2PKDA 4NCC2 5A2KH 5F89A 3MNWB 2IQAA 5T3ZD 5F7LB 3BH8B 4KROC 3BDYL 3MRCB 3QQ3A 1KEGH 1Z2KA 4XCEB 3BZFA 4XCCH 2FLBT 1RUQH 1P2CB 1T1ZB 1H8OA 4MB3A 1GOFA 1OGAB 3G04A 3KNBA 3V5KB 2W92A 5GGUB 2NX5E 4U6XA 2ZOKB 3T2NL 4PLNC 4POUB 4D3CL 5GZNC 1EEQA 3IU3A 4MA1C 1KENL 1OM3H 1S7QA 4P23B 4QOKA 4ZODA 2Q1EA 3AGVA 2W9EH 3KPSB 3RPIA 1I7ZB 3GMQB 4K8RL 4PRPA 3S97C 3MRMA 3OHXA 4WO4D 2P5ED 1LNUA 1I3VA 4ZS7L 1TCRB 5I18H 3LQAH 2E27H 4OUUB 4LU5L 4OKDA 4KQ4L 4HUKB 3STZA 4DEPC 2XN9E 3MRHA 1X4ZA 4ZG1A 3MGOA 4LEOB 5JIHA 1NCCH 5EBGA 4M93B 3N85L 3QFJA 3E6FA 1BJ8A 4X7SL 4K3DL 5HHPA 3HTLX 5I1LA 1QSED 4EOWH 5L9DL 4RISL 4G6FB 4J3VA 5GZOD 2WP3T 1AR1C 5DJCB 2E8ZA 4JFFB 3PWVB 5HYJE 4GFTB 5GGQL 2OR7A 2UY6A 3LRSB 4HMEA 4R8WL 4FZEL 3TNNB 1CT8B 2PW1A 3H3KA 4JKMA 2B0SH 5A43C 3VFOA 4Z6AT 4LLWA 5DJYB 1QHOA 4GH7B 5C6PB 3NACL 4NWUH 4TRPH 1HILB 3D48R 2VDKH 3BWAB 3HC4L 5DD3L 3GMLA 1WZ1H 4TPRH 3MBEC 1KLUB 1EGJA 3SDAA 5EU5B 2Y6SD 3KPRA 4LAJH 5JMRA 4YXHL 1RHFA 1JWUA 2XZZA 3MODL 1YA5A 4GRWB 3DUSB 3CDFA 4KK9D 2LVEA 4PGBA 2WIIB 3DJ9A 4E5XB 2DQFB 3HPJB 4KPHL 5ENWA 3SGDH 3G9VA 3V7AE 4CAGA 1U8OB 3EKCA 4PY7B 5EU6D 1NGWA 3S88H 1U0QA 1S9XB 3EYOB 3HUJA 3BQUD 5DURD 4NCDA 5IMLA 1MCSA 3F6IA 2VQ1B 1OPGL 4DGIH 3VFWB 4CMMA 3FQUB 3W0WE 1KB9K 1BM3H 4PRHD 3QUYC 1ZA3B 4PGDA 4KU1A 3DRTB 4XP1H 5DUMH 4PUBL 2NQCA 3RWFB 1JGEA 4L3AA 1WF5A 3I2CH 5CGYD 1HCVA 4HWBL 4UV7L 2OK0L 4Y19A 2VO5A 2EIBA 3ARBB 3VDAA 3FQNA 3ARRA 4ZUWB 3BPNB 4PB0H 4F7EB 1P4LA 3GFUA 5E2WH 2XWTA 3MA9H 4D94A 4PJ5B 3C6SA 4HAFA 4UAOC 3H9SD 4HG4J 3Q3GA 3N9GL 4N1CA 2VXUL 5FYJD 3IGAA 1HH9B 2CD0A 3CXHK 3EO0B 3WXWL 2D03H 1J0KA 1ZANH 2X89A 2Y7QA 5KSAD 5D7LE 3DX9B 3QXAB 2BHZA 4M03A 4JFDE 1WQVT 4TQEL 3BP7B 4ZFGL 4ORGA 5IHBA 5EB9A 3B8YA 1OQOA 25C8L 1JGDB 2VLJD 3RVTC 2DKSA 1YMMD 1CLCA 2GJ6A 1KACB 4UQ2B 4W6WB 1BJMA 3SE9H 4N0YH 3DXAB 5AAWA 1NUNB 1EX0A 3GBML 