3TPUA

42f3 p5e8/h2-ld complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
207
structure length
205
Chain Sequence
AQSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQMLLKYYSGDPVVQGVNGFEAEFSKSDSSFHLRKASVHWSDSAVYFCAVSAKGTGSKLSFGKGAKLTVSPNIQNPDPAVYQLRDSKSKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 42F3 alpha
publication title T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 31
structure length 205
sequence length 207
chains with identical sequence C, G, M
ec nomenclature
pdb deposition date 2011-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tpuA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tpuA01
3REVA 3RDTD 5BXFA 5JMRA 5IQ9A 4HC1A 2J4WH 5C2UB 2BFVL 4KMQA 2GKIA 4W4OA 4PRID 2CKBA 3D18B 3MXWL 3QZWA 5I17B 2E9BA 1NKRA 1JWMA 1IC4L 3ARFD 3ISWA 3C5ZD 5CD3B 3CDGA 2ZCKL 4LGRB 4Z78B 2WUCH 5F1NB 4L8CA 4YDKL 3AMLA 3ALWA 3U4EA 3MLVH 4LSSH 3NIGF 3MGOB 5ERWA 1DUYB 3MQIA 3S37L 4QTHB 1CLYL 1S5HB 1FPTH 4J3TA 3C2AH 1A3LL 4LASL 3BZEB 3EYUH 3V5HA 1IM9D 3BZ4A 1H15A 4MNHA 3S4SG 3U7WL 3DI3B 1FYTA 1Z3GH 3UJJH 5INCA 5IB4B 3SE3A 2X10A 4MJIE 4AIZA 3NPSB 4C56E 3ME0A 2DQHH 4FQXC 1LE5A 3FN0L 5GGRY 4U1KA 5SWSE 2VXQL 4PGJA 1KNOB 4AY0A 2HLFC 2BJMH 5C0BE 4XMKH 4QGYA 1YYLH 3VI4F 3MNWB 4HXBL 4ZXBB 5KSAD 4FFWD 2D2OA 4D0DA 3T2QA 1IGTA 3AVEA 2YZ1A 5I1JH 2EDOA 4P5TA 4LGPB 4LEXL 1HI6B 5KTEL 1FZOA 2PF6A 3M1BA 1IFHH 5I8KL 2X9XA 5F89A 4RFEA 4PLJD 1KCLA 4OCRH 4X5XB 3JTTA 3QO1B 3RVXD 1JI1A 4PJ8C 5ID1B 3IT8D 3RIAK 2J7LA 4TNWF 3QCUH 4XVJL 4TUKL 5DD0L 4X6EA 4JHAH 5FUCE 5H8DA 1CGSH 4NO2B 1OTUC 5KVGL 5CEXA 4P46A 5E9DB 2D9CA 1YZZA 3IDUA 4EDXB 2R1YA 3GHEH 3RY6C 4KUZH 4NO3B 4D0CA 1BZ9A 4Q0XH 3MRHA 5DVKA 1S7QA 4BM7A 2E9JA 4OZ4B 3O9WB 3U4BL 2J3SA 2IEPA 4OZGF 2ZSWA 4JM4L 4FZEH 2EE9A 4XBPB 2R0ZL 2YWZA 2ED7A 1SYSA 1NBYA 3MNZB 4LCWA 1J18A 1T66D 3I2CH 2YPLB 3JWDH 32C2A 3MNVA 1DQLH 4FFZL 3FT2A 1J0HA 4E42A 3RWFB 1AKJB 1KJMB 4NC2B 5CINH 2F8XC 1GOGA 4N9GB 4XRCB 1OAQH 3P4LA 2FEDD 2OK0L 4N0FA 4KJQD 4KVNL 1A5FL 4QLRA 3O6KH 4EN3C 4Q6IA 5C8JB 1HE7A 3S3SA 3R8QA 1JGEA 3LEVL 4MQXD 2BNUA 1QD0A 3IVKB 4X98A 3WHXA 5JIIA 1FNAA 1KPVB 2ZG1A 4BQ9A 5DQDL 4HIXH 4MX7B 1P69B 3QJHB 4XMLH 2J8UB 1G7PB 2FBJH 4XWGH 2C3WA 3RDTB 3VWKB 4FQ2H 4JRYB 2GUOB 4G9FB 4MAUL 5GRYA 3OJ2C 3TCLB 4LF3B 4AMKH 1MRFL 1QVOA 1YPZE 4Z7UB 4GKNB 1JGDB 4RFOH 3MRGB 4BJLA 4NJAL 4X6DB 1MJUH 5IEHA 3ARFB 4MQTB 2XN9B 1EPFA 2FJHB 4PJ7F 4S2SA 1R3JA 3SKOB 4PLNC 1YDPB 4MXWL 4XP1L 5K9KB 3UTTB 1MAMH 2BNQD 3BDYH 3GJFA 4JZJB 4OBSA 1YUHA 5IG7B 4W68A 1RSFA 3QUXD 4KZEH 1UADC 4BZ2L 3KNBA 5CZXC 3ULVC 1JGUL 5T5FL 4PD4K 3UCRA 2ILLA 2R9HD 1D6VL 1DLHB 5GXBB 1ZE3C 3V5KB 1INDL 1CD8A 4MD4B 4P9ML 2XPGA 4OZHA 2FJGB 4JY5H 4BYHA 4D9RE 1CXFA 1J9CT 1NCBL 3G6JF 4KJYA 4OIBA 4Z0BH 1JI2A 5TE7H 4L1HA 2ZG3A 3LPFA 3GBMH 4AH2A 2J8HA 3VU2A 5D1ZD 4ZFZA 4APQA 3LY6A 2V7NB 4ELME 3DROB 5FHAH 2C1OB 2APVA 4Y8DC 3U2SA 2VLRE 5GJSH 3VFSA 3G5ZB 4Q9CA 5FO8B 3TT3H 2C26A 2DWDB 1D6EA 4OLVH 2P45B 1GGCH 3FO2A 1Q1JH 2RAMA 1JHTB 3T2PA 3FO0H 3K2UH 4F7TB 3S98A 3T77B 4S1SL 4WTZG 4UOJA 1Q8MA 5DDHB 3OV6A 3BYTA 4EOWL 5DTFB 2DKMA 4I5BA 4JRXA 3DV6A 2HT4D 4U1HA 2R0KL 2PW1A 1H3UA 1CFBA 4QRSB 4Z5RB 3ARED 4J2XA 4X6FA 1RJZB 5I1GL 3KYAA 1EXUB 4ODUA 5FYJD 3O3DB 3L5XL 3VCLB 4FQHA 2JB5H 2DQCH 3H6JA 1AGFB 4HFUL 5MHSE 4LQFL 3X12B 1D7FA 5FHBH 4JFEA 4J1UB 2XIDA 1FFOA 3VG9C 2VN7A 4JFFB 3UPRB 4OCXH 3P40A 1RZ8A 4JR9H 4GLRH 3O8XD 2MOVA 3MXVL 3FL7A 4O5LL 1KB5A 3WE6B 5D93B 3EFDL 4KK9D 4PRDB 2YPKB 3DSFL 1LO5B 4R4FL 3ZLQC 5J3HD 3TV3L 2EDBA 3QXWA 2IPKA 1NDGA 2Z93B 4R6UA 4W6YB 1HILB 3EYFB 3EOTH 4R96B 4WY7H 4BSWA 1ZA3B 1I4FA 1EIBA 1AFVH 3H7LA 3MRBA 2R0WH 3O3BA 3PIQB 1J0YA 4ERSL 3CFBB 4NQVB 5DQ9B 2IPTL 5E99L 4W4NA 3OKKB 4LK4A 4WWID 4X6BA 5HTSA 3GI9L 4KXZH 3SQOH 4FXGA 2LFGA 5GGTL 1A6VH 2Y7QB 1M6OA 5C0CE 4E41E 2NXYB 4Q9RL 4OQTA 3KLSA 2NQCA 4UI2A 1NCCL 4CL7A 4IRJC 4GKZB 4JG0H 1S7VA 5EOCH 4KUCF 4FMFA 4HDIA 4L3ED 4Z95L 4RFNC 5EUOA 1DQQB 4PJHB 1JL8A 5GIRA 5KSVB 1A9EA 2I5YH 1U2CA 4G8GD 8CGTA 1TCMA 3BI9X 5CJ5A 1RZKL 1F4WH 5C92A 2VZVA 2R4RL 4U1MB 3ZKSD 1F6LL 1CLZL 1HKLH 1NCNA 1S9XB 2YUWA 3QUZD 3BW9B 2EE6A 2NLJB 2AJ3A 4ZPVA 4EI6A 4JO3H 4KQ3H 4KROD 1UXSA 3MLZH 1R24A 4TQEH 1UH4A 4NQCE 4D8PB 2AK1H 3FTGA 3HR5B 4GAJL 4YHYC 1MWAB 2V2TB 3LN4B 1CN4A 2W0PA 4MMXC 5I2IA 4GW5B 3QUMB 1X5XA 1S7RA 1C5CH 2FZ3A 4OZFG 5CZKA 1PJ9A 4LARL 15C8H 4DTGL 3BIKA 4P2RD 5ANMA 4HSQA 1ODAA 5GGSA 3WFZA 4LLVA 2O61A 4G42B 4H20H 1SBSH 2CR6A 3L7EB 1KFAL 4JQVA 1J5OL 1KXTB 3SGEI 5L6YH 1OCWL 1JZ4A 5FO7A 3HNVL 4JPKH 3T4AB 4Z7WB 4HS3A 2F19L 4MS8D 1OP3H 1DSFL 4X5WB 1UWGH 3IF1B 2B1HL 4FG6D 1FBIH 1CS6A 2YD8A 3C6LA 3RJDA 4UAOC 5HD8D 1KTRL 3GFUA 4B7IA 3X13A 1AGCB 2OX5A 2ZUVA 3BEVB 3X14B 5ICXB 2VABB 2ORBH 4J4PA 3SO3C 2YHGA 3AAZB 2OL3B 3D6GA 5H94B 5JXEA 1MFBH 2PNDA 4TNVF 5EPMB 4YBQC 4C59B 4F7EB 3MRIA 4CVWA 1P5VA 5C7XL 2EIBA 1MI5D 1RIVH 1BQLH 1KELL 2G60L 3DX6B 5HHME 5J6GA 4DN4H 1OPGL 3DOSA 9CGTA 3MROA 4DZBA 4G6FD 5IF0A 3RU8H 1T1XB 3N0PB 4PGCB 2HTLD 4JFHD 3QNXB 3QNYA 3TH4T 4TSBH 1ZHBB 3U7YL 3VXSB 5ACZB 4FQJL 4NKQB 4JHWL 3X11A 2VWEC 4WFGD 3P30L 4PGZA 3BP7A 1BIIB 