4P5KA

Structural basis of chronic beryllium disease: bridging the gap between allergy and autoimmunity
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
181
structure length
181
Chain Sequence
IKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 181
sequence length 181
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p5kA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p5kA01
3VRIB 1RK0B 2F5AH 3BJLA 1CGVA 3QDGA 2B8OT 1NSNL 1NCBH 4JCLA 5ICXB 4BH8A 2ZUUA 5FYLE 2OXGA 2JJSA 4X0KA 4J2XA 1F3DH 1YEDB 4NFBA 4NQCA 1U6AL 4JFDA 2VE6B 3BN9D 1Q0XH 1WZKA 1N59A 1AIFB 2K7PA 5IW6A 2FGZA 3TF7C 4YR6A 4NN7C 1T5XB 4YXHL 5C09D 4YBQC 5DJDA 1MEXL 3RFZC 5KBNC 4LHUG 4N1HB 4HKJB 5ICYB 1U8QA 2W0KA 3QI9B 4UOW0 4JO3L 4G7VH 5ISZA 2WSKA 3CX5K 3CFBA 1FPTL 3BEWB 4U1NA 3ULSA 1SJHA 4POZC 3LY6A 1FH5H 2AABL 4XPTH 4F33A 2DL9A 1ITCA 3V6OA 1N8ZA 4ZAKA 1BD2B 2C5DC 4LPTA 4JPKL 4P4KD 2ZUWA 4DW2L 3IXTA 1UWGL 4FQ1L 4K3DL 5T1KA 1AQDB 5F7MC 1FE8H 5I18H 3VXSA 1L0YA 3HG1E 3V4VH 2IH3A 2W60B 2WQRA 4UQ2A 1D6EB 1RULH 4L8BA 3MYJA 3QULA 3RIFK 2BNUB 3MYZA 5DQ9B 3T0BA 4LSQL 3PGCB 5A2LH 4MQXC 3U6RB 3H9HA 5E0QA 1L7IH 5DD3H 2DIBA 1YQVL 4FABL 3IDIB 3H3KA 3QUYB 2DQCH 3SDAA 4ZDHA 1FCGA 4ZUTA 1JNHA 3LQMA 5E2UH 1MHPL 5FDYA 3TBYB 3VDBA 3EHBC 4GRWH 4ZXBC 3MO1A 4ONOA 4OLVL 4OLWH 1FFRA 3KLHC 1RJLB 4F8TA 2WWKT 4QRSB 4OZHB 2Y06H 3W82A 3SE4A 1NAMB 4JFQA 4W4NA 4MJ5B 3ZDXE 4PY7B 1T2XA 3THML 1RU9H 3UAJD 2Z93B 5JPMB 3CFCH 3RWIB 1EBAA 3SDXB 1NGPL 1CLZL 5DJ8B 2BVYA 2VDOL 4C56E 5IFAH 3VRLF 3BESR 4RQQA 4LGPB 3SE3C 5C0NC 3O3AA 5F1KC 2X4OA 1U8PA 3O6LL 1CFSA 3AB0C 4UV7L 4NO2A 4KJPC 5KS9E 5E94B 4O5LH 3O4LA 4S0TD 3DYOA 1N0XL 3S4SB 3X3FH 3OZ9L 2NY3D 5BQ7B 3F5WB 5F21B 4QOKA 4HC1A 4HDIA 5BO1H 4O02H 5IIEA 1JUFA 4OGYL 1JNLL 3GSWA 4PGEB 4V1DD 2Y25A 1KTDA 4MA3B 4NQEB 4HJGB 3P9MB 4YDKH 4Q0XL 4GW4A 3TT1H 2HVKB 4PPTA 3AY4A 5B38G 5HDLA 3C6LC 1X5LA 1N5AA 2YD2A 4ODBD 1NANH 4MWFB 3KR3H 5ENWA 2VXUH 5DO2C 2LU7A 1WZLA 4KMQA 1ONQB 4QXTA 3FOLA 4MXWH 4Y16B 4MD4A 1KB5A 5CBAA 4UU9B 3HRPA 1E28B 4OQTH 4X4ZA 2R0ZH 5DD5L 3EYSH 5FIEA 3OJMB 3ZT7A 5D72H 5TGBA 3MA7A 3DX8B 5IB3B 3WXVH 1JPSL 2HKHL 3U2SB 3DXAA 3D85B 3QRGL 2DQHH 3AREC 3HC3L 4HS8H 3ARDD 1FNAA 1AGFB 3JV6A 4Y1AD 1RI8A 1HE7A 1P7QB 1B0GB 4G6AC 1KNOA 1G7LB 4NSKB 3FQRA 5FV2A 4KROC 5IGXL 3VG0H 3MGOB 1MLBB 4KRNA 1JNNL 1PYWB 4RRPG 4L8DA 3IDJB 5FK9A 3F12A 3RX7A 3BO8A 3HZYA 2VLRD 4G42A 2IJ0C 5EIQA 1G7QA 2HLFC 2RB8A 2ZNWA 2LTQC 2R2HB 2XKUA 3T65B 5A1AA 3AS3A 4U1LB 3RGVA 2AJVH 3P0GB 3L6FA 4G8FB 4Q7DA 3D39D 1NSNH 4XBPA 3LZFL 1UH4A 3REWA 4R9HA 4HT1L 2LABA 3WJJA 1CU4L 5CMAA 1NBYA 4KMTH 3HCVA 3WFHB 3IS0X 1S7UB 3X3GH 5DRNB 4ZOEA 2W9LA 4YE4H 5CIPA 2BJMH 3DROA 1NC2A 2FX8L 4O2EB 4RGNC 5GGQH 1V3KA 1XGQB 1YEIH 3CXHJ 4X5LA 1CD9B 5HD8C 3BRGC 5HYQB 2EH8H 4JB9L 1U41A 3LEXA 4DQOH 1KJ2A 4EDWL 2MTPA 1G7JB 3UTTE 1MPAL 4H8WC 4TVSa 1JGVH 2EDHA 1U95B 2AABH 3HG1B 4PJXE 5EU6A 1V3JA 1AGCB 4DN3L 3QHFH 2IFFL 4EI5D 5BMFH 3BSZL 4OCRL 3KNBA 3TA3A 4NQVA 3CFJA 2V2WB 3D5OF 3GZKA 4FQIL 4KV5E 5DVOA 5I1GH 1JF1B 4Z95H 1AR1D 1HYRC 2V2TA 3ARYA 2R1YB 3Q3GB 4XPGH 1YUHB 4C55A 5E2WL 5JA9A 1X7QB 1YA5A 4J23A 3D6GA 4Z6AT 3CFEA 4P23C 2FL5A 3DO3A 4HIEA 4N90D 4I18C 4QCIA 2EDFA 1P4IH 1NFDA 1JVKA 4X7TB 2P5WB 4S1DD 4J4PC 5KVFH 4X7DC 3MV01 2Q8AL 3ROLA 2A38A 1JP5A 4IMLA 4X9GA 1MCPL 1TNNA 3JWDC 2P24A 1JV5A 2X4SB 4DKDC 3U79A 1WCBB 2IPUK 43CAB 3V4UL 4K8RC 3T0AA 4I77L 1G7PA 5KSVA 1A6TA 2NXYC 3QUMA 5C3TA 3OPZH 2HT2D 3F7YB 4WHYG 3HNVH 1X5IA 2AQ1A 4NQXB 4WCYL 3DPBA 4ZODA 4X4XA 4R2GB 3D3VA 5KS9B 1HH9B 2DLGA 5F7KC 1M7DA 3QO1B 3TN0C 5EOCL 2AEQL 2L4OA 3BPLB 1CDGA 4WV1A 5AZEH 5IR1A 2Q6WA 1GGCL 5I73B 4U49A 4U4BA 4ODXA 4JO4H 5JXED 3C8HA 2APVA 3B4NA 4G43A 4CVXB 1YNTA 4LHUA 3GB7B 4ENEC 4D94A 2J6EA 4XPAL 4ZFFA 1T03H 2QR0A 2NY5L 1M7XA 3SY0B 5GGTA 1PQZB 5EIIB 2ARJA 1MI5A 3HMXA 4B7IA 1SJEA 4KRMB 4D3CH 3I6LD 3ZKQD 1JPFA 2MFNA 3BKYL 1UM5L 4Y19E 3KLDA 1H3PL 4L4TD 5F9OL 1F6AB 4KJYB 3QNXA 1L7TL 5HY9B 1E4XH 3N1QC 5CINL 2GEEA 3FKUS 1KULA 5I0DA 4KFZC 3D69B 3SDDC 1U58B 4KK8C 3BP7A 4P2OC 5E00B 4JG1H 4MJIA 2HTLD 5J3HC 3CZFA 1OAYH 1MCOL 1JWUA 1NLBH 1JE6A 4LP4A 1MNUH 1CR9L 1KLUA 1PVHA 3BZEB 3ULUF 4TOYH 3LEVL 3PWNB 1KYOK 4MDIB 4JDTH 1OTUC 1FFQA 3AS0A 3RWCA 3QPXH 3KLAA 1MCJA 1ED3B 5IEHA 3HNTH 2H32H 1YNKH 5I8OH 4FQJH 4X6EA 1MAJA 3MJ9L 5I8EA 5KANI 1I9EA 5IVXE 1QQDA 5JNYB 1IC7H 2CQVA 3RKPA 3BHBA 3R4DA 4NHUB 3I50H 4L8SB 3E2HB 3SOBH 4JY6B 4FG6C 1Q9LA 1GIGL 5J11B 3L3DA 1ROWA 1SQ2N 3DSFH 2FLBT 1MVFA 4HMDA 3NBNA 4XPBH 3RTQD 1FNFA 4OD3L 1KN2H 3FO9A 3VXMB 4AZ8A 2VLKD 4RISH 3O9WD 1BX2A 1PKQE 4FQCH 4WWKD 4APQA 4R7NB 1OTTD 4XGZB 4RGMC 1KB5L 3U9UB 1S5IL 1S3KL 1CFVL 1SJVA 3U4BH 1Y18A 2AAVA 3PL6B 4NCC2 2A9NL 3NA9L 1DBKL 3H42H 5GJSL 4WIQA 1K4CB 3QQ4A 4GKSA 4PJFA 4WGVB 3NGBC 4E0RA 4JRXA 5E4EC 3UDWC 5EU5B 5GRVL 4XP4H 5IJKA 1BFVL 3O3BA 5IP4A 5D1QD 4PJXB 2AGJH 2EDRA 4EEEA 4OM1H 1XGUB 2AK1H 5B38A 3OX8A 1S9YA 3OHXB 3PHSA 2C7UA 4Y4KD 5LGHH 5C0AE 4PJ9B 3EJYC 3CVIH 5TE7L 4PRHB 4NQDE 2WINB 2A9MH 4WU5A 4F7CB 1FYTD 1VEPA 5T3XH 1MCCA 2ADGA 1NPUA 3TV3H 1T0MA 2AJSL 