4P5KA

Structural basis of chronic beryllium disease: bridging the gap between allergy and autoimmunity
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
181
structure length
181
Chain Sequence
IKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
total genus 34
structure length 181
sequence length 181
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p5kA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p5kA01
1T1XB 4S1RL 2ICWJ 5D7LA 3DRTB 4QOKB 1HINL 3UBXB 4P3CH 5FA4B 4R8WH 5INCB 2VB5A 3B8YA 2BCKA 3DETC 2DL2A 2XTJB 4W81A 4L4TA 3UTSA 2DF3A 3OL2A 4TUOB 5E99L 3HZYA 4DFHA 1H15A 3NCJL 2GJZA 2QQLH 1I7UA 3WJJA 3BKCL 4JPIB 4LVHC 7FABH 3GK8H 3QUXA 2FH8A 1G9NL 2FHFA 3MX0A 4HKJB 4AM0B 1JZ8A 4U0RB 2A73A 3C6LB 2LTQB 5T1KB 2P49B 3D0LA 1NC4A 4WCYH 2AI0H 3QWOB 1A9EB 5IFAL 1LHZA 1ORQA 3BP6A 3WDIA 3SJVA 1TZIA 1Y0LB 1PYWA 3P9MB 4MXWH 3MLYL 5TDOA 2NTSP 1R5WA 2IG2H 1BVKB 1NSNL 2NY1B 5D7JD 4G6FB 4YWGL 1T22A 2BNQA 2JJVA 3MRFB 1UC6A 3KS0J 1TZIB 1Y0LA 1K3IA 1YNTA 1EX0A 3GO1H 4Y16A 3IJSB 4XNYL 3QHZH 5BS0E 3UTTB 4OCLC 3O3AA 4X7FC 1QFWL 2ZPKH 5KVDL 2CK0L 1F11B 3VFPB 2V6HA 4K3DL 2CXKA 1F97A 3CZFA 1NBVH 4I3SH 3T0DA 4ZFZA 5H2BA 2BNRE 1TXKA 4G8FB 1F6LL 4KV5F 1UXSB 2YA1A 4ODWA 5DD5H 5JXEC 3ARYA 1LDSA 5AUMA 2X4NB 3EJZD 2O5XH 1J1OL 1I1AD 1RZJH 1E27B 2EDLA 2B2XL 4QHMA 2V2XB 1MHPH 3UTSB 2BVQA 3UX9B 4U6VH 1BFSA 3DIFA 3QUZC 4OLUH 5E9DE 1S7WB 2GSIB 4H26B 4JCLA 4PRHE 5A1AA 1Q9WA 1I4FB 3BH8A 4A6YH 3CFJA 3LAFA 2WINA 5L0QB 2OXHA 3FFCD 5E6ZA 1T6WA 4WFFE 4CUCA 4F2MA 5I75B 2DOCA 4HUUB 1UACH 4K55A 2E7LC 2A83A 3KYKH 1XEDA 3HG1E 4NZJA 2J88L 5EWIH 4OZIE 4F9LA 5K9KA 2X1XR 2F53A 4N9OB 4FQXA 1JK8A 4HH9A 4PY7A 3AGVA 5FM5M 4QRRB 2XWJA 5EORH 1U8NB 3V5HB 2XY2A 4YDLC 5JXED 3NA9L 3L3OA 2DQTH 1HH9B 2N7BA 4PJ5D 1MCEA 3PNWB 3K4ZA 1MVUA 4O2FB 5BS0A 1QUNA 1QLEL 2VC2L 3IXAB 3GSWA 2WBJC 1MRCL 4ZUVA 5I76A 2C3HA 4XB8A 4S1SH 5TQ2H 2XWBA 4O51B 4XAWL 2P5WB 2NY1D 3CMGA 3MSPA 1I7RA 2DMCA 3G6DL 4G6FD 4PRHD 2J7LA 1AXSA 3PWLB 2EE6A 3VXUA 1H5BB 3QI9A 3LMJL 4CADB 3V9FA 3MRJA 3NPSB 3HZMA 5CGYC 1ODAA 4EJ1C 2ZUXA 1TQCB 3MLXL 3OAYK 4P23B 1BD2D 1IGYA 2AV1B 2AJVH 3GMPA 4J3UA 5DJZB 4PJIF 2X4QB 2NXYC 5JOFB 4HXBL 1JPTH 4NKIL 5CINH 5KJRH 3WUWB 2NY2C 1I8LA 3WS3B 3RX8A 1YYLH 1N8ZB 1W72B 5KOVC 3SEPA 4ALAH 4QNPE 3INUL 4WY7H 3O3DA 2BNUB 3TFKC 1ROWA 4QCIB 2EC8A 1XIWB 1T04A 1MH5B 1VENA 3IFLL 3QXAA 1ZGLB 1HQ4A 3MBED 1QQDB 2R0ZH 5GSRB 3O6FD 2ZSVB 1HXYA 5L9DL 4DN4L 5JDJA 4S1DC 2VLMD 4XNZC 4QTIL 4ZTOH 4KVCH 2HJFA 5KS9F 3AU1A 4QRQA 5E00B 3GNMH 4K7PX 3LN5A 3EOBB 4ZAKC 4YHPB 1S9VA 5E2UL 3VFRB 3RVTC 3ESVF 1TVBA 1K4DA 1W2KT 4RDQF 1P9MC 3GSQA 3QFJD 4GBXB 1RIHH 1K4CA 3SDXF 1UXWB 4UB0L 1BAFH 5C0CA 1CLYH 4OFIA 1CDBA 4TQEL 5C6TL 4QHKJ 3DUUB 4TN9A 3V52H 2BVYA 4KVNL 1J7VR 3ILQD 2X4PB 3E3QC 4M93B 4FQ2H 5KSUB 3IFPB 3DO7B 4PJBE 3U4AA 1KNOA 3CFKB 3OHXB 4U3XA 2UWEE 1KTLB 4R3SA 3EOTL 5GS0L 1MCQA 4RGNB 3BRFA 5CJXC 5E5UB 3RIAF 1TIUA 2XA8L 5E4EB 2RFXB 1ZWIB 2X2YA 3SDAC 4FQXB 2NY2B 2VDLH 3QXTA 2R2EB 4YHYC 4PJ7E 1UWXH 3OKKA 4U6YA 1BD2B 5CSGA 5EUOA 2P5EE 3FL7A 1J5OL 4HWBA 1KLUA 5CSZB 1IT9L 1XIWA 5I6XC 3FB6A 4HIXH 4GW5A 1XMWA 2WWKO 1NL0H 2P46B 6CGTA 4FQPA 3CSYB 2BJML 3KPOA 3NZHH 4X9GA 1G6RH 4GRLA 1G9EA 5FV2A 5MEQB 1WSST 4K9EL 1PKQB 3DX9B 4ZPVB 2B4CC 1OLZA 2EE3A 5IGXL 2CGRH 3UJIH 3E2HC 3PQYA 3O6FB 4OCMC 4DK6A 5KSBB 4U6TA 1U8OA 1MWAH 1WEJL 1AHWC 3E6FB 2HH0L 3SKMA 3W0WB 2FX7H 5CMAA 3BGMB 5IBLC 4OM1H 3U7YH 4LIQE 3HB3D 4FP8L 2VZTA 9CGTA 3ARFD 4WI4A 3OZ9H 3BWUC 1A6TB 1D7FA 1T83A 3TN0A 1JHTB 3KLSA 3QFJB 4G8GD 1IBGL 2OL3H 4I2XB 1T1ZB 3BP4B 2MHAA 4OF8A 3SCMB 5IB3A 4ENED 1OL0A 1BFVH 1BVKA 1OTSC 2FSEA 3OJMB 1HHIB 1J1XL 1JK8B 2YS4A 2JIXB 3DV6B 3W2DH 3UPCA 3BKYH 4ZYKB 1CD1A 3EYSH 2HKHL 3BGFC 2KH2B 1A6WL 4Y2DD 2FD6H 2B4CH 5A16A 2XN9E 4DKEL 1AD9A 3TVMD 2NY4B 3DGGA 4Z5RB 1FO0H 2P8LA 2VABA 4P5KB 1C16B 1PBYA 3GSQB 5MENE 1T5WB 2WK2A 1G7QA 1JMXA 5C8JA 5DJ6B 2BNRA 3MUGB 3RL1B 3SDCB 3RZCB 1SY6L 4HEPG 4BZ1H 4L4TB 1I1CA 1MI5A 1WVZA 2NYYD 4EDWH 1H9VA 1TJGH 4G8GE 2R0WH 3BQUD 1H3UA 1FNAA 1IAIH 5TPWH 5LAXA 2CJUH 1X5GA 3MOBL 4MA7L 5MEOA 3GIVA 2OTUB 3S37H 2AXGB 3WD5H 4OD1L 1A5FL 1K8IA 2CLZA 2E27H 3PHQA 1RUMH 4P3WA 3BAEL 2FJHA 5E4IA 1J0JA 4IDJH 4XRCA 1B4JH 4XI5D 2OR7A 4FXGB 4R7NB 4CVUA 3HUJF 4OCXL 4BH8A 5KG9A 2R1WA 3MRMB 3RKPA 4Z76B 5EZOL 5I1KH 1U8IA 3VI4F 3WFBL 2N1KA 3D69B 1PYWB 1VADA 2HTLD 4JZJB 3LKRB 1V5JA 1UVQA 4PJIA 1YMHA 5HGGS 5EPMB 3WXVL 3QNYB 4M6AA 5IBTH 1T3FB 3ZHLA 4PJFB 2Y06H 1ZLUK 1U8HB 4HWZA 4OZGF 4JO4H 3GI8H 5F9OL 5J6GB 1UXWA 3MRQB 3X13B 3B5TA 4M7KL 1MHCB 1RZ8A 4KROC 4TTDC 3G5YB 1U3HA 4P99A 1NBQA 5C09D 5SWZB 2J8UB 2GUOA 1E0OB 2AW2A 1NCNA 1H15B 1WIUA 2P5ED 4Y2DB 1KPUA 2YD2A 3T0WA 3KJ6H 3RPIA 1F3DJ 1A7NH 4QTHA 3AMKA 1X9QA 2HMID 3FT2A 2J1KA 1QEWB 4N8PA 3EOAB 1AGBB 2VDQL 1V7MH 4OT1L 2PTTB 5J12C 4Y4KB 1DDHB 2VDNH 4QCIA 2P24A 3KPTA 1CFSA 4KGLA 2WINB 4Z77B 4OCWH 5F9JB 2OM5A 4NFBA 1F4YH 4O4YL 3CH8A 1KLGB 5KTEH 4R2GC 3UP1A 4GW1B 1KJ2A 2BVPA 2W0FA 4RFOL 1CG9A 1KBGL 2YRPA 3PWJB 3VFWA 1ES0B 5JW3H 3SPVB 3B2VH 5CILL 3WKNA 5EIIB 1PVHA 2OXGA 5BVPL 