4LVNC 3RWEB 1FV1B 1RMFH 3WKML 3KHQA 5FECB 2AEQH 3ZT5A 3CVHA 3RI5K 3NPZB 1OGAB 2IQAA 5I76A 4CMHB 3VD5A 2JIXA 4WGVB 3IS0X 3EDKA 4XC1H 5CIPB 4KRPD 1P2CA 5I1LA 3IFPA 2X70A 3V79C 3TJHD 4O02H 3TO2A 4FXKA 1G7QB 1QRKA 1U8LB 3WXWL 2AW2A 4YLQT 3RZCC 1FO0A 1U95A 4KTDL 2NY4C 4I48A 2AJSH 2LU4A 1JMXA 2B4CC 1MUJA 3KPNB 4NHCL 2XZAH 2ADFL 4JKLA 3BKMH 2LAGB 2ZJSL 1VGEH 4UV4L 4P4KC 3BOVA 4DCQA 2VLME 4AG4H 1RZ7L 3WIHH 1HNGA 3GMRA 5FGBA 1SYVA 4HZLB 4NQDB 5I6XB 3SE3C 2JB6B 2PYEA 3RTQB 4MD0B 4BELD 1ZWIA 4FFYH 4PJ5A 3VDCA 5J0BA 1NC4B 5C0AB 5E94B 5IGXL 1ED3B 1UACH 3MV8B 3T09A 4YDVA 2UYLA 4G8GB 4Y16A 1WWBX 4DW2L 1V3KA 2XICA 1TJGL 4BFGA 4WV1B 1D5XA 1Q9KB 3DX9A 2VE6A 3BGFC 1JWSB 1EZVY 5T5NG 2WV3A 1HHKB 3GKWL 3HUJA 3QEQA 1FNEB 3UTPD 1J8KA 4JREB 2QADD 4P57A 1H3PL 1FH5L 1H0DB 2E7CA 4P5TC 5C0EA 4KQ4H 1PYWB 1N4XL 3B9EA 3CSYB 4WDIA 5EC2B 4G6KL 3GUTB 1XF2B 5EUKA 2P24A 4FQIH 4XHJC 3M07A 1JF6A 4J6RH 4XCYB 3WFCH 2WINB 3U6RA 5IESL 1I7UA 4U1GB 4YO0B 4GS7C 3BO8B 3FOLB 3VFRB 5CGMA 4ONOA 1YECH 3MBEB 1N2RA 5SWQA 1MFEH 4NM4L 2Z91A 1FFQA 1N3NB 4KK6D 3QIWD 4NFCA 4Q2ZA 1UC6A 5KS9E 4IRZL 3A6OA 4NO0D 2PTTB 3ARWA 4JKPL 4M9OA 3VRLE 1CQYA 1I1AA 2W0LA 4OFYA 3B2UD 3P77B 5KANI 4K8RL 4XP5L 2CIKA 5F7LB 4HK3N 1MCQA 3L3DB 1X9QA 2D4DA 5D6DA 1FRGL 1NGPH 5KVDH 1QA9B 4XCNB 4IJ3B 1T7WA 4YXHL 4XCEB 5E2WL 4FABL 2OCFD 3M17A 4CRPA 1A3RH 2L0DA 4OV5B 4P9HL 5DT1L 2FR4A 4ZAKD 5MENE 4IHOA 2QSTA 4P23B 1MI5B 1YYML 5F7YC 3VFWA 5AD0B 5I1IH 1XT5A 5K9QG 2A0LD 4WCYL 5IBTH 5L2JB 5IR1A 4OM0L 2Q20A 3NOIA 4Q6IC 4G6FB 3P9MA 5EZOL 3WFHA 4JM2F 3DWTA 3MJ9L 1G6RH 3ARDC 5F6HI 4Z9KB 1K5NB 4XAWH 5KSBF 1U8PA 3BZDA 3UTSA 1EX0A 2NTSP 2JTDA 1DBJL 3A67H 4PG9B 5T33H 4HUWB 2DMCA 1YEFL 3U36A 2BY2A 3E6FA 5HDQH 2EEBA 3L5WB 2D31A 1UQSB 3TYFB 5BQ7A 4QRQA 3MLSH 3LHPL 2NY1C 1UXWA 4KVCL 5C07D 1FNFA 4DKEL 3S5LB 5FUOH 5BRZA 4DGVH 1P7KB 1BECA 5C08E 5C09D 2APTA 5GS0D 3LMJL 1R5VB 4N8CL 3T8XA 3DV4A 3EOBA 3TZVD 4HBCL 2VDNL 3MLRH 4XNUL 1PZ5A 5KG9B 3QUYA 4CADB 5HHQA 1KCKA 1FDLL 3DXAD 1JYWA 4PV9B 5D7IF 4PJ9A 2JLLA 1FGVH 1KJ2B 3W0WA 5DJ6B 3H9SD 1RU9H 1T5XB 4O4YL 3VH8A 3KYNB 1R3LA 1RZJH 2ZP0T 5EO9B 4BSVA 4DUWA 1PY9A 2ESVD 3HPLA 4JO2L 1HK6A 1A0QL 3R06B 3OX8A 1WAAA 2OTWA 3LS5L 1CXKA 2VZ1A 4MA1B 3BZFA 4ZS7L 5LAXB 1XCQA 1JZ8A 3EJYC 1A02N 4MCYB 3QH3A 3DJ9A 3SBWA 1BM3H 1FAIL 1MHEB 5EIVA 4APQC 2FJFB 2QADB 4DGIL 2C3HA 1J1OL 4C57C 1WISA 4F15C 1DLFH 1OSZA 3WHE1 5D2LA 4FQ1L 4O2EA 1A7RH 4I4WA 5IVXF 2DLFL 1KACB 2V2WA 1Q72L 2I60L 5HHVH 4R26H 3VXPB 2JCCF 4HWBH 3J7HA 4D0BA 3W39A 2GTZA 4OF0A 3OMZA 4RAVB 1U3YA 1MJ7L 3NCJH 1LNUB 3HC4H 5I9QB 4MDIB 5DFVC 5F96L 1VGKA 2VDLL 1T1YA 3TBSB 3QNZB 1T22B 2YBRB 3SEPA 3O4LE 4K7PL 4XCFL 5IP4A 4B41A 3GMOB 3VXUA 1AXIB 1NH6A 1EEUA 3GKZA 5JO5A 4L29B 3IDXH 3DRTB 3VXME 4ZNEE 2Z31A 1CF8H 2HFGL 3J8F7 4X0KA 3VD4A 1BFSA 1TXKA 4FFVD 4Y2OA 1FN4B 3G08B 5E6YA 2XV6B 2R8SH 3TO4A 2X4OA 3RUGE 1DE4A 2RFXB 1QQDB 4QKXB 1I3GL 4K9EL 3P4MB 4QYOB 3AU1A 3I6KA 4PFEA 2J6EH 4PGBB 4QXUH 3GSWA 1G0XA 5LXGH 2R2CA 3LZFH 3OKLB 1WJ3A 2G5BB 1RZGB 4HIHA 5FKAB 1TNMA 2H9GA 1G7JB 4ODXA 4R3SB 1AQDB 3CFEA 5DGRA 2OYPA 2FIKB 4HV8B 2KDGA 3B5GA 1FVCA 2IFFH 1KENL 4I3RH 3TBYA 4TULH 4X7EC 4WFED 4KWUA 3G5XB 3NGBB 5L2KD 1S9WB 4QXTB 2ZUXA 4ONHA 1OAXH 1ADQH 5D7JB 3TBTB 3SCMA 1V7MH 1DEEB 3K81A 3MYZA 4WEBH 3CPLA 5SX4I 1Q94B 5JQ6H 3IFNL 2IG2H 3MCKA 4Z8FH 4KMTL 3MR9A 1AR2A 2ZCLL 2AABL 2VWEE 2O5XL 4JANA 5FB8B 2VSCA 5C07B 2EKJA 3RHWK 5BS0E 2CO7B 3CH1B 2VB5A 5DSCB 3C08H 3RL2B 5IBLD 1XGQA 1P84J 1A9BA 5KAQG 4AT6A 5J11C 4G6JH 3P0VH 1KIUA 4K7PX 2APBA 3U0WH 1EAJA 2WLZA 2X2YA 3OKDA 5I1CH 3KYKL 5DMGD 1MJJA 4WW2F 4YH6A 5T3XH 2EDKA 4NSKA 3OZ9L 1MHHB 4CAGA 4K2UL 1AHWB 2K3TA 2BCKB 3PHQB 5HJ3B 4JZNB 4N5EC 2GJJA 2EE3A 1CVRA 3MRDB 2ESVB 4OCWL 4X4XA 4Y1AA 2W9EH 4P2QB 2Z92B 3MZGB 4I0KA 4LSDA 3C8HA 3BQUB 4X4ME 5CBAB 1FLRH 1QFWI 4A6YH 5IEKB 1WQVT 5DWUL 3ROOB 1A6PA 3VXQA 5T1LD 3VFGH 5KZCD 1I8MB 1JHLH 5KBNC 1JFQL 4JQVC 2A74B 4OGYH 4U31A 3VMNA 3GZKA 4MWFB 5J57B 3U46A 4NZRL 4OZFH 5B21A 1XGYL 5HYSB 3NFSH 1C16B 1L6ZA 2W59A 1JCKA 4HK0A 4GG6E 3HI5L 1IAIL 4Y5VA 3HG1E 5DRNA 4Z7QE 5D96C 1LP9E 3ZL4H 1AGBA 1MFNA 1C1EL 3C6LC 1YPZF 1XGUA 4KMLB 2V7HB 1BQHA 3TESA 3O6LH 1ZSDB 4KI5D 4WU5A 3ZKNC 1MHPL 4Y5XB 4YFDB 2X4QB 2DI9A 1Q0XH 4J4PC 2AJZB 4H5SB 2F58L 1KLGB 1UYWH 5JXEC 1TZHA 4Z76B 5C9JA 1VACA 4KRMB 1WBZB 3BP4A 4HWZB 4UTAL 1HXYB 5LJYH 4WNQA 4YGVB 4Q58C 1NEZA 1MCCA 1JTTA 4DVRH 1I9JH 4LCWE 5F3BA 5I8CB 3KXFB 4OCSH 1FGNL 3U0TB 2OP4H 2NX5B 1KIPA 4I9WD 5FA4A 3EHBD 4NKOB 3SY0B 3S34H 3RA7L 5F9WC 4UMGA 4ELMF 4RX4D 2BVQA 3P4OA 1QPPA 1YC8A 2W92A 3B6SB 1VPOH 5GS0H 1GVIA 4JPIA 2MJWA 4W6WB 4ZDHA 3MRFB 3PQYA 4NBYB 1A1NB 3WHE0 4XXCA 1S7SB 3ZYOA 1V7NH 3O2WH 4M1GL 4GBXD 3Q3GA 3AXLA 4HGMA 4FOMA 4AEHH 3I85A 3LKQB 1AC0A 3GSNL 2R0LH 2V17L 5HYJA 3SDCD 4C54A 5E2UL 4LU5H 5K9JH 4WO4A 4O58L 3PP3K 1Q9WB 3RPIB 4L4TD 2AV1B 1GC1H 2BNRD 4PJBB 4GFTB 4ZFOL 1XF3B 3PXJA 1IGJB 3WNNA 2B2XH 3KS0J 3KJ6L 4PPTA 3HI1B 4IOFD 4QOKA 4HJJL 1IBGL 3LRSA 4XP6L 5HGGS 2D7TH 3NFNB 4Y16C 4TTDC 5KW9L 3UJIL 5CD3A 1DBKH 5EZIH 1FZJA 4R7NB 1DBBH 4JO4H 5KVEH 5F1NA 3TIDB 3EYSH 1W0WB 2AJUL 