1YNTA

Structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
213
structure length
213
Chain Sequence
DIQVTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4F11E12 Fab variable light chain region
publication title Crystal structure of the complex between the monomeric form of Toxoplasma gondii surface antigen 1 (SAG1) and a monoclonal antibody that mimics the human immune response
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 49
structure length 213
sequence length 213
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yntA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yntA01
4U1LA 3SKOA 5MEQA 4KAQL 1N6UA 1TCRA 1NKOA 1IGIL 3NTCL 1G7QB 1P84K 2CH8A 4Z7QF 5EC1A 3JWOL 3PWJB 1MCOL 1YNTA 4XP6L 1F3JB 3FRUA 5C6PB 5IESH 1A3QA 3QDGE 2G5BA 4OZ4B 5C07B 2ATKA 3O9WB 1K4DB 5F8QC 1CZ8H 1KTLA 2DN7A 5HBBA 3MRLB 5GS1C 5KSBF 1DN0B 3MUY1 3PGCA 3HRZA 2DTMH 3R1GH 1F11A 1DN2A 5I16B 3DTXA 3MC0A 4JZJC 4Q9BA 3TT3L 1IC7H 3SO3B 1KCLA 4JZOB 3RU8H 4EEEA 3DXAA 3CPLA 1BZ7A 4JG1L 3ZYJA 3KPOA 2IC2A 5ALCL 1PYWB 4KI5D 1YEKH 4ZNEE 4DGVH 5B21A 3O4OC 4LSSL 2CK2A 2J2ZA 1QYGL 4JKMA 4PGBB 2B2XH 1BQHA 4PB0L 4QXGL 3DX9B 3F6LA 2EYTB 2X10A 1VFMA 4WEUD 1NFDB 5FB8A 3O8XC 3ARFD 4KHXL 1YEGL 4WHCA 4LSTL 2NPLX 3MXWH 4HHAB 3LQAC 1PY9A 4LDEB 3VFPB 4AK1A 5KVGH 2DBLL 2WQRA 1UEMA 1H9VA 1MPAL 1EUTA 1I1AA 3BT2H 3HE7A 3IDJB 4QRPD 3RUGF 1UKSA 3ARGC 1AGBA 1RK1B 1W72B 3QPXH 4PJAF 3VFTA 3LD8B 1G9NC 4HKZA 5KOMC 1HXYB 2CLRA 4RMTA 4RSVA 1JI2A 1LK2A 4UBDC 1FP5A 2F53A 5C0NC 5E95B 5DRNA 4FFZH 3SDAD 2UWEB 1MCRA 3C60B 1KPRB 2B4CH 2XZQH 4OLUL 4L29A 4OCRL 1F02I 3FFDA 2XA8H 1UZ8B 4HKJB 3IAQA 4JFFD 5H8DA 4AIZB 2VDMH 3BP6B 1QFWM 1CL7H 2ORBL 5HVFB 3DROB 5TQ0H 1FC2D 5E00B 4L4TE 1BX2B 4N9OB 5ACMA 3MV9A 2HJLA 5D6DC 5I8KL 3WNMA 1I9JL 3DYOA 2B1HL 4NZUH 4W70A 5DRZA 5B8CC 1RQ5A 3IDYB 5E2VH 4X6CF 5HGDA 2FJHA 4IS6B 1ZKAA 3JTTA 4LF3A 3ILPA 3PL6A 1F4XH 2DWDB 3VRJB 1E6OL 5GRJL 2A9MH 2Y6SC 3LS5H 4FZEH 3HAEH 3QFDA 1V5JA 4XVTL 5HDOA 3ZTNH 1XGRA 1M71A 2ZUXA 2ZG3A 3ARBA 4KUCF 1KTKE 1KTDB 4ELKA 2MKLC 4GG8A 5D8JL 4MA7H 5D1QC 4ZPTA 4IOIB 3Q6GL 4ZAKB 4WVRA 1QLRB 5T1LA 3QDMB 3QJFB 4X7SL 4LHUB 5JOPD 2VN7A 4MNGE 3LKQB 3LEYH 1MCHA 1N5AB 2DWEA 4BKLB 4W81A 4KRPD 3K2UH 4UINH 1WSST 4X98B 4FABL 1L0XA 2GJ6A 2XWTB 5DJZA 2XPGB 4FP8L 5HHNA 4LLWB 3T2PA 3F7PC 5TE7H 5FA3A 2B39A 4Y4FC 4X8JB 4M93C 5GSRA 4P2QD 1YEDA 4LKXB 4HMEA 4PPTA 4EN3A 4YQXL 5CEZE 2VZOA 5F6IC 4Z0XB 2RBLA 2GW5A 3B9KA 4X7TB 4PJ9C 4U6YB 4KJYA 3LPGA 1GJIA 3O45B 4G9FB 4KK5C 4M00A 3NCJH 5IFJB 4MXVE 1CQKA 4LLUB 2YPKA 1R24A 1FLTX 1ZHLA 1T1XA 4K7PY 4NSKA 5DD6A 2YD3A 1TJGH 3O6ML 4HWUA 3ZHLA 5D7IE 3VXME 1UENA 3QULA 3TBYA 2NY2D 4HXAH 2DQEH 2I9LA 4ZS6D 5FYJL 3DBXB 2X4UB 5C9JB 1NQBA 3VXQA 5JXAL 1A4JA 3IDUA 4RMWA 4AENB 3LZFL 4ZUUB 2DQFB 4GFTB 3CFJB 1WTGT 3GI9H 3U48A 4DWHA 4F7CA 4R7DB 2IG2H 5F7HA 2OQJA 3VXSD 4GQ9H 3LMJH 4OLYH 3DUSA 3ULUC 1FGNL 2F54A 5D6CB 4NBZB 3O4LA 3MLVH 4OFIA 1UH3A 4CW1A 2DLTA 4MAYC 5IW1B 4ETQA 4WU5B 3K8LA 4PJCB 1XF1A 3ET9F 3FHQA 3R0MA 3P4MA 1T22B 3AXLB 4QRRA 1CGSH 2DIJA 2I5YL 1IEBA 2P8LB 1I3RA 4NO5A 2CIKA 1KPUB 3OKDB 1PJ9A 3CDCA 1FL6A 3QRFM 5HPMB 2UVEA 1ZVSB 4C56B 4BELD 1MEXL 2F15A 4M8VA 1HZHH 3OKLB 2ITCB 3FZUC 2C1OB 5IK3A 2DB8A 3Q5YA 1NFDF 2XN9B 2WANA 3OZ9H 4OD2B 2NXYB 1RIHL 4ONFL 5DZOA 5C0EA 1CXLA 3IYLW 2ZOKB 5C08A 1S9YB 3UTTB 4UNUA 4UUJA 2X7LB 5BCAA 5I1DB 5HGAA 4ONOA 3QQ9D 4JPIB 1N59A 2O93L 3AREC 2ICWB 3U2SB 4GAJL 3ULVL 4Q58C 4H0HB 2UWEF 3LEXB 1MIMH 1AHWA 2BNRE 1W0VB 5KSBA 2BNUA 5KANG 1IKFH 2O26U 3OKOA 3UPAA 2NW3B 5CSZB 4GW1B 3RVUD 1RUQL 4H8WC 1S7QA 3UBXI 1A3RH 4FRWA 5D2NB 3TNMA 1MRCH 3SJVD 2ZSVB 4PS4H 5F70A 1GVIA 2C4FT 3GMOA 3FFCD 3EBAA 3GSVA 1O5DT 3LDBC 3P9MB 1D5ZA 3IDIA 4YDLB 2VLRD 3ARTA 3I3BA 4Q9QL 12E8L 1QFWH 5CD3B 1OAQL 1QG3A 4P23C 3QIWB 4LCCC 4JKLA 1YNKL 4NUJA 3T8XB 3DGGB 1GGYA 1ZLVH 3HUJB 3RIAF 1DL7H 3DWTA 4FTVD 1H3WM 1CFVH 4KI5E 4QT5B 3EYUL 1BOYA 1E4KA 3FONB 4YFEA 4UTBH 3KPRD 3T0EA 1XGQA 3T77A 1I7TB 1GGUA 3MREB 1Y6NR 2YN3A 4PJDE 2EE3A 2NTSP 2BVYA 3UJTL 4UV4L 4OQTA 4X6FB 5DFWH 2EYRB 5DJXA 3WNLA 4JDZA 3AU1A 5BV7L 3VA2C 5L0QB 4XRCB 4MA3B 4PJEE 1EEQA 1TZHA 2C3VA 4Z78A 1DFBL 3OJVC 2YOCA 3QCVH 4NFCA 5E5UB 3HR5A 2CKBA 3TPKA 4P4KA 2OK0L 3GB7A 3AAZA 4QRPE 3UTZA 1JZ5A 5I1GH 1A6ZB 2FECL 3G6JE 4FFWC 3VGAB 2DKMA 2ERJC 5IR1A 1FFOB 2AJUL 5IQ9A 3T4AB 2N1KA 1HHIA 3HPJA 5EH1A 1KYOK 4Z76A 3V6OC 4OI7A 3BPOB 3I02A 1KULA 4KWUA 3VI4E 4JFXA 4CGTA 2VLLB 2NZ9C 4MD4A 4KDTC 4J3UA 9CGTA 3QRGH 4FFYL 4DCQA 3K7UA 1WBYB 4XCYA 3UX9B 3U0TA 3OGCB 3H9SA 3MNVB 5JORB 4PJ7E 4DZBB 2FZ3A 4PY7B 2L7UA 1NGQH 5HYFA 4HH9A 3BPCB 5D70L 4X6DE 5JDJA 1BGXH 3S3JA 1DANT 3CVHB 4OZHB 2GJZA 4LIQL 4QTIL 4PJCF 3OJMB 1EAPB 4LVEA 4WJ5B 3WBDA 5CJ5A 1G7JA 3CVIL 3FB7B 3V95A 1DEDA 2IADA 3OQ3B 1TJIL 5I76B 3D39D 2DD8L 1P7QD 3WD5H 5IJKC 4FG6C 3C5ZA 3MBXH 4GRLD 4JY5H 5JOPE 5CHNA 3D3VA 4ZXBC 1CLZL 1Q94B 3OAUH 3OR7B 1MNUH 3K2MC 4WO4B 1AXTH 5MEND 2BVPA 4OSUH 2OR9H 1OWRM 4BFIA 4MD5B 1U9KA 2VWEE 3Q3GB 1KCUH 5JW4M 3BI9X 2FJFA 3C87A 5EO0B 4GAGH 2JIXD 1XCTA 4O02L 4P2QE 5F9DC 3T4YB 2R56H 4LLYB 5C0DB 4XPFH 4AEIL 