4P5KA

Structural basis of chronic beryllium disease: bridging the gap between allergy and autoimmunity
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
181
structure length
181
Chain Sequence
IKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 181
sequence length 181
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p5kA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p5kA01
4GW5B 5BZDA 4FTVE 4KZDL 2FYYA 2EEBA 2GHWB 1SM3H 2AI0L 1WISA 3OX8B 1IEBB 5E4IA 3SDXF 2AJYH 1IEHA 3UYRH 5LVEA 1FBIH 5F21B 4PG2C 3MMEB 4PJ7B 2WWMD 1J0ZA 3PGCA 2Y36L 4P46D 1BIIA 4LBEA 3PDDA 1R5IB 4KK8C 5E08H 1LD9A 3I02B 2NY2D 4IMLA 5IBLC 3FHAA 4WDIB 3ZKXC 3O6FD 3HZKB 2VXUH 3CZFB 1BQHA 5EC2A 4F57L 5GRZA 1IEAB 4PJ5A 4YDLB 4EIZC 4Q0XH 3IS1X 2HMID 1T5WB 1GPOH 2Q6WB 4P3DB 2OTWB 3L7EB 1HHKB 5IFAL 3N1PC 1FJ1B 1FYTB 3W0WB 2ZPKL 1HH9B 1P5VA 4L3CB 4UBDC 4HGWA 5CJ8A 4HUWB 2R69L 4LRIC 1GZPB 5JUEH 4Z7UF 3VXNA 5SWZB 5I74B 2NX5B 3VXRB 2ICCA 4TPRL 4L5FL 5HYSG 3RX5A 2CLZB 3G5VB 2WQ8A 4LDOB 5E8PA 1GC1L 4OM0H 3GGWA 5DEGB 3M8OL 5ISZE 1N6UA 4WI4A 2PYFA 2D0HA 4M61B 2GK0B 2E5EA 2XA8L 5EU6E 1BVLB 4L9LC 2VO5A 3PV6B 3JBG7 2F8XC 2PYEE 1EAJA 1S9VB 1IMHC 2IH1B 5KW9L 1CFQA 3H9SE 5IR1A 5DS8B 2Y25A 5C6TH 5EIIB 2KBGA 1JWMB 2WIIA 4S2SB 4C59B 1TZIA 1MFAH 3HN3A 5D9SB 4NN7C 2UZXB 3MV11 3NCJL 3NMEA 1WT5A 1M71A 2IGFH 5CD5C 1YMMD 2Q76B 4OGXH 4OQTA 4FP8L 1U6AL 1IC4H 1T89A 2AJVH 3P4MA 1N0XH 4ZODA 4Y5VB 3B6SA 3VFMA 5HDQL 3UC0L 1OP9A 2OP4H 4HS6B 3QXAB 2FL5A 1FAKT 1L0XA 4YHMH 3RX7A 2E8ZA 2OSLA 3CVIH 3SKNA 4KUCF 5CEYA 2VRAA 3GB7A 3PWPB 4E0RA 2VAAA 1WTGT 4PB0L 4KKLD 1QFOA 4HCRH 2IMMA 3LN5A 4X4ME 3QEQB 3W39A 5BS0D 3SDXE 3QDJE 1JWUB 2I60L 1RFDH 3UPCA 3ARGB 4CAGA 4PRHE 4X7SH 2N4IA 4PJEB 4P2OB 1MLBB 2QL1A 4OD1H 5DJ0A 1AC6A 1UH2A 4D0DA 1R3JA 4GOSA 4L8SA 1HI6A 5K9QG 2FHFA 4BH8A 2HTKC 1QSED 5IBTL 2FEDD 1KB5H 3SCMD 5LXGH 3C6SB 3KVQA 4P59H 2DLHA 2LTQC 3VXUB 5ICXB 2IBZX 3P73B 3T1FB 1KJ3H 1N2RB 3NFSH 1N64H 1DVFB 1DDHB 2VMFA 2RFXA 1ZT7A 4TQEL 3LQAL 3OV6A 4LVNC 3RIFK 1LO4L 3WLWD 3S9DB 2IQ9L 4JRYB 1CGSL 3A6BH 2JB5L 1E6JH 4XBEH 2ZG1A 1WC7A 2IALB 1VEOA 5EU4B 4EI5A 1YN7B 4Y2DB 4Z7UE 4Y16D 1ZLSH 5HHOB 3B9KC 3ARBC 2A6DA 3ARDC 1JUFB 5I76A 1FL6B 4W6YB 3RBGA 5DJXA 2OK0H 1VESA 4I3GA 3PIQB 1CFNB 4F7EB 2QQNL 5FDYA 3UAJC 4UV4H 5GS1B 3BAEH 4OLVL 1MI5E 3VG9B 5FB8B 1CDGA 4MXQD 4NZRL 4LARH 5GGTL 1LK2B 1MRDL 3UJIH 5BOZG 2FRGP 1G7LB 2VUYA 1RZKL 1C1EH 2HKHL 5AUMA 4RMQA 2Z4QA 2BY1A 3BKCL 5C7XL 4QOKD 4LMQE 2B39A 4OGYL 4EUPG 5L88H 4QTIL 2C4FU 3HI1A 4LU5H 4MD4A 4F7TA 2CKBB 4GXVH 1EHLH 4PJDA 5EUOA 3IDMA 1UQSB 1J05A 1U3ZA 5DHYB 3DWTA 2VN7A 2C5DC 3RWGA 4BSWB 1JPGB 4KAQH 4Z95L 5IFJA 1K5NA 2CK2A 1A3QA 3IKCB 4PGCB 1RI8A 4WEUD 1CLYL 1YEDB 2HKFH 2M8XA 3VXQB 1YYMH 4XMLH 3INUL 4AH2A 4RMTA 4H20H 4YAQA 3PABA 4H1LB 3D48R 3D25A 4NRZB 2FYYB 3TN0A 4YDVA 3REVB 1KXTB 3NFNB 3V0WL 2YPLA 2MTPA 3GHBL 3BPOC 3U46A 4OCSH 5GGQH 2AP2A 4HLJA 4ZFZA 3S98A 3V52H 3I9GH 1OVZA 3QIBA 4IDLA 4XWGH 2AJ3A 1IAKB 4NUGH 3SQBA 2Z31C 3IDUA 4K07A 2IANE 1IL1A 4JFFD 1OWRM 1ZT1A 1A6ZA 2ZOLA 3GMPA 1S8DA 3K8KA 1AI1H 4N8CL 3H3PL 5H8DA 3X13A 3WUZA 3AS3A 1IFHL 3T0EB 4NNYB 4QRPB 3IAGC 2AQ3A 5A1AA 4APQB 5KSAD 3QCTL 4PLJC 4P3CL 2Q86A 5JR1L 4NZUL 5HD8D 4PRBB 1JZ3A 1X5XA 2EXWD 2CLRA 4R4ND 4RFEB 4PTUB 4QRTB 4GBXC 3BPCA 15C8H 1N59A 3BXNA 2D7TL 4Z5RA 1ULVA 2A74B 4S1SH 3CSPA 3EO9L 1SY6A 3PDGA 5TF1H 4KRMB 5F88B 4J3OC 4G8GE 5A2LH 1CICC 1E27A 3T2NL 5C0FB 4R7NB 4X80H 2DM3A 2YN5A 5JHDB 1NFDF 2OS7A 4NZTL 3G6JF 1J12A 3O2DA 4HWNA 3HZVA 4NNPL 2DM2A 2W9DL 1YNLL 2X4NA 4MNGA 2NY1D 3L5WA 3F58H 4NN5C 3FRUB 2F74A 5BZWB 3VD4A 1R3HA 2A6IA 2X7LB 3D85D 3FB8B 3T3MF 3SKJL 4XCFL 2J12B 3FQNB 3MRIB 4XVJL 4M62L 1U8OB 2CMRL 5J7CC 1G0YR 3AXLA 1MREH 3OKLA 4NNXA 3G04A 4UOW1 1EVTC 4GKSB 3S35X 4Q7DA 2NNAB 5D1ZA 4JRWA 1FGNH 1FNEB 4HUXA 3NVQA 1CXIA 4ZXBA 1FLRH 2NXZC 1KTDA 4ODBD 3MBEB 1A5FH 5T3ZE 1M71B 2EDTA 2VZOA 4ZTPH 2QKIA 5I1EL 3P4MB 5DMKA 1FH5H 3HUJF 2D3VA 3B6SB 1SY6L 3UTQB 2XTJB 3K1KC 4L4VE 5KN5A 3F7YB 3BKYL 1BJ1J 3BQUA 3QEUA 1R6VA 4YPGA 4AYFA 4LCWD 5ALCL 1DQTA 1D5IL 5D1XD 3SKNB 3OKDA 4UNTA 2CSPA 4J3SA 3V79C 3QIWA 1PSKH 2ZUSA 3GB7B 3KS0H 3HMXH 4E0RB 3O2DL 3KR3L 1RQ5A 3O4LD 1QYGH 1EGJH 3X11B 2ADFH 4S0SD 3LN5B 5ECJE 3GBMH 2H8PA 1DQDH 2NYYC 4XNUL 2ZNWA 3NAAH 5GIRA 3RTQC 3VG0H 4WHCA 1FG2B 2C7UB 5FYLL 2PUQT 1BAFL 4OIBA 2X1QA 1F90H 3EIFA 5DDHA 1HI6B 3UTPD 5J1SC 5FM8A 2HWZL 5JHLL 5INCB 4RGOH 5HYJA 3OJMB 4GMSL 1AGFB 4OLUH 5D7KD 2FIKB 3BOVA 2BDNH 1TETH 1ZT7B 4OM1H 2X4UA 2VXSL 1P9MC 1A1OA 1BFVL 3TIDA 1W8NA 3LKPB 3D39D 1CGVA 4KMTH 3L95A 2OLDA 1RSFA 4P9HH 1A1MB 5C0IB 4JZJA 5HYSA 1WC7B 3LRHA 4EI5B 1RZIA 2W9LA 1B2WL 4U3XA 1NFDE 5A16B 5KZCD 3G6JE 1TPXC 2A6DB 3AB0B 1URLA 1H3VA 4HZLA 4UIKL 3X17A 4YQXL 3DUSA 1T1XB 4LKCB 5ICYA 1GC1C 4HUNB 1PG7L 5FUCC 4J3UA 2LVEA 3T3ME 1Q9WA 3ET9F 1OCWL 2D31B 2VKXA 5C0DB 2FX7L 2HJFA 2OI9B 3LKRA 1PX4A 3VI3F 5ERWB 4FXKB 4A6YH 1YEFH 2UZYB 3DVGA 3D0VA 3GO1H 1JNLL 2FBJH 5DK3A 4I3RH 3HI1B 5CAYB 5JPMB 3QYCA 3P77A 4FHBD 4K8RL 3QRGH 4PJDB 1U41A 3IKKA 3MNVA 5DFVC 5JOFB 3IDMB 3PQYA 