2MCPL

Refined crystal structure of the mc/pc603 fab-phosphocholine complex at 3.1 angstroms resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
220
structure length
220
Chain Sequence
b'DIVMTQSPSSLSVSAGERVTMSCKSSQSLLNSGNQKNFLAWYQQKPGQPPKLLIYGASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDHSYPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGA-KAPPA MCPC603 FAB (LIGHT CHAIN)
publication title Refined Crystal Structure of the Mc/Pc603 Fab-Phosphocholine Complex at 3.1 Angstroms Resolution
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1984-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcpL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcpL01
1ZLSH 5A2JH 3PXJA 5FKPB 4XMLL 3KDMA 5IMOB 4X99B 3C5ZC 3D85D 1EPFA 1GVIA 4FNLH 1FZKB 3S34H 2ZUVA 1QR1B 2CJUH 3QFJD 5HYQB 1MREH 1X5KA 4JZNB 5BMFL 4OTXH 2ZUQC 5KW9H 5J11B 1NC2D 4C83A 5F1IB 4ODWA 3PV6A 1X4YA 4HKJB 4TSAL 1XGTA 1UH2A 4LBEB 2X4UA 1U93A 2ZSVA 4DKFH 2EDQA 5DEGA 3ALPA 2NNAB 3C60B 4OZHA 3C5ZD 1Z9OA 5D7IB 4HKBB 2IQAA 5EO9B 2LVCA 3CVHL 3MV8E 2JIXD 1S9XB 3CFIC 4R26L 4PG2C 1MHHB 5HYSB 1D5BA 1ORQB 3B2VH 4ZFOA 2PW1B 3NIGF 5IEKB 2EYRB 3MMEA 4KHXL 4HPOL 5J13C 4LASL 5FKPA 3I9GL 4JFPA 5IMOA 4X99A 4LQ1A 4LLDB 2AAVA 1FNEA 1FZKA 4FQXB 4M1CC 1MLBA 3PHOB 1JGVL 5CBAB 4KZDH 4JZNA 5C0GB 3DX7B 2V9QA 2YOCA 5C0CB 5GJTH 4X8XA 1KCSH 2X4TA 4OD1L 4MDIB 4HKJA 3VXSA 5MP6L 5F1SA 1U95B 5D9SB 4LBEA 4LGRB 3O3BB 4FQCL 4F57H 2HKFH 5J4MA 5D7IA 2FGWL 1UKQA 4UNVA 4HEME 5J89A 4M1CD 5EO9A 1QFUH 3N50A 3RU8L 1X44A 2GJJA 4PJ9D 5CZVL 1S9XA 1J0HA 2MPAH 3WNKA 3DYMA 4OZ4B 4TSBL 1KLGB 1MHHA 2PF6A 1DBKL 3TO4B 4EUPG 4QRQB 2ZUYA 1ORQA 3BVNA 4DN3H 5HYFA 3KXFD 3O3DB 2RB8A 5IEKA 3P4MB 3VRJB 2EYRA 1P4IL 2KBGA 1RIHL 5D2LF 5D1ZC 5TDPB 2YD3A 4C56E 3SE9H 5T1LD 4LLDA 5C0BB 4FQXA 5HHNB 2YRPA 3PHOA 4G8FB 5CBAA 2HG5B 5C0GA 5FGBA 2V7NB 3DX7A 1IM3A 1N5YH 1SY6H 3BOVA 2H8PA 2NY1B 2QTEA 1A1NB 5IOPA 3AGVA 1BD2A 4MDIA 1SHMA 2Q20A 4OF6A 4P4RB 1SJHA 3K2UH 4HIJB 1LDSA 1WBYA 3MRGB 4XNXL 5CP3A 1U8MA 1TZGH 5E6ZA 3SJVD 1V3LA 2J8UA 4DFHA 4LVEA 5I1KL 5D1ZD 4ONGH 2PN5A 5FUZH 2Q6WA 4KUCD 1CICC 3BE1H 1FGVH 4OZ4A 5BZWA 1KLGA 2FSEA 3TO4A 1Q8MA 1CDJA 5CJQH 5DC0A 6FABL 2N56A 1LO0L 3S5LB 4K7PL 4MNQB 4LFHD 2YN5A 1N5AB 1IAIH 4JVWA 3O3DA 4M6MH 2Q87A 1NCCL 1KJ3H 3U0WL 4JO1L 2QADC 5GRJL 4PJDF 4NZRH 4QHMA 5TDPA 3BW9B 1QSFA 3L5HA 3WHXB 5C0BA 5HHNA 1CICD 4G8FA 1OCWH 3ARDA 2HG5A 1CFVL 2V7NA 1YPZB 4KQ3L 1D5ZB 3PDOB 3SGEI 2VZTA 2YXFA 4XP1H 1D5XB 2XQYG 2CDEA 1NFDA 2QSCH 3T65A 1A1NA 1DBJH 1DBAL 1DSFL 4XAWH 4JO2H 3N1MC 3SQOH 3SKOB 2QADD 3QUYA 3QWRA 3ARGA 3FT4B 1A7QL 1OQOA 4NUJB 1G7MB 3AY4C 5CJ8A 3U48A 1G9MC 1UB6B 2MJWA 2R0ZL 5KVGH 2V7HB 3RWHA 5HGBA 4RFNC 2XTJC 4NM4L 2VDKH 5JQ6H 2B4CH 4V2CB 4UIMB 5ESVB 2CLZB 4J4PC 2VLJE 3BQUB 1YZZA 4LSQL 4JPKH 4MNQA 3REVB 2EXYC 3B6SA 1XF5B 1N5AA 3WEXB 2RHEA 1EMTH 1A3LH 3QIBC 2E9JA 3O2WH 3ZYOA 4I9WE 1QUNA 1U3YA 1W0YT 1QBMH 1T1WA 3A67H 5HVWA 4F7PB 3GBNL 4FFZL 4RX4D 4AIZB 3BW9A 2IEPA 4LSPL 5D70H 2H3NA 2IBZY 2XTJD 5DRXB 3WHXA 3O9WA 5AEAA 4HCRH 4I2XB 3I50L 4ZOAA 4QKXB 1YPZA 1CE1L 4J4PD 1CD1B 4WENB 1K2DB 3N1FC 5DD1L 3ILPB 2EXYD 2HP4A 3QIBD 1SM3H 5DHYB 2H41A 3MRNB 3T0WA 4DEPC 4P4KC 1BFVH 3SKOA 4NKDB 4MQTB 3FT4A 5IB5B 