1YEKL 4ODUA 1Z0NA 4G8IA 3HAEB 4Y5XA 1J0JA 4XCEB 1CLYL 2FNBA 1U3HC 1VGEL 4OLUH 1DQQA 4J12A 3O6KL 3BDXA 2ESVE 3U7WL 4I2XB 4LSUH 3WNLA 1U3YA 2MNUA 1C5BL 4JHAH 1HOCA 3MRMA 3A6BH 1GOGA 4WUUD 3G5XB 3L9RB 4J3TA 5ESQA 1VKXB 3ULVL 5D7KE 5T1DL 3FFCA 4RRPA 4TNVK 3T4YB 3AS2A 1U92A 4RX4D 1CGTA 1T2QH 1KJ2L 1JHTA 1MFDH 5KVEH 1TENA 4LRNL 3SDCB 4EVNA 4Z18A 3T3PE 3KPRD 4WTWA 3VXUD 2ED9A 5BXFB 2EDOA 2DD8H 2QL1A 2DIAA 1UXWB 3Q2CA 4HIXH 4I77H 4GKZB 5JPNB 5EZOH 1ACYL 3BRFA 2BSSA 4H1LB 3GSOA 1AHWA 4ZNEE 5L2KD 1FORH 2Z4QB 4RA0C 4AMKH 4JFZH 4F58L 5F3HA 3MRLB 4QRPE 3H3PH 3G08B 2PO6D 3BZ4A 3IJHA 4GUPA 3RBGA 3K80A 2APTA 2BVOA 3UX9B 1RUAL 2WNGA 2O5XH 4XXDA 4RIRB 4G5ZL 2QSCL 4OCMC 2B0SL 3RDTD 1FIEA 2EXWD 3OL2A 1S78C 2R2CA 3A6CH 4NZJA 3P3YA 3RL1A 2X4UB 4X6FB 3GIVB 3BGAA 3L3KA 3PWJA 3H9SE 5EN2B 1KUMA 4YDLC 3HI6H 3MLYH 5C0BA 4NUGH 4CW1B 2Z91B 5C7XL 3UTQA 2A83B 2FB4H 1I3GL 4H0HB 4ONHB 5EOCJ 1WFTA 2VDLH 4R2GC 3WSQH 2BRRH 2OZ4H 2AQ3A 4P46C 4PP1D 5TE6H 3WUZA 4GFTB 3B6SB 5C08E 2EIDA 4GBXB 4DJMA 3L95B 1MCNA 1KIUA 1UM5H 1BECA 1LWRA 4BK4A 2VLMD 1LO3H 3LN9A 1TJIH 5DJ6B 5IBLC 5KVDL 3RY5A 4PV9B 5HBBA 5FCUH 3RL2B 4LDEB 1NQBA 1OSZA 4XHJD 3DV4A 5KVGL 2N4IA 2WMPA 4FMFA 4OZIA 1BJ8A 4IDJH 4F9PC 2ZCLH 4S1SH 3WEXA 1A9BA 1R5IB 3LOWA 2R1XB 4XP1H 2GSIA 4PGDB 2MCPL 1OQOA 43C9B 4Q9CA 1V7NH 2E6QA 3EOAA 5I19L 3LRHA 4ERSH 2ZOKB 1EO8H 1T1WA 3RVTC 5F7DA 5CBEB 2R0LL 5GISH 4PRNB 4AY0A 2GJ6E 3RRQA 3BAEH 5L2JA 1CCZA 1A9EA 2JCCE 1UADC 1AO7A 3QWRD 5EU7C 1PKQB 3B8YA 1CGSH 1KACB 2DQFA 1I8IB 4XVJL 1WFUA 2DMCA 4PP2B 2EE6A 3KWWA 3GRWH 1FGVL 2UWEB 1BBJB 3P4NB 3AM8A 1KG0B 3PGFL 4U1GB 4ZUUB 4I48A 4M6NH 4P49A 3REVA 3D0VA 1TZHA 1T20A 4O4YL 1OAZH 1XFPA 2CIKA 4ONGL 2E5EA 4JR9H 5INCA 3GSRB 1FDLL 5IB2B 3NVQA 3L5WA 1WUNT 4MNGE 4GG6E 2F54D 5DMIH 5IB4A 3QUKA 4OFYA 5DHYA 1NCAH 2IANE 1FO0H 4KAQL 5FKAB 4P2CG 3BQUC 3I02A 1S9WB 5C0DA 4KDVA 4OFPA 1J0KA 2XRAL 4UT9L 4PB9H 5K33A 5HI4D 3D2UB 2C3XA 4XWOC 2AV1A 3CVHA 2A2QT 5BW7A 3C60B 3R06A 4Z7QF 2CDFB 4JKMA 1BIHA 2Y6SC 4FQXA 5MEOA 1LP9E 1WEJL 5IHBA 4YO0B 4WNQA 5ERWA 2B1AH 2F53E 2FGWH 1YN6B 4H25B 3QDMA 1HHIA 1PG7X 2PXYB 4OQTA 1ZGLA 1ZGLM 1WJ3A 2GHWB 1DVFD 5IMMB 4A6YB 4CMMB 2GAZA 3C5ZA 5CUSH 2DDQL 3MGAA 3LS5L 2P45B 3DTXA 5C9JA 1FFOA 1WBZB 5JZ7C 1IKFL 4KK9C 1F4WH 2G2RA 3VXRA 3DMMB 3FQUA 3HR5A 4IJ3B 4UAOB 2OL3B 1GL4B 2XT1B 3BZFB 5D5ME 3MLVH 3DBXB 3FB8B 4NRYA 3DVNB 4PGJA 5GGUB 4CBPA 1BM3L 2H8PB 4RMTA 1M05A 2I24N 2VL4A 3O2VH 2E8ZA 4Y5YA 3O6FA 3VWJA 3ARPA 3CAFA 4X9FA 4NOFA 1J05A 5F9WC 2V17L 4R8WL 3DGGA 4JM2B 1I9IL 4FFZL 5HGAB 4P4RB 4G7YL 2XQBL 1X5KA 4XNQB 4OGZA 5DQJB 2HN7B 1R3KB 3JUZA 2YBRB 4JPWH 3HHRB 1E4KC 5E99H 1ZV5A 3GMLA 2V9QA 3MUJA 2RJMA 4M61B 3QH3B 5SWSA 2FEEL 3BD5A 1YDPA 1PAMA 3T1WA 3CUPA 1HXYA 3DIFA 4LKXA 4QRPB 4FFVC 5FB8A 2WUCL 4R6UA 4R26H 1CD1B 4NGHL 4MNHB 2B20A 5EO0B 4J1UA 5I1CH 1WTLA 4MB3A 3TH4T 4UIMA 5IMKB 4JRYE 4TN9A 1UJTA 2X40A 3BOVA 4BFGA 4DKFH 3H9SB 5HHVL 4DGIL 2NLJB 3NN8A 4F58H 4Z7NE 4H26B 1Z5LB 2D7NA 5JTWA 1WT5A 1F4YH 1A8JH 2Y23A 3RWEA 3CPLB 1QBBA 5KZCD 1RMFH 5IVNA 5AYUL 4WU7B 3M8OL 3RHWF 5C08B 3P2TA 1GJIA 1A4KB 3WUWG 3RWHA 1LO2H 4DGYL 2IMNA 2ARJQ 2Q3ZA 4LVNC 5E9DB 4HF5H 2D03H 4RGNE 5C6PB 1RUMH 1YECH 4N8VB 4KUCF 4QHLB 4WWID 5SV4A 2VDNH 4GRLA 2DQGH 4FTVA 3DOSA 1SMOA 1UYWH 5CEZD 1HQRA 4WJ5B 1WAAF 1U8MB 1EXUA 2HP4A 4J6RH 1I7ZA 3U82B 2NQCA 4F7MA 1OAQL 1TZGL 4PJIA 4PLKD 5DURD 3MX0A 1A1NA 4JFPB 1KIRA 2YMXH 4HIJB 3FONB 5IEKB 4LVEA 5C0FB 3QXUA 4KKLD 4MVBC 2CIIB 3QR2A 5KG9B 1I3VA 3HB3C 2JCCB 1JL8A 5ELIA 4OFKA 3QIUC 1LMKA 1A3RL 1J88A 1IAII 2IG2L 5A2IH 2OX5A 4WFGE 5BZWB 1JTOA 1F97A 3C6SA 2FO4B 5GGSA 4Z7VA 3GI9L 5DLML 3ARQA 4Y0GA 2Z8WC 5ACZA 1OGAD 4MAYA 3T0ED 1YEHH 2BFVL 5HHPA 4FQHA 3GMNB 3LCYA 2HTKC 4MNGB 4NYLA 2NXZB 3GKZA 1XIWB 1FGNH 2ZG1A 5IBUB 1IC5H 5DS8A 5D7JD 2F58L 1FGVH 5HYFA 4LLUA 2Y5TB 1QNZL 1Y6MR 2OSLB 2VH5H 4M1DL 3V7AG 3Q6GH 1PX4A 3QIWD 1PG7H 2NNAB 3VFPA 3PIQA 4ZFGH 3RIFF 4Z7WF 3UCRA 6CGTA 2WK2A 1LP9B 4FZEH 4MA7L 1DQDL 3PG2A 3MRIB 4ONFH 2F53B 1F4AA 1EHLL 2ZWLT 1BVLA 2ENSA 7FABL 1CBVH 2DLFH 2YPLE 3G6JE 5EBWA 1JJUA 2V7HB 1R6VA 1FFPB 4NUJB 2WW8A 3CLEL 4D8PA 3O2DH 4P3DB 3R0MA 1PGRB 3LPGA 3MXVL 3KPLA 4D0BB 4HUWB 5D2LB 2ZOLB 4IRZL 1ADQH 2H1PH 5E08L 1GGBH 5D5MB 3TPUA 2BY1A 3HE7A 4P5TA 3ARGC 2LVEA 3HZKA 1TITA 3IRZA 1Q1JH 3SE9L 3IFOB 2PUQT 4JRWA 5HYEA 4DUWA 3IRPX 3LEYH 3EOTL 2DDQH 4JZJB 1PEWA 2DQJH 1W0WB 3FQNA 1FRGL 1BJ1H 5SX4I 1DZBA 2J2ZA 3B3IB 4ORZC 4NFDA 5KSAB 3MNVB 3VXQB 1JHLL 2MCG1 1G1YA 1K6QL 1CQYA 1S7WB 4LLDA 5FYJU 4LIQL 3ULUC 1JZ7A 1RV6X 4U1JB 1RZKL 4TVPD 5GSRB 1S7QB 1TCMA 3LQAH 2C26A 3PP4H 2H3NB 4ODSH 3W11C 1HI6A 1OP5H 1KIQA 3EJJX 1I8KB 4AG4H 1OAKL 3CVHL 3QFJB 5EU4A 1S9KC 3O45A 2EDTA 5J1AA 3D1MC 1HWGB 4OIAA 4HUUA 4FA8A 2VDMH 1PY9A 3FQTA 2OJEA 2ILLA 1ITBB 3O6MH 2B5IB 4MAUL 4JHZA 1AQKH 4N0CC 3GO1L 4X9IA 3KDMA 3B8SA 2NW2A 2Z8SA 2GKIA 3GMRA 4UBDC 3MBXH 4QO1A 4TQEL 2PCPA 1V5JA 5H2BB 3CU1A 2V7NB 3A0OA 3GIZL 3B9KD 4Q9RL 4PIRF 5CZVL 1VADB 4LNRA 1RK1A 5JDJA 2VITA 2XZQH 4QHNA 3VH8G 4P2RB 3B9AA 1F90L 1KCVH 1LEIB 4NGHH 4Z7OE 1FNEA 3VXTA 4L1DA 