4HIJA 3S36X 5I18H 1Q9OB 2R23B 5H94A 1LDPH 3KPMA 3HMWH 2EC9U 3NIGF 32C2A 4LP4A 5F7WC 2VXVL 3RGVC 1F4YL 3WFCH 1KCUH 4GO6B 1G7HA 2W0KA 1QUNA 3OKMA 4WTWA 4AH2B 2EDOA 4YAQB 3HUJE 3PABB 2C3HA 3WEXB 4XPAL 2NZ9C 4YDVB 4PY8J 4JDZB 4ZD3L 3RPKA 1HIMH 3HE6D 3R1GL 3GJFK 3U46B 1WV7T 5JNYA 1YEKL 2WINA 4ZFZB 4L4TD 4LAQL 4PJ8D 3QCUH 3HG1A 3BP6B 4K3HA 3ULUF 4HWZB 1A6ZB 2ZOLB 3GMPB 1S8DB 3PUCA 1HKLH 4WTXA 1I7RA 1L6ZA 1RURL 2C3VA 1WTLA 4CJ1A 2Q3AA 3O6FA 2VIRA 1QRNB 2DLIA 3P4NA 4XBPA 4ZFFA 4JEGB 4LPYA 2JLLA 3EHBC 3TNNA 2ITDA 5HPOA 3LS4L 2Q86B 1R5WA 3HNSL 4G42A 5D1QD 4MJ6B 1KSRA 2CLRB 2HVJA 4Y4FA 2Y7QB 2L0DA 3BPCB 1T66D 4CADB 4ZUUB 2G2RA 1T20B 3O2WL 4EIGB 4RBPH 2JB6B 1QBMH 2F54E 4KROB 1WT5C 3QEHA 3ILQD 1S9WB 3C09C 4ORGB 5FK9B 1JTTA 2BRRH 2WM0A 2EDRA 3CMOH 3FFCA 5JXAH 4QHKI 4Z8FL 4YHIA 2BVTA 1T89C 3WD5L 3LQAC 3SKMB 2QQQA 2PO6B 3EZJB 1NKRA 4XTRD 1AO7D 3MRHB 3TESA 4PJHA 1PFCA 2X4NB 3L3HB 3T4YA 4NFDA 1WWAX 5F6HJ 5GXBB 1TJGH 1R3HB 5D7JD 2A6IB 3ZKSD 1PX3A 4MJIE 4PGBB 5LKNA 3FN0L 4F37K 1G9NL 2NTSP 4TVSa 4FXGB 4M6MH 5HPMA 1PKOA 5EDXA 5BOPA 4JDTL 2CQVA 4JDVA 4MVBD 1SVZA 4OFIA 4LAJH 4FFWD 4JB9H 2QADC 3OKLB 3LKQA 1MRCL 5C6WH 4RGMC 2VLJE 2BXZA 3WN5C 5HHXL 3C60B 1K2DB 2BVYA 5EO0A 5B39G 1GXEA 3OF6D 4EUPA 2J8UF 3MLYL 4ZOEA 1RZKC 2NCMA 3VI3E 5DJZB 1FC1A 1LEIA 2VE6A 3ZHKA 1YMMA 4J3TA 1NCWL 3LEXA 4X4XB 4L8SC 3OZ9L 1A7RH 4XNMB 4F33A 1KTLB 5F7MC 4ZUVA 1N3NB 4NSKA 2AJXL 3VD5A 4OLXL 2HJKA 4XCEA 5IMOB 4QTHB 3F6IA 1I7ZA 2GTZB 4XZUB 5M7QA 3NIGE 3BQUB 3QEUB 3L7FA 5F3BB 3WBDA 1GJIA 2AVGA 3OKDB 2XIDA 1KLUB 5FUOH 3RY5A 4FQHA 1T3FB 12E8L 4YXHL 1UKTA 2K9UA 1SJHA 3C6LD 4XMPL 1RZGA 2H8PB 3GSQA 1WK0A 5KJRL 4PBWD 2DLFH 1AD9A 1T5XA 5L0QB 5GIRB 2LU3A 2YD1A 4LF3A 2DTML 1VPOH 3P3YA 5LWYH 3ULUE 4XC3L 3EGSA 5IIEA 3TO2A 5ISZD 1WBYA 2HT3C 4AMKH 4HH8A 3HI6L 1HHGA 1FFQA 5CKAA 2B1AH 3ULSA 1Q1JL 5DDHB 1NCDL 3DRTA 2JK5A 4R2GD 3RGHA 3A0OA 3BYTA 1X5LA 1GGIL 1K8DA 4XP1L 4J3VA 3ALXA 4ZUSA 3H9SD 1K8IA 4ONFL 3O6LL 5SV3A 4NHUB 1JTPA 4UNUA 1IAOB 1KLFA 1M6OA 2R9HC 5KVGH 2ZZUT 2VISA 3FQRA 3B2UD 1CLOL 2VXQH 1A1OB 3ZTNL 4AY0A 3VXME 3AMKA 5CLWA 4MZ2A 5E4EC 4HJGA 4OCLC 3S37X 3CSGA 1NC2A 4F2MA 1SEQL 2NY3B 4BFBD 1BZ7B 4WTZG 1W72L 2ZCHH 5E8OB 5C0AE 2G5RA 2Y6SD 3TN0C 3TA3C 1ZVSA 4PS4H 4U3CA 5FA4A 1IM3A 1MJJA 2WW8A 4JPKL 3P4LA 3BH9A 4HV8B 5JXED 4KI5F 1A4KB 4U6VL 4ZDHA 5DK0B 2YUZA 3QIBC 1CE1L 3LV3B 5DJ8A 5HBBA 3HNVH 1QR1B 2FHBA 3S96A 4OKDA 1DLHB 5F7KC 3V4UL 4ZOAA 3IDJB 3QSKB 2JTDA 2ENYA 4ERSL 5IV2A 4J2XA 4PRHD 2V5TA 3MRJA 1HINL 3VRLF 1ITCA 1YQVL 2J8UE 3VDCA 4JM2A 3MNVB 3OR7B 3PQYB 5DO2D 2R2HB 4HUVB 4FQXA 1T80A 3W81A 3T77A 4BZ1H 1DQML 4OZHA 3V8OA 5DRXA 3JTSB 1OAUL 3OBAA 4CL7A 5FHBL 4ZS7H 3MYJA 4Y88A 5DR5L 4Q2ZA 4TULH 4FQ1L 3TP4A 1BMGA 1F4XL 4UTBH 2BSTA 4MA1C 2WINB 4OUUB 5D93B 2FWOA 4M1GL 4KH2A 3HG1B 4P46B 2F53D 4TOYL 2WUCL 5E1AB 3T65A 4P2RE 1CF8H 5E2UL 1AHWA 4LKXB 4HD9A 5D72H 1R3LB 4HWBL 3T0AA 2RCSL 1ZSDB 1NCUA 1S7RA 2XZAL 2FATH 1TITA 4N0UE 4WO4C 4I9WE 5DRNA 4ZO9A 3O6FB 1F2XK 4JFXA 2VIRB 2I27N 2CR6A 3P4NB 1L7IL 3NTCL 5D2LF 4A6YB 3KXFE 3TIEA 5K59F 4XBPB 5KSAA 4RWYH 2EH7H 3CSYA 1CFVH 5K9OB 4JQVC 3VJ6A 5J6GB 1UACL 2ITDB 5AD0A 4NRXB 3SE9H 4YPJA 1D7FA 5TF0A 2AXJA 4G42B 2R2BA 5D1ZC 5B38G 4XPTH 1I7TB 4QRUB 1CD1A 4JJ5B 1KJ2A 1D5MA 4ZXBC 1S7VA 3Q3GA 3PHQA 1RUQL 3MUGA 4XCYA 4KK5C 2GT9A 4MQXD 2PW2A 3KJ6L 1ZLVK 2ZUVA 4HJ0D 4XP6H 1EZVX 1J8HD 2M26A 3FTGA 4YX2H 2DKSA 3C87A 3AGVA 3TT3H 1HDMA 4OF3A 4Y5YB 3VFSA 5I1AB 3IAQA 4EBQH 3TO4C 1ZXQA 3DTXA 3R8BB 4TSBL 4JRXE 4OFDA 1LP9F 3GBLA 4PGDA 3UMTA 3O3BB 3QNYA 1UWEH 2P48B 4Y0GA 3NABH 4QHMA 2VWEE 5ACMA 4WEBH 3C08L 4XP4L 5L6YH 4PRIA 4ZO7A 4LNRA 3QIWC 5L9DL 3CXDL 4J6RH 5CSBA 5HPMB 1T7YA 3WIFA 2Y9RT 1E0OB 3B8SA 1RJYA 2DBLL 1S7TA 4X6CA 4DQOL 3L3GA 5JOEA 3LKQB 2J4WH 5ANMA 4EDWH 2MQ0A 5EOCL 3GSVA 4BELD 4ZS6C 3UZVB 5BVJA 2MKLC 5E2WH 4D9RE 1BFSA 4KI5E 3PGFL 1D5ZA 2IAND 1TZHA 4IRJC 4MA7L 2IG2L 4EUPB 2NY5H 1WEJL 4X7FC 2O5ZH 1C5CL 2HLFD 1XF3A 4YHNB 1YMMB 4I2XE 3LEXB 5I8CA 1OSPL 2R4SH 1I85A 2DWEB 3D69B 4IRSA 4K8RC 4X6EA 2XKSA 5DEFB 1UM6L 4JFEE 4EOWL 4GRLA 2NZIA 3QPXL 2HJKB 4XCEB 3HB3C 1RUML 3R8QA 3JWDL 5ESVA 3L7FB 5CJXA 4U4BA 3B4NA 3VFVB 3PGDB 3SJVE 3O6KH 3AAZB 5EOTA 2JELH 3NA4A 4ELMF 2H6PA 5FYJE 1Q0YH 4KK6C 3QUZD 5I16B 2NW2A 4G8GD 4FQ2H 4PD4J 1P1ZB 5BS0B 4UAOB 2BSED 4RAHA 3U0PA 1NGPL 1PEWA 4U1IA 1BFOA 5GGRY 4NBXB 3QUMA 3BDBA 4JZJC 5GRJL 5I1IH 4Y4KD 4YHLL 3QWRA 2W92A 4JHBA 3TBTA 3C5ZC 2VDOL 3UDWC 1U3HA 5IW6B 4DKAA 3H8NA 5IIEB 4M5ZH 1WBYB 1MHHB 1D5BB 3MNZA 2P8PA 3SO5A 4H88L 2OR8A 4N1HB 1QSEB 4XPFH 5JIPA 4O9HL 4O2FB 5D2LE 3L3OA 3WMSA 5F70A 5K59E 1XCTA 5KAQG 4XH2A 1DL7H 1CFTB 1YNTA 3UEZA 1BLNA 4ZUSB 3FMGL 3FCTA 2R0LL 3NGBC 2R0WL 1BQSA 3BW9B 4GW1A 4PJIA 5ENWA 5CJ5A 1R0AH 1G9MH 4BUGA 1M6OB 3DSFL 2AS5M 3IDYC 3U30B 2VISB 1TZGH 3D39A 1G7IA 1MCWW 2W0FA 3PE9A 1CG9A 3X3GH 5C07D 4JQXA 4KV5F 4WENB 5DT1L 2A6JA 1CLZL 4Y16B 2CIIA 3E1F1 2Z92B 3BIKA 5EULV 1NC2B 4NM4H 4LPVA 2O5XH 2CRYA 3E8UL 4L4VD 4AQ1B 2YRLA 4LLYB 1LP9E 4QCIB 1QOKA 2HVKB 1ZVSB 4EKXA 1IBGL 5JQHC 3QUML 3RA7H 1MJJB 5DXWA 4HC1A 