2MCPL

Refined crystal structure of the mc/pc603 fab-phosphocholine complex at 3.1 angstroms resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
220
structure length
220
Chain Sequence
DIVMTQSPSSLSVSAGERVTMSCKSSQSLLNSGNQKNFLAWYQQKPGQPPKLLIYGASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDHSYPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined Crystal Structure of the Mc/Pc603 Fab-Phosphocholine Complex at 3.1 Angstroms Resolution
rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords IGA-KAPPA MCPC603 FAB (LIGHT CHAIN)
total genus 41
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1984-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcpL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcpL01
3MYJA 5C0FA 3QHFL 1WJ3A 1NCTA 2A6IB 5HHMD 3IFNH 4I48A 3QXAB 5IEHA 4ZUVB 1M6OB 4QHKI 4RDQG 1G6RB 1OD7A 3TIDB 4U1NA 3BEWB 1Q9WB 2EC8A 4ZFOA 4NUJA 4B50A 4KZDL 2IH3B 3PDGA 5FGRA 5FYKL 4IRJB 2CJUH 1RMFH 2ORBL 1HHGB 5C6TH 4NQSA 3NFSL 1DBMH 2FL5A 5ESVA 5DD5H 1Z5LA 4NDMA 2XN9E 3HE6B 3GK8L 4N5EC 1LK3H 4P23D 1NGPH 4QHUB 3UYRH 3HNSH 4KKBD 5J11C 2FGZA 3K1KC 2XZQL 2Y23A 3HTLX 4NN7B 1FNHA 3HPLB 4EI5A 1CXFA 1CXLA 1FBIL 3SDYH 1T7YA 3GMRA 4OFVA 4E42A 1H3PH 1KENH 3VXSD 3T2PA 3MLXH 3QHZL 4BFIA 3MJ9L 4M93C 1TJIL 4HC1L 4M8QB 3V5KB 1KCVH 4HHAB 1MFDH 2PO6C 1P9MC 2ZJSL 1MHEB 3FO2A 5HGAB 3WN5B 3QDMB 2NTSP 2R2HA 2XXMB 4ELKB 4F7TB 1MIEL 3WE6A 1NSNL 4JRXE 3UJJH 4G9FE 1ZLSL 3LEYL 4ODXA 5DJXB 1YNLL 3QYCA 4G6JL 5AUMB 4LEOB 1NGYB 5IIEB 1SMAA 2J12B 4X4XB 3BZFB 2RB8A 1RZKH 2DWEA 3CLFH 4GKNB 4KTDH 5JOEA 4M61B 2AW2A 4X6DB 1UM4L 4KK8D 3EOYG 2E8ZA 5CIPB 7FABH 3WUWA 2VZ1A 1UWEH 4NJ9H 4U1JB 2V5YA 5EO0A 1F90H 5JLZA 4G6KH 1MCSA 5F9WC 5IESH 3GJEB 4F15B 3CSYB 3PXJA 2AKRB 3REVA 3Q5OA 4P5MB 4M4RA 3FRPG 3KLHC 1MFCL 3GSQA 4HLZH 2VLLA 3MOBL 5I1DB 1TZGH 4QRUB 5L9DH 1PAMA 1NCAH 5E6YA 1D6VH 3GSWA 4M5YL 3W0WE 4KDVA 2ZCHH 4ZTOL 4NFDA 2AJ3A 3VFUA 3M8OH 5GRJL 4LSPL 1JWMB 4GRLB 1CICC 4PIRF 1YNKL 4RAUA 2P5WD 2XQYK 3LKSA 1NBYB 3PWVB 4KK6C 3B2VH 1ZLSH 3NTCL 1CR9L 1JIBA 2FATL 2PO6D 2Q86B 3T77A 3QAZC 1JN6A 4I0PA 3UYOD 1QFOA 2CMRL 1YC8A 1A9EA 4OLZL 3CC5A 3FT3B 5HYQA 3N0PB 1NL0H 4KKLC 3PL6B 1NC2D 1TZHB 1TZIA 1RUKH 1S7WB 2FJFA 1RULH 1UXWA 3MRMA 1P6FA 1N6QH 4E9LA 2QSCL 5E2VH 1JYWA 4D94A 4HFWA 3ARBD 4P59L 3VWJD 1MCPH 1KIPB 5T5FH 1X5ZA 3VI4E 3EYFA 5L88L 5I8CB 2CKBB 3HUJE 2A6DB 4J7RA 2F5BH 2DQHH 2A73B 3MJ6A 1P4LA 1KUMA 3SHSA 4OV5B 1DVFD 3T0XA 4XI5D 3RI5K 4C55A 2OL3L 35C8H 3EYQD 4LVOC 3VFTA 4OLUL 3EW3B 4P9HL 4DOHE 4Z0BH 1RZJH 2O61A 3MLVL 2ZG2A 5JMRA 3DV4B 2D31B 3F6IA 3QG6A 1I3GH 5FKAB 3WNLA 3V5KA 4OCLC 4X7SL 5C2UB 4QHLB 3HNVH 2VISA 4L8CA 1T0NB 2VE6B 2ZUUA 2BVUA 4EZMA 1TVBA 4A6YB 2JELH 4GW5A 1YEKH 3FO1A 1RJLA 4LEOA 4HUXB 3EYVA 1YNLH 5FYKD 4JVPA 1YA5A 2GITA 2OJEB 2CKBL 5IB2A 1AGBA 1QRNE 3GJFB 4XB8A 4TRPL 2G2RA 5GS2H 3O81A 5D2LB 5K9QG 2P5WB 2YEZA 4G8GB 4P2QD 3PP3K 5DUBB 3CXDL 5BS0A 5L8LB 1KSRA 3SOBL 3TZVA 4ELMB 1NCCL 3WXWL 1U8PB 4LLMB 4K3DH 2NTFB 1I4FB 4BQBA 5C86A 3LKQA 1G0XA 4FHBD 4XP9L 5CP3A 3OHXA 1UWGH 3H6JA 4JRXB 4UAOB 5D5ME 3IDYB 3ZO0A 5JW4N 4A6YL 1HNFA 4PJHA 5BZDA 5CJ5A 1J8HB 1HZHH 5D2NC 5BW7A 2BOBA 3WIFB 2IBZY 1H8NA 2HFGH 3FB7A 5C0ND 4Y16B 5KSAD 2BNRE 2H2SC 1J8HD 5D7IB 4CVUA 4XNZB 5HD8C 3NACL 5AAMA 4X6EA 1QNZH 4FQXA 3ZKQD 2YXMA 2OTWA 4MCYA 3MO1B 1IL1A 3VXRB 4DN3L 3EDEA 4OF3A 5C0AA 2IQAA 4LGPB 4O51B 5J56B 1ORQB 2OLDA 1IFHL 3RQ3A 5EBGA 5E7FA 5E2TH 1KB5A 4JQIH 1NCDH 2W38A 5E99L 1A2YA 2Z93B 1ZHBB 4WU5A 3UJIH 3GSNB 4G8GD 3S36H 3ZE1F 1IEBB 3H9ZA 1F8TH 1DLFL 2X1XR 4FRWA 5A3ID 2H6PA 4CADA 2N56A 3UJTL 1VFMA 1XF2A 3MV8E 3R0NA 1YMMD 2ICWJ 5I18H 2KZ1B 3H7BA 5I15L 3D25A 3ZDYF 1XGUA 1PGRB 1RV6X 1H3TA 3B2UC 4ZS6C 3IDJA 2YD3A 4Q9CA 4BZYA 4HZLB 1MRDH 5IW3A 1N59A 5I1IH 3MA9H 1OCWH 3LB6D 1VGEL 4L1DA 3CZFB 4TQEL 2VDPL 4P3DA 3T65A 4CL7A 4OZGF 1BD2B 5IG7A 3CVIH 5HHNA 3MRHB 3ARGC 3QXAA 1TTUA 4P2QE 2RIKA 5T3XE 1J18A 2W91A 4PV9A 4GW5B 4ZNCD 1DVFB 3BP5B 5I6XC 5JW3H 3IXTB 1QO3A 1J1XL 3BUYB 3MLXL 1XIWD 4NKIL 3SE9H 5GGTH 4CBPA 4JG0H 1JMZA 5DRXB 2ESVB 2NW2A 3VXOA 3VXPB 4H8WC 3GKWH 3QPQC 4LSRH 4Z7NE 2Z31C 3VG0L 1C8PA 3MRLA 4RAUB 3T3MF 5HHME 5BQ7A 5L88H 2PXYA 2I5YH 2R4SL 2G5BB 4JFDD 5DD1H 3GUTA 1U36A 4YDIL 1VACB 4HPOH 4H1LA 1JN6B 3A6BH 5FHBL 3BQUA 2HKFH 5GS3A 2HG5B 2VXUH 3OXRA 1F4WL 1SM3H 3BWUC 2WP3O 1BBJB 5C0DB 4LP4A 4KKBC 32C2A 4YPJA 3OKEA 5D7SH 1VFBA 1IGTA 1I7RB 2IFFL 1EJOL 2J6EA 4HSQA 3ZYJA 4LLAA 4M7KH 3S4SB 3JWOH 4FQQB 1IGYA 1RUQH 3OV6A 5B8CC 5E2TL 3T0EE 1IL1B 3BWAB 2YUZA 4YXKH 4GAGH 5IW1B 4P5MA 2AKRA 2L7UA 5HHXH 2NX5E 1O7VA 1HSAA 1IC7H 5JW3L 4OCSH 3RVXD 4PTUA 2WNGA 3L5JA 1CE6A 1G7HA 3HMXL 1UC6A 1CFVL 5CEZD 4ORGB 2ZUWA 3FB8A 5T1MA 2R1WA 4QOKB 1IBGH 2BHYA 3VFWB 1DBBH 4Z7UF 5E08H 4PRPD 4D9RE 5EOTB 3QEUA 3HR5B 3LKPA 1MJJB 3ZSTA 4XBGB 3V6ZA 2B1AL 3GI9H 1RK0B 5KVFL 4X5LA 2AVGA 2CGRH 1FN4B 4KWUA 2P45B 3QQ9D 3QEQE 3VD3A 3MC0A 3EOAB 4NN5B 3ARPA 1WLHA 5TE7H 4BZ1L 4MA7H 1MCKA 4V2CB 1XH3A 2P5ED 5IMKB 1TIUA 3RPIB 3JWDL 3SKNB 4N8CH 1ZV5A 4WO4A 1S7WA 2H41A 3I75B 3TO4D 2ZUYA 1TMCB 5AUMA 1NGYA 4H25B 4OCWL 4HC1H 4PJCA 5D7LD 5IJVA 2K3TA 