4U6VH 3RNQB 4BKLB 1SJXA 4JFXB 3HMXH 3EYVB 1AXSA 3UX9B 1OQXA 4QTHA 2MQ3A 1KJ3H 3TNNB 5T1DH 3SJVA 1GIGL 1S5HA 3BZEA 5F6IB 5I66B 4HLZH 1PFCA 4OLXL 4HS8H 5IB4A 1EO8H 5F7DA 5CEYB 3CFKB 2HKHH 4MNQE 5KOMC 3DARA 4P3DA 3HE6D 2DI8A 4KJWD 1UZ8A 3Q0HA 1KIRA 1YEKH 2WWMD 3QEUB 4OBRA 4XP9H 1OTTD 1KNOA 3DTXB 1ZGLM 4H8WC 1NSNH 5T3ZL 5J8OA 3CDFA 4F9PA 4ZXBA 3ARBD 2EXWD 1F6FB 4YBLC 5BVJB 3C2SA 2N7AA 3EO9L 1D3CA 2ZUYA 4FQCL 1KT2A 3CC5A 2XKUA 3FQWB 5LCVH 5DYOB 2VTFA 5E56A 5KVFH 4X5XA 4CDHA 1DQDL 1F90L 4QRPB 3QO1A 1JNHB 4RGMC 2QSQA 5D6DC 3DECA 2PR4L 4X80L 5HDOA 1RAMA 2FX9L 1R3IL 3EJZC 3RIAF 5ABDE 4ZPTB 5DURD 4NO2A 3H9YA 4RBPK 3JWOH 1HZHL 4ZYKB 1LE9B 5JORB 3LIZL 2R1WB 4OF6A 1H3VA 1QNZL 1ZT1A 2UZYB 5E5UB 2GJZB 4OZ4A 3O9WA 3B3IA 4WFHE 2VDRL 4JFEE 3WFEL 5ALBL 2UZIH 1GGBH 3KVQA 1QOKA 1G9ML 2H41A 1YEEL 4S1DD 2CR3A 4XBPA 3A6CH 3IU4L 4J3UA 4NKIL 3GMNB 3Q6GL 3IJHA 3MNZA 4H0IA 4ZUWB 2V5MA 4LSUL 5I1AA 3TN0A 3MA9H 2YPLA 1D5ZB 4YHMH 5GGVY 4JN1L 4X99A 1UEMA 2H1PH 1DL7L 2YD7A 3SGKC 3RWFA 1AKJA 1OY3B 1KJMA 1QRNE 3PGDA 4CKVX 4N9GA 2LQRA 1BFOA 1NJ9A 4WWKB 1LDPH 4P2OB 1MREL 4QHMA 4LAQL 5EB9A 3WN5A 4I3SL 1UGNA 4M7JH 2AJVL 3QUYC 5L0QB 3IVKA 4M5YH 5D7LE 1KPVA 35C8L 5IHLB 5SWZB 1UENA 3H9ZA 4PJ9C 1CVSC 2WM0A 4MX7A 4RZCB 3LKOA 2VDKH 3SDCB 1T2XA 3ILQC 3C87A 1IT9H 4R90L 1B2WL 4DUXA 2Y5EA 5IVZB 3RDTA 4S0TD 2GUOA 4G9FA 4KDVA 1IGMH 3QHZL 2P5EB 3TCLA 4LF3A 1F4YL 3G5YA 5AWNL 4Z7UA 1OP5H 1QSED 2B0SL 2CGRL 3BIAX 5I74C 1OD9A 3STZB 2DLGA 4OZIB 3ARFA 4U6TA 2XN9A 1KV3A 4YHLL 4R97B 2MTPA 3C5ZA 4GLRI 2FJHA 5GHWL 5F7FA 3MV9D 3G04B 3SKOA 2QQLH 5EUOE 3VFVA 4PJFA 5BV7H 5EIIA 1YJDC 1ORQB 1DQJB 3FMGL 5FGRA 5MEQB 3UTTA 1J7VR 2LE9A 3SBWC 1FVEB 3BE1L 5FYKE 2GCYB 4XBEH 2W65B 4OFKA 1A6WL 2YWYA 2YRLA 1PD6A 2ITDB 3KPSD 1B9ZA 2PN5A 4DKFL 3PL6D 4OFPA 4NM8H 4OGAD 4EI5B 3D3VE 1DQMH 4N0YH 3PHOB 1FCCA 2BSRA 1J1PL 1QKZH 3QR2A 4HUKB 4RGND 1DLHA 1WV7T 5CJXA 1UVQB 4Y4HB 3HE6B 2B1AH 5D1QB 1A14H 3LS4L 4FTVB 4DUVA 1GPOL 4IMLB 1FSKB 2FJGA 3S8WA 1HCVA 4JDTL 3KPRB 3IFOA 3SPVA 3WNMA 4ALAL 3CVIL 1EUUA 4FP8H 2IAND 3K1KC 2AQ1A 4I77H 5ISZB 3B8SA 5KSAA 2V7NA 3OAUH 1R0AL 1MEXH 3KR3L 2Z31C 4WEMB 2C1OA 1LO2L 4JY6A 4M7LH 4M1CD 4DOHB 5MI0B 3ULSA 4OKDA 4LDOB 4MJ5B 3G5ZA 4GAYB 2UV3A 5FGCE 5FO8A 2DWDA 3LAFA 3QXVA 4HMDA 1JHTA 4F7TA 5HXMA 3QCVL 3O4OC 1FAKT 4F3FB 3GHBL 2D7OA 5EOTB 2RB8A 3EYQC 2O93L 1TVBA 5DTFA 4EIZC 1F00I 1N6UA 3B2VH 2VAAB 2X7LB 1AIFB 3QUKA 2XY1A 4XBGA 3VXRD 5EU3B 4HIJB 4Z5RA 1T03H 4BZ1L 3QXAA 1GXEA 4NRZB 3O3DA 3K8KA 3VCLA 4KY1L 2IH3A 1BPVA 1AGFA 2FECI 5HHOD 2AEWA 4BH7A 2FNBA 3QI9D 5F1IA 4J1UA 3Q1SH 6CGTA 5GGUB 3UPRA 4TVPL 1T5WA 3SCMC 1U8IB 1QO3B 2R2EB 4HPOH 2HFFA 2RCSH 1PG7H 3I50L 1KXVC 3QDGD 1OAZH 3WE6A 3ECBB 5H35B 1BAFH 3C60D 4PRDA 4MA7L 1LO5A 5L8JB 2BRRH 3LV3B 4HXAL 1PAMA 4MHHG 3OAZK 1HILA 3EYFA 4R96A 1NFKA 3F7VB 3WUWG 4HS6A 1PEZA 2WQ8A 3TGXA 2FRGP 5FCUH 2P4AB 5KS9F 3L3KA 2GSIB 4ZUVB 3PIQA 1JPST 3OTTA 1E4JA 4U6XB 2VLKD 3VRLF 2XFXB 5HHXL 3PWUB 5DJ2B 4UIKH 3NMEA 4L8BB 4QHLB 3MLWH 2R15A 4EEEA 3DGGB 4UT7H 5E1HB 4LLYB 4YNYB 3R0MA 4G8FB 4PJEE 3HAEG 1H3WM 2R23B 3MRMB 1K8DB 3BXNB 4TPRL 4JVUA 4NZTL 3VA6A 5IROC 3T4YA 3O2VL 3X17A 3GSUA 4MJ6B 1VFAA 2PCPB 5CLWA 4BFEA 2IPUK 2H2SC 1DQQA 4PJ5E 4ZODA 1YEGH 5KSVA 3VG0L 2X4UA 1LGVA 2AGJH 4JZOB 25C8L 4HBQA 3RGVD 3OQ3B 5FF6B 1S9XA 3T0ED 3V52H 3BW9A 1FE8H 3H7BB 4L4VD 3HUJE 4CN1A 2E7MA 3LKRB 3BP5B 3ZTNH 3BPNC 4PY7A 3WIHA 5JOFA 3RBSA 4L5FL 3TLRA 2ATPB 4M00A 4D8PA 5EU5A 1MWAA 1SVZA 1S7TB 2V2TA 1HXMB 2NNAB 2EKSB 3QUMA 3DO7B 3PV6B 4OCYL 5JHDB 3PHSA 2XTJC 4NKMB 1JZ7A 2YD3A 4POUB 3BDXA 3R0NA 4HFWA 4MQSB 3S4SA 4LIQH 2LU3A 5D1ZA 1CXLA 4LFHD 1CFVL 3PWPD 4GG8B 4P5MA 4KKLC 2DWEB 2OQJA 2VXUL 4UOW1 1NBVH 1EFXD 2A1WL 4G3YH 4OZGB 2ZCHH 1QSVA 4RISH 3KDMB 3RVWC 2ENYA 1P53A 3K3QA 3QZWG 1I85A 1OTSD 3IF1A 5ALCH 3ZKXC 5C3TA 2W60B 3HE7B 4N8PA 3P3YA 4HG4K 5ADOL 3NH7H 3HNTH 4M43L 2PO6B 1YNKL 3BEVA 3RX5A 5ICXA 2CK0H 3ARGD 3QIUB 3V9FA 2QSCH 3LDBC 3DYOA 3QAZB 2HH0H 5CMAB 4LLUA 5F1SA 4ORGB 1G0YR 1NMCB 2DTML 5H94A 4K23H 5D70L 4F7EA 1H9VA 1NGZB 1ZHLA 2EH7H 4G7VH 4RMUA 3S3PA 4PLKD 3H9HB 2D0GA 1CICD 3HTLX 4LVOC 4OLWH 3DX6A 4I0PC 2Q8AH 1I1YB 1MY5A 1T20A 2VLJB 5DLML 5I73B 3QEGH 3O8XA 5TDOA 2XWTB 1MH5A 1W72L 4J3XA 4XXCC 2ZUUA 2H6PB 4LLWA 4PGCA 3CMOL 3QNXA 3CFDB 4TSCH 1ZHBA 4ZD3H 1RJLB 4LPCA 2R4SH 3JWDC 4TSAL 1GZQB 1YNTA 5CEZH 5CZVL 4QRRE 3SDAD 5E6ID 2QHRL 4JFDD 4M8QB 1X5JA 3RWEA 4P5KB 2QTEA 2JELH 5DI8B 1RJYA 4KU1A 3ALPA 5E5MA 1OGAA 3GNMH 2C7UA 1NLDH 5L88L 4XPHL 3RI5F 4KHTL 3WNKA 4B50A 5TJWK 1HH6B 5HGBA 1A7PH 2XWBA 1U3ZA 1RK1B 4PJ7B 5CJOH 3RJQB 1ZTXH 5F9OL 4K8RD 1YEHL 1P4IL 2VLKB 2M1KA 5AAWA 1W0VB 1U8LA 1CL7H 1REIA 2VISA 1AD9B 4PRHB 4HT1L 4J8RB 4PRAB 3RUGF 3LCYA 5ID0B 3D39D 4XI5C 3KPNA 4QHKI 4UDTB 1UA6H 4PBWD 2GJ6B 3NA9H 3F6IA 1DVFB 4U1IB 5LGJB 3NIFE 1IGCH 3BD5A 2W9DH 4GXUN 3RWDB 4CVZB 4NQDA 1KLFA 1TVDA 2X89D 5FUZL 4L3EA 3FO1B 2DQFA 3RTQA 4OAWB 4NBXB 5I8OL 3T0AA 4TOYH 4DFIA 2Q76A 5C0AA 3G6JB 1ED3A 2VL4A 3MV8A 4G8GA 4NP4H 4PJXA 3QQ4A 4Q9BA 2D7MA 1ZHKA 1Q9KA 4NKDB 3VXNB 3QUZA 4WI7A 1VFOA 3T0EB 3QXDB 3MRJB 4QXGH 1HHKA 2HRPH 2YEZB 