3AS1A 1HDMB 4MXVE 3UTTD 1QRNE 1T5XB 1V05A 5FCSH 4PJGB 3C5SA 1RVFH 2Y07L 2B4CH 4MD5B 4LSPH 1XIWC 2VE6B 1Z3GL 1DE4A 1O5DT 4QWWC 1FV1A 5EOQH 5IB4A 2NY6B 3CFIC 4YC2C 4YZFF 5LKNA 2ATPA 2YD6A 2ZUQB 3G5XA 4JO3H 5DYOB 2NW3B 3D0VA 4R90H 5B38G 4P46C 3LV3B 1EA9C 1UXSA 3CUPB 4NBZB 3L7EB 8FABA 3VDBA 3RDTC 1S5IL 2AS5M 4TUJA 1S9YB 3BAEH 4M9OA 4Y5VA 1NAML 4CU8A 3CSYA 5EUOA 3L3DA 4X6DE 3ZKSD 3WFZA 4Z76B 2HH0L 5HGGS 2NX5D 4PJEE 5A3ID 1G7LB 1R5IB 2NLJA 1VCAA 3GSQB 2YSSA 3OR7A 4K23H 1HE7A 5DQJB 1BQUA 2DKMA 3ESUF 4XVUD 4DCQB 2F19H 4WHYH 3TJEL 2M26A 1IGTA 3FRUB 1J1PH 5I73B 4HKXA 1FFPB 3DGGB 4KGJA 4I8DA 1RZ7L 1DBJL 4I0PA 4HK0A 1U6AH 2ZNXA 3LIZL 3Q5YA 5EO0A 4EZMA 3FB6B 3GMRB 4X6FB 3WFDL 1X4YA 5BRZB 1B9ZA 4JHWL 1RZJC 5AD0A 2Q86B 4G9FB 2BSRB 5TE6H 5DTFA 2F58L 3RY6A 3OJDA 1W0WA 1K4CB 1OF2B 2RFXB 4O00A 1KV3A 1T20A 3K3QA 5LGJB 1WVZA 1ZGLM 3BZ4A 5LCVH 1E4XL 3PL6A 3WS3B 5SV4A 1IC4L 2GFBA 2FR4B 2Q20A 5HYJD 3L5XL 2VDLL 2F54A 2ADIA 2DLIA 1NCDH 5GRYA 4LARH 3GIZH 2COQA 4MJIA 5E9DE 3MRIB 4NZRL 1VESA 3JWDC 4QHMA 2BRRL 3VG0L 2J6EL 1NC2A 1HI6A 5D6CB 1E27A 5K9KB 4U6HB 5E8EB 4XX1G 3FOMA 5C0JA 5I19H 3TZVC 5HD8D 2A6DA 5D9SA 15C8L 2YA1A 3WE6B 2NY5L 1UJ3B 3RKPA 5L2KB 4PY8I 3SO3B 1ZHLB 4XBGA 3PWLA 1KXTB 4HWEH 3ZTNL 3ARFA 5C0RL 1P4IL 2C1PB 1GGTA 4JZNA 4JG1L 3RWJA 4M6ML 4ODUB 3LKNA 1GGIH 1NAMB 4RGOL 5FKPB 2D9CA 3HRZB 4NC1C 1SBBA 3QUXD 1QR1A 5EZLA 5EU7C 2AABH 4M43H 5AYQA 5BV7C 1H3PL 4U49A 4PJXB 5C2UB 2EECA 4HGMA 3I6KA 2VZUA 5HHVL 4YH6A 4MMXC 3WJJA 4Y5YB 3V0VA 3S4SA 3UTQB 1AR2A 1ORSB 4HFUL 3NCCB 1AY1H 3ROOB 5F7UA 3W0WD 3EOAA 3FMGH 4WW2A 4OAWA 1O0VA 1YEJH 5DWUH 4BFIA 1D9KD 4YHLH 2A77H 3FN0L 3RWDB 1ITBB 3BEVB 5IBUG 2A83B 2IFGA 4JE4B 1ZWIA 3H0TA 2XNAA 3EJYC 2APWA 3MRNB 4YQXH 1BPVA 2DN7A 4U4BA 2L7UA 1RZIA 4Q6IB 4HIXL 3D9AL 5DZLA 2VABB 4X7FC 5F8RC 5I1CH 3AREC 4PD4J 1HCFX 4F7CB 5IQ7L 1MAJA 1SM3H 