1X5GA 5CZXC 1I9IL 5KVDH 1RJCA 3IS1X 1CLYL 5CWSB 5MERB 3VMNA 3NZ8A 1VGEL 2PUQT 4U1SB 2GAZB 2HMID 3VFGH 2AJSH 3CX5J 3DMMA 5CJXC 5JQHC 3LN5A 4G8GB 3W9EA 3H42H 1BIHA 4MS8D 3MNWA 5A16B 3BSZL 4TVPL 3FB8A 1MI5B 5D5ME 4JZOA 5ALBL 2PCPA 2O5ZL 4OIIL 4Y5XB 4MJIB 1BWMA 4ZQKB 3MJ8A 1N6QH 2NY4B 4R6UA 1WBZB 1N8ZA 2XV6B 1SBBA 5LAXA 2DLIA 1LP9B 1DVFC 2D03H 4H26B 5GGVY 2D7OA 1IZKA 4Y1AB 1A6WH 2HKHH 4D0DA 2BCKA 4JRYD 4WCYL 4JANA 3SCMB 3TH2T 5I8EA 1P4LB 4PGEA 1Z9MA 3D85D 2EYTA 4WNQB 3IVKA 1DBJL 3HUJF 2H1PH 3ISWA 2WK2A 4ODVL 1UGNA 3WL9B 5KS9E 1FO0H 3FQRB 4HHAA 2GJJA 1A1MA 5DMYA 2BSED 4HQQL 3WLWC 1JGUH 3MFGB 5ICZA 5JW5B 5GGQH 5DUPH 2XYCA 4TQEL 3C6LD 4AM0B 1JBJA 2VL5B 3KR3H 4X4YA 4UIKL 4KJQD 4JZJB 5DI8A 1U3YA 1FRGL 2XICA 3EYFB 1HXYA 5GGUA 2FGWH 4DW2H 3TNNB 2N56A 4LCUB 4PUBL 1KPRA 1TETL 1A1NB 2ZP0T 5GZND 5EU6D 3P2TA 2W0FB 3BP6A 4P2RD 1U3HB 1PD6A 2X4RA 1JL8A 2NY1B 3W5MA 1MHCB 4OKDA 5D7LB 4JKWA 1UC6A 1BX2A 4XNQB 3TCXA 4N8VG 1T89C 3X11A 5SWZB 1AE6H 1DBKH 3NA9H 3O8XB 4DK3A 4L3EA 1CLOH 5FM8A 5I19H 4DN3L 1WCBA 1EERB 2EDXA 2XKNB 4Y16A 3DVGB 2UZIH 1WEJH 4IS6A 4CVZA 4RGMB 4HF5L 4GBXA 4NC0B 2NTFB 1YEIL 1KB5H 1AKJB 3ARGB 1XF3A 4AH2A 4QHMA 3GBLA 4JR9H 1K8IA 2MPAH 3QR2A 3KPLB 4W4NA 3HG1D 5EN2A 1A7BA 5JW4Q 2D3VA 3O2DA 4NQCD 3VFWB 3I6KB 5AG9A 3BEVB 4CN4A 3TN0B 4P59H 1MHHA 1DANU 1ONQB 2AABL 4IOIA 4Z5RB 2G75A 3TH4T 4Q9CA 3RDTB 5FEBA 2VXQL 4WTZA 4Z6AT 4JFQA 5KTEL 4OZHF 3RX8A 2AV7A 4LVOC 2VDLL 3P4NB 2GIYA 4EUPB 4FTVE 3GSRB 3CFCH 4ZFGH 1DUZB 3EOTH 3I9GH 4NRZB 4NZDA 3MUZ1 4X6BB 1A22B 5CEXB 3D9AH 2Q7YB 4YDKH 5EOCH 4N0FB 5HYSG 1ZVHA 2Q76B 3NPSC 3C6SA 1JPTH 4JKPH 4NKMB 4G6JH 3H8NA 3MYZA 3TGXA 4R7NA 4AJ0A 3BN3B 3RA7H 3WS3B 1N2RA 3GKWL 4G9FA 5D96C 4Y4KD 4OLEA 4MAUH 4LLUA 5ENWB 5IBTH 4M03A 3QBTB 1NMCC 2DRUA 3TZVB 5FCSH 3MRPB 2DM7A 1S5IH 5D1QB 3V5DA 1AQDB 2GK2A 1UZ6F 1CE1L 2Q3ZA 2YUZA 1VKXB 4Z95L 1MJ8L 1RIUH 1A1OB 4JRWA 3L3JB 5LJYH 3S97C 1FNGA 3WNPA 4EI5D 3RL2A 4KJPC 5DHVB 4LRIA 2BERA 4AMKL 1I8LA 2NY5H 1HNFA 5D6CA 4Y5YB 1EEZA 3CSYA 3UZQA 3FO0H 4K71C 3MOAL 2HFGH 3U83A 1QFUH 3QDJA 5I15L 2P8PB 1FCGA 5E1AB 3OTTA 1RPQA 2ADGB 4KUZL 4PJ9B 4FOMA 1G6RL 5GHWH 1H8NA 2F5BH 2XRAH 3NACH 3MV7D 4GXUN 4Y19B 5HDLA 4KK9C 2XTJB 3ESVF 4R26H 5I9QB 1MAJA 1LP9F 4OLZH 1GGCL 3V4VH 1Y18A 3MACL 3MCKB 1HEZB 1MVUA 3W81A 1YQVH 3VWJA 3AY4A 4UOW1 1IC4L 3O2VH 2IANA 2OJZL 1ND0B 4WUUD 5EU4B 1JI1A 1JNHA 2FNBA 2XN9A 4U1KB 1VADB 4U6XB 5HYQB 4OZIE 1JGLL 2VR5A 3L3GB 3B5HA 3HTLX 4G8IA 5CINL 6FABH 3PP4L 4ACPA 3D39E 5GGRY 2ZOKA 1HOCA 3UJIL 4YWGL 4U1HB 3O6LL 1EHLL 3CX2A 3GSUB 4F7TA 3BRDA 5I1DA 4AZ8A 2BOCB 2DQTL 4HWBH 1E4WL 1OSPL 4TULL 5IB5B 4JPIA 1DQLH 1T5XB 5C0GA 2W60A 5MENE 2DL9A 4ZFZB 2WINA 1U8NB 5B39A 5IOPB 3H9HA 3I6GB 4OCLC 1U91A 4LPVA 1MFBH 4JVWA 4RQQB 1YQ2A 2NXZD 4F8QA 5JIPA 3RTQB 2H26B 1GOHA 2GTWA 5JO5B 5SWQB 1JIBA 2L4OA 2ZSVA 2HG5B 1UJ3C 5E56A 1J88A 5GGVH 3VXRB 1A2YB 3PHQB 5DD0L 4HJJH 3GIZH 1MY5A 1XF4B 4JFPA 4QOKB 3H3PL 3MA9H 4BQ8A 4FHBD 3UZEA 5HHMD 3L3DB 1UXWB 5C0JA 4NNXB 5CD3A 1MHPL 1J9CT 4L5FH 2VH5L 5IUSA 3KYOB 1IKNA 1DE4A 3UO1L 1BAFL 4OZFB 4YX2H 1DQQA 2O5XL 1JGVH 5IT2L 4C54A 4KVCH 1PKOA 4L8SA 5J89A 5ESAB 1SVCP 3IU4L 1FFPA 1P2CA 5MEPA 3G6DL 1H3UA 3KLAA 1YEJH 5BVPL 3V4UL 1PZUB 1OGAA 4PRDB 4JRYE 3W11D 3VWKD 1Q72L 5AYUL 4NQVB 4DVBA 4YFLF 3QUZC 1MOEA 3QNZB 3MRMA 3MCLL 5IKCA 3B9EA 4JM4L 1MFCH 4GJTB 5KZCD 5FECA 4K8RL 1FPTH 4J8RB 2C3WA 1DQDL 1G7MA 4X80L 4RZCB 4Y5VC 1UEYA 2DQDH 4H25A 3WIHH 2PTUA 3GMNA 1MWAB 1SJXA 4PJ5B 5L7XH 2MTPA 4JJ5A 1KACB 4H20L 5C0RH 5JR1L 1RZJL 3O2DL 4IRJD 1JGEB 3PGFH 4ZUWB 3MRIA 5F7EL 3UYRL 3T4AA 1O7SA 5BQ7A 3RJQB 5EU6E 2VZ3A 3O3BA 3GSNH 4YHOL 5DFVD 4P2RE 1N5YL 1L7TH 1PKQB 2I9TA 3MV8D 3ZDYF 1XR8B 5BXFA 2VLLA 3BAEL 1NEUA 1NC4A 4IRSC 2QHRH 2R9HC 3O6FD 5KSAA 1VERA 1BQHG 3GM8A 1IAIL 3MJGX 4PRBA 3BEWA 3NCYP 2BY3A 2V5YA 5F7DB 4GKNA 5EZLA 5FYKL 2Y7QB 3BPNC 2EEAA 4Y89A 3MFFB 1M6OB 3GGWA 4PY7A 2OTWB 4GUPA 4GAYA 1T7XA 3NFSL 3BPCA 1DBBL 4CDGC 1A6PA 2EKJA 3UBXA 4GO6B 2X4SA 3HZMB 2VDRL 1U8LA 2V7HA 4WJ5A 4U7SA 5JIHA 4YPJA 5IB1A 1FNEA 2F8OA 4TPRL 5E08H 4YBQD 1OAKL 1JRHH 4KMTH 3ZKSD 1AP2A 1MLBB 4P49A 5FUOL 5IM7B 3RI5F 3F7YB 5E8EB 3C9NB 1JYVA 1FVEA 1UM6L 2OI9C 3S36H 3NOIA 1X4XA 4JFDD 1XGUB 4NKDA 1WFTA 4PRNB 5FFLA 1J0IA 3N50A 2XY2A 3QI9A 4HUXA 4JEGB 5GISH 4XNUH 3EO9L 2AKRA 4MXWL 1XF2A 1OP9A 4JZNB 3I2CH 1RURL 5F7KC 2EE9A 2BRQA 4ZNCD 2R1WB 3PABA 5D71L 5FF6B 4FQCL 1ZGLP 4OKVA 3BHBA 5DD3H 5DHYB 1CT8A 3MX0A 2V5MA 1GSMA 3IS0X 1MUJA 1PFCA 1FZJA 2FBJH 3CFDA 1B6UA 3OX8A 1NGWB 2H8PB 3P30H 5SV3A 4GMSL 4E42A 2VLKD 1KJMA 3MRGB 5J4MA 1PW3A 3OXRB 4RAVA 5ITBH 1LGVA 1FVCB 3HB3D 1HWGB 1ZHBB 3IU3A 1NBYA 4E41A 2IH3B 3QUYD 4U1SA 1FFQA 4KMLB 3BWAA 2D9QB 2APTA 4LNRA 5TPWH 1FGVH 2ARJQ 3QHFL 4XPGL 1QBBA 3WJJA 4K94L 3WKMH 4YE4L 1SY6H 3P73B 1KLUB 5KSVB 3S4SB 2OP4H 1MI5A 4ORGA 3RWIA 3UDWA 2OZ4H 4ZXBB 5JUEL 2EXWD 1NJ9A 5IW3A 3BUYB 4CMHB 3OHXA 1KIQB 4U7KA 4FQ1L 4ZQKA 2ZCKL 2HRPL 3HE6D 4KY1L 3WMSA 4JGJA 2A6JB 4EJ1C 1WBZA 4CVUA 2X05A 2ZUYA 1AO7A 3G5XB 2X4NB 1D5MB 4KDWA 1OM3H 4JM2A 1T2JA 1KGCD 5FOJA 4WW2A 3RPIA 1ZGLB 5DMIL 3ZL4L 2G5RA 4KI5C 4J4PC 