1C16A 2K3TA 1BBJB 3DUHA 2RJMA 3JV0A 4KK5C 5ITBL 3O8XA 4Y4FA 5GISH 4K3EL 1F58H 3QRGL 1KXQE 2YPLD 3MREB 4LCYB 4LVHB 1OP5H 2XNAB 1DQML 3PXHA 5CCKH 2R1XB 1QBMH 5D2LF 1EA9C 5E99H 3DECA 3QISA 4JM4H 5I74B 4LLQA 3GMMA 4BZ1L 5HI3D 1W0YT 3MJ8B 5CZKA 1R3LA 3ARXA 3DUSB 4NM8L 5ETUA 1H3WM 3D39A 1KTLA 2CIKB 3QZWA 2ADIB 1PEWA 2BRRH 2P7TB 2SEBB 5D7IA 4RA3A 2AJZB 2CDGA 2E9JA 3S97C 3QI9C 4UV4H 1G9MC 4G80B 4D3CL 1PQZB 3FN0H 3KR3H 4PJIB 1MPAH 5IIEB 3DLQR 2ZOKB 3T0VA 2GCYB 1JF1A 3VE0A 3GJFB 3DTXB 3CXHK 5GRVK 2D0HA 2UZXB 3EJJX 4NO0A 4LGPB 1HYSD 3SGEI 3ARBA 1BMGA 3HR6A 5M95B 4TUJA 4G9FE 5ALBL 2DYPA 1TVHA 2WANA 1SY6A 4PJBA 1G9MH 5DT1L 3PJSB 4WJ5A 3GKWH 4HZAA 1HZHL 2PW1A 5FGCB 4XC3H 3RL2A 1IM3A 3RFZC 4F9LC 5D7LB 4MD5A 1HINH 4LKCB 1EHAA 2Y6SC 5DJCB 2F74B 3VG9C 2AK4A 2Z8VC 3U6RA 5DMKA 2GTWB 1UT9A 4ZFGH 2PCPA 3EOAA 3VU2A 4HC1A 4PRAA 5GGSY 4YNYB 1PGRB 2JJWA 2CRZA 2PYEE 1RSFA 4HX1B 1UWXK 1XCTB 3CXHJ 4MJ4A 2A6IB 4MA1B 4GAYB 1G7LA 4O5LL 1A3LH 1T0NA 4N8VB 4P57B 2D7PA 3SJVB 1Z3GH 4U7MA 4PJ5A 3SQBA 4KXZI 2Z35B 4BYHA 5BS0D 4L8CB 1MHEB 3H9ZA 4QT5B 3UO1L 2P47B 2V7NA 1J8KA 4HUKB 5D7KE 3HE7A 3NZ8A 3SKUD 4Q97A 1IC1A 3RBSA 3TIEA 3OAZK 2ARJB 3P4MA 4MD4B 4H8WL 3MLRL 4CMMA 4LNRA 1T7WA 4F80A 4ZOAA 3BZEA 1S7XA 4A2LA 1OTUD 5CZXD 1ND0B 5BZDB 4Y4KC 1W72H 3I02B 1I9JL 5CGYD 2VLME 1WZ1H 1X5XA 2ENSA 5BRZD 4F7PB 5IMOA 4PJCF 2GTWA 3O4LD 2O5ZH 1ZXQA 1NCWL 1KEMH 4XX1E 4WFFD 2X4RA 4JO2H 1JUFB 5CKAA 3B43A 4LAQL 2WW8A 3QFJE 3KR3L 5FFLA 4XNMB 1BFOA 4CNIA 5I8CB 2VDML 5JXAL 2VAAB 2KDGA 4UV7L 1I9IL 2XG5A 3P0VH 5DHXB 4EIZC 4YHOL 3BSZL 4MQ7B 4GRWE 3QDMD 3S36X 2RBLA 2AJVL 4HQQH 4PTTA 4HKZB 3NFSH 3FJTA 5BO1L 3HMWL 2HKFH 3GBNH 5IFHL 1P84K 3DX7B 2XT1B 4PJ5E 3ELAT 5FKPA 3DBXA 3QWQB 4PJEB 5E8DL 2HYMA 1LP9A 1UFUA 3QP3A 1LGVA 4I3GA 1XGRA 3VFPA 2H26B 5TE7H 2VC2H 3OB0K 3IDGA 5DHYA 5F7LB 3GSWB 3WL9B 2R23B 4IDLA 1DTUA 1NC4D 3HZVB 1ZOXA 1ZT7A 3NABH 1X3DA 2AEPH 4I0KA 4MJ6B 2LU3A 1J8HA 3B83A 1MIML 4RISH 1LNUA 2ATPB 5EZIL 1BZ7A 3VXME 4Q74A 1YECL 4LLQB 2DQJH 4JKLA 5E4EC 1KN2L 4YNYA 3X3GL 2D31B 4P5TD 3RX7A 4JAMB 4NZTL 1WWCA 3BJLA 3BGMA 4LDEB 5C1MB 3RZCC 3FO2B 5JDSA 2MPAH 5TGBB 4X5LA 5LXGL 2VZ3A 2VDNL 3OGOE 3DVFA 3TP4A 5HDBE 5F89A 5HJ3B 1I3RB 3FHQA 1QFWM 5F7UA 1J86A 3O4LB 4NJAH 2A6KA 3K80A 1WJ3A 2OI9B 2Q86B 2DLHA 4JJHA 4OV6F 4GFTB 2WIIA 3X12A 1MJ8L 2DAVA 1KLGA 4RAVA 4P2OA 1HNFA 2A1WL 3QXAB 5GS2D 4AIOA 2VQUA 3PWPB 5FYKU 1GZPB 3NBNA 1WK0A 4LCUA 2Y23A 4PREB 5I1LB 3VFVA 1PFCA 3MJ9L 4JEGB 2AVGA 5SWSB 3RWGA 1Z9OA 1XCQB 2ICEB 5D1ZC 1L0QA 3NIFF 5FCUL 5FO8B 1Q94B 4D9LL 1ZV5A 2XN9D 3HRZA 4Z7WF 4BQCA 5HHQB 3QIWC 2BJMH 2QADD 1HE7A 4DVRL 2X4QA 5JOFA 2JB5L 4EN3C 5D2NC 3AXLB 1OCWL 2KL6A 4OBSA 3AM8A 3L9RB 4U6XA 4YEEA 5C0AD 1E4WH 1MHCA 2X9WA 3MRPB 5E9DB 4HPYL 3N0PB 4OZGB 3JVGC 4F7TB 2X4PA 5IWLA 4XH2A 1FG2B 4KPHL 4NSKA 5J3HC 5T1KA 3GSXB 1TDQA 3ULVF 2DIAA 4IRJD 1DEEA 3LVEA 4MDJA 3SDDD 3O2VH 4Z95H 1NGPH 3O11A 4JFDB 3RWCA 3GIZH 3GBMH 5K33A 4QHUA 1VADB 1II4E 3FOMB 3FQWB 1EXUA 3PWNB 5I1CL 1PG7H 2R1WB 2XWJB 3QIWA 5E00A 4B7LA 3MUJA 1XGQA 4LF3A 4MXWL 5ABDE 1NCDL 2CR6A 4BK5A 4M93C 4J4PD 1ZHLA 5JW5A 3DX6B 2FB4L 4KJPC 3OBAA 3OKDA 4LRNL 2QQNL 4EN3D 3MBXH 3FMGH 4FZEH 4TSAH 3PWPA 4MD5B 3L7EB 3QDME 5IHUL 1BWMA 4Z7VE 2GEEA 3U0TB 3ET9F 1BQHG 3TWCL 1A4JA 1NKRA 3LRSB 4P2RB 5EZJB 2R2HB 4OUOA 5C08A 3BKCH 2YUXA 4NQDA 4JM2C 3L5XL 5GRUL 4OLWL 4Y2DA 4U1JA 4XAKE 3O41B 3MFGB 2J8UA 2OZ4A 3CH1A 4X83A 4G7VH 3SDYH 4P46B 3W9EA 4DZBB 4P49A 5D9SA 1RK0A 2Z31C 3OKNA 5FO9A 2V9RA 4XPBH 4Y19B 1KN4H 2HT3C 2YBRB 2R9HC 3C87A 2E6PA 1FRGH 3MROA 4TNVK 5FUCC 5DJAA 1SEQH 2AEWA 3MGOA 4UILL 1B0WA 1JGEB 1NBZB 4XCFH 5ISZB 1A9BB 4HV8A 2I27N 1QO3B 5F70A 3W5MA 5DUML 1N6QH 4U2YA 5AYQA 4P9HL 4F9PC 1E4JA 2A0LC 1KT2B 1ZHBA 4K71B 3HE7D 1IJ9A 2AK1H 3PXJA 3H9SB 4HK0A 3IDYB 3HZVA 1I1AA 3WIFB 2VO5A 1YYMH 4HH8A 5KN5A 2C4FT 4GMSH 4U1KB 1HHJA 4IIQB 1U91B 1EVTC 4BUHA 5C0BB 2DLEA 1GGBH 2W60A 1QSFB 5F9DC 3HI5H 2BVOB 3V8CA 5HHOE 1MRDH 1X4ZA 4PJ9A 4GKSB 5J4MA 2AXGA 3B2UD 1NGPL 2ZOLB 3ES6A 4AH2B 1NFDB 4ETYA 4KJWC 3VWJD 3W9EB 4DZBA 3FQUA 5CEYA 1P2CB 5H37H 4MCZB 4NQDE 3K4AA 4Y16D 2GJZB 2IPUK 5TQ0H 3FFDB 2AV7A 4I0CC 5TF1L 2ZUVA 3FONA 4PP1D 5F96H 2E7MA 3MR9B 3L3HB 3LZFH 1TTFA 2K9UA 3QQ3B 4G9DB 2IANA 4JO3H 4QRSB 4PYGA 4OJFL 1BOGB 1DBAL 2APFA 4H0GA 1GOHA 1J05A 3WFBH 5JUEH 2HT4C 1P7QD 4LIQL 2FX8L 3U36A 4APQD 3KLHC 1M7IA 1AI1H 2NY3C 5F6IC 4OCXH 1FNGA 4HSQA 1TITA 4KK5D 3T1WA 3BHBA 1BAFL 2ED9A 2EDOA 2IMNA 3SE8L 4BUGA 5I30L 1ZHBB 4FFWC 3RTQD 3KNBA 2A77L 5E7BA 3WIHH 3ZTNH 5DRXB 5KSAA 3N85L 3U7WH 4GKZB 4JZNA 5ID1A 3BRGC 1FSKB 2J12B 5IWLC 4ONOA 4Z9KB 3TBTB 5B39A 3MOAL 4JM2F 4BSVA 1UJ3B 4PJGA 4MJIA 3VI4E 4IBLT 4MAUL 1D5IH 4LLYB 3BT2L 5I17B 4C83A 1NCCH 3E6FA 3BPCA 3MODL 1B0RA 3OKNB 5FO9B 4CW1B 3PHSA 2YK1L 5L2JB 2WNGA 2YD3A 1EZVY 4ZSOE 2HRPL 3MC0A 2GTZB 5ESVB 2MCPH 3O8XD 4Y4FD 3UCRA 1WCQA 2DBLH 4YHKL 1CBVL 4DUVA 4NKDB 3L3IA 3R0MA 4FXGA 3WHXA 4Z7OF 4PG9A 3PL6B 3BD5A 5DC9B 4HWNA 5A2LH 5L2KE 1O7SA 1YY9C 3OKLB 1O5DT 5I73C 2EEBA 3A6OA 1CFSB 3WSQL 4XCYB 5GJSL 1WBZA 1J1XH 5DWUH 4OV5A 2AJ3B 4TSAL 