2A6KB 3D39D 4WHCA 2Z8VC 4A6YA 5JDSA 5E95B 1J10A 1AXIB 1I8KB 3HZYB 3U0TA 4ONHA 1KELH 4JY5H 2A38A 2A1WL 4W4NA 2EDXA 3CFKA 1SJHA 3REVB 2F5AH 5E5RB 4PRHB 3UDWC 3QIWB 3RGVD 3CK0H 4R3SB 5FUZL 2DMBA 1FIEA 4NJAL 2HTKC 3VFTB 5HVHB 1FVCA 4UILH 4LRIC 1WT5C 3HG1B 3KWWB 1MAML 5ICZA 5HYSA 1U8PA 2DS4A 5KVEL 3GRWL 4L5FL 1FRGL 4NKMB 3U0PB 3HG1E 4W6YB 3DMMC 2CRIA 4YXHH 2EE2A 2ZWLT 2VL5A 4PJEE 3DRQA 3DGGA 4RBPK 1SJVA 3KYMB 1HILA 1FYTB 1KPRA 3P11H 5F7EH 3NAAH 4W68A 3V6OC 4HUXA 4X6DE 2IALB 5L6YH 5EPMB 1BX2B 1VFAA 3IFOA 1DQDH 3L95A 4GKSB 4JFXB 4QOKE 3ZHLA 3V6BR 3RBSA 4HT1H 3P30L 1FH5H 2QKIA 4HFUH 4KROD 4LQFH 1KFAH 4XHQA 3TBYB 2VDKL 4PJGE 5J13B 2HAZA 2NXYC 3ABZA 1CXHA 3X13B 5C08B 1TJHH 4L4TE 3X3FH 2DWDB 5ISZE 4EOWH 4QRPA 5D72L 1GC1C 4OD2A 5HHOE 5SWZA 3DVNA 4QO1A 1AHWB 5T1KA 5E56A 5F1NA 1VKXB 3C8KA 1B3JA 1D5IL 5JOFA 2BXZA 3QO0B 2IMMA 4RFNC 4PBVC 4IRSA 4KJYA 2X9YA 3LN4A 4E0RA 2GSGB 3FB7B 4JPIB 1MPAL 2HFEA 4HKBB 3C60B 2FGWH 1F6AA 2ICEB 2Y25A 3TBWA 1CLCA 4H26B 4OFYD 4Q0XH 5BRZA 1HHIB 3I50H 2HJFB 5LBSL 4OF7A 3C09B 4LPVA 1QRND 3I6KA 1RZFL 4MA7L 5DJZB 1ZVSA 3KYOA 2N1KA 2NX5B 4HF5H 3FFDB 5HHNB 1Q0YL 3PWUA 5D7KE 3UZEA 4CW1B 2OS7A 4U6XA 1NCCH 4KDTC 3VI4F 5TQ2H 3KNBB 2E7LA 2YPLD 3KPTA 5I76B 4WI8A 3HUJF 3DMMA 3U30C 1AI1L 2MOVA 3PGDA 5JHDE 1KGCE 1FC2D 2GQHA 2QLVB 3MNWB 4WI6A 5D2LA 1I3UA 1P5VA 4WTXA 2B5IC 4R7DB 3MRNB 3KPQB 1M05A 4HQQL 5D2LF 4WNQB 3OKYA 4LVOB 2B1HH 1GGBL 4LGRB 5FO8B 4FTVE 4XPHL 3O6FB 3FAWA 5EU3A 2X2YA 4Q6YA 1E4XL 4FQCH 4XVUD 3BHBB 3TJHD 3U1SH 3QCUL 4FZ8H 1JV5A 2B1AH 3GI9L 2MCPL 3MR9B 3T0EC 2OJZL 3GMOA 3IDIB 4YBQC 3G08A 5MEND 2VR9A 1P7QD 2R9HD 1CGWA 5KTEL 3CCHB 1BX2A 3PL6C 3QI9A 3TIEA 1KFAL 5D8JL 1SHMA 5J89A 2HTKD 2UUDH 4GS7B 4P4KA 1BIHA 1NUFA 5DJDB 5DRZB 5JO5A 5BXFB 3NA4A 3JSSA 1B2WL 2AV7B 1G7IA 4GBXD 1F3RB 4PB0L 1LE5A 4NGHH 2Q76B 1CXEA 4KRPD 1QVOA 1VESA 4ESKA 5T3XD 1KTDB 3MRKA 4TN9A 1B4RA 3MCG1 4JHWH 5DRNB 1HN1A 3BSZL 4AENB 1RURL 1XF1A 1PLGL 3P4OB 1CT8B 4O4YL 2I07B 1ONQB 4KJWD 1ZTXL 1U58B 4XP5H 2HG5A 1ZMYA 4X5WB 1J8HE 2H6PB 3FB8B 1ZEAL 5T1MB 1AGEB 5IVXE 4MNHA 4WWKC 1NAKL 5C3LD 4M1CD 4WUUB 1RUPL 1I1AB 2AQ1A 4PRID 4U2YA 3T04D 1N7MH 1NCNA 1U8LB 5LBSH 1NKRA 4DKDC 4F15C 5A40E 1IQWH 5T1DL 5F3BB 1F6AB 2ICEA 4TVPE 1JL8A 4M5ZL 2PW1A 4MA1B 1GGCL 5DD1L 4I3SL 5IR1A 2GT9B 5EH1A 4EBQH 4Y19E 2D03H 3L5XL 4P46B 4OZFG 5IW1A 1OLZA 3ES6B 3BRGC 3VFVA 2OL3B 3F6LA 4JFPA 1HINL 4PV9B 4G5ZH 4LVNB 5MP6H 2R1XA 1RIUL 2PYFB 4MDJA 25C8H 3F62A 3L3DB 3ARED 3DTXB 1ADQA 5FOJA 1HHGA 3LSOA 4JEGB 1PD6A 4PJ8A 1LK2A 2XI9A 4Y0GA 1RJZB 2D7TL 3U0TB 4Y2DD 4ZOAA 2G9HA 3ZDYE 3BDXA 4M7LT 5EOTA 3VXRE 5HYJE 1ZWIA 5I1JL 2XG4A 4NWTL 3LH2H 4UMGA 4KXZI 3D85D 4XNXH 5FO9B 2BSTB 3QA3A 1FGNL 2PYEE 1URLA 3LQAC 4Q74A 3L7EA 4QRRB 2HKHL 3T3ME 1Z2KA 4X0KA 1F3DH 2CRZA 3QIBB 3EFFB 3VCLA 5I1HL 3ZE2F 2X4OB 4RNRB 1R3KA 4WI5A 5GRVK 1A3RH 4H8WL 4I77L 5CKGA 2OMNA 4MLSA 4LCUB 4HWZB 4DVBB 4KRPB 4Z78B 32C2B 1KXVC 2ZOLB 4PRPE 1Y0LB 4RGNB 1EH9A 5DHYA 4NUJB 2AK4D 5IJVB 2HN7B 3F7QA 3JWDC 1UB5A 4TUKH 2CLZB 3DSFH 5I1GL 2E7CA 3F5WB 1UA6L 4YDIH 2AEPL 2B8OT 4G43A 4LNVA 1NGZA 3GM0A 4PJ9A 1MHCB 3PP4H 5KJRH 1S5IH 3ZT7A 2V5MA 1JYXA 4JJ5B 1MJ8L 1U2HA 3JVGA 4P2OD 4IMLA 5EBWA 4WCYL 4HK0B 4N9OB 2VZSA 5JDJA 2P47B 2XRAH 2D7OA 3DIFA 4KJQC 4ZFOB 1A6WL 4BSVB 4GKZA 5HYSB 1F13A 4U1MB 3KDMA 4GFTB 1I3RA 1NMAL 1OGAE 4RBPH 4HC1A 4YGVA 2BSRA 4L29B 3MJ9A 2VLJB 2EIBA 5BVPH 2JJUA 2A1WH 2LTQC 2BCKB 3MLSL 1CGVA 3HUJB 3L7FB 5MEOB 1P7QA 3EO0A 5EIIB 1PSKH 4XCFH 5EDXA 4GW1B 3SDCA 3WFEH 4AT6B 1KF9B 3BN9D 3LHPH 4KJPC 4JPKH 5SWQA 3HRZA 4YZFF 4GAYA 3SOBH 5IT2L 1EFXD 4GW4A 4TVPL 2V2WA 4XNQA 5JHLH 1MCCA 2ZG3A 5EWIH 1P2CA 5DD3L 1T1ZB 1XCQB 5I2IB 2R39A 4WI9A 4WWKA 4D8PB 5I1DA 3FFCD 5IK3B 2VLKE 3OGCA 4MDJB 5TDPB 2HLAA 3U79A 2CGRL 2R56L 3OR6A 4EDWH 1T2XA 4Y2DB 5L2JB 4U1GB 4RGMC 5CIPA 4JO1L 2Y07H 1MI5A 1VGEH 1BOGB 4X6DF 4X6BA 3TNMA 2ADIB 2V5TA 1CYGA 2E7BA 4YR6B 5CEZL 3DX8B 4FQLL 4LAQL 4NZRH 2VXTH 4IEFB 4LKXB 4BZ2H 3FRPA 3MRGB 5FO8A 2VR4A 1D7FA 1CLOH 1GIGH 1CVRA 1HQ4A 4OM1H 4XXCC 2HVKB 3GMPB 2DQGL 5ERWA 1NAKH 5EU6B 1UJ3A 1HHJA 1V5JA 3NGBB 5CCKL 4NBYB 1NUNB 1CE1H 3OKMA 4JFFB 3L3OA 4BH8B 3VFGH 3ARYA 3WYRA 2FZ3A 1MFAH 3C5SB 3FN0L 4L3ED 5LWYL 3D3VD 2O5ZL 5D93C 2WANA 4IHOA 1AFVL 4LFHG 3V6OE 2ARJB 3BPOC 3VD9A 4OB5H 1A1OA 4OI8A 1CDUA 2XTJE 2UWEA 2FB4H 1HWHB 2W0FB 5CEXB 1BZ7A 1ND0B 4XP9H 2YMXL 5CD3B 1CDJA 3GKZA 4TUOA 2AS5M 1BFOB 2I24N 5A2IH 1HKLL 3SKUD 4O58L 1LE9B 3MNWA 3NAAL 4ONFH 3GK8H 4NDMB 5I0ZA 1S9YA 1E4KC 1ULVA 4U7SA 1IM9B 4OAWA 1BFTA 5DJDA 1WTGT 5C6TL 1NCAL 3ARDC 3LS5H 1CBVH 2XRAL 5FDYA 2R8SL 3OR7A 3QEQD 5KVDH 5I66B 3BHBA 4M6OH 4AENA 1I1AD 5SWZB 1XGTA 4JO1H 4HIXL 4G8FA 4IS6A 3U7WL 4QRQB 5TPWL 4ZODA 3SO5A 2CKBA 4FQIL 4PJBF 1J5OL 3WV0A 4FXKB 3VFRB 4NYLA 2DKMA 3T0WA 3O0RH 3FL7A 4N68A 2VO5A 3QZWA 4S1RH 4YBLB 3B3IB 2RBLA 1U8NA 1U8HA 5D5MB 4I0PC 1EO8L 2YD9A 2EZ0D 4YFEA 5D1ZA 2DQJH 5JOPD 2I26N 2XZCH 3HLAB 4PJDF 2VWEC 1CVSC 4X9HA 4A2MA 1VA9A 4K71B 3OGOE 1IJ9A 2C3VA 1H3UA 3MREA 5C0CA 5IHUL 2HKFL 4HKJA 4CN1A 3UBXI 1AD9A 3PHOA 4OCNC 5IVZA 1ADQL 2DQTL 4I9WE 4XMKL 3RZCC 3LAFA 3BXNA 2XG5A 3NN8B 1FL6A 2QBWA 