4MXQC 4NUJA 1G7MA 4PRPA 4PREB 1UB6A 3QEGL 2ADIB 2WAHA 1QFWM 4S1RL 3L1OH 1NC4B 5D7LB 3QEHB 4JQIH 2AJXH 5ERWB 3N85L 5C0JB 4UIMA 5C0DB 5ESVA 2CLZA 1NEZG 3BQUA 5GZOC 1JTTA 4XPFL 3IXAB 4G9DB 2LTQB 3REVA 1XF5A 3FRUB 3TPUB 4P4KD 3WEXA 2I24N 4MDJB 4KROB 4CJ1A 1Y6MR 4EI5A 5ALBH 2WBJC 1OY3B 3F6IA 4MXQD 3PJSA 2XY2A 5C0RH 4FABH 4AIZA 4PJCA 4BFBD 5DRXA 3RP1A 1U8NB 4I2XA 4WCYL 1T89A 4LCWB 5D7JC 1CD1A 3VWJB 4WNQB 5GZOD 1K2DA 3ILPA 3HMWL 3O4OC 1J5OL 4G6JH 3DSFL 2AV1B 1YYLL 4GKSB 2WBJD 3JVGC 2O5YL 4MHHG 3KPTA 3WSQH 3K81A 4HV8B 5CEXA 1BBJB 3GIZL 3IFPA 1ES0B 3FFDB 4RMQA 4PREA 3OKOB 5ICXB 1WWBX 4NKIH 4UTAL 2ADIA 5DYOB 5E7BA 4OD2B 5D7JD 2EKJA 4HJ0C 3BPLC 1NC4A 5D7LA 4EXKA 5IFHH 5J8OA 5L8KB 2G9HB 3QEHA 4OFVA 5ERWA 1XGYH 5C0DA 2Y72A 4J3OC 3SGKC 4OZHE 5C6TH 3PWPB 4G9DA 3T4YB 1I8KB 3TPUA 2EDYA 4MDJA 4NSKB 2OL3B 3QI9C 4O2CB 5TE4H 1V5JA 1JRHI 4JFFD 1ZT1B 5B4MC 3QAZC 3LD8C 2ATPB 4M93C 3FRPA 1BWWA 4L8BB 1NGXB 5DVLA 3WS6C 5L2JB 2EDDA 4HJ0D 4U33A 3JTTB 1U8NA 4GMTH 4CVZB 4PJHB 3HR5A 5IVXB 1JGEA 4OT1L 5I71C 4LCWA 3BEVB 4WNQA 2G60H 1S3KL 2ZP0T 4WFFD 3MRMB 4YHKL 2Z31A 3CGTA 1FIGH 2NXZC 5DK2B 3QI9D 5T1DL 3BHBA 4HV8A 5B4MD 3GMPB 3C8KA 1BBJA 1HXYB 3LKPB 2Q8AL 3FQUA 5K9KB 3INUH 3RTQC 4OCYL 5DSCA 4YZFE 5C9KA 3KPRB 5ICXA 3MRQB 1F8TH 3VXSE 5JO5B 4XPAH 3D39D 3CUPB 4YLQT 3VA2C 5BVPL 5F1OB 1C5BL 5IVOA 3CK0H 2NXZD 5JUEH 3WKMH 1FGNL 3PWPA 5D7IE 4Z7OE 1J0KA 4QRTA 4NSKA 1J0JA 1KFAL 2YA2A 4TOYL 1L0YA 2OL3A 2VLRA 2XY1A 4O2CA 4ENEC 2LV4A 1MY5A 4P2QD 4UV7H 3RA7L 1ZT1A 5GSVB 3BP7B 2R4RL 4L8BA 1HKFA 1NGXA 4ZAKB 3U36B 3DRQB 5L2JA 4P48A 4NC0B 1KCLA 4QLRA 4KAQL 1VEPA 3JTTA 4YR6A 4PJHA 2X4RB 3BEVA 1J1XH 2YRZA 1FO0B 2D0GA 5I74C 4DZ8B 4MVBD 3MRMA 4JPIA 1PAMA 1KACB 2XYCA 5DK2A 3QUXB 3MNZB 4ENED 2BHUA 4RRPA 4GO6B 1CBVH 1JMXA 1A2YB 1T5WB 1HXYA 4MD0B 3LKPA 5E1HB 5LKNA 3RIFF 4H20H 1X5ZA 2AJVL 2OZ4H 1BD2E 1XF1A 3MRQA 4KDVA 1GZQB 2H1PH 5E08L 2A1WH 1BBDL 2J8UE 2VDLH 2HRLA 3MOAL 4JFED 1OT1A 2N1KA 4YDJA 1H9VA 4FXKB 2RFXA 2GSIB 2VKWA 3FN0H 5CAYB 3VXNA 4JHWL 3TNMA 5I8KH 2AK1H 5J12B 1XAUA 2NLJB 3SKJH 5JHDD 3MOBH 4S1SL 5GSVA 3O3AB 5H2BA 1ITCA 3BIKA 1KUMA 4ZAKA 3U36A 5I16B 5KSVB 5IKCB 4QGYA 4NCC1 3DV4A 5ADPH 3P77A 1RI8A 3BN3B 3GMMB 3FB7A 4IS6A 1FH5H 4KVNL 2J6EA 3U1SH 3HMXL 1OP5H 1HHKB 5B39B 1MCJA 3UTZB 3M17B 3QUXA 4PY8J 3MNZA 4H26B 1LK3L 3RWJB 2VL4A 4CL7A 1QSFE 3EOAB 2AKRB 5C0BE 3SQBA 4MXVE 4Y4HB 5KVMC 4ZFZA 4GAJH 2F8OA 1A2YA 1RVFL 3TESA 4NBXB 4A6YB 4PRID 1OW0A 5I6XC 2CGRL 3Q5TA 3LQAL 5HI5C 1NFDE 1RJLB 3VFUA 1F6FB 3KGRA 2J12B 5JOEA 1GZQA 4NO0D 4RGNB 1F4WH 3ECBB 2J7LA 1F3DJ 4OQ1A 1WWWX 3MBXL 1R5WB 3ESUF 1RK0B 4ETYA 4NKQB 3ZYIA 4RBPH 3UMTA 2NLJA 2A9ML 3OKKB 2PTUA 3O3AA 5HI5D 5IW1B 3RZWA 5I16A 2K7PA 5IKCA 5KSVA 4Z9KB 1A14L 4X6BB 4QRUB 1N6UA 4MNQE 2BP3A 3GMMA 4DUXA 5E99H 3SHSA 5F97E 1QBLL 2IJ0C 1FG2B 4IM8A 4XCEA 3T8XB 4L4VA 1HHKA 3R8QA 3UTZA 3M17A 4H26A 4YC2B 3EOAA 2AKRA 4L4TA 1I8IA 4RDQG 3GJFH 2FO1A 4MAYB 3C2AH 1YPZE 1F4YL 4A6YA 1YJDC 3W11C 1FFRA 2WP3O 4B41A 4JG0L 3E2HB 5FGSA 1CU4H 3ECBA 1MCOH 2IF7A 1JI2A 5D1XC 1R5WA 5SV4A 2OM5A 5M94B 4PRPE 1YC8A 1RK0A 3QSKB 1UJ3B 3BRFA 2BOBB 3GBMH 5E5RB 2J1KA 4G3YH 4L1DA 2VDML 4HS8H 3R1GH 1RULL 4OZHF 5FA3B 4AY0A 2VDNH 5IW1A 4OSUH 5DTFB 3TLRA 3W11D 1EZVY 5AD0A 