2FIKB 4UT6L 4N0UB 3VWJA 4B7IA 3HN3A 5EOCJ 5F7YC 4LRNH 3MUY1 4WWKB 4HIJA 1DN2A 2FJFB 4BZ2H 1URLA 2UYLB 3STLB 1DP0A 3VFTB 4D0DB 3JVGA 4KMTH 3AAZB 3HE6A 4KRPD 3HZKA 3OAZH 3MV7B 4XBGA 1NFKA 4K8RL 4Z7UE 3MRJB 1BREA 3BIBX 2IH3A 5B8CA 1AXSB 5GHWH 4TUKL 1CD8A 4XPGL 3W39A 3UJIL 3O9WC 5J6HB 2WQ8A 5AYUL 3DV4B 5ICYB 1FG2A 4NSKB 3TYGL 4NDMB 4XMPH 1UEYA 1EH9A 2DQFB 2IH3B 7CGTA 2SEBA 2Q7YA 5D7IB 25C8H 3Q6GH 5IJVA 4MDIA 1DQDL 4JRYA 5DJ0B 1FIGL 1TENA 5FOBB 3QXDA 4RZCA 1OP3H 3P9LB 3T0XA 1Q0YL 4LPYA 2W9LA 32C2B 5J1AA 4L3CA 5J57B 4JHAL 5KG9B 4LEOA 4XNZB 4OI8A 1CIDA 3G6JF 1D5MB 4JG0L 1QD0A 2IANE 3TBVA 4RMVA 4HEME 3VGDA 5C0IA 3FAXA 2NXZD 2MJWA 2OCFD 4PG2A 2NY5H 1AGFB 4LCYA 1YEGL 4LLVB 1DQJA 3ORJA 3ETBF 5ESAA 2FX7L 4JFQA 1H8OA 4PRPD 5L7XH 1CE1L 4X4MA 1QHOA 1MCLA 4DTGH 5ALBH 3J8F7 2BNQD 2OSLA 3RDTD 2CK0H 2ZUQC 3B6SA 2ERJC 1MI5B 3QEQE 1FGVH 3DYOA 1X5ZA 3TC9A 5EU7E 2V2XA 5CAYB 1A7PH 2VDRL 2F19L 1PJ9A 2VYRE 1DBJH 2YMXH 2VSCA 3MCLH 1I1YA 4F37F 4KJQD 2CDEA 4MLIA 1B0RB 1KJVA 3MRHA 4HFUL 5TFSL 2FLBT 1U58A 2PTTA 1NMCC 2BOCA 3AREA 1TQBB 1AGBA 4TUKH 4XX1G 5DQDL 5I0DA 1RMFH 5ACZB 3P77B 1CFQB 1RUKL 1H0DA 3BN3B 1NH6A 3LN9A 2VH5H 4KK9D 5DEGB 1G7JB 5T1LA 3TA3B 1PKOA 5FUOL 3NIDF 1YNTB 2WWMD 1WZMA 5HYSB 4FFVD 3E3QE 3RUGF 4M7ZB 3TCLA 3UTSD 1QVOB 1X4YA 2DIJA 4U1HA 1TVDA 5FV1L 5EOCH 4PLJD 1N26A 3FFCB 2VERN 1SBBA 4H88L 2FRGP 2H26A 5FHAH 5BQ7A 4RWYH 4RMRA 4LSSL 1DUZA 5EBWB 4G8GA 1ONQB 2KQMA 5KVFH 3KG5A 4PJAA 4ZAKA 4OBRA 1T5XB 5EZIH 3UTQB 4ERSL 3D9AL 1LEGB 4NN6B 4XMKL 4H26A 3LV3A 3RUGE 4Z0BL 1DUYB 3MJ7B 5DVKA 1VACA 1IEBB 1VB9A 4L29B 4DKFL 1WC7A 4N9GA 4I4WB 4PGEB 3SGJA 2WWMC 3QFDB 3HAEH 5F97E 3UTSE 4MB5A 3OAUH 3G9VA 4JR9H 2H45A 1GC1L 2GIYA 2GY7B 4YR6A 3RGVC 1DDHA 5F9WB 5FM4A 1KIQA 4Y5VC 2HVKA 1EUUA 2ITDA 5FGBC 4JFEA 3UPAA 1MRCH 2YXMA 1N8ZA 1W72A 2R2EA 4YFLF 1GJIA 1IILE 1DLFH 4PJXF 4X5XA 4ONFH 3TEUA 5C92A 4WEUD 2JCCA 2HT3D 3SE8H 4FQHB 1KT2A 3PABA 3CVIH 3VXMD 3KYAA 4NUJA 4QRUA 2CD0A 1YEGH 4FOMA 5J6GA 3BWAB 5KW9L 2FATH 3PV6A 1OAKL 4H0IA 3CCHA 2NX5D 4LCWA 3HMXL 1F4YL 4O4YH 4MJIB 1A7RH 5DQDH 3V5KB 4XAWH 3HE7C 3RHWK 1CLCA 1GH7A 3K8MA 1T1WA 4JRYD 1R0AH 4ONHA 5E2TH 4FTVB 1DSFL 3EAKA 1H8SA 5ETUB 3V4UH 4OF5A 2GAZA 1BEYH 2VLRD 3MCLL 3DX8B 3BIKA 3JV6B 3EHBC 1I9RL 4KV5E 5J11C 2KKQA 4MA3A 4XI5C 5ACMA 1UWGL 4GMTL 1T2XA 3B2UC 2DB8A 3VXQA 4XPGH 4JQIL 4JFEB 1N5AB 1AR1C 1XGUB 4XVSL 2V5MA 1J05B 1RFDH 1XGYH 2ZNXA 1S7QA 3PGFH 4NKOB 3M45A 2JTDA 2FGZA 4XCYA 3R8BB 3P0YL 3QHFL 4QRSA 3QUZD 1XF2A 4JKWA 1FVDB 2DM7A 3RA7L 4Y7MA 4M43L 1E6JL 3TM6A 1U41A 2H2SC 4FRWA 1CK0L 5F93C 4MD0B 2BSTB 5GZOC 3O2WH 4LDOB 4EUPB 5EU7C 5HHXH 4R7DB 3DURB 3ARSA 4WWKC 1P5UA 2H1PL 4OIIL 1B2WH 1NFDA 3JTSA 4XP4L 1G0DA 4ZAKB 4NZUL 3SDAA 4K94L 1A21A 1G9NC 4NQCB 1MPAL 3QDGB 3KYMB 1KIUA 3QWRD 2HMIC 4XPBL 4XH2B 3ZDYF 2EH8L 1OWWA 1A3RL 1VEOA 3IS0X 1UB6B 2XKSA 4GBXD 4WHTB 2ZCLL 1SJHB 2NNAB 4LPUA 1KPRB 5FIEA 3FMGL 4ZUTB 1F90H 2OK0L 4M6ML 1T1ZA 4TOYH 3L5XH 4CN1A 1CVRA 2GY5A 4R2GB 4WTZA 3HI1A 4EXPX 3BP7B 2W65A 4LLMB 4KDWA 1OSZB 4Y5YC 1YMME 4KQ4H 5D71H 2LVCA 1KC5L 5IKCB 2PF6A 3IDXH 5DJAB 2HA1A 2Q3AA 1N0XL 1A6AA 3B9VA 3R1GH 4NJ9H 1NUNB 5GGVY 5IFJB 2LU7A 2H9GB 1J0KA 5I1GL 4YE4L 5DI8B 4U1NA 4GG6A 5D8JH 1AJ7H 1SJXA 4H20L 2BXYA 5GRZA 3LKSA 1I8LC 2EDNA 3FQTB 3GMQA 4EVNB 2YPKA 4H1LG 4PRBB 1VDGA 1KGCD 1P4BL 4WV1A 2OJZH 3VD3A 3TN0D 5C08B 1P2CA 1S78D 3QYCA 5EBLA 1I9EA 4ODWB 3DXAD 2RQ8A 4L8BA 5HPMB 4PB0L 4NKMB 3QUKB 1UM5L 3T8XB 1JRHH 4OLYL 1T03L 5IVXF 3JWOC 3FOLA 3FT4B 3MLUL 1CS6A 1I3GL 3ZKMD 1EHXA 1DBBH 1OPGH 4NRXA 3AROA 3NN8B 5CHNA 3U7YL 5HHPB 4HS3B 2YZ1A 4MQSB 1RZGA 4D0BB 2FYYA 4BM7A 1D6VH 1J18A 1CU4L 2DQHL 4XTRD 1IM9B 1RZFH 4G6JL 2Q3ZA 3RY6A 3U7WL 5GGTL 5ESVA 1FNFA 4LNVA 2EKSB 1I9IH 2FDBP 3CFDA 1NC2A 1YJDC 1FDLL 1UKSA 5KVEL 3OXSA 1ORQB 2IC2A 4ZDHA 4OZHA 2W0KA 3T1FA 2XFXB 3OMZA 3G5ZA 3RTQC 3SGJC 3FB5A 3TJEL 1FCCA 1NL0L 4P4KB 3TZVA 2F8XC 5EDXA 2A1WH 3KPNA 2WUBL 5F1OB 5KSVB 4WU7B 5C6PB 3L3OB 4G5ZL 3DI2B 3IT8D 3KNBB 5HHVL 2P48B 4GXUN 4K8RD 4WO4B 1NCBL 1U8PB 1G7PB 3O4OC 3WNPA 2AKRB 1P53A 2VDPH 3MLWL 3F62A 1C5CL 3FO0H 4FQCL 3BH9B 1YEJL 1JWMB 1P5VA 3ULVL 1BFOB 2AEQH 4M8QA 1F3RB 2BMKA 4RGNE 4BA8A 2ERJB 1VKXA 1Z5LB 1E6OL 3MRLB 1DLHA 4KKBD 5DFWH 1OM3L 4U6HA 1FLRL 3SQOH 4L4TD 2BDNH 4LSUL 1MFEL 3WJLA 1CL7H 2FHBA 2EDTA 5CBEA 1Q9WB 3BH8B 1U0QA 4F3FB 1WBXB 5D1QA 5SWZD 4JPWL 4KJQC 2Q86A 3OGCB 4LSDA 3DXAB 1SHMA 1B4JL 1ITBB 1QACA 3DVNA 4IDJL 2A6KB 3L95B 1P4IL 5IQ7H 4WW1A 3VFMA 1A6ZB 4LKXA 3BZ4A 4L3EA 1B3JA 4QHNB 3T2NH 5I66B 3DTXA 4WEMB 5EG6C 3TNNA 3SDXE 2JJSC 3P4MB 4MD4A 3V6ZA 1GHFL 3VFSA 3CJJA 3I3EA 4Y4KD 1WT5A 1AGFA 1JRHL 4NN7C 4OLYH 1T03H 1Q8MA 4HUWB 3FB5B 4X6DF 1C12A 3GHBH 5CP7A 3H0TB 2VQ1B 5IB4A 1XR8A 1QNZL 3QO0A 4Z7VB 5FYJE 5D1QC 2CKBH 5DYOA 4KKBC 4KROB 4U6XB 3DUSA 4OFKA 3CVHH 4HIEA 5ANME 2DICA 1SMOA 1X5IA 3QDGE 3BO8A 5E08H 1WAAE 4YHOH 1RPQA 4H1LB 4Z7VA 1DE4A 2Q87A 1T66D 4WHTA 1RZGB 4D0BA 1KNOB 4MWFA 5I1HH 4NQVA 2ESVE 5D1ZD 1XT5A 3Q5OA 5LG1A 4XHJD 3RY4A 1I8MB 2EC9T 4C4KT 1R5VB 3O81A 3KYNA 4G7YL 5JR1L 3SE3C 3ARGC 3G6DH 1RY7B 1A6ZA 4LKXB 