3MLZH 1FVDB 5D7LD 1R5WB 2YD2A 4X80H 4E41E 5DI8A 4JFDD 5E4IA 1CLOL 3GMMA 5FYKE 1NPUA 2HT3C 3DVFA 1A6WL 3CVHL 4RGNE 2KPNA 4GRLC 1M1SA 1GZPA 1FNLA 2F74B 3DIFB 4QRTB 5FECA 4Q9RH 3W39A 3FRPG 1S9VB 1YY9C 1EEZB 4IMKC 3ULSB 1ED3A 3T1FA 3L3GB 4HZAA 1QRND 5BQ7B 1MJJA 2R8SL 2APTA 2B8OT 2DQGL 1BD2B 2ATKB 5E00A 1VEOA 4QRPE 5HGBB 4ZSOB 3BP6A 1FPTH 3MUJA 2GSIA 3UO1H 1MFBL 4Y2OA 2AERT 1QLFB 2DQUL 4CVZB 3S8WA 1RPQA 1FZOB 4P4RB 4OZIB 5GGRB 3RJQB 1ADQA 2VR9A 1FFRA 3FO1B 4ENED 3KHOA 2JIXB 4HHAB 4UIMB 1KEGL 5D7SH 3IU3B 4XCCL 3RZCB 3T77B 4JKLA 3T3ME 3Q5TA 4ZXBC 5IGXH 4IS6A 4U1JA 3MLXH 1GYAA 1TPXB 2V17H 1M71B 1Q38A 5KVGH 5C71A 3AB0B 3ILQD 4RAUA 1YZZA 4TN9A 2ICEA 2Q7YA 3CLEH 2GCYA 2BDNL 2ED9A 1OGTB 1J87A 1OM3L 5LQBH 1P7KA 1CD8A 3GBNH 5C0GB 3QXDB 2W9EL 4LSSH 2I25N 4KK5D 4TNVF 2M1KA 3ARGB 4C54A 4NP4H 5I18L 3LQAL 2Z92B 2E27L 4HULB 5IFJB 1INQA 5C07A 2FBOJ 3FT3B 3RI5K 1IEAA 2JELH 3GMNB 4L4JA 3E8UL 1B0WA 1HHJB 1NCCL 3MV9B 4JANB 3BE1L 2J12B 1CF8H 4EN3C 5F8QC 2SEBA 3RVUD 4LLMA 4Y5XA 3CVHB 4YHKH 1WFTA 5HHNB 2AV7B 2FD6H 4UZGA 5T1MA 4RFEB 2VLLA 5AWNH 2IC2A 3SJVD 3ZL4H 4G9DA 4JM2C 2EIEA 4KFZC 1ORQB 2ITCA 3RTQA 4U0QB 2B0SL 2EXWC 1JJUA 1BWMA 5ETUA 4KK6C 3IJSB 2NR6D 5D6DA 3KPOA 5JQHC 4N1HB 5I1AB 5FK9B 5JXAH 2Z4QB 4NWUL 2VL5A 4TRPL 2VZVA 1I1AB 4PGBB 3G08A 4PYHA 1CDYA 1KJMA 5DUBB 1WZ1L 4TPRL 1I8MB 1CGTA 4G6AD 4MJ5B 2FO4A 4Z7VA 3QG6A 3UDWC 2P8LA 1RUAH 2YZ1A 4HS6A 5FKAB 4FFVD 1CFNB 3F7PC 4PJFB 1A3RH 3NIGF 4WUKH 5CIPA 5KSVB 1AP2B 2QBWA 3QNZA 4IRSC 4HJGB 3PWUA 5JHLH 3QO1B 2H2SD 4PJHE 4PJAE 1RZJH 4NQEA 3WIFB 1ETZA 1YN7B 3CFCH 3HPLA 1QBBA 4WWKD 2W60B 3ULUE 4X6EA 1FYTE 2L4OA 3S88L 1AGDB 2YWZA 1YJDC 3VE0A 4PR5A 2MCG1 4X6CF 1CLYH 4APQB 3LN5B 1RSFA 3MCKA 2C4FU 1FORL 1IAIH 4NNYA 3VWJB 4DGIL 4H1LG 2EIDA 4WV1A 5IR1A 5DUML 4PRBA 1I7UA 1VFAA 3C09B 1XMWA 3I2CL 3JWDH 2VKXA 5KSBA 2XQBH 3R8BB 