5DK3A 2CDEB 3MJ6A 4ODHH 4PRNB 1U91A 2OXGA 4U1LA 2ZUTA 2GT9A 1T3FA 5TE6L 1B6DA 5AZ2H 3WCYA 2WBJD 4RAUB 2C5DC 4HGKC 4G5ZL 1FFPA 1T2QH 1PYWA 1VKXA 3BJLA 3F5WB 1LD9B 5EC2A 3GUTA 1XF2A 4UDUB 3TFKC 2R2HB 5GZOC 5TE4H 3BRGC 4P2RA 4EBQH 3FFCB 2EYSB 3O3UN 2YA1A 1NMAH 4FZ8H 3MX0A 1IAKB 3BWUC 2FX7H 3G9VA 4XCYA 5C1MB 3MLUL 2I07B 3EBAA 4YO0A 4HWUA 3MMEB 2ZZUT 1WWCA 1H8OA 3BO8A 3FOLA 5AG9A 1KF9B 4KK8D 3EO1B 4EIGB 1RY7B 1IJ9A 2HLAB 3T2NH 4HWBA 5LBSL 1YN6B 4JKKA 2GTWB 4F2MB 2PTTA 2OJEB 2FHCA 2HWZL 1FL5B 1S78C 3UC0L 3D9AL 4FNLL 1O7SA 2MWCA 5D2NA 4OSUL 4LPYA 1EJOL 3S88L 3L3DA 4JPVH 4L8SC 3ARGB 2DS4A 3BT2H 3TN0C 2CDGB 4XCNA 3N1MC 2QBWA 4LEOA 5CD5D 5A1AA 2KUTA 3G6DH 4Y5YA 1HWHB 2MQ0A 3L3GB 1DDHB 1C5BL 5CGYD 3NACH 5J1AB 3PXHA 4P23A 1NCDL 1MI5A 4WIQA 5E03A 1M7IA 4F8TA 1CICB 1URLA 5L7XH 5L2JA 3WN5C 2QQKL 4WHDA 4GG6F 2ERJB 4CVXB 4Z7QF 5FYLE 3CXDL 3V4UH 1LP9F 1X5GA 4PUBH 3NCBB 3NTCL 2CPCA 1K4CB 1K5NA 2LU7A 1QYGH 5JW4Q 3T65A 3ULVH 3IKCB 1NAKL 5EIQA 4PTUA 1JVKA 3Q6FA 4PG9A 4HUWA 2FO4B 1DANT 2FB4H 3MJ7A 2NY3D 3RDTC 1YMMB 4XWOD 1VFUA 1QUNA 2GIYA 4UINH 1KUMA 4IIQB 5DMKA 2LABA 1AE6H 3BPOB 5ICZB 3ARFC 3BGMB 1A6ZB 3C5ZC 4OM1H 4RWYL 2FD6H 3BISA 2V2XA 1FIGL 5KG9A 3K7UA 3DGCR 2NPLX 4LSRH 4CADA 2AJXL 4I2XE 1TQCC 1MCLA 4R7DB 4Y19D 3PABA 3HLAA 1M7XA 4PV9A 2IBBA 4D9LL 1M05B 2NW2A 1I9RH 3HMWL 1Q0YL 5DJ6A 4JGUA 4ZFGL 1B0WA 3ES6B 2OMBA 1R5IB 2BY1A 3KYNA 2ICWA 1NL0H 4PG2A 3SOBL 5EO9A 1I1FB 1B90A 4JG1L 5CJXC 1A64A 2V6HA 3ARRA 5CSBA 4V1DE 4Y1AE 3O6FB 4LHJB 1N6VA 2WWKT 5DO2D 1T0MA 4P46D 1FYHB 1SY6A 4XVTH 4Y4FD 1BEYH 1I3UA 5JLZA 1XH3A 2CMRL 5LAXA 1B4JH 3QDMD 5KSAC 2QQNH 4FFWC 4F7CB 1KPRA 2VC2L 3IETA 2VDOL 2MSPA 4EUPH 3OXSA 3GI8L 1F42A 4DAGH 1KN2L 4PLJC 1QSFD 4H1LB 4X8JB 1D9KB 5C0DB 3EKCA 3RVXC 2DM4A 3BKCL 1K6QH 3LEXA 5KOVC 2APFA 2J88H 4TN9A 5C0GB 4K71B 5DMJB 1LNUA 2F54D 4OLZL 5MERB 1FCGA 3CLEL 1J8HD 2XTJE 1IKNA 2YBRA 3MJGX 4NQXB 4OD1L 3GMOA 4ZS6D 3QFJD 4NNYA 1OQOA 4L29A 3NCYS 3KLHC 3DRTA 1I1CA 1MHCA 1CLOH 1ZS8A 3V0WL 4LKCA 1NAMH 4OD2A 4NO0A 3MO1B 5HBBA 4JM2D 2OI9B 3OJDB 4GXVL 1FN4A 3FOMA 1MCJA 4ODTH 2EDXA 3GMQB 4RAHA 1IARB 2RFXA 1QQDA 3P4MA 1T66C 3THMH 3G5VB 4OUUB 4S1RL 2AK4D 2VLLB 2FATH 5E0QA 4PGBA 5DUPH 3C6SB 3IXAB 1XIWD 3OKLA 3FB7A 2G5BA 2Z8RA 1RZGA 5DD5H 3RPKA 5FKAA 4F33A 1G7JA 1JPTL 2FEDC 2GK0B 2PYFB 4R3SA 1AQDA 3RKPA 4KJQC 3B9KD 5KJRH 3TT1L 5HVHB 1FNGA 2FIKA 5E7BA 4HV8A 3QPXH 2RHEA 4MQXC 3GK8L 3KYOB 2LAAA 4DKDC 1LO3L 1UWEL 3SE8L 3G5XA 1EK3A 2I9LA 1S9WA 3ZKQD 4B53A 3QQ3A 1AO7E 4XNYH 3O0RL 5D7JA 2PXYB 1H5BA 5HY9B 1DEEA 5I1HL 1HINL 1VFBB 4BQBA 1S5IL 1ZVYA 4NQUA 3STLB 1WK0A 5I1DB 5HYJE 2NXZB 5E8EA 1QR1B 5HI4C 5FB8A 5C07A 3CH1A 5IFAL 3AC0A 4LSQH 3RHWF 6FABH 1MCOL 1MCKA 5DSCA 3SGDH 2VXSL 3RFZC 4UILL 3RL2A 5D1XB 3TZVA 4QOKE 4DGYL 4LCIL 4MD5B 2OBGA 2WK2A 4ZSOB 4PJIB 5J12C 4OZFB 4Y19B 4YXKL 3DXAA 4U7MA 3M8OH 5I18H 3HAEH 4HWEH 1OSPL 1OL0A 3MV7E 3EZ8A 3QUXC 4GRWH 1Z9OA 2OTPA 1MHHA 5DK0A 3H9SA 1OM3H 1AHWA 1L0QA 1DCLA 1I8IA 5GS1A 2BCKA 3PHQA 4GSDH 3IDNB 3ZSTA 2A6KA 3SJVE 4JZNA 2R9HC 1X3DA 5F9DC 5CSZB 2NY2D 3KWWB 1ES0B 1Z9SA 2ESVA 4M61B 5T1MB 2OJZL 5EWIH 3ABZA 1FFNA 2GFBB 1J0JA 3P0GB 1II4E 2YK1H 3FHQA 4Y4FB 3DMMB 5CBAA 2DQDL 4MA8L 3HC3H 3KPQB 5I19H 3ROOA 4KHXH 4JFZH 2XZCL 3UYRL 4OQ1A 4Z7WF 5D1ZC 1K4DB 4LRIA 5DD6B 5EO1A 3P4NB 5I8EB 1IGFH 3UYOD 1BBJA 3CNKA 4OF3A 5HYSA 5AZEL 4Y2DB 3VRIB 1MQKL 2VIRA 4JFYB 3AFLA 5DJDB 3MCLH 5DS8A 5CS7A 1I85C 1KCSH 2EIEA 3UO1H 2F54B 2DJ4A 1J8HB 1ZSDA 4C56D 4XZUB 4BK5A 4HC1H 2X4QA 3W5NA 3AREC 3V7MA 4B7LA 5FKPB 1KLGA 2CKBH 1AJ7H 4HUUB 2IC2A 5DA4A 3ESUF 5F72S 4OF7A 1PKOA 3WMSA 3TBWA 5B39A 1Z9LA 4JM2B 5L8KB 1WWAX 1PVHA 4MGXA 2OTUB 1O5DT 4HWZA 2B4CH 5KSBB 3O8XC 1BD2D 1HXYA 1KGCE 3LEYL 1B0GB 4NYLA 5EU6E 2AK4B 2P8MA 5M7QA 1EV2E 1N5YL 4KK9C 5HVGB 5AAMA 5T3ZD 1IAOA 2A9NL 5J3HC 4LLMA 4LVEA 2NX5A 4FMKA 5E4EB 4CMHC 1U8JB 3NZHL 4M6NL 5FDWB 3SY0A 4NKOA 3OXRB 4W6XB 4XB8A 4J3SA 3HB3D 5GISH 1J86A 3B6SA 4UB0H 3MRFA 4ODVL 2EO1A 5L2KA 1A1NA 1NPUA 1OWWA 2JF1A 2P5WB 1S7SA 3LH2L 4L3AA 5D7IB 4RA0C 4DOHE 4PGEA 5CHNB 5L9DL 4JFQB 3U83A 4HHAA 2YD6A 1LO0L 5FM8A 4ZOAA 1HSBB 4CU6A 1FZMA 1TETH 1Q9WA 3RPIA 2HN7B 1MRCH 4PJBA 1CBVL 3BYYA 4WI9A 1BJ1J 5HGDB 2P49B 4LSVL 1MCHA 1IGJA 3MLPA 4PRBB 3HKFA 1LO4L 4PRIE 2BVPB 1EHAA 5C6PB 4KAQH 3NFNA 4YAQA 5J1TC 3DVIA 3OKMA 4HIEA 4NUGL 2EDYA 4R7NA 5BOZG 3O45B 3QUZC 1OAUH 4PJFE 3TIDA 2OR9H 1W0WA 4PRPD 3PWVB 4JEGB 5JXAL 1YQVL 5IVXB 3EYVA 4KROC 1QR4A 3K4ZA 4QTIL 3WFBL 4YWGL 4YFEA 4MJ4A 2FX8L 2VR5A 2JCCB 1LEKB 1RZJC 2NY2B 5HVWA 1UM6H 4GAGL 3JUYA 2G2RB 5I66A 4NC0B 4OLUH 3IDGB 3TA3D 2HP4A 3UTOA 1GAFL 3O41B 5CEYA 3VXOB 2J12B 1JGLL 1DTUA 5KSUA 1EDQA 4I13B 3SE9L 3JVGA 1JTOA 1PG7W 3QEUA 2Q6WA 3VA2C 2AXGB 3LQAH 4DZ8B 5EORL 4HF5L 1L7IL 1TJHL 3DTXA 3LN5B 3NCMA 5IB3B 1J1XH 4HKBB 5BJTB 1RUKL 3M45A 3MJ8B 4JKMA 4ZFOB 1A4JA 4MS8C 3KHOA 5TQ2H 4S11A 5BVJA 5JNYB 2I25N 1IC7L 1SEQL 5D72H 3FQWA 4PJEF 1BREA 4XPFH 4PY8I 1UJ3A 4FG6C 5J89A 3QFDB 2PW2B 1N7MH 4EDWL 4MJIB 5HD8C 4WI8A 5D2NC 1T1WB 5IVOA 4C4KO 4CJ0A 4C56B 4F9LA 1KCRH 1CTOA 2FGWH 4X6CA 2JIXD 4IJ3C 4WTXA 5SWSB 1R3KA 3S6CA 4Y5YC 3WS3A 