1OWRM 3LRHA 4KI1A 1WWAX 1QSED 3UEZA 5I19L 1NEUA 3D87B 1MF2L 1QYGL 5DVKA 4K9EH 3G9AB 3AS0A 4B53A 5D1XD 3BPOB 1I9RL 3WUZA 1FG2A 1R3LB 3W2DL 1KTRL 3T8XA 3NPZB 2HFTA 1INEL 2HFFB 1HHIA 2D4DA 2YN3A 1NBVL 1TVBB 4PJCE 1YNLL 5L8JB 2PNDA 1I75A 2VAAB 3CDGB 2BVEA 3Q0HA 4MCZB 3ZTJH 4I2XE 1PSKH 1AKJB 4LSUH 4JR9L 4MAYA 2CIIA 5LWYL 3QDJD 3EYQC 3I3BA 1A7PL 3U9UB 3MLSL 1MIEH 4XVUC 2DI7A 4P9ML 3FO1B 1JF6A 2Z0BA 2YUWA 3TGXA 2HA1A 1SMAA 1RZ7L 2F5BH 4Q7DA 3EYUL 4U1HB 3MJ9H 4YZFF 4PYGA 3E1F1 4HPYH 1A1OB 3RZCB 2BOBA 3TC9A 4LFHG 3O11B 3MZGB 4POYA 4XNZC 5LBSH 3EYQD 5D7LE 5FA3A 4OCMC 5D7IF 4Z7OF 4XVUD 1L9NA 3WO3B 3ZLQC 4P46C 5E2VL 8FABB 4PJEB 4XMKL 2Z9TA 3DLQR 3CDCA 1KXTB 3IRZA 1R3LA 2O5XH 1NCNA 4XCFL 1WFNA 4OZFH 1RZ8B 4M4RA 2HFFA 2R2EB 1FAKT 1JJUA 3HC0A 1TVBA 2HFGL 2GTWA 1T7VA 2VAAA 4JFOB 3CDGA 3DSNA 5I76B 1AKJA 4KKBC 4LCWE 2DLIA 4ZXBB 4P46D 1PGRB 1SEQL 1ERNA 5E7FA 1LQSR 2D7TL 1OAXL 3G08B 4PRNB 2ATKB 3SDDB 4OLEA 2W0FB 4DWHA 2H2SC 1QPXA 3IDYB 4U1HA 3HPJB 4JHAL 1P2CB 2NY2C 4JY5H 4RISH 3RWCB 2YK1H 2R2HB 1TPXC 1MPAL 3RZCA 4KKBD 3EFFA 1JPGB 1NCWL 3O11A 4MHHI 1XR9B 3SGDH 1NCBL 3GB7B 2X89A 1TCMA 3PWPE 3V5DB 3LKOB 4PJEA 2IFFL 8FABA 2H2SD 1AGFA 3GSOA 1RU9L 3DIFB 1U0QA 2VLRE 2NY2D 3O6ML 2DQTH 4YHNB 3LPGA 4V2BA 5FUOH 1CZ8L 1SYVB 4JKPH 2R2EA 4LRNH 4XPTH 4RIRA 2ARJB 3MLYH 5BO1H 1HYRC 2Y23A 1F90H 5IB1B 4JFOA 4D94A 1A9EB 4Q9BA 1OM3L 2NY5L 4PJHE 3BAEH 1AQDB 5EA0L 3VI4E 4IMKC 3BO8A 5FK9B 1Y18B 4MXVF 3S37X 3G08A 4PLKC 4PRNA 1VGEL 2ATKA 2Y36H 3QXVA 4G6KL 5HBBA 4X9FA 4ELKA 1LEIB 1MHPL 1I3GL 3HPJA 1NDGB 1P2CA 2V5TA 3UC0H 3RWCA 4UILH 4FA8A 1IGYB 4U31A 2R2HA 3OX8B 4IJ3C 4GLRH 4JANB 5CKAA 2E8ZA 1NUNB 1X6LA 1KELL 5IIEB 1FSKB 2VXQL 4JO4L 3P30H 1HQ4B 1XR9A 3TT3L 3TT1H 1QACA 4PLKD 4APQC 3GMRB 3TBWB 3CJJA 3DIFA 2IG2L 2PTTB 2E7CA 2HYMA 2RQ8A 4YHNA 2KZ1B 4EUPB 3WFZA 5JOPD 3OMZA 1J0IA 1U6AH 2CRMA 1JP5A 2RCSH 3CCHB 5C08B 3VWKA 5KJRH 2HTKC 3HNVH 5F93C 2Y07H 2EKSB 1AQDA 4NOBA 4APQD 1W2KT 3D3VB 5F7EH 1MRCH 4XPHL 2CUHA 5FK9A 1Y18A 2QKIB 4R0LC 5SX5H 4I77H 4XX1G 1DLFH 2W1NA 1YPZF 1LEIA 4N0YL 4YBHA 1JI1A 4XCYA 3V6OA 4L3CB 4JM2B 5E2TL 1VACA 2GY5A 5CINH 1IGYA 4Y5XA 4JGMA 2VDQH 2HTKD 1QZ1A 4JANA 3IJHB 5J06A 3LN5B 4U1MB 2Q3ZA 5EBGA 1FYHB 3K80A 1ZLWH 3TYFB 1HQ4A 3DETC 2H32B 3JWOL 5AZEL 3HE7B 5EOQH 3VFGH 4BH8A 1MNUH 2EDFA 3TBWA 3OAZK 2D7PA 1VPOH 4YHIB 1DQML 3RY5A 1WJ3A 3HLAB 4YXHH 5E00B 4HDIA 4XNYH 2NY4C 1U8KB 3RDTB 4EUPA 1G6RB 1CDBA 3FTGA 3G5ZB 5EU6B 3SDYL 1NSNL 2ICES 4DKDC 2B0SL 4K94H 3CCHA 5JHLH 1OVZA 5C08A 2GJ6B 3VFNB 3DETD 2FHCA 5MEND 3HI5H 4NO5B 5I15H 2DTML 2DLTA 4JHBA 4L4VE 3D3VA 5JW4M 3P4OB 4NC1C 1B4RA 3L5IA 5A3ID 2NY4D 5GGVH 2XXMB 4JKMA 4L3CA 3BMVA 1IGIH 3C6LC 2YZ8A 3MCLH 3SGJA 4LVNC 3TWCL 3IJHA 3LN5A 4U1MA 1V8HA 3TYFA 3U7AA 4RGNE 2DWDB 3UZQA 4PB9L 3CDFA 3HE7A 1MLCB 5JW4Q 1ZXQA 1ZS8B 2R9HC 5EU5B 3HZMA 5EOCL 3MV9D 3KAAA 1NCAH 2X1WL 3L3JB 3HLAA 4N68A 3C6LD 5EU3A 5FO8B 1U8KA 3RDTA 4KPHH 3S36X 1ZANL 5CWSB 4H1LH 5EU6A 4PJAB 1I85C 3W82A 1PZUB 2GJ6A 1J8HB 3EW3B 4DTGL 3VXMD 2K7QA 4LPUA 3PWVB 5BOZG 4NJ9H 1WT5C 4MNHA 3UTQA 5D71L 5IJKA 2R9HD 5DXWA 2N7AA 1XFPA 4XPBL 1BP3B 1KJVA 4NHCL 4QWWC 5KOVC 1EJOL 3DI3B 5GS2H 3LEVH 4WY7L 2Q8BL 5F7FA 2QBWA 5EO1A 1YDPA 2YWZA 3EYVB 1OF2A 3G5YB 1QSVA 3ZDXE 2CKBA 