1HNGA 4RMRA 1NBZA 4PRIB 3BEVB 1UJ3A 1N7ML 5C9KA 1Y0LB 3KPTA 3P9LB 1EFXB 3D48R 1AKJB 4X80H 4Q6IA 1UT9A 4HXBL 4X6BB 3Q1SL 3T4AB 5EU3B 3KPSE 4AQOA 5KTEH 3IT8D 4X5WB 4W6YB 4O2FB 3WE6A 2OJZH 3UJTH 4RGOL 4R7DB 1J8KA 2VN7A 5L0QC 1VFAB 2VIRA 2J7LA 1MFCH 2YK1H 5DK3A 3QUZC 5EOTB 1MAML 3MRGB 2X4QA 3MV9A 1KJVB 4YHLL 5KW9L 1YN7A 2FJFB 1QVOB 4NKOB 3U46A 4X5XB 5ISZE 2VC2H 2WBJA 1C5CL 2J4WL 2C1PA 1N6UA 4HFWA 5B39G 3SJVB 2X09A 3IU4L 4M93B 4JHWL 1R3HB 5LBSL 2IAMB 3T0VA 4JFYA 2BOBA 4YJZL 1SY6A 4Q2ZB 4ZOAA 2BSRA 5EPMB 4HWEL 5DHVA 2Z31A 5ILTH 1R3JA 3TPKA 1BZ9A 2D7MA 1F3DJ 3BKCL 3S6CA 4C4KT 5IT2L 2CRMA 3O8XB 1OP9A 4XVSL 3N1PC 3VXSE 3E1F1 4DVRH 1RZ8A 3WFEH 3SDYL 4MJ6B 1N6VA 4LLQA 1QLEH 1KCKA 2R9HC 3Q48A 2GTWA 1LO0L 4L3ED 3K4AA 4TULL 5DJCA 2P5ED 3RAJL 5FOJA 2XWTB 4U33A 2E9BA 1TZIA 4JFFA 1MFAL 2AK4D 2J8OA 1V05A 5IQ7H 4X8JB 4M43L 1G7HB 4KQ4L 5B21A 3LRSB 1QHOA 1UEMA 1NEZB 4LLMB 1FSKB 4UV4L 3W81A 5AWNH 5HDQL 4PG2A 2NY6C 3QDJA 2R4SH 3L5IA 3QXAA 4XMLL 5T1MA 4AEFA 4YXLH 2GITB 5B8CC 3RVXD 5CD5C 1N64H 3BIAX 1XGPA 4H0IA 1GC1L 4KKBC 4OTXL 3LKOB 4YBQD 2XTJB 4HKZB 4H20L 4OV6F 5D8JH 4P57B 3K2UL 3WCYA 2YPLB 3KYOA 4IIQB 2EYRA 4HCRH 3U36B 4ZYKA 1RAMA 4DWHA 4G6KL 3ARTA 4XAKD 4YWGL 2GI7A 2HA1A 3QWQB 4G6JH 1D9KB 3C5JA 1OD7A 2XZCL 4EN3B 3WUWA 2ZSWA 3W9EB 2YD9A 4MA7H 4OZGF 4FP8H 5LCVL 1IGYA 1R24A 3MCKB 5MEQB 2WUBH 3RP1A 3RVUC 2YS4A 3O4LE 1RIUH 1T2JA 2JELL 4R0LA 4IDLA 1T21B 3CIQA 4P2QA 1QP1A 4CMHB 5L8JB 3AU1A 2QV2A 5FCSH 1AXTL 1YEJH 4OUUA 4MHHG 2WM0A 3LD8C 4W4OA 3WKMH 5BZDB 3KLSA 1XF5B 2I9LB 5TDPB 4OSUL 1FP5A 4DOHE 3KPOA 1HDMA 3MROB 4TSAL 2NX5B 1EIBA 4EKXA 1A2YA 4V2CB 3PWVA 3HE6B 2GTZA 1WSST 2YZ8A 4HD9A 1J8HB 4XNYH 5KSBF 4FFWC 2IQAA 4QRRD 3V4PL 4L5FH 4PRBB 1OF2A 4B0MM 3G6AB 1QO3A 5SWQB 1YPZA 1CN4A 5EUOA 2EO1A 2YSSA 3OKOB 3KLHD 4PREB 1L9MA 3P4OB 4OCSL 3RWGB 3VI3E 3VA6A 4ZS7H 1P53A 1WV7T 4R96A 4Y2DA 1NGXA 1YEGL 2UUDK 1CG9A 1H3UA 4QXGL 2LAGB 1QLRB 2ORBH 2WIMA 3TCXA 2AXFB 1DDHB 3EYUL 4U1IB 3P11H 4U6HA 4XBGA 1TVHA 2EE3A 2A6JB 5F44A 5C07D 1LK3H 1TLKA 4OLXH 1NCNA 1AXSB 5I75C 3OV6A 2PETA 5HVGB 5C70A 1FO0A 3KXFD 2PNDA 4LARH 1C7TA 3BZDA 3GMQB 3IDYC 1PDKA 1DBJH 4PJ5A 4UQ3A 4F2MB 3IFPA 5C0ND 1HN1A 2ERJC 3VFGL 3MLWL 5GS1C 2M26A 3F6IA 3QDGB 5EU7E 4LSRH 5DT1H 4BH8B 4F15B 4LSSL 1INDL 3CZJA 2BNQE 3VGDA 4X0KB 1L9NA 4UNUA 2HG5A 4E41D 2V5YA 2CJUL 4NQCB 3L5JA 3NCYS 5C8JA 4JFDB 1DEDA 1U0QA 1LO4H 1N59B 4GH7B 5IESH 5IMLA 5IW6B 4JY4A 5C0IA 4OCXH 4YR6B 4LCCC 1QR1A 2APWA 2ED7A 5DJDB 3ZE2E 4XC3L 3KYNA 3HR6A 3PWPA 3RY6C 4BSJA 3VRJA 5EZJA 2R8SH 1U8QB 3D25A 3C6LD 5ISZB 1KXTB 4HGWA 1U8IA 3CFBB 4HEPG 1MCBA 1VDGA 4U1NB 3Q1SH 1MWAH 3ULSB 1SJHB 4OCNC 2O26U 3J8F7 3I3BA 3DHJA 1AD0A 5DO2D 4F33B 3TIEA 4JQXA 2E7CA 5FHBL 5DMKA 1KOAA 1J1XL 5DJZA 3BT2H 3HI1A 1N8ZB 2CLRA 3H8NA 4ZAKB 1G6RA 3IXTB 5FUZH 5T1KB 3EYQD 1V3MA 4K3EL 2CPCA 3VXSB 4ZUSA 2IH3B 2B1HH 4JHWH 5F7LB 3NCJL 5LBSH 2XZZA 2HKFL 4UQ2B 1N4XH 3RNQA 1RJZA 4L8BB 2DRUA 4YFDB 1QD0A 5I16A 4JFXA 3MYJB 3JSSA 1MJJA 3QULB 2XN9D 1EVUA 1IEAA 2J5LB 4S2SA 3H9HB 4X99A 5AZ2L 5GS2D 1R3IL 1ZANH 2MQ0A 3AMLA 4ZO9A 12E8H 1CICA 4YHKH 1GCFA 3SDAB 4ZDHB 4ZUTB 1JNHB 2J8HA 5JOFA 5BRZD 3RAJH 2HLFD 3D39A 4OT1H 3MO1B 4X6DA 1MFAH 3FRPG 5AD0A 1A1MA 4W6WB 4X7EC 1J5OL 1EUUA 4HUKB 1NFDE 4JFQB 1SYVA 4JAMA 3TZVC 3VH8A 1G6VK 3A6OA 1P4BH 4Z8FL 1CGYA 1SY6L 4HPYH 3VU2A 3TO4C 1QRNE 2BC4B 1UM6H 1SEQH 1RIHH 4Y2OA 3FN3A 4ESKA 1FC2D 1NBVL 2HWZH 4RQQB 1HEZA 3QCVH 3O3AB 1NCWH 2X4OB 1U8PB 4OF3A 3ZSTA 1CFSB 1NUNB 4NO2B 2JB6A 2CUIA 2JJTA 5HD8D 1VFMA 1KELH 2X4PA 3O4LB 5EWIH 5CKAA 5CAYB 3IJYA 2EDBA 1FSKC 4TNVF 3MLUL 4QOKB 4HDIB 3VMOA 3ORJA 1J18A 5IIEB 1JUFB 2B2XH 3GSWB 1K4DA 4LLYA 4L29A 3T77A 2YXMA 1KTDB 3MV7A 3STZA 4GMTL 2F5BH 3I75A 1MUJA 4GW4B 5C0RL 5JW3L 5B39A 1MI5E 4P9HH 5A43C 4U31A 2ICWA 1N5AB 5SWZD 4HLJA 5CEZH 3IDGA 1UCBL 5ENWB 1S9XA 1D9KC 4QHKJ 3VFVA 4K9EL 4QXTB 3FOLB 1I1AA 2VQUA 3N1FC 5DC4B 4MD4B 1FQ9C 1KB5B 4YUEL 5CBAB 9CGTA 2HRPH 3RUGF 1VGKA 1BD2D 5TGBB 3K8MA 3MA7B 5GJTL 4BH7A 1JNJA 4I8DA 4KI1A 4MJIE 3ZYIA 1A14L 1UACH 4CMHC 1CE6A 3DXAB 4XCNA 2R69H 3JV6B 2EXYD 3SE8L 1AGDA 4K8RD 2NXYD 2BVPA 1KNOB 5DUMH 5E6IA 3FQRB 3UYPA 2NY1B 1JRHL 2XZAL 2Z8VC 1WGOA 5TQ2H 3KJ6L 3HC0A 4Y4FA 4L8DB 5FK9B 1GZQA 1MIEH 1OCWL 3F12B 4YC2B 2NCMA 3BO8B 4LDLB 3QUYD 3HZYB 5F7UA 3CD4A 3L1OL 5K59F 4G42B 1G7QB 4ELMF 5I15L 1BGXH 5D93C 4BZ2H 5FGRA 3RGVB 3GM0A 3VGFA 3L6FB 3MLWH 3VFGH 4ENED 2WANA 2DAVA 3MR9A 3SCMA 5ID1A 1K5NA 3REWB 1HINL 3A67H 3RZCA 4LSSH 4L1HA 5CMAB 1DQMH 1NBYB 5CJBA 2BNRA 3HCVB 4M7LL 3VG9C 2YRZA 1KN4H 4L4TA 3P0YL 4XNXH 5HHNA 4HG4J 1UA6H 1OY3B 4Y4HA 5CIPB 1NC2B 4R4ND 3WD5L 1OAXL 1SM3L 3QQNA 4M7JL 2EKJA 3X17A 2CKNA 1INEH 2GY5A 2HFFA 3NACL 3RA7L 1RURH 2BDNH 2XI9A 4ZFOL 4PJFE 4JRXE 4NWUH 3KGRA 3LEXB 1K2DA 1KJ2B 1Q94A 3KJ4B 3NAAH 2B39A 4ODHL 2NW3A 5C0CA 2EEBA 5CJXA 1L4IA 4UDTA 2D2OA 5EU6B 3ARFC 2CK0L 2P48B 1V7ML 4PJHA 5DFTA 3CMOL 4YQXH 1WFNA 3KNBB 3UEZA 3TA3B 4NQED 2JB5H 1NMAL 5DWUH 3NH7H 4PB0L 1PJ9A 5CJQL 4NQVB 3CFJB 4Z0XA 1OTSD 5T3ZD 4LU5L 5JHLL 4KUZH 3N0PB 2HKFH 4TVPH 4AIZA 1N5YH 2LVCA 2V2TB 