5C0BB 1KPUA 5AYUH 2QJDA 4G7YL 1G7IA 4M9PA 3MUGA 1LE9A 1KB5L 1M4KA 3VH8G 1IQDB 3HUJF 3FZUD 5C2BH 3GJFH 2DYPB 2VLRD 2ZSVA 2DQJL 2NY0B 2HTLC 1KBGH 4MNGA 1TDQA 1BLNB 1N64H 1JF1B 4TRPL 1IAMA 3LKPB 3C09B 1Y0LB 2W0KA 2Y9RT 1JNNL 4KPHL 5JR1L 3AY4A 2JJUA 5JDSB 5EBLB 1D5ZA 3VFTB 1JZ2A 1WZ1L 4NHUB 4U1JB 2ZOLA 4KRPC 3T04D 4R8WL 4RX4A 3TJHC 1DBAH 3VFUB 4WWKA 5E8NB 1KB9J 1BWMA 1KCUL 1JK8A 1E4KA 1R5WB 2A9MH 1DBMH 1A7NL 4MLSA 5ICYA 4WW2B 1CFSB 1DJSA 5I71B 5SWZA 5JW4M 2BHZA 4RZCA 3EFFA 3SDCA 4K3GA 5FK9B 3H0TA 3IGAB 4L4TA 1T0NA 2BNRA 5DK2B 4RMTA 5FYKL 4PG2C 3JBG7 4JQIL 2P5EA 5ESAB 2Q1EA 5TQ0L 3PP4L 3BP6B 3STZA 1A2YA 3WFDH 1Z5LB 4LBEA 4TVPD 2A6IB 3CDCA 1BGXH 3HNSL 4NZUH 4R4ND 4QHNB 2BDNH 3RWGA 3N1QC 5BO1H 5INDB 1DQJA 2BNQE 2OR8A 4F7MB 4MCZB 1FJ1B 1T89A 4ONGL 1FVEA 2QADC 3BKJH 4FQLH 1N0XH 3OB0H 2D03L 2GCYA 1I1AD 4N1HB 5BCAA 3R1GH 5M95B 3S35H 3TA3B 4NDMB 4KKBD 2N7BA 2YKLL 1YPZB 4YHPA 5IJVB 2IPUG 3I84A 4YC2C 1E6JL 1BJMA 1IEBB 2BVYA 1TCRB 2EC9T 1UVQA 2DD8L 2FL5B 3HE6A 5D1QA 3PGFH 3GMPB 3QA3B 1IKNC 4BQ8A 2X44D 1LK2B 3KPRA 4EJ1C 1H3XA 3BAEL 4YHOL 5ISZA 3JTSB 2Z0BA 1C5DB 2XRAL 4KK6C 3QIWC 4WUUD 5JOEA 1U8HB 4U7KA 3B4NA 3BPLC 1YNLH 3UTSD 3V4PL 3NIFF 2FHFA 4M48H 4MJ5A 3BKYH 4NQCD 5B8CB 3B2UC 2EE2A 1E6OH 4AEIL 3DYMA 4PBVC 4DKAA 1I7RA 1RFDH 4F3FA 4YBHA 4CVUA 1N6QH 4OQTH 1HQRB 1FIEA 2VAAA 1AIFA 5BRZD 3RL1B 1A4KB 5FCSH 5BMFL 4ZAKC 1RUPL 4QWWD 1B6UA 4HIJA 2D7QA 4Q9QH 1NEUA 4NFBA 2NR6D 4ELMB 3K46A 3W5MA 2A0LC 4NRZA 4RDQF 3AM8C 5CAYB 3S36L 3TJEL 2VLRB 3VE0B 5ENWB 4Z7VE 4IBLT 2ZUQB 5E8OA 5HDBE 2XQYG 3I02B 5FGSA 1P6AB 1G7MA 4R2GD 1U6AL 4ODBD 5GSVB 3W0WD 1EEZA 5CUSH 3TYGH 1H5BC 4YHKH 1AP2A 1U8IA 4ZUTA 1MJ8H 5DRWB 1QO3A 3GSRB 2R2EA 1BVKB 2EZ0D 5K93A 3T3ME 1ZLWH 3U82B 3A6BL 1MAKA 5ITFB 4NNXB 1MQ8A 4N0CD 3ECBA 3SDDB 5C6TH 3OWEA 1FO0L 5IMKB 1MCPH 5JA9A 2MKLC 3LV3A 7FABH 4K3JL 5GGRA 1MELA 5GZND 3ARSA 5GS0C 3ULUH 4KGLA 1MIEL 3F7VA 2WW8A 2A77H 4XVSH 2XYCA 2B20A 5EA0L 3TZVC 3G9AB 3U9PL 3P11H 5EOQL 2F8VA 4LSPH 5D7KD 4F57L 5HHPB 1BQHG 5FM5M 3C8DA 1IL1B 2XFXA 3GRWL 4M7KH 2MMXA 2AI0L 2IBZX 3O3EA 5DJ2A 2YD5A 4XPBH 4QHLA 3OHXB 3P9LB 1WBXB 1AHWC 3O6ML 4O00A 1GC1C 4I0CC 12E8L 4XGZB 5GS1C 3IDJB 4LLYA 1JE6A 4G8FA 3ARTA 4G8IB 4M93B 2F9BT 3MRMA 1K8DA 4ZO6A 2IQ9H 1EFQA 1CR9L 3VXUD 3NAAL 1GOHA 4K07A 2PCPA 3MV9A 2V9TA 4L3EE 1CIDA 1P6FA 3PE9A 1NEZG 3IDYC 5EBWA 4WI4A 2HKFH 4ZFFB 1JV5B 4DQOL 4EVNB 4JE4B 4PJXE 1SMOA 5FF6A 3KPSA 3H7BA 1E4WH 3TO4D 4KDTA 3S36X 4P3WA 3LKRA 3BP5A 3DVNB 4LCUA 1F58H 5C0CB 3DUSB 4E41B 4OJFL 2PUQT 2ATPA 4PS4H 3T0VA 1DN0B 5I15L 3DO7A 1UZ6F 1BVLB 1CK0L 5J9PB 1FL6B 3PV6A 1CL7I 4KKAD 4NKMA 3CVHH 1KJ2L 1ONQA 3VFNA 1GL4B 2DIBA 4P2RE 2DF3A 5LG1A 2IANA 3VJ6B 3VFMB 1CE1H 1I8KB 5FM5O 5F3HA 4GG8A 1L7TL 1XR8B 5E08H 5JHLL 4AEFA 1EMTH 3I6LD 4FFVC 2ICEB 1F4XL 3U1SH 3V6OC 4NQCB 2EDJA 1MY7A 4LCYB 3KDMA 3V6ZA 5JDJA 5LWYH 3BMWA 1A1OA 1OW0C 1RUQL 4WFFD 5TF1L 2EIZB 2CJUL 2W60A 3HE7A 1F11B 3SKJH 5F93C 1U8OB 2H8PA 3GEWB 2Y36H 5D2NE 2PO6A 1TMCB 5DJZB 3VXRA 4FQXB 1C08B 3JWOC 3QIUA 8FABB 1SJEA 2XOTA 5CMAA 2GHWB 3C5JB 3LRGA 3O2DH 4ORGA 4JO1H 2YUVA 1T6VN 4X9HA 4ZO7A 1NUFA 2YSSB 3QI9A 3DX8A 3KS0H 4EQ2A 3ZHDA 4QO1A 3T1FB 3H9HA 1NMBH 3RWIB 1I1YA 1CDYA 3VWJD 2VLJA 3E8UL 2XWTA 5A3ID 5F7HA 4BQCA 5K59E 4GRMB 3VFOB 5HHNB 4ZMAT 2H6PA 4JFHE 3FONA 4LCCC 3UPCA 3CFDA 2R1XA 1RJLA 3QDGA 1GZQA 3KPPB 4PJ8B 3KPTA 2P42B 4WFGE 3C60A 4M8QA 3GDBA 2C9AA 5DD3H 4JDVB 5T1KB 3K4AA 5IBLC 5LGHL 1M71A 1XCTB 1FFRA 1ETZB 1HH6A 4D9QE 2R29L 1NFDA 2HFTA 1RK1A 4PJ7A 4H25B 5HHMB 1MPAH 3DHMA 2BP3A 2VLKA 4H8WH 4LLDB 3U79A 1W0VA 4LMQI 1EGJH 1A7QL 5DMGC 2PETA 1FG2B 1AD9A 1XZ0A 4GMTH 4PRHA 2YOCA 2CLRA 4J8RA 2Q86B 4EQ3A 5TDNA 4Z7NE 5ID0A 1WIPA 1HIML 2A73B 4QT5B 4UDTA 3CXHJ 5IVNA 4DFHA 5DHYB 4HUVB 4HX1B 5IMOA 2Y06L 1YJDL 2R69L 2C4FU 2VH5L 2WAHA 2YD9A 1TZGL 5F6IC 3L3OB 3P73A 4WEUD 1DUZB 3RWDA 3VXTB 5EU7C 4K7FB 5E1AA 1W72B 3DLQR 1RULL 1X5AA 2VDPL 2CRYA 1S8DB 3FO1A 3MLXH 3NABH 4OAWA 5GGVH 5C08D 2HVKA 2ZKHL 3QPQD 2XTLA 3MOAH 4ENED 4EN3B 5BV7C 5D5ME 4MDJA 5C3LD 3JVGC 5JPMB 5GGQL 1QG3A 1KN4H 1EH9A 1UM4H 1RHFA 3RGVA 1NCUA 3T0EA 1JPSH 5T3XE 3QXDA 3MRJA 3CUPA 4L4VA 5C86A 1HYSD 3UTPE 3WSQL 2CDEA 4RGOL 4NRXB 3NBNA 3BMVA 2AEPH 2BC4B 5DD1L 1CFQB 4RAUA 4N8VB 1UJ3C 4YHZH 3OKYA 2X1QA 2EDHA 1A47A 1IGIL 2R2HA 4HIIA 4KI5C 4LNRA 4F9LC 2CUIA 3DURB 3LKSA 2EYSA 2KBGA 4N90E 5DJXA 4ETQB 2F5BH 3DVGB 1N8ZB 1TJIH 2I07A 2XA8L 3D0VA 3ZKMD 5CILL 1IQWL 3X3GH 1U42A 3PQYD 4PJIE 2CRZA 1ACYH 1EFXA 1J05B 2Q8BH 4BA8A 1X5LA 3EO1A 4YK4C 3CCHA 2IH1B 5MP6L 1QBML 5CJQH 4DVBB 2GTWA 4F2MA 5B38B 5F7EL 1OP5K 2OJEA 4NT6A 1H3GA 2YMXH 3F58L 5FDYA 1CU4H 5JPNB 1A1MA 5IW1B 4WO4D 1T1ZB 3WIIL 2ZUSA 4KZDH 2W38A 1TLKA 3ARGA 2GI7A 5FYLL 1T7XA 3AY4C 1RVFH 5A16B 4QNPE 3NN8B 3D2UB 2ZPKL 3L3GA 3QXUA 4PB9L 3EHBC 1NCAH 1U93B 3BFOA 3TBVB 1IAIM 3BD3A 3K1DA 2VDMH 3FN3A 5KS9B 1CICA 4UV7L 4RQQB 3HZYA 1D5IL 1P1ZA 1X7QB 3TCXA 4XH2B 2EYRB 4CVXA 3ZDYE 1ZV5A 3WIFA 4IOSD 4GBXC 2JJTA 2BOBB 1I75A 1K4CA 1N5AB 2FWOA 2H32A 4OLYL 2K1MA 4NNPL 5E6IA 4JFDA 3SDCC 2NY5L 1BF2A 3SDXE 1QFWL 3PWLB 1S7WB 3O11B 1I9IL 1YMMA 3MRQB 1PLGL 