3Q6FB 5TE7H 3VXPA 5C3TA 3T2NL 3P0GB 4JPVL 5MEOB 4BH7B 1MLCA 4PGBA 1MH5B 2I26N 3GHBL 3X3FL 4BZ1H 4QWWD 1ZS8A 1NGQL 4MCYB 5CJXC 3S35H 5A2LH 4FMFA 3L3JA 3MREB 4EBQL 3HAEH 5I1DB 4LVOB 1QRKA 2YKLL 2A9NL 5T1MB 1NEZB 3NACH 5KVDH 5CWSA 2YPKB 3MRPB 3HI1B 1BF2A 4PJAA 4PIRF 2X9YA 3KYKL 4LP4A 5K9QG 12E8L 1J8HA 2AV7B 2R4SH 4G6FB 1FORH 5HJ3B 2ICWI 5CFHA 5J6HB 2DD8L 2GHWB 1MAML 4HWEH 3RKDC 5JTWA 4OGXH 1DQJB 3LRGA 1AHWC 5F44A 5GHWL 3U30C 3D0VB 3OBAA 4PJHF 4U6VH 5IVXF 3RUGA 2HRPH 4N0CC 3VI4F 1D6EB 2BSSB 3EYVA 4S1QH 3G5YA 3TBVB 4LEXL 1FQ9C 3V4PH 3PGFL 3TH4T 3Q6FA 1N8ZB 5KSUB 4H8WL 4WDIB 1P1ZB 3RKDD 5MEOA 5DEZA 4BH7A 4I4WB 4NKOA 4AIXA 1CGSH 3PWLB 4JDTL 2VXSH 2EIEA 5K59E 3TFKC 3CU1A 4GRLC 4N0CD 3MREA 5I1DA 4OAWB 4IEFB 4J23A 4JGJA 5IMMB 3HRZA 4XBEL 5T1MA 1NEZA 4OD3H 2IPTL 4HULB 2YPKA 3MRPA 3HI1A 2IQ9H 1S8DB 4P5TA 4P3CL 2VDOH 3AB0C 2AV7A 3UYRL 4PJEE 3FB5B 4Y89A 2NY6C 4M43L 5J6HA 2VH5L 3QIWB 1A5FH 3KPMB 5L2KB 1JWMA 5IMLA 1I9EA 1NUFA 4JB9L 4I0KA 3U0TB 5IBUG 3TFKD 1GGTA 4GRLD 1PDKA 4P2OB 3D0VA 4Q9QH 2M26A 2WZPD 1LMKA 3Q1SL 4F3FB 2DDQL 4JJHA 4F7EB 5C2BL 1GGIH 2ADJB 2YUXA 2Y5EA 5C71A 4XNUL 4YE4L 2BNQD 1TZIA 4QXGL 5F6IB 5BV7B 2NY6D 5FM4A 2DB8A 2IBBA 1N8ZA 3QG7H 4I3GA 5KSUA 2YD1A 1P1ZA 2YBRB 2UUDK 3LCYA 2DIBA 4POZC 2BVOA 1OWWA 2YUVA 5FA4B 1PFCA 4BFIB 4NNPH 2QHLA 1IL1A 1IGFH 2VQ1B 5I75C 5DFVC 4JM4L 2R1YB 5JZ7C 1L0XA 4F15B 4WV1B 1R3KB 4R8WL 5IMMA 4AG4H 1DQTA 3D2UD 4Y5YB 4J2XA 1EFXB 2OR9H 1S8DA 3AM8A 3CAFA 1A6UH 3FB5A 5DZOA 3NFNB 4POZD 3WUWG 3QIWA 5L2KA 3HA0A 5DFVD 4QTIL 5JZ7D 3DTXB 4NQXB 2E7LC 3U0TA 2QSQA 1L0QA 3BIAX 3QQNA 1BQLL 1YUHA 2HT2C 4YBQD 3CFJA 3SO3C 4GKNA 4HG4K 2O61B 4I18C 4F3FA 1DZBA 4F7EA 3QDGB 5GGQL 4Y4FC 1W72H 4S10A 3G6DL 3SPVA 5GGUA 1H5BC 2X4QA 1T0PB 4JY6B 1CFNB 4CMMA 4LMQI 4ZFOL 5DT1H 4K2UH 4LGPB 4YO0B 3ROLB 2XV6B 4OBRA 3NCFB 2YBRA 4LU5H 4GAFB 5DLMH 3EOYG 5FA4A 3V6OE 4BFIA 4K07A 1J9CT 2VQ1A 2HT2D 2R1YA 5INDA 2KQMA 1N4XL 1XIWB 3I6LD 4O2EB 3GK8L 4Y19B 1R3KA 4Y4FD 1OGAA 1RUMH 1CYGA 4AJ0A 2NY7H 1CF8L 4G8EA 3GSVB 4Y5YA 3RQ3A 1EFXA 4YBLB 1AD0B 1G7QA 2OBGA 4JCLA 5KBNC 1D3CA 2HVJB 4OCRL 1NL0L 1YMHB 4HIHB 1B4JH 3NFNA 1J88A 1YMMD 3DTXA 1DBML 4DGIL 3BGFB 5FF6B 5I1LA 1E4XI 3LV3B 2VZVA 4K3DL 5C08E 1OPGL 3D85B 2DYPA 4O9HL 3QDGA 3QFJB 1EUUA 1IAKB 3P4NB 4ODSH 1CL7I 1M7DB 1NC2B 3D3VE 5IROC 3PDGA 1CFNA 3WE6B 3EYOB 3S97C 4YO0A 1G9NC 3ROLA 3IDGB 1DBBL 4PV9B 4OGAC 4QY8A 5DMJB 1UA6H 3QRGL 1L7IL 1JMZA 5IB3B 1XIWA 3D9AL 3C5ZB 2GJZB 4K3EH 4G7YH 4O2EA 1KB9J 3OAYH 1BJ1H 3LEXB 4HGMA 2ZUQB 4B0MM 1X5HA 3EUUA 2JIXB 4WEBH 1P5UA 2WBWB 4A2LA 1AD0A 1CE6B 1HXMB 3VGGA 2HVJA 1VA9A 1YMHA 1TQBC 1O0VA 4HFUL 4OGAD 4XMLH 4P3WA 4XZUB 1CVRA 4HAFA 1C5CL 1A6PA 2R23A 5BMFH 5EU6E 5FF6A 3PL6C 4FTVA 1TCRB 4YAQB 4LDOB 3LV3A 2GJ6E 1O7SA 1Z0NA 4TSAH 4G42B 1F6LL 1A0QL 4U6TA 3UDWC 2XA8L 3QFJA 1JF1B 2X9XA 3CFCL 3CH1A 2NZ9C 1HINL 4WFEE 3JV6A 4HWNA 1NC2A 4BQCA 4IOSD 1U8LA 5DUPL 3TO2B 3WE6A 5GISL 3EYOA 5EUOB 1CWVA 2ZG1A 3GSUB 1IVLA 3F12B 3BI9X 4PV9A 1WTGT 5J13B 3PL6D 1TJGL 1I3VA 4M7KL 3C5ZA 4R26H 1NMAL 2F53A 5KVEL 1KPVB 2EDLA 2NZ9D 4MWFA 2WWKT 2JIXA 3WS3B 1WVZA 1XGQB 2IPUG 4LAQL 1G7IA 4K8RL 4RWYL 5K59F 1LE5B 3LKNA 1CE6A 2ICWB 3W9DB 1HXMA 4KHXH 4HPOH 1KIRA 1JV5B 4LASH 5FO7A 1XMWA 4YIQB 3I9GH 