3WS3A 2YUVA 3ZTJH 1FAIH 4XAWL 4FG6D 2EH7H 2YZ1A 4FN0A 5LJYH 1R0AL 3O2WL 1TVBA 3RTQA 3GDBA 3CFEB 3EFFA 2X1OA 1I8LA 3O0RL 4U0RB 2FL5B 4HIEB 1NFDB 1R3IH 4FQ2L 1AFVH 2RAMA 3QJFA 4KI5C 3D85D 5ESVA 3ROLB 4YXKL 4IMLB 2EZ0D 3FB7A 2P24B 1JV5B 5I1EH 5LQBL 4HEME 4EOWL 4L9LA 1X44A 1G6RL 1HHGA 1BQLH 1G7PB 5KSVB 1A6TB 5I6XB 3QUMB 2XACC 3KAAA 3FO0H 1JK8A 1CK0H 2VDPL 5I1KH 1OM3L 4PLJC 5E8DL 3TT3L 3D3VB 2CDEA 2X5PA 4MD5A 1M7DB 5D1QA 2C3VA 2MKLC 2APBA 4WV1B 5T5FH 2LAAA 5IR1B 4MJ4A 2Q6WB 5HVFB 3L7EA 4YFLI 3IAQA 2R0KL 4UZGA 4ODXB 4NDMA 3BUYA 3K1KC 4I3GA 4G43B 1YNTB 4JFEA 1GPOL 4J3WA 4LHUB 2DJSA 3OAUH 4ZFFB 2R23A 2IPKA 2QR0B 3TLRA 3SE4C 3U4EB 1FNGA 4OCWL 4P4KC 2ARJB 1EA9C 1LK2A 1MI5B 3EJZC 2YKLH 1SJEB 3DUHA 2MPAH 1EGJA 1JPFB 1D5BA 5DK2A 4MCYA 5C0BE 3QNXB 1CT8A 2FECI 1C1EH 1KCRH 4U3CA 2UUDH 5J6GA 3GSXA 3VGHA 1F3JA 3BP7B 3FO1A 3LKRA 4MJIB 3KVQA 1CFNA 5D96C 5HGGS 1XH3A 3CZFB 1KC5H 4MQTB 1JWUB 5J12C 1JCKA 2D7PA 1KLUB 3UO1L 2AXJA 1RUPH 4HUMB 4QT5A 4KQ3L 1EBPA 3SKJL 2Q8BH 1Q0YH 2Q3AA 3RWCB 4LRIC 4G9FE 4KVCL 5F70A 4G8GE 3KLAB 5IEHB 2DM3A 2OP4L 3F8UB 3STLA 2ITCA 1E4WH 4X6EB 3KPRA 1YJDL 5ETUA 5DTFA 3VXUA 1JZ4A 5I8EB 4GRWE 1A0QL 2FBJH 3VWKC 1DEEA 3R8QA 2DBLH 1QQDB 1IFHH 3BKML 4N68A 4Q97A 3BHBB 1HIMH 4F37K 3FRPA 3ZKNC 5CJOH 1Q9LB 3RI5K 4K94L 5D1XA 2DLIA 4CDGC 3L3DB 2EDKA 2A6KA 3AVEA 4KTEL 5I1LA 5MP6L 4JKPL 2YEZA 3FO9B 2X10A 4KTDH 1ZLUK 3TM6A 2E7HA 1BX2B 2P5WD 4APQB 3W5NA 5FUOL 5CP3H 3S37L 32C2A 5DA4A 5IROC 5H37G 3KPNA 3MLXH 4I0CC 1Y18B 1NEUA 3ZYZA 1H3XA 4O58H 5LAXA 5IB5A 4R2GD 2IALA 3RNKA 3QQ4B 4GKSB 4PJFB 4GLRH 1QPPA 4E0RB 3NCYP 4JRXB 3U7YH 1KCSH 2X1XR 4FQQA 4I3RL 3O3BB 5IW3A 4Z0BL 1KTKE 2A6IA 5EOQL 1QYGL 3S88L 5B22A 3MZTA 5TDOA 5IBLD 4H88H 5B38B 3OX8B 3PV6A 1S9YB 1IAOA 3P30H 2C7UB 4GSDH 3PABA 1FJ1A 1A6UH 1JZ8A 3D0LA 1B6DA 5LXGL 1AI1H 3QDME 1ZOXA 4YNYA 4WU5B 1WZ1L 4WW1A 3ZYOA 1OSPL 4OGXH 2ADGB 1EX0A 2YPVL 1T0MB 3ARDC 1QFUH 4UUJA 2IQ9L 1N6QH 4K2UL 4ODUB 2C3WA 4G8IB 3FQXA 4D9RD 5K93A 1HZHL 1DP0A 4WO4C 1PD6A 4C56A 3HUJF 5I66A 3JTTA 3VXRE 3ULVC 1DQQB 1NANI 2RFXA 1MQKH 2VJXA 4CAGA 2IEPA 2E9JA 4I3SH 5K9JL 5ADPL 5CP7A 2ZCKL 1HOCB 3MRMB 4UTBH 3KJ4C 5CSBA 5ESQB 2DQEL 4PG9A 5B4MC 4JPVH 5ABDE 4YH6A 1U42A 2MJWA 3FFCB 1IL1A 1I3UA 1U92B 2UY7A 3D87B 4IHOA 4PJBF 2H2PD 1JHTB 5I1JH 5JXAL 1W72A 4QHMA 1GOHA 1A7OH 2ZKHH 4OCYL 4X6CF 3VXNA 1VFOA 4GKOA 3BQUD 2BSSB 1GGUA 4DN4L 4UOW1 1G9ML 3GSOB 1AHWB 4XC1L 4HH9A 2NTSP 2O5YL 1FL5A 5IB1A 5F3HB 5E70A 1L6XA 3KPPA 5TPWL 1BQUA 4PJAF 3IJHB 3BZ4B 3MRRA 4GUPB 2Y6SD 4U0RC 5E2VL 4DUXA 2BVOB 4GAJH 3VXMD 4XXDB 1NGYA 3T1FA 1DVFA 1Z9MA 1ZA3A 2R56H 5E5MA 3OG6B 4Y7MA 3SO3B 3RL1B 4NJAL 3MCLH 1TQBB 3N1MC 3L3KB 2XQYK 3PWJB 4S0SD 1ZEAL 5C0BB 5E4IA 3WFCH 1TETL 3O11A 3UTQB 4EI5C 4RNRA 4HQQH 3PL6D 4CN4A 5JZ7D 2ZCHL 1EJOH 3LH2H 4KK9D 3UBXG 3GI8H 3FB6A 1EAJA 4N1EA 2OTWA 4GQPH 3T0XA 1SHMA 1MCQA 3L3JB 4GW5A 5K9QI 3WL9A 3UPCA 1AR1C 4NQUA 3TBSA 1DN2A 1J1OL 3B5TA 1QLFA 3LKNA 4XPHL 1DCLA 4PJGF 1ES0A 1OSZB 5EH1A 4RBPH 1TQCB 4FTVE 4PJ9D 4WEUD 4RFOL 3DV4B 3QEQE 4PRHD 2X42A 4GRWB 4OZIB 1Q72H 2O5ZL 5D2NC 4S1DC 4NO0A 5DRWA 3WEXB 3OGOE 1KLGA 1A9BB 1B4JL 4R4FH 5ANME 2GSIB 1I75A 1AXIB 1CLOL 4H5SA 3EOAB 3B9VA 4KVCH 2YWYA 3WLBA 1T1WB 5GS2H 5F7DB 4EUPH 2AEWA 1JFQH 1G0DA 4XH2A 3ZYJA 1YZZA 4P3CH 1EGJL 5L2JB 3GGWA 5F97E 2J8UF 1A9EB 4YDVA 2W9EL 2G75A 1AO7B 5IHUH 3WHE0 3WYRA 2DL2A 1CXKA 2DQFB 3QAZC 1HILA 3UTTA 5D71H 3KWWB 3GMPA 2F8XC 3MACL 4I48B 2HJFA 2P8LA 4F9LA 5JOEA 5JXEC 1ZT4A 5I30L 3REVB 3D0VB 4Z7VE 1TZHB 1T20B 5D9SB 3TJEH 2CIKB 2XY2A 5INCB 3U7AA 4L3CA 3IDMA 3SDCD 5FYLL 4JJ5A 2AKRA 3CLFH 1XGYL 3L5WB 2DTML 4D0DA 1CFTB 5IB4B 3QUKB 5L88H 3GM8A 5DHYB 5IFHL 1OP3K 4LVOC 1F02I 4ALAH 4PYGA 3PDGA 5HHXH 3I02B 4QHKI 5C0DB 3GJFH 3LPFA 1AY1L 3ARBA 3VFUA 1NFKA 3ZMRA 3GNML 4W68A 4G8EA 2AV1B 2ICWJ 2VUYA 3CVHB 1IGCH 1YYLH 5BVJA 3R06B 1J12A 5JO5A 2QHRH 3CFIC 4FQXB 5EFIA 5MEOB 5J13B 4XMPL 2MWCA 3PDOA 4WNQB 3EO0A 5ERWB 3QDMB 1HHIB 2HTLC 4APQC 5C2UB 2DQTL 5JQ6H 3S8WA 1ZGLB 1RUQH 2ZPKL 3GKWL 3HA0A 5E2TH 3WN5C 2CLZA 5GZND 3WHXA 2M2DA 3V6ZA 1QKZL 2R15A 3C5ZB 4K71B 3JBG7 1F4XL 1J0ZA 5FYKD 3DTXB 5C9JB 1FFOB 2KUTA 3FMGL 4WEBL 4IOSD 2G2RB 5FM5M 3VXRB 3FQUB 3HR5B 4I0PC 3BVNA 4NNXA 2VZ3A 4PGCA 3TBTA 3M17A 1X9QA 1OSPH 2NY0B 4NRYB 1E4XI 1P84J 4GBXD 1XEDA 4TUKL 3O4OC 3LDBB 1KCUL 4O00A 3ZL4L 3RWFA 1M05B 3OKYA 3HNSL 1A6VH 4OUOA 1C8PA 5AG8A 3PJSA 4Y5YB 3O6FB 4K7PX 3VWJB 1LO5A 1ORQA 3T0EA 1J05B 3ZE1E 2R1WA 3DGGB 4M1CC 5F7FA 4FNLH 3BRDA 4H0GA 3G5YA 3F7PC 2HTKD 4K8RH 3EDEA 4U7MA 5E7BA 3ES6A 1IGJA 2YXFA 2ZUQB 4OKVA 5D7JA 5F8RC 3O9WC 2X4RA 1OTTC 2KZ1B 1DL7H 1SBSH 4K23H 1P4LA 1T22A 3N85H 3F65A 4FZ8H 1WFOA 1WLHA 3GMLB 4OD1L 1FNHA 4Y19A 5SWSB 1YDPB 1A3QA 3CUPB 4OQ1A 2CLVA 4CU7A 1HXYB 4LQFL 2XYCA 3DIFB 4LKXB 4TSCL 5D6DC 5EZIL 5FB8B 3QIBA 3C08H 3IJSA 4JN1L 5FM8A 2FX7L 3WV0A 5H94A 2EE2A 4M6AA 5I1DA 4J1UB 1UC6A 4OLYL 5FYKU 1DLFL 1A3LL 4UIMB 1VACA 1X6LA 1NAMH 1CXLA 4NZRL 3WFDL 2WBKA 2BVQA 3VFSA 3NN8B 4TRPL 5T1LA 4NKIH 5IV2A 2NY7H 4KHXH 4BZYA 3OKLA 4Y4KC 3INUL 5HXMA 4MB4A 7CGTA 4PRPA 3RWEB 4HWUA 