4PB0L 1DANU 1IKNA 5E2WL 3ARDB 3MA9L 3O3AB 4Z7UB 1T5WB 1G0DA 3EYQC 4MCYA 2R2CA 4X4ME 32C2A 4BH7A 5GXBB 4GT7A 3UPCA 1A1NA 2D03L 3NPZB 1HQ4A 3STLA 2C3HA 1ZANL 4MAYB 5DVOA 2AJZB 2C4FT 3LPWA 4H88H 4L8CA 4XCYA 3ZKNC 2FCBA 3B9KA 4PGEA 3VXNB 1HYSD 4FXKA 2ZG2A 5E24E 5HHXH 5BV7H 2B5IC 3C5SB 1JPTH 2ZJSH 2RR3A 3PDOB 4E41D 5MEND 5I15H 3SE9L 5FYKD 2BNQE 4N0YL 3OGOE 4RGND 1DE4B 5IW6A 3VCLA 3MREA 1DP0A 3MJ9A 3DRQB 3AROA 5JHDA 1J8HE 5D1ZB 1RVFL 5K59F 3RWEA 2FJFA 1YEDB 2EDKA 3I3DA 5TQ0L 1JK8A 1A6AB 4QGYA 3KJ4B 4NO3B 4ERSH 3QB7C 1N64H 5KS9F 2DM2A 2IPUG 4Z95H 4JQXA 1MCNA 2FEDD 3VXMB 3QH3A 1VACA 4JO3L 3AXLB 4OQTH 1H9VA 4WI8A 4OZFB 1SJEA 2EDFA 4R90L 5ACZA 4OTXH 1WLHA 3BUTA 4LCYB 4U0RB 1U8JA 4LLQB 3STBA 4KVCH 4LMQE 5HGAA 1HOCB 3B9DA 1X5JA 1JPSL 5D5MB 2E7LC 4XAKE 2Q6WA 2LQRA 2AJVH 3QCTL 4F9LA 5BJTB 3BKCH 3KXFE 2QTEA 3L3KA 4PY8J 3QUZB 5IMMA 5EFIB 5F88B 2JB5H 2QQKH 3MA7A 2YD9A 5F3HB 3W82A 2FDBP 2OX5A 3NCFB 4X5XA 4ZUTA 4K23L 4PG9A 5I9QB 1WFUA 4Q97A 4RFOH 3V4PH 2E7BA 3BKYH 2F19L 3VWKD 3VGAC 1LQSR 4CGTA 1J1PL 1HXMA 2DLTA 2YBRA 2W0LA 5KAQF 2E6JA 1A6UH 1U6AL 4F3FA 3PE9A 1CDBA 3QIBC 1J05B 2X4NB 5CLTA 5I8CA 4ELMA 1BP3B 1JGLH 4C56A 2ZOLA 5TE6L 1W72A 1WFOA 1LO4H 2P24B 4MGXA 3O3EB 3MLWL 2W38A 1UH2A 2HRLA 5HVWA 5FB8A 3PXJA 3BMVA 3MROA 3MV8A 5LCVL 4J8RB 2GK0B 3BSZH 5FYLH 3FOMB 5DEFA 4MD4A 1JUFA 4L9DA 2DJUA 1NCDL 4LARL 1DN0A 3GIZL 1UWEH 2P48B 2P8MB 2P49B 1MFDH 5FDWA 3O8XC 1L7IH 3BZDA 4U33A 1S7TA 4KV5F 3SDDB 5GRXG 1N3NB 5TJWK 3PQYB 5C6WH 1DQJA 5JNYB 2Y4SA 3FFDA 3G6JF 5EZLB 4NNPH 1JTTA 2ADGA 4HWEL 3P11H 3ZE2E 3AMLA 5LGHH 2HJLA 3NCJH 4N9OB 3B5HA 4ONFH 4OZGB 5ERWB 1IFHH 3DMMC 4Q74A 4W70A 1GGIL 3IDIB 2V5YA 2WNGA 5KW9H 1WBXA 3BI9X 3RGVC 4RRPG 4M8QA 4F80A 4QY8B 2W91A 1LEGA 2H26A 4ZO9A 4M43L 1MEXH 4O2EB 4BH8A 3ULUD 1TMCB 1FYTD 4HX1A 4I3GA 2ZUVA 3MOAL 3V4UH 5BW7C 4UTAH 1CLZH 3HE6C 3O11B 