2C9AA 3KXFB 4OM0L 2Z35A 4YXKL 1K6QL 3HE6C 3BX7C 4IDJL 1JGVH 1TTUA 2I27N 4Q2ZA 4PJEF 4PJAE 1TCRA 1J8HE 4OD1H 1ORSB 5T1LB 1TQCC 4G42A 5MERB 5MP6H 2BY1A 5BW7C 5JDJA 4PG2A 3MRLB 2VO5A 4X0KB 3WFHB 1RK1A 3BP6B 3TO2A 3M45A 4FQCH 4BSJA 2FGWH 3JWDC 3GSUA 3HE6D 3F12A 3GZKA 3RU8H 2VAJA 3SJVB 3RUGE 5CZVH 5D1ZB 1XCQB 3DMMC 2C3WA 4AENA 4TSBH 2X09A 1DBKH 1KPVA 3T0VA 4PJ9A 4M7JL 2D7OA 3C5JB 2W65B 3WS3A 1XGQA 3DROB 1N0XL 1FE8L 3K3QA 4NN6C 1LE5A 2LVEA 2ICWA 3W9DA 2V9RA 1RZJL 5TF0A 1P7KB 1P4IH 4PJ5D 1RIHH 1JV5A 2R8SL 1I1AC 2VXUH 4MJ2A 1IQWL 1A6AB 3KXFA 3S37L 1N6QL 3MCKA 3DMMD 1MY7A 1S7RA 3KPNA 1PEZA 5CSGA 4HK3J 3RWDB 5GGRY 3NTCL 5E4IA 1ZVYA 1A64A 1ORSA 5T1LA 2Z4QB 4PRAA 5BXFA 2X2YA 5MERA 1CICB 4OZFG 4Y8DC 4XNXH 4KK8C 4OCLC 4AMKL 3MRLA 1QEWA 3OGOE 5EZJB 4X0KA 5I1KH 3QXDB 2AEPL 1U8HB 2GTZB 3BP6A 1I1AD 4P2YA 2X7LA 3LS5L 1BQUA 3ETBF 4U6YB 3MBEA 5K9QI 5DFTA 2MCG1 4JZJC 2ARWA 3KPOB 3SJVA 4ZMAT 4L3AA 3BKCL 5ICYB 4LHJB 2QADB 2XN9A 5D1ZA 1XCQA 4YHYC 1G7PB 5FYKD 2DKSA 1CR9L 6FABH 1C08B 1LO0H 4K7PH 3DUSA 3VFPA 4KK8D 3ZDYE 3C5JA 4NHUB 2CLRB 3DROA 3ABZA 3O4LD 2BXZA 4OFPA 4D0CB 1NCCH 5T3ZD 1VESA 1BJ8A 4X9HA 3VRLE 1P7KA 4UU9A 3U0WH 4JO1H 4ZQKA 4D9LL 4XHQA 5GRJH 1BFTA 4PBWD 1A6AA 5JLZA 1LNUB 1NGWB 5F7WC 2WINB 1CFVH 2VZSA 4KQ3H 4XNMB 3GGWA 4RFNB 5HHXL 2XTJB 1WQVT 2Z4QA 3IKCB 4MGXA 1MSPA 1DBAH 1DSFH 2K3TA 3MJGX 5L2KE 5EZJA 2BVQB 3GFUA 5DVNA 2GTZA 4H25B 5EIIA 4U6YA 1A7QH 3QIBB 3NAAL 3KPQB 4JFDA 4U1JB 3MO1B 4U1IB 2J8OA 3SOBL 1CD0A 2R0ZH 3C09C 3AXLB 4GXUN 5ICYA 4KKAC 4NM4H 1G7PA 5DK0B 4PP1C 5ETUB 1ZHNB 3B9AA 1BX2A 1IZKA 5C86A 4LSQH 4L1HA 4NHUA 4JM2F 2CLRA 3U0PA 4D0CA 4FZEL 1CDIA 4R97C 3ZT6A 1MRDL 4B5EA 4DEPB 2X4NB 3GBNH 4FFZH 4P4KB 5HGDA 3L6FB 1R3HB 4LSPH 1NGWA 1A4JB 3R0NA 2WINA 4KKAD 1OGAE 5DS8B 4E41A 4PP1D 1NANH 3FCTB 3I50H 1IEHA 1CE1H 4XNMA 3DVIA 4RX4A 3IKCA 2RBLA 3VD4A 1P53A 4FXLA 3KYMB 3C8HA 2BVQA 4H25A 2DRUA 2L7UA 4WI2A 3TEUA 1PKQB 1HHGB 3QIBA 3KPQA 3V0WL 3WYRA 4U1JA 3MO1A 2OL3L 1PZ5B 2WBJB 4U1IA 3QEGH 1XCTB 3T3ME 5ID1B 1MCDA 1EHAA 2A6JB 3QDGE 4S1RH 5JPNB 1BWMA 1KCUL 4FFYL 2BXYA 3IAPA 2W9EL 1FYTA 3S36L 5ETUA 1KGCD 1QHOA 5DRZB 5IW6B 1MELA 4TUJB 1OAQL 4AT6B 4XPFH 2ARJQ 5B8CC 5DURD 5D7JB 3SDCC 3VGHA 3GEWB 2DQFB 3OSKA 3O4OB 3D25A 3QUZC 3WNOA 3RY4A 3T0EC 4PTUB 2X4NA 3U6RB 1R3HA 4JJ5B 1A4JA 4JY4A 1W0WB 1CDUA 1A7NL 3Q6GL 3FQWB 3FCTA 3KYOA 4WCYH 4JFFB 4YGAB 1NMCC 3T0AA 1YEGL 3GSXB 4GBXC 4D8PA 1JNHA 4WHCA 4XP5L 3HMWH 1J5OH 3DSFH 3CD4A 3CIQA 3SDCD 5HDLA 1QA9B 3BPLB 1YYLH 1G7JB 1S7UB 1EBAA 2O5YH 5EU7C 3QUZD 2UY6A 3KYMA 5ADOL 4PJAF 2OXGA 4HMCA 2YPVL 3T0ED 3GIZH 4LKXB 2GK0B 1HHGA 4FTVE 3KPSA 3QI9B 2XQYK 1ZLUK 1ZGLM 1ZLVH 3N9GL 4UTAH 1XCTA 3MRKB 4JCMA 1S7SB 5ID1A 2A6JA 3QAZB 3LD8B 4M93B 5JPNA 3QFJE 4GBXD 3WN5C 5DRZA 3PGDB 4TUJA 4HQQL 3ULUC 4AT6A 5I71B 4GRWH 3BRGC 3D39B 2J6EL 2ZSWB 4ZNEA 2HVKB 2YWYA 2EIDA 3KHQA 1Q9LB 3S4SG 4MJID 3SE4C 3QYCA 2NXZB 2NX5A 4BFGA 3JVGA 2X4SB 4PTUA 3U6RA 2F53E 1IC5L 5CIPH 4CVXB 4W4OA 1IRAY 4JJ5A 1ONQA 3BEWA 4IBLT 3CC5A 5FFLA 1HILA 5GIRB 3FQWA 4JRYD 1U8QB 4P2QB 3RTQB 4NZUL 3A6OA 3LOWA 1HQRB 3ULUD 4N90D 3FQRB 1INDL 3IU3B 3MUHL 3NCCB 1KXQE 1S3KH 4XH2A 4YHKH 1DEEA 1C5DB 4ESKA 2ENYA 4I1NB 4QOKA 1AXSA 2BMKB 5T1DH 3SGKA 4H1LG 3AREA 1JN6A 5IK3B 2FX7L 