2GTZA 5D96C 4LSPH 4OIAA 1WWWX 1AGEA 2C1OA 2AAVA 5C09B 1BVLA 4O5LH 3WFBL 3FB5B 5D1QC 4LCCB 1A0QL 1UCBL 4PP1C 5I74C 4NCDA 3LKNA 3OAZH 4LSUH 4ERSL 4M6AA 5DJ8B 3VWKC 4JO3L 3NTCH 4YHLH 1CLOL 1GIGL 5CSZA 4NKOA 4FFWC 4JY6A 3MXVH 2Z91B 3PV6A 1IC7L 5IMMA 5E00B 3TP4A 1XEDA 1UJTA 2C1PB 3JV0A 3V6OA 4NM8L 1X4YA 2FX8H 4KI5E 5EZIH 1I8IA 5H35A 4I0CC 3S98A 3V7AG 1S7XB 2VQUA 3WSQH 4Q6IC 4GT7A 4UUJA 2R0KH 4Q58C 1Q1JH 4NHCH 3HI1A 1JFQL 1G7PB 4G7VH 1N7ML 2ZSWA 4P4RA 1XR9A 3GDBA 1L7IH 1IC5H 4U1MA 1KPVB 2JB6B 2XN9D 1Z6JT 5CUSL 3O6KL 3QEQA 1LK2B 5I1EL 4KU1A 4ZFGL 1TJGL 4JAMA 3BKYL 3D39E 3SKJH 4ETQA 4PRNA 1G7IB 4X9BA 2VLJA 1OAZL 4MNQA 5DI8B 1OAQL 3E6HB 2ZSVA 2DOCA 5B3JE 2EXYC 3IT8D 2VXQL 1H0DB 1A5FL 4L8BB 4LSQH 5K9KB 4X5WA 1FSKB 2NXZC 5IF0B 5JNYB 3TFKC 4L4TD 4P2CG 1FG2A 4Y4HB 3D3VA 2JIXD 4PGCA 4GRMA 1P1ZA 1LO3L 2I60H 3N1GC 3AM8C 3CMOL 1KXQE 3OB0H 3F5WA 1YJDH 1UZ8A 2R0KL 1W72A 4DFHA 2GFBB 1WCQA 1KLGA 4CVXB 3DX9A 2A74B 3BP4A 1Y18A 5DO2C 3BX7C 5J7CC 4QNPE 4LLYA 5C09E 5I1HH 2FWOA 4LL9A 4UV4H 4P9HC 1IZKA 2BVEA 1AIFA 2IFGA 2YWZA 1VSCA 1HEZB 1X6LA 3Q6GL 3UTTA 5J3HD 5AYUL 1HSAB 1JE6A 1MCPL 4ZD3H 4R9HA 3QWQB 3VFPA 1OT1A 4R2GC 4XAKD 2JJSA 4HWBH 3PABB 4JFYB 4JFQA 2AJUH 2ZUTA 3TA3D 1Z3GH 3MRIA 2F5BL 1T4KA 4XTRD 3IDMB 3MMEB 2GTWA 4PUBL 3IGAA 1HOCB 2P7TB 1GGTA 4PRBB 1YYMH 1EXUA 2ARJA 4JDVA 1I7RA 4TYUA 2AI0L 3RTQB 4WCYH 5DZLA 3JTSA 3T0EB 5DJ8A 1S7UB 3ARFD 1PX4A 4BH7B 5EU7E 3QJFB 3G5VB 1IRAY 3QUZC 2EDTA 1R3KB 3QULA 3DROB 4MX7B 2DI9A 3BD4A 2E6JA 1BECA 4M7JH 4O9HH 1S9VA 3PWPE 2R23B 1C16B 1EHNA 1NLBL 1DANU 1W72H 4Y5XB 3HMXA 1T1ZA 3O3AB 4ZYKB 4LF3A 4EDXB 2HN7A 2HWZH 1TNNA 3NCMA 4W70A 4GAJH 1TQCB 2QQNL 2YKLL 1GSMA 2X7LB 5AG9A 4KJPD 4Y4HD 3U30B 3M17A 3QCUH 4FZ8L 3CSBA 2CUMA 2PYEA 2PXYC 4PRNB 4G8EB 5KS9B 3HR5A 4CMMA 1NCBH 2R4RH 3ZL4H 2CXGA 3GBML 3MBXL 3MNVA 4WUKH 1WZLA 4OZGB 4W81A 2VWEE 3PDDA 4HWEL 5LCVL 4I2XE 5JZ7C 4PP2A 1CQKA 2D4FA 3V5DA 4OKVB 4BA8A 5EWIL 3MV7B 3U4BL 3MLYH 2IF7A 3DRQB 5JUEH 2DLTA 4GRMB 2W9DH 1MJJA 4H25A 4Y4HC 3ROLB 2V6HA 5JDSB 3UTTD 4JFZH 2FATH 5E1HB 3FQRB 1U8MA 4OD3L 1UQSA 5I8EA 1NCWL 2BNRD 3IFLH 2AGJL 1GOGA 3S96A 3V4PL 1IM9A 4OAWB 4EN3B 3I85A 2KZWA 3QO1B 1T1WB 3HFMH 4X7EC 2IPTL 4YZFE 5I75C 4E41A 2VH5H 3QUZA 5F7DA 3KPRA 1ES0A 1QZ1A 1R3IL 1ORSA 5CSZB 4I18C 5DXWA 3RL1A 1I8LA 35C8L 4NO2A 4G8FB 2E9JA 2NXZD 2NY0B 3BGAA 5CBAA 1N5AA 5DTFA 1N4XH 1JWUB 4PRHD 4S0TD 4O2EA 1JGLH 1BVLB 2FIKB 3KPMA 2C7UA 3O3BA 1UEMA 2UY6A 5I71C 2BMKB 1ZA3A 4OZ4A 4ZDHA 4I0KA 3JTSB 4MQXC 4BH7A 1XGPB 1FV1B 4PB9H 4NKOB 5B3JF 4PY8I 2CIKA 3RUGE 1BF2A 4YDJA 3BWAA 4N90E 3VXNA 3KYOB 5GRZA 3K1DA 4UBDC 4OZHA 4JO4H 4K3EL 2ITCA 1QR1A 5SWZE 2ATPA 1SYVA 2CKBH 3O8XB 1DQMH 1YN6A 4PJHE 1MI5E 3NN8A 4PJBE 3BXNB 1T83A 4OBSA 1KPVA 1TNMA 4BK4A 5TJWK 1K5NA 5FA4A 5GJTL 4ZG1A 3TA3C 1MCJA 1RD6A 2X9XA 2BVQA 2NW3B 1NJ9B 1FG9C 2B2XH 1QEWB 1VCAA 4ZTOH 1UB6A 1JZ3A 4J3OC 4V1DD 3E6HA 3CK0L 3DPBA 25C8L 3MPCA 1RZ8B 1RMFL 1M71B 4GQ9L 2FNBA 3OKNA 5I16A 3RZWA 2B4CC 3IU3A 4HGWA 1PW3A 3ULUH 1FZKB 3NA9L 2HFFA 5JORA 1YUHB 5K9JL 5E8PB 1JWSB 4CMHB 5LJYH 1JF6A 1PKQE 1FG2B 1GL4B 2VDRH 4M7LL 4Y4HA 1GZPA 3RRQA 1QLRA 3ARXA 2XT1B 2D31A 4EVNA 1KBGH 1F00I 1DBJH 1LO0L 3B5TA 3QXUA 3IFOB 3QDJB 2XWTB 4L4VD 1R0AL 2A6KA 4OCXL 2F19H 4OUOA 5J06A 3P9LB 5ADOH 4D0DA 3GIZH 2X70A 3V0VB 4APQB 4MCZA 3FQXB 1K8IA 5DJ0B 5DI8A 4WNQA 3ARDB 1JZ6A 5EUKA 4URTB 3AXLA 5EU6D 1MNUH 5FYKE 4M62L 3LEVH 4U3CA 4OUUB 5KSAB 1FORH 5D4QA 1JZ5A 2NY3B 5EUOA 4JGMA 1BQUA 4OI7A 4L8BA 1F4HA 2YPLA 4BQ6A 1OP9A 2UYLB 5DUPL 3JBG7 1DN0B 1A4JB 3MRNA 4PJIE 1JZ7A 2HH0H 5D93B 1KLUB 2Y5TA 1A7PH 1T20B 4GOSA 5IJKC 4L5FH 1PEZA 3REWB 5ADPL 2VJXA 1JGDA 4H26A 4P2RD 4QTHB 1DCLA 2VR5A 4TUJB 1KT2B 4P9ML 2WIMA 3MOBH 2VDPH 1CU4L 3H0TA 5HY9A 2RFXA 2MSPA 4YDJB 1GGUA 4OCYL 3SCMA 4F7MA 1KTDA 1YEEL 2BVOB 4X6CF 4DZ8A 2BY2A 4KI5F 4HF5L 4UIKH 4Y2DC 2QHRL 2AV1A 1EEUA 3LEVL 5C0IB 2R1XB 4RZCA 2DQEL 4MNGA 4ZUWB 5I1AA 3QDJE 1E4JA 1G1YA 1GGBH 4N0CC 1T4KB 5CHNB 1R3IH 3RX5A 3KPNB 1MCLA 3UBXB 5BV7L 5D70H 4K7PX 5BS0E 2DL9A 5KSVB 3VXSA 2CDEB 3ARGB 4NJAH 4EI5C 2X05A 2BSTA 4PJGA 3PUCA 3RNKA 4MD0A 4PY7B 1TETH 2FH6A 1ZGLP 1OM3H 4WVRA 3PF2A 2VDRL 1YPZA 2V2TB 3CSGA 3BAEH 1CGUA 4M8QA 2A9ML 2Q7YA 2X09A 3T2NL 1PKQA 4YIQB 1H15A 1G7JA 3MV9D 3JWOL 4LMQI 2FBOJ 4KKNA 3SDXA 1CU4H 1Z0NA 4Y1AA 1K4CA 4WHTA 1FNGB 2IFFH 1R3HA 3QDME 5D8JH 1UXWB 3MRMB 5IFJA 1OAUH 5D7JD 2YD1A 4B0MM 4HMCA 1QLEL 1QBAA 3HNTL 4OCSL 3OKKA 3S4SG 3H9HB 1E27B 3TESA 1RJZA 1I1RA 3DO7B 3TJEL 1ZLUK 2AV7A 2EDFA 2J7LA 4JR9L 5EUKB 3G6JA 4WFGE 1A3RL 4H8WH 4OFPA 5IBTH 2C7UB 3O3BB 3U48A 2FECI 5SX4I 1KXTB 1JZ2A 2W0PA 1VADA 2EYTB 2YUXA 5EUOE 2ESVA 4ZTPL 3L3GA 1J1OH 3NIDF 3RUGF 2WAHA 4HIEB 2YPLB 4ODUA 3WDHA 1NKOA 1HK6A 1HYRC 2W0KA 4GRLD 4ZOCA 3BMVA 5FV1L 2CIKB 4RGNC 4TNVK 4X7DC 2VAAB 1FCGA 1AXTL 3ROLA 2E27L 3EGSA 2DM2A 2ITCB 4PRIB 3VH8A 2WQ8A 3CFJA 4HS3B 1UM6L 3OXRB 1F4YH 3BYYA 2APTA 3WJLC 5F88B 5F7EL 3BPLB 3LD8C 5FKPB 4YBHA 1EZVY 1YQVL 9CGTA 5JIHA 3MLPA 5IBLC 1YECH 4YHMH 3ZZ1A 4CDHA 3O3AA 3VFVB 2V2WB 4CU6A 1MOEA 4JN2B 3WO4C 4AIXA 1KIUA 1H9VA 3O3UN 1IT9H 5L0QB 5D1QA 2Y6SC 4ZXBA 1VERA 4U6HB 3MZGB 1ES0B 