3I9GH 2VXVL 2DDQH 5MENB 1IZKA 4HPYH 2AV7B 3V6FA 4L3CB 4QF1A 3QJFA 4IOFC 1MF2L 1IC5L 3RVUD 2VKXA 3MGTB 4IIQA 2YS4A 5EDXA 1W2KT 4YHIB 3VRJA 5C09E 2B5IB 1WCBB 2CLZB 3LSOB 1T4KB 3F7QA 2J4WL 2H3NB 3BGMA 2ZOKA 3MRPA 4ZXBD 2Y4SA 3VG9B 4EUPB 2ENSA 4JKWA 1L6XA 3RVTD 5CP7B 3MV11 2X09A 5EBMB 3WUWA 1H8NA 1XF4B 3DXAE 4R7DA 4JDZB 2WUCL 2NW3A 2Q87A 3TIEB 1INEH 1HNFA 2UWEA 3NIDE 3H9SE 3MLVL 4LSSL 4XNZB 3ES6A 2IWGA 2LTQC 4JB9H 2A83B 1R5IA 2SEBA 4G8EA 1FPTL 2BVTA 3MJ9A 3CX5J 3C2AL 1I1FA 5C08B 1A6TB 3EYUL 3HE6C 4HQQH 3WKNA 5FOBB 1QLFB 3EOAB 3KJ4C 1NQBA 2FDBP 2WWMC 1Z3GL 4MA3B 4MHHI 4MQ7B 4GW1A 4OLEA 5E9DD 3UJJL 3EW3B 1DFBH 2Y23A 1OTTC 3MRNB 3FQNA 2DQHL 3MBXH 1S9VB 1WGOA 3O9WD 2DB8A 1P4LB 2YC1A 4HKZB 3ARBC 2EXWC 4M4PA 2BJML 4XMKL 2CLVB 4N9OB 1YYLL 5J7CC 1FZKB 3QULB 3PDOB 2KL6A 4P4RA 4H1LA 1D9KA 5I1JL 2YPLD 4KDWA 1UH2A 4JFOB 5C0GA 1IFHL 1UG9A 1AKJD 1HSAB 2OZ4H 1AXTH 3L6FA 4OCRL 1QFUH 4RFNB 3JV5A 5DJ8B 3QCTH 2Y72A 4NQXA 3QCUL 3ZT7A 4PJFF 4OFVA 4JHAL 1CGSL 4LOUD 5GJTH 4YPJA 4HH8A 3HI6H 1KG0B 5E5RB 2RJMA 4S1DC 1VENA 3HG1D 3OJDA 3V6OE 3GHEL 4KUZL 2XI9A 4Q0XL 4YHYB 1CE6B 1ACZA 1UCBH 3VWKD 4JRYD 3MREB 4G9FD 1NUNB 3QIBC 4FZEL 1MFAH 2P44B 1NDMB 3OR7B 4YDIH 2VLLA 3O4LB 3C6SA 3QRGH 5I1EH 3MOBH 1BMGA 3ZMRA 3FO9B 4PJGE 2XN9D 1GGUA 3I2CL 3JWDL 3QXTA 3VXMB 1EHLH 1DQLL 5A2IH 1OF2B 3UTTD 5CINL 3FHAA 4M7LT 2WZPD 2CO6B 1OAQL 4M5ZH 1CFNB 4WFEE 3VMOA 4M6OH 3RUGB 3D85D 5L2KE 4JLRB 3O6KL 3ALXA 4PLOB 4ISVB 4PJCA 4UTBH 4Y0GA 4UAOB 4KH2A 4YDLC 3MRRB 3T08A 1VFBA 1K2DB 2X4RA 3STLA 3ZO0A 4YIQB 5F88B 4HIXL 3MCG1 2RBLA 3MFGB 4XMLL 4PP2A 5DEFB 1CIUA 3SO3B 1MLCB 1QR1A 1Q9LB 3LQZB 3BWAA 3CZFA 2FBJL 2DM7A 4XWGL 5A43C 2IMMA 4FQ2L 3HRZA 1JNLH 2E7HA 4Z77B 4AMKL 2CH8A 2Y07H 4AL8H 1KJVA 5HDLA 1INQB 4MD5A 3ARUA 4RFOL 4ZSOA 2ATKB 2V9QA 2E27H 1MJUL 1YEIH 4Y19A 5FYJU 3OGCB 1ZANH 1AI1H 3ARDD 5KN5B 4OGZA 3PL6C 1NGWA 1MAML 3BDYL 2C3VB 3IDNA 1HHJB 5BS0B 2KKQA 4KZEL 4RGNC 4ODWB 5CSZA 5BXFB 5IK3B 1ES0A 5IQ9B 2DICA 4M61A 4OKVB 5T1MA 3S96B 5EU7E 2GFBA 4YHNA 1WTGT 4FHBD 5BZDA 2J5LC 2XKNB 4Y4FA 2OMNA 3DMMA 2VQUA 4ODSH 2D9QB 3CD4A 1LDSA 3QDMA 2X1XR 1G7LA 5DZLA 2ICCA 3RZCB 3CDGB 5ITBH 4XMPH 5K9OB 2HJFB 2VQ1B 5DD6A 3LQMA 4L8CB 1WIOA 5DHVA 3P4NA 2NY4B 4JY5L 3U4EB 4Z0BL 4L9LC 5TE7L 4JFFD 5ERWB 5CWSA 3GBML 4LSTH 3EDJA 4M1CC 1HKFA 3VRIA 1QSFA 3CH8A 3DRQB 4P4KB 3BZ4B 5FHAL 1U58B 2HG5B 5GJSL 1V3LA 2F54A 2MCPH 3JV6A 1BZQK 3TT3L 4JN2B 4OLVL 4MNQD 3GGWA 1J8HA 1GGCL 2DQGH 4OB5H 5LKNA 1Q1JL 3FO0L 3K2UL 3VDAA 1LE5B 1NCWH 3QFJA 4X6CE 5HYEA 4U1KB 3GJEB 5FKPA 2EC9U 3BGFB 4OT1H 4P59H 3GBNH 5B3NA 3QI9C 3IYLW 3V5DB 4D0DB 2JK5B 4GG6B 4JM2A 3HG1B 1WUNT 2OTUA 4OCMC 1LP9B 2VXTH 4QHUA 3M1BB 2JB5L 2DQCL 1OGTA 3UBXI 4RFEB 3CFCH 5FHBL 3FN9A 5HGAB 3MYJA 4KRNA 3TWCH 4MNGE 5IBUG 3JTTB 2NXYD 3CX2A 2AK4A 4OCXL 1WZMA 1IVLA 1U8KB 1JRHH 4JR9L 1XIWA 3V95A 3C60C 4X6EB 1CDUA 5D7SH 5I16B 2BOCA 5ADPH 2O5YH 5CBEA 4GO6B 3B9KA 4GS7B 4NJ9H 1U8JA 3OKNA 3MPCA 4I9WE 1CZ8H 5FDWA 3CMGA 1I7ZB 5HPMB 1KC5H 3L9RA 1OT2A 4D3CH 1BZ9B 3OJVC 1GJIA 3MRHB 3EOTL 1F3DH 4J3WA 3D85B 4WY7L 2VUOA 3SO5A 2AJYH 5JUEH 2AEIT 1B88A 2KQMA 4YE4H 2ZSWB 2XNAA 3DX7B 5DVLA 1RK0A 1VADB 5DR5H 1AFVL 1QFPA 2R0WL 3H2WA 4LCWB 4ELKB 3V0VB 4QCIB 5BW7C 4MSWB 3QP3A 4YJZL 2NZIA 4LPTA 3SQOL 3UBXB 4L4TE 2HN7A 2BNRE 1A6VL 3SKUD 2FSEB 1E4XH 5GSRB 4TTGA 4PRBA 4N0FB 2CDFA 3T0XA 3LRHA 2I9TB 5E2VH 2BVPA 4Z7VF 4Q6IB 4JG0L 5EOCL 3WL9B 5DRZA 3LOWA 1WZKA 1YMHB 2BNUB 1AQKH 3ARDB 3RGVC 2O5ZH 4X98B 3WHXB 3O45A 3HPJA 3BSZH 3T0EC 5D7LD 5CCKH 2I5YL 2ID5A 1ZLSH 3T3MF 3KYMB 1F4WL 4QHKJ 1LEKA 4OUOA 1HKLL 2G2RA 1BFTA 4JO3L 4KQ3L 4YPGB 3MLZL 3MODH 2NY1B 4TQEL 4F58H 4C4KT 4N0UE 1QVOB 3UEZA 2WUBH 4EXKA 1HHIA 3FT4B 2AK1L 2FECL 3MRKB 4OIIH 5E2TH 4YEFA 43C9B 3GSNA 4XPGH 1C5CL 2DRUA 1RUMH 4PB0H 4DZ8A 3LN5A 15C8L 5IB3A 4JVWA 5BJTA 3MJ8A 4FQPA 3F7YA 4P49A 2F74B 4H20L 1SBSL 3KNBB 5KANG 5JNYA 4NQSA 3VXSD 1JWUB 3EZJB 3S5LG 3D3VD 3WXVH 1OTSC 5F1OB 5L6YL 3CIQA 4JAMB 4JPKL 2BY0A 4IDJH 4ZUSA 3K2MC 3QFDA 3RWCB 1QBBA 4MNQB 2M8XA 2IFGA 1T1WA 2ARWA 5HGHA 1UWGL 4XPAH 4C56A 1OGAD 3ARGC 3DBXB 1PKQE 1FBIL 4NUJB 4ZOEA 4I18A 1HH9A 3I3BA 4LIQE 1TQBC 1N59B 4CDGC 2F8OA 4AH2B 3IJYB 3LVEA 3PDDA 4PJXF 2ORBL 4ZFZB 1RZFH 4APQB 4LNVA 4ACPA 4F15B 4PLKC 1CICC 1IQDA 1MFBL 2B39A 3U2SB 4YQXH 2DYPA 1Z2KA 2KQNA 1BD2A 3P2TA 1RIVL 5MEOB 1BQLL 4P2CG 4POZD 4Z0XB 3FO2B 5D6CA 1BLNA 4DN4L 5C0JA 3IDMB 1JGVH 3LKPA 3QG6B 3SDAC 4U1SA 1Y0LA 5E6IC 3RU8L 1KEGH 2GAZA 4X4ZA 4TSBL 4NQDD 5JDSA 4U1HB 3RTQD 2PW1B 4UUJA 1F2QA 4WI3A 4NHUA 1NC4D 3AB0C 5C0AD 3MV8D 4X6FB 1ZKAA 4ODUB 1RMFL 1LK3H 1RPQA 2AEQL 4IIQC 4FQHB 4AJ0A 5E8NA 5IQ7H 2VITB 4I3GA 4NGHH 4JFEB 5JW3H 4V2CB 4XC1L 3C8KA 1FFOB 3TH3T 4O9HH 4O02L 3PJSB 1X5KA 1RZ8B 1AH1A 1U3HD 2YD1A 5CEZE 5DJAA 4RRPA 4DK6A 1KB5B 1DQTA 2AJSL 4IS6B 5E8PB 2QR0B 1QRNB 2XZAL 5K33A 4TYUA 2JJWA 3BKML 5JQHC 5I30H 5AUMB 4NN6C 5ESAA 1VGEL 2J1KA 1QSEE 4KV5E 4AG4L 4YZFE 3WIHL 3H3PH 2A6IA 4URTB 4OD3H 3BUYB 3OJMB 4YDJB 3VGEA 3VD9A 3MRBB 2R39A 3O3BB 3UDWC 3MV9E 1SM3H 3MBED 3UZVB 4QHNA 4FFYL 4NWTH 5D7LB 4PRPA 4FRWA 5K59F 1UACL 5INDA 2FHBA 3DPBA 4X6BB 4F7MA 