1NAMA 2Q8AL 4APQD 3SE9H 1MELA 5FO8B 3AM8C 3PV6B 4U6HB 3D6GA 3MV7E 1SJEB 3WL9A 5EU3B 2YR3A 3CFKB 4HPYL 1RJZB 5GS1A 4QO1A 1CXFA 1Z0MA 1FNLA 5C0AA 1OAUL 3ARFC 1CD0A 4MYWB 3VFNB 3O41A 2A6IB 2IH1B 5BRZD 1TVHB 3HFML 4WUUE 3EYFA 3BKYL 2EYSB 3VFRA 1QR1B 4MNQB 4U1JA 1KJVB 2W92A 4HWEL 3JSSA 3QG7H 4N0RA 1N64L 3EAKA 1LNUB 4OGYL 2VJXA 3KXFE 5IB4B 1JNLL 1DLFH 2W0FA 3SDYH 4BQCA 4JREB 1DVFB 4TNWK 1YMMD 1HQRA 2B4CC 3SDAC 1IQWL 4R2GB 2GTZA 3BXNA 1MCCA 5KW9H 5TDPB 3FMGH 3P0VH 4K7FB 15C8L 1G1CA 4XAKD 3HNTL 4HDIB 1JZ6A 3X14B 3U46A 4AT6B 4I18C 1WCQA 3QJHB 4KVNL 4BFEA 4IOFD 4OCXL 3BKCH 1HIML 3OKNA 3NIFF 5H37H 1G6RB 4JFHE 1J7VR 3MUJA 2ADIA 5DDHB 3AS2A 3BKML 4OV5A 5DT1H 3P77A 5DC4B 3F7VA 1JZ8A 1QFHA 1BBJB 3WUZA 3RWFB 1OAXH 3UTOA 1HH6A 3S8WA 1FNHA 3ARGA 3EYOB 4I0PB 4D3CL 3C08L 5F6HI 43C9B 1UWEL 4NQDB 4PJXB 1CXHA 3DX7A 5JQ6H 2VAAA 1FL5A 3T2NH 2VXVH 4X6EB 1CGYA 5KAQF 4JHAH 3STZB 3QEGL 4JY4B 1DBAH 1JYXA 3BEVA 3T2OA 2CDGB 2HFFA 5HHME 3VH8A 4PJBB 5DJ8B 4MQXD 5ADOL 4HWZB 1A9EA 4YH6A 4N0CD 3P0GB 4HS6B 4HFUL 3P11H 1KEML 3B8SA 5DEZA 5ID0B 5D6DA 2GK0B 4P5KA 2W65B 3GHBL 3S37L 3D25A 2R2BB 5C3TA 3EZJB 3TVMB 5AYQA 4X6BA 5CEXA 1QNZH 1YY8B 5B8CA 5HHOE 1FZOB 2YRLA 5F1NA 1JCKA 1MRFL 3IDMA 2R1YA 1XR9A 3RWHB 2YPLA 2DLGA 4KRPC 4NKMA 1A6AA 2E7MA 1O0VA 4UU9B 4JPWL 4PR5A 3UCRA 1ORSA 2VWEC 3DARA 3EKCA 3TBWA 5IV2A 3PWPB 4JHWH 1AFVH 3TF7C 2Q86B 4PRAB 2VLJA 3GHEH 1U8OB 4PRHB 1VPOL 4TSBL 1C7TA 4UMGA 2LU4A 3GJEB 3MZGB 2HA1A 5I8OL 4IHOB 5D1QA 1XIWB 1Q0YL 4ZDHA 4IBLT 3IDXL 4EVNB 4RISH 3MLUH 2UYLA 3D0VB 3B5GA 1FSKB 4HJ0D 2Z93B 1S3KH 3A6BH 4CU8A 5LG1A 1NLDH 4PJHB 5JPMA 1HQ4A 4FQJL 2NY2C 4ZS6C 3GO1L 5DHVA 4BZYA 2MCPH 2PXYB 1TJHL 4POYA 2A9NL 4OF7A 3L7FA 5FM4A 1LO4L 3RIFK 4RMSA 3KYNB 4KUCD 4UT7L 2DYPB 4FQHB 1OB1A 2WUCL 1PEWA 4Y4FA 4PJFB 3GMMB 5EBGA 2IPKA 2ADGA 1LE9B 4YK4B 1KJ2H 2BNQB 3LN4A 3QISA 2OL3B 4JDVB 4PG2C 2LU7A 4KZDH 4JLRA 2WQ8A 1QSED 2V17H 4KTDL 4M6ML 5T5NG 4ODUA 1HEZA 5DJAA 3CK0H 1I3UA 5TH2B 4RAHA 3QDGB 3JWNC 4HGWA 3T65A 2W59A 3D1MC 43CAA 1ND0A 2EDQA 2EH8H 5MP6L 1XF5B 4CVXB 3P4OA 5DGQA 4HULB 1CTOA 1A0QL 3O81A 3CU1A 4U6XA 4GXUM 5CBEB 3BOVA 1EJOH 4D9RE 1MQKH 2QSCL 4JJHA 5AZEH 1G6VK 2R2HA 1UH2A 4NGHL 1RJLA 1WWCA 5DD5L 3OPZH 2WLZA 4MAYA 1QPPA 1T1ZB 5IHLB 3G04A 5A2IH 4G43B 1U8NA 3FCTB 5F93C 3EIFA 4QHLB 3LKRB 1AR2A 4JO1H 3V7AE 1Z2KA 1RUML 5DJYA 1Q1JL 4LSRH 3QQ9C 4RQQA 4PBWD 5C07D 1A7RH 1CFBA 5DEGB 3O9WD 3A0OA 1NAML 4XNZB 2XWJA 2ZJSH 2H26A 1SJVA 3E1F1 2VO5A 3SKJH 5M7QA 4I1NB 5TF1H 1EIBA 3VJ6A 1T3FA 5GJTL 4WV1B 4HSQA 4KPHL 1KELH 1KEGL 1HILB 4F9LC 4B50A 1A2YA 3AFLA 3RVUC 3NAAH 5ACLA 3SDXE 4YZFF 1M05A 2AAVA 4L9LC 4RX4A 4LPCA 3IFLL 4QOKA 4Y0GA 3SQOH 4KKCD 4RWYH 3IDNB 3GSWA 2GY7B 4JN1L 3WIIH 2AQ1A 3BIAX 2DMKA 3MGOB 4KROB 3SOBL 1GGTA 1AD0B 2J6EA 4P3DB 4OZFA 3C09B 3I50L 2R69L 4I77H 4PJXF 3IGAA 5GGTH 3KWWA 1JPSH 3E8UH 2LE9A 3AREA 1JPST 4XBPB 3ZO0A 3QAZB 2DOCA 2LTQC 5L2KB 3SPVA 5EZJA 3MRDA 4DN4L 1BQSA 4LCWD 4PJBF 3RKDD 5C0CA 4LSQL 5JNYA 1WAAE 1PQZB 4BZ1H 2P24A 1KB9K 4NKIH 4CJ0A 2JELL 2Z8RA 3HC4H 3PWLB 1D7FA 5TQ2L 3LQAL 1UJ3B 1W72H 4PB9L 4NBXB 5JHLL 1JYNA 4IJ3C 4HC1A 1EXUA 1NCCL 5BMFH 3C60D 3NIGF 1G9NL 3MRBB 3U0WH 4C57C 1DUYB 3LKPB 1B4JH 2A1WH 2FJGA 4JVPA 3PIQB 5BRZE 3PDDA 1BMGA 4P23A 3QPQC 4LCCA 4O5LL 1HI6B 5BVJA 4Z7QE 1U8HA 1JGEA 4XWOC 5GS0D 4KH2A 5DR5H 4UNVA 5GS0H 5LKNA 4XT1C 1S9KC 1CDIA 1TVDA 5E5MB 4O51A 3KS0H 1IAMA 1P4IL 1E0OB 4MNGB 1YMME 4OGZA 5IF0B 3GMLA 4LEOB 4A6YL 2YBRB 4DTGL 1MJJB 3VXTB 3QCTH 4XAKE 3I3DA 4MSWA 4XCNB 3PJSA 4X4ME 1GGBH 3STBA 1U92B 5JOEA 5ABDE 5F7DA 1MFDL 2EDLA 1K8DB 1OAYL 4PJHF 5JZ7D 5GS2H 1MLCA 1FZMA 3NZHL 1IM9B 2NX5A 4O9HH 4X5XB 4TNVK 1WC7A 3IJYA 7FABL 4Y2DB 4Y5VB 3ZYIA 4FXLA 1XZ0A 2VXSL 1MCPH 1GZQB 3GZKA 1F5WA 1D6EB 4AQ1B 3WHE1 4PJFF 5IMLB 4ZAKD 2OXHA 4ZSOE 2BSTB 3SGDH 3QDMD 3PGDB 4LHUD 5BS0B 3GMQB 1F45A 3BZ4A 4EOWL 3RAJH 2WLYA 5I73C 1T1WB 4RNRB 3S35H 3U30C 1OP5H 5JA9A 1XCQB 2PW1B 4HUVA 5JOFB 3QSKB 5AWNH 4JZNA 4KDTA 4BM7A 4FXGB 4IRSB 1ULVA 5ADPL 5IMMA 4PJAE 5DJ0A 2R1WA 3RWCB 3KPSB 4IMKA 4LCYA 3FQTB 3U7YL 4K3EH 3C2SA 5DWUL 5EBLB 3VG0L 4M62L 5FA4A 1MF2H 3BPNB 4PRIA 3VG9C 5CZVH 3V52L 2E6JA 5GSVB 5I18H 2JB5L 1MRDH 1S7UA 4MD0A 4OLVH 2YSSB 3DRQB 3OAZH 4S1RH 1OLLA 4M1DH 1DDHB 1F6AA 2APWA 1IGFL 1MJ7L 4WUKL 3CXHJ 3E2HC 4LEXL 3VI3F 1GZPB 2D7TL 5LQBH 1IM3B 1QRNA 5IJKA 2YMXL 4LLDA 1IEAB 4ERSH 4WTZG 2GHWB 3HI6H 2X9YA 1OTTD 2HMIC 4ZXBA 1AGCB 5KSUB 1WIOA 3BUYA 4HLZH 1AQKL 2H2SD 3V0VB 1R5IA 1EZVY 5T3XL 4MS8C 3ULUL 1H5BB 1BD2A 5CAYB 3MROA 4P5MB 5I1CH 1FLRL 3G5XA 3V4PL 3O6KH 4ENED 5F9WB 2B20A 4WRLA 3B83A 3X3GL 4OTXH 4R4BB 4XWGH 1UKQA 3W0WA 1J1OL 1QTYT 4DKEL 2BNRB 4C56D 1S7SA 3QP3A 5F9OL 3FTGB 4Y2OA 3ZKMD 4I2XE 3WFBL 4N0UA 1I3GL 5T1DH 1RZGB 1U8MA 2D9CA 1Z0NA 3S37X 1RJZA 5CJXA 1EFXA 1ZA6A 4M5ZL 1J1PL 2XNAB 1IRAY 1J86A 3ETBF 2A6IA 4GKOA 1R3LB 2F74B 3UTTD 1QR1A 4EDWL 3V2AR 1S7TB 1QO3A 1VGKB 4MWFA 3C6LC 1YEHH 3VDAA 2WBWB 3M8OH 4AQOA 2ZKHH 1QR4A 3V5HB 1JHLL 1S9WA 3MRHA 2IFFL 3TWCH 1C16B 3ULSB 5TDPA 2ZZUT 5GZNC 1ZT7B 4K07A 3HMWL 4HMCA 3DO7A 3G5YA 4AG4H 4BFGA 4P99A 1JPFA 4PJDB 1T1YB 5DTFB 5HDQL 4O2CB 