1I9RH 4DKEH 3ARTA 3U0WH 1OAZH 2DOCA 1OTTD 1HHJA 1G9NC 1J1XL 1EEZA 2FBOJ 2P5WE 3KPRA 3RY6A 4M7LH 1FAIL 1C12A 4QOKB 3REWA 4W4NA 5B39A 5KVFH 5I17A 5I1CL 5MEND 3MLVL 3U4BH 1N8ZB 1UENA 4XRCA 3OAUL 2HFEA 2I07B 1ZT4A 3HCVB 2B0SH 4OAWA 1IGFL 3MNWA 4JKMA 2FX9H 4MAYA 4RA0C 2VC2H 1NPUA 2FX8H 2CRMA 4RX4A 4N1CA 4DZ8A 2EIZA 1TJIL 4Y4FC 5I30H 1HSBA 1FL3B 3LS5L 5I1JH 4BQ9A 4G8EB 4R0LA 1QLRB 3E6HB 3EYVA 3ZE0F 2OR9H 4WCYL 1D6VH 2JCCF 4P2CG 1KIRA 5KVEL 4PP1D 4F15B 3GMNB 1Z5LB 1X5AA 3I6LE 5IVXF 5EBWA 1KOAA 4L4TA 3D9AH 4L8CB 1HXYB 4ELME 2FJHA 3KPNB 5GRXG 1JYWA 3NFPB 1AHWB 3BT2H 2A9MH 4U1LB 5D2NA 1FZOB 2ORBH 4YE4L 1UA6H 4QHUA 3LIZH 1VHPA 1S7RB 2FJGA 1U92A 8FABA 4HDIA 3LPWA 2BNRA 1N5YL 3N9GL 2L7UA 3D1MC 3JSSA 4LIQE 3TIEB 5KSAB 1JGDA 3KHOA 4WWKC 5IHUH 2DQEH 5IFHL 3E2HC 4UDTA 5AD0B 2UZIH 3CIQA 4AEEA 2R2BB 3PNWA 4OGAD 1CD1B 35C8L 4HXBH 4UT9H 5DD6A 5I19L 2CUMA 1KJ2B 1S7VB 3T8XA 5MEQA 3PHQB 1CD0A 3MUGB 3GSWA 1HWHB 1WQVT 2PW2B 4XHJC 4D9QE 1R5VA 4ZUWA 3K7UA 1RZ7L 1JMZA 3BMVA 1J88A 3WFDH 3ZHLA 1HDMB 4C54A 3LDBC 3QHFL 5DVMA 2DI7A 5DGQA 1MAML 2D7OA 2MJWA 4PLKD 4KV5E 1KBGH 4PD4K 4PGDB 3NA9H 2NY1B 5HGDA 3LB6C 4QHMB 4WTZA 1BGXH 1MCOL 3V4PL 4FTVA 4RRPA 5A2FA 3BPNB 5SWSE 2B1HL 3KLDA 1P4LB 1KN4L 5GSVB 4MA8H 5B3NA 4HIXL 4OFYA 3WIFB 2P46B 2R56L 1A9BA 1YY9D 3H9HA 4YWGL 1WZLA 3QDGD 3WDHA 2OM5A 3FT3A 2YMXL 3B83A 3G08B 3EYSH 4Y1AE 3VI4F 2XG5A 5ADPL 3N50A 5BVJB 1QR4A 5E8DH 2FO4A 3M17B 2DJ4A 3OF6A 4NO0A 2OL3A 1D5ZB 2EIDA 3NIFF 4HBCL 5DK2B 2DKMA 3CDCA 5ALBL 1XF3B 5I8CB 4LDLB 2FD6H 4N0FB 3QXVA 4IBLT 1GVIA 5TE7H 1TVHA 4IRSB 4P57A 3L5JA 2D4DA 1BBJB 1TVBA 1SM3L 3QRFM 5A2IH 1AGDA 5IHBA 4LCWB 3IAPA 5D1XB 3V2AR 3VGGA 1SVCP 2AJYL 4Y19E 3FQWB 3UYRL 1FBIL 1L7TH 3BKMH 5HI5C 1VGEH 5BRZE 5I1KH 3S97C 3O4LB 2F54D 1SHMA 3RU8H 4JFYA 3ZE0E 3LPFA 2J1KA 3KPOB 4MAUL 2JCCE 3PL6A 3MCKA 5E08L 1UVQB 3MRDA 4KKAC 1CFSA 5L8LB 5IVXE 2EDJA 2OTUA 4OTXL 2YOCA 2DQFA 1RK1B 4FMFA 5CZXC 5I0DA 4AT6A 2VXUL 1REIA 2XZQH 1XGRA 4U1GB 4LGSB 5CS7A 4YHZH 4C4KO 4Q0XL 2Y07H 3LN9A 3MNZB 1MVUB 4JG1H 4MJID 5EU6A 1GPOL 3QIUA 2EZ0D 2OL3L 5FYJU 2R8SH 1DN2A 1ZWIA 2PYEA 1XCTB 1Y6MR 3H9SA 4R4BB 3RZCD 2FO1A 3HZYA 2IQAA 3FCTB 1AQDA 2VLJD 3MREA 4PJIB 2YD3A 5ENWB 1IGCH 2IPUG 2GITA 2GTWA 5FM4A 4I0PC 1P2CA 1BX2B 1OTUC 4G80B 5F9DC 3D39B 1T22B 2V5SA 1CG9B 1UJTA 2CJUL 3P0YH 3EYOB 2P44B 3QAZC 4FQXC 1CDUA 4OM0L 4X7TA 3S35H 3EYFA 2ZUWA 4H8WH 3BESR 4DEPB 3PF2A 5H35A 5KZCB 4LLDB 5I73C 3WS3B 4LSVH 4LOUC 5F7LB 4M6NL 2YWYA 1DFBH 4P5MB 1E28B 1MSPA 1U95A 4K7FB 2XKUA 5ICZB 5BMFL 1BFTA 1A64A 3SPVB 4P5KA 1FO0A 4N9OB 5JXEA 4LSTH 2C1OB 2QHRL 1OY3B 3K4AA 1KNOA 4Q9QH 4X4MA 3TZVA 3SDXA 3QDJA 1MFAL 4GRWB 1EEZB 2Y23A 2JJSA 4JG0H 5MERA 3RKDD 5D5MF 1VFBA 5B39B 3VI4E 4PRHA 1A7PH 4MQSB 3RIAK 5I17B 2IGFL 3L3JA 4OF7A 3LHPL 4OGXL 1INEL 4XRCB 3ULUD 1IC4L 2HFEB 2HH0H 3BE1H 5SX4H 4EDXA 3NIFE 1JWSA 4YHYB 2GJJA 3AY4A 2EICA 3FZUD 3NPZB 3MNWB 1U8LA 1IC7L 1UWGH 3BP7B 2OP4L 4YHML 3WJJA 1YC8A 3RI5K 5ACLA 3CVIL 1WF5A 4DZ8B 2EIZB 1Q0XH 3RVVD 2DLTA 1HSBB 1TENA 4R0LB 1NGXA 1U8IB 3EYVB 1ERNA 4R26H 1X6LA 3O3DB 4WW1A 5ACZA 4Z76A 3D2UA 2HT2C 1MIMH 1KIRB 3HE6B 3JWDC 1KT2B 3KLAB 1RFDL 4L4TB 4PJ8B 5CD3B 5GJTH 1EFXA 4JFPA 4IJ3B 1LO0H 3VXMD 4X7SL 2CPCA 2FJHB 2DQJH 1J0JA 4OD1L 1I1AA 4E42B 2RJMA 1A1NA 1T1WA 3DROA 3QWOA 3QFDB 4U6YA 4XVSH 4YBLC 5LJYH 4QHLB 4QHUB 1KIQB 2EDKA 2FJGB 2W1NA 5GQBA 1U92B 8FABB 4AEFA 4HDIB 1XEDA 3QDME 3RZWA 5C0AD 1KB5L 1MI5A 3P4OA 5LXGL 3MGTA 4P59L 4CUCA 2VABB 1Z9LA 3BEVA 2WIMA 1IM9D 3U4AA 3VFRA 5IW1B 1CXEA 1AFVH 1KJ3L 5D1QB 3NFSL 1N64L 3V8CA 2WUBL 4NC2B 2IJ0C 3PNWB 5DMJB 1ZHBA 5GISH 4CN1A 3GSWB 2F5AH 3W9EB 3ARSA 1MFDL 3A6BL 2RBLA 1WFNA 5B8CC 1E6JL 4XB8A 4XBEL 3VRJB 3X14A 1R5VB 4ZUWB 4F58H 1A47A 1I85C 4RGND 1MFCH 2I24N 1XIWD 5I8OH 2BHZA 2FEEI 3OKNA 2OK0L 1SMOA 5IWLA 2YBRA 1AO7B 2WBJA 3BH8B 4GRLC 3QG6B 1JGLH 3BIAX 4U0RC 3BAEL 4UV4L 4PGEA 1OAYH 4F7CB 5HGDB 5IQ9A 5EO9A 2DLEA 4BUHA 4YUEH 5D7JB 4FTVB 1F58H 3UJIL 3S36H 1C1EL 2PF6A 5LQBH 5J3HD 3IJHA 3OJ2C 2VH5H 5EFIA 3MO1B 1A9BB 2GJ6D 2XXMB 3H9HB 4NC0B 1OTSC 3NOIA 4ZFGH 1P6FA 1H9VA 5L88L 3KPQA 4LU5L 1W8OA 4GXVL 1EHLL 4P2RD 3KHQA 4Q9RH 2BK8A 4Q6YA 1P4IL 4G9DA 3SKOA 5D5ME 3OAZK 3SGJA 5DHVA 4I9WD 1VERA 3MUZ1 3KXFD 2HKFL 1T1YA 4OI7A 1QBAA 1YYML 4XMLL 2HTLC 4H20L 5AG9A 5J6HB 1TVHB 3CH8A 4J8RA 3SDCD 1AXTH 5T3XD 4WI8A 5CBAB 2HJLB 1OAXH 1RVFH 5GZND 3O3UN 1EXUA 1AGDB 4OZ4A 5E8NA 3QCVL 1WFTA 4OCSL 5GGQL 1JGVH 3G6AA 2ERJB 1ZK9A 1BEYH 2EYSB 3QUZA 2H32H 4TSCH 3I9GL 4EN3D 1ONQB 2JIXD 2UY6A 4NUGL 2CDGA 1DBMH 4PG9A 3UTZB 4NN6B 5E6IA 2GUOA 2DB8A 3HAEH 1AI1L 2VL4A 3L3KA 4Y4KA 5FV1L 1BZ9A 5IB3A 5I2IA 5IBUG 1YC7A 3IFOA 4YC2C 2VL5A 4R7DA 4XBGA 1XGRB 2CH8A 3TJHD 5ISZB 5FHAH 1FVEB 2VITA 4N0RA 3IXTA 5GGUA 3ULVH 5EU6B 5CMAA 2XWBA 3OB0H 3QIUB 4R2GB 15C8L 2PYEB 4N9GA 3WFBH 4S1SL 3H9SB 4XGZA 1N7ML 3O8XD 2PR4H 5B38B 2EO1A 3RY6C 2VR5A 5T5NF 1DSFH 4P23C 4KI5D 2D7PA 3S3SA 3MREB 4RDQF 6FABH 3JWOH 4X80L 1OOAA 3D0LA 2GTWB 1WICA 2LVCA 3HMXA 1MEXH 3DO3A 1SJEA 3OQ3B 3BI9X 1K3ZA 3P9LB 1U93A 4MAYC 4GSDH 5EZLB 3VGAB 3WJLA 4X7TB 1KJMB 