3SPVA 5DTFB 2XWTB 4U6VL 2DI9A 1A8JH 5HVHB 1FFPB 1MHPL 4PTTB 4OCSH 1CG9B 1A7PL 1BVZA 2VDRH 3P11L 4K9EC 1RHHB 1F42A 1U42A 1OP3K 2F5BH 5KVEH 4S1QL 3G5XA 5IB1A 4OGXH 4YC2B 1CD9B 4JM4L 5IOPA 3KPOB 4J23A 4MLSA 5JW4M 5I1CH 1FIGH 1DQDH 5DI8A 1MCOL 3WE6B 1VFUA 4JFQB 4PV9B 4G8EB 3VFNB 2BSSB 3EYFB 1AY1L 3GIZL 2BVOA 2W60B 1FV1A 2MSPA 3MGTB 3PWVB 4DGIL 3T77B 4F9PA 4P2OC 3ZKSD 3WUWA 3JWOL 2AQ2A 2CIKA 4ZSOA 4W4NA 4NQSB 4PB0H 3K8LA 5T5NF 2XICA 1JFQL 3DX8A 4LU5L 3LQAL 2HLFC 4ZNCD 4G8IB 4XP1L 5DJZA 5E6IC 4HIEB 3MXVL 3P9LA 3H9HA 5LGHL 3T0BA 5FOBA 4GG6F 2P44B 3LHPH 2EZ0C 2ZSWB 5DLMH 3MXWL 4PJGE 4LCIH 2BK8A 2AGJL 5A43C 2E7HA 1GGCH 1KENL 3KDMA 1FL3A 1ZHKA 4KVNH 4ZUUA 5GZNC 3AY4C 1JPFB 5GXBB 1K85A 1MUJB 5CZVL 1NEUA 5BW7A 4ZDHB 4J4PA 2MWCA 2V7HA 3NIGF 1QRNB 2PR4L 4YDVA 4JZJA 3E0GA 2B8OT 5F21B 2AP2A 4JKKA 2BNQE 3VJ6A 3GMRB 1JHLH 1I8IB 3QCVL 4LP5A 4C59B 1L7IL 2E3VA 2NMSA 4UUJA 1KCRL 1HOCB 3QIUB 1T83C 3AB0C 3KYOB 4WUKH 4ODVL 4YIQA 2IADA 5MHSE 5I1LA 3L7EA 2AK4B 3IF1A 5E6ID 1HILB 2R0ZL 1C5DB 4RGNC 5D2NB 1PG7X 1DZBA 4G8EA 1U8LB 2X4RB 5IF0A 4JFYB 4QYOB 3BQUC 4AEIL 5HDQL 2HJLA 4NNPH 4F15B 4I18C 4UMGA 3BH9A 1F2QA 1DQMH 3CK0H 4KVCL 2I9LA 4WI6A 4IOIA 4Y19E 3SGDI 4OQTH 5KOMC 2VR5A 4XMKH 3BVNA 5KSAC 5D93B 2QBWA 1JZ4A 2EYRA 1ORSA 3KJ4C 2GTZA 4HXBH 3WS6C 3C60D 3IDIA 4E0RA 4EI5D 1EBPA 3GMNB 3CLEH 4XNUL 4P2YA 4YDVB 3B9KC 1R5VA 4LSPH 2NY0D 2E27L 4JY5L 4JM2A 2E6QA 3QWRA 4B53A 5JOEA 4LIQH 1E6JH 1X5FA 1SBSH 4K3EH 1FVEB 3N1FC 4JR9L 3JTTB 1VEMA 5IKCA 4WTXA 3FQNB 2HWZH 1JP5A 2FEDD 4QY8B 3LKRA 3VFGH 4XPAH 1KCSH 2HN7A 4U1GB 3BDYH 3MV8E 4P2QB 1MCWW 2A77H 4L4JA 1NLBL 2DKUA 3RKDC 2AXFB 2VXUL 1ULVA 1CI5A 4HIHA 3BEWA 1T0MB 4KKLC 3QG7L 3T77A 4WFHD 3SGKA 2VISB 3RBGA 1MEXH 3QUZA 2R1XA 3PP3H 3KYMA 5HHMB 1U58B 2DKSA 3FB8B 2OL3B 4Y4HD 4PG2C 4QXUH 5AWNH 5JUEL 3H42H 5FYJU 3W2DL 4JPIA 5EU4B 4JO2L 3HNTH 4FXKA 3GM0A 4PJHE 2ESVB 2BRQA 1T4KA 1VACB 1D6EB 1NFIB 4NQEE 4AEHH 3C5JA 4Z7NF 1A6VL 4YK4C 4RIRA 4UZGA 2C4XA 1WZ1L 1UH2A 4X4ZA 1WBXA 2CMRH 2GT9B 2LAAA 3OZ9L 3UXFA 5IVXB 4HUMB 4NKQB 3B9KB 4P23C 5IIEA 1G0XA 2FJGB 3S8WA 5EU6A 4EUPG 3UTTE 4PRIB 5E7FA 3GEWB 4R90L 1A1MA 2Y5EA 1YEIH 1T89A 4J1UA 5JW5B 2JJTA 3KYOA 5CJQH 3TH3T 1RIUL 4PJHF 3DROA 1JZ6A 3IJHA 1LNUB 2ATPA 2J8OA 4AYFA 4MJ2A 3TFKD 4S0SD 3C5ZB 2YZ8A 1S9YA 3V6OC 3EJZC 1GPOH 3H8NA 2UZIL 3X13A 2F5AL 1CE1H 3VRJB 5JHDB 3VXOA 2PYEB 1N0XH 2IALA 3WO4C 5ICYA 3GSNA 4TRPL 1JWSB 4F57L 4LEXH 3V4VH 2FGWH 5D71L 4OD1H 1UZ6E 5AD0B 4GAGL 4LSVH 4IOFD 5C09E 3UTZB 1ZA3A 5EC2A 4AEFA 4M6MH 1NC2B 3AB0B 5CUSL 1BJ1J 5GRYA 4FXLA 5JPMA 2E9BA 4OD2B 4MNGB 5EH1A 1JNLL 2JCCB 5EO1B 4AG4L 4FQLH 3OGCA 4GW1A 1BIIB 4KDVA 1RUQL 3GSVB 1YEHL 4F7EA 3T3PE 5KSBF 5L8KB 4LCCA 3BI9X 3GMLA 1MHHB 2ZUTA 5C0GA 2E7LA 3U82B 3UC0L 1KULA 1LP9E 4UOJA 1RUPH 1ZANL 3U1SL 4LLVA 3X17A 5EBGA 43CAB 1S78C 5K59F 1HKLL 3IKKA 1F00I 2QQLL 2C5DC 2E7CA 5HVWA 3SE9L 3D2UB 4P3DA 2ADFL 4UOW0 2BERA 1PY4A 3DMMD 5LGHH 3LKQA 1E28B 1JNJA 3QDMA 4IOFC 4ZXBC 5D2NE 4YHZH 1JFQH 5FO7B 3CIQA 2XZZA 1MNUL 4PGCB 1QR1B 2XQBH 2BVEA 2Y25A 3CFKA 1A2YB 4NGHL 4YHNA 1V7ML 1XF3B 3VXSA 2EH8H 3AVEA 1FL5B 3L7FB 3WFZA 5ALCH 4R90H 5C09A 5E8NA 4NQVB 4OZGA 4XPTH 5F44A 4YHNB 1U6AL 4KUCF 2AQ1A 3G04B 1ZVYA 5L7XL 1IZJA 3ARWA 5GISL 3LSOB 1U2CA 3CDFA 4IOSD 4PJ5B 3W11C 1I1FB 4WFHE 2O93L 4LOUD 4O58L 3OKMB 1JL8A 3W81A 2GSGA 5IP4A 1LD9A 3VDAA 4IMLB 4NHUA 5C7XH 1JN6A 4AEHL 1C12B 3B8SA 5ILTL 1KELL 3FO9A 4FQQB 3PF2A 4RX4D 1KOAA 5KTEL 3QEQB 5LGJA 1JF6A 3I3BA 5DJXB 2XRAH 4OZFG 5I71B 3O3UN 4YK4B 4LKCA 3F7YB 1J0ZA 3WE6A 1TTUA 4KI1A 2HTKD 3S6CA 1JZ2A 2EDBA 3ZYIA 1MAJA 1KTDA 2VIRB 3O9WB 1Y6NR 3WS6A 1Q9OB 4KFZC 5KVGL 4M6OH 5D6DA 1IFHH 2IBBA 4PJ8D 1XGTB 4G6KL 4JDVA 1IQWL 2G60H 2H3NA 2LTQC 3H3PL 5FYJL 2AV7B 1ZEAL 4YEFA 1EHLL 4YPGB 1RIVL 4QXGH 3NFNB 1A14L 5K9JL 4P23A 1BEYL 1U2HA 4XNMA 5HY9A 1HCFX 15C8L 4XNQB 1NEZB 4I8DA 1VKXB 3UEZA 1D9KA 5HGAB 3SDAD 1FZKA 1N5AA 4TQEH 1OD7A 5L9DH 3V7MA 4L8SB 3JV4B 2JELL 4NHCL 1TFHA 4GS7C 4XP6H 2FATL 4UU9A 5BV7C 4YBQD 3MV9D 1MCNA 1QVOA 3CVIL 4PRIE 4X98A 2H2PC 5IROC 3ZE2E 5SWSE 4UU9B 4HKXB 2CLRB 3WL9A 4I3RH 5D2LA 4HWUA 5C0AA 4GRMA 3AY4A 1UM6L 5LGKA 3EYSL 2Z93B 1E4XH 3DUUA 1HKFA 3F12A 3QDGA 1OT1A 3OJDB 1GGBL 2IWGA 4IRSA 2VJXA 5EOCL 1JTTA 5CGTA 1QFWH 2ZPKL 1ZVSB 4LLWA 4OTXL 4X4XA 4X4YA 3WN5A 2X70B 5HYJD 4JZOB 4FQIL 3CFJB 4K3JL 5HHNA 3NH7H 1CQKA 3MRDA 2OX5A 4L9DA 5CUSH 3S9DB 1R24A 2PXYB 5C0BD 3QEQD 4JQVA 2OR8A 8FABB 4M7JL 4F33B 5MERB 4HQQL 4M1GL 2GJJA 1FFNA 4CKVX 4PJHA 1ZA6B 1U8QB 4KI5C 5GPRA 4K94C 4PJCB 4XHQA 4CNIB 5CBAA 3P4NA 4FFVC 3SE9H 5IR1B 5C9JB 1MH5A 4XBPB 4OV5B 5F1NB 2EIEA 3QRFM 2CGRL 4OQTA 4PLJC 4LCCB 1KEML 3RVXD 2D9CA 2PN5A 4MXQD 4P2QE 1KCRH 1ZHLB 2AJXL 4WJ5B 1UZ8B 3KYKL 1IGJA 4Y2DC 3IRZA 1DVFA 3BD4A 3UROR 3WIFA 3D85D 4NO5B 1U95B 1QSEE 3MMEB 1OGAE 4P2QA 3EO0A 4LNRB 1T5WA 4QXWA 1KIPA 4JZOA 3WFHA 4P3CL 3I75B 2FEDC 2I07B 4G8GB 1VGEL 1F3JB 2EE2A 5CEZD 3F58L 4U1LB 4C54A 4AM0A 5EUKA 3SCMD 5EN2B 4NO2A 4ZO6A 3S37X 1QPXA 5IW1B 3V95A 1CDIA 1FZJA 2OR9L 4GMTH 3QZWB 4X7SH 3QAZC 5J3HD 3GMOB 3MXVH 4LHUB 1CFTA 2AERT 5D7KD 