3EDKA 3HI5H 3L3HA 4RFNC 3BZEA 3REWA 4L4VB 1DLHA 3ARFB 2A6DB 4PJEB 4GS7C 1ZA3A 4JQIH 1YYLL 4M3JA 1HINH 4HC1L 1D5IL 1KIPB 1KENL 3KVQA 4K9EL 4Y8DC 3QIWD 2E7LC 3KYMB 1C1EH 1II4E 1U8PB 3VXUE 3ROOA 2HFEA 2A77L 1MAML 5CD5D 2HVKB 1YEEH 3C8DA 3G6JB 1HWHB 5I30H 5DJ8A 3WUWB 3MPCA 4UV7L 5JW3H 1UYWL 1ACZA 1K5NB 4U31A 2V9QA 4TUOB 2EDNA 5DC0A 3FN0H 3OAYH 2BY0A 4ZYKA 1TQCB 2W65A 1T89A 3VE0B 3QEHA 4I18B 1H0DB 1NFDE 3VDBA 2OR7A 5B39G 4K7PL 3IXAA 2KDGA 3NTCH 1FZOA 4M7ZC 3JWOH 3WHXB 5D1ZA 4LCWE 3ZKXB 3HS0A 4XP6H 4CN6A 2E9IA 5IFAH 5AUMA 2VXTL 1CGTA 3Q2CA 4NO0B 2ZNXA 5IGXH 4PJ7B 1NLBL 3FL7A 1ITBB 2E6QA 1FIEA 5DD1L 2EDYA 5E8NA 3M17B 2R8SH 2Z4QB 3TT3H 3NABL 4HZLA 5EUOA 3MLZL 1FE8L 5BJTA 2IMMA 3HAEB 3OB0K 1WV7T 4JG1H 1K2DA 3O3EB 1G7HB 1FG2B 4Y4KC 5E2TL 1WITA 4NQEA 5ALCH 3DLQR 2GSGB 4AEHL 5INCA 5DUBA 3S3SA 3MLXL 3TIDA 4LSSH 4JPVL 1S7VB 2Z8WC 2VB5A 5IBUB 3IAGC 3CZFA 1NEZB 4PJHA 1QYGH 5AAMA 4HK3N 3C5JA 5E99L 3RX7A 3NFNA 4BH7A 2HWZL 1ACYL 5IB3A 4QXGH 1NGZA 5HYJA 3KYNA 4UDTB 4WEMB 2DYPA 3ARDB 3KPPB 4Q7DA 4WWKD 5EWIH 4YHNA 1YC8A 4KRPB 4EI5C 2YD5A 4HCRL 4KHXH 1YEGH 3JBG7 2NY5C 2UY6A 5J12B 4YHZL 5IVXA 1OP3H 3QQ3B 4NO2B 2AXGA 4R4FL 1MPAH 4K3HA 1TITA 4U1IB 4TUJA 2UV3A 3MMEA 5IHZB 2R0WL 2IWGA 3OKYA 5F89A 3QDME 1XF5A 5FUCE 4OCRH 1BVZA 3FQUB 3DUUB 2X4TA 1BQLH 1KCKA 5FO7B 3OF6D 3EO1B 2CSPA 4P46C 2BSSB 2ORBH 3BQUD 3HLAB 4S1SL 4WO4D 3SGEI 4F7EA 3GIVB 5I8KH 1E6JL 1I9JH 4GLRI 3HCVA 5E0QA 3NMEA 4LAQL 3J7HA 2R0LL 2EDFA 4FZ8H 1YN7A 2IPTL 2L7JA 4A6YB 3U7WL 2EDJA 3QDHA 3T0XA 2IALA 3RIAK 4QHLA 4J1UB 5DK0A 3TYFB 2DDQH 1NC2B 1UM5H 1RHHB 3HHRB 2HN7A 4JRXA 4M7KL 4LQ1A 1E6OH 1ZMYA 5JHDD 2VKXA 1T7VA 2VE6B 2P7TB 3UBXG 2DQGH 4G8GD 4KI5F 4GXVL 4ZD3L 5KS9B 2HH0H 2NXZC 5D8JH 5EORH 5EULV 5D7JB 2WIIB 4YBLB 3HC3L 3Q6GH 3I84A 4PJDF 1NGYB 2D0GA 4MJID 4X7SH 1FORH 3LPWA 2NY4D 1D9KB 2AXFA 4GKSA 3IDNA 3MNZA 5FHAH 2MHAB 5B3NA 1JTTA 4KXZI 3MGOA 4L1HA 4PJEF 4IDLA 4Y1AD 1RZ7L 1ZOXA 4P9HL 3SCMD 4PJCE 2JK5B 1ZEAH 4ZOCA 3O11B 3MRNA 4F3FB 5E03A 5C0BE 4YQXH 4JFED 4L4TA 5T5FL 3RNKA 3R06B 3ZE1E 3G6JF 5H94A 4EXKA 3W9DB 3TFKD 2C3XA 4LKCB 2CGRL 1N6VA 3PWLA 2AEQH 4MCZA 1Z5LB 1QQDB 4ZTOH 4V1DD 5IEHA 2GSIB 3W11C 3VI4F 3VWKC 3I6LE 4WW1A 2A73A 1JFQL 5CGYD 4L9LB 1NFIB 5JXAH 2VMFA 1B90A 2O5YL 1J8KA 4QXUH 3LKPA 3PIQA 3VU2A 1YYMH 4X0KA 1L6XA 2BK8A 1U3HD 4PJ7F 1F4YL 1IAKB 2NY1D 4BUGA 5D7LD 3B43A 1YNLL 1FGNH 1OHQA 1EBPA 4D8PA 5C8JB 1L4IA 2OTUB 1WGOA 4ZTPL 3GMRB 4PJIE 5SWZD 2LTQB 1B0WA 4IRJC 3O8XD 5HVHC 1CG9A 4CMMB 2I5YH 1Q9KB 4YHML 4QRSA 5I2IA 2AXHA 2NR6D 5DFVC 2RCSL 1KBGH 3QUZA 2BJML 5GIRB 4PRPD 1KPVB 2W0LA 5D2NE 3CJJA 5CLTA 2AI0H 1IM9A 4KK6D 2XKUA 3DOSA 3O6FC 1YDPA 2YD6A 5GRVL 4JO3H 4LVHC 5I1AB 5FGCE 1KCVL 5EUKA 1RIHH 3X3FL 3TN0D 3MLTB 4HS8L 5IMLA 2G9HB 4U7MA 4HKXB 4E5XB 3RDTD 4LPXA 4QXTA 4HS3B 3GMQA 4MZ2A 3BDYH 5D7IA 1I8KB 5ESQA 2PTVA 1SEBA 3VXMA 4G42B 2DQUL 2EDBA 3IRPX 2EDTA 2EKSB 2DIBA 4JB9H 1WWBX 5FV1L 2PO6B 2KZWA 1DQML 4YBQC 2VDKL 3TV3H 3ULVD 3RVVD 3ULVH 2B8OT 1QEWA 5JOFA 1WBXA 4DUVA 4IRSA 5I8CB 1EGJL 3RWEB 4M43L 1QFOA 3RNQA 4IIQB 3C2AL 5FGRA 4JFOA 5IP4A 4XC1L 1RUQH 4ODTH 1WVZA 1LD9B 3S9DB 5GGRA 1BOGB 2Z92A 4YHLH 1T6VN 3TZVD 3MRFA 3TJEL 3PWUB 3CXHK 4TSAL 2V5RA 2Z91B 3B9DA 2YEZA 5D7KE 3KNBA 2FL5A 5DMGD 12E8H 4XBEL 2JJWA 1FL3B 2H32A 3CLFL 1OAQH 4IRZH 3HB3C 5F7WC 1YNKH 4JY6B 3VH8G 3F7RA 4QHNB 3GFUA 3UPRB 3B2UD 3F12B 3EDDA 3QUYC 3BH8A 3OAYK 4UZGA 3U6RB 5C0FB 3QUMA 5KS9F 3MUGA 2X4QA 4H0IA 1T0PB 4O2EB 1INDL 4YLQT 2HRLA 4P5MA 1WIUA 3ZHDA 2AK4D 4UV4H 4PJ9D 5E2JA 2EXWC 4G3YL 1J8HB 4EBQH 2AK1L 1G7IA 2LABA 4OD1L 1H3PL 4OAWB 4Y19D 4DKAA 3BMVA 5BV7H 2XTJD 3VFSB 5MENB 4PJ8B 4R4BA 4M9OA 2YD2A 2YD4A 3MJ9A 2H9GB 1DFBH 2BNRA 2P8MA 4PY8J 3GSOB 4RAUB 3EFDL 5LGHL 4F7MB 2OK0H 2CO6B 4RDQG 2JCCB 3E2HB 4MDJA 4HX1A 1I7RB 3JWDL 4APQC 1A7QL 1IQDB 2RFXA 2AJUH 3EO0A 5DYOA 4YC2B 5D2LB 1NAKL 1CD1A 1R3LA 2C3GA 1ZWIA 1P6AB 3B3IB 1G9ML 2DI9A 1LVEA 5C6TH 5FYJU 2MQ0A 5FKAA 4HK0A 4Q6IB 5FO9B 1J0HA 4Z7NE 3DVNB 3WE6B 3WXVL 1RZ8A 4FFYH 3JV5A 4OQ1A 4QRTA 2I27N 4G7VL 1ZT7A 1HDMB 1OP3K 2J3SA 1UZ6E 3RTQD 4R0LA 3E3QE 4PP2A 2C7UA 4JDTL 4HG4K 5D70H 4MHHG 4U4BA 4O2CA 3VDCA 1A6UH 5I1EL 5JHDE 4YHIA 3VXRD 4LIQH 1SMOA 4QTIH 4IOFC 1I1YA 3HZYB 4HUWB 4D0CB 2VZ1A 2IFGA 3ARFA 4G8GE 3CVIH 5HJ3B 1FO0B 2GKIA 4PV8B 1TJIH 4YEFA 1RZFL 2J4WH 4ODXB 1R0AH 1JZ4A 4Z7WB 4ZUTA 6CGTA 4QRPA 2MMXA 1CLZH 1P4BL 3VRIA 1I9RL 5KN5B 1IGTB 3NH7H 4XTRD 3G6JA 4Z77A 1MCNA 4TYUA 4XZUB 1LP9E 3SDAA 1LEGB 3ARUA 4TUOA 4Y1AE 4XP5L 1TVBA 1KIRB 4JKKA 4JFFA 2DQHL 4I18A 4MQXC 2BMKB 4M61B 4EI6B 5K93A 1R3JA 2P5WE 4N0CC 3ZSTA 3FAXA 4JFEE 1QOKA 2E9WA 1MREL 1I9IH 4MQ7A 1HNGA 4RFNB 2AJYL 1OARH 5IIEB 1JPGA 1CLYH 1QVOB 4B7IA 1CDJA 4K3JL 3KPMB 4I3RH 1VGEH 2BY2A 5FYLL 3IFNL 5HHQB 4M7JL 2AJVL 4QTHB 4V1DE 4PJ5D 1X5JA 5IB2B 2NMSA 3N06B 1FIGL 4L3CB 4X6DA 4NNPH 4JN2A 1KB5B 4EXPX 1AJ7L 4TVPH 1OQOA 1AGEB 5ALBH 3LKNB 2O5ZH 5CFHA 2A0LD 2VIRB 4OIIH 1ED3A 1IGYA 2AJ3B 4R96B 2QSVA 4M8QB 5TDNB 5E8OB 3ZZ1A 5IJVA 4OZFG 5D7LE 4KGJA 1NSNL 3RZCD 5BZWB 5L6YL 4YJZL 4NRXB 4WENB 5ANME 5DJCB 2WBJB 3OR6B 4LCIL 1ZHNB 4ZS7L 1OSZB 4OB5H 4M7ZB 