5HGAB 3F58L 3EYFB 1U42A 1F11A 3JV4A 3JUZA 1II4E 4P5TD 5ADOH 2M1KA 4GXUN 3WIIL 4Q6IB 5FUCE 4K23H 2PXYD 1FO0B 1F8TH 3Q48A 1FGNL 3QUXD 4LLQA 5LAXA 4OLZL 2H41A 3ZKMC 3E3QC 4DVBB 1FLRL 2Z9TA 3Q6GH 1J9CT 4PR5B 2R29H 4F9PA 4JHWH 1A5FL 5IHLB 4HJJH 4I3SH 5KANI 1S7UB 5D2NC 5MERB 2BNQE 2VAJA 4PRHB 4Y4HD 4ZTPL 1UWXK 1A9EA 3HPLB 5I75C 2VZ1A 4P9ML 4G8IA 5F1NA 2X89D 1FH5L 1KCRH 3MUHL 5GGSY 2V7HA 4K3DH 1GIGL 2A0LC 1RULL 4U1HA 4MLSA 5EWIH 1CCZA 2GY5A 2ZCKH 4XAKE 5JOPE 1PSKL 2Y06H 3HMXL 1UJ3A 1ZHLA 1C5DA 1QSVA 1NUGA 1QYGL 4WW1B 3WIHH 1EGJL 4YGVA 4XC1H 1FE8H 5F9JA 2VDQL 3GBML 4KJWD 1DQDL 1F3RB 2XFXA 4J7RA 3MR9A 4OI9A 4U7SA 3NAAL 4JGUA 3C9NB 3U7YL 4WFHE 1CDCA 1NGQH 4N90D 4WI9A 4Z7UB 3N85H 1OF2B 2KH2B 4O02H 4PREB 1F90L 2Z93B 3FQXB 1C16B 4RFNB 2DQGL 5DURD 1VGKA 5A3IC 4RGOL 2IF7A 1NBZA 1C08A 4OLUL 3ZYJA 4YHOH 3VFRB 3N1GC 4E41D 1ADQA 4MMZC 3S37H 3H42H 5DVKA 2BDNL 1TETL 1KB9J 2DICA 4I13B 4OM1L 1HCFX 1EO8H 4LLVA 2I5YL 3EYQC 4IOFC 5F96L 3IU4H 2ED9A 4FFVD 2K3TA 1J8HB 4P9HL 3P11H 2P5EE 1JHLH 5E8EA 4BQBA 3DURA 1QZ1A 4Y89A 2Y1VA 3UPRA 1RUPL 1M1SA 1J1PH 4JY4B 2XY1A 5ESQA 4PGEB 1T4KA 3PXJA 3BZEA 5FM5O 3HUJA 1W0WA 1N4XH 4XPGH 4B50A 3PHOA 4TVPH 1S3KH 1HHHA 5EC1A 3C5JA 3IJHB 3MLSH 3PHSA 2WSKA 4WIQA 1YEFL 3K4DA 2WP3T 4I3RL 2IANB 4HPOH 3MV7D 3QRGL 4JFDD 3TCLA 1ZA6A 2EO9A 5F6IC 5IBLD 5I18L 1IZJA 4G7VH 4MCYA 2APBA 5MEOA 4I77H 2IAMA 2K7QA 1LDPL 1OHQA 3CNKA 3HMWL 5DHVB 2DM7A 1T0NB 2Q7YA 3D3VE 3RNQB 1TVDA 4TUOA 5DD1L 1FCGA 4X5XB 5CWSA 3WFCL 1KCUL 1T1YB 1WJ3A 1YEEH 3EOBA 5F7EH 2MPAH 1ORQB 4RAUB 4J8RB 4YLQT 2AGJH 5JIIA 1G1CA 3NZHH 4WFEE 4WI2A 4MB3A 1HIML 3FT2B 5C09D 1FNGA 4DKFH 3HE7A 4UBDD 1H3GA 2C4FT 2NLJA 5C08E 5C0GB 4NWTH 3QCUL 3QUZB 4YHKH 2QSCH 4G8GB 1D9KA 1VFAA 3V5DA 2ADGA 5I1GH 4PG9B 4ZO8A 5E6IB 2GUOB 4V1DE 5C0RH 4LLMA 1U3JA 43CAB 3MQIA 1YNKH 3L3KB 4Y4KB 1NLDL 1KELH 1BZ9B 5IB3B 5FOBA 3AREA 4TRPH 4P48A 1OGAE 2OR7A 4XCCH 3DXAE 5D96B 5DSCB 1SYVB 4PLOB 4O5LH 3DGGB 5H37H 2VITB 4MJIA 4B53A 1I8IB 5JQ6H 4ONGH 3MV01 5GGUB 1FL5A 4B7IA 3VFPA 2XWBB 4M8QA 1AKJA 1DBKH 5DD3H 3TZVC 4M02A 5MP6H 1QBML 5EUKA 3MLUH 3RL2A 1BD2D 4MNQD 3MRCA 1RZ8A 3RDTA 3FONA 4MA3A 2BRRL 3ZE2F 4IIQC 3CMOL 5JXAL 5INDB 5IEHA 3I6KB 5CUSH 4HUUB 1LE5A 2B4CH 3AY4C 3U2SA 3FJTA 1IAIH 4N5UA 3CUPB 2R4RH 3BDYH 3HC0B 3WJJC 1CIUA 5IESH 1TJGL 3L3DA 4KJYA 3HAEB 1ODAA 4KRNA 2B2XH 3JV4B 5IVZB 4L4VB 3MGOA 2D4FA 4S0TD 3ZT5A 5IMMA 4JB9L 2FR4A 2CLVA 2DQTL 3QQ3A 4Y19D 1X7QB 2UYLA 4AEIH 2X10A 3Q1SH 5DD5H 3RVXC 4WFFE 2RQ8A 3QPQC 5LAXB 3FB6B 3DX6B 3STLB 3BVNB 4HK3J 5EIQA 1I1AC 3VGHA 3BGAA 1A14H 1LNUA 4HKJB 5JDSA 4CNIB 4QF1A 5T1DH 2FGWH 1V5JA 5SX4I 1A7RL 1EV2E 5FO7A 1FZJA 4P2QD 3UBXG 2OXGA 4HUMB 2CIKA 5CLTA 1FVDB 4HS3A 1CXLA 1KB9K 4QHKJ 1X5GA 2VLKE 2HTKD 1MF2L 2V2TA 3MRQA 1HSAA 4J4PC 4TSAH 2E9WA 5JW4Q 2V17H 3F6LA 4HK0B 4Y2OA 4NHCL 3TT1H 4ZFOA 5FUOL 4GKNA 2PCPA 2SEBA 4ZNCD 3RWDA 3MRPB 3JZ7A 5F9JB 5F7FA 1FN4A 4M9PA 2XFXB 4ETQA 2IADB 1VKXB 4PRAA 2X4OA 2DLFL 3VXPA 3VWKA 1N5AA 1FZMB 1CGYA 1IKFL 3V5KA 3HFML 1VPOL 5CGYC 3U48A 2P8MB 1MQKH 4MNGE 4G7YH 2V5MA 2WBJC 4AMKL 4KJQC 1NFDB 5HTSA 3MJ6A 2B1AL 3G6JB 4MHHI 5E5MA 3IJSA 5TPWH 3WO4C 5GRVK 5C0AA 1DQLH 3UAJD 2IBZY 2QQLH 2VDRH 3R0MA 4HWEH 1LK3H 1MHCA 2DKUA 3IFLH 5FYLE 1IM9A 1NBZB 1C08B 4NCC2 4NDMA 2X41A 1XCQB 3S88H 4AIZA 4NKDA 4FZ8H 2NY7H 4NBZB 3DYPA 5KVGL 2YWZA 5IT2H 5MI0B 3B9EA 4KDWA 4LLVB 1CT8A 4QYOB 3EJZC 1WLHA 4N0CD 3SGJC 3P0VH 2J8UA 5T3XH 3A67L 1NC4A 2V2XA 1T21A 2OBGA 4P4RA 3ZE2E 1MUJA 1Q94A 4ZFOL 3DURB 1IJ9A 1W0VB 3T0WA 4NQEE 4WUKL 2ZCHL 4MWFA 3TC9A 3UPRB 4U1SA 4QXGL 5ESQB 4WI6A 4PS4L 4HIEB 3BZEB 3W0WD 3CFEA 4X99A 4OFKA 1H8NA 5JO5A 1CQYA 4U1JB 3CVHH 5J13B 3HNVL 3QDGB 5BJTB 1T2QH 4NCC1 3L5IA 3K74B 3MRKA 3VXRD 3WNKA 2ED8A 3ZDXF 2Z31D 4P3WA 1MCIA 2DQCH 4MJ5B 1YUHB 4GAFB 4CW1A 2XV6B 1I8LC 2R0KH 1MH5B 2PW1B 3WL9A 5C0CD 4BZ1L 4JR9H 3ME0A 5KOMC 3VXSD 5FKAA 4PLJD 4O00A 5CWSB 2V7NA 4ZS7L 4XWOD 4YDIH 3HR6A 2DYPD 3RFZC 4XNZC 4GBXD 4JO3H 4FQPA 4TULL 2WMPA 1WWCA 3X12A 5FA3A 1FNGB 5CP3H 1XF4B 4EXPX 4DOHE 2F54B 1UZ8A 2NLJB 5A40E 2BERA 1CICD 4LEOB 5C0BA 2P8LB 2IPTH 2YC1B 1CF8L 1VFAB 4F7MA 5D72L 4PJHF 4TUJB 3O3AA 4U05A 4KPHH 5J12C 1DUYA 2HRLA 4HKXA 1Y18A 1UH4A 3RWIA 4PGZA 2FATL 2EDQA 2DQDH 1KC5H 4JM4H 5J1AA 4JRXA 1IARB 3AREB 3ILPA 2D9CA 4UDUB 1YECH 1KV3A 1X5FA 2EH7L 4RWYL 4NKIH 1CFVL 4HIHA 2KL6A 1FSKB 4OIIH 1PZUB 3G6DH 4IS6A 4MJIB 2VN4A 3SE9L 3KYNB 3KGRA 1FDLH 4QRRE 3HI5H 4L1DA 3RZCB 2ZUQC 5AWNH 4QGTA 3R4DA 1H3XA 4F9PC 2G60H 5EUKB 2VLJB 4GKOA 5CIPA 3MRCB 4PJBF 4XP6L 2H9GB 4YX2L 4P2OD 4QY8A 3LEYH 1XF2A 4MA3B 3GNMH 3EYUH 1V7NH 4CMMA 4EBQL 5EB9A 1G7MA 3ZYZA 5K9JH 3ARRA 1O5DT 1GOFA 1TFHA 1I8MB 1LE5B 2VLLA 1VACB 3ARVA 4O58H 3NABL 2BVPA 2DIJA 4P9HC 2CUIA 2ZG2A 3ARUA 4JFEA 4WEBL 2YN3A 3L3DB 4KJYB 4Z7VF 1K6QH 1UJ3C 5KG9A 3HR5A 4J6RL 4F9LA 2C3GA 3SJVA 1H3WM 2BC4A 3K81A 5CZVH 1E6OH 3L3IA 5IKCA 2WWMC 2CLVB 3QQ3B 5KSBF 4TNVK 2J4WL 2UYLB 2ZOKA 4EDWL 4LSQL 2ESVD 5E2WL 1RZJL 3RWJA 3MLXH 2HG5A 4RMUA 5KVDH 4LLWA 2NYYD 1FG9C 2NY2C 2NY5L 5E99H 2O5ZL 4Y4HA 1T0PB 4GFTB 3ZDXE 4EQ2A 1KIPB 1RHHB 