2NW3B 3QJFB 4ZOBA 4FFZL 2FBOJ 3F7QA 5FK9A 4ZUTA 5CD5C 2FNBA 3T3ME 3JWOH 5HYSA 2F19H 2ED8A 1AR2A 1C7SA 5C07E 4EZMA 5KVGH 4WI3A 2VXSL 4GG8B 1JPST 2NY4D 5D6CB 1EO8L 1CLZH 1WBYB 1HXMB 3P77A 2DJSA 4WO4C 1U3HC 1NSNH 3OKOA 4ZTPL 2D3VA 1UM4H 3VXUD 5CEXA 2J2ZA 2CKBA 2EDJA 4PBXA 3BFOA 4YDIH 2DM3A 3LCYA 4L8DA 2AI0L 3L3DA 3QHZL 5MI0C 1SEBA 1AIFB 5B3JF 3ZE0E 5D7JB 1X5LA 1N7MH 1IKFL 4QEGA 4QHMB 1TETH 1WIPA 1EHNA 2OBGA 2HG5A 4XXCA 2XTJE 3GMPB 5FCUH 2DI7A 5C8JB 3DETD 5EU4A 2E9WA 1UXSA 4IHOB 3K2UH 2A9ML 5I8EA 4ZMAT 3G08A 3TESA 3D85B 1MOEA 3LH2H 4Z18A 1AQDA 1YZZA 4NZTH 4S2SA 1FAKT 1JWSA 2DQCH 4UOW1 4CVWA 3FT2B 2ITCB 5F88A 1NJ9A 2R9HD 3HI1B 1MI5D 2I60H 4RGMB 5JW3L 4PRHA 1FORL 1FYHB 4CN6A 2FECI 1BQUA 2Q1EA 1V3LA 4RMWA 2FLRT 2DIBA 3LKOA 3KLDA 4PY7B 3UMTA 4QY8A 1T1YA 3ZSTA 4GO6B 5JHLH 3MGOB 4OCWL 2BVTA 2HWZL 1NGWB 1LE9A 2VDKL 1PG7L 3NA4A 1T3FA 3KPSD 1IGMH 2D4FA 1OF2B 2UWEF 3QNYA 1XZ0A 3V6ZB 5A2FA 3QEGH 3I9GH 4PV9A 4YHLL 2DQTL 1I8KA 4XPHH 4AJ0A 3E8UL 2G75B 4PD4J 5AZ2H 1FFQA 1N3NB 1CDJA 3PABB 1EHLH 3CGTA 2R0LH 5BVPH 3CMOH 4HCRL 4YHPA 1N4XH 4HJJH 2PYFA 4LARH 3O2DH 3F8UB 5MEQA 1ZTXL 3RVUC 2OSLB 3U9PL 1DQQA 5ICZB 2Z8WC 1KPVA 3C6SA 4JDZA 1DFBH 1GAFL 3NVQA 1CFNA 3L3GB 4YAQA 5EBMA 3QA3A 3S88H 1MRFH 4HFUH 1PX3A 5IT2H 1TZHB 1KTRL 1L9NA 3BXNA 4XP9H 3I2CL 5GGTA 4PGEA 1U8QA 2ZG1A 3WS3A 3KPLA 4YH6A 1CGTA 3GKZA 3ZHDA 1P1ZA 2VH5L 1ACZA 3ZE1E 3OPZH 5JPNA 1ZLSL 2YPLB 1MIEH 1KYOK 1IMHC 3FRPA 4GOSA 2VDMH 4K23H 4CMMB 1OGTB 2R2BA 3ZT6A 4ONGH 1UM4L 1YMMD 3GRWH 5T3XE 2VQTA 5A16B 2XYCA 5SX4H 4OCRL 5DK2B 2ZWLT 4PFEA 4Q6IA 2FECL 4PJFA 1MREH 5L88H 4NQXA 1FDLH 12E8H 3TBTA 3VG9B 3TYFB 1NGZB 1KELH 2QHLA 3OAUL 3RWJB 1T0PB 4KHTH 1CGXA 4PGCA 1K4DB 1CE6B 1JV5B 4J6RL 4R96B 4IJ3C 5H35B 3WCYA 1A1NB 4X6FA 1AGDA 2BFVH 2YD1A 3PDOA 3TF7C 3KPSB 3D6GA 2B1AL 3LPFA 4AIZB 2UWEA 5IB2B 3ZT7A 4DUXA 1ZTXH 1BGXH 2EDFA 4MA8L 2CDFB 4TYUA 1NLDH 1OLLA 3U1SH 3DXAE 2BOCB 2A83B 4XZUA 4GSDH 4MJID 4YAQB 2W1NA 1DANT 5EUOF 3QNZB 5HBBA 4XBPA 3B9KA 5I0ZA 1IEAA 5I8OH 1HZHH 3HI5L 3L5HA 1YN7B 2IANB 3EYVA 5DJ8A 1G6VK 3HTLX 1A7QL 5H8DA 3R0NA 5SV3A 4UTBL 5D7LD 2X4SA 1KF9B 5EO1A 2R1YA 1MWAA 5CIPH 4FQXD 3VJ6B 1JGUH 5L8LB 2EKJA 5GGSB 5D1XA 2KPNA 3ARGD 5FHBH 1MI5E 4L1HA 1HDMB 4M7ZC 3QEQA 4UILH 3UBXG 5DK2A 2Z93A 4XVUD 3OR7A 3BYYA 3GNML 3O6KH 3IDJB 3VI3E 2HFFA 4N8CH 5FECA 1AHWA 4CU6A 3BKYL 5EIQA 1HSBB 1M7DA 1X5AA 1F13A 2A9MH 1NAKH 5I16A 4NCDA 3BPLC 4OGYH 1BM3L 2YD4A 2WLZA 4JFFB 1EUTA 2DQDH 1ACYH 2IJ0C 3TO4D 1DQLL 1G6RL 1J9CT 4HX1A 4YX2L 3IXTA 4XB7A 3JV4A 4O9HH 4KXZH 4NQCD 2X05A 1KB9K 2A73B 2MTPA 4WWID 4CVZB 5J11B 4OCYH 4M4RA 1RUAH 4NN6C 5EZLB 4HUUA 4OM1L 4F8QA 3F6LA 4HMCA 5HD8C 4PJEE 5I8KH 4J3SA 5BOPA 3A67L 4M48L 5D1XB 3ECBA 3L1OH 4PJDA 2YN5A 4OFYD 4FZ8H 3L95A 3GI9L 3LN5B 3R06B 2BSTA 2DYPB 2QHRL 2BFVL 5I30H 2CUIA 1MCPL 4NP4H 2FJFA 3GMQB 1WAAA 3OAYH 3MRRA 1KJMA 3SKJH 2OZ4H 5AZEL 1AIFA 3D2UA 4KQ3H 3MZTA 2HFGH 2DTMH 1N3NA 4DAGH 4UDTA 1MAKA 4Y5VA 1U8LA 2FX8H 5IF0B 3IJYA 2XY1A 2WV3A 3D25B 5INDA 5K9QG 1HILA 5D2NA 5F3HA 3ULVE 5F7KC 3Q2CA 2YWYA 2CDFA 3T65A 4I0PD 3CZJA 4ZOCA 1O0VA 3IXTB 5GRXG 3L3IB 3WHXB 4KHXH 1IC5H 1KPUB 3RZCD 4P9MH 5DMJB 4UINL 1S3KL 5EWIL 4Q9QH 3SKNA 3MJ8A 5IT2L 5A2IH 4Z7WB 1DBKL 2NNAA 1QRNE 5HVHC 3BE1H 4F7MA 4JFDA 4U1MA 3QXWA 1QLRA 2K7PA 4HV8B 5E5MB 3S34H 4KHTL 3RU8L 1NC4B 4JO3L 5MEPA 4N0FB 2V5SA 2XTJC 4YC2C 5BJTA 3BW9A 1TNNA 1L4IA 4I18B 4PTUB 3L6FA 2AABL 1TJIH 3QQ9C 4XAKD 4LARL 3TO4B 4D3CH 1S7TA 5D93C 4ELME 5I66A 1YUHA 2AEPL 3QH3B 1AP2B 1NDMB 3AREC 1LDPL 3T0EB 1LEIA 3TVMC 1AR1D 4GKNB 4NKIH 4OQTL 3STBA 2HJFB 1Q9KA 3DROB 3LKQB 4M4PA 4CBPA 5JTWA 2EC9U 3IDNA 3SDCC 3VH8B 1MFAL 2XKNB 4AEIH 4QNPF 3SDDA 2C1PB 1FV1B 3MGTA 3P73B 1I7TA 1YEKL 4TVPL 4RGOH 3MODH 3I2CH 4XNYH 4U6HB 5DC0A 4FQIH 3KGRA 1IAOB 1BZ9A 4Q6IC 3IJYB 4U4BA 1MRFL 3FQXA 3Q5YA 1E4XI 1UM5H 4QGYA 4KDTC 3VFUA 4NM4L 3RKDD 3QQ3A 4EDWL 3VXQB 1OAXL 1KIRA 2QR0B 1M71B 2PNDA 4G7VL 1IEBA 4QTHB 1F58L 5I1KL 4FQJL 5GZND 4IRJC 3QCUL 5C07A 1RJYB 5I1IL 1TTGA 5AEAA 2VNCA 2DQCL 3MV9E 3DI3B 4DQOL 1FO0L 5HHOD 5SWSD 4EI6A 4GQPH 3HS0A 4RWHA 3QQ4A 1AKJD 4MDJB 4NQTA 4WU5A 4KMQA 5KAQF 1I7ZB 4S0TD 4ZG1A 1P6AB 5BJTB 4X6CA 4Q2ZB 5J89A 1UCBH 1N59A 3P4OB 4Z7OE 2D9QB 3O3AB 1RZKL 3BWAA 1IAIL 4NZRH 1FCGA 4GKZA 1CXHA 4JZNB 5ID1B 4ZO7A 1N5YL 4I13B 3U9UA 3O6MH 2I5YH 5DHVH 1YJDL 4RAHA 4UINH 3ZL4L 3GUTA 4NQCE 4Q9RH 1D9KD 1JNHB 3CLFH 5DS8A 4I5BA 5FUOH 4JN2A 1BWWA 4CU8A 4P4KD 1M7DB 4WFEE 5IVOA 5FO8A 1VGKB 3M17A 1FZOB 2GJ6B 4TRPH 5D96B 5CD5D 5TFSH 2UZIH 3C60C 4LLDB 3MRHB 3L3GA 5EA0H 3C6SB 1K6QL 2YPLE 2F54A 2IPTL 3TGXA 1RIUH 4LBEB 4LHUG 3CDCA 2IBZX 1N7ML 3TZVC 1S5HA 2O5YH 4X7SL 1B4RA 1G7HA 3MNZB 3Q5TA 2G75A 5CJ5A 4GW5B 1T1XA 3VMNA 4KKAC 4G8FA 3QHFH 4OZIB 4KHXL 5CEXB 4UI2A 4NN7B 3G5VA 3X14B 5J13C 4ODUB 2C1PA 5EU6D 4KK6C 1AO7B 4U1KA 1LE5B 3UPRB 5TDNA 3QIBB 5DQ9A 3Q3GB 3KPSE 4H25A 5D5MF 5IEKA 3H9SA 4HK0B 5F6HJ 3QO1A 4OGZA 1A1NA 3NCFB 2QEJA 1NGYA 3NZHL 4OLZH 1A6UL 4ONHB 4UTAL 3ZKXB 4EUPH 2EH7H 3P11H 3QG6B 2IBGA 1D5BB 4JKMA 4I48A 5ACLA 3VXSB 1D9KB 5CS7A 4Y4HA 5CZXC 1S5IL 1YNKH 2HJKA 