5F1IB 1IKNC 1C5CH 3SDCC 5HBBA 4PJ8B 2Q6WA 4EUPB 4GRLA 2PCPA 5I1AB 3LPGA 5ILTH 4XMPL 3MLRH 4TNWK 4ETYA 5BZDB 3N1PC 2EYSB 1E28A 1JI2A 3QUMB 4MAYA 2JELL 2DM7A 2L7JA 4KI5C 4RFOH 3DXAE 4OCRH 4N0UB 3IETB 2ZUVA 4MJIB 1FO0A 2X4OA 4RNRA 5FYLH 2NY7H 3QG6B 4U1HA 2CSPA 1MCOL 4RMQA 2FX7L 3U9PL 3ARDA 3DV6A 3HZKA 1ZOXA 1I1AC 3MJ7B 4WWKB 3HAEG 1ETZB 2P8MA 2Q1EA 3HS0B 3ULVF 2VOTA 5EU4B 1GJIA 3D9AH 3O2VH 1MLBA 4LAQH 4KKAD 4PG2A 4RMWA 4N9GB 1RIUH 1U8IA 1UXSB 2AXGB 5I1LA 4KKLD 1D5XB 1LO4L 1KGCD 4WEBL 5DF0A 1VGKB 2ADFL 1HNGA 1IEBA 4GMTH 3VG9C 2WBJB 1N4XL 4KMLB 2PXYD 1F6LL 3CLEL 4JJ5A 1UYWH 4IMLB 5EBWB 4DN4H 4RMTA 3KPLB 2JLLA 3C6LD 1S7QA 2BFVL 1XR8B 4NN6C 1BEYL 1K3IA 3G5YB 3O3EB 3HRPA 4PLJD 1EEYA 3RY6C 5HHQA 2MPAL 2XNAA 4CDGC 5E8DL 5DEGA 4MYWB 3TNNA 4G6MH 3WLBB 1MF2L 2YXFA 3HA0A 4QXUH 5ID0B 3IFLL 3PGFH 4HWZA 4DVBA 1YEIH 5BW7C 5D2NA 5MEOA 2BOBB 3K2UH 3EZ8A 2VXQH 3GJFA 4OFIA 4XHJC 4J3TA 2MWCA 5GSRA 1QUNA 2DQCL 4LSRL 1OAQH 3KHQA 3QQ3B 4GSDL 4HCRL 4GRWH 3WNNA 5KVGH 3ARDD 1F3DJ 2ATKB 4F7EA 2IALA 4F57L 5IIEA 5KN5A 4XC3H 3FO0H 4PJ5D 3ZYZA 4RAVA 3C08L 4PRPB 5FHBH 4XNUL 1JGUH 1J5OH 4HUUA 4POZC 5BOZG 4QOKD 4I8DA 4ODVL 1CD8A 2O93L 3NIFF 5T1LA 3IKKA 4K55A 3T0ED 4C56E 3TIDA 1INEL 1A4JA 4NM8H 2R56H 3O6LL 4BSWA 1SMOA 5C09A 4X9IA 1HDMB 2EXYD 3VMNA 3MX0A 4Y8DC 2VLJD 1E6OH 4KZDH 1LO5B 3V7MA 4TVPD 3UTTE 3OKDA 4KK8C 5FHAL 4XBPB 2I25N 4M93B 2IQ9H 4K2UH 1H3GA 4J3UA 5HHXL 3RU8L 2DQCH 5IEKB 3ISWA 3HAEA 4K7FB 3AY4C 4LLUB 3WFEL 2E3VA 3SCMB 3ZE2E 1ETZA 1JJUA 5JHDD 1FZMB 3QFJB 1TENA 3LD8B 4UIMA 4M6MH 3GMLA 2J88L 3QIWD 3RGVB 4PJBB 1G7HB 5IFJB 2DLEA 4EJ1C 4OJFL 1R5VA 4LCWA 4IRJC 5GJSL 1FJ1A 2HA1A 5C0CD 1KJ2A 5F7LB 2IEPA 3C6SA 3MNZA 3ULUL 4HFWB 4XNUH 3RUGB 1F2XK 4WW2A 3OKOA 2JJTC 2FEEL 2VAAA 3DUUB 3SE8L 3QCTL 5C0CB 3HI6H 3D2UA 4ONOA 5KW9L 3U7YL 4HX1B 1M05B 2D7PA 5ECJE 5I19H 4X6FB 1PKQB 1ZHKB 5F1OB 5J9PB 1G9ML 4LVHC 3LV3B 1KELL 1CXKA 1JTOA 3MLSH 3HAEH 3ARBB 1YEIL 5BS0D 4GBXC 1CD9B 4PJ9D 1JGDB 3ALXA 5D70L 2ZSWB 1YEGH 4X4MA 2RAMA 1ND0A 3RU8H 3B9AA 2AJVL 3O2DH 3H9HA 4TULL 3MXWH 4MNQE 4UOW1 4FQ2L 1G6RA 2A9NH 4LKCA 3MRLB 5F8QC 7CGTA 4UV7L 4MNQB 3KPRD 1SJHB 4HH9A 4K3GA 2BJMH 4BZ1H 3TCXA 1AD9B 2PR4L 1YC7A 3AB0B 4EUPH 3I6GA 3HE7B 5D9SB 5C9JB 2PTUA 3EYOB 4MMXC 4N0FB 1X5IA 4X9GA 3UXFA 5CD5C 4KUCD 4WV1B 5F7MC 4Z7WE 4NQDD 4ALAL 5D6DC 3P11L 3HPLA 4RWYH 4MAYC 4KUCF 4ELMA 3MRIB 2R8SH 4LHQB 5D7JB 3KR3L 3MV7D 1QFWL 2UZXB 4YHZL 1EFQA 1E28B 3QUMA 5HVWA 3TEUA 3LIZL 4GAJL 3S4SA 3CFJB 3K2MC 3VH8B 1CL7I 5JPMB 4KAQH 5HGAA 1Q8MA 1IKNA 2NY2B 3ZT6A 2J8UA 4UDUB 2EICA 4P57B 3BKMH 2N4IA 4V1DE 1G9NC 4KRLB 1UG9A 1G9NH 1IC4L 3I3BA 5EOCL 3VGAC 3NIDE 2P42B 3FT4A 1TJHL 1A3QA 2W1NA 4HPYH 3L5WB 3RTQD 2BJML 1BJ1H 1NAMB 3WFCL 1KYOJ 4HKZA 3HB3C 1NUGA 3EOTL 1SJEB 1JPTL 4UTBH 5INCB 2PCPB 4EUPA 3NIGE 5AZ2H 5C0EB 3FJTA 3GSQB 4NQEE 4ETQB 1DSFH 2IMNA 3FFCB 4MQTB 1Q72H 4F37K 2I27N 2QJDA 3MLUL 1J0KA 4FFZH 4FMFA 1E6JH 1S8DB 5I1EH 4I5BB 4M3KB 4PGJA 3MGTB 2Y4SA 4YHPB 4BELD 5GZND 4JFFE 4JFDA 3MRDA 3CFDB 1P69B 1MFBH 4XNXL 3GZKA 1LEKA 4U05A 1UZ6F 2VLME 2WM0A 2K9UA 4XT1C 4LASH 1ZVYA 4LRIA 1MREL 4CADB 3PWPA 3ESUF 1IC1A 1DANT 3QUMH 3HI5H 4NC1C 1QA9A 4GMTL 4YBQD 2HJFA 3M1BB 1A4KA 3SPVB 3HE6D 1D5ZA 3DV6B 3VXME 3MV7A 4G6FD 1LP9E 5E8EB 2DQDH 4HZLA 4YJZL 3QJHB 1A1MB 4PJ7E 2ZG1A 3MUGA 4NZUH 3QIBA 4OLEA 1R3JB 1U8IB 1UXSA 2AXGA 4POYA 1I9EA 1AGDB 1MUJB 1QBML 2EDYA 5CBEB 3NFNA 2JB5H 2PN5A 1FIGL 4G8EA 5KS9A 3NABH 5KZCB 3LPWA 8FABA 3KPLA 4KK9C 4ZNEE 5FUOH 4Z7VE 4AEFA 1UVQA 1IVLA 4JQXC 5DMKB 5IUSA 1X5FA 1QRNB 3E2HB 5C08E 3SDDB 1IGML 2VDOL 4GG6A 4YDKH 4NM4H 4L8DB 2NYYD 3CFBB 3T4YB 4JHZA 4RGOL 2M8XA 4WU7A 1S9XB 4NO0B 3PHQB 4L4VB 4Y16D 1T0PB 4LCYA 4CMMB 5IB1A 1B88A 4OCYH 1KPUA 1EA9C 4J8RB 4LSVH 1ZA3B 5E94A 3S6CA 1HYSD 1OY3B 2QADB 3UTPD 1FO0B 4L29A 2WINB 3DYMA 1UADC 3FFCE 1MIEH 4F7EB 3VFGL 5EBLA 2R69L 3EYVB 1QSFA 2VLRA 3WS3B 1RZKC 3O2DL 3OKOB 4LLUA 4J3VA 3QQNA 1J12A 1CG9B 2SEBA 4NOBA 4M48L 5F70A 4YQXH 3BEVA 4PJAA 3A67L 5E1AA 1JYNA 2HWZL 5BO1L 1Q38A 4PYHA 2YA1A 1AE6L 5HDQH 3PGDB 1KCUL 4HLZG 1TETL 5C6PB 1T89C 1WFTA 5GGQH 4YH6A 3S96B 1NFIA 3O2WL 1JPST 5GGSA 4LPTA 5DGQA 3IDMA 2IAND 4HJGA 2F53D 4S2SB 2BOCB 4MQSB 1QEWA 1B2WH 4PG9B 4I18B 2OMBA 1MI5B 3H42H 1XGPA 3PG2A 1N0XH 2YZ1A 3PWNB 1KN2L 1LHZA 3WL9B 4UIKL 2ZJSH 1LDPL 4ZPTA 1AQDB 5MP6L 4EN3C 3UDWA 4JN1L 3RIFK 4U1IA 3VXQB 4Y5YA 4PJBA 3FQRA 3I3DA 4X99B 2A2QT 4OB5L 4O51A 4HPYL 3RVVD 3OL2A 1XFPA 3RGVC 3PGFL 1ROWA 3HPJA 3LH2L 4P3WA 1V3KA 5F6HI 4QGYA 3M17B 5DJ6A 3T0DA 5F7KC 1FZOA 5FM4A 2IG2L 4AG4L 3SDXE 2IGFL 1JRHH 3O4OB 2ICWI 2VUYA 1QVOB 5FHAH 2GCYB 4QXTA 2EDNA 2FSEB 4S0SD 1FFNA 3IDUA 5FYJH 3FONB 3GBNL 1NPUA 5CP7A 5IB3B 3ULUE 3MV8A 4RMVA 2EYRA 3VXUB 3SDDA 5M95B 4F7PB 5CP3H 2OK0H 2XWBA 4ODBD 2D03L 4XGZB 4GSDH 5JIKA 4MLIA 1LEGA 3QUML 1QLRB 5L7XH 3ARBA 5HHMB 2CQVA 5BMFL 4R96A 1KULA 15C8H 1KJ2H 3FZUD 4NUGH 1T83C 1TDQA 4G80B 1HXYA 2ENSA 5F3BA 3C9NA 3KLDA 5I8KL 3DVGA 1MCNA 1KJ3L 2O5YH 1JHLL 3AS3A 2AJYH 5F9JA 1WISA 3TO4A 1XIWC 5B39B 3MOQA 3T08A 2Y06L 5GRUH 1EO8H 3QCVL 5DZNA 5EPMA 2VLRB 4AY0A 3S5LA 1NCDL 4WENB 2VZ3A 5T3XL 3VRIA 1UACH 5D9SA 5C9JA 