2F9BT 5JDJA 1NLBL 4D0BA 2IBGA 2R4SL 5FO7B 5E1HB 3SO3B 4DAGH 3V95A 5JW4R 2CIKB 3UPAA 3UYOD 3BISA 2P47B 1BM3L 2F8VA 3B9AA 3J7HA 3S3JA 3DHJA 3SE8L 5D2LA 1HSAB 4G9FE 2YD9A 3DI3B 4J1UA 3O6KL 3WNPA 1QPPA 2JELL 1GGUA 4M7JH 1Q0YL 2R1XB 2SEBB 2VOTA 4LP5A 1VFMA 2QSVA 3IDNA 3RWDB 4DWHA 4F7PB 4FQ2L 3W9DA 4LSPH 1KGCE 3KNBA 1MJUH 3V6BR 5F7UA 3FFCE 4PB9H 5DUPH 4UNVA 5I1IL 2R1WA 3OXRA 3VXMB 1F97A 3OKKB 2BVQB 5BVPH 3MLZH 4OLYH 2D7NA 4HLZH 4QXWA 2I26N 1V7MH 2DJUA 4PJHE 4S10A 2DQHH 4M5ZL 5IBUB 4N8VG 3ARPA 5FYJL 5EZOH 1NAMA 3IJSB 5EPMA 4WHTA 4XPFL 5C0AB 1F5WA 3AC0A 1DL7L 1MHCB 5E9DE 3QJHA 4PJFF 3LRSA 3WFHA 1IM9B 4FFYH 3O4OB 4OKVA 3MCG1 5FYKH 1PLGH 5CFHA 5HVGB 1RIUH 5F7HA 3B3IB 1RJZA 1XZ0A 3MROA 1F42A 4AIZB 2W65B 4NKDB 1R0AL 1G9ML 1VADA 5IVNA 2AK4E 2P5WA 3RX8A 1CGWA 2OZ4A 1QD0A 3I85A 1TZGL 3OTTA 3X3GL 2G9HA 2BNQD 1NBVH 4NO2B 2IAMC 5FAAA 4L9DA 3IDXH 5DVLA 3BUTA 3CH1B 4PJBE 4OZHF 4LRNH 3OKEB 5EU5B 1T21B 2V2XB 1MUJB 4RGNB 3TM6A 1XIWB 4PJ5D 5JPNB 2OQJA 4Z6AT 5DHXB 3IVKA 3MLWH 4ODVH 1RD6A 3GMOB 2O5XL 2W60B 3IETA 4MWFB 3O2VL 4XT1C 1HHIA 2RGSA 3RGVD 1ND0B 4NFBA 4U1SB 4WUUE 2BCKA 3IJYB 3RA7L 1OPGH 4XAKD 5JOPD 4KKLC 2MQ3A 2NZ9D 3VWJA 4C83A 1MCPH 4M1CC 4UQ3A 3PWUB 4Z7VE 1I9RL 3HE7C 3H3KA 3U0WL 2K7PA 4DKEL 1OAZL 3Q2CA 5I66A 1D9KC 4LPXA 4M7LL 2D03H 5KSBE 4ELMA 3CDFA 3MRKB 5KVFL 1NAML 3PWLA 4BQ8A 4KGLA 3RWHA 1EUTA 3U4BL 4P2RB 4WFHD 5KSUB 2PETA 3U9UA 1BQLH 3MXWH 4CVZB 4U6HA 1I1FB 1RAMA 1JE6A 4PUBL 3SN6N 2B0SL 4R6UA 4K7PX 3QO1A 3BGFC 3LKOB 2FX9L 3UBXA 1OM3H 4N0UB 2E9BA 4XAWH 3SCMC 2ICEB 1FNSH 5JIKA 3KXFB 2FX8L 5CGTA 3VMOA 4D8PB 3EHBD 2RR3A 5CKGA 5FKAB 3TPUB 2OZ4L 2L7JA 3WNLA 4OCRH 1A2YA 5I30L 2W59A 5I1JL 4AEHH 2EDEA 4IOIA 3V6OA 2V7NB 3SDCB 1MWAB 4G43B 1OARH 4OFPA 2FECI 5F89B 3VGFA 1K4DA 2OR9L 1D6VL 4LCIH 1PD6A 4GG8B 3FB5B 3QULA 1AIFA 1GGBH 5I1DB 3X12B 3D9AL 5FA3B 3QUKA 4EN3B 1UZ8B 2JIXB 3T0VA 2UWEF 4UT6H 1E4KA 1I3RB 1KTKE 2P5ED 2A9ML 3BT2L 4F7MB 2ORBL 1UA6L 1UB5A 4HKXB 3W2DH 3MJ7A 5JLZB 1V3LA 3CVHB 1NGZA 3JWNC 3LKNA 2I9LA 1JIBA 4JANB 4HQQH 3ILPB 5J11B 4PJCA 1I3GH 2KZ1B 1DN0B 1H5BC 2A77H 3IRZA 4P4KA 4MXQC 4X6CF 4FQQA 2DQEL 5SWSA 1I3VA 3CFCH 4L9LA 4IS6B 2UZIL 2A73A 1Y0LA 4MSWA 3F12A 1ETZA 5TFSH 3T0BA 3OR6B 2QADD 4HXBL 4UT9L 5A43C 1FNFA 4DZBB 4PJFE 4Y1AA 5ID0A 1ZVYA 4OZFA 2DJSA 3OGOE 5EO1A 3MJ8A 1JYXA 4L8DA 4UOW0 1BVKA 4L3EE 3ZHDA 1XF2B 4P0DA 4GS7C 3P9MA 5EG6C 1GH7A 4MDJA 4M00A 1BQHG 1I7UB 2G75A 1IAII 4I2XB 2XWTA 3QZWG 3VRIB 5DC4B 1KBGL 5DEZA 3NA9L 4OZHE 4FMKA 1IGJA 1UC6A 1BGXL 3VGDA 3CLEH 3WHE1 2GSGB 4MA8L 4P5TB 3L9RB 3HR5B 1KENH 1D5XA 5FECA 1NCBH 1A7NH 2JJTA 3GEWB 3L3IB 3MZTA 5BRZA 5J57B 3C5SA 4PJEF 1KEML 3FOLA 4BH7A 3PV7A 1G6RH 1Q72H 4M8VA 2ZOKB 1ITBB 4Y8DC 3RPIB 3V0VB 5E8DL 1Z6JT 4QNPF 3RWJB 3VWKC 2JCCA 1KYOJ 2HG5B 3EFFA 3MXVH 5EZJB 4EI5D 3TF7C 3BPLC 4X9BA 3VH8G 5EBMB 4RNRB 2YPKA 2DTSA 4Y4HB 5HHME 3OKYA 1BJ1H 5JW3H 5DFTA 4OD2B 1X9QA 1OGAD 2FD6L 2HT3D 1AXSB 2ADJB 1FORH 4NGHH 5TE7L 1U8HB 2W07A 1A7BA 3CZJA 3WHXB 4Q9BA 5D2LB 1S5HA 4JVWA 4J1UB 4NWUH 1VB9A 2YD8A 1L7TL 3QISA 1VGEL 5I1KL 3RU8L 1I1RA 1DJSA 1CXFA 2EH8H 3HS0B 3BZDA 3RUGB 2R9HD 3IDNB 3W9DB 5SWZE 5T5NG 4R9HA 3KNBB 3MCLL 4D3CH 1WBXA 1ZMYA 4H5SA 3ZTJH 4RDQG 2R1WB 4K55A 2AK1H 2UWEE 4I48B 1A3RH 4PJXB 2XZQL 3GMQA 3K2MC 4QRSB 1KLGA 5L2KE 3B9KA 3ARBA 3SDYH 4CDHA 1EMTH 3ARDA 3FQUB 3S4SG 1P7KB 3TBVB 25C8H 2Z35A 1JZ2A 4LASH 4JG1L 2EC8A 1KG0A 3AROA 3TN0D 1U8QA 4WHTB 5DURB 4U2ZA 3TA3D 1LP9B 5IJVA 2R8SL 2VLRE 2YPLD 5J06A 1S9YA 3GHEH 1BHGA 2AEPH 2YS4A 3QJHB 4KJPC 4X6CE 3WFHB 4OKVB 1G7JA 4PV9B 3VXTA 2Q8AH 4JZOA 4CVXA 1RJZB 3QIBD 3QNZB 1XZ0B 1Z9SA 2NTFA 4KUZH 2HT4D 2X42A 1IGCL 1VADB 5FYKU 2NXYD 2P5WB 2DRUA 4AIXA 1WCBB 4B7LA 2HFGH 3U4EB 1SJXA 3P0YL 5CEZH 4JN2A 4M43H 3S35L 1UXWB 4OV5A 1FFNB 1NDGA 2X09A 1FFOA 4LSVL 4PY7A 2OQJB 3IVKB 1EERB 3GRWH 1OP3K 4FOMA 1HXMB 3MRBA 1DFBL 1HHIB 1WZMA 4YXLH 5D6DC 2BCKB 3ELAT 4LSTL 4RCAA 4ZPTA 4Q9QL 4CN4A 1CE6B 5BV7C 1NFIA 5F9WB 2D2OA 5I66B 3E0GA 4JG0L 2BY2A 4RZCA 4ELMB 4PJEE 1A7PL 3CCHA 3PWLB 2A6KA 5AZEL 4QNPE 4JFDB 2XZCL 1RZJC 4Y5XC 5D7SH 3U9UB 1A21A 2IWGA 4HG4J 4QXUH 2R1YA 3PWNB 2Y5TA 3LEVL 2VWEC 3ZKXB 2IPUK 2NY5C 3A6CH 2P1YA 3QDMA 1UWGL 5HDOA 3QG7H 4WV1C 1B0WA 1KJVA 1PBYA 3QXDA 3ZO0A 4TUKL 4FXLA 5DJ6B 4KRPC 1Q0XL 1U91B 3DYOA 4MMXC 3VXUE 1JGEB 1M7IA 1NDMA 5CHNA 1JZ7A 3DARA 4IOIB 2ICWI 1EHXA 4R26L 5D1ZD 3KYMB 3HC3L 5FO8A 1CGXA 2G5BB 1MIML 1Y6NR 3QULB 4ZXBD 5L2JA 5C09B 2Y72A 3GI9H 5FXCH 5GJTL 3QR2A 4JRYE 3F62A 3QUKB 5E94B 2QLVB 1F3DJ 1LO0L 2I9TA 3G9AB 1J10A 4ZOCA 2AV1B 4KVNL 3GSOA 5ILTH 1HZHL 5HHOE 1DEEA 1A22B 2NQCA 4RSVA 1B90A 3EFDH 3KYOB 1UB5B 1QRKA 5DD0H 3TO4D 4JY6A 1NGZB 3LKNB 2KDGA 2I9LB 4IEFB 1ZA3A 5EU3A 4U33A 1KYOK 3BQUD 4KZDH 1TCRB 4F9LC 1CD8A 1I4FA 4MLIA 1A7OH 3VW3H 5SWSB 5KVMC 2WZPD 3SBWC 4E5XB 3QIWD 4L9LB 1J11A 4X98A 5DI8B 3BSZH 5H2BB 1ETZB 4JY5H 1MCKA 1KXVC 1EZVY 2Y36H 1JL8A 3KPRE 3RHWF 4ZS6D 1BD2B 2F5AL 2J6EH 4L8BB 4LQ1A 4MNQB 3JUYA 2R2EB 4IRJD 5TH2A 3MJ8B 4L8DB 4NN7B 1BVKB 4PRPA 5EORH 2C3WA 4F58L 1UG9A 1G9MC 1JVKA 1U8KA 5IOPB 4OCNC 3P9MB 1IGIH 5D5MA 1MFCL 