3RIAK 4DCQA 1ZSDB 4E0RB 4YXHH 2FR4B 4LP4A 5DHVA 3PWJA 3VFWB 1S7RA 1YEDB 4X80H 4EIGB 2I26N 4F7CA 2MQCA 4TVPE 3IU3B 1W0VB 5ERWB 1CGYA 2NY3B 2DQIH 3IGAA 4XVTH 2GYSA 1SEBB 1T6VN 1U8KA 1WWWX 5D70L 4WUUA 1FNLA 4L4VD 1C1EL 4HK3J 3ROOA 4ODTL 2P45B 1SM3H 4M62L 1BIHA 3CSGA 1GGIH 4XCCL 5C0JB 3F7YA 2J8UE 4G6ML 4RBPK 1CVSC 1YEEL 1YC8A 5DRNB 5FGCE 4EQ2A 3VW3H 1I7TB 4DOHB 4FQXC 4G43A 4YIQB 3IDNB 1N6VA 4WW2C 4PV8A 3RWEA 4WTWA 5D7SL 5IMOB 1A47A 3WO4B 1BX2B 3T2OA 2NY5C 4JN1H 4ZO8A 8FABA 2WQRA 3ZKMC 4DGYH 1WFOA 3MO1B 2HLAA 5LBSL 3ZE0F 2NW3A 5D5MA 2QKIA 4YBLC 5E8DH 3ZDXF 1F8TL 5IVNA 1AO7D 3EOYG 5JQ6L 2HFTA 1T7VA 1JPFA 3P40A 4AMKL 1A14H 5FYLD 5BRZE 1EEYB 1VPOH 3I50H 5HI4D 3QPQD 3RWIA 3MV8D 2VWEC 5I8OL 3GHEL 1A1OA 4LLMA 1O7VA 3MYJB 4NUJB 4X6EB 3BQUA 2VR4A 3VG0L 4N0UE 1W72L 2X1PA 4IRJA 3F5WA 3T3MF 3MBEC 5J56B 1RV6X 3IJHB 4G6KH 4O2EB 4J8RA 3LIZL 1OD9A 3H0TA 4HULB 3DMMC 5DD1H 4I77H 4X7TA 1RZ7H 4ODUA 5IQ9A 3TT3H 2VLLA 5KS9E 3D85A 5DXWA 3VWKB 5IEHB 1KJ3L 4PBWD 4L8BB 5HPMA 4P46C 3BUYB 5CWSB 3BYTA 5ICZA 3PL6D 1R3HA 5ICXB 1H3TA 2DJUA 3NFNA 4I4WA 3H7BA 3X11A 2B0SH 4OCRH 3FT3A 1FFNB 1D5ZA 3RIFF 25C8L 5E6IB 3MJ7A 4MQ7A 1F4WH 3L5WB 2FL5A 3DHJA 4O58H 3HLAA 3OF6D 8CGTA 2F54B 3UTTD 3AC0A 5DMGD 4CAGA 1XF2B 1V05A 1LO2L 3TO2B 5MHSD 3WD5L 2H9GA 4OZGE 4Z6AT 5GJTL 3U2SA 5DUBA 4ZUSA 2QADC 4ELMB 1OPGL 4WGVB 1GRWA 4XXCC 1SBSL 4NWUH 3MLUH 4IMLA 3FQRA 2UY7A 4UIMB 4HKXA 2AXFA 4X6CE 2O61A 1ZLVH 3HG1A 4OLUL 1FNHA 4X98B 1ZT1B 4XVUC 5L6YH 3MLYH 3U4BH 1ZHNB 3EFFB 5IMLA 1YYLL 2HN7B 2X44D 2J6EL 3NIGE 1HSBA 5D1QD 3MRQA 1XR8B 5TDNB 4OLVH 2XPGB 2G9HA 4RQQB 4HUVB 4N8CL 4NBZB 4OFDA 3AM8C 1G9NH 1K2DA 1YEFH 3V4PH 1OOAA 1HDMA 4PJXB 1FN4B 5F7EH 4YE4H 3FKUS 1KJVB 2CDEB 3REWA 4QRPD 4JG1H 4P2RE 3MBXL 3OQ3B 4YQXL 2EKSA 2X1QA 5D72L 1KB5L 5TQ2L 3MR9A 5A3IC 2X4OB 4JVUA 4P59H 4HUNB 1H3VA 5T3ZH 1XR9B 1W0WA 1ADQA 1M71A 4U31A 4MQTB 1A7QH 4YDLB 2P1YA 1JJUA 5DRZA 1KV3A 1ZGLA 1LO2H 2O26U 2P8MA 1OGAB 3ME0A 2X42A 1EO7A 1D3CA 3KLAA 1BQLL 4JFDD 2IQ9L 3FTGB 1F4AA 5C0BA 1YDPA 4KUZH 1GSMA 4LSTH 4U1GC 5HDLA 3BPNC 4OLZL 4HIHB 2AKRA 3OXRA 4JFOB 4RFOH 5BZDA 3RZCA 4GKNA 2AJSH 3BESR 1S7XB 4JPKL 3JZ7A 4PRID 1CXFA 3JUYA 3CSBA 4X99B 3GUTB 4HIIA 1A4KB 1G7QB 2P43B 5TH2B 3H9SE 3U4BL 3U9UB 1U3ZA 35C8L 1RQ5A 1ZVSA 3T09A 2JK5B 4OF7A 1DVFC 2VXVL 2P42B 1HIML 3HR5A 5EUKB 5AD0A 3MBEA 2RB8A 3QULB 5J6HA 3QG6A 1CT8B 3VXRB 1OAZL 1LO0L 1FO0B 2EZ0D 2JK5A 4JFHD 5BOZG 1QLRB 3D2UD 4QOKD 2ZCKH 3GB7A 4JRXA 2R69L 4BK4A 1NCAH 1NANI 2DMBA 4LGSB 4KKLD 1U8IB 4B50A 1EPFA 3TCLB 1MLBA 1X5JA 3VWKC 4MXQC 5T3ZD 1BBDH 4WTZG 1RJYA 4ZS6C 1UKTA 3LS5H 4WENB 1CICD 3ARTA 2AJUL 4XNXL 3VDCA 1IGFL 2G2RB 3I6GB 2MNUA 2YD5A 4HLZH 5JIHA 3MYZA 3MREA 4PREA 4JY6A 4Y16C 1GZPA 1CGUA 4PP1C 5KW9H 4PJDE 3KPQB 3P73A 3BZFB 4MJIE 4JCMA 2Y9RT 1MFCH 3LS4L 5FA3A 3TNMA 4RGND 4PJBB 1JHKL 3S4SA 2EXWC 4GRWF 2YPKB 4PRPE 1DUYA 2K1MA 1JPGB 3EO1B 4IS6B 4TPRH 4OZIF 4HJJL 4L4VA 2FO4A 3FAWA 3REWB 4OKDA 4GLRI 2ZOLA 3ES6B 3NCJH 1KJ2H 1I3UA 35C8H 4JGUA 1E4XL 1BPVA 4M3KB 4Y4KA 1TLKA 3GDBA 4HMEA 4FMFA 4G80A 4KAQH 4M1DH 5GRWA 1QA9A 2EYTB 3QDHA 2XZQH 3UBXI 1ZVHA 3LQAC 2AJZA 2YKLL 4Z8FH 3MLSL 4RFNC 5I9QB 2Q7NA 4Y16B 3JSSA 3A6CH 2ICWA 4LEOB 4M1CD 3LKOB 1FSKC 5T1DH 4HUXB 1RAMA 1T22B 4R4BA 4HGWB 3ARGA 2APBA 3QEGL 1UA6L 3CDGA 5GGQH 2WZPD 5HYSG 3VGEA 3F7VB 2DLFL 3CVHB 4NM4H 4LSRL 5CP7B 2H2SD 1WTGT 3JTTA 4Q2ZA 5C0DB 5GZOD 4DOHE 4APQB 4ETQB 3WFDH 3VFSB 2BSSA 5HGDA 4D0CA 4QRUB 1YEKH 4GBXA 3WUWG 4WNQB 5I15H 4KTYA 1KIPB 1A02N 2NY2D 4N0YH 1KTKE 2UV3A 4G9FB 3ZT5A 1SM3L 4M62H 4E41E 4ODXA 3NCEB 1UB5B 4JG1L 5J9PB 1UM6H 1YY9D 4U1JB 3SO3B 3DVGA 3MLVH 3SBWA 4U3CA 4Z7NE 1M6OA 4HT1L 3RTQB 4TUOA 1ZAGA 2YC1B 3C09B 4M6OL 2YXFA 1BX2A 2J5LC 3WDJA 5DD3H 4MNQE 4KJWD 2L7JA 3S35L 5EC1A 1Q0XH 4KZEH 1MCSA 3O6KL 4E5XA 3UZEA 2P24B 3MCG1 5IM7A 4TNVF 3RWDA 3ROLA 4LLDA 1T7XA 3OKOB 3GIVB 4M5ZH 1NKOA 4D2NA 1BD2A 5IBTL 1B90A 2NTFB 2ZJSL 3GSVA 2W92A 3UTTA 4WUKL 4UUJB 3TA3C 2F53E 4K9EH 4A2MA 4KK6D 2RHEA 4Y1AB 2YUWA 1HHKA 1OY3B 2Y4SA 3BQUB 4ISVB 4C55A 4L4TE 3LRGA 4G6AC 5IB4B 1MCPH 3S96B 3P4OA 3F12B 2A6DB 1UYWH 5CZVH 4NRZB 1P69B 1UZ6F 4HUWA 3CCHB 4LOUC 3W39B 3LDBB 4L9LB 3IFNH 2Q6WA 2OTPA 3ARZA 4RX4A 3VRJA 4W68A 3MOBH 4MA7H 4ZNEA 4JB9L 3F7PC 4HAGA 1QR1A 4ODBD 4LHQB 1IQDA 5DA0B 3ARUA 5J7CC 1W8NA 3VRLF 2VXTL 1M05A 1H3PH 3MO1A 3SO3C 4GXVH 5EIVA 1R5IB 1AC0A 1P7QA 2XQYG 4JRYE 3ULSA 5K9KB 1AH1A 3L1OL 1S9KC 4IMKC 5ACZA 3BXNB 1HXYB 4H20H 4X6DB 1LVEA 43C9A 4KUZL 1Q0YH 5HGAA 3TPKA 3U0WL 5SX4I 2DQJL 4U1SA 5F1KC 1T04B 4Z7VF 1N64L 1R3IH 3FN0L 4RFNB 4RAVB 5IESL 4IRZL 2Y5TB 4FQLL 1AGEA 4UT7L 1TVHB 1VFOA 5DMGC 2WLYA 3MLVL 2DQUL 5ADPH 2AJXH 1ND0A 2EXYC 2PTUA 4QLRA 5BVJB 3MUGA 5B39G 2ZUWA 5E8OA 2YK1H 3T0EE 3IDUA 4LQFL 4MS8D 1ZLWK 4ZXBB 1I8KB 3WFDL 3WJJC 1CD0A 3ZSSA 2YA2A 1NGZA 4JO1L 5HGDB 4ZFZB 1S9WA 4LLYA 1G7IA 3O4OB 5IFAH 1QSFA 4M9OA 1QTYT 3GSNB 5BV7B 4Y2OA 4ODHL 2F5AH 2XPGA 2PYEA 4QTIH 1RJZB 2OYPA 2XI9A 2VLKD 4MX7B 4NQEA 5EB9A 4KTEL 3TVMA 1AQKL 1U36A 1P4IH 3ALXA 5SV4A 3ULUC 1CL7L 1QSED 3BP4A 3MTRA 2VKXA 4U33A 1E6OH 1OM3H 3MLXH 