3HE7A 3VFNA 3FO9A 5F9OH 4PGBB 2BRRH 3QUZB 3H7LA 2DBLH 5F1KC 4WV1A 1ZS8B 1R5VB 4PRAA 4XVSH 1DQML 1A4KB 3SPVA 4MWFB 1NBVH 3O9WB 4Z7OF 3WFDL 3BO8B 3KPSE 2BSRB 3ZKND 3ZKSD 3IJYB 1G1CA 4FQHB 1G0YR 2W9EL 1OAUL 4P2RE 5FB8A 5DDHB 2CLRB 3U0WH 2ZCKL 4YUEH 3QAZB 5DQJB 5ETUB 3OXSB 3QNZB 2I9TA 2DQEH 5LAXA 4G9FB 1BQHA 3B5GA 4PJXA 3PNWA 4ODSH 3LKNB 1PG7W 3M1BA 2WIIB 1EJOH 3L5WA 2IPUK 4ZOBA 1F4AA 1I9IH 1CICB 12E8L 5KAQG 1FNSH 4YFLI 2XWTA 1NAMA 3DNKA 3RAJH 4D9QE 1IE5A 5GPRA 1A21A 4J23A 1NDGA 2HJLA 1BIIA 5EZOH 5BRZD 5DGRA 5EU6E 2ERJB 4FXLA 4NSKB 4YHOH 3RKDD 1FNEB 3MV9B 1OTSC 1G7MB 1RUKL 1IC5L 2CIIA 4XNYL 2OR9L 5IFHH 3O11A 4D9QD 5K33A 1TTGA 5A2JH 1FPTH 4XH2A 1SY6A 3UC0L 5I76A 5CJQH 5CCKH 5E99H 1Y6MR 3QWRD 1I8LC 1TVHB 5TQ0H 1FSKC 2NXZB 1GOFA 3ALWA 5GGQL 3SBWC 3O4LE 3UPAA 1KNOB 2FR4A 4PGDA 3VFMA 1MCWM 2GW5A 3GNMH 1ZT7A 2XKNB 4F33B 4K94H 3ZKNC 4P23B 4Z77A 2H26A 2Y36L 4AH2A 1KN4L 4UTAH 1SEQH 1F11A 5DUML 4AEHH 3SDCD 5F7HA 1VEPA 1FZJA 1K4CB 4WHTB 1JWSA 3MOAH 1A1MA 3OKEB 1WZ1H 3NIGF 1AR1C 1R3LB 4HUNB 2H2PC 1RI8A 5JNYA 1E4WH 5D6DA 4DCQA 5CILH 3WIHA 1AGFB 3F12A 3NCYS 4PY7A 1OP3H 5KG9A 2W0LA 5IMOA 1EHXA 1MREH 2BERA 2N7BA 4RWHA 4GW4B 1ZSDB 5HGGS 1I9IL 5CJXA 4XVJL 3TVMC 3EJYC 5F7FA 5BRZB 2CD0A 5I9QB 4DKEL 5HGHA 2C3XA 4R4BB 4OCRL 3P9WB 2PTTA 3STLA 2P24A 4FABH 4I2XA 1MVUA 4PTTB 5ANMA 4HUWA 1KEGH 3KLAB 2VLKB 1OQXA 1PZ5B 3S3SA 5ENWA 1IQDB 1Y6NR 2JJTA 4F7CB 5CEYB 2GSIB 4JPVL 4U0QB 2A83A 1DN0A 4GRWE 5DHVB 1DBKL 4LAJH 4ONGH 2EYSA 1V7NH 4B53A 4C56D 5GGSB 5ELIA 5D96B 5F6IB 3P77B 2EYTA 3LZFL 3KPQA 5C6WH 3OQ3B 1X7QB 3DX7A 1YPZB 1KEMH 4CGTA 1WITA 1HHJB 4X4YB 3O6LH 5FF6B 3NA9H 5EA0L 5KVDL 1I9JL 2FEEI 2XACC 3ELAT 4XZUA 5GHWL 4D8PA 4JANA 5IWLA 2QEJA 2QSQA 4HKXB 4HWBA 3QP3A 3SGKC 3MREB 5J12B 4OCMC 5HGDA 1H3VA 1OHQA 3DARA 1IMHC 3V6FB 4XNYH 3JWDH 1BZ7B 1GPOL 3VXQA 1PQZB 2W65B 5FCUH 4HT1L 4AK1A 1MHEA 4ZFOL 4L8SB 4ZYKA 2ADIA 2VLLB 4ZO7A 4L4VE 2NY4D 4JRXD 4FQJL 2WBJA 4IRJA 4UINL 3CDGB 2BNQB 4JHAL 1D5BB 1JMXA 4U1LB 1LO2H 1I9RH 4NQCB 1EHAA 1RK1B 4JFEB 4WI3A 3FTGA 3W11D 3AY4A 3QDGA 1D5MB 5HHOA 1NSNH 3GMQA 2WQRA 4J2XA 2J2ZA 1V7NL 2F8OA 4N0UA 1QKZH 5A16A 4LHUG 1Z3GL 5JO5B 4X80H 5JOFB 3AFLA 4WDIB 1Q0XH 3LKRA 5BV7H 3K4ZA 3FONA 1MWAA 2V2XA 3O6KH 4YHYC 4G7YH 1CDBA 1ITCA 3QUKB 3VXUA 2VITB 3TBTA 5E00A 2P8LA 1Q1JL 4YEFA 4P2OB 2IGFH 2VXVL 5JZ7D 3EGSB 3BT2H 3FRUA 4F8TA 1OAKL 1NBZB 1LEGB 4HUKB 4PRIA 3VXSE 4KHTL 4JCMA 5DJAB 1MPAH 4R96B 1CFQA 3H9SB 4HMEA 3CVHA 1ZXQA 5DO2D 4MJ5A 4CW1A 3VD7A 4DK6A 1JPGB 5D1ZB 2A77H 1NGWB 4Y2OA 5D5MF 1QFWI 3C2SA 3I84A 4RDQF 1MCEA 3B9KC 4Q9RL 2P5EE 3MJ7A 2Z8SA 3QUXA 3F7VB 4U6HA 4E5XB 2OZ4L 5FUCC 5J57B 4HBQA 5F9AC 5CJQL 4YGAB 2EC9U 1GGIL 5DQDL 1TVDA 3DUSB 5DJCB 2F5AL 1K2DB 5IVOA 1MY7A 1ZGLM 4NRZA 4NQTA 1RIVL 4R0LC 5IVNA 4OQTL 4LHJB 2CUIA 4M9OA 2ARJQ 5CJOH 1PFCA 2BOCA 4KY1L 1CICA 1UACL 3X14A 3ARFA 1BJMA 3LRSA 2Z8RA 5T5NF 4QT5A 1KB5H 1SY6L 1XAUA 3PWNA 3MLYL 4G42A 4P5TA 2BNQD 2F53B 5ETUA 3WKML 2RJMA 5FK9A 5AAWA 5DS8A 2B7DT 3BP6B 1ZLWK 3QUXD 2VMFA 1T03H 1BGXH 2VQ1A 4Y5YB 1DBJL 1LO0H 3VJ6B 5JIPA 3QUYA 4I0PD 5AG8A 5MENA 1T2QH 4WRLA 1OL0A 3CFEA 2GTZB 5TF0A 4QHLA 1WQVT 2NCMA 4LSQL 2A77L 3TBVB 3UPRB 2NY6D 5HI5C 4HEPG 1DQJA 2CDFB 4KDTA 1YEHL 2DTMH 4YHLL 3QBTB 3GSNL 4NRYA 3CDFA 3GKWL 4UU9B 2B4CH 2AI0H 3P3YA 3GI8H 1X5JA 2BXYA 2FHCA 5MERB 1HOCA 2VC2H 3NCEB 3VXTB 1E4XH 2EDKA 4FQCL 2UUDK 3CDYA 4NZUL 5DEGB 4TVPH 5EC1B 4UQ3B 3FOMB 4HK0A 1XF2B 4NO3B 2QR0A 5T5FL 1I8IB 4WGWB 1A64A 1S9VB 1ZEAH 3DIFB 4PGZA 5D7IA 4DUXA 4ENEC 1WZMA 2WIIA 4NO0D 1JHTA 5T33L 4JDTH 3UTZB 3BH8A 3BKJH 4YWGL 1NBZA 3SGEH 3WJLA 5C0AB 1T1YA 4HGMA 4DTGH 4LLQB 4Y5VA 2HVJA 1AY1H 1LWRA 4LEXL 4V2BA 3UAJC 1CS6A 3GSOA 5IEKA 3DECA 1RZJC 1YNTA 4JREB 1ZHBA 4WU5B 4R26L 3RUGA 5C0NC 3J7HA 4KRPC 3ZYOA 5B38G 2B4CL 5LGHL 3K80A 1YPZF 4TSAH 4G8GA 3FQXA 2NW2B 4EEEA 1INQB 5IF0A 3DX7B 3BE1L 3T0BA 4C4KT 1UH3A 3F58L 3QA3B 1G9NL 1O5DT 1EDQA 2H26B 3WUWG 1J0HA 5K9OA 1K2DA 2K1MA 4QRRA 5I73B 1ZE3C 5ID1A 4OD3H 3T1WA 4BKLA 3TC9A 3OHXB 4OZIE 4H5SA 2NY0C 1JF5A 5HGDB 4WHYH 5DLML 4JVWA 3MJ8B 3ULUD 4CNIB 4MSWB 3KPPA 4GUPB 4Q2ZA 1V3LA 1BP3B 3ILPB 2IBGA 3AU1A 2OI9C 4JGJA 1JF1A 4YO0B 5I75B 1P6AB 4ALAH 1CD1B 3MRGA 1A6UH 2CLZA 4Z76B 3FN3A 4ZFZA 1I3VA 4P23C 4X6EB 1EIBA 2VQ1B 4R97B 5HHOB 5D6CA 2DLIA 3QUXC 1WC7A 4HIJA 3L3HA 4Z7OE 1V7ML 3H0TB 5HY9B 1KJMA 2BVYA 2OTUA 3KLAA 3U82B 4GH7B 3PWLA 3MCLH 3OF6D 5ENWB 1FJ1B 3W5NA 2ILLA 5ITFA 1QFUL 2VXSL 3BP7B 3EYUL 5TE4H 3O11B 1K3ZA 4L8SA 1A2YB 3PDOA 1EERB 1C5DA 3WIHH 3QCTH 4OLYL 3M07A 4OF0A 5D7JA 2HFGL 2YD6A 5GISL 4QYOB 3LDBB 4ZSOB 4O2EB 5KANG 2VLRE 3BUYA 5KS9F 1DUZB 1G6RL 3VDAA 3LQAL 1NDMA 4YHPA 2EDJA 2OM5A 1INEH 1W0WA 2AK1H 1RUAH 5LGKA 5HYQB 4AMKH 2F8VA 4X4YA 1UM6H 4MD5B 4N0CD 4GXVL 1HHHB 3OSKA 1BBDL 3V5DB 5I19L 3E1F1 3DI2B 4EIZC 2DIAA 2Z0BA 4L1HA 3G9VA 5D7LA 1X5LA 3ROOA 1OAZH 3BPCA 5H94B 1MCOH 1IAMA 4QRQA 4UIMB 1QR1B 5M7QA 1Q0XL 2NR6C 2OTPA 1XCQA 4DKFH 5I2IA 3WFBH 3EYFB 1S7XA 1JNNL 3MA7A 1YEJH 3TT1H 3NFPB 3ZKXC 2RHEA 1K5NB 3P30H 3SE4A 1D5BA 4G9DB 2X4RB 1DTUA 3U4EA 3FOLB 4ZPVB 1U92A 1U3HB 1YQ2A 2P24B 5BJTB 2WUBL 2AEQH 4HXAL 1FHGA 2X44D 4M7LH 