1FJ1A 1HHGB 4FXGB 4JGMA 5IFHH 1YN7B 4ORZC 2KH2B 2WBJC 4NO5B 3KPSE 5IHZA 4X7SH 2EH8H 5IFJA 3IU3B 5F8QC 3WEXB 3TA3A 3N9GH 1T04B 4OGXH 5IJVA 1M7DB 4RGNE 4MB3A 1MCBA 1TCRA 4KQ4L 1S7VB 3TP4A 4HDIB 5C0ND 3QWRD 3GMPA 5EUOB 4P23D 2EDNA 4O2CA 2P48B 1CWVA 3W2DH 5J11B 1A9EB 2AAVA 4FQIL 1LK2A 3DUUB 4HJ0D 1VEPA 2DQUH 4KK8C 2IANE 5IHUH 3JTSA 4J6RL 4Z7NF 2NY7H 3WFCL 1C5DA 2GITA 3HHRB 2AJ3B 4ZPVB 1K8IA 1BWWA 3MTRA 3D3VB 1MVUA 1R24B 4X7CC 3U7AA 3INUH 1YECL 1EBAA 5TF0A 2OI9C 5B8CA 2W91A 1MFEL 1FNSH 4BH8B 1CGXA 4HGWB 4XCCH 3RAJH 4JCLA 3L3HA 1LMKA 4Y88A 1PQZB 3SDYH 2FZ3B 1U2HA 3CK0H 1A6UH 4HEPG 5CD5C 5D5MF 2P8LB 4W4OC 3C9NB 2WIIB 3BIKB 4XNXH 3RL1A 3VXRE 1H8SA 1KIQB 1GH7A 4DJMA 1NGPL 3OF6D 1UB5A 5KVDL 5GGSB 5C0RH 1C12A 1KEMH 1YEJH 4ZOBA 4ELMA 1T83A 3MV01 1A3RL 4PR5B 2YUZA 4ZTPH 5FO7B 2VLRA 3VE0A 3Q5TA 5HHOE 4HS3B 3ZYIA 3B5TA 5I1IL 5FGCB 3LKNA 3PUCA 2EEDA 4S1QH 5IBTL 3KPMB 1FVDA 4LMQE 3KPOA 3C6LB 5D9SB 1QLEH 4M7ZC 1BVKA 1G6RL 1I8LA 3QDGE 4XAWL 4NNXA 2NY3C 1MWAH 4XWOC 4LDEB 3O2DA 2HA1A 3QUMH 3A67L 5T33L 2VN4A 5HYSG 3MACH 5HDQL 4NQEE 3BUTA 1S9YA 1CD9B 1PX3A 4PJIF 1AGDB 1QFOA 3BESR 3MLSL 5LQBH 4LKXA 2VAJA 2BSTB 1NFDE 4C58B 5FUOL 4DGVL 1G1YA 5HHPA 3MROB 1MCNA 1WVZA 1U3HB 4K7PY 3ULVE 4X4YA 3QNYB 2VL5A 3MLRL 4U05A 2AQ2A 3MC0A 3X11B 3P9LA 5IWLA 3RP1A 4U1NA 4QNPF 1FGVL 5B39G 5EFIA 4G8IA 3CVHB 3RNKB 5I76B 1RU9L 1P7QB 1ZK9A 4P46C 5F9WB 3QWOA 3IFPB 2X70B 3HZKB 4JPWH 1EGJA 1F13A 1KYOJ 1RZJL 3QDHA 4WUKH 2OL3H 4Y4FC 5FYJH 1RUAH 3TO2B 1ZEAH 3OKEB 1RIUH 3FAWA 4U3CA 5A2LH 3TVMD 2X5PA 5E00A 3ZDYF 1FO0B 4PV8B 1U95B 3OSKA 4ZFFA 3JXAA 4I48B 3AS2A 4L4VE 2Q7YB 3TNMB 3SDXF 4PJEB 1X5YA 1BM3L 3DUSA 2LV4A 1YY9D 2MFNA 4YXLH 1DLFL 3HCVA 4YX2H 3SGEH 1A7RL 1ZLUH 2EDWA 5D8JH 4JJ5A 4ZTOH 3GMRB 4R26L 1SYVB 5HHVL 3ZE0E 1DN0A 1JPGB 3MRCB 4HWBL 1BVLA 4MAYD 1HOCA 5J9PA 1FL6A 1ZWIB 4PJ5B 3LQAC 4XX1G 2GQHA 3V7AG 3W11D 5J13B 3NCJL 4Y16B 2DM2A 4ZS6C 3HC4L 4P99A 5F9JA 3OKOB 3VJ6A 3OGOE 1TPXC 3DX9B 2VE6B 1I8KA 3PWPE 1X4YA 4WUUA 1YA5A 1CD1A 5DUMH 3HUJB 1F8TH 2R56H 4AZ8A 1U41A 2F5AH 5D7JD 4JM2C 3IDXL 4FQQB 3NIDF 5BVPH 1CGWA 1AGEA 4NQCA 5C0EB 4K3EH 4LCYA 5DJ0A 4OTXH 1CF8L 4HCRH 1P4BH 1TVHA 1F11A 2P24B 1IGYB 2V5SA 3VW3H 1WF5A 2R8SL 1U8OA 4X7DC 3QDJE 1XIWC 1KLUB 5DJZA 2YD4A 1OAKH 4FQXA 2IALA 8FABA 2C1PB 1Y18A 3U6RB 2J6EL 3B9KC 1CDGA 4QXUL 3C5JA 5LXGL 3LZFL 5CLTA 1U8MA 3RGHA 1BJ1H 1N2RB 4Z7OE 1NANH 2EICA 3UTQB 2Z91B 2JKXA 4PJAA 4YBLB 3T1FA 1MNUH 5D71H 3SKMB 4RMQA 3UAJD 1OARH 2AXJA 4GRMA 5HHNA 2IFFL 2ARJA 2X4TB 4I3RL 5T5NF 4TULL 1JBJA 3W81A 2HFEA 2CIKB 4AENA 4RGMB 4PJ8A 2RR3A 3CSBA 1OAXL 1ADQL 2EDTA 4JFDE 1V7ML 4P2QD 2WIMA 2YZ8A 3BVNA 3CLFH 4WEBL 1LWRA 5JQ6L 3BQUD 1EEYB 2IG2L 1EVUA 4Z8FL 1RURH 3D69B 1D5MB 4IHOB 4CU8A 2P8PB 3SKNA 1B0RA 2BERA 4DEPC 3V8OA 3ARZA 4PJDE 3P9MB 4WW1B 4LLDA 3DUHA 2H2PD 2NCMA 3WO4B 3C08L 1X44A 4ONFH 3FRPA 2Q86A 5DEGA 3SKMA 4ZG1A 4OI7A 1U8PB 3D39E 3F8UB 4G6JL 4QRRB 3P0VL 2ADJA 1LILA 2A73A 1J0ZA 4QT5A 4QY8B 4XXDA 3X3FH 3U0WL 2RGSA 5I1CL 3HZMB 2NY2C 2D31B 5T3XL 2UWEE 2D4FA 2WWKO 5BQ7B 4PJGF 2DL9A 1BOGA 1ZGLP 1W72A 4UZGA 3GJFK 4EKXA 4XP4H 1FL3B 2DQIH 1IKFH 2W9EL 3QQ9D 5GQBA 4EN3A 1ZLVK 3TVMB 1A6AB 2E8ZA 4X8XA 4UNUA 5HHQB 3N85H 4GRWE 1FLRL 4A6YL 2KPNA 1FNHA 4PJ9B 3VFGL 4YUEH 1RHHA 3FQXB 4NN7B 1JHLL 2DBLH 2CXGA 4XTRD 4OGYL 5IV2A 5HI5D 4UQ3B 2BC4A 3DO3A 4N8VA 2E9IA 3NFSL 1NUGA 2HTKC 4MAYB 3KXFD 3HPLB 2DQEH 2CXKA 1IZJA 3PWNA 5I74B 3ZL4L 2NX5D 3DURA 1MSPA 4I18C 3O6LL 4PREB 2H2SD 1N8ZA 2NYYD 3ZZ1A 5IOPA 1FG9C 3SN6N 1U8QB 1Q0XL 1XGPB 3QYCA 4DN3H 1J05A 1OSZB 4I4WB 1UYWL 5EH1A 2IH1A 2V2WB 2QLVB 2F53E 4DVBA 4UBDD 4M62H 2GTZB 2OZ4A 5IW1A 3STBA 1MIMH 4J3OC 4GQ9H 1T1ZA 1BQSA 2EECA 3P0YH 2I26N 2GEEA 3FQTB 2PTVA 1XAUA 2Y1VA 1T1YB 4G43A 3NN8A 5EU4B 1JHKH 4DVRL 1I9JL 2XZQH 3OB0K 3U0PB 2EO9A 3FRUB 4OI9A 1SY6H 4OCSL 2QQQA 5TGBA 3MRLA 3HB3C 4U6HA 3TBVA 2OP4L 1NBZB 5KS9A 2Z31B 5TFSH 3ARVA 5CP3A 3VWJA 1X7QA 4XPTH 1SEBA 4JQXA 3S34L 4MYWB 1SJVA 1X5HA 5FAAA 2EYRA 5DA0B 5JW4N 3T0WA 2NTFB 3L1OH 1WFOA 2BHYA 5GS0L 1VPOL 2X4OB 3R8BB 4TUOB 5IUSA 1N5AA 4U0RC 3O4OB 4M1DH 2DQTH 3I6KB 4PJCE 4C55A 1V7NL 3PWLA 1FYTE 2V5TA 3O2WL 4AEHL 3GSWB 1E27A 3O11A 4X6CF 2R0LL 3ULUC 5MENA 3PGCB 4ODXB 2P43B 4LU5L 3CFEB 5DJYB 5K9JL 1NGQH 2ADIB 2CQVA 1G9MC 5IW3A 4PP1D 1GC1L 3MLYH 2N4IA 4YHIA 1WCBA 2CLZA 3LSOA 2H3NA 1FVCB 2HT3D 3TBYB 3OPZH 2B2XL 43CAB 1WWWX 1SJHB 3QEHB 5CP7A 2D7TL 3SCMB 4JDZA 1DBKL 3CPLB 5EZIL 1DBBL 4JO4L 5KVEL 3MCKB 3EYSL 4U6VL 1KTDA 4QRPD 3HMXL 1A21A 1G9NH 3TA3C 1KJ3L 4JANB 5T1DL 4LHUD 1VDGA 1KTKE 4WVRA 5C08A 1A6TA 3HFMH 1QLFA 1P84K 3EOAA 4NCDA 1XGQB 2IF7A 3EOYG 4MQ7A 4HS8L 4MA3A 5DMIH 4AT6B 4U3XA 1EO8L 2OR7A 1DR9A 2HKHL 3MRNA 4I2XB 1BBDH 3QDME 5C6WH 1ZLWK 3NCCB 1SVCP 2MPAH 4WHTB 1YEKL 2DLEA 3MV7D 1P4LA 4HUNB 4HKZA 3IKKA 4XP9L 4LP4A 4WHCA 3FCTB 1NSNL 4AEEA 2I24N 3RWHB 3WBDA 1FZKA 3QULA 1QSFE 3PDOA 1JYNA 1MRDH 3C5SB 4X7TB 4V1DB 4X4XB 4Y1AB 1AY1H 5DEZA 1RIHH 5LCVL 1VSCA 2IBGA 4U2YA 4TUJA 1GGTA 5JW5A 1C8PA 3LPWA 5EBGA 3FB8B 5KVFL 1U3JA 4NIKB 5DUBA 1HCFX 2BSSB 4LRNH 5DJ8A 4WWKD 1CD0A 4G6MH 4P2OD 3VXQB 3QFJE 3B9VA 1MFCH 4RA3A 3GO1H 