3NBNA 5I8OL 2GSIA 3MC0A 5FGRA 4HF5H 2XWTB 1JGLL 2OJEA 3L6FA 4BYHA 4RAVA 4K8RD 3GM0A 5D7IA 4YUEL 1Q9KA 5HYJD 2CKBH 4GRMA 1XF5A 3U79A 3LOWA 1RZFH 1M7DA 4XCNA 5DRWA 3S36L 1G7PA 3QJFA 4GUPB 4WW2A 5LQBL 2VH5L 1AC0A 4Y19B 2JJWA 4HAFA 1ACYL 2X4SA 4KK6D 4M03A 2LFGA 4PV8A 4BH7B 3E3QE 3F7VB 4Q9RL 2JCCB 4XP9L 1NCAL 4FZEL 1ED3A 4JKKA 4L5FH 4JFQA 3T0EE 3LKSA 4LCYA 5IVXB 1FCCA 3W5MA 3RTQA 4LCUA 1ZLVH 2BMKA 4LL9A 2X70A 2NY3D 5HJ3A 2BNRE 1MELA 3MRRB 2CDEB 1V3MA 3OG6B 5IMKA 3GJFB 5HHNA 4UIMB 4HKZA 1OAXL 1RVFL 4O2EA 1T66C 2LTQB 1JPFA 4BFGA 2LV4A 3P0GB 1S5HB 3E6FB 1QQDA 1MCJA 4YH6A 1JGVL 1BEYL 4XI5C 2BNUA 3NN8A 1FV1A 4UZGA 1RUKH 5SWQB 3F7QA 1DBML 5D7LE 4ZAKA 3NCJH 4LVNB 5JHDE 4PBVC 5F71A 1H8SA 2CO6B 3DBXA 3PQYD 1QFPA 5HDLA 3U9PH 3RQ3A 3HC4H 1G6RB 1OLZA 3GMQB 4HIIA 4P2YA 3B9KB 3ARBB 2AXFB 5HDQH 4NKOB 5FHAL 2JE8A 3ARDB 1FLTX 1FIEA 4HX1A 2OMBA 4WY7L 3VFNA 2Z35B 5C3TA 2C9AA 3GSNA 3ULVL 4MVBC 3VWJC 2ATKB 5TDOA 5EZIL 3BO8B 4M5YL 4PRNA 3WFBL 2PR4L 1BWMA 2CDFA 3VXTB 1DSFL 3ES6A 3VMPA 4JZOB 3HG1D 3VD9A 4XMKL 6FABL 3HRZB 5T1KA 2EE3A 4K2UH 4LHUA 5B21A 2BNQA 3BP4A 4YDJA 1OLLA 1QFUH 2H26A 5B3JF 2RHEA 2DI8A 4GSDL 4XX1G 4OLWH 2AJUH 3KPLB 3OXSB 2XTJE 3QZWA 5LGHL 5IBTH 2HN7B 3K1DA 4PY7B 3DO7A 3V6OC 3RGVA 1XH3B 5ADOL 4K94H 4GQ9H 4X5WA 4Y4FD 3DVFA 1ZS8A 1DBJH 4Q58C 4KC3B 2C1PA 1F8TL 4OQTH 5FKPB 1YN6A 3C6LC 5C86A 1JI2A 1GGYA 3BPOB 3Q6GL 5IVOA 1DLFH 1OD7A 2R29L 1E4KC 1MAKA 4JHWL 3U82B 3FFCD 1R3IH 3FKUS 3IDGA 2Z31B 3TVMA 3GSNL 1EFQA 3CCHB 1UM4H 2VQ1A 4Q97A 2A6KB 1O7SA 3VH8A 1FFPA 1MCFA 2FLBT 4EXKA 3WNMA 4H26B 2XXCB 2R1YB 1HN1A 1KCRL 1SEBA 1QFWH 4PIRF 3GFUA 4P4KC 4MJ2A 5C0CB 4K3DL 4U6TA 4ONHA 3BKJH 5F1SA 5CJBA 1IRAY 3VXSB 3DECA 2ZCKL 3QXDB 1MRDH 5DRZA 1M7IB 2Y06L 1NDMB 1FZKB 5CHNB 2DYPB 2H45A 3WIHL 4GBXB 1JN6A 4ZSOE 4XC1L 1FE8L 4G6KH 1AY1H 4HKBA 1U8NA 4K71C 4N5EC 3WXWL 4M7LT 4XHJD 1DQJA 5IROC 1CICB 1RIHH 4UTAH 4MB4A 3MOAH 1NCCH 2P5EA 5FCUH 3GSRA 4MDIB 3MRGA 4KWUA 5CSZA 5B4MC 5M94B 3N85L 2O61A 4O02L 4FRWA 4KK9C 1CLYH 3F65A 4KHTH 5DJCB 3PWJB 1S7QA 5F3HA 3S4SA 4N8VB 5JORB 3LB6D 4NN5B 1J0HA 5EU3B 4NBYB 5EBLA 3HZMA 3ALWA 4JLRB 2BVOB 3GBNL 4LCCA 4YHOL 2JJTC 4PYGA 4QT5A 2A2QT 4X9IA 3VCLB 3S37L 2QQKH 3H0TA 3H42L 1LO3L 2UVFA 1EO8L 4FN0A 4CVWA 3CDGA 3CX5J 3WN5A 4G6AC 5GGTA 2LE9A 1R3KA 3IU4L 1A6VH 1CYGA 1ZAGA 3B5TA 3NCBB 2Q7NA 5TH2B 1IFHH 3P11L 4DK3A 1RJLA 1JHLL 3KLSA 3JTTB 1U8PB 4R97C 1TQCC 1YY8B 1JNHB 3QDHA 1KCVH 5D5MB 3D3VA 1ZTXH 3BIBX 1MJ7H 1QA9A 1J1PL 5B3JE 2OJEB 3L6FB 1ORSB 3C8KA 4RAVB 5DJYB 5HYQB 2PTTA 4GRMB 1CXKA 2IPKB 1N4XL 1XF5B 4XPGL 4WU5A 2P49B 4YIQA 4GLRH 2D7TH 4TVPL 5DRWB 1S3KL 4OFVA 3P40A 1MY7A 5HI5D 3MLSL 3I3BA 3TBWA 5DGRA 5C08A 5I9QC 2X4SB 1JHTB 4OT1L 2GFBA 1EAPA 2ESVB 3G5ZB 1WIPA 1OSZA 4HPOL 4V1DA 4GW4A 5DLML 4O51A 5HY9B 4AENA 5J8OA 1AH1A 1ED3B 4G7VL 4JFQB 3MLTA 2VLME 4I77L 1QRNE 4NNPH 2B5IB 3MV8A 5C2BH 3RTQB 4NT6B 2OYPA 2BMKB 1NC2D 1OGAA 2QBWA 3MA7B 3DXAA 4NQCE 4ZUTA 5HJ3B 1JZ8A 4XCFH 1EEYA 1YEEL 5F7EL 4XVJH 3UTSA 5IMKB 1NGWB 2MPAL 4Z77B 2CMRH 2MHAA 2OJZH 3LD8C 3ROLA 3NZHL 2FECL 4GJTB 4L3AA 4FQIL 5GGVL 4MYWB 4EI6A 4ISVA 1A0QH 1EIBA 1BZQK 4DKFL 4NWTL 5I71C 3UJTH 2BNUB 3NN8B 5E2JA 4HJ0C 1FV1B 1F02I 3TGXA 4AJ0A 1E4XH 3CFKA 5HGBA 5I1GL 5C0RL 1OTUD 3WSQL 4JM2D 4AK1A 1XGTB 1KELL 4ODSH 1QNZL 2OTPA 3KWWB 4FQXD 4TRPL 4PJGB 4XCCL 5E70A 5EN2A 3S3PA 4O5LL 5E2TH 2X1OA 2LU7A 5D8JH 1KPRA 1TPXB 4WWID 4LOUD 1M05B 2O26U 5BZDB 5JQ6L 4ONGL 1GHFH 4POZC 5HHPA 1D5IH 3QA3A 3TA3A 3WDIA 3OL2A 1BOGA 3DIFA 4M1DL 5T5FH 3O2DH 3AU1A 5MP6L 2WWKT 3PGCB 3MLUL 2XRAH 1JYVA 3TYFA 2LAGB 3WFEH 4X4ZA 1BIIB 1NBYA 2WLYA 4LBEB 3UTTA 4F80A 1T1ZA 1YPZA 1P69B 1SQ2N 1Z0MA 2HLFC 1LD9B 3ARQA 4IMLB 2BNQB 5CUSL 2B4CL 1H15A 1IAIL 3OHXA 4WHYG 2MCPH 2R4RL 1BQHB 3QHZH 5EC2B 3I3EA 5IESL 2VLKA 3QZWB 4PJ5B 1WZ1L 1L9NA 4F3FA 4NJAH 1CZ8L 3RGVB 3ZSSA 2E27L 4XPBH 3O9WA 1ZS8B 2WK2A 2C1PB 2YSSA 4RMRA 1KEGH 2KUTA 3Q1SL 2VDMH 3F7RA 4NYLA 4HGWB 5DD5L 1ZLUK 2HT2D 4M93C 1QSZA 4HHAA 1ZOXA 3MOBH 3O0RH 3VXNB 3ZKNC 3FO1A 5DVOA 2A1WH 1A14L 4POYA 3BZFA 4RFOH 2FGWL 2XKNA 2VQ1B 5E8PB 3VH8B 5L2KD 1CK0H 3GGWB 1LO5A 3U1SL 4WO4A 2PYFB 4EQ3A 4UIKH 3CX5K 1UB6A 5GRYA 4PY8I 5TE6H 4TSAL 5FOJA 3EJYC 4PRID 4M6OH 4JQVA 3OAYH 2ICES 4LQFL 3TT1L 4CN6A 1OCWH 2MMXA 3ZT6A 1A7QH 1CFQB 1UKSA 5IR1B 1QSFA 1NSNH 4HEPG 2AJZA 3KLHC 1P4BH 3Q5YA 4ZYKA 4MNHA 5BQ7A 2WIIB 1TQBC 1TZIB 1RK0A 5TGBA 3M45A 2HLAA 4U2YA 1S78C 3C09B 1WIOA 5J9PA 1DBAL 3S34H 3D5OF 1MQKL 2P5EB 3DNKA 1Q9LA 3UZEA 2DI9A 4G7YL 3MRGB 1T2JA 5ID1A 4RIRA 3RAJL 4AIOA 3TO4A 4IRSD 4NQEA 2EYTA 5MHSD 3VFMB 5IM7A 5JW5A 4GRLD 3TWCL 1S7QB 5DJAA 2VDRL 3S4SB 3GIZH 2FL5B 4HWEL 5F1IA 1LK3L 5EBLB 3HZMB 3IFLL 4W4OA 2OSLB 3LH2H 1SYSA 4XPAH 5CEYB 4WW2C 5AAMA 2VAAB 4QT5B 3ZLQC 2WLZA 4FZ8L 2QADB 1YEKH 3ULVC 1HEZA 3ARFA 3W39B 3H0TB 3OKOA 4X5LA 4RGMB 3WN5B 4IRJA 3QWRD 2ICWA 3T0DA 3BN9C 1U3HD 5F6HI 1RURH 3P0VL 5T3XL 4CJ0A 2VDNH 5DJ0B 3FN9A 1MHEA 1QTYT 1MFEH 3D87B 4D0DB 4OF5A 1RJLB 2X4QA 5CP3A 3OGCA 1R3JB 1ZHKA 4L8SB 1F6LL 1AQKH 1VFUA 4BH8B 1QA9B 2HTLD 2ZKHH 3PWVA 3CX2A 4I4WA 4ZQKA 5F72S 3RL1A 