2D7TH 4JKPL 4FFYL 2CO7B 4CVWA 3QNXA 3HG1D 4X7FC 5CILL 4QRRE 1QYGH 1X5GA 2XZCL 4Z0XB 2A6JB 4YGVB 4PBXA 4DN3H 2PF6A 3QZWG 3LQZB 1JK8B 1XIWB 2HT4D 4O2CB 3AGVA 3O8XD 2DQGH 1J1XH 4HD9A 1JTTA 3OKMB 1NLDH 4GRWF 3DHJA 4OZ4B 5C0AE 5GZOD 3NVQA 1I1CA 5IESL 1U42A 2J8UB 3L9RB 3LKOA 5IT2H 4OBRA 3AREC 3BGMA 3ARFB 3IKCA 1BOYA 1FCCA 1BD2D 1P84K 2R2BA 3D0VA 3DGGB 3S88L 3VDBA 1DQJB 2CDFA 3LKPB 5GJTH 4OGAD 2DRUA 1XGQA 5CEXA 4L3CB 4LIQL 4X6CB 4PS4L 5HJ3A 2ZCHL 3KJ6H 1EAJA 1TQBB 1MJ7H 1FL3B 1NC2B 3BZFA 4XC1L 1AP2A 3IF1B 2C4FT 3BI9X 1EEZB 5H2BB 3CFKB 4DQOL 4GG6E 4DKFL 2JTDA 3CPLB 1N26A 1FGVL 3CZJA 2LABA 4LBEB 4OF8A 5CZXC 1OP5H 3SJVA 1FVDA 5GJSH 1AC0A 4ZUUA 3K3QA 4BZ2L 4XVUC 8FABB 1XGTB 4PJCE 3BDYH 4KZEH 4FNLH 1FFPA 5ALCH 2ESVE 3RHWK 3X3GH 1AHWA 5T1KB 4FQ1H 4NRXA 1EV2E 1EAPB 4CVZA 1KT2A 4KI5D 4EN3D 3NCYP 2JE8A 4P57A 3L3OB 1WK0A 1E4XI 5E6IA 4IRSB 3MRFA 3QJHA 5C71A 4YHIB 1KB9J 2YC1B 3KGRA 3RY4A 1RJYB 1XGRA 3EO1A 4JFXA 1SYVB 3HMXH 2LU7A 3KJ6L 4PP1D 3HC3L 3PWJB 3U7AA 1YQVH 4R4FH 4K3JL 4KJQD 2ZOKB 5C07B 3QHFH 4OGAC 4YDVB 1M6OA 2J3SA 3CX5K 4MAUL 1FNFA 4X99A 3WBDA 4EDXA 2O5XH 2W9LA 4QRRD 2BVQB 2C4XA 3QR2A 5SX5H 3PHOB 2ADFH 3F65A 4MJ2A 3C5ZC 4GMSL 3RWGB 3S35X 1U95A 4M4PA 1QSEB 3MA9L 4JB9L 1S8DA 5FGCE 1FZOB 1C1EH 1GCFA 2H8PB 3SGJC 3WJJA 3WNPA 4M61A 4X6DA 1KCSL 3UO1L 3Q5YA 3W39A 1BQSA 4LLYB 2E7HA 2D0GA 3OB8A 4WGVB 3HNTH 5HVHC 3CFBA 1DQDL 3MQIA 3VRJB 3RAJL 4F7PA 5A2LH 4HZAA 3MV01 3GIVB 4N5UA 4ZFZB 4OSUH 1NFIB 3X17A 3IVKB 1BZ9B 3PABA 3CXHK 4H88L 2B39A 3G6DL 5HHOD 5DRWB 3P4NA 1NEUA 1R5WA 5ISZA 4GG8A 1QD0A 2MQCA 1HIML 1G9MH 4N0RA 1RSFA 2K7PA 5DRXA 2VDLL 4I18A 2L4OA 4JDZA 3GBNH 3FN0H 3TZVC 4I48B 4QXWA 1MRFL 3FQTB 1GRWA 3HLAA 1PKOA 3WS3A 4X4XA 1A14L 3EOBA 2Y5EA 1EBPA 1FVEA 2Y6SD 3LEXA 1JGVH 2EDWA 4G8IA 1LP9A 4K8RC 3WCYA 3TPKA 4DUVA 1CZ8L 1CGTA 1MAJA 3IAGC 2PNDA 3CPLA 4RZCB 1OM3L 3QO1A 5LXGH 5KN5B 1DR9A 1RURH 3MUHL 2QQKL 5DA4A 5ID1B 3MFFB 4WU7B 3QNYB 4YX2L 1S9XA 2HMID 2AJ3B 3HI6L 1CTNA 4MZ2A 4N8VA 3UTSD 2WLZA 4RGND 3C8KB 2GCYA 4QXTB 4NP4L 2E7LC 4S11A 5I15H 4Q2ZB 1JUFB 3E6FA 4L4TB 5D71H 3TV3H 1GPOH 3D3VE 2VDQH 3EYUH 5TE4L 2NPLX 4FABL 2J8OA 5HSFA 2I9TB 4TULH 4YXLH 3BRDA 3HC4H 1GZQA 5DFTA 2CMRH 3DWTA 2XFXB 1MQKL 3W11C 4GKNA 3N50A 3N9GH 3KJ4C 1D5IH 4MB3A 3O6ML 4G6JH 5FYJE 3SBWA 4KPHL 4D3CL 4ELME 4OZIF 2Q6WB 3TO2B 2C9AA 2VDMH 4UV4L 2WP3T 3BP7A 3BPOB 2MCG1 4NKIH 5F8RC 2F8XC 3EAKA 3BZ4A 3VD5A 3OB0K 3TT3H 4LOUD 1T22A 1U0QA 5DLMH 4WEUD 2NY4B 1J0JA 4PJIF 4I4WA 2J8UF 3S5LG 3NGBC 4ZPVA 4PJEA 3KR3H 3O45A 2AP2A 1KTKE 4FQXC 3Q6FB 1P4LB 4PG9A 6FABH 3MV9E 3WO3B 1VPOH 1PBYA 4ODUB 1P7KB 4R8WH 1C5BH 4Q97A 2XWJA 5IB4B 1D9KC 1A5FH 1FNGA 4O00A 5E03A 3WL9A 5GS0H 4L3EA 4RGMB 3W0WD 4F9LC 4YHKH 4PB0H 3F7YB 4ZS6D 4KXZH 3NZHL 3RWFB 1CDHA 1R3LA 1L9MA 2JJSC 2CLRA 3UAJD 1KLGB 2WUCH 4CVXA 5ICYB 1DVFC 4G7YL 5CGYD 2NY5H 4WI7A 2BY0A 5KG9B 3GGWB 4WO4C 3W0WB 2YBRA 1J0ZA 4HJJH 2FBJL 3S37L 4DAGH 4NQEB 5B21A 5BJTA 5KOMC 5C0JA 2G9HB 2P5WA 3TVMD 2V9TA 3HE7C 3PWLB 5D7KD 5L2KD 1G84A 4NRXB 1EEZA 2AXHA 1XZ0B 2YKLH 1V05A 4BFGA 1RFDL 1G7LB 3AM8A 3L1OL 1NGPL 2QL1A 3UYRL 3VGFA 5HGBB 1CF8L 4OZIA 3GBLA 2EO9A 1NMCC 2GTWB 2YR3A 2BDNH 3W9EB 1FLRL 1WIUA 2FRGP 3I2CL 3I9GH 3S34H 4OLWH 1I7ZB 2DI8A 1QFWH 3C5JB 4JLRA 3WIHL 3TYFA 2EIZB 5FAAA 2OR7A 2FHBA 4GBXB 1F42A 4H20H 2VISB 4UOW0 2QHRH 3PNWB 3JV4A 4LVHB 1EAPA 4CVZB 5I8CA 4F3FB 4JHWL 4ZO8A 4ISVA 2W9DL 1EO7A 1P5UA 2DJUA 5HJ3B 1RZ8A 1OTUC 4KK6D 1S7RA 4OLVH 5JPMA 5ANME 5EZLA 5JUEL 1OAYL 4FQXB 4AM0B 2MHAA 2XA8H 1AP2B 2R1YB 3T1FB 3GSXA 3LQMA 4N8CL 5CINL 4XCCH 1MLBB 3PP3H 4HUMB 3NPSB 43C9A 4I1NB 3PWJA 1MCRA 1RUPH 5FGCB 5CUSH 1L0YA 3V8CA 5DUBA 3SY0B 1KIRA 3B83A 3UZVB 5JXEA 2VH5L 3L6FB 3W82A 3CDGA 1J0YA 1BM3L 3HFML 4MA3B 3IDYC 1NANI 1SBSH 3V7AE 3QIBC 2HRPH 4AL8H 5CBAB 2HYMA 2X40A 3KPNA 2VUOA 2NY5C 3FQUB 2UZYB 1QP1A 4NNPL 5HDLA 5C0AD 1GHFL 5JA9A 1MCHA 1C12A 4ZFFA 5FOBA 4L3EE 4XAWH 1MWAL 2WMPA 1T2QL 2YC1A 2VABA 5AYQA 1E4WL 3VCLB 5CS7A 4PRDB 4MQ7B 1QBLL 1OF2A 1JGUL 1R6VA 5J4MA 2V2TA 5B39G 3RWJA 4F9PC 1BF8A 3QIUB 1NCWH 4WTWA 5EZOL 4W6WB 2WUBH 1AQKL 1YN7A 3SKNA 1T0NA 4OZHB 4JDZB 4MJ5B 1R3JA 4OLVL 3FO1B 4QTHA 1BQLH 3BH9B 4LU5H 3MUZ1 2UV3A 5T3XH 5JMOC 4Z95H 1YY8A 3EHBC 4MA1C 5FA4B 4ZFGH 1EO5A 1I85A 1QSVA 3R0MA 4PJ7F 2D9CA 4HWBL 4DVRH 2HLFD 3QUKA 2BDNL 4NO5B 2XQBL 3V4UH 2F74A 1N5AB 4K8RH 1HQ4B 1YMHB 4PRIE 1JZ8A 1JGVL 2CR6A 3D25B 4HLJA 3T4AB 1MCBA 1HI6A 4WW2F 1I4FA 2APVA 2IADA 2AJSH 3D87B 5LGJA 1NFDA 3LS4H 4AIOA 2BSSA 3LN5A 2EDQA 4WJ5A 2V7HA 1YYLL 3RWCB 4GG8B 4V1DB 1HHKB 1G9MC 1JGLL 2DI7A 4UNUA 1UWXK 3O4LA 4JY5L 4AEEA 4QHMB 5JR1L 1VFBB 3KYMA 1OLLA 4X8JB 3QEGH 4HAGA 4TSAL 3G6AA 2GKIA 4HH9B 4FQQA 1RHFA 3G5ZB 4CN6A 5FV2A 1VFAB 4OGXH 4KJWC 5DRNA 5E2WL 1LILA 1FNLA 1TLKA 2YRZA 3MO1A 3VXRA 3OJDA 3GIZL 4P2YA 5T3ZH 4Y1AB 3C5SA 3BKCL 3C5ZB 5I8OH 1WWAX 5IK3A 3TBVA 3UPRA 1CE6B 1U3JA 4XPGH 1U95B 2HRPL 2XWJB 2CLVB 4HKJB 4NRYB 2BRRL 3VG9B 5DJ2A 4F9PA 4TUOB 2X89A 4N8VB 3IRPX 1BM3H 4NT6B 1UB6B 5J6GB 5GS0D 2VZUA 4YDKL 3ZKMD 4OD2B 3SQBA 4WDIA 5JA8B 1WT5A 3R06A 4WUUE 4IRZL 4K7FA 1DFBH 3Q6FA 1U8KA 4X7CC 5CGYC 3SJVD 3T0AA 3PXHA 5DWUL 2B5IB 