3ZE1F 5I73C 2Q8AH 5IESL 2GK0A 4OV5B 3PDDA 2E7MA 4OCYH 4ACPA 5HD8C 5L88L 4OB5L 1YNTB 2J5LC 1FNFA 1UCBL 1BJ1J 1HDMB 3I6KA 3WS6A 5BVPH 1C5BH 3CXDL 3GIVB 1VFMA 1FGNH 1HHJB 4ZTPL 1WZLA 4UQ2B 2ZSWA 2HVKA 1KFAH 5I74B 4TOYH 4LCYB 3B9KA 4JFEB 3NGBC 3RA7H 5HD8D 2FBJL 5EZLB 2R4RH 2X4SA 3ZDYF 5E6YA 1KIQB 4CVXA 4FS0A 4KAQH 4M48L 2AQ1A 5GIRA 1E4WL 1U8QA 4A6YL 1HQRA 4LVHC 4EI6A 1NCUA 4OKDA 2JB5L 4J3TA 1XF4B 3ZYJA 2JCCA 3ARWA 1C5DA 3HAEG 5HHPB 2PYFA 3LPFA 3KLSA 2BMKA 3KXFE 4M02A 3FKUS 3N0PB 1RAMA 5GS0C 2E9WA 5IK3A 4UT6L 4P2RD 1IAOA 4OV5A 1CIUA 3ULVF 4M6AA 2AJVH 3V6FB 1T1ZA 2AXGB 1HDMA 4WHYH 4PJ7B 4I3RL 3TA3C 5E08H 2BZDA 5IR1A 5JQHC 4PGZA 1BBDH 5T1KA 1C12A 4PRIB 3QWOA 3MOAH 3GIVA 2DQDL 4HJJL 2VQUA 4UQ2A 3JBG7 3V6ZB 5GS0D 4NO0B 3FONB 4JHWH 2YD5A 4LCYA 1UACL 3SJVE 4J8RB 5C6PB 5D7SL 4JFEA 2CQVA 4U7KA 4S1SH 5EZLA 1HNGA 2ID5A 5TH2B 3K1DA 4Q9RL 5IVZB 1T1XA 2VKXA 2Y6SC 2ZUXA 3H7BB 3TA3D 4X4YB 1RV6X 3P0YL 1A9BA 2PYEB 5JHDA 4KVNH 5I6XB 4PR5B 5J1AB 3HMXH 4HWBA 5F1NB 3QH3B 1XF4A 2VN4A 3GBLA 5HHPA 1U8JB 1HH6B 1LK3H 5SWSD 2JK5A 1TJIL 1FAIL 4OIBA 1VB9A 1C7TA 3RL1B 3M07A 3NH7L 4FZ8L 2DL2A 4Y1AD 1EH9A 1RVFH 2FCBA 2WMPA 2Y6SD 1AI1L 3LQAH 3U4EB 4N1EA 1FZOB 4PJ7A 3X11B 5IBUB 1IGJB 4PRIA 4C4KT 5I1CL 1WV7T 3MBXH 3T3MF 4JFDE 4L4JA 5FM8A 3V6ZA 3UPRB 5GS3A 2W91A 2P8MB 4J8RA 2A9MH 4W4NA 3B9EA 5I30L 3I02B 2H26A 3NFSL 5D7KD 4F33B 5J1TC 5TH2A 3PGCB 4N0UB 2NXYC 5IVZA 5BVJB 1A14H 1MCSA 3HCVB 1U3HC 4G8GA 3ZSTA 2EYSB 4D0BB 4M61B 1LILA 3WDHA 1QBLH 4PR5A 5J1AA 5F1NA 1A7BA 1RUAL 3TBTB 1QSEB 4RNRB 2UVFA 4GAYB 4P57B 1HH6A 5E1AB 4GAGL 3FB6A 5D1XB 1G7HB 3RL1A 4E41E 3BH8B 3MODL 3WHE1 1F4YH 2NXYD 1JRHL 1U3HD 1MJ7L 3WUWB 2XTJE 4Z7QE 1FZOA 2XZCL 3BT2L 4KI5C 5HGHB 3X11A 4JG0H 5KS9A 1IGJA 4LMQE 1EEUA 3DX6B 3QDJB 4D0DB 4WI4A 3FO2B 1HOCB 5ISZD 3CZJA 4XB7A 5F9JA 4AM0A 4PPTA 1T2JA 1J87A 2VDMH 4L8DB 1RULH 1WWCA 1FYTE 1TIUA 3I02A 4F33A 4N0UA 4KI5D 4QHNB 1I7UB 5BVJA 1E6OL 1P9MC 2Q76B 2XWTB 3PWNB 4OM1L 5I19H 2EYSA 2F9BT 4D0BA 1MF2H 1QYGH 4M61A 3W39B 1MAKA 3NIFF 3W2DH 4F8QA 4KJQC 1INEH 4WEMB 3TBTA 1NBVH 2WLZA 4GAYA 4UT7L 4P57A 1YNLH 3FQNB 4LLVB 5E03A 2DF3A 1G7HA 2FB4L 4KKNA 4BSWB 4M6NL 3BH8A 5LGJB 4JR9H 4ZPVB 3WNMA 1AR1C 5LWYH 3GRWA 3CH8A 3KWWB 1A7PH 3WUWA 3MLSH 2J8HA 4XNZB 4P9MH 4X4XB 1MCLA 4EN3A 1IKNC 1DQLL 4KJQD 1RZ7H 3QDJA 4P46B 3EYUH 4WW1B 4D0DA 1UM4L 4F9PC 3LKQB 4GKZB 4PBVC 4LEOB 3FO2A 5DRNB 5ESAB 2FATL 2W9LA 3KPSE 4U3XA 1HOCA 2C3XA 4Z7UB 2JELL 5J7CC 3BH9B 2P42B 5C92A 1AR1D 1PX4A 1BQSA 4L8DA 2FHFA 2HJFA 3QBTB 5CSBA 4RDQF 3QQ9C 5EUOF 1Q9OB 4QHNA 1RUQL 1I7UA 4XX1E 3PWNA 2XWTA 2Q76A 4YDKL 5E2VH 2Z8RA 3EO1B 4XMKH 1KB5B 4EZMA 4ZNEE 3DHMA 3O41B 4OFKA 5HYIA 1WGOA 4XCFH 3ROOB 4PGJA 4KFZC 2NX5E 1L9MA 3DVGB 4ONHB 1DN2A 5C09D 3OPZL 2HFGH 2KDGA 3FQNA 4H5SB 4X83A 1QTYT 2EO1A 2NY2B 1HEZB 1KEGH 3DBXB 5LGJA 3QQ9D 4KXZH 5CLTA 4ZPVA 2WK2A 1IMHC 1TPXB 3KWWA 5ALCH 4Z18A 1SEQH 3IDMB 1F3JB 2D7TH 1OAXH 5ESQB 1X3DA 4X4XA 5E8DL 4QOKE 4GFTB 2C3HA 2Y7QB 1DLHB 2APVA 5D2NC 3V6BR 4G9FA 4WW1A 4JHAH 1BFOB 4WFFE 3LKQA 1QFWI 1ZGLP 5ESAA 3X14B 4HK0A 4J7RA 1ZHBB 3ZYZA 4O02L 1MPAH 3ISWA 1AQKL 3QXUA 1NCWH 2JJSC 1JYXA 3MV7A 4DJMA 1TLKA 4LNRB 1NCBH 1Q9OA 3VJ6A 3GJFB 3MSPA 5MHSD 3HNTL 2IFFH 1BHGA 1KB5A 4GT7A 4PUBL 1JWUB 