3VXQA 1AY1L 3VG9C 3GSRB 1MI5A 3B3IB 3NTCH 3DX8B 5CKGA 3HE7C 3FMGL 4QGTA 1Z9LA 5FM8A 3S3SA 2ZSWB 3WHE0 1YEJL 5DWUL 2XG4A 4NZTH 4LIQH 1S8DB 2ZUXA 3MACH 2A77L 5D1XC 3QI9A 4KROB 4Q6YA 1FL3B 1S7VA 2ARWA 4YQXL 3DX7B 5DI8B 5FA4B 3QDJA 3HMWL 5E6YA 1YPZF 4MNQA 4UIKH 4U7KA 5I1CL 4U1NA 4L9LC 1RMFH 3RNKB 3O6LL 2DB8A 1FJ1B 4XH2A 3NPSB 3L3OB 4PS4H 4RIRB 3QDMA 3JBG7 4NJ9H 4L8SB 2N56A 1A7QL 4L3EE 2V9QA 4PRIB 1DEEA 1SM3L 3MLZL 4TULH 1MQ8A 4XX1E 5C70A 4YFEA 5J0BA 3O41B 1YJDH 3NCYS 1G7IA 4MA1B 2HTLC 4WI9A 5JZ7D 3D3VE 3IT8D 1CICC 3ZDZF 1LP9F 3MO1A 1H0DB 1MHEA 1PY4A 2Z31A 4I3SH 1LEKB 1YNTA 2X7LB 5FF6B 1R6VA 2FBJH 2NNAB 5EU3A 4RMQA 2C3VB 1BFOB 3PGDB 4Q9RL 2BNQD 3IB4A 1QSFE 2C1OB 4FP8H 4ODWB 3X14A 5CFHA 5AG8A 5HHOA 3X11A 3VXTB 3L6FA 4X4XB 1P9MC 1I7RB 4AIZB 4N68A 1KJ3H 1HHKA 4R2GD 5C0AE 4PJ8A 4K9EL 2D0HA 1S9WA 1MPAH 1FPTL 3UO1L 1Q9OA 3UBXA 1F4WH 2A6JA 2GT9B 2YPVH 3NIDE 4P2OC 2YD1A 5DJ0B 3C60C 4OQ1A 4OD1H 4GS7C 3DVGB 4S1RH 4ETQA 3GJFH 1ZA6A 2WLYA 3O9WD 4XHJD 5D7SL 3BP5A 3TCLB 3CC5B 5IGXL 1ZAGA 4IOIA 3RIAF 5FO9A 4IM8A 2CRMA 3L3HB 2V17L 5KVGL 5KVEH 1JMZA 1L0YA 4QO1A 3LN4B 5EORH 3CLEL 5E6IC 3D5OF 3PHOB 3C5JA 3MBEB 4XNUH 5TGBA 1KG0A 1KPVB 4RAVA 5JXED 3MFFA 4R96B 5LQBL 2PO6C 4LVEA 3N06B 3WKML 3GBNL 5LVEA 1C8PA 1X5LA 4U3XA 4LSSL 4UQ3A 1NEZB 3GK8H 3LQMA 2BOBA 4P9HC 3IRPX 1ROWA 3PJSA 1WBYB 4L3CA 5ANMA 5BZWA 1JI1A 3P4OA 3FB8A 5FUCE 2X9WA 2N7AA 3MUGB 3EFDL 2JELL 5CILH 3DOSA 2BCKB 4YE4H 1NCWH 4FXGA 5I1JH 1CF8L 2EDLA 2HJFB 1I1CA 1ZVSB 3U2SB 4LLYA 4YHKL 4IHOB 3KPLB 2FD6L 4AJ0A 4U6YA 2HWZH 1MUJA 2JCCA 2FL5A 3WDJA 1Y18B 4I4WA 5AWNL 4YHNB 3W9EB 4G6MH 1V7NH 3ILPB 2LTQC 4D0CB 3ZL4L 2IEPA 1UM5H 3QQ9C 2MQCA 3CX5K 3ISWA 1FL6B 2X6MA 4HW6A 3WFHB 4HUXA 1K4DB 5GJTH 3NCYP 2O93L 1FGNL 2DTSA 3JV6B 5DFVD 4EEEA 3WD5H 3FZUD 1C16A 3LH2H 1V5JA 5IHZA 2WIMA 2DLGA 3O2VH 1PKQE 4YGVA 3RL1A 5I76A 