3RIFF 5F9WB 4OF5A 5IB4A 4PRDA 4FTVA 3S3JA 5L2KA 4HIIB 4QRSA 4EI6A 2IC2A 3S8WA 1Q9OA 4PLOB 4ODSL 5EU5B 3DI3B 4F58H 1OD9A 2OQJB 5J6HA 5M94B 3TM6A 5F9OL 3FQTA 1NGWA 1G7LA 1A1OB 4RISL 3JTTB 2UZIH 3U2SB 5DSCA 5EBMA 4OLUH 1V8HA 1DEEB 3WN5C 4KGLA 3SE9L 3QEHB 1T04A 2ZPKL 4I4WB 3DSNA 4K9EL 3FTGB 3R1GH 3I6GB 4KI1A 2DIBA 3IJSB 5D71L 3TV3L 5C0JB 1FPTL 3IDXL 1DE4A 1LD9A 3AS2A 4D3CH 1L6ZA 4NN7C 1N6VA 3LN9A 4OIIH 3HB3D 1EVUA 3IFPB 4QNPF 1MCWW 4PJ5B 5HHQB 1MQKH 1OAXL 1AHWC 3HE6C 3MLUH 4KQ4L 1JNNH 1WF5A 1FE8L 4PJFF 1QQDB 4XX1E 3E6FB 4N0UE 2VL4A 3QDHA 4NGHL 4UTBL 1MHCA 4UQ2B 1CGSL 4LSTH 3SY0A 2EIZA 3TGXA 5FECB 3VMOA 5J13C 3HI1B 1G7PA 1YNTB 4RA3A 5MEQB 2EXWC 2YOCA 5I1KH 1N8ZB 2HT2D 1JRHI 3MRBB 3RL2B 3G5ZA 12E8H 5F1SA 4FQIH 3TIEB 4YX2H 4D0BB 1QLFB 3KYNB 2YA0A 4OFDA 4NQDE 3ARQA 4XCEA 5ESQA 2VIRA 3HZKB 1RZIA 3U4AA 1EGJL 1W8OA 5SV3A 1T7XA 2FJGB 3E3QC 1J87A 3TF7C 4JRYA 2X4QA 5F7YC 4FS0A 3BZ4B 4O2FB 4YDLC 5H37H 4F8QA 2RCSH 4YC2B 4P4RB 1UKQA 3DMMB 2P5EA 3KWWA 3W9EA 2AK4A 2DQHL 4HIEA 1CQYA 5HD8D 5F1NB 1VKXA 4FXGB 4JZJB 1DL7L 1N64H 2C1OB 4HCRH 4YE4H 2GUOB 4XP6L 5IMLA 2R69H 1FE8H 2I9LB 2NY5L 5E2JA 4KVNH 4F7TA 2JF1A 3WE6B 2GJJA 5J0BA 2FCBA 4JFHD 4G42B 1IAOA 1JFQH 4KY1H 4JDTL 4TTGA 2ZSVB 3N1QC 2QTEA 1B90A 2ESVD 1D5ZB 4U7MA 4HS3A 1HHIA 1XGYL 4K7PL 5FYLD 2LVEA 5D6CB 1Z9OA 3MACL 1AO7A 1PZUB 1GVIA 3B5HA 1JV5B 3MYJB 5C0FB 4R8WL 1H3XA 2VKXA 2EIDA 2OCFD 4WO4B 4M3JA 6FABL 3AU1B 3WEXA 1CL7L 1P1ZB 3V95A 4X5XB 3X13A 5F1IA 3WS6C 4S1DC 2YD8A 1PEWA 2DN7A 2FL5B 1P9MA 5ESVB 4G6AC 3QQ4A 4JAMB 2V7HB 3MV9A 1CGYA 1KYOK 2QQLL 3WSQL 2HT3C 3EJZD 5F21B 1HHKA 3WD5L 3HZVA 2R4RL 1Y18B 1OARL 5DVOA 4OIBA 2O5XL 3FQUA 1CFSB 4YPGB 1DE4B 1T3FA 2Y7QA 3AC0A 5I1GH 1FDLL 3LVEA 5BO1H 3EDJA 3FO0L 3P4MA 3V0AC 1OF2B 1CIUA 4XBEH 4KTYA 1F45A 2AXJA 2IG2H 1D6EA 1LNUB 1SY6H 2FX9L 3RDTD 5FYKU 1IGFH 2APBA 3CVIL 2FLBT 4YWGH 2KUTA 3OJ2C 1GOHA 1IARB 2OXGA 2BVPB 3H42L 5CMAB 3SDYL 4HBCL 1F5WA 4MXVF 1T0MB 4AM0A 2QADD 3GHEH 4ZXBC 4EXKA 1S7TB 3G5XB 5FCUL 3BPCB 3ULVE 2IQ9L 2Q76A 4K2UL 3BD3A 1RZGA 4TPRH 4K9EH 3HCVA 2HT4C 5DJYB 2X4TB 4X7TB 1TCRA 1FQ9C 3IDGA 4J6RH 3CFIC 5CIPH 1A6TA 1OSZA 5AD0B 4KKCD 1DLFH 1YDPA 3LQZA 4B5EA 2F9BT 1JTPA 1B0WA 3WHE0 1FDLH 1HXMB 4APQC 5EOCJ 5LGJB 4GKZB 1NDMB 1UWXH 1ZHNB 3Q6GH 3Q1SL 2GUOA 3MGOA 3C6LA 2A83B 1U8HB 5D5MA 3C9NB 5MHSE 4YHNB 4X83A 1ZLVK 5F9JB 5ESAA 5EN2A 4M9PA 1WBYB 3ZDXE 1QHOA 4P0DA 5E5MA 1AO7E 2P44B 3MBEA 3QEHA 4UT6H 5CZVL 1NC2A 4LOUC 1AGBB 3U9PH 2C3HA 5L9DL 1HWGB 2FX9H 3OJDB 4PJGF 3VXUD 3I6KB 3BZDA 4WWKD 3FT4B 3LPFA 5CLTA 3MCLL 4LCIH 5EU5A 1DUYA 1KENL 2D2OA 4HIHB 5KSUB 5C3TA 3UTSB 2CH8A 3B9EA 2BFVH 2X89D 2D0HA 4HWEH 1QFHA 2C26A 1QPPA 4H88H 3OGCB 1EUTA 5BMFH 3PE9A 1FFQA 4PJFB 5EIQA 3WUWB 1CFTB 3BKML 3KHOA 1WAAE 2R0WH 3V0WL 4NO5A 4OV5A 5DEZA 2DLFH 5INDB 3JUYA 5H35B 3QPQD 2EXWD 4DW2L 4KVCL 5L2KB 4HIIA 5F3HB 5D7LB 2VLMD 4XRCB 3L9RA 4AG4H 4I77H 2NY7L 1KB5L 3QFDB 4JRXA 3QEQB 4I3SH 5CSGA 3ES6A 3MACH 4XVSL 4R0LB 4X9FA 5F93C 1EHLL 1FP5A 4NSKA 4PGEA 3BKJL 1TVBB 1LEIB 5EBMB 4M1DH 1JGEB 4LHUA 1AGDA 5DYOB 3S9DB 2GIYA 3QDJA 4UNTA 4KDWA 5JW4Q 1U3HA 3MV8B 1FV1A 1MQ8A 1TXKA 2B20A 1T66D 4Y16C 1T1WA 3TN0A 1RZGB 5DVLA 3O3DB 5EOQL 5IB5B 1JNHA 2FYYA 4NC1E 4OT1L 2V5SA 4KZEL 2UVFA 4JQVA 1I3RB 3KVQA 1M1SA 1AO7D 5I1JH 3QNYA 2DF3A 1XF4B 3F58H 3OMZA 1BREA 3DUSA 5DJCA 5T33H 3RVWD 3U6RB 5E8PA 4LDEB 1FIGH 5D1XD 5E2WH 5C0BE 1BOGA 4X6BB 1J8HA 1A9BA 5LQBL 1OAKH 2F58H 1S9WA 1IQWL 1KPUB 4FXKA 4YHIA 3HC3H 4KK5C 1CFNB 2X1OA 5IVXF 3T3PE 1MJ7L 1NBVL 3QFJA 2ADGB 3WNKA 2EE9A 2OTWB 4MCYB 4PJ9B 4PLNC 3MRQB 3IB4A 1NDGB 3VE0B 1EHLH 1CK0L 3LZFH 5DHVH 1SBSL 1NMBH 1IGIL 1QSFB 4MWFA 1UM4H 3BO8A 2J88H 1JNLH 3MRHA 3VI3F 1HH6A 1KJVB 4PFEA 4O2FA 2Z93A 1NEZG 1I1YB 4KUZH 3U83A 3DYPA 1WBZA 5DR5H 3STBA 2PR4H 1TQCC 4PJHB 5HHVL 2P49B 3D2UB 2FO4A 2R2EA 4XP5L 3L3JA 1T5WA 1ZHLB 2VAJA 5C0BD 2XA8L 5FDWB 4LSDA 1N3NB 5MERA 5TE6H 4M1GH 1RPQA 5KSVA 2N7AA 4XVJH 4WFFE 2X4UA 3CAFA 4PD4J 1N59B 4NQXB 5T1LD 5TDOB 4HULB 1HQRB 4U1KA 1S7TA 4K23L 1QQDA 2Z91A 3QUYD 3SGEI 3RTQC 3OAYK 2XTJB 3RWEB 5LWYH 2A9NL 3S7GA 4E41E 1SVZA 3IDXH 1OW0C 1ACZA 4XP6H 3EOBB 1LEIA 1YDPB 1DVFA 2BSED 2DKUA 3EO9L 4F57H 1EEQA 1J8KA 1X4XA 1QR4A 4R2GB 4OLYH 4A2LA 5B3NA 4PTTA 5ANMB 5C0BB 1VEMA 3DGCR 2JIXB 4RWYL 1NC4D 2OR8A 2X4NA 3TVMB 4MJID 5IWLC 3CVHH 1BZQK 2XPGB 4ZTPH 3ULSB 4EDWL 3GSUA 4JRWA 5GGRA 2G5BA 5FM5M 3GUTB 3O41A 5GRVL 4GKOA 3I6LD 1RZKL 2P5EB 5B4MC 3L3GB 1A3LH 1HXMA 1BD2A 5IG7B 4ZUSA 2UYLA 1LMKA 5KANI 4YLQT 4G6AD 4JFOA 1LNUA 1MCDA 1HCVA 5ADOL 1KC5H 4LLVB 3UCRA 3P4NB 3LDBC 4RIRA 4BH8A 2OZ4H 4TOYH 1QO3B 1S9WB 3GMMB 3UTSA 4EI5D 3H3PH 2H3NA 1T21A 1W0VA 2NY6B 4P3CH 4XTRC 3WIIH 1PLGH 2XN9B 4N1HB 3ARUA 3FT2B 1MI5D 2EH8H 3MODH 3BZEA 3EJJX 2JCCB 3P9MA 1DBBL 1ORSB 3RL1B 4I9WD 3RWFA 2NY6C 5HI5D 1CD1A 5BQ7B 2C1PA 3SDXB 2NY2D 4L4JA 1NGXB 4M8VA 2IPKA 4LRNH 4JPWL 4LNRB 1KJVA 3RVUD 3UTTB 1A7PL 2BZDA 2OI9B 3BVNB 5C92A 3PIQA 4PBWD 1I7UA 1B0RA 3EHBD 2E5EA 2Z31D 3O9WD 1X5HA 3F8UB 4ODHH 1K4DB 1U3YA 2FO4B 4S10A 4QRPE 4LQ1A 4O5LL 4MXVE 1T5WB 1A7OL 5HI3D 5IHBA 2Z4QB 4RFOL 5I73C 5A3IC 4OV6F 1B0GA 2YPVL 5DEFA 2WBJD 3DLQR 