3RDTA 1BJ1H 3SE3A 3C6LA 4WI5A 3RWHA 3I6KA 4OD3L 4XVTL 5DUBB 3CXDL 1HH6A 2BC4B 3W0WD 3DSFL 2FJGA 1CLOL 3UJTL 5JZ7C 1GHFH 4GAFB 2CH8A 4UAOB 2HG5B 1ITCA 1MWAB 1A6VH 4EUPA 3VFTA 1B88A 3HAEA 2ORBH 1UADC 3ARBB 4GRLB 4M6NH 4J3TA 4FHBD 3C8DA 2RGSA 3OB0H 3RDTC 4UBDD 4OFVA 3CPLB 3C2AL 2DM4A 1K3ZA 3ZKND 1KB5B 1AGCB 1Z3GL 1JTOA 4MVBD 1HSAA 5FYLE 2R0KL 4J2XA 1UQSB 4KQ3L 3BPNB 2VR9A 4JRXE 1N2RB 1RI8A 1NFDF 2D31A 4X5WA 1PX4A 4HBCH 1IQWH 2G60L 5LJYH 1OARL 2NCMA 2OQJB 1WAAF 4PJBF 5DQJB 3THML 1QBLH 3MRGA 1DVFD 4MNGA 3ZE2F 4KK9C 4POYA 4Z7QF 3VG0H 1HQRA 3Q0HA 3DGCR 2I24N 1GZQB 5F96L 4DN4H 2LU4A 4LGRB 1ETZB 1A9EA 4HKBA 3V0WL 2VLKB 4JPVL 3RWIB 4PTUA 4R4FH 2CSPA 2G5BA 2ID5A 4KROD 5DT1H 4M61B 1TCRA 1QSEB 2V7NB 3N1MC 4GAJL 1SQ2N 4ZUVB 2Z8RA 1ETZA 5I76B 3CFBA 5GS2H 1UVQB 1Y6MR 3PNWA 4AY0A 4IMKA 1S9YB 5HYQB 5D1XC 5KSAB 1R3KB 3IAQA 2MKLC 3D87B 4NOFA 2Z31D 4R7DA 2HT2C 2X1OA 4DKFH 3STLA 4AENB 4FABL 4ZODA 1YYML 3VXNB 5IJKA 5DJDB 5D8JL 1G6RB 4P2OD 1EO5A 5CHNB 3TWCH 1U8JB 2AK1L 1GGYA 5CJXA 1TZHA 1NMBL 1BQHB 3QNZA 1LO4H 5F7DB 3GO1L 1IAOA 2I9TA 1DR9A 2CJUL 1CLOH 4LK4A 3UJTH 5MEOB 3W9DB 2IPUG 3ABZA 2BNUA 2QQKH 3HC3L 3WFEL 3P4NB 4U0QB 4GRLD 3ZE1F 1BFTA 3BMWA 3H7LA 1S7WA 5T3ZL 1ZS8A 4H88H 4PJHB 4PG9B 2J3SA 4JPKH 1XIWC 5GRVL 4JFHE 3SDDC 3WKMH 3B9EA 3R06A 1GOGA 4NYLA 2XWTA 5DHVB 2IAMB 5D2LE 5C0AE 2W59A 3AUVA 3K81A 4P5TA 4POZD 2JE8A 1OP5K 2I25N 2VXQL 4ZO9A 1BQLH 1WWAX 5DD6A 5DEZA 4D8PA 7FABL 5FGRA 1YNKL 4ZFOA 5JORA 5IG7A 5EBWA 4NQXB 1MCWM 1JHKH 4APQA 4LCWE 2V5TA 3LRHA 2Y07H 2P5WA 4OSUL 4PJAE 4NQED 4HK3N 1FJ1B 4DZ8B 4GRMB 3BKMH 2EICA 2CLRA 3MV8A 3WFHB 3TZVD 1PZ5A 1IKNC 3M1BB 1MFBH 1JF5A 5B21A 1ZHNA 3EFFA 4I5BB 5FF6A 3EDKA 4YFEA 4ZPTA 3SO5A 1MJ7L 4S10A 2CLVB 3L3JB 3M1BA 2Q76B 3G6JE 1RULH 1X44A 4GRWB 3NH7L 4OKVB 2GKIA 4HPOL 1AHWB 4M3JA 2R4RL 2EEAA 4XRCB 3ZZ1A 1ZGLP 2BY2A 2VLJB 3CFEB 5DDHA 4PRAB 5KSAD 2HH0H 1E4KC 3BX7C 3A0OA 1NCAL 3DRQA 1FH5H 5ADOL 3HCVA 2A74B 4PJ7B 4YO0B 5DZNA 4JFDE 3VI3F 1WFNA 2EDQA 2YUZA 5BRZB 5DRZB 5E8PA 5IVZB 3RVUD 2NY5L 2GT9A 3TN0C 1ORSB 3D0VB 1RK1B 4LPTA 4N5ED 5FYLH 1OWRM 5I6XB 2WIMA 2DL9A 5DLML 2QSCH 3FQTA 3LKSB 5GS3A 4UQ2A 3O4LA 4D9LH 3VXTA 4U7SA 4XWOD 1Z9MA 3NGBB 1EERB 1P7HL 4JPVH 4X6BB 4P0DA 2AJSL 4GKSA 2ED7A 2VLLB 3T2QA 5MENA 5DD1L 4XMPL 5IQ9B 1J1PH 1KN2H 4C57C 4MNHA 4FQ1L 4OF3A 1Y18B 1ADQH 4DN3H 2ADIA 4FFYH 3PDOB 3BO8B 3VXSE 3MFFA 2IGFH 3HNTL 3NABL 1IFHL 4ZPTB 1V7NH 1UH3A 5I16B 2PO6B 4NQEB 1T89C 5F8RC 2F58L 3O11B 2XACC 4RNRA 1KCSL 1CIUA 3G04A 1CDCA 4PLKD 4NDMA 2CUMA 1OSPH 5DURD 3HFMH 2OZ4L 1AXTH 1QA9B 2EYTA 4LSRH 4PJ9D 1NDGB 3U2SB 5IHBA 2GITA 3AS0A 5DD6B 4D8PB 1BVLB 4N68A 2XXCB 1OGTA 5CD3A 4ZD3H 3EKCA 4H1LH 3SE4A 3KPRE 4N5UA 4M48H 4YHIA 4ORGB 1CFVH 3V6OA 3LB6D 3FB7A 2V5YA 1SYVB 2R1YB 3EOBA 1MIMH 4D0DA 4F58H 4NO5A 4XCNB 1NPUA 3GJEB 3IU4L 4P3DB 5D7JA 2WBWB 4HT1H 5FA3B 5FA4A 2EIBA 3L3DB 3SJVD 2PCPB 1J0HA 3HUJA 3MOQA 1KN4L 4RMQA 3DRTA 4QOKA 2V17L 1F6FB 1QSFE 4JFYA 4QYOA 5CJOL 4FFWD 4GW4A 1IGTA 3EYFA 3E8UH 1EJOH 2VITB 1MJJA 4MMXC 5D70H 2D2OA 1FE8L 1X7QB 3ZKXC 3EYOB 4N9GB 2VDPL 5CKGA 1EK3A 1OVZA 3S3JA 4P5MA 2FBJH 1JPTL 5B8CC 5B38B 5K9QI 1QLEH 1OQOA 2RFXA 2X4OA 3WNKA 5ANMB 4HBQA 4YXHL 1R24B 2PXYA 1L0XA 3MLZH 4Y89A 4YDIL 2EDXA 2JCCE 6FABH 5JIPA 2ZZUT 1F4WL 2FO1A 1IAKA 5I1DB 4OM0H 4I18A 3I6KB 1UENA 4Z8FL 4JY4B 3TH2T 2G5BB 4JFZL 5C0CE 4ZYKA 4JDTH 1IAKB 3CVHA 5D2LB 5C0AB 3R4DA 1JBJA 5DK0B 5F3BB 1L6XA 4IRZH 5MP6H 3WFCH 3V5HA 3QAZB 1S9VB 3MRIA 1J8HB 5DMIL 2PR4H 3QXUA 1FFRA 4D9RE 4FQCH 3QO0B 1KCUH 1XH3A 4X0KA 5GGUA 4ZNEE 2NY6D 2B5IB 1LP9F 5EOQL 3W5NA 3F58H 3KVQA 1RHFA 4RRPG 1E4KA 3QUYB 4XXDB 4ZQKB 2EECA 2FGWL 5C07D 4G5ZH 3T04D 2F74A 3SKOB 3T8XA 5I8EB 3QUXC 1CFBA 1ZGLM 4NIKB 5ADOH 3CPLA 3O3DB 1S8DA 5CBAB 1I1YB 1DQQB 3U30B 3QXVA 2HVJB 2XXMB 1PG7W 1Q72L 4JB9H 3OG6B 3L5WA 5HI4C 2V9QA 1MJUL 1W0WB 1EO8H 3RNQB 3ILQC 5MERA 3IFNL 4JQVC 3TT1H 5L2KA 5JA9A 1KACB 1P4LA 2V5RA 5DTFA 4BQBA 4RCAA 4K71C 5FYJD 1OP9A 5CD3B 2Q8AL 4NNXA 2IG2L 3FB6B 2CO7B 4J3OC 2VL5B 1DUZB 2V2WA 3K46A 4BKLA 2ADJB 4O2CA 1CD1B 4MA1C 1NUGA 5HHOB 3C60A 1MF2H 1EJ6A 5GS1A 2J6EA 3O0RH 4M5YL 2FBJL 4LQFH 1XFPA 4CDGC 3CUPB 2X89D 1LD9B 1HH9A 4NM8H 4WI7A 3GK8L 1U8PA 4YQXH 5DS8B 5GIRA 3O6ML 4R0LC 1CE6A 5FF6B 3L3KB 5LXGH 2MQ0A 1G9ML 1RD6A 1BQSA 4WU7A 4HZLA 4BH7B 5F72S 4V2BA 2RCSH 5I1JH 1OB1B 4NCC2 3IU4H 1BZQK 3AREB 1XF3A 4W4OA 5B8CB 2WWKT 1MEXL 3V8OA 4JHWH 4J7RA 4N1HB 3EDJA 1CWVA 4GAYA 4K3HA 1HWHB 3MLZL 3CLFL 3I6LD 1KJ2B 1IGIH 2BVPB 4V1DB 3BT2H 1T20B 3OX8B 1U3YA 2FH6A 3RIFK 4XC1H 2YPVL 1B6DA 5HYIA 1YN7A 4N0UA 3VWJB 4S1RH 3FTGA 4Z77A 1QQDA 1EAPB 4ODSH 5CFHA 2AJ3A 3N9GL 1CF8H 5FM5O 2ZCLH 5CP3H 4PJ8B 1G7MB 2NW2A 2D7QA 3GSUA 4JQIH 2HKFL 1NBYB 3GBNL 1IM3B 1QP1A 4P2CG 3HUJB 4UBDC 4UIKL 4ONGL 5DVNA 4WV1B 5LQBL 3S7GA 3BEWB 3HC4H 4AIZA 4I3RL 3I02A 3HE6C 5ITBH 1A64A 1RJCA 4J12A 4JN2B 5D6DC 5JXAH 5KANG 3SDCA 5CINL 5KJRL 2DDQL 4ODXB 3HI6H 3P2TA 3WLBB 1MCDA 2CO6B 4FTVA 1IGCL 3GMOA 4LHUA 4NNPL 4XMLH 1KJ2L 4CW1A 1DBAH 5IJVB 3QEUA 3IFPA 3DO7A 3LMJH 1VFAB 3ULVH 1BLNB 3L7FA 3KDMB 2VAJA 4OT1H 1AXTL 3MV9B 