4HJ0C 5FK9A 4GG6B 2XQBL 3KPPA 4KQ3L 1I7ZB 2EDEA 2WP3O 1P5VA 2HTKD 1SJHB 4ODVH 4WHTB 1HK6A 2FSEA 3VCLB 4PRPE 3RWDA 4C59B 4HQQH 4NOBA 4XX1G 4YAQA 1ZXQA 4P2QA 3O3AB 1I7UB 4KTYA 5HGBA 1WZLA 4FFWD 3LN9A 4UIKH 1R5WA 3K74B 3JTSA 2DBJA 1FRGH 5C0IA 3G5ZA 4U1IA 2GT9B 5CGTA 1IZJA 2DM4A 3VXPB 1Z6JT 1XGPB 1NBZA 1CDYA 4PUBH 1TETH 3IKKA 3FHAA 4HT1L 1TQBB 3FQUA 4PBXA 2DI7A 4WU7A 4URTB 1A6VL 3PWNB 1EHNA 5FO7A 3QO1A 3G9VA 3IF1B 4X9BA 4Z7VB 2JCCF 4M48L 5E9DD 5D5MA 3P9LB 3GIVA 1HYRC 3ULVE 4N9GA 2V2WB 3QXDA 2VQ1B 3QUML 4L9DA 2LV4A 2VITB 4BH8B 1I4FB 5D2LF 4EI5B 3VXSA 1S9XB 5F7UA 1K6QH 2V2TB 2YUWA 3WEXA 1JMXA 3STLB 3KYKH 4DN3H 2GFBA 3N9GL 1IC5L 4J1UA 4RGOL 3TYFA 3ZDXE 1QBAA 3CZJA 1PZ5B 2NY0D 3BP5A 3UTQA 1YEIH 3G5VB 4HIIA 4PG2A 1R5VB 3DI2B 35C8L 3MJ9L 4RA0C 3VFMB 4OM1L 5CEYA 1F8TL 2DQJH 2P7TA 2Y5TB 3ZDYE 5DQJA 4NCDA 1B0RB 4YHPA 2MSPA 1W0YT 1KFAH 5ILTH 2XWBB 5IESL 2OMBA 2F53E 2X4PB 2ID5A 2VXQH 2GI7A 1INEL 4P46B 5EU7E 3WSQH 5H2BA 4XHJD 1MY7A 2VDLH 5EFIB 3SO3C 3DRTA 2K7PA 2UUDH 2PN5A 1LO5B 2Q7NA 3JV4B 3R1GL 2ADFL 2HKFH 4PJGA 3TA3D 4M1GL 3RGHA 1IC7L 5KBNC 1KTRL 4KKCC 1AR1D 4CNIA 3QUKA 1RJYB 2X9XA 3KXFB 4Z7WF 2JK5A 3C5SB 3GSQB 2AK4E 3L3OB 2AS5M 2CIIA 4PD4K 4F3FA 4HK3J 1F00I 5EC2A 3I3EA 4G9DB 5F21B 1F42A 2FEDD 3GKWH 1FJ1B 1YJDL 2WNGA 1IAIM 1NCDH 5F72S 4P2OB 4F9PC 3VFVA 1XEDA 4RFEA 3BVNB 5DEFB 3RKDC 1U93B 2FECI 2MWCA 4K2UL 4MNQD 4NN5B 5DJ6B 3GI8H 3DIFB 3FOMA 4XH2A 5HHPA 4HIJA 1JF1A 1A02N 5IMOA 1BVLB 1CE1H 4NDMA 1ZT1A 4L9LA 1YPZE 1C08A 4I5BB 4Z95H 1MJ8H 3SJVA 3OKMA 1NANH 3LD8C 2EDHA 5KVGL 1X5ZA 5J6GA 4OCYH 1XH3A 3OJ2C 3FFCA 4L3AA 2CRIA 1DVFD 5CKGA 1IAKA 3QZWA 4WHYG 4R2GD 4AMKH 2VLRA 1Q9WA 5EU5B 5HHMB 1GH7A 5CP7B 4L8BB 3VFOB 4U1MA 3HI1B 3W39A 3MOAH 3RI5K 2GUOA 1HHGB 3DV6B 4O2FB 4YNYA 2GJ6E 3P40A 1XAUA 3QXTA 4U1NB 5GS0C 3CD4A 4KUZH 1G6RH 2RGSA 4FTVA 4BQ6A 4CMMA 5T3ZD 2OYPA 1CL7L 5T3ZH 3KPRA 1OGTB 5E8DL 1BIIB 1SBSL 4BSWB 5HHOB 2OXGA 1GGCH 3MACH 2QQKH 3IDYC 1I8IB 4I0PD 2X42A 3FB6A 4NZTL 4NQDD 2P5ED 4LIQE 4MJ6A 1IC4H 1CN4A 3VXRE 2AP2A 2OJZH 1VACA 5I1AA 4M7LH 4LOUD 3LQZB 4GG6F 1I75A 3EGSB 4M7LT 4MX7B 2X9WA 5JZ7C 1M7XA 3MLTA 5FKPB 2PR4H 1JGLH 5CINH 3PP4H 2W38A 5TGBA 4I3SL 2H6PB 5EPMB 4D0BB 1F4WL 4YWGH 2A9ML 4Y8AA 1EHLH 1K4CA 5ICXB 4CKVX 1X7QB 2DQTH 1E4WH 1JWMB 4TULH 4X4ZA 3JXAA 2EKSA 5FUCC 3TVMD 5C6WH 4PTUA 5HVHB 1HHJB 3LKSB 1BZ9B 3BO8B 2VABB 1MH5B 1S7RB 1JGDB 3FOLB 3RWEA 3KLHD 3BYYA 5CIPA 3ZT6A 1F58L 4FQQB 3PWPD 1UB5B 4YDVA 3GUTB 3K2UL 4UINL 4Z7VF 4CADB 1T80A 1T0MB 4PRHD 4LVHB 3H7BB 4Y88A 5B38A 5E8PB 5DD0H 2IPUG 2Z91A 1XIWD 3ES6B 2FX9L 3H3PH 4PJ5E 1HXMA 3S88L 4TVPE 5LGJA 1MHPH 3NCJL 2VH5H 4LFHG 5BO1L 1H3GA 2H2PD 4NWUL 1UQSB 3CUPA 3UO1H 1BAFH 5J13B 3CU7A 4JY6A 2WAHA 5C08E 2PXYD 3QIUC 1TJGL 3UYOD 5IT2H 3P4LA 2HJFA 4OZIA 3U9PH 3IU4H 4GRWB 4UIMB 3RZWA 3G6DH 3D39A 5K9OA 3VD3A 1P7QA 3K1DA 4LLQB 2C1PB 5DMKA 1GC1C 3TCLA 4GRLA 1OTTC 2IG2L 3D0LA 5DGRA 4NFBA 2BNQD 1D5XB 2H2SC 1PG7L 1CFNB 4HIEB 1C5DA 3F58L 3QUXB 2OL3H 5BOZG 1AI1L 3VFSA 2VDNL 5MENA 2F58H 3MCLH 2R4SL 1FBIH 3H6JA 4JM4H 4K8RD 4AL8L 4H1LA 4K8RH 4F15C 3HNSH 5D9SA 2YS4A 5EIIB 3QDGD 4I0KA 3IKCA 4X80H 3S36X 4FS0A 2DAVA 1R3KB 2JIXA 5I74B 3T1FA 3BP4A 2QL1A 5HY9A 4N8CL 5FOBB 1P7KA 5M95B 4GH7B 1I7RA 3OL2A 1U36A 3V6ZA 2FIKA 2H3NA 1VCAA 5JR1H 1RZJH 3O2DH 2N7BA 4GSDH 3ZKMC 5F7EH 2YC1A 4BK5A 3UYRH 5AD0B 3SDXB 1HZHL 4YHOH 5GQBA 1OTSD 1QACA 2DMCA 3SGJC 3BAEH 1RK0A 5E9DE 3T0EE 1JYWA 2FR4A 2V2XB 1KN4L 4KK9D 5TDOB 5FYKD 3LEVH 5FYKH 3JV6B 4I48B 4PYHA 3OJDB 4MDIA 5J06A 1CYGA 3NFSH 3X17A 2C4XA 1DBBH 3OXSA 4EZMA 4B7LA 1C12B 1A7OH 3FO2B 3WV0A 3Q6FB 2VYRE 4JRYA 3NN8A 5IHBA 1BLNB 3D85A 2VDRH 1DEEB 4Z18A 3TJHD 3HZYA 2BVQB 2OR8A 4JGMA 4TPRH 2Z35B 5D2NC 4HEME 2D0HA 3U9UB 5FUOH 1OQXA 2VDQL 5A43C 1GCFA 2WIMA 1UM6H 4HJGB 1U8QB 1NGXB 4KROD 4MJ5B 2AEPL 1MRCL 1OF2A 2HLAA 3BZFB 4YDLC 3C6LA 3EO9H 4MXWH 1ZTXL 5DSCA 1CE6A 1RURH 2EH7L 2BDNL 1ZLSL 3QIWC 4XZUA 5D71H 2X4OB 5C09D 5L2KD 4TSCL 1C5CL 2LAAA 3T0BA 4OUUB 5EU6A 5CD5C 1QKZL 4QYOB 2ARJB 2YA2A 4P2RA 1Q9OB 4JPKH 4XXDB 4LLMA 1DL7L 3S34L 2R2EA 2C5DC 4GMSH 3E6HB 3NFPB 1I1FA 3BFOA 1DQJA 5L0QC 5ETUA 5KVEL 1OAZL 1EHAA 4XNMB 1WLHA 2E7HA 4NP4L 2CRYA 4Q2ZB 2ATPB 2ESVB 3BE1H 2IAND 4IDJL 1ETZA 4OCMC 5JPNA 3PHOA 4XPGH 3EOAA 4WY7L 4K94H 4YE4H 3UTSB 2E7LA 2XZCH 5AG8A 1Q0XL 3QFJD 1HCVA 1G9EA 4P3WA 4R3SB 4D9QE 2UUDK 5JUEH 2HJKB 1DCLA 3V5KB 4FQ1H 4CAGA 2HRPH 4KY1H 1JWSB 3HG1A 2WW8A 2AV1B 4QY8B 3L6FA 1TZIB 5E8OA 3W2DL 1XGTB 3D3VE 2R0KH 4NQCA 3KPQB 4G80A 3MCG1 5I1GL 2VXUH 2DKSA 1JE6A 2NW2B 5DMIH 1M7DB 3ZL4H 3LKOB 1UACL 2CDFA 1OSZA 3LRSB 2Q8AH 2CR6A 5E94B 3TPUA 4YZFE 5L8LB 4J6RL 5HVWA 3REVA 2JB6A 1T20A 3EFFA 2EIZA 3L3KB 5T3ZE 3SDCB 5ITFA 4NNYA 3D18B 2E9JA 1OW0C 4Y2DD 3HRPA 5EOTA 4GRWF 3VCLA 4OGXL 4HPYH 3LS4L 4JAMB 4KFZC 1JUFB 1CR9L 3QRGL 4WWKC 1OAUH 2P5EE 1U3JA 3HC0A 1EV2E 3U1SL 4FXKB 2UZYB 4Z7UB 5BS0D 1RZKH 4MGXA 3HFMH 2XIDA 2ZWLT 3BKYH 4IMLB 1HSBA 4FQLH 3DV4A 4EIZC 1N3NA 1I3VA 5BOPA 4Y4KA 1KCRL 1BGXL 4Q9RL 4L8CA 1N64H 2Y07L 3QEUA 3CFBA 1JNLH 1VEPA 2X70B 5EBWA 4OCNC 1CFQA 1T0NA 3QEQB 4HFWA 3WO4B 5I17A 1RFDL 1IQWH 3TO4A 3KPSD 