3THMH 3G6JE 4FNLL 5GS1C 2GEEA 4WWID 2WV3A 1PSKL 4XCFL 5T1DH 3GMNB 4QGTA 3K2UL 2VDQL 4CAGA 4CRPA 5GIRA 1MHHB 1I7ZA 2O5ZH 3QWOB 5F71A 1MUJA 3LB6C 5D1QD 1ZT1B 4LARL 5AZEH 3KG5A 5IEHB 4HEME 1DUYB 4Y5XA 4PJIB 1WV7T 3DURA 2BVPA 4JFEA 4PJAE 3BIKA 4KHXH 3Q3GB 1KN4H 4UTAL 1S7RB 5TH2A 1K85A 1T22B 2A9MH 3QRGH 1RJCA 1YY8B 2IAMD 3HNSL 4WTZA 2IBBA 3B4NA 3FOMA 4X98B 5JPNB 1RY7B 2EH7H 4K7PY 4NQVB 2MPAH 5DFVD 1DEDA 3ULVC 3LOWA 3DETC 1ZANH 2YN3A 1JNHB 2FR4B 3OR7B 4OZGA 1CF8H 2ZPKH 2R0ZL 4ZAKD 3TYGH 1U8QA 2BNQE 3RX8A 4YHOL 3PV6B 1Q94A 3WJJC 4DK3A 1T1XA 2P1YA 1CCZA 4YHNA 4ELKA 5I1IL 3UTSE 3H9YA 4NQCD 3U46B 4QHMA 4MCZB 4HG4K 4O2CA 4LPCA 1RK0A 1HH6B 5IQ7L 4U6XB 2RGSA 1VDGA 2YA2A 4YXLL 4U0RC 1D5XA 1LDPH 4MNGE 5HI4D 1CLYL 3PV7A 5SX4H 5DYOA 1OAXH 8CGTA 3GSXB 3EZJB 3QXDA 5I8EB 5DK3A 1DQLH 3QULB 4J4PA 2G60H 4RRPG 5LCVH 4BSJA 1EK3A 4U3XA 2ZCKH 4Z7VB 3O4OC 1CGSH 5EG6C 3I02A 4ZUTA 4AIZA 5ADPH 5FYLL 2BHUA 3TT3L 4IJ3C 2NZ9D 2DLHA 4AEIH 2OSLB 1J1PH 1NANH 2FECL 4NQSB 4N9GA 2IADB 1NFDB 2FIRT 1MRCL 2XQYG 5LXGL 3PGCB 5ALBL 1FNEA 2DQUH 1FGNH 5J6GA 1JWMA 3VW3L 2GSIA 1S7VA 3MRRA 4PYGA 3N1MC 4TTDD 4H20L 5GSVB 2NY3D 4BSWB 5T3ZL 4MGXA 4JPIA 2GSGA 2R2CA 4G80A 2VDKH 2PUQT 4MQ7A 4BFIB 1MRFH 3OKDB 4S1QH 4GAFB 5AWNL 3UTOA 2CDGA 4M7JL 4O9HL 5C8JB 3P40A 5DZOA 2BRQA 4HIJB 1F11B 4LMQE 3RDTB 3IFNL 4J3SA 3FMGL 4Y5VB 4U4BA 2OBGA 1OAYH 4R7NB 1X5XA 1UWEL 4LPXA 3P4LA 4NJ9L 4OT1H 3RHWF 3FB6B 3SEPA 2LV4A 5IROA 4QRPB 4U1GC 2WBKA 4KHXL 3EDKA 1KIPA 2G5RA 5DK0B 1AXTH 1MNUL 2ZUSA 3JV5A 1Z5LB 2XQBH 5FGSA 1SQ2N 4NO3A 3ARVA 1MFAL 1AD0B 1KCSH 4NHUB 3UO1H 3MV11 2R0ZH 4EN3A 2MKLC 3G04A 4J1UB 1IILE 3RKDC 5HYJA 3MBXH 4WUKL 4HCRA 4B7IA 3W5MA 2OYPA 1MWAH 1QLEH 4CU8A 4YHYB 5A16B 4GRWB 3RY6A 4FTVB 3DHMA 4C83B 2NZIA 4TNVF 3QH3B 2CR3A 2VKWA 5IBTL 4DN4L 3G6DH 3CLEH 1ZHKA 1J05A 2X4SB 3BISA 3LKSB 4LLVA 4UT9L 3GHBH 2PYED 3X3FL 3DO7A 5C0RL 2A0LD 3BESR 2FIKA 2E8YA 3KPRE 4P9MH 2IH3A 1ODAA 1T89A 4J6RL 4BJLA 5TE6L 4PJ7B 3QI9B 3L5HA 1VADB 2WUCL 3E3QE 2B0SL 1XT5A 5C7XH 2VXUL 5DFVC 1UM5H 3BZEB 5JQ6L 2JIXA 3RA7H 1WBXA 5HHPB 3KXFA 3D0LA 4EQ2A 5CZKA 1IAIM 5FUOL 3KS0J 1E6JL 1CD0A 5TQ0L 4JFHE 1T80A 3VI3E 4OGZA 5AEAA 4FFVD 5EUOB 1CDGA 4NKDB 1N0LA 1W0WB 1DP0A 1Z9SA 4JZJA 2C3WA 1JF1B 3BDBA 5C1MB 5EFIB 3TYGL 3OF6A 1K4DA 2ZOLA 2BY1A 2R2BB 5F96H 3BPNC 3F7RA 2H3NB 1T20A 2J5LB 1FAIL 2X1PA 3IRZA 3R8QA 3LRSB 1FNSL 1UH2A 3MROA 4NQDB 1C7SA 1WZ1L 4ACPA 3HNVL 4ZXBB 1OGAB 4U1JA 2JCCA 1LK3L 3GMOB 3D5OF 4XCEB 3HE7D 2NZ9C 4P99A 1U93B 2EKJA 4UT9H 4KH2A 4ZUVA 1YPZE 3RDTA 3UBXG 1MHHA 2H9GB 4KV5E 5EC2B 5C0GA 4S1SH 2XTLA 1FNAA 3MRPA 4XVTL 2AJZB 3MLTB 4QRUA 3OJVC 4F80A 1Y0LA 5GGTL 4NQUA 3KPRB 3DTXA 1Q72L 1U92B 3B43A 1OP3K 1NCUA 4LCWB 4Y4KA 1KC5L 5TH2B 1QLFA 1F2QA 1NGZB 4LVNC 3KS0H 5DC0A 2A6DA 4P23A 3QPXL 4QHNA 4K3DL 3VRLF 3H7BB 3PJSA 5E8OA 3QB7C 3P0VL 1UJ3C 1SEBB 3C8DA 3P4OA 5ISZD 4PJEB 4AT6A 3S35L 1S3KH 4HUVB 3QIUD 1FZKA 2GYSA 4M43L 4Z7VF 2XZAH 2DM4A 4DCQB 3U36B 3TCLB 4LCUA 3FZUC 4M6NH 1MIMH 4WUUA 1P2CB 1GAFH 1U8OA 2X4RA 3WKNA 4OLXH 5IBUG 3U2SA 1LGVA 5JW5A 1T1YB 2XN9A 3IXTA 3NCFB 4R2GD 3DUHA 1EJ6A 4JE4B 3THML 2WWMC 3TPUA 2GT9A 5JIIA 2AGJH 3C5ZD 4C58B 1JYVA 3VXPA 3X3GL 3AB0C 2JCCF 3BP6A 3KXFE 2FJGA 1HH9A 3T2NH 1NGXA 2Q3AA 1AE6H 4N5ED 3LIZH 4ZS7H 4YNYB 1FVDB 1NFDF 4HJ0C 1PDKA 2XTJD 4K3JH 3H2WA 2P48B 2Q8AL 3OAUH 3QUYB 1FFRA 1CFVH 3SCMD 1MLCB 1ZA6A 3SKOA 4GS7C 4H1LB 4UV7H 3DOSA 4JZJC 4PJ5A 2HTLC 5LKNA 5KVGL 3G9AB 4WFHE 2R9HC 3V4UL 4JRYD 4YC2C 5K9OB 4UOJA 1N5YL 3ZE0F 1N2RB 4YDLB 4NFCA 4C59B 4KMQA 1S78C 2LU3A 4NNXA 1BWMA 4TQEH 1IGTB 1QG3A 4DGVH 1CICD 5ESAB 1RHHA 4GMSH 4M1CC 5E6IB 5IB1B 4CNIA 2GK0B 3WHXB 3K0WA 4FFWD 5E9DE 4JN1H 2ZCLL 5D7LE 4XMPH 4LCWE 3DXAA 4GAYB 4MMZC 2YPVH 1EMTH 1AQKH 5I30H 3ZTJH 2DBJA 5ICXB 2DTSA 1UVQB 4F2MA 5AD0A 1MAKA 4U1LA 1O7SA 4LPYA 1KB5B 1QSED 2EE3A 5ITBH 5TDPA 1VFUA 3RNQB 1LP9F 5BVJB 3MBED 3LCYA 1A7BA 3OKKB 4YAQB 3O2WH 2E9IA 5GGVL 5DFWH 1CFSA 4YPGA 3PQYE 3QEUB 2PW2A 2EEDA 1QBMH 1NJ9A 3O6MH 4LKXA 3UTQA 3PJSB 2FDBP 2VXVH 2DQIH 1SBBA 1U8JB 1N6QL 1A6TB 1OSZB 3C09C 5IBLD 3MBEB 4FFZL 2VSCA 3FCTA 3FRUB 4M6NL 3SQOH 3SO3C 4MHHI 4CJ1A 3OPZH 4ONFL 5C08D 3IU3B 3C60C 4XBEL 1IAII 3C6LB 4MDIA 5B38A 2VABB 1INDL 2O5YL 1EVTC 4UI2A 3HI5L 4HXAH 1RQ5A 2CK0H 3RVWC 2L0DA 1K6QH 1R0AH 5IB2B 3U9UA 4NZRL 5ACMA 5JW5B 2F54D 4MJ6A 5CD3A 4XPAL 5HYEA 1JGEA 1SJXA 5GS0L 3VFSA 5TPWH 5IROC 3KPOB 4DEPB 1M7DB 3HRZB 4PLKD 3U7WH 3FQNA 3RIAK 3UYPA 4UU9A 3BJLA 3I02B 1HH9B 2KL6A 4XWOD 4LIQE 3JWOC 2QSVA 4MNQD 1OPGL 3SJVE 4Y88A 2EZ0C 4Z18A 3IJHB 1P7KA 1AGCB 1QSFE 2SEBB 3KYAA 4S1QL 3HG1A 1BLNB 4JM4L 3G5YA 3O3EA 4UILL 5DQ9B 3VDCA 1VACA 2GI7A 4GG6B 1B4JH 4QHKJ 4O02H 4ODWB 4MD4A 3PDOB 1IFHH 4KK5D 1HILB 1ADQH 2DQTH 3VFRA 2V7NB 2Y5TB 1WBYA 2AJZA 2M26A 3LN5B 4WHDA 4WJ5B 2GAZB 3RVUC 5INDA 1XR9B 4M7KL 5CZXD 5EU6A 1CBVL 3QRFM 4PY8J 3JV6A 4NQEA 2NY0D 2EKSA 4RGOH 4L3CA 2WK2A 3TO4B 2KQMA 5EO9A 1BQLL 2VN4A 3QIWC 2NXYD 3J8F7 1ZKAA 5HGBA 4OZIB 2WBJC 1F58L 2EO1A 3GSNA 2QHLA 4HUUB 4BFBD 5C0IA 3VFNB 5A1AA 1WTLA 4MXWH 1LE9A 4NKDA 3QFJD 3GO1L 3D6GA 5KVEH 4XGZA 2JB6A 4Z7WB 3QO0A 1NAMH 3RKPA 2JJVA 5JTWA 5EZJA 4WI2