4F7TA 4Y19A 4QT5A 1GZQA 3AMLA 3IDMB 4Y88A 4F7MB 4QRPE 2XTJD 4WWKD 4PIRF 5EULV 4HGWA 3IS1X 4K23L 2K7QA 3UJJL 3IDYC 3O4LE 5K9JH 1EV2E 4NYLB 3O2DA 5EORL 2LABA 1KYOJ 2ARWA 3ZTJH 1BD2E 2BSED 3ARDB 4QRPA 1A7NL 2J8UF 2R69H 5E5RB 1QBAA 1P9MA 4YLQT 2ZKHH 1FG9C 3HE6D 4KZDL 2HT2D 3G5VB 4RGMC 1INEH 5DRNA 4Z7UB 2CRYA 1I1AC 3O8XB 4Y4FB 1I3GH 2NZIA 5E2VH 3MPCA 3HMXA 5GGTH 2XZAH 4QGTA 3VH8A 4IS6A 1HYRC 5IW6B 4TSBL 1ZT4B 3MLTA 2XG4A 2QHRH 3MLPA 1S3KH 3SCMC 4Q9QL 4C56E 3WXVH 1XGTA 1P4BH 1M6OB 1D6EA 1NFIA 3B6SB 1P7KA 5K9OA 4K7PH 5CSBA 4XNUH 1ZT4A 4OD2A 2X4NA 3H9SD 3RI5F 5ICXA 5I8KL 3HI6L 3T4YA 1RU9H 3GRWA 1GGIL 4XCCH 3VWKD 1CR9L 2X09A 3OTTA 4Y4HB 5KZCD 2NX5E 3HNSH 2XOTA 1H5BC 4H8WC 5HXMA 1DBMH 3JWNC 3VA6A 5F7NC 3RGHA 3WKML 1RZIB 1JN6B 2D7NA 1IZKA 3FHAA 4GMSL 1I1AB 4J8RB 3LKPA 3D3VA 1MLBB 4GXUM 1IGIL 1OQXA 4MNGE 4YGAB 4XP5H 3GI9H 4YDKH 4M02A 2YPVH 4DVBB 4X4ME 3OSKA 3C9NA 3G6AB 3MV8B 2YD7A 1IC7L 2R23A 1A0QH 2VQ1A 2B7DT 3UPRA 4KK8D 2QQNH 4J1UB 3BKML 1A22B 1RUAL 2WP3T 1EDQA 5IESH 3SGKC 3QDJA 3H3BC 5MENB 1G7IB 3HR5B 5BMFL 3SKMB 1A2YA 3OB8A 2VE6A 1AGCA 2ILLA 5D96C 5IW3A 4PR5A 4OZHF 4G6MH 4DKEH 3O6FA 3EO9H 5TDPB 1A4KA 1I4FA 3FRUB 4G9DA 3HLAB 2E9IA 2EDRA 1XAUA 4PGBB 4RAUA 3H2WA 4PGDB 3X11B 3PV7A 3ZDYE 4GBXC 2X4TB 1DBKH 3DO3A 1KCVH 5JHDD 5CBEB 3GHBL 4QXTA 1NANH 1F6AA 1XF4A 2HVKB 5HI5C 1OGAA 1SVZA 2QQKL 2M26A 3WFEH 3MLRH 1KLUB 1WBZB 3O0RL 3QHTC 5CILH 4V1DE 5I75C 4IM8A 1QZ1A 5ISZE 4P23D 1K9TA 4ELKA 4F57H 3TBVB 1BIIA 3ZMRA 3QI9D 3ARDA 2CXGA 5C0RH 4LF3B 3KLHD 1GGUA 4DKDC 4TVSa 2CRMA 4YUEL 4JPWH 5IB5B 4U3HA 4ZS7L 4Z5RA 1OAYL 3BPCB 1INEL 5FECB 5ID0B 2DTSA 2UY6A 4TULH 4DEPC 1FJ1A 4L9LA 4PP2B 4PUBH 1OGAD 1FAIH 2BY3A 5C0EA 3MBEB 2H32A 3QPXL 3OWEA 3RAJH 4O02L 3TJHC 2PW2B 3BGFB 1C5CH 1TZGL 2YEZB 3RWFA 3DMMB 3B4NA 3RNKB 5T3ZE 1YJDH 4WFED 3IDIB 2Y1VA 5JNYA 3V79C 3O41A 5F9WC 2EYRB 4Y5XB 3MRGB 4JFFE 4ZFOL 3LY6A 4KJYB 5MEND 1RURL 3CFCL 5DQJA 1P1ZB 1LMKA 1FBIH 3OG4B 1OAKH 2NTFA 4ELMA 1EJOL 5GRJL 5L88L 4PRIA 1G1YA 1DFBL 2YD9A 2VL5A 4NQDD 4C56D 5K93A 3HPJB 3NFPB 5C3TA 5E1AA 4NNXB 4G6AD 4KWUA 1AD0B 5IVXA 2DM2A 3QJHA 1W8OA 3BISA 2VN7A 1TJHL 3PGDA 5GGRB 5GHWL 4TUJB 2DQEH 1PAMA 1A0QL 2MCPL 2PYFB 3KXFA 3DVGB 3CVHL 3RHWF 1AP2A 1NDMA 2QLVB 5E95B 3CSYA 5IBLD 3E1F1 3FRUA 5EU5B 2YUVA 5BXFB 4P5KA 2YEZA 3RWFB 3VMOA 2AQ3A 3HZMB 2EDKA 4X4XB 4X4YB 5I74C 1N5YH 2X9YA 4QRRD 1H5BA 2NXZB 3F65A 3QI9B 3FB8A 1FN4A 3ZYOA 4TVPH 3IETB 4DEPB 1RZKH 5ENWA 4AIXA 3GSXA 3AS2A 4FNLH 1OB1A 5JO5B 1LILA 5FCSH 3D3VD 3FO1B 5IHLB 5I18L 5F1SA 2EO9A 1MHEA 2OI9C 2W65B 4M7LL 3VXPA 3D39B 3H9HB 2FSEB 4HGMA 2P5WD 3CFDB 3NFSL 5BO1H 4R4BB 1SVCP 1IKNA 1P6FA 32C2A 1YNLH 2AJYL 3CLEL 4PRHB 4PYHA 4RISL 3SCMA 2DLIA 5C2BH 2NX5B 5A2KH 3P0VL 2QSQA 3DSNA 3BP6B 1G7JA 1A1OB 2FD6L 3FQNA 3K4DA 2B1AH 5SWQA 2OJEA 4ELKB 1JWUA 1GGCL 1A1MB 3MROB 2H8PB 3SQOL 1Z0MA 5TE7L 1J87A 3VFVB 3EJYC 3MXWH 3TPUA 1JZ7A 5GSVB 3LHPL 4PJEA 2H32H 2N56A 4ZD3L 1YPZF 5A3ID 2A6JB 4MGXA 4GG6E 4A6YL 2NXZC 2OTWA 4UDTB 1UWEH 5B4MD 4ORZC 4L1DA 1JPGA 1EEUA 2CK2A 3EO1A 3PJSA 3LIZH 1S5IH 4LVOC 3S35X 4X9HA 2D7OA 4EQ3A 3FRPG 4NQDB 3KJ6L 1GXEA 3RWEB 3H7BB 1U9KA 2HVJA 4LPXA 5AUMB 1JHLL 3NA9H 4O02H 2I9TB 4QF1A 3QPXH 4OB5L 4WI9A 2W9DL 4Z7UF 3DHMA 3I50L 4M8QB 4XCEA 5C0CD 5F8QC 1L0YA 5C0IB 1YMMA 2Z91B 5SWQB 4GG8A 2VLKE 2H41A 5ERWA 3SDCD 4EXKA 3ARGB 5LBSH 1SYVA 4L3CB 5E1HB 4JZJC 4BFIB 3QDGD 2Y72A 2OR9H 4HS8H 3D3VB 4XCFL 2V7HB 4F15C 4AEEA 5DF0A 2BHZA 5I2IA 1EGJA 1JGEA 1NBZA 5E8EB 4MHHG 5ISZA 5L0QC 1QSEA 3Q6GL 1JCKA 3IB4A 2V9TA 3VFOA 2O5XL 1XGRB 2QSVA 4NN5B 1XIWD 1F3JA 5LWYH 3N1QC 2XFXA 3BD3A 4X7EC 4UT9L 3NMEA 5DD5L 3K0WA 5CJ8A 5EPMA 4JHAH 3QEHA 4I0PA 4ZXBA 5DMIH 5BXFA 2Q20A 2ZUYA 2NY4C 1IGML 5LCVL 1CZ8H 4K8RH 3LPWA 2DTML 3AXLA 3BVNB 5IEKB 1XCTA 1U93A 2LFGA 2OMNA 4HPOH 4G42A 4YDJB 2YD6A 2IF7A 5HHPA 2QR0A 1CGVA 3RY5A 3HC3H 3VFUB 1NGQL 1S7VB 2PXYC 3PHQB 2IFGA 4OSUH 2BVUA 5D5ME 4ZFGL 1K8IB 4TVPD 3QA3B 1DCLA 4UV4L 4YR6B 4QF1B 2R8SL 2BNRD 2FB4H 3NCCB 4POUB 5B38G 1G7HB 3MNZA 2VUOA 2PETA 4LHUD 2IEPA 3HRPA 3EFDL 4P4KC 4E41D 4PJGF 2DD8L 2YKLH 1INDH 1MY5A 1FFPA 1R3JB 2H6PB 3QRGH 1BJ8A 4X8XA 2OTWB 3VE0B 4E42A 3QEHB 3O2VL 4I0PB 2J4WH 4Z95L 3V0VA 5D7LE 1AD9B 3INUH 3PWLA 1QNZH 1YEFL 1ERNA 3OJDA 4WY7L 3KWWA 3VXUB 4HWZB 1WICA 4GAGH 4CMHB 3UTPD 1F11A 5HI3C 4J4PC 1PZUB 4IIQA 1CXEA 4Y1AD 1QPPA 4FS0A 4ELMF 2VISA 3S96A 4BJLA 2MKWA 4BH7A 1CN4A 2JIXD 1JYNA 2WMPA 3LEXB 2Q76A 1PKQE 1BZ7B 2CLVA 2XIDA 4ZUWA 3PP4L 3ILPB 3RUGB 3MFFB 3C5ZC 1SJHA 3HPLA 4QHLB 5BZWA 1XF5B 2KZ1B 1RJZA 2X7LB 4AQOA 5EU6E 3NN8A 2FJHB 3HFML 3TBYA 4UNVA 4ZS6D 1H3GA 2YBRA 1NEZA 3QUYC 5F1NA 2XQYK 4HIXL 4F2MB 1GVIA 2F15A 3PUCA 4B41A 3TO2A 1UCTA 1XF4B 1UKQA 3V6FB 4QHNA 5EIIA 3DURA 4A6YA 1KUMA 3P30L 4NO3A 3PDDA 1ES0A 3G5XB 3ALPA 1T20A 3OX8A 4UQ2B 2NPLX 2W0FB 3TV3L 3OKYA 2VDLL 4M03A 2J8HA 4PS4H 4EVNA 4CJ1A 4WVRA 4LDLB 1TCMA 1WT5C 1CGWA 2I5YL 2WBKA 2P8PB 3PWPE 1UWEL 4GG6B 3EBAA 2P8LB 2VABB 4BQ9A 4E41B 2F9BT 4LLWB 1JUFA 2NR6C 4LHJB 2D0GA 12E8L 3LB6C 3RZWA 4Y8DC 3ZTJG 3QUYA 5IMKA 2XKNA 4FG6C 4RQQA 1H3XA 3MJ9H 5KS9A 2X7LA