5L6YH 4Z7WE 3KS0H 5HGBA 2IPTL 3AMKA 1KXQE 4KRPB 1T80A 3TNNA 4XVTL 4DEPB 1NGWA 3HUJB 5IVXA 5CLTA 3RWHB 1G0XA 4WW2F 4OAWA 1EEQA 1GHFH 2AEPL 4JVUA 3UXFA 5T3XE 1W72L 4XP6H 3D2UD 3C60D 2EICA 4GRLB 3X14A 4FTVB 2AQ2A 3ULUD 2VAAA 3LKSA 5J89A 5JW4N 1QBML 1HQRB 1O7SA 2BVUA 1EXUB 2W38A 1QRKA 1I7ZB 4HWBL 3C2AH 4N0RA 2X44D 3W11D 2PXYD 1EPFA 2P46B 5TQ0L 1OL0A 4ZUWA 2MHAA 4F7MB 4PJIB 1A1NB 3OKNA 1KIRB 4LPUA 4NWTL 5A2FA 3NFSL 3TCLA 3U1SH 5T3ZH 5J6HA 1RUKL 1ZLUH 2E27L 1QFWH 4LF3A 4MJ2A 3DMMD 4N0CD 2O5ZH 1H5BA 5JUEL 2EDXA 5I71C 1IQWH 3MLTA 1FNSL 2VDQL 5FXCH 1YNLH 5BS0A 1B4JH 1HCFX 4PGZA 5E1AA 5C6WH 1KENH 5ACMA 1DBMH 3UC0L 2W59A 1ODAA 4GG8A 3C6SB 1TDQA 4RFEA 3WKNA 4YHZH 3SKMA 5GGSB 3Q5OA 4Z7VB 4BFBD 5H35A 4RFNC 3NFPA 5ACZB 4MAYB 4PJ7F 5HHPB 2PO6C 4JM2D 5C0AA 3U0WH 4FQHB 4NYLB 4NQDA 1MREL 2DM2A 4HKXA 1MFNA 4PJEF 4UT6H 3MSPA 3GBMH 1BEYL 3QHZL 3RDTC 1U8JA 5DS8B 1MCWM 4LLUB 1NKRA 4MD0A 3OF6D 4LCYA 1Q9WA 5DF0A 3TH2T 1RZ7H 5CCKH 3VFPB 5DD6A 1IEBA 3PIQB 3E3QC 4WEMB 3UJJH 1I4FA 2BP3A 1XF1A 1DSFH 2R0WL 2ESVA 1OAUL 3LRGA 2OI9B 4OZ4A 1BVLB 3ZKXC 4LEXH 5LWYH 5C0EA 5EBWB 1KJ3L 4HBCH 3NABL 4RMVA 3TVMA 3UBXA 3WLWC 3ZKSD 1U8KA 3E8UH 3B2VH 3H9SD 4D8PB 4U1MA 3KPLB 1ZT1A 4EBQL 1HHKA 2DJ4A 4C59B 4M48L 1A6PA 3B9DA 3S3SA 3TPUB 3HE7B 4K7PH 4P5TB 1I7RA 3HZKB 1T1YA 5FOBB 4B53A 4P2QE 4CDHA 3BH9A 1PY4A 1RZKC 4P2YA 3UTZA 3VCLA 1F4XH 3WNOA 1QHPA 4L3EA 2A74A 4Q74A 2P5EA 3OMZA 3FQNB 4GMSL 4HUNB 2EIZA 4RDQG 5E9DD 3ZDYF 3EAKA 3MBEA 2Y36L 4K55A 1HNFA 2K7QA 4LLDB 5C86A 4NRXA 3LMJH 3QWOA 1UKSA 4XWGL 1HI6B 5T33H 4M6OL 1KIQB 1UWXK 5EU4B 2F19L 5AAWA 4JJHA 3O45B 5HGHA 1KEGL 5J1AB 1Q9KA 4OZFG 2KPNA 4HUUB 4UB0L 2Q20A 4S1QL 5IOPA 1NCCH 1YPZE 3FQTB 2OJEB 5GIRA 4AL8L 1JZ3A 5EUOE 1W0VA 2R4RH 2J88H 1EEYA 3IXAA 2CO7B 3LS4H 4PJDF 3KDMB 5D7IA 2E7LC 2NW2B 1CD0A 3GMRB 5D70L 4M62H 4RWYH 4KKBD 5JIHA 1HSAA 2PCPB 1AJ7H 2XKSA 3U30B 1RZGA 5K9OA 5I8KL 4LNRB 1FL3A 1RK1B 4KZEH 5HI4C 2VITB 1F2XK 1QSVA 4JZOA 4ODVL 1JI1A 1ZHLA 4QHNB 4JN1H 5JIPA 5GRUH 5JMOC 5CILH 3H6JA 1JPGA 5BV7L 1FNEB 3VXTB 1KGCD 1LE5A 2X1PA 1NBZB 1XIWD 4ODTH 1UJ3B 3S35X 1CXFA 4R90L 4NZRH 3S9DB 4K3JL 2JKXA 4Q6IB 1GZPA 1DBAH 3QG7L 4V1DE 2K1MA 1RZIA 4N0UE 5FYJL 2CKBH 2E6JA 3GSNH 5GHWH 4WTXA 3WE6B 3ZHKA 4IMKC 5FF6A 4Q9QL 1QSED 2Y9RT 3OXSA 2VIRB 5F1NA 2GJ6A 4PJCF 4XXCC 3MLRH 3U83A 1FIGH 2X4QB 4OZGE 3MV9B 1WWWX 1BIIA 2EDEA 1YN7B 3U46B 1J87A 2AJUH 2WBJB 2AEPH 2C1PB 4LHQB 4LGSB 3ZHLA 3G04A 1XF2A 4HFWB 1T04A 1FG2A 3UYRH 4ZXBA 3OKKA 1MJ7H 4AH2A 3OKMA 4JFYB 1ZHKA 2BOBB 2XA8H 4R97C 2BSRB 5DHVB 1CIUA 3SQOH 2Z31B 1R3JB 4U7KA 1S7SA 4GG6A 1HKLH 1BZ9B 1QBLH 1YYMH 1T4KA 4IEFB 4DEPC 4R4BA 3ZKMD 2DBJA 4Y1AE 4OI9A 3CSPA 2IANA 2CGRH 1RZ8B 5DC0A 1VCAA 2HH0L 1JMXA 3K81A 2GTWB 4G80A 3L3OA 4M3KB 5DJCB 5TFSL 3DO7A 1MFEL 4LAQL 5CHNA 2FLRT 3SE3A 5KSBE 3EDKA 1TZIB 4JFFB 4UILL 1MRCH 2DI9A 4XX1G 4XMKH 5DYOA 4DTGH 3MRBA 5DJYA 5HI3D 3JVGA 2A77L 3CU7A 3UTSD 4WHDA 3QFJD 2VLRE 4E41A 1X4ZA 2VWEE 3NOIA 1GC1C 1XZ0A 5D7SH 3O3DA 3IB4A 3EO9L 3QDJB 3RWJA 5T1MB 2JIXA 3D39E 3QXAB 4X6DE 3OJVC 3H0TA 1XGPB 4ZOBA 4N5UA 5TE4L 4AIOA 3UZVB 3I6GA 3FOMA 4OJFL 4I4WA 4EI6A 2FD6L 3KYOB 2EYRB 4ZYKB 1ZLVH 2YD7A 4JLRA 3Q5TA 4JDVA 3C5JB 1BQSA 1NMBH 3G6DH 4JO1L 5KJRL 3WUWB 4P2RD 4P9HC 2ZSWB 5IQ9A 2DF3A 4RAVA 3UJIH 3HLAA 1IGYB 3RX8A 3R1GH 1R24B 4Z7UA 3FZUD 1T6VN 1NAKH 1A5FL 3AREA 4R0LB 4JM4L 4MNQB 4PRID 5E03A 3LIZH 3I9GL 4P2QB 3ZTNL 1UB6A 3AU1B 4LSVL 2JLLA 4G6MH 1T6WA 3GHBL 3EW3B 1EFXD 1QOKA 4OUUB 3RJDA 4PLKC 4K7PY 4QTIL 2B4CL 4YHMH 2OR9H 3Q6FA 4JQIH 2KKQA 2VLJA 3LQZA 1JWSA 4MA8L 4S1RH 4UINL 4ZO6A 2ADJA 3CXDH 1Z3GL 4M02A 4XNUH 1B2WH 1FVEA 2DOCA 1O5DT 2ITDB 4DZ8A 3KPOB 1HDMB 1S5HA 1YC7A 1A2YB 1UGNA 1UWEH 1OOAA 3ILQC 3ZSSA 2GTZB 3DVIA 5KN5A 4NN5B 4M5ZH 4P99A 4PTTA 4JRYA 2IQAB 5C3LD 4BQBA 2Y36H 4YPJA 1OF2B 3SJVD 4LASH 5TDNA 1QO3B 1YPZB 3IFNH 4HSQA 2IAMD 5EUOB 5DJ2A 1TMCB 3LSOA 2YSSB 3RVVD 4EXPX 4KGJA 2P8PA 4N90E 1J0IA 5HGDA 3HAEH 1P5UA 3VGBA 4R96B 2BY2A 4Y2DB 1NGXB 3MXWH 1UQSA 3BP6A 1CG9B 4QRQA 1U93A 2J12B 3O8XD 3WO4B 4U6HB 4XBGB 1TVHB 1R3LA 2QADC 4OZHF 2ICWI 3F7RA 1ZHBA 2VZSA 1Q9OA 4UTAL 3QIWC 4IBLT 5AUMA 5JR1H 1FO0B 3S35H 2G60H 4KDTC 3AS1A 3GJFA 4PJ5B 4UQ3B 3IFLL 4M7ZC 3IFPB 1RZFH 4JY5H 1ZWIA 3SDXF 1YEEH 4XRCA 3MUHL 3GBLA 5DSCA 2CRIA 3QEGL 3L3IA 5B3JF 3RKDD 2ZSVA 3NPSC 2XXCB 4F80A 5MEND 1WICA 3WJLC 3CXHK 1LDPL 5IVZA 1IAIM 2HG5B 4YX2L 1LE9A 4ZO8A 4LSPL 5C8JB 5IMLB 3WIHH 2BOCA 4JY4B 1B0WA 4NOBA 4OI8A 5C0IB 4MZ3A 4UIKL 1CDIA 1K8IA 4O9HL 5HYIA 4F37F 3I6LE 3KYNB 2XTJD 3QZWG 3PWPB 2FR4A 5SWZA 2YOCA 1T3FA 1XF3A 2BNRE 3VRJB 2EC9U 2H9GA 5EZJB 3D25B 3NIDE 3RI5F 1C12A 1CL7H 4U7SA 1U8IB 4L4TE 1J1PH 1WBYA 4U6VH 2O61A 4DKEL 1KB9J 1IGIH 1AD0B 1D9KD 3TIEB 4F7PA 5DMKB 4P23A 3MA9H 1IAMA 5DJZB 5I74C 3HI1B 5LG1A 2CLRB 4I18A 4LSTL 1G6RB 3FHAA 4OLZL 2DMBA 4J4PA 5FYKH 4F7EA 2BSTA 5ITBH 2YN5A 3DRTA 1KEMH 2ZG3A 4BYHA 4GQ9L 4ZUSB 1N2RA 5HVHC 3D9AH 1RFDH 4BQ9A 2PTUA 3HMWH 5IW1A 3RNQB 4POYA 4NRZA 1RJZB 4CUCA 2VDRH 5I16B 4JFXB 6FABH 1MJJB 4OZFA 2V5SA 1P7KA 2NX5D 3TN0A 1IEAB 4NP4L 2I5YL 3HE6D 4S2SB 3OR6A 4X99B 