4BSJA 2PN5A 1X5ZA 4YIQB 1AGBA 4D0CA 4K7PH 3O2WH 2RFXB 4ZAKC 3TBWB 4NQDA 5JA9A 3X3FH 5C9JA 1FPTH 1TXKA 2DQCL 4NQTA 4NRYA 2ZSWA 4V1DB 5TQ2H 3WD5H 4O51B 4S1QH 3C5ZA 2R0KL 3MLTB 3UDWA 1FNLA 4H0HB 1FRGL 2YA1A 3O11A 5I76B 5DJXB 1PZ5A 1OGAB 4ZUTB 4JR9L 1DEDA 1RIVH 4BQ6A 4KKBC 3WO3B 1G9NH 5TJWK 4NC1C 4X8JA 4JDTH 1JF5A 1F45A 4QRRA 4JO3L 1U9KA 5DMIH 1KPUA 5AUMB 1MRCH 4U31A 2KQMA 4EI6B 2Z4QB 4ISVB 3KPRD 2AEIT 3SY0A 3ECBA 1C5BH 4P23D 4KI1A 4KQ4L 4G5ZH 2IPTL 4NJ9H 3DRQA 3L5XH 4TNWF 4MD4B 4F7TB 1XGUA 3V6FA 5EUOB 4KPHL 1DE4A 1B6DA 1J05B 3RWGB 1NUNB 1MPAH 2ARWA 2DQDL 4JM4L 5IFJB 1K5NB 3PP4H 4X9FA 5E4EB 4MAYD 1JNJA 5C8JA 1AD0A 2AJXH 4NQSA 4R96A 4NQVA 4RX4D 3OAZH 5AYQA 1KPRB 4MXVF 4OIIL 3D25B 4KZEL 3UZQA 4OBSA 3BEWA 3O41A 3TN0B 5HHPB 3TA3B 3QA3B 1AGCA 2YPLB 4FQJL 4G6MH 3HI5L 1E4JA 4OZIF 3VFOA 5AWNL 3AU1B 4ZTOH 3ZYOA 2G60L 4NQXA 3ZKMD 2XTLA 2NY4C 3QIBB 1LWRA 2AJ3B 4XP5L 3TYFB 3TVMC 1IL1B 3QI9A 1ZT1B 2NXYB 3LEYL 5FO9A 1A6TA 1UH3A 1JPSL 3GNML 3X13B 3EYUL 1V7NL 4TTDC 2VTFA 5BXFA 5K9JL 3VD3A 1CGTA 1H15B 2BNRD 1CDYA 3HI6H 4O58L 3EOTH 3IXAA 1G0XA 1ZHNA 4YFDB 2ATPA 5D71H 2ARJA 3GDBA 3Q5TA 4TYUA 4UU9A 4Z7WA 4PJAA 1NCDH 2VLKB 4XVUC 3TYGL 3SQOL 4UB0H 4EUPH 4F3FB 1G84A 4U1MA 4G9FA 2YKLH 2ID5A 3JV5A 3NCMA 1N59B 1X4XA 3BXNB 3QNXA 4Z5RB 1HCVA 5IB4A 3WNOA 3ARYA 1A4JA 3GSXA 2YSSB 3FO9A 3SDDA 4NYLB 4MS8C 3MLXL 3T09A 1CLOH 3MRFA 5D7LD 5KVDL 4MA1B 1E27B 1JJUA 5E99L 1UGNA 2GAZA 3FO1B 3BZFB 1S9KC 4WNQA 1VA9A 2VYRE 3HZVB 1S5IH 2A83A 4MNGB 3L5WB 1LO5B 1QFWI 2F74B 4WO4B 3BGMA 1QSEE 4FTVD 1A6AA 4OB5L 2CUHA 2EZ0C 3EZ8A 4LCCC 5A3ID 2AXGA 4WWKA 5E9DA 3BN3B 3R06A 3AXLB 4OFYD 1U8MA 4NNXB 3G04B 4UILH 4M7JL 1LEGA 1NCTA 1JI1A 5D1ZB 3FT4A 3MACH 4Z7OF 2D7QA 1R24A 4HUXB 2AK4A 3IF1A 4JVUA 2AJZB 4LSPL 4ZXBB 4B5EA 4NO0D 4ZYKB 2P24A 5BQ7B 5CEXA 1KTDB 4W6WB 1RK0B 3LSOA 2ZNXA 4IOFD 1CDHA 4NUJA 4PB9L 4OF0A 2VR4A 4L1HA 4ODWA 4LEXH 5BVPL 3MLZL 4OLYL 4PJBA 3KDMA 1V7ML 2QKIB 1Q9LB 2PNDA 5ID1B 4CDGC 1XR9A 5DMKB 2DQUH 2BHUA 4H1LG 3TO4B 5EZOL 1H0DA 1UWXH 3EOAA 1I9JL 4KDVA 3RVWC 5E7FA 5KN5B 5FHBH 3CLFH 4WUUA 4YPGB 5C0JA 3BHBA 4F8TA 1NH6A 2GJZA 4FFYL 1IAMA 4HMCA 3QIWB 4MXVE 5FYKL 1PLGL 4Z7VA 3H3BC 1RIUL 1W72A 1P53A 3QUYA 2HFFA 4QOKE 2FB4H 2CXGA 5KSBA 3RKDC 3PL6D 4M1GH 1B0GA 4OZIE 3OKOB 3DMMA 1NBVL 4IRJB 4POUB 4ALAH 3IDXL 4BKLA 4HZAA 4WU7A 4ORZC 4BA8A 3PDOA 2X5PA 3OJDA 4XNXL 3MLWL 4A2LA 1JZ4A 4LVOC 2EYRA 4TN9A 2AJSH 5EU6D 3QIUD 1FVCA 4X9HA 2B4CC 1UACH 2BOCA 3FL7A 5AEAA 2PYED 1OPGL 5HYJB 3VXOA 3PWVB 3KPSA 4WHDA 4GLRI 1MCPL 4L29A 4C56A 1IGMH 1AGBB 1RUQH 5D6CA 4G6JH 3T2OA 3ZKQD 4DOHB 2X4UB 2X1XR 4UQ2A 3TIDB 4RQQA 4JFFE 4R90H 4U1NA 4YO0A 1D6EA 3L95B 3R0NA 2FSEA 3GIVA 1BQLL 3L5HA 3MXWL 4JZJB 4OCMC 5HYSB 4FS0A 1RZIB 4GXUM 1A6UH 2FHCA 2VSDA 3N1MC 3C5ZB 2F19H 1T7XA 2DLGA 3GKWH 3RJQB 1OM3L 4BSVA 4FFZH 3C8DA 4XAWL 1BF2A 4GQPH 1FNSL 4RRPG 4HZLB 2FIRT 2GI7A 4HWBA 3DUSB 4DGVL 2YZ8A 3U7AA 5ICYB 3NPSC 4AEHL 4ENEC 2WANA 2H2SD 1DCLA 2XNAA 1OARL 4X8JB 5L9DH 1Q9WB 5J89A 2O5YH 3AM8A 4LCIL 1PJ9A 1J5OL 3TZVD 1KPUB 3EO0A 2GYSA 2HJFB 1WBZA 3QDJD 4PJFA 2DWDA 3LKRB 3NGBB 5T1MA 4PJ9A 5AYUH 3MFGB 5TDNA 3ECBB 3DVGB 3D0VB 1E4XI 1YDPA 3IDYB 4Z7OE 4L3EA 4I0PA 3P77B 1XGUB 3JXAA 5SX5H 5ESAA 4RGNC 4X8XA 3SDAA 1DE4B 4HIJB 3W2DL 1VDGA 5H94B 2ZUUA 4HQQL 3KPMB 1KJ2H 4YFLI 4G8FA 32C2B 4EOWH 1G9EA 1I3GL 2A77L 3QPXH 1GCFA 1G7HB 3OKMB 3OX8A 1IEBA 3CFCL 4ETYA 1RUMH 3UXFA 4JPWL 1YEGH 3O9WC 3O41B 5J3HC 5TFSL 4I5BA 3MMEA 2YD7A 3D2UD 4Z7QF 5HYEA 5JNYB 5HHQA 3RVXD 2AW2A 1EFXD 3QH3A 4S1RH 3I02A 1JP5A 1I1AD 1A6TB 4WDIA 4PP2A 3HZKA 1I7RB 3CZFA 4QGYA 2C3VB 4MD5A 5BXFB 2YD4A 4NQCD 1IEAA 2X9YA 7FABH 4LSUL 3IXAB 4ZFFB 1MI5D 2ATPB 5DC0A 1YA5A 4P3DA 4JFOA 4UU9B 3TNNB 2VDLH 2OTWA 4DFHA 4HFUH 5E5RB 3L7EA 3KPTA 4LCWE 1HHKA 4L4JA 5GZNC 1R5WB 1FJ1A 1FYTA 3KJ4C 4OD3L 4U1MB 4ODXA 1KENL 4Y4FB 2HVJB 3FMGH 4L3CA 1NCBL 1CU4L 4HUWA 3H6JA 2G2RB 3QNXB 1GZPA 4HWUA 5SWZA 2CO7B 3BWAA 2NX5A 3QEHB 5C0BE 3N06B 1AJ7H 5BO1L 1I8KA 3IB4A 4K9EL 2CLZA 3G5VA 1TDQA 3FFCB 4YHIB 1JCKA 2UWEA 4YK4C 1HKFA 5JW3L 4G6FD 5CGYD 1DBBH 4WNQB 4JO1L 5L2KA 2WBJD 1MHPH 4PJHB 4KJQD 3TBYA 3T4YB 1FORL 4NGHL 5AZ2H 2DBJA 4YFEA 3RVUC 4LSDA 4W4OC 3PV6A 3V6ZA 1S9VA 3W5NA 2IH1A 2VLRA 4YHPA 4GG6F 4S1DC 1L9MA 4JDVB 4WWKB 5D7KE 5DS8A 4NWUL 5EIIA 3E2HB 3O8XC 1Q8MA 3QQ4A 4KUCD 3ARFC 2DL2A 1U8MB 1LEGB 3BWUC 3H9ZA 1X5YA 2F15A 1FAIH 5LGJA 2AK4B 1CDIA 5EO0B 4D3CL 2P24B 3ZYIA 5IJKC 2Q76A 1BBDL 4NUJB 5B8CA 1LEIB 3FAWA 5C71A 2VE6B 2D9QB 3MJ9H 4XB7A 3T4AA 1A3RL 4Y5VA 3QXTA 4PJBB 4HT1L 4JREC 4PRDA 3VRLE 4F33B 1FHGA 4HS6A 1H3PH 3QXAA 4ZUVB 1MFBH 1KIUA 25C8L 4NSKB 1XR9B 4I18C 3UTOA 1I7ZB 3PWPA 2MKWA 2V9RA 1B4RA 5HVHC 2PXYC 1J0KA 4OUOA 3GHEL 2AEPL 1CR9L 5L7XL 3BHBB 4TTGA 1N6QH 3QEQA 3QUXC 4FQHB 1LDSA 2Q8AL 1YEHH 4Z7VB 1BWWA 3DJ9A 3MUJA 1JWUA 4KUZL 1SJHB 4CRPA 4JO2L 1MVFA 3ARGA 3GI8H 5E6ID 1RZGB 1LEKA 4Z7QE 1G7QA 4PFEA 3GSQB 4LVHC 5KSBB 1B0GB 4PJEA 3DX7A 1MLBA 2HFGL 2EIEA 1AD9B 1T5XB 3EKCA 4LF3B 5CEZL 2IFFH 4M43L 4BKLB 3EGSB 2GQHA 3TO2B 4HC1H 5IP4A 3PDOB 1N5YH 1HHGB 3ULSB 4GRWH 3GRWL 5HI4C 5DA4A 