1T83C 1WZLA 3FZUC 1S3KH 3BHBA 3U46B 3JWOL 2CUHA 3GB7A 5KAQF 3BPNB 3H42H 4YR6A 5SWZD 1PSKH 3QG7H 5DRNB 1AGBB 5HPOA 1CE6A 1CFTA 1BIHA 1XGUB 1MFDH 3CSPA 3QHTC 5FGBC 1I8LC 1GGBL 2UZIL 1XF5B 1NDMA 2P5ED 3OR7A 2XTJB 3A6CL 4WU5B 3TFKD 3IFLH 1F97A 5I17A 3D18A 5SX4H 3MA9L 3WD5H 4YHML 1TZHB 4ZNEA 2H1PL 4UT9H 4Z78A 2Z35B 2YR3A 1MCWM 1VACB 5FA3B 2VKWA 1OF2A 3MGOA 2HT2D 1DUYA 5TDPB 4IDLA 1KTLB 2V9RA 1BFVH 1LDPL 4HK3J 3RUGA 1CDCA 5ILTH 3UTZB 3ZKXB 4EI5D 4WNQB 4M7JL 5EU6D 2VDQH 3Q5OA 4NPYB 3MRRA 1KULA 1K2DA 4M5YL 3QHFH 4Y4HD 2VZOA 5F88A 3K8LA 2VDKL 3LDBB 5D1QD 4OZHE 1MLCA 4FTVD 4H88H 1IT9L 1EJ6A 2YPVH 1KIPB 1TFHA 4J7RA 5FA4B 3KPRD 1NC2B 1GGIH 1QPXA 1QBLH 2XWJB 1I3RB 3KLAB 1IGML 2BVQB 4Z77A 4R4NC 5ISZD 3MNWA 3NA4A 3JV4B 4JPIB 4LVOB 4I0PB 4KRLB 5TPWH 1UM5H 1UKTA 1AO7B 4HH9B 1JRHI 1HI6A 5FEBA 3AXLB 2BX5A 1I1AC 2QQLL 5IT2H 3V6BR 5BV7L 1T6WA 5KN5A 5HYJB 3VDBA 4KC3B 2C3VA 2X9YA 5ID1A 5GRUH 3RKDD 4KKBC 4LHUB 1HHJA 4XBEL 1OAYH 3ZYZA 4ODWA 5GS3A 4JRXE 5IK3A 2AXFB 3S96A 4OKVA 4NM8L 1DQML 4N0YL 2BMKB 3GMLB 1QKZL 1BZ7B 4QOKB 5IKCB 4K94H 5E9DA 2XKNA 1HYRC 3LRSB 4EDXA 1A7OH 1IEHA 4K3DH 4NO3A 2B1AL 4GRLD 4MJ2A 1A14L 1FZJB 5K9OA 4TVSa 3RZCA 3MV7B 2HJFA 2VQ1A 5GRJH 3IXTB 5FXCH 1CDIA 3CFIC 1F2XK 1AXSB 4M6MH 1KCVH 2XQBH 4FP8L 4I77L 3BEWB 4WTWA 3SJVB 3OAUL 3DRQA 1MEXL 1E4XI 3CAFA 2BVOB 4P4KA 1L0YA 1U58A 2HG5A 4M7LL 3GIZH 5CKAA 1EHXA 1NLBH 1VFMA 2IGFH 3ZTJG 1IE5A 3ORJA 4X4MA 5E4IA 5F7DB 4KV5F 5SX5H 3WJJA 4JN2A 3UJTH 1HHHB 4XRCA 1FORH 4GXUM 4YZFF 4P3DB 4P3CH 1UZ8B 4QWWC 1KIRB 2FEEI 5C8JA 3V4VH 2NR6C 3GJEA 5E8DH 1GHFH 3B2VL 4K3HA 4XVUD 4LDLB 3OG6B 4QXWA 2Y5TB 4NWUH 5GPRA 1T03L 4GMSH 3V5DA 2JK5A 4GG6A 3TPUB 4KTEH 3HG1A 3QJHA 2J8UA 4R2GC 1A22B 1G7PA 1KT2B 3CC5B 1LP9A 3B83A 1TIUA 1BD2E 2UUDH 3VWKA 4JRYA 4XC3H 5HGAA 5LVEA 2EZ0C 3FAXA 3Q1SL 4A2MA 3D87B 4N0CC 5I1KH 3UMTA 1U8KA 4GKNA 1JGDA 4RMRA 3MRGA 2MHAB 5T3ZE 4X6DA 1J12A 5I16A 1WT5A 4HPOL 2RCSL 1PG7L 5GZNC 5JA8B 4LGSB 1UWXH 1OAZL 3L3IB 1YDPA 1BAFL 5K9KA 1WEJH 1I7ZA 4JZJA 5HPMA 1V05A 5IG7A 2BRRL 3QO0B 3KLHD 1ZT1B 4UT6H 2W1NA 1P5UA 3D85A 3B3IB 3UROR 4B5EA 3DX7A 2BFVH 5EU6B 1VADA 5FCUL 4E5XB 4PD4J 3MXWH 3IJHB 4LFHG 3V5KA 4ELKA 4L8SB 4MD4A 3V0VA 4QCIA 3S37X 1IC4H 5I1AB 4MSWA 2BVUA 3TN0B 1PGRB 1NUDA 3EIFA 4UIKL 5DQJB 5C70A 4X99B 2ZCKH 1IM3B 3GM0A 3WLWD 3UBXA 5JHDD 3E2HB 3MLWL 4YDKH 3PGDB 5DHXB 4PTTB 2QKIB 1W8NA 2FSEA 4KXZI 4UT7L 5A2FA 1XGTB 3ULUE 3S37H 4KGJA 5ANME 1CLYH 1BFOB 1NJ9B 4MVBD 5GSRA 4RCAA 3U4AA 2I9TA 1A3LH 4LASH 5FIEA 4QHMB 3DROA 2HMID 3WN5B 3MLTB 1XMWA 3WL9A 1YMHA 3U7WH 3GIVB 3ARDA 2O26U 1YEGL 4PRPE 3TO4C 3LKOB 2AGJL 3T77A 3FN0H 3KYMA 1EO5A 5DDHA 3HE7D 1MLBB 3FQRB 2VXQH 3V52L 1MCWW 1FE8L 2MCG1 4F80A 2PO6D 4YPGA 4L4JA 4LVHC 3ZTNL 5IW6B 4QRSA 3G5YB 3QIUD 4HXBH 5HI4D 2PTUA 4KKAC 4NN5B 2I27N 3NZ8B 4PRIB 1RJZA 3FT4A 1EXUA 2VZTA 3MRKA 3DYPA 4LEXH 43C9A 5KTEH 1NFDF 5I8KH 3C5ZB 1G7HB 4GRLB 4L8DB 5ECJE 1GOFA 3X12A 3VFVB 2DAVA 4PJFB 5EIIB 3PNWB 1PG7X 3ULVF 1TQCB 2X6MA 4HEME 4JFFA 2E8YA 2VLJD 4LIQL 4XVJH 4TUKH 5DD0H 3RX7A 2F74A 4KK5C 1IM9B 4HJGB 5KVGH 1JWUA 1NFIB 2BSRB 1NBVL 4JAMA 4P2YA 2NY6D 3K80A 2YPKA 4G3YL 3RWCA 5EZJB 1EUTA 3WYRA 2ZCHL 4RISL 4MNQA 2Z93A 5J6HB 3FB5B 3DBXA 3QBTB 5ALCL 3U4BH 4NUJA 1F3JB 4JM4H 1ZA3A 1N59A 3NH7L 3HNTL 3IFOB 3SPVB 4AQOA 4ZO9A 2R0ZH 3IJYA 2CK0L 3CFBA 1OOAA 4NQVA 5DQ9A 5KSAB 2QSCL 3OKKA 4IOIB 4UIMB 2W07A 2A6JB 2HH0L 4PRHD 4AK1A 3VWJC 4JY6B 4K23L 4FFZH 4JQXC 4BFBD 3ULSB 5A3IC 4LQ1A 2GJ6D 2EH7L 2Y7QA 4G7VL 3T0BA 5MEOA 1ZVSB 3CGTA 1DVFD 1ERNA 4Z0XA 4OLWL 2Q8AL 3VGFA 2OK0H 3ZE0F 4KVNH 1A5FH 3IDMA 3QEGL 3QG6A 4GKZA 1D5BB 1TVBB 4TSCL 3LEVH 3QUKB 4ZD3L 2PYEE 2FGZA 2R4SL 4XBGB 1BQUA 4PJHA 5CEZL 2FYYB 5DQDH 3QXAB 2P47B 2JELL 5DF0A 2P1YA 4H1LG 2IH3B 4U1MA 3GNML 1QACA 1W0YT 1NLDL 2B5IC 2VOTA 4BH7B 2VITA 2E6PA 2NLJA 5F1IB 3QEQE 4MAUH 1A7PL 4Y7MA 5CJOL 3VGDA 1MRFH 1ZTXL 3MOQA 3PJSA 4Y5VC 2YRPA 1T5WB 3HR5A 4NJAH 3UPAA 1CL7L 3LN4A 3IDIB 3BRFA 4GW5A 2HFFB 1A7BA 5JZ7D 4PIRF 4IS6A 4CGTA 2V5YA 1G6VK 5E8PA 4OI8A 1MOEA 2QR0A 4MXWH 4XNZC 1QRNA 4XP1H 1UA6L 3NA9L 2QV2A 4GH7B 4P48A 3FFCD 5ESVB 5AUMA 2EXYD 4KI1A 1IGCL 3QPQC 4G42A 4BZ2H 5J1SC 3T0DA 4ENEC 3L7EA 4HS6B 2W9DL 4Z7OF 1UH3A 4TVPE 1JGUH 5T5FH 3BUYA 4YDJA 1V5JA 5EULV 3L3KB 2JJVA 4Z7WA 3T4AA 4TOYL 4HLJA 4OF5A 1D6VH 3VGAB 1I1RA 5D7LA 1INDH 1HYSC 4X5WA 4P9MH 1HHGA 4NP4L 2G9HB 1YN7A 1E28B 4NCC1 2XQYK 1NCBH 4NO5A 2FIRT 4QXGL 2HRPL 1AGCA 3IU3A 2XA3A 3WEXA 3X14A 1ITCA 2VABA 4ODHL 1T04A 5JW4R 4YEEA 5GRWA 1M7DA 3AAZA 5AZ2L 2OL3A 3BJ91 1T2QL 3T4YB 2E9WA 3D25B 3GSUB 5EPMA 1VFAB 5DVMA 4PJDF 3ZKMC 2EDQA 1G1CA 5J12B 3LD8C 2BNQB 2X4UB 3DUUA 5TE4L 4EBQL 4S1SH 1NMAL 4FZ8L 1T1XA 2FX7L 3QUXB 4EOWH 4WUUE 4IRSD 2R0KH 3GMMB 3VXSA 5ACZA 3D3VA 4M4RA 4N68A 4PY7B 2GSGB 3UTSE 3BH9B 5JOFB 2NY6B 2UWEF 3EGSB 1BIIA 2DL2A 5I1GH 3T2NL 1FV1A 4WO4C 4BH8A 4HGWA 4HWNA 5EU5B 5FECA 3L5XH 1YMMD 4HFUH 1PQZA 1U8NB 4LQFH 1WC7B 3REWB 3KLDA 5CIPA 1NBQA 4X9FA 4KUCD 3U30B 2P8LA 3C9NA 2WIIA 3EO0B 5BRZE 4WJ5B 3SGJA 4HFWB 3L7FB 3S4SB 4JPVL 1ZGLB 1KIQA 1SMAA 3BT2L 1G7QA 5D1ZB 5H2BB 5B4MD 4GRWF 2EC8A 1WBYB 4P5MB 3MXVH