4N8CL 3RUGE 4P9ML 1SMAA 1J8HD 5FAAA 4K7FA 1CICB 1T66C 1SYSA 3DNKA 3G6JA 2HVJA 8FABA 4CN6A 5JOFB 1FN4A 1E6OH 3MGTA 2W65A 1RJLA 3D39B 4X6DB 1OW0A 2R2BA 1D6VH 5JW4M 3HPLA 2VXTH 5AD0B 1A1MB 4NZTL 2ARWA 1NL0H 4ZTPL 1SYVB 3MUGA 4JAMB 3QP3A 2DQUH 3VH8B 2DQDH 4ISVA 2Y5EA 4HXAH 5B3NA 3DECA 1A6AA 2ZJSL 3CK0L 3OGCA 5FO7A 2VRAA 3ESVF 3V5DA 3OXRA 1IGFL 1HEZB 2RCSL 1CF8L 1DTUA 3SDDA 2QQKL 2M1KA 4ELME 2JB6B 4P2OA 3QDGD 5IKCA 2YD5A 3BW9A 2X4PB 3V5HA 3ARUA 1TJHL 3WDJA 4LCWD 1X5YA 3V52H 3IJYB 4I1NB 1MJ8H 4NPYA 2C3HA 3C09B 1OLLA 5D1ZC 3GSVA 3P0VL 2P43B 4NQCD 3ARFD 4JFDD 3QUXA 4NNPL 3W39A 1GGIH 5ECJE 1K4DB 4LLYB 3EIFA 4L29B 3T77B 1RD6A 3STZB 3MV7B 2AJXH 4WW2C 1ORSB 3I75B 1MUJB 5FO9A 3F58L 4JREC 1FYTE 4K9EC 4TSBL 5B39B 2QLVB 5HHOD 3BGFB 2ICWB 3DYMA 25C8L 3ULUH 2B4CH 3VDAA 1A7QL 4PUBL 3IDGB 1A47A 1XR9A 1S9XB 4QNPE 3GBNH 1ZLSL 3VFVB 3EO1A 4Z5RA 1I1AB 1YMMD 3B83A 4N0YH 4KWUA 4A6YH 1VGKB 4ZAKD 3BPNC 4BH7B 5I9QB 2QBWA 4WUUE 5T1KD 4FXGA 1CE6B 1NLDH 2YD6A 4O2CA 4XCNB 4KI5D 2I60L 2OL3H 4M6ML 3TBWA 1AGDB 1IBGH 1TPXB 1B0GA 2AXHA 4W4OC 3RX5A 1DUZA 3ZDXF 5ESAA 4WTZG 4JGUA 2BVPB 2ZUXA 3KPSA 4HFUL 5DQDL 5E6IB 3RVXC 3KPRE 3VXUE 2H6PA 4PLJD 3UDWA 4KY1L 3HC0B 5DC9B 5BOPA 4Y4FB 2D7TL 1GZQB 5CSGA 2YR3A 1MRFH 1WWBX 3T0DA 2VXSH 3EFDL 4DGVH 5L2KE 4AENA 3RU8H 4ELKA 3Q5YA 4UT7L 3TEUA 5KS9F 5GZOD 3PV7A 4M5YH 4U1LA 4N9OB 4G8FA 5EBMA 3W2DH 4XVUC 5MHSD 3BPOB 5DR5H 4IRJC 2ICEA 3SCMB 2XG5A 3MR9B 5ID1B 4MGXA 4E42A 1K5NB 1U2CA 2CK2A 3CCHA 4Y2DC 1XGTA 35C8L 3RZCB 3VW3L 4JN2A 1M1SA 5F6IC 5JDSA 5JLZA 3EJZD 4KH2A 2BNRB 3WO4C 4HS6A 3IVKA 1OWWA 1K3ZA 4L4TB 5HHNB 4X83A 3T04D 4Y4HB 1K9TA 4Z76A 1U3HA 2YA1A 4WFHD 5IBTH 2EEAA 1OLZA 3IDXH 1RVFH 1BFTA 2HFFB 5IWLC 2HT3D 4HJJL 1ZTXL 4LVHB 5DD1H 4YDIH 4YBLC 4Y5VC 2H26A 1V3LA 3TIDA 2DQIH 1GAFL 1K2DB 3N9GL 1Q94B 2VLME 1J11A 5ALBH 4HKBA 4NBZB 1A6ZA 2NW3B 5C0CB 2BY3A 1VHPA 4UDTB 4QOKD 5EORH 3S5LG 1ZAGA 4JO2H 3H9ZA 4L4JA 3IDUA 3SGJC 1U91A 4PJHB 4H8WL 4KVNL 1NJ9A 2VDKL 1IAIL 4YAQA 1ETZA 3AXLA 3SPVA 3UTPD 4Z0XB 2Y07L 3ROOA 1G7MA 3VWKD 4GRMA 1MVUA 2EECA 5EA0H 3IU3A 4AIZB 3WS3B 3ZKND 2VXVH 4LPXA 1FFNA 3NTCH 4OM0H 1I9JL 4MSWA 1YEFL 3L5XL 3V95A 5GRZA 3AAZA 4QRUB 4WY7L 3PNWA 1TVBB 3S36L 3RTQB 3EFFB 4GOSA 1I85C 4FOMA 3C8KA 4YHOL 3UZEA 4ZPTA 1OARL 4M4PA 4CJ0A 5DD0L 5JHDD 1E6JH 3ZHDA 3DETC 3QJFB 1UH3A 3DXAD 4XP5L 5ESVB 3FB7B 3WDHA 4X7CC 3U4AA 3NZ8A 4CGTA 4TNWF 1A7PL 4L9LB 5JW4R 1HHGB 4J8RA 1WQVT 4LLWA 1FHGA 1JF6A 1JK8B 2F54E 1B9ZA 4NBXB 4HJ0C 2NY1D 3QXWA 4P46A 4AJ0A 2CDEB 4MD5B 4WUKL 2CKBA 1YMHA 1GH7A 3GSNA 4KK6C 4RA3A 5D1QB 3AGVA 2C3VB 4LCIH 4BZ1H 3L7EB 2VXQH 1G9NH 3WS6C 1FBIH 4NDMB 3BUYB 1VPOH 3QZWA 3GMOA 4JFEB 4YIQA 4GT7A 3RGVD 3JWOL 2R23B 1UM4L 2IPKB 3I2CL 1RIVH 1DE4A 3I6KA 3NIFE 1A7RL 4PJXF 1FNGB 3E6FA 4NIKB 1I9RL 1IC1A 1AE6H 4QXUH 1LK2B 3EYQC 2AI0L 3TBVA 1TXKA 3ME0A 5FHAL 4ZG1A 3P0VH 1D5BB 2AEIT 3MRDA 3V0WL 5DK2B 5GPRA 5K9KA 4MCYB 1F58H 1UCTA 3HZVA 1NC2D 5DUPH 1E4JA 4WO4D 1CT8B 4GS7C 1JGLL 4FXKA 2YUXA 3ULVD 1U58A 3L3GA 2OS7A 3K74B 5J6GB 3GSXB 1F3JB 1HHHA 3FO1B 3LKRB 1CFNB 3ARXA 1XH3B 2EDWA 1CE1L 3SO5A 1ZA6A 3QCUL 3MJ8A 1QSFA 15C8H 2F74A 4X4MA 1YJDC 2BNQA 2CXKA 4QT5B 5EU6D 5B4MD 3U9PL 5T5NF 2PR4H 4CJ1A 5DVNA 4TUJA 3TA3D 3TH3T 3STLB 2ITCB 5ETUB 5DTFB 3VXUB 1YY9D 5I1HL 4D9QD 1BVKA 5DMGD 3T2OA 1DEEB 3TWCL 3BQUA 3IS1X 2NTFA 2GJZA 2Q7YA 2DYPA 5J0BA 1FLRL 1U6AH 2FATL 4WRLA 5D1XB 1I1AC 4YHPA 4NC1E 3NIGE 5FUCE 4KKAD 2A6KB 5I1LB 4YXHH 2YEZB 4P3WA 1MEXH 4R7NA 3F7QA 4BSWA 4GKNA 4PJBE 4LNVA 4JO3H 5A16A 1FPTH 32C2B 4QHUA 2E9WA 1TPXC 3KPNB 3TYGL 2XA3A 2VLLA 4X6CE 5DDHA 2KL6A 2Z0BA 1QG3A 4I0KA 1U8HA 2VZVA 5LAXB 4JPKH 3CDCA 5IB5B 4J3VA 3ZE0F 4DW2H 2IALB 3D3VD 1II4E 1UWGH 3JUYA 4FQ1H 4K3DH 4XNZB 3RNKB 5HYSG 1U8NA 5C0JA 1IRAY 4FQQB 1QSZA 3QI9C 5GRVK 4L4VA 2A6IB 4DAGL 1HK6A 4EIGB 3OKDA 4NJ9L 1AD9A 5TDOB 5F93C 3PV6B 4V2BA 1IAOB 4LHUD 3TP4A 1KFAL 3L5HA 3PABB 3WNKA 4ZNCD 5CEZE 1OWRM 3K3QA 1K8DA 1CZ8L 3SCMC 5F7EL 1CVRA 3PGDA 1FJ1B 4LSQH 3D0LB 1MQ8A 3QEUA 4YNYB 4WW1B 4E5XA 1YQVH 4FABH 1B90A 1E4KA 4UUJB 5FKPA 3M45A 5LGKA 2EXYC 3FQXB 4Y4HC 2HFGL 1MHPH 1MRDL 1QRNA 1MHHA 4OLVH 4C56B 5I66B 4OV5A 3JTTB 1MY7A 4I2XA 2RFXB 1H8OA 3IDNA 5DI8A 3KYMB 3QCTL 2GIYA 3O41A 3THMH 3G9AB 4MJID 5CP7B 3VGGA 4WTZA 4MA1B 2VNCA 5BVPL 4N0FA 3OSKA 1NGPH 2UV3A 3QUYC 4PG9B 1IGTA 1CLZH 1I9JH 1Y6KR 2VDOH 5GGVL 4YGVA 1IL1B 1OGAE 3T0EE 4IHOB 5A3IC 2P47B 5FA3A 2RGSA 3O6LH 4BA8A 4UV7H 5DVKA 1NCDL 3QNYA 2UWEF 1W72B 1VEOA 4QHMB 4QXWA 3PP3H 4XP5H 5JW4Q 5FYJE 1N0XH 3SGDH 3CSYA 3VXNB 3OZ9H 2QJDA 5DJXA 3U0PA 1RPQA 5J56B 3OJDA 4HH9B 4M1GL 4OGYH 4R4NC 3ZT5A 1JNLH 2CRZA 3JV5A 1FL5B 2MSPA 5IB1B 3VD4A 3KPPB 5ALCL 3HC4L 1IM3A 3MRRB 4M4RA 4Q0XH 5EBLA 3B2UD 1NGYB 3T1FB 2AJYL 5E7FA 1ZA3B 1MCHA 1A4JA 4M8QA 2RR3A 4APQD 3BP4A 5E5MB 1IJ9A 1XR8A 2JF1A 4L9LC 1UH2A 4CW1A 1I1RA 2D0FA 3O11B 3FB5A 5CSZA 1AC0A 4NO3A 4WHCA 5TF1L 5DD5H 4DK3A 3FB6B 4LOUC 3VFTA 4I0PD 2OTWB 4XCFL 3DJ9A 4PRPE 4ZTOL 5F9JA 3PWUA 3S5LA 1JPSH 4GW5B 1A7NL 1UZ6F 2HKHH 1C16A 3QIUA 2VQTA 4JRXD 4NZUL 3QRGH 1X5ZA 4HC1L 2NY2B 1OTSC 3HC3H 1LD9A 