4LQFL 5J1AB 3U36B 4EDXB 4U2YA 15C8H 4QHUB 3B9AA 1Z9SA 1MJUL 3CDGB 3HNTH 1BEYL 1HIMH 3BQUC 5TE4H 3NIGE 1IGJB 3MBXL 4HBCH 4OI9A 4WO4C 4EI5A 1Z3GL 4OF5A 5EB9A 3SDXF 3BKMH 4Y4HB 5IMKA 5I0DA 2M26A 3BDXA 1NGPH 3PE9A 4GKZB 3PWPE 1AXTL 2EIBA 1PZ5A 4X4XA 1KG0A 4OGAD 5CKAA 1U58B 5B3JE 4D3CH 4PRHE 3ECBA 3C08H 1BPVA 1KCUL 1UWEH 4ODWA 5FYKU 1MSPA 4ZFFB 3MV7A 4I2XB 5DRXA 2R56L 3QEGH 2ADJA 5HGGS 2XWBA 2X4PA 3T0DA 1LE5A 5I1LA 4R9HA 5ADOH 3SKNB 2IMNA 5J11B 1M7IA 1HH9B 3FQXB 2ZSWA 4WUUA 3ZKQD 4HFUH 4DKFH 3MRCA 3VFGL 4MCYA 1KEMH 2N4IA 4X5WA 3GHBH 1QA9B 3S37H 1CBVH 4OJFL 4Y5XC 2ZUQB 2NY4C 3KDMB 1BFOB 4M6NH 4X7DC 5ESVA 4QRUA 1T7WA 4TNVF 5DS8B 1X6LA 3WKNA 3S5LA 1WISA 4J2XA 3L3OA 4YPGA 2RHEA 4XNYL 2BNQE 4JPWH 5INDA 3MLRL 4YFDB 1ORQB 3NGBC 1PSKL 2W07A 3SCMC 5K9KB 2D03L 2XT1B 5DVOA 5IG7B 1S7XB 4S10A 4K23H 1VPOH 2CKNA 3IXTA 4TSBH 1IL1A 1IGML 4OM0H 1F2QA 4F80A 5HD8D 5I8OH 4BJLA 4DGIL 3QO0A 2H1PL 3BGMB 3TFKC 3BPLB 5C2BL 3IDXH 3BIKA 1BVLA 1U8IA 4G8EB 4I5BA 3F65A 1AIFB 3MXVH 1E27B 4BA8A 4F7PA 1L0QA 1JGUL 5ELIA 2VAJA 4G6ML 1UM4L 5CGYC 2XKSA 4FQJH 2XFXB 3KR3L 3GO1H 3QIBC 3VXUB 3MJ7A 1TJHH 3SEPA 3FQNA 3X12B 2Z31C 2A9NH 2DTSA 2D2OA 2ITDA 1LO4H 4J4PD 5ERWA 3VGGA 3D69B 1S9VB 4UT7H 2BOBA 1IAII 3WIFB 1U3HC 4YIQB 3UXFA 5DO2D 2NY1C 4D9LL 3VI3E 5ISZB 1CGVA 2P46B 1ZS8B 3FT2A 3H7LA 2ZCLL 3QA3A 5FYKE 4ZO7A 3WXWH 1Q9LA 3L5WA 1BIIA 4HKBA 4L4VD 1BWWA 4KTDH 5D1XD 4LCWB 5I66A 1KLFA 4R8WH 1AD9B 5J3HD 3AB0B 3VWKA 1DBKL 3NA9L 2NR6C 4RGMC 1HSAB 3D2UD 4P4RA 5MP6H 1CLOL 5CBAB 2EDRA 2J8UA 1A0QH 1CQYA 3ZT7A 5F1IB 4KK6C 1HHHB 2MFNA 2OX5A 5ICYB 1V05A 4LLVB 1PY4A 5KOVC 2QSCH 2H6PA 2Y36L 2ZUSA 4D0BA 3U0PB 4JR9L 3H0TA 2MPAL 1X7QA 4Q0XL 1DTUA 3BH9A 3TN0C 1G1YA 1JWMA 5DD5H 4YGVA 5IQ7L 4Z7UF 1FCCA 3MRRB 3G6AB 3RDTC 5DJ2B 3K81A 3GRWA 2WP3T 3MBEB 4IRJA 4B53A 3MUHL 1HHJA 5C09E 5L2KE 3LKSA 3RVXD 5T33L 3GSNA 3OG6B 1RUMH 1Q1JH 3FO1B 4U33A 4XCEB 2FWOA 1GAFL 3ULVC 2EDDA 3MV8A 4NO0D 3RVVC 1JNJA 4PTTB 4ZFGL 1H15B 4E0RB 4OT1L 1QLFA 2DJ4A 1T0MA 5KG9B 1BJ8A 3O6FA 4YHYC 2QLVB 5GJTH 1U8KA 1X5KA 4YDKL 2NQCA 2W9EL 5EOCL 1KEGH 5HTSA 1DQTA 3RWGB 1NUDA 3S96A 4ONHB 2IANE 1ZSDA 1S5HA 3VXNB 3GDBA 2VUYA 3SKMB 4JN1H 3TZVC 2EEDA 3QFJE 1KLGA 3DJ9A 3SOBH 3QNYB 4HUUA 4MAUL 1I1AC 3DHJA 4C55A 2J1KA 3I50H 4HAFA 4UQ2A 2R69H 2KBGA 5DMGC 2PKDA 3WN5B 5MEOA 3EYVA 1S5IL 1P1ZB 3NBNA 2YUXA 1INQA 3ARDD 4NHCL 1REIA 4LU5L 4JFDA 4DN4H 3IETA 2C1PA 3B2UC 1NDMA 4LSQH 1SEQL 3GMPA 3ZE2F 4Y5YC 1XMWA 3RL1B 2GITA 4HIEA 1AXIB 1BVKB 5DK2A 4PP1C 1HYSD 3V0AC 3LQAH 2D31B 3NCCB 4PB9H 3FO0L 3L3IB 5JHLH 5BV7C 2R23A 4GOSA 3S35X 1NCCH 1IBGL 2XTJC 5I9QC 1YUHB 1OPGH 2XI9A 2F5BL 2VLKA 5BS0E 4YO0B 1U8JA 4X8XA 2AJZB 1LWRA 1LO2L 2BRRL 4O5LH 3LIZL 3CFEA 3QIUB 3FT3A 3QUYA 2I60L 4NYLB 1MCBA 4XPTH 3VD9A 3UTPE 1P4IH 5E6YA 4QF1B 4QNPF 4YDJB 4XMKL 3QQ4A 3KPSE 4P57B 1KNOA 4NCC1 1NBVL 4A6YH 4DTGH 3CCHA 3BP7B 5L88L 4KZEH 3AUVA 4ZFOA 4POZD 2NNAA 2F19H 4DZ8B 1TMCB 1NC2D 2E5EA 3HE6A 2JTDA 5EO9B 2A83A 5TDOA 5L8KB 1OGAE 5IFHL 1JWUB 1F3DJ 4UT9L 4F15B 2RR3A 5C0BB 3F5WB 2A6KB 3SE8L 3MGAA 1AY1L 2BSRB 1RZIA 2VXSH 3LSOB 3Q6FA 3PWVA 2V5SA 2PYEB 5D7JD 1WAAA 4PIRF 2DMBA 1JMZA 2A74B 3RTQC 3WYRA 1NMBL 1MFBL 2WMPA 4LP4A 4APQA 1V7ML 5J9PB 1G0DA 2YA0A 5F1OB 4PGCA 4ZOBA 1D9KD 3WJLC 3UROR 4EOWH 4B41A 4GAFB 4XPAH 4X9IA 4DOHB 2KQNA 3FO9A 1IAOB 5F3HB 4RIRA 4JCMA 5BRZA 4P9MH 1E28B 2Y9RT 5ADPH 4ZUVB 1DJSA 5HVGB 4B5EA 2X4OA 3U7YH 1ZANL 1A6TA 1BBDH 3VG0H 4M62H 1QSFB 2ZOLA 4XTRC 3OBAA 4PJIB 5DQ9A 3V52H 1AGDB 3VGDA 1MCLA 1YMMA 3O3DB 1A9BA 5CILL 4ISVA 1D6VH 5F88B 1JF5A 3RY4A 1YMHA 3E6HA 4YXHH 1EO8H 4PGJA 1NBQA 1JNNH 4X4MA 4OD3L 4WDIA 1MJ7H 4WUKH 3HZVB 4LEXH 3RGVD 2D7TH 1ZT4B 4QWWC 1EVTC 2ZCHL 3U4EA 5DJDB 2HTLD 5FGCB 4GW5B 3IDGA 1R3HA 1V8HA 2V7NA 4OFVA 1B9ZA 4R3SA 2XTLA 3H9YA 3FQWA 4G5ZH 4X99B 1FPTL 4ZSOA 1AQKH 3DX6B 4TUKL 5T3XD 1FAIL 1LEIB 1JWSA 2FO4A 2HT4D 5T3XH 1UB6B 2VC2L 2YZ1A 3ULUH 1T6WA 3MYJA 5C70A 4X7CC 1FLRH 5IVNA 4PG9B 2A0LC 3V4PH 5GRUL 3MLSL 3X3GH 2FO1A 3DX8B 3GRWL 3ZYOA 5I75B 1DSFL 5KJRL 1TTFA 4H0GA 1ZLUH 4Z0BL 1B0GA 3RZCC 3GSNL 2PTTA 4UDUA 1A21A 4DKEH 3RUGA 4PJAA 2HLFD 5F9OH 3MV01 1MFEL 4N8VB 1S8DB 5K9JL 3WFBH 4NKOB 3LPFA 1I3GH 4L4VE 2NLJA 1AHWC 5T1KB 1EMTH 1N7ML 3B6SB 5JMRA 1JUFA 5J1TC 1CGXA 2CRMA 1BJMA 3THMH 2FIRT 4NQXB 3CC5B 4E41E 5HGHA 1J1PH 4AEEA 3QDAA 2HTKC 4IM8A 3QPQD 3MR9B 4G8FA 2FX7L 4XWOD 5D72L 2B5IB 5TF0A 3VFUB 4GMTL 1K3IA 4IEFB 4XVSL 2J5LC 3QG6B 2EC8A 1MHEB 4DVRL 1T03L 2Y5EA 1PG7W 4JO2L 4P5TB 2PO6D 2JJSC 1JHTB 1JHLH 3QZWG 3WFEL 5J6HB 2IFFH 5CUSL 5K33A 4RBPH 2CDEB 5E08L 1FZKB 4KMTL 4X6CA 1JK8B 5KVFH 3PNWB 4EDXA 1I85C 1AO7E 4QHUA 4F33B 4NRYB 3IB4A 3VGEA 8FABB 2F8VA 3WFHB 5HDQH 4HIHA 5JDSB 4WI8A 4N0YL 3T0EC 2FB4H 5LXGL 1WWWX 4GKZA 3VGHA 1C5BL 4WWKB 5HYSB 4K3GA 5F3BB 3FT4A 1VA9A 5F44A 1YYLH 3TC9A 1NCNA 5F7LB 2CLVA 1L9NA 4KKBD 1KJ2A 5J56B 4NZRL 4K9EH 2NY0C 3P30L 2XG5A 4IOSD 1QSEA 1X5HA 3LB6D 1MAMH 1CFTB 3TIEB 3SY0A 1AC0A 3ZE1F 3CH1A 1T5WA 3TBSB 2ZPKH 4GQPH 4XCCH 3QXAA 1A4KA 1T21B 1FG9C 2BHYA 5FDWA 2XA3A 4MNHB 3UAJD 5E6IB 1J8HD 4CMHC 2RB8A 3WKML 2Y06L 1FN4B 3BQUB 4K7PH 3ZKND 1M4KA 