4LLUA 3DRTB 2JK5B 2P7TA 1FVCB 3VXUA 5ICXA 5I6XC 1QVOA 4YXLL 2FJFA 2BOCB 3P73A 3T1FA 1K8DB 1DVFA 3VXOB 1K8IB 1LO2H 3H9YA 5JMRA 3LN4A 2ENSA 3SGEH 3FQRB 3I2CH 4JRYA 4ZO6A 5EU4A 2IALA 1LMKA 5T3ZD 4U1NB 1YN7A 3NACL 4YO0B 1D6EB 4Y2DA 5I15H 5HHOA 1NMCC 5D7SL 1JUFA 1FL6A 1BPVA 4PJCF 2NY0C 2EDHA 3QHFH 4HJGB 4U6XA 5DF0A 1CFNA 1MAMH 2BFVH 3QEGH 3A6CL 4BSVB 4F2MB 3V4PH 1JF6A 5LG1A 4WJ5A 2B1HH 4C58B 5FA4B 1JK8A 1G7LA 1IM3B 2UUDH 3BH9B 3FB7A 2GCYA 5DQDL 4GG6E 4ZDHB 5T33H 1KTRL 3EO0B 4PJFB 5DJ8B 2DWDB 3QI9C 3S96B 4P23A 2XY2A 5T1MB 5K9QI 3B43A 5TDNB 1UQSA 5IV2B 1YDPB 2H1PL 5GS0D 4HBCH 1NJ9A 5DHYA 4BSWA 1INDL 3MRJB 4I0PB 1JPGA 3IKCA 4PGCA 4JM2B 4JHAH 5DD0L 1YEDA 1ZKAA 1AO7E 3QAZB 4FQXB 3FO2A 4BK5A 3T77B 4H1LA 4OZHB 5DRXB 4NRZA 4OCYH 5I73B 3VW3L 1A7OL 3REVA 3NFNA 1UCBH 3C2AH 4DFIA 2EEDA 3BJLA 3MYJB 3BSZL 2DIBA 4I5BB 1IVLA 4MJ4A 1PG7W 5F9WC 2FCBA 4Q2ZB 4JY5L 3SDDC 1IAKA 2BSTB 5E6ZA 4MAUH 2ICWJ 5HHQB 2J6EL 2FWOB 3QH3B 3T65B 5EORL 2B7DT 4BFIA 1UT9A 3T0EA 4OTXH 4NNYA 4QRPA 4QXTA 4G3YH 1A6WH 1IGIL 1GAFL 4PP2B 3DLQR 4APQA 3GZKA 5HHMB 1EUUA 3SHSA 5J56B 5DRNB 3BD4A 4MD5B 4HF5L 2B8OT 3PP3K 4JFXB 1I9EA 3W11C 4PRBA 3CSYB 4JKWA 4PYHA 3FFDA 4JVPA 4RFEA 1CGUA 2CKBL 4JFOB 4PTUA 4QRTA 3VJ6B 3V6OE 2OL3H 2Y5EA 4X6DF 1RZFL 4R8WH 5IB2A 1XAUA 4LHJB 2A74A 3T1WA 4ODXB 3ZMRA 4HGMA 1HYSC 5F88A 1D5MB 3Q3GB 3KPPA 4DGYH 2VZTA 4XCYB 3WFZA 3DETC 5C0FA 4R7NA 2X6MA 2GT9B 4ODTH 5D7LA 5JHDA 3BWAB 1DP0A 3FTGB 1I8KB 2CJUH 1NL0H 3DOSA 3QB7C 3VFSB 1JPST 4U7KA 4YJZL 3OJVC 2UWEB 3FRUA 5BZWA 1Z2KA 1GZQA 1NANH 2ZJSH 3DTXB 3P2TA 3FB8A 2X7LA 4UT7L 5L2KB 4YBLB 3QNYB 3TBYB 5KAQF 3FQNA 3MRIA 4PJCE 2BSRA 1U8OA 4M6NH 1GYAA 3V6ZB 1F4WL 4PRIB 4LNRB 5BMFH 2F5BH 4GKSA 2VLRB 1E4WH 4YHPB 2NNAA 5HVFB 1RJYB 3QUYC 1FNEA 4X6CB 1S7TB 2QHRH 3QQ4B 4HMEA 3L3GB 5ANMB 3RJDA 2Q87A 3GSVB 2V5RA 3THML 4KQ3L 1RUKL 3MBEA 4CMHC 1B3JA 3DMMC 1TZHB 4IMKA 5LGJB 1L4IA 1LE9A 3SE4C 3UYPA 1CWVA 3NCYS 3LQMA 3LHPH 1INEH 4M6AA 4YBQC 3U9PL 1EK3A 3P30H 2IAMD 4RISH 5B8CB 2IC2A 5HVWA 3PG2A 3HC4L 5E5UB 3T4AB 4OJFH 3UTQA 1BJ8A 4PRDB 3M07A 3O6MH 1OAQH 1XFPA 1IC7H 4ZG1A 3F7YA 4OF8A 4X6EB 5EU7C 4GRLB 4U0RB 3I50H 2E3VA 5DA0B 1MNUH 1I9IH 5ESVB 3CXHJ 3EJJX 5IEKA 5DMGD 3LZFH 3MODH 3X11A 2IEPA 4M1CD 5EOTB 5F8QC 5F1OB 2H6PB 3HE7D 1BF8A 3L1OH 4LLAA 1J0YA 4HPYH 2NW2B 3U6RA 1D9KD 1Z3GH 2N56A 4O4YH 3MV9E 4NKQB 3U0PB 4DGIH 4U1IB 4K2UL 1LEKB 1BFOB 3QUMB 1G7QB 4QEGA 1EBPA 1P5UA 1FG2A 2CRIA 2C7UA 3DX7B 1QFUL 4ODHH 4U0QB 3TH3T 4DW2H 1CD9B 3TBTB 3K46A 3ARED 1U3HB 4JO4H 4OLWL 2AJUL 1FO0H 2BJMH 5LBSH 1JRHH 2P8PB 2VJXA 1M7XA 5INCA 4JKLA 1AGFA 4LLUB 4K94L 4GQ9L 2PTVA 3L3OB 2P7TB 4XH2B 1NAKH 1QVOB 3AM8C 2FIKA 2FJFB 1YNTB 4M7ZC 1DBJL 1AKJD 4RA3A 3UJJH 1BLNB 2W9EH 4OQTL 2WUBH 1CQKA 2YPVH 4ZSOA 4X6DE 4PJ9C 4GW1B 1ZLWK 2FH6A 1DLFL 5JUEL 4MZ3A 3LKPA 2J5LC 2NY6C 4YZFF 3RDTD 3LN4B 1MIEH 2XACC 2Z8WC 1UM5H 2F53E 1MFDH 1R3IL 1A1MA 4GAJH 5C0IA 1G7IB 5GGRA 1U0QA 2W0FB 4K7PY 3SDAC 5F7NC 1UM4L 4HCRA 5A16A 2HP4A 2A6JB 2XA3A 3ZE1F 2CIIB 4U6XB 1QFWL 3BIKB 4K9EC 1T1XA 3GK8H 4LKCA 5I1HH 4YC2B 3BKJL 2CXKA 2D31A 1V3KA 2AXHA 4WJ5B 1JK8B 5C0DA 2H2PD 3B2VH 5C6TL 3FB7B 2GCYB 5ERWA 5FGCB 1KB5A 4FXKA 4G6KL 5C3LD 1AY1L 1HHJB 5A2JH 1KUMA 3KPRB 2UY7A 5JPMA 1C12B 3REWB 4P23B 1J8HE 4N0CC 1RIHL 1VENA 4UTAL 3MOAL 1NCCL 1P4IH 5JOFA 1HQRA 1Q9OA 1ZE3C 2R23A 4IIQA 4UV7H 1EEQA 1NJ9B 5FCUL 2AJVL 1ZT4B 1L0QA 1N0XL 4YDLC 5D7IF 1OP5K 3TJEH 3U0TA 4OAWB 4KHTL 4MAYB 5CSGA 3FO2B 1VFOA 4WW2F 3WEXA 4XVTH 2VDKH 2YR3A 1XGYH 5CJOH 3K4ZA 1MCQA 2MNUA 2JKXA 4JDZA 3ULVF 1J8KA 3QCVH 2N7AA 3PJSA 4HCRL 1WZKA 3TFKC 2QQKL 3BRGC 2AEQH 3BP6A 5I74C 5EBWB 4HWZA 3VWKD 1UEYA 1A6VL 5DYOA 2JF1A 2X44D 4BFIB 5D2NB 1QRNA 4QXTB 1KFAH 1KCVL 4NQCA 1ZTXL 1MJ7L 2BNRB 5I75B 1WGOA 4B0MM 1ZVHA 4GAYA 2O93L 1JGDB 4XWOC 3FFDB 3VA2C 4MJ6A 4J4PA 2Y7QA 4UDTB 4CADA 4ZUUA 1BIHA 1OWWA 5IB2B 1T20A 4UOJA 1EBAA 2JB6A 1N7MH 4JJHA 2VKWA 5DD6B 5DHVH 1S9WA 3T8XB 5MEQB 3KPPB 4ORGA 5FK9A 5EOQH 5D7LB 1MLCA 2DAVA 4YZFE 4NOFA 4NQUA 1X5JA 3CXHK 4Y5VC 1ZLSL 3SKMA 1NC4D 2PO6A 3B5GA 5C2BL 3MRHA 5JW4N 3L3HA 5F97E 3HLAA 1GZQB 4PGBA 1CVRA 4FXGA 3ZE1E 2BSRB 5CCKH 5IMLA 4LARL 1QLFA 2OJZL 3WIIH 1YEIH 1RMFH 4KJPD 1NUFA 4HSQA 4IOSD 1S9XA 1A0QL 2NR6C 3MRNA 4OLZH 3C60A 3FT3B 1K2DA 3ARGC 5HXMA 3UJTL 1KXQE 3DGCR 4P2OC 5DJZA 2FO4B 1E4XL 4NO0B 2OL3B 4PRPE 1LE9B 2BY0A 4OSUH 5C07E 4X4XA 2BX5A 4ODSL 4XNMA 4KAQL 5HGHA 1KTLA 1N3NA 4P9MH 4MD0A 4FG6C 2IH3A 4YNYA 5E2TL 4JGJA 1IZKA 1J18A 5IMOA 4QTHA 3RVTC 5D8JL 1GIGH 2GTZA 3IRPX 4XZUA 5D7IE 1SJVA 1RULH 4P57B 5E2VH 5F3BA 1Z0NA 3QQ9D 1GHFL 1T83C 1DVFC 1TVBB 1HOCA 3OPZH 1KLUA 3FO0H 1EJOH 4OCWH 1N0LA 1T3FA 4LSRH 5T3ZH 5T5FL 5IEKB 4JQIH 1P84J 3V52L 2XRAL 4XWGL 2CGRH 2VDQH 3ULVE 4JFYB 1H3UA 3WFEL 4QWWC 5C0BD 3U6RB 4NM8H 3UO1H 4Y2DC 1TTUA 5ITFA 3PL6B 3MCKB 5MENE 3U7YH 2B5IC 5EOCJ 3MRDB 1CFSB 2X05A 1BP3B 2OTUB 2YD6A 2DQFB 4AT6B 5GS1C 4JRXD 1I8LA 3WKNA 2MCPL 5F6IB 1CXHA 3VG9C 4ODUA 3QHZL 1IKNA 4DVRH 4JN1H 3OG4B 3NCEB 2DQGH 5B22A 2P4AB 1FGVH 5EH1A 4DJMA 5F9AC 4NJAL 2W38A 3DYMA 4KRPD 4V2BA 1ZWIB 4NHUA 4XPBL 5GS0H