5DEFA 3WL9B 2IH1A 3VMNA 4PBXA 4LBEA 4JKLA 2VL5A 2IBZX 3TBSB 5CZXD 1FAKT 1QLFB 3LKNB 1W0YT 1DFBL 1ES0B 4N5EC 4Y16C 4TVPE 4ORGA 2JTDA 5IGXH 3HI5L 1OPGL 3P4MA 4QEGA 1ZS8A 2AJ3A 5F96L 1JNNH 4M1CD 1T1ZA 3WXWL 3SEPA 5F1IA 4NO0B 3WDIA 5DRWB 1KLGB 1QBAA 1U8LA 5DZNA 2EZ0C 2BHZA 4JM2F 3MRCA 4ZD3L 4PS4L 4OF8A 2DLEA 4TPRL 4H5SB 1U9KA 3T3PF 5EO1A 5CBEA 4FQLL 3WLBB 5K9QG 4YDJA 4XH2B 4XI5D 3LZFH 4L8CA 2EDQA 3GGWB 1J0HA 1L0XA 4YDVB 4HT1H 2G75B 3MRFA 1CU4H 1RZJL 5BS0E 3GK8L 5L7XL 1HILB 1IQDA 3UTTB 4G3YL 1C5DA 3GMPB 2FX8H 2HJFB 2P8LB 1I3RA 1ZT4B 3FFCD 3V7MA 3MODL 1XGRA 4FFYL 5I1AA 1VB9A 4L3CB 3IDMB 3S3PA 4JJ5B 2AKRB 3ARGA 4JB9H 4D0DB 1D5MA 1YY8A 4EDWH 4AEIL 2BHYA 4M03A 1MPAH 3BDYL 4OB5L 4LPVA 3ARBB 3VFUB 1R5WA 4LK4A 1D7FA 4G8EB 5F8QC 4DN3H 2VSDA 2IFFH 5C6TL 1MAKA 5BVJB 3BSZH 4OCRH 5JO5B 3O81A 4C83A 5EFIB 5DRZA 4JG0L 3PDOB 3EO0B 5EZLA 1BBDL 4FQIH 1JHKL 4A6YA 5CFHA 2KZWA 2CLZB 3WHXB 3NZHL 3V6ZB 4QYOA 5E2WH 2DICA 3QO0A 2CDGA 2OL3A 2ADFL 5F7EH 4HLZH 4NNXB 3BVNB 1CS6A 3WIIL 4PGCB 5GS0L 3TBTB 3M17B 2J1KA 3BE1L 2BSED 4GXVL 1IGML 5KSUA 2Q8AH 5L8KB 1WISA 2FO1A 1LEKA 1MCPH 5BV7B 1MRDH 3RWFB 3V4UH 1DN0A 4L3EE 3UBXI 2P5EE 4L9DA 3MOAL 2JCCF 3LN4A 3PJSB 2A1WL 1LO5B 4KPHL 1ORQB 2AK4E 3T0EB 1S7VA 2R1WB 4WCYH 4PV8A 4KU1A 3G5YB 5EOCH 3SGKC 2AEQH 3MRPA 3ES6B 1IGJB 3GSUA 4OKVB 5D7JB 2P4AB 2X4RB 1VFBA 5BVPH 5I76A 3CDYA 4U1KA 1GGCH 3P73A 1P4LB 1T22B 4M61A 1MHCA 1MIML 3K1DA 4JZNA 4OD2A 1D3CA 4Y19B 4XPAH 2GK2A 2CLVB 2XOTA 5EO9A 4ETQA 2NY5H 3QIBB 1LVEA 3IJSB 5D7IE 3QUZA 5H94B 4GAGL 2W07A 1JZ6A 5I1DB 3RBSA 1AO7D 1G9EA 1PLGL 3BPLC 4ZMAT 2QQNL 4XAKE 5HYJD 3QUML 1RHHA 1VACB 2SEBA 3BKYH 1LP9F 4M1GH 1KPUA 5I73C 3WLWD 1H3PH 4EJ1C 4P0DA 5F9OH 3W0WA 3NCFB 2BVQB 1D5IL 3VFSB 4BFIA 5T1LB 5IV2B 5HYSA 1L7TH 2UZIL 5CINH 3OKLB 4G9FA 4CN1A 4G8GA 3FN0L 3HC4H 5J1TC 4ODWA 1KTLA 4HZAA 4HX1A 4HAFA 5HPMA 4PRPB 5HGBB 4FRWA 3TNNB 1MCOH 4OFYD 4PBWD 4EXKA 1CR9H 1NGWB 3GHEL 5D2LF 5IVXB 3LEVH 5FO8A 1B0RA 4BK5A 5E9DA 1R5VA 2J6EL 4HHAA 4OAWB 5D5MF 3OQ3B 3VFRA 3V9FA 4GLRI 2WWMD 4AEHL 5MERA 5GGTL 1A6WL 2XIDA 3QBTB 3X14B 3HMXL 2D9CA 3JZ7A 3MJ9H 2VAAB 4FQXD 1A7NH 3LKSB 3MLSL 1XAUA 2LV4A 3QDMD 1WIPA 5C2BL 2ED8A 2H45A 2FCBA 1BQHG 4QRRE 4JFPA 4ZUWB 2MHAB 1GIGH 1PSKL 3OKNB 3TCLB 3RIAK 3ILPA 4XCCL 5J6HB 2G9HA 3F7VA 5B8CA 2H2PC 4M3JA 4LF3B 2VTFA 4OD3H 5FDWA 1X6NA 4RAHA 5C0GA 5HVWA 2NY0D 3MLTB 3AC0A 5BS0B 1JPTL 5E1AB 1EMTL 5C07E 3S34L 1KB5H 1S5IH 1S3KH 1CFVH 4HH8A 4L8SC 3E2HC 4NFCA 2FX9L 1SEBA 4IOIA 4GG8B 4UDUA 4PFEA 4RFEB 3SKMB 5J11C 3VWJD 4M00A 3KYKL 2OK0L 3BKJL 2CH8A 2A9NH 2VR5A 3NA9H 4XP9L 5H35B 1CDUA 1DBKH 3NFPB 1KPRA 5DRXA 5EIVA 5C0AB 5GJSH 4NQSA 4NQDB 4HKXB 3D18A 4AM0A 2PYED 4Z7NF 4MLIA 1BFVH 2HFTA 4LL9A 5E6ZA 1U8JB 4WVRA 4E41E 2FEDC 4NM4L 4LPYA 4CADA 5FGBC 2ATKA 3K8KA 4MD0B 1O7VA 1Q9WB 3EDJA 5DD6B 1IEBB 2IGFL 5TF0A 5SWSD 4JGJA 2W0FA 3PQYA 1QSEA 3PL6C 1I4FB 2AP2A 5F9AC 5TE7H 4POUB 2D4FA 2ESVB 1T0NB 2EDJA 4HK3N 1TJGL 1IC4L 2N7BA 1BOGA 4OZ4B 3X13A 3IYLW 3V5KA 2AJSH 1YEKH 2XY1A 5C0EB 4DCQA 3TVMB 3UBXB 1EERB 1U8KB 5DMJB 4GAFB 5DZOA 1CLYH 3E6HA 1OVZA 1CI5A 3BMVA 4U1MB 4NM8L 1ZT1B 1VGEH 4IRSA 1HHKB 4KDWA 3O6KH 4JG0H 4PJ9C 3U7WH 2R29L 1BBDH 4Z7UE 1I7RB 3QQ3A 1C5BH 4KRPD 1T1YB 4HPOL 1NUFA 1XMWA 2CMRL 2QEJA 3BH9B 3UTZB 3VCLB 3FRUA 5T1DH 1CDHA 1X4XA 3ULVH 3ARBC 4L3EB 2A74B 4U1SA 2P5EB 2FHFA 1M6OA 2EIZB 2VLJE 4M7KL 5DEZA 2QQLL 2L7JA 3MBEB 2W9DL 1KJ2H 1KBGL 2XN9E 5JOPE 4KHTL 4LRNH 4GRLD 4RMWA 5GS1A 3MRHA 2DTSA 4GXUN 4XPFL 4NRXB 2LU3A 3WFBL 3UTSA 1M71B 3QWOB 4KKCC 1D5ZA 1WBXA 4XBEL 4HUXA 4X7SL 3QJHA 1JGUL 2XNAA 5ITFA 5HGHB 5BRZE 1ACYH 1Q9KB 3RPKA 2VKWA 4JQVC 5IOPB 3AROA 4JFHD 5GIRB 1W0VB 1O0VA 4HUVA 1EEYB 3IXAB 1DBBL 3H9YA 4LCCA 3SDCC 1VESA 2F5AL 5D7IB 1RUAH 1S7RA 1NCBL 3UTOA 4G5ZH 3RY6A 2QSCH 1ZVYA 1HSAB 2B0SH 2LQRA 1RZGB 4UMGA 2WZPD 5K9OB 2I26N 1QEWA 1FL3B 4XT1C 5BCAA 1JWMA 4JZOB 5C7XH 1K85A 1Q0XL 1ZHLB 1I3GH 4QF1A 1PZ5A 3MNZA 3QEQA 3GUTA 1LE5B 1Y0LA 2P1YA 4YEEA 3CH8A 2IBZY 2ZNXA 3JV4A 5GZNC 2V5TA 4G7VL 2FECL 2IMMA 5ANMA 5KVDH 3TESA 1GZPB 1FH5L 1PX3A 2UYLA 1IM9D 1RZIB 4MQ7A 4XPTL 1TFHA 5KVGH 5FF6B 3OXSB 3WNNA 3K4DA 5F1NB 2GJ6B 3NPZB 1KTRL 5EUKA 5SWZE 3ILQD 4GBXC 1FE8L 1BIIB 2ZG2A 5I18L 2QHLA 2MCPH 2HRLA 3V4VL 5I19H 4WFEE 5GSVA 3G04B 3U48A 5E8PA 1XF2B 1T04B 1FG2B 4ZXBB 3OKKB 1NCTA 4AH2B 2R0LH 3OKMB 1RULL 1ZHKB 5J9PA 2VISA 1D5XA 1BD2E 1ZLWK 2D4DA 4RAUA 5C2BH 1S7SB 4GG6B 1I7TA 3TZVA 4MLSA 1T4KB 4R4BB 1L7IL 3EYOA 4XVJH 3EOYG 5DD3L 2BCKA 2IANB 5FEBA 3TO4A 2DQCL 3HFML 2QADD 3PGFH 3TYFA 3J7HA 4HWZA 5E2UL 4PRAA 4G80B 1HCVA 3L3OB 4O4YH 1QFPA 3DO7B 5CHNB 4ONGH 4OLWL 5IF0A 1FDLH 3AB0B 4D2NA 4ZS6D 1NH6A 2Y06L 1G0YR 3QQ9D 5DYOB 3HRZA 3MRBB 5DJYB 4PJ8A 3S34H 5MENA 4KAQH 1FZKA 1RU9L 2QSVA 4E41B 2PTTA 3CFCL 2XRAH 4UT9H 2GK0A 1UFUA 1XZ0B 3VFWA 4Z7OF 5A2KH 1UVQA 2FWOA 3O3DB 3DUUA 1NC4A 4U1GC 4PRDA 3O3EA 3RWJB 1MCIA 5IFAL 2JIXB 2DS4A 3H0TB 4CVUA 1WEJH 1T0PB 2NZ9C 2YRLA 4KTYA 1P69B 4O5LL 2IPUG 3I6GB 3FOMB 4I4WB 4EI6B 3SDXE 2H32A 1KXVC 2NY4B 3BJ91 3TFKD 2H2SC 4OGAC 1VFUA 1WAAA 5FA4A 4JLRB 3LS5H 5BO1L 4O02L 