2OP4L 2ICEB 3NCBB 1U3ZA 1UT9A 4XHJC 1F4HA 4PJ8D 4U1GB 1CFSA 3HZKB 4FQ2L 4ZFOL 3TA3C 3U7AA 4RGNB 4FQXB 2VXTH 3TO2A 4OIAA 4XVJL 1AR1C 1NLBH 1J5OH 5K9KA 5DD1H 1G7QA 5EZOL 5B38G 4NT6B 3PWJA 5IW6B 3VGFA 1F3JA 1XT5A 3T08A 4OZ4A 5C07A 1FE8H 1WJ3A 3O9WA 1K4DA 4PJIF 5H35B 5JHDB 2FEDC 2VR9A 4AIOA 3SE9L 4ELME 2VISB 3MRLA 5E2TH 4KTEL 1DN0A 2EIDA 2F5AL 4G8EA 1D5BB 4AEHH 5JLZB 5I16A 1F13A 3K80A 2VSCA 4YR6B 3TBTB 2CLZB 1J05B 1T4KB 4YFLI 3MO1B 4LPYA 5E99H 2EO1A 1H8SA 2VN4A 4AIXA 4UOJA 5I1KL 1PYWA 2HWZH 1ACYH 1YEFH 3PP3H 3L7EB 4J3VA 1EZVX 1HN1A 3D69A 3WIFA 2DM3A 2DM2A 3TYGL 1FV1B 4JREC 3BKJH 4HCRH 3QG7L 1U42A 1LHZA 4R2GC 5GGTA 4YHZH 4EQ2A 3NGBB 3IJHB 4PGBA 1T83C 2YPLE 3DX9A 4L4JA 1NFDA 4R4FH 4F9PA 4H1LG 2P5WB 4PLNC 3T2QA 2XY1A 4JFEB 2IQ9L 2BVTA 5FCUL 4LCWA 5CS7A 4NUGL 3LVEA 2FYYB 2R0WH 1VFBB 3VFPA 2N7AA 3TM6A 3VD5A 3FB5B 3L95B 1T04B 3IDJA 4Q6YA 5DT1L 4I0PC 1W72A 1RK1A 4V1DB 5F7MC 2WWMD 2VTFA 4S1SH 2Q8BH 2IQAB 3QIBB 2Q87A 2UWEA 4I9WD 4LOUC 3LHPH 3C60A 2Z31B 3N1GC 3HKFA 1E6JH 4WHYH 5JQ6L 4LLAA 1UZ8A 4HKJA 4AIZA 5HPOA 3PDOB 4JHAL 4NN6B 2R0LH 1RVFL 4XGZB 2IPTH 4BZ2H 3DROA 3U7WH 5E00A 5ANMB 3FO1A 1RHFA 4NO3B 3TVMC 3FKUS 4MHHI 1RAMA 5KVMC 1MCFA 4E0RA 3Q5OA 4OQTL 2APFA 2R4RL 4KQ4L 4ZUSB 1CICD 3QB7C 4U1LB 5GGSB 1QNZL 3SKOB 4ZD3H 5MEQB 1Y6KR 3KLHC 1TCRB 5EC1B 5EG6C 1X44A 3OKKB 5C7XH 1QHOA 1YNTB 4PRPB 5TJWK 2KQMA 3VRJA 2DWDA 2P48B 3HC3H 4QHKJ 3RWGA 1P84J 2G5BB 1RMFH 4ONHA 1C7SA 2QADB 4DUXA 1KTLB 2CKBL 5MI0C 4JHWL 1A3LL 1KTDA 3HRZB 5FUZL 3AC0A 5FGBC 1NPUA 1F11B 1XIWC 4ZAKA 3DTXB 3KAAA 1LILA 1QLRA 1RZ7H 3QDMA 5T3XE 3QJFA 2WBJD 4LHUA 3VMOA 4P9HH 3DXAB 4ZO8A 3CPLB 3LKQA 1BZ7B 1BM3L 1FSKC 3KPOB 2H2PC 1N5AA 1P7HL 4BKLA 1IFHL 2BXZA 4X98A 5T5FH 2PXYC 4MA8L 1YA5A 2VOTA 2XWTA 2XPGA 1I9EA 4G6KH 1CXEA 4LLWA 1S3KL 3LOWA 1NLDL 4MB3A 1YECH 5CJQL 2CGRH 1UCBH 1TPXC 4QCIB 4X8JA 1J87A 3T0AA 4YHYB 4WGVB 4HEPG 4LKXA 1BQHB 4Z0XA 2D31A 4U3CA 4X7TA 5FB8B 4U6YA 4YK4C 3O45A 2HYMA 1JFQH 3BGFB 1OWWA 3HMXA 5IFJA 4Z7NF 4ODBD 4UTAL 2R0ZL 1KJ2L 5F6HJ 4K8RC 1L0YA 4GBXC 1TXKA 4OBRA 4KMQA 3HE7B 1I1AB 5F9JB 1F4YH 1AGBB 3VFTB 4HKZB 1YNLH 5C9JA 3DBXA 2X4UA 1ZLVK 2CLRB 1GGIL 4AENA 1LK2B 4ZUUA 2DQFA 5LCVL 2F53B 3SDDD 1UVQB 3CFJA 4MVBD 4CN1A 4R7DA 4QF1A 4NFDA 4L29B 3FFDB 1A14L 4P57A 1ZLUK 2MNUA 4LHQB 4YHMH 1EJOL 4J7RA 2DICA 1OTSC 2RCSH 4U0QB 3MV9B 3ALPA 5IW1A 3C8HA 4WU5A 4PJCA 5C0CE 3H3BC 1T22A 3AXLA 2AK4B 5E4EC 3OPZL 2FX8H 3GSXB 5BV7B 5DRZB 3GBML 2P8LA 5D7SL 4MA1B 3EYQD 4QLRA 1KPUA 3H3KA 5HGDB 4YXLL 3OKDA 2FJHB 1KCVH 3LSOA 4WEBL 1NDGB 4XNZC 3JTTB 4LF3B 2A74A 4HS8H 4LRNL 4LSRL 5HPMA 1ZVSA 4C56A 3QHZL 2DQIH 3ILPB 3PL6B 4P46D 5K9QI 3OKLA 2ITCA 4WV1C 5SX5H 2C1OA 3QFDB 4OD2A 1M71B 3TJHC 3ARBB 1YPZB 3O2WL 3BRFA 4ELKB 1DQMH 2VDKH 1ADQH 2QV2A 2RIKA 4ZPTB 3SGJA 3CLEH 1S9YA 3KXFD 3QWOB 4HWNA 3UTTA 2X7LA 4KROC 1EGJH 2DLFL 1J8HE 3C09C 3SQOL 2DWEB 3WIIL 4WFGE 4XC1H 2ICWA 3U2SA 1N0XH 2YA1A 3IFPB 4P2OD 4PJIA 3QAZC 2GJ6B 5DJZB 3OKEB 3LEXA 5HHNB 1W0VA 8CGTA 4JFHD 5E2UL 1CI5A 4TN9A 3TJEH 5FA3B 4N1HB 5GSRB 2NX5E 1YEDB 2JCCE 1CXIA 4EN3B 2BHZA 5CSZA 5CJOL 4GW1A 4Y7MA 2NW3A 3B9KB 4KJYB 2OBGA 5D2NA 3EUUA 3CLFH 4BQBA 2YPKB 5D2LE 1R24B 4LVNC 1ZHLB 3MLYL 5DJDA 1T1XB 2E7BA 3ARZA 3P9MA 4X7FC 4NSKB 5DD6B 2W0KA 1W72L 4RMRA 3QULB 3TBYB 3CSPA 2I9LB 3VXQB 5EDXA 1A4JB 1IJ9A 3QIWA 1C8PA 3U0WL 3T8XA 3DGGA 4F7CB 3HUJA 3RKPA 3MTRA 3HA0A 4G3YH 2OQJB 2AK1H 4QT5A 1V3KA 4OD1H 1H3PH 3FONA 3DX8A 3DUSB 3K1KC 3ZYZA 1I7TA 2B1AH 1K3ZA 2F54B 3S5LG 3MREA 5HHOD 4NJAH 1Z9OA 2FCBA 2HT2C 4X6FA 4XPHL 4ETQB 2EYRA 1YC7A 3EFDH 3P4MB 2YD1A 4QRRB 5GRWA 4XRCA 4MA3A 3JWDH 4NO5B 2CIKB 1A7QH 2FRGP 3ULVF 1OLZA 4NCC2 1FL6B 4Z7WE 4Y2DC 3UC0L 4RA3A 5F71A 4WIQA 2G60H 4O9HL 4W6YB 4HIXL 5HI4D 3NCEB 2HVJB 5IK3B 2XACC 1G9MH 3ARRA 1QRNE 3V8OA 1A6ZA 1RZKC 4K3DH 2W9DL 1FFOA 3ZDXF 4I9WE 3M07A 5C0EB 4JQVC 3WXVH 1SMAA 1FH5H 4HXBL 3INUL 5C08B 4OF8A 2YK1L 4M6OL 3ILQD 3PNWA 1BREA 5HGAB 5D93B 4F33A 3RZCB 1EHXA 4N68A 1N59B 2DI8A 2MOVA 5JDSA 1OW0A 3W0WE 4LMQI 1WBYA 3GK8L 4XP9L 5I1EH 2I07B 1AHWB 3OGCA 3MNVA 5JORA 4DZBA 2BNUB 5IWLC 4WWKA 5HYSA 4K3EL 5DUML 3OKOB 1X5YA 1BFVL 1S7QB 3HNVL 5CP3A 1RZFH 3CVHA 4OZHA 1SQ2N 3HMXL 1RV6X 2J5LB 5I18L 1KN2L 4NZJA 4O4YH 1EAPA 1MRDL 3K3QA 4OGAC 3WFZA 3DSFL 3GMOB 1P4BH 2FATL 3GSVB 5GS3A 1I9RH 4AY0A 4XMLL 2EDWA 4M1DL 1PX4A 3FB7A 1D5ZB 3IDIB 3L5XH 1GYAA 2NY3B 4HAGA 5I76A 4D9RD 5HDBE 4GRWH 1F3RB 2IGFL 3ESUF 2CK0H 2FHFA 4NJ9L 4BFBD 4UOW0 4G6AD 2XQYG 3UMTA 1M1SA 5I71C 4YHKH 1FNFA 5E2WH 4NUJB 1Q94A 5LQBL 2DQHH 4LARL 1F6LL 3OR7A 3OF6A 4GG6E 3QUXD 4UNTA 4WO4A 1GC1L 1H5BC 3QHTC 5E9DB 4MD5A 1XGQB 2XXCB 3T0EB 3T77B 1YPZF 5CCKL 2AJYH 3HZKA 3Q3GA 5F9WC 4Z8FL 1KF9B 5EO0A 4K3JH 1B4RA 5FYLH 3IFNH 1B3JA 4M7JH 5EO1B 1AGFB 3T4YA 2AJVH 5IHUL 4LLYA 4JDZB 3AU1B 5C0DA 2VERN 5CMAB 2HAZA 1CDCA 1A5FH 1WFOA 1FIGH 2NY0B 3CX5K 2VR4A 5CWSA 3KGRA 5MERA 1TZHB 2C3VB 2LVCA 4HLJA 4Z78B 5JHDA 4JHZA 2FGZA 4P2YA 2GAZA 1B6DA 4R97B 3SE3C 1P53A 4G8GA 3GB7B 3AAZB 1EPFA 4Z9KB 5T1DL 5HD8C 1VENA 4Z7VE 5A16A 1NSNH 1MAKA 3OB8A 4LPTA 4WFED 1ZE3C 1DBML 4Y5XA 4MJIA 4ZS7H 1HHIB 4Z76B 2LAGB 3L7EA 