5CZVH 2X4OB 1SHMA 3QDGD 4LF3A 5DD6B 4PRNA 1QFPA 1RUAL 1H3XA 4QYOA 1A3RL 4YIQB 4CNIB 2X4RA 4WUKL 3VU2A 3CH1A 4M7LT 4GUPA 1S7RA 4JAMA 1D5IH 1EEYB 3QQNA 1IRAY 3B2VH 1HHIA 3VFUA 2FH8A 5JHLL 2VXQL 1RZJL 1U8IB 3CFCL 2YWYA 4Z9KB 3LKQA 4Y4KD 3KPRE 5EBWB 3VFTB 4HIHB 1A6TA 2PNDA 1CLYL 3U6RA 1E4JA 4G8GB 4ODBD 4PJ7A 4FZ8H 5D2LF 2YS4A 6CGTA 3A6BH 1IC7L 3CPLA 2CQVA 4MZ3A 2PYEE 1UQSB 1G1CA 2XQBL 4NSKB 5LBSH 4Y16C 5DRXB 4XNQA 1WZMA 4HFWB 4CVXA 3PWPA 4YC2B 2FJHB 1K5NA 3K4DA 4XPHH 1QO3B 4P4KC 3MJ7A 3C5ZC 4W81A 2EC9T 1DBKH 4P46B 5IB3B 2EDTA 4IRJA 1U58B 1KB5H 1CU4H 4XWOC 2Z91A 1XCQA 4D9LL 2BNRE 1TTFA 5C08E 3H42H 5SWSA 4LQFH 2AI0H 1XGUB 5HHXL 4O4YH 5BV7L 1NDMA 1PX3A 4L3ED 2ZJSL 3REVB 1YC8A 1GZQA 1ONQB 1CQKA 5I15L 4QHKI 3QPQD 3D3VD 4HJ0D 4Y2DA 1S7XA 4UBDD 4YHOH 4NT6B 4PG2A 5SV3A 3P9MA 1XAUA 1UB5B 2MPAH 3OKOB 3CZJA 3X3FH 1QSFD 1LVEA 3VFSB 3CFBB 1G7QB 4HKBA 4X0KA 1MAMH 4TTGA 5F1KC 1ZHNA 3WNKA 4UI2A 4ERSL 3NFSH 1N64L 3PWJA 5C0AD 3QQ4B 4L4TA 4YDJA 5KS9A 2YEZA 3IDNB 1NGYB 4Z95L 2NXZB 5HHME 4HK3J 3SCMA 4OQTL 1CYGA 4OTXL 4OF5A 2YPLA 4NO0D 4ZUSB 2VXSH 5TDNA 4KVCL 1XR9A 1N6QH 3T2PA 4R3SA 3GB7A 4KJQC 4V1DA 4KMTH 1DBBH 5F3BA 4F37F 4P5TA 2AJVL 1EIBA 5KTEH 1FSKC 3HA0A 4XZUB 3BKCL 4KDTA 2JK5B 3P4MA 1ZHBB 2MQ0A 4G8EB 3TZVB 1AHWC 2EDXA 4Z7NF 3EYFB 5JR1L 4XB7A 2QQKL 2YRZA 1BVZA 1KJVB 5ESVB 5AZ2H 2BVEA 5F7DA 1C12B 5L0QC 3QEQB 4RFOL 1CI5A 1EFXB 3V4PL 2ZOLB 4BKLB 2DMBA 3K4ZA 4X99A 2EDOA 1JPFA 4ZUUA 1AGBA 5FB8B 3KS0H 4ALAH 1A6UL 3CGTA 1AQDB 3BKJH 1D5XA 4ZS6C 2LV4A 5BV7B 1JGLL 1NAKL 3C6LB 3ZT5A 4I18C 4QOKD 2D9QB 2E9WA 1LO4L 5IKCA 3HLAA 1FP5A 2EH7H 2DQJH 1X3DA 1DQTA 4WUUE 4ZYKA 1LO3L 2IAMA 3OTTA 1T1YA 2IGFH 3FO9B 5FYLL 2VDOH 3RQ3A 1A3LH 4ZTPH 2O26U 1UWEL 3BGAA 3O2DA 2XRAL 3BVNA 5A2FA 3L5HA 4AQOA 2W65A 1MFDL 4UU9B 1L7IL 2G75A 1UT9A 1G7MA 3D39A 3QIWC 2NY3B 1NMBH 4UOJA 3C8DA 5GISH 4BM7A