1F11A 4JDVB 4N8PA 3SKUD 1H3GA 1IKFH 4BELD 1P1ZA 3C60C 3W5MA 4RAVB 3FCTA 3HLAB 2B4CC 2I27N 4YDKL 4Z7UB 3TT1L 1P5VA 3AREB 5D7LD 4PTUA 1P2CA 1BM3H 2PXYC 3OKEA 2F9BT 3RWDA 2XPGA 4ZFZA 3KR3L 3WFZA 3Q6FB 2VXUL 2VLJB 5E95B 3LQZB 1JWSB 4UNVA 4NQEE 2ADJB 4MXWL 2V17H 4R8WH 4KI5F 1BQHA 3FAWA 1FVEB 4KROB 3T2PA 4OQTL 5E1HB 1I9IH 3DMMC 4FFZH 2R0ZL 4IJ3C 4UAOC 4DZ8B 3EYSL 1S5HB 2XQBH 4G7YH 4QY8A 5D72L 1UENA 5T3ZE 3WXVL 5JORA 5KN5B 3MV9D 4HS8L 2DQHL 2RHEA 4PTTB 4JRYB 5KAQF 1T66D 3WHE1 2LTQB 2BHUA 2Z92A 4U2YA 4UNTA 5TDNB 3V0VA 5HHMD 1N3NA 5DJ2B 5GXBB 3LSOB 2P8PB 2WUCH 5HGDB 3WFBH 4JM2C 3VG0L 2Z31D 3L7FA 4Z7WA 1MSPA 1BWWA 1UQSB 3BP6B 1MCSA 3VFNA 4QRQB 1U93B 3SKNA 2VERN 1R3LB 2ATPA 4PR5A 1ZHBB 3LAFA 4IS6A 4CU8A 4XX1E 5HHVH 1Q9OB 4DGIH 2PW1A 1FVCA 5AUMB 3MBEC 1CGWA 1XF4A 4J3XA 4YPGA 4RGNB 3GJFB 2AJVL 2D0GA 4HG4K 4JFFD 1ZWIB 3PDDA 4XRCB 5AYUH 5DSCB 3M8OH 4LCWA 3L3IB 4NHCL 2ZSVB 4HAGA 4KMTL 5CWSA 2G5BA 4GW1A 4NKMA 3X3GL 3C9NA 4DGYH 2VUOA 5IVZB 3ARFA 2PYFA 4YE4L 5D1ZD 2BJML 1LE9B 2I9TA 2VAJA 3MV8D 3QDJD 3CC5A 3MFFA 3NCEB 3T08A 1CXEA 1JTTA 2BOCB 1ZVSA 5GGQL 1Y6NR 1I8MA 1YEIL 4WFFE 1K8IB 5E8NA 2WV3A 2EH8L 5HHOA 3V8OA 2FJGA 2FR4B 5C92A 3H7LA 5SWZB 4DQOL 1T3FB 1XF3B 2H41A 2H9GB 3HPJA 1C12B 1JGVL 1OAQH 1TZGH 1WBYB 2O61B 4WI8A 4JVPA 5EBGA 1YMMA 3PXJA 2D7OA 1NDMA 4U6XA 2UVFA 4PLNC 3QHFL 4F7PB 2DI8A 4P23B 5BMFL 3H7BA 2OTUA 3CFDA 4I13B 3BPCA 4I18B 5DGRA 3TO2A 4F7EB 1A3RH 2BSTB 4MNQD 4P2QD 3DRTB 4HK0A 5E8OA 5I1GL 4Z95L 1YC8A 2IG2H 1N2RB 3W9DA 1JIBA 1I1YA 3JV0A 3K2MC 3VI3F 2NXYB 2FIKA 4XPGL 1FZJA 3GI9H 1EH9A 5DLMH 5IW1B 4NRZB 5F1OB 1IAKA 1ND0A 5GGRY 2BFVH 1LQSR 5C09A 4OZFB 2C1OA 1P7KB 3TN0B 4A2LA 4WI6A 1P4IL 2DM7A 1SJXA 3OR6B 5KVFL 4B50A 2F58H 2X9WA 3HFMH 5IM7A 4X98B 2XWJA 4K7FB 1QNZH 4M1DH 1SYSB 3G6JB 2OZ4A 2HVJB 8FABB 1FN4B 3MGTB 2W65B 3UMTA 3OPZL 2R2BB 3R0NA 4XVUD 3HNVL 3HPLB 3FTGA 1EEZA 3ECBB 1DQDH 1KT2A 3GMMA 4JVWA 3BH8A 4IRJD 4P4KA 5HPOA 3K7UA 2P5WE 1G9NC 1EHLH 2NXZC 3MUGB 4Y2DD 1XIWC 4RZCA 7FABH 2VQ1A 5EULV 1DLHA 4ISVB 5AZEL 2BC4A 1A6AB 3CLEH 2Q1EA 3TNMB 3OGCB 4JO4L 3ZE2F 1U3JA 5FO7B 3MXVH 5E6YA 2UZYB 3V5DB 3OXRB 4NCC1 4IRZH 1FYHB 1KLFA 4WHYH 1T03L 4PJ5D 5E08H 3SDDB 4P2OB 1T83C 1T5WA 2NYYC 5IKCB 3BW9B 5IK3A 3JVGC 3V5HB 3SE9H 1WIOA 5FECA 4D3CL 3MJ9A 2X2YA 1IZJA 5F3BA 3ULVF 3EOTH 3B43A 4NPYB 3DSNA 4EQ3A 3I84A 3MQIA 1FRGH 3GSVB 1RJCA 4LRIA 1JHLH 3QUXB 4MMZC 3W39B 4RWHA 1K6QH 1E4XL 4LIQH 1RZKH 1JZ2A 3GRWA 1K3IA 2WQ8A 2C4XA 2FHCA 3QXDA 5FO9B 1B4RA 4L3AA 3QG6A 3VWKA 4JG1L 1OAKH 3CVHH 3PWPD 1OAYL 3ZKMC 1NLBL 1JGEA 1MNUL 2NY4C 4D9RE 4TOYL 4JZJC 4JDTL 1XR9B 2F15A 2OXHA 1HSBA 3EO1B 3QPXL 4PBVC 4Z5RB 4PD4J 5KSAC 4MAUH 3GO1H 2GJJA 4UOJA 3HNTL 2R39A 1YNKL 5I8OL 4FQJL 3DX6A 2EDNA 4TQEH 5JHDA 2CR6A 5HI3C 4FXGB 4O2CB 4RGMB 3U0TA 1IC7L 3GIZH 4Q9RH 1QSFE 4X4ME 3DETD 5CZVH 5HI5D 3I50L 4PY8J 5IROA 3SOBL 3TBWB 1L0QA 2EIBA 3OJ2C 1MHEA 1NFDF 1DUZB 4HS3A 4J3OC 4V1DA 5ESAB 3DSFL 1F90H 3KPSB 4N0UA 2VZUA 3Q0HA 2B5IC 1GGTA 4NKDA 4XPBL 3NGBB 4HJ0D 3T2NL 2H6PB 4U05A 5E4EB 1KN2L 1IE5A 3QSKB 3VRLE 5TH2A 1N7MH 4RISL 4FQCL 3BP5A 4KK6D 2XICA 4OZGA 3VD7A 3SKOA 2AS5M 4N9GA 1CICD 2GCYA 4AENB 4ELKB 2KQMA 4LEOA 4HXBH 4LLVA 3U4BL 1RHFA 2D3VA 1NDGA 4GXUM 5EBMB 4RGOH 2VO5A 3VXME 1S7XA 2ICEB 4NHCH 4E42B 3H42L 3FZUC 1MAMH 1U8OA 3CCHB 1XGTB 4HZLA 4JN2B 4YHLH 4XP4L 5JDSB 5KW9H 3ARDA 5JLZB 1C5CH 5M7QA 4HS6B 2J4WH 1FLTX 4Y1AA 3IVKB 1BF8A 2AGJL 1DUYA 2EDLA 3IU4H 4OM1L 4WO4A 1ZLWH 4Z76B 5JQHC 1U3HB 2AK1L 3V6FA 5LGHL 5KSBA 3QFDA 5HHQA 4HWEH 2BXYA 2IBGA 3CVIL 4HIIA 4LPWA 2H26B 1DANU 3TIDB 1T89C 4GJTB 3BKCH 4GAYA 2A9ML 5IT2H 5T3XL 4LPCA 4XVSH 2NR6D 3TV3L 4HKBB 3DRQA 4L4VE 2VLRA 1A6ZB 1FG9C 1OGTA 3SDYH 5INDA 5DK0A 1KJMA 1P6FA 3QRFM 1LO0H 4TULH 4M93C 4WI9A 1U91B 3VFMA 2IAMC 3NCBB 3RVVC 4PRHE 4OLUL 3MV7D 1JBJA 2W0PA 5DJ0A 1NJ9B 1UKTA 2GSGA 4KK5D 1ETZB 4M43H 4YAQB 3WNPA 3AXLB 4KQ4H 4LSUL 3SPVB 4JHAL 4XNMA 3ROOB 3FT3A 1G7MB 4GRMB 3A6BL 1MVUB 5CS7A 4UV4H 3O8XC 2E6PA 3VFOA 3DVGA 5HDQH 5EC1A 3IU3B 5GRXG 1FFNB 1Z9LA 3QDHA 4XMLH 4MSWB 4MXQD 2D31A 1H3VA 3AAZB 3PNWB 1T2QL 1I1AD 1RSFA 1AGEA 1MFDL 4I2XE 1KPVA 5KVEL 1GC1H 4OTXH 4G9DA 5IJVA 2P7TA 3C8KB 4H20H 4ZPTB 3K2UH 3RKDC 1YQ2A 4U2ZA 3SBWC 5J8OA 2DD8L 4U6YA 3IETA 4G6KH 3NZ8B 4HIXL 4YWGH 4YDLB 5EZOL 5CEYA 4J8RB 4EI5A 2XZCH 3FN9A 1FORL 2WWKO 4AMKL 4LLWB 4JFZL 5LCVH 4DOHB 5E6ID 3H3PL 1GSMA 4WI2A 8CGTA 5CGTA 4P46B 2CKBB 1YMHB 2JELH 2O5XL 2Q76A 3GSNB 2XTJC 4Y4FD 1GRWA 3JWOC 1S8DA 4OF0A 3A6CL 3BISA 3QHTC 1AXTH 4IIQC 3QI9D 4NC2B 1LHZA 4PJFF 3HI6L 3MLYL 3MMEA 4Y89A 1ERNA 4NUGL 4OSUH 3QZWB 3GMOB 1OW0C 1JF5A 4YIQB 4EN3C 2FB4L 3U4EA 4XZUA 3LHPL 4NNYA 3RVWD 1QFOA 1DE4B 4TSAH 2VDLL 3I6KB 3C5SA 3WSQL 2BRRL 2EKSA 3SCMD 2OZ4L 5D2NA 3E6FB 1FCCA 1T1XA 5TE6L 3RZCD 2BNRD 5LVEA 3TBVB 3ZE0E 4TUOA 3V4PH 1LO3L 3MRDB 5FYKE 1TJIL 4Y4HD 5K9KB 3DYPA 3HZVB 4BSVA 5GGRA 5FCUL 1CL7I 4OCSH 5JIKA 4FXKB 4XCYA 3PF2A 2KDGA 1CDCA 4OIIL 3L3GB 1HHHB 1LEGA 1YEGH 4IDJL 5F9DC 4QXGH 3HE6C 2ZCLL 3EYUH 4S1SL 1IKNC 1ZA6B 3MJ8B 1QSFB 2F74B 2BVTA 4XP1L 2BNQB 5C0CD 3T8XA 3ZDZF 5JXEA 1CFBA