3EHBD 2QKIB 1JHKL 3I02B 2XQBH 4KQ3H 4XP4L 1LP9A 1FV1A 1YEHL 5E7BA 4JFXB 4LK4A 3TA3B 5I6XB 2E9BA 3M8OL 1KYOJ 4H26A 4MD4B 4Y1AA 1E4JA 25C8L 2CJUL 2IAMD 4KKAD 3SCMA 1CWVA 1P4LA 2PETA 3EYSH 4XBGB 4DCQB 4WNQA 4XCYB 2FD6L 3U0TB 5DO2C 2P1YA 3H9SB 4JFYB 4BYHA 4AG4L 3FQRA 1PX3A 4M5YH 4HH9B 1VFBA 1E4XI 4QHKI 3ZLQC 4DKDC 5JW5A 4AM0A 3RRQA 5D1XC 3HI5L 1T04A 4HT1H 2VL5A 5B4MD 2GJZB 4JZJA 4M3KB 5J3HC 1FHGA 3PXHA 4U05A 2K7QA 4NQEE 1G7JB 3TNNA 4M48H 4LCUA 2IADB 1A1NA 4D94A 4XC3H 3QUMH 1KJ3L 4DQOH 3ORJA 3C5ZB 1U3HA 2UY7A 2WUBL 2OTPA 1RUPL 2PW2B 3D3VB 5CHNB 1MHCA 1SYVB 5D7LA 5HSFA 3N9GH 4LASL 4EIGB 5JW3L 1GIGL 3DECA 3MQIA 1QP1A 4RGOH 4XNQA 2BVPB 1TQCC 2D7MA 4BFIB 5SWZA 2QQNL 3O8XA 3V7MA 35C8H 3MJ9H 4KJWD 1BJ1J 2FJFB 4OM1H 3RVXC 3ZKXC 2ESVD 2XKNA 1F90L 1F8TH 3DVGA 5K59E 5GGSA 2XOTA 3UTSD 1X4YA 5EZIL 2M2DA 5SX5K 2NTFA 3OKKA 1AKJA 4PRPA 1UA6L 1B2WL 2P45B 5IFAL 4F8TA 4F58L 2P5EB 2F9BT 3A6CL 1INEH 2BFVL 3KPLA 3NZ8B 4HUMB 4NWTL 1LMKA 5DRWB 5IGXL 2YRZA 1PVHA 3DMMB 4BSVB 3K46A 3LN5B 4LP5A 3VFWA 3I6KA 3W9EB 4WTXA 2ADFH 3TN0A 1KCSH 1ONQA 4Z5RA 2R8SL 4M1GH 4R4ND 4DFIA 3MNWB 3RDTA 3FB8B 1VDGA 4NM4L 2PCPB 3GM0A 5E7FA 4MJ2A 4QXWA 3MJ8B 3P4NA 4EUPA 4W68A 1YY9D 1OOAA 3GSRA 1DUZA 2E27H 1N8ZB 3MLWH 3SDCD 4NRZA 5LAXB 1GPOL 1TTGA 2Q7YA 1XGYL 1YJDH 1X4ZA 2X6MA 4N0FA 2Q76A 1LEKB 3ARDC 3WFCL 4QCIA 4D0DB 2BCKB 4JRXE 4JANB 4UQ3B 5I8EB 4ODSL 4PGEB 2IBZY 5J12C 5H37G 3WS3A 1NUFA 3IVKB 1H8OA 5EWIL 4K2UH 1WQVT 3LRGA 2ZUUA 4FNLH 3ELAT 4I13B 4ALAH 4RMVA 5ENWA 1HYSC 3VRLE 1A1MB 5MI0B 3TZVA 5ICZB 3CVHL 3MRPA 2E7CA 5F9JA 4X4YB 2X2YA 2R29L 3QEQD 5DI8B 1AQDA 2WM0A 1JZ3A 4NN7B 5GGUB 1VKXA 3D5OF 1V7NL 2X40A 1A1OA 4C4KO 1UVQA 5DURB 5GJSL 3V0WL 3L3JA 1A7PH 5LWYL 4OF3A 5T5NF 2Z8VC 1BQLL 4Y4HD 4FQPA 1JZ7A 2X4RB 4Y5YA 5J0BA 5E8DH 1SBSH 1TPXB 1CDHA 2P8PA 1IT9L 5E1AA 3NCFB 3A6OA 3X11B 4NZTH 2AK4A 4YBHA 4PJ9A 3GSXA 4L3EB 1BJ1H 4FZ8L 4POZC 4Y19A 4LGSB 4X9FA 1WCBB 4DEPB 4Y16B 3DPBA 2NY6B 1NDGA 4CVZB 3MCKA 5EA0L 4GBXB 2DDQL 1UM5L 4MMZC 4I3SH 4AH2B 1F4WH 1XF3B 1NH6A 4QHMB 1K8IB 5EU4A 5D7JC 1RIVL 3CIQA 4YBLC 4U1KA 2BC4B 2DQGL 5EN2B 1VADA 1P5UA 2DKUA 5HYQA 1YPZA 3L3GA 2HH0L 4GRWE 5EORL 3BDBA 1D9KC 1MHHB 2G75B 4DK6A 4WGWB 4U1HA 3C8KB 3QWOA 4M4PA 3GSUA 1FORL 1X5IA 4JFQB 1PEZA 2BOCA 2OMNA 1CS6A 2AV7B 5IB5A 1F58H 5FHAL 3VW3L 1T5XA 4ZFZA 2AGJL 1NCAH 3IFPA 5E4EB 1RSFA 3OKEA 5IOPA 3I6GA 5FYLE 4ONGL 3C6SB 3DGCR 1ZEAL 1LK3L 3PXJA 3RTQA 3BZDA 4H88L 4R7NB 2FX9H 4EKXA 5JO5A 1SHMA 3BD4A 5SWQA 2R15A 1N2RB 3S88H 2J8HA 2HG5A 3WJLA 5BO1H 3GBNL 4NWUH 2VUOA 3VXRA 3PHQA 2IEPA 2AEQL 5BZDB 4LSPL 1XF4A 3VXUD 4N90D 4ZTOL 5HXMA 4P0DA 4NC1E 3V5DB 3GJFH 3L3DA 3RGVC 1UXWA 4NNXA 3VMPA 4QGTA 1I1CA 1WK0A 1U95B 4WFEE 3UEZA 3KYOA 2HTLC 1MFAH 1PLGL 1N4XL 5ISZD 4QXUL 2C3HA 1YYML 1FNGB 1EEUA 3RL2B 1PG7H 2CUHA 5ESAA 3F58H 2HT4C 1AI1H 1CDGA 2VDNH 5C09B 2R4SH 2XXMB 1EEZB 3CSYB 4AL8H 2YUVA 4ESKA 4KV5F 3QDJB 1CDUA 3L1OL 4PRDA 2HP4A 4DGYH 1WFUA 3K8KA 3IT8D 4NQVA 1KUMA 4YDIL 4CUCA 3QNZA 4N8CH 4NC2B 5ID1B 2HLFC 4LVNB 1KBGL 4J8RA 1Y18B 3UPCA 1L7IL 1EO7A 2B0SL 4RZCA 1MVUB 4LGRB 4WWID 1FYTD 2AI0L 3VWJB 4YXKL 1MWAA 3OMZA 2IANB 4JO3L 4XMPH 2HVJA 4PJ5A 1T66D 1JNHB 4JE4B 3MBED 4J3WA 3QFJB 1UWGL 4ZUWA 4G8IB 1Y6MR 5B3JF 2NCMA 1HOCB 1KN4H 4W6WB 4O58L 5SX4I 5A3ID 2PO6C 3BDYL 4AEFA 1PKQA 4F7TB 4PV9B 1XR8A 1FNSH 3RZCA 4JB9L 2FBOJ 5C0GB 1WT5C 2W60B 5HHVL 3TV3L 4TTDD 2WINB 4IIQC 5A1AA 2VKWA 5B39B 2I07A 3H9HB 5GS2D 4KK8D 1U91B 2Y7QA 3MFFA 1M6OA 2ESVE 2OTWA 3DETD 1DR9A 1HHKB 1EVUA 2VDQH 3M45A 3UTSE 1NCBL 1NUNB 4U0RC 2DS4A 4ODTL 2GTWB 1HKFA 3EW3B 2AEPH 3KJ6L 3HZMA 2AEWA 3QXUA 5DMJB 4YHLL 1KC5L 5F96H 3HN3A 2JJSA 3ALXA 4LNVA 3RY6C 1ZTXH 1MLBA 5IM7A 4KKBC 2FH6A 2EH7H 4K9EC 3F7YA 2BDNH 4XHQA 3C9NA 5E8EA 1ZLSH 4JFPB 1S78D 5LBSL 4RMUA 4TSCH 1C5CH 3V6OA 5C0JB 3JVGC 3U82B 1XGUA 4PRNA 3LB6C 1I85A 4IRZL 1D3CA 2DIAA 3SGEH 1DE4B 1QKZH 4J3SA 1DQQB 3ZE0F 4GLRH 3S34H 5I1HH 4L8SB 5FF6A 1CF8L 3PQYD 4H5SB 5E9DA 1FFPB 1P2CB 5DHYA 5MEPB 1VFAB 3UAJC 3EZ8A 3KLAB 3ZKNC 5KVEH 1OAZH 3G08B 1OGAB 3A67H 1FQ9C 2CR3A 4HBQA 4NP4H 1NGWA 2H8PA 4PJ8C 5EO1A 3ZTJG 1AGFA 4EBQL 4Z7UE 4CL7A 4DVBB 4IDJH 3MRGA 5CMAA 3OXRA 1J1XH 5SWSD 4WY7H 5F1SA 1FVCA 3MRMB 5IKCB 1ZHBA 5F9AC 1Q0XH 4E9LA 2QQQA 1A7NL 2IH3A 2QHLA 1OTUD 4X83A 5FECB 4XB8A 3QIUD 1G7MB 5I1JH 4H25B 2NYYD 3W2DH 3QEQE 3GMNB 3P73A 1KLUA 5KSVA 4YC2C 2DLHA 3S4SA 4LHUG 4JJ5B 3ARWA 5I71B 1KIQA 3MRIB 3RHWF 4KXZH 1UACH 4LSUL 5BQ7B 2A6JA 1G7PB 2YPVL 4Q6IC 1CL7I 3O3BB 4J6RH 4JFFE 2QKIA 2X4NA 1D5MA 3RVTD 2I9TB 4FQIH 5CIPH 5C0BD 2Q20A 2DJSA 3TA3A 5C6TL 5BXFB 1QFPA 3CXDH 5EOQL 3O0RL 1ZGLA 2P49B 1NC4B 4OGXH 2PYED 3LS4H 5KSAB 1CK0L 4IMKC 1IMHC 4UILH 4OFPA 1CR9H 4OLWH 4PRBB 4XBGA 3BEWB 5FO8A 3U1SH 3T0VA 3PV6A 4U6HA 4GKNB 2DL2A 5EZLB 2DQCL 1SJEA 4JFYA 3MA7B 3GGWB 4GUPB 4GAYB 5EU3A 3U79A 3I6LD 4X9HA 3CFKA 1KCRH 4MB4A 4Q9RH 4DAGL 3UBXB 1A6UL 2BP3A 3VFNA 4M9PA 3ZE2E 2X4SB 4YUEH 1TZGL 2Y07H 2IH1A 4J3TA 3N0PB 1U8LB 1TVHA 2V7HB 2Q3AA 5DA0B 5JMOC 5IB1B 2EYSA 4MNQA 1FNEB 5EIVA 1RFDH 1KJVA 1AP2B 3RBGA 1UXSB 4LQFH 2VNCA 3N85L 5FXCH 1FVEB 1MJUH 2CQVA 4MXQD 5GZOD 2J4WL 1QSFD