2FJFB 1RU9H 1AR2A 3O41A 4LLQA 4LPVA 5KSBB 3O6MH 1Z3GL 3ROOA 4DKEL 3RKPA 1CZ8H 3DVGA 1LK2B 4ONHA 1JPSL 2VLLB 1E28B 4KUCF 4RCAA 4H5SA 5INCB 3O3EB 1OM3H 4UNTA 2VDRL 2V2XB 1MCBA 2NY5H 4H0IA 4ODUB 3DBXA 5EA0H 1EHNA 4IJ3B 5FYLH 3CVIL 1BVZA 3IDMA 1G9EA 1H3GA 3R4DA 1FZJB 2XTLA 3IS1X 4N1HB 5EZIL 5SWZA 1RSFA 2JCCE 4J3UA 5ESQA 3O6FC 4ORGA 1VGEH 3UYPA 2DLEA 3HUJF 1HHHB 4G6KH 1DLHA 2DS4A 1MHPH 1JPFB 2HT3C 1I3GH 4APQB 3L7EB 5EWIL 1BFOA 3CFDB 3P2TA 5IP4A 3MJ8A 2DLFL 1T0NB 2IH3A 3BMWA 3O2DA 5C7XL 1DR9A 2B2XL 2P8PA 1M4KA 4OLUL 5DO2C 2GI7A 3RFZC 1KELH 4YWGL 4JFYB 3V7AE 2VXQH 4JO4H 3HR6A 2DQCL 4LNRA 3TT3H 4ONOA 3BDYL 1LVEA 1I4FB 3O6FD 1U91B 4PS4L 2C3VB 3RX7A 2ICEB 1XGUB 1BECA 4OLVL 2R0KL 1FFQA 1JWUA 2HT3D 1DTUA 5KSBA 2R2CA 2IG2H 3MR9B 3RWEB 1JK8A 3SKNB 4JFEE 1CXKA 4R0LB 4CVUA 1JYWA 1LK2A 2Z93A 2VLLA 3MTRA 5DO2D 1E28A 1GGYA 4H88L 5INCA 5KSAA 3FHQA 1GSMA 1RURL 2P45B 2V2XA 4J3SA 4ODUA 5JHDE 1PVHA 2C3GA 3ZTNL 2CKBL 4ZO6A 1DQDL 4JRXD 4XPHH 2CD0A 1Q0XL 1FNAA 5MENB 1HHHA 3HFML 5IBTL 3UTTD 3VXRD 3HN3A 4N0YH 1IT9L 2WWKO 1IJ9A 1JPFA 4APQA 3CFDA 5E2TH 4JG1L 3MQIA 5J3HC 4HIXL 1T0NA 4UZGA 4D9QD 3EOTL 1G84A 4OZFB 5MEPB 1NJ9B 2EE3A 2NY4B 4OLWL 5F72S 4ODBD 4R4FL 4PJ7E 2G75B 5EORL 5GGTH 4IRSC 3DXAA 4PRIE 3JWOH 5AZEH 1I4FA 4ZSOA 1U91A 2OQJB 2ICEA 1XGUA 1HNFA 2CDFB 2LU7A 5EBLB 3LKSB 3IU4L 4FQ2L 1DQMH 1UKSA 3MR9A 3RWEA 2EIBA 5J3HD 3SKNA 3S8WA 3BP5B 3SDYH 1NSNH 2B0SH 9CGTA 3MV9B 2CUIA 1NCTA 2P46B 5F7MC 3MJ6A 4G8GE 4IRSD 3C6LB 4YDLC 3OR6B 4FQIL 3T2QA 3DGGB 4LVNB 1BGXL 3NCBB 4OF7A 3GMNB 2DTMH 3WIHA 1Z9MA 2OCFD 1RUPL 3N1QC 1WFOA 2QSTA 3VXMB 3VRIB 2Z92A 4IMLB 5HXMA 3W9EA 3SY0B 1F6AB 4KY1L 3VXUD 1GYAA 4R2GC 1JZ2A 3C5SB 2W92A 3E8UL 3T3PE 5I17B 1ACYL 2GK2A 4ZDHB 5TE6L 3H8NA 5MEPA 1NJ9A 3TWCH 2YXMA 2CK0L 4QYOA 1KTLB 5KS9E 4PB9H 4NFDA 4MD4B 3KLDA 5F88B 4X7SL 4XMPL 5EOCH 1GOFA 3KR3L 4R2GD 1N64L 1ZANH 4KVCL 2DI8A 2IMNA 2UYLB 1QSZA 4Q0XL 4XHJC 4N0UE 3MV9A 3WIIL 4U1KB 2NY5C 3C6LA 4OIIL 4DTGH 4PY7B 3WNLA 3T0XA 4JFQB 5D71H 3S7GA 4XPBH 2AXFB 4DFIA 4NHCH 3VXMA 1YEFL 4IMLA 1Q72L 3JWNC 1VHPA 2FD6L 1F6AA 4WY7H 2Q8BH 4JLRB 4HFWB 4XHJD 2BHYA 5I17A 2BJML 1MQKL 5F6HI 4ZDHA 3ZT5A 4PTTB 2JTDA 2ZWLT 1LEGB 1G6VK 1EO8L 1U2HA 5FYLD 4ODXB 3TM6A 2ZJSL 4N5EC 3T2NH 5BRZD 3LN4B 1I85A 2CXGA 3SCMC 2L4OA 5CEZL 3QDJE 4JPVH 4ZTOL 4MD4A 5CEYB 5DI8B 3MRCB 3GHBH 3LS4L 3X3FH 1NGQH 5F88A 3BWAB 1WT5A 4WWKC 4ZO8A 1J1OL 5DGRA 3S3JA 3DO7B 1ZT4B 4EBQH 4JQVC 2YKLH 2A9NH 1AHWB 2F54B 4FQJL 1LP9B 4M4PA 3U30B 3QJFB 2UYLA 5I9QC 2GKIA 3KYKH 12E8H 4N5ED 5LXGH 3SCMD 3MC0A 1KBGL 3AFLA 4HSQA 4HS3A 1KSRA 2DD8H 1MCEA 1MAMH 4JFQA 4PLOB 5BV7L 1WIUA 4KUZL 2A83A 1S9WB 4UOW0 4MJ5B 2X4PB 4WWKD 1EAJA 5TFSL 1DP0A 2AXFA 5GHWH 5FGCB 2RAMA 2EDTA 1IBGL 4JLRA 2FJHB 4HFWA 5HDQL 4RAUA 3S88L 4NRZB 4GRLB 3MV8D 3BKYL 4LEXH 3PGFH 3WJLC 4H8WH 3RVVC 5T3XE 1ULVA 4QHUB 4KKLC 3RRQA 4RMUA 1KULA 1Z5LB 3PABB 1YEKL 3V52L 2BRRL 1KENL 3AB0B 2BNQB 4G9FE 4OF3A 5CEYA 3WO4C 2NY6B 3MFGB 3B8YA 4JDTH 3NA9L 2VUYA 3WXWL 3MLXL 4QHKJ 3NOIA 2AW2A 1ZT4A 1GPOL 2CDGB 3IT8D 1KEML 4XBEH 4D3CL 1AHWA 3Q2CA 2IPTH 2WIIA 3MV7E 3QJFA 4P3CH 4NZTL 3RVVD 1UWXH 4KKLD 3UYRH 4U1LB 4NQUA 1RZKC 4WFHD 2NR6C 3S4SB 5DHVH 1JGUL 4M43H 3UJJL 2VH5H 1JHTB 3D2UB 2ADFL 3BUYB 4JB9H 1L6ZA 4MJ5A 2X4PA 3MGOB 4XVSL 2Z91A 5AYUL 1NGZB 1P5VA 3Q1SH 1CFSB 5I75B 2FJHA 3TH3T 2DDQH 5C2BH 4NRZA 1IAIM 3JV5A 4GRLA 4XNUH 1F58L 4QXGH 1CFBA 5EBWB 2NR6D 2GYSA 1SJEA 2ORBL 5SWZE 4H1LB 4NRYA 1FNGB 4QHUA 1U8IB 1FCCA 4PJDA 3PABA 1K4DB 4JREC 3TVMC 2P5ED 2Z8VC 1Q9WB 4JM4H 4R6UA 2G2RB 3DO3A 4PJ7F 2ZNWA 2CDGA 3TCXA 3BRDA 1VERA 4NQCD 4R8WH 4P23C 1WZ1L 1P84K 5HHOD 4LQFL 1UM6L 3SO3B 4I18B 2AJSL 1QO3B 4U1SA 4U1LA 4Y4FB 4LSVL 5KSBE 3RY6C 5A2FA 1H5BB 1JHTA 2VIRB 1CLOL 3BUYA 4JAMB 4QTIH 5C0IB 2W07A 1BQLH 4WW2C 1EHXA 5KOMC 1NGZA 5AZ2L 4P23D 5DJ2B 1YMMB 3MRFB 2JJTC 5GGQH 4DGVL 3OJ2C 4NQTA 3HAEB 3G6DH 5EBWA 1IGCL 3M1BB 1AGEB 4H1LA 3QQ4B 4CU7A 1U8IA 1JNNL 1K4DA 4N8VA 4JN1L 2VZ3A 3T3PF 2FL5A 3FL7A 1Q9WA 2AABL 1MHEB 3C9NB 4XC3L 1N4XH 3RIAK 4YDIL 3MLTA 3GK8H 5JORA 2E7LA 2ZUWA 4X80L 1EEZA 1CF8H 3DXAE 1N2RA 4ZSOE 5B38G 4IIQC 1IQDA 5DJXB 1QO3A 4I5BB 3ES6B 4OCRH 5FOJA 1NL0H 4CADB 2VLKA 1H5BA 2VIRA 4JAMA 3O6LL 1F2XK 3VGEA 1DBMH 4DGIH 5C0IA 4I3SL 2D7NA 2F19L 3MLUL 5F1KC 4K3DH 1OPGH 5HY9A 2VSDA 2BNRD 5DJ2A 1YMMA 4K23L 3ZMRA 1KPUB 4O9HH 2VOTA 4LCCC 3Q3GA 1A47A 3M1BA 4GUPA 2AVGA 3QQ4A 5FYJE 3H9ZA 3P4LA 1UKTA 1DBBH 5EH1A 3MA7B 4MNGB 5HHVL 1E27B 2APFA 2A6KB 2GCYB 1TQBB 1MHEA 1DVFC 3C9NA 3QRGH 1L7IH 4I9WD 3D9AH 4UOW1 1OL0A 3P11L 2P48B 1KG0B 5DD3L 1ZSDB 3DX8B 4LF3A 4KJYB 3PL6B 5JW4N 2O93L 1P7QD 2XKSA 1I7RB 4WI8A 3IJSB 4S1DC 5DJXA 3EDDA 4I5BA 3ES6A 1MFAL 5CP3H 4HFUH 3IDNA 2PTVA 1P6FA 1CT8B 3BZEB 1YY8B 1JGLL 3CFEB 1MCPL 3IXTA 3MCG1 3PIQB 1DVFD 5IROA 1PQZA 1QVOA 1C5CH 1UWEL 4NC1E 3HS0B 3OTTA 4HHAB 1EVUA 4PYHA 1MCWW 4BK5A 5HDOA 4P9HC 3MV9E 5GSRB 3RGVA 4PGEB 2QEJA 1DL7L 2JKXA 3EFDL 1KPUA 4OQTL 1A0QH 4CN4A 1KJ2B 2XA8H 3CFCH 1W0VB 4S1DD 2BNUB 1HINH 5F7YC 4OI7A 4MQ7A 5DUPH 1ZT7B 4O00A 5GISH 5F3BB 1CTOA 3LAFA 4R4BB 4EEEA 1F13A 3VXME 5EU4B 1EO5A 2EDHA 2PKDA 4NYLB 3RBSA 3MA7A 4MNGA 1E27A 3GKWL 4DKAA 1TJGH 4M7KH 4QEGA 3RWGB 4O4YL 1NMAH 3NCEB 5JR1L 3HE6B 4MYWB 1KG0A 5DC4B 5KVEH 4QCIA 5B39G 2L7JA 4KJYA 3PL6A 3K8MA 4HC1A 4XNQB 5C8JA 4LAQH 5IF0B 4K8RH 4MLSA 3AMKA 4RWYH 3IJSA 1TQCB 1D7FA 1G0YR 4Z7UF 3UDWA 3WCYA 1W72B 3QUMB 2VWEE 1NDMB 5K33A 1CT8A 1YY8A 4FQ1L 3PIQA 4OM0H 1K6QH 4YXKH 4HWZA 4QNPE 4IDJH 4G8IB 3GJEB 2HJKA 4HHAA 4W68A 4PJ5B 2XKNB 1YECL 3RJDA 1OT2A 4PRDB 5JIPA 3H9SD 3DMMB 3T2PA 1KJ2A 1W0VA 4UT9L 2BNUA 1CGYA 3OQ3B 1G0DA 2WWMC 2P44B 4U2ZA 5EOCJ 1NBZB 2V5RA 4BQ8A 5FKAB 4ALAL 4XBPB 4NN6B 1AD9B 5EU4A 3DGCR 4NYLA 3WXVL 2DOCA 1OP5K 3HI6H 1I1AB 5I1GL 2CRIA 3HE6A 2PETA 43CAA 4NBZB 2ZCHL 4M7JH 4TN9A 4X8JA 3LDBC 2WWMD 1G9ML 4XNQA 5IF0A 1N0XH 4GXUM 2Y5TA 4D2NA 1RZJH 3BKML 5BW7A 3QUMA 4R90L 2R8SH 1NDMA 4Z7NE 1IQWH 3KLAB 3S37H 1N6QH 3O4LB 1OP3H 3RNKB 1Q0YL 5I8EB 1VGKB 2I9TB 4FQQB 4CU6A 3GJEA 1DDHB 5DJAB 4PJ5A 3VD5A 2XKNA 2VJXA 4JZJB 1FZMB 2DQUL 3NTCH 3QFDB 3ALWA 1UVQB 3IAQA 4PRDA 2R56L 5KSBF 3QUKA 5M95B 2EC9U 4RBPK 4YHYB 4XVJL 4LKCB 2HLFC 3VXSD 4AMKH 3LN9A 3STLB 2D03L 5JW5A 1PEWA 2AEPH 1NBZA 4L29B 4XXCA 4ZFFB 5FGCE 4NKMB 4XBPA 5E8PB 1YQVL 1DFBL 3PF2A 1AD9A 1OB1B 1FJ1B 2BC4B 2IGFL 3KYNB 5GS1C 4AEHL 4XCCL 1I1AA 2PR4L 2VISB 1CR9H 1QLFA 3Q5OA 1KN4L 1E4XL 2HLFD 3L3IB 3E3QE 5GRUL 1OSZB 3GJFK 4PJDE 5J6GB 1UXSB 1CL7L 5IFJB 4D9LH 2XZQL 3GSNB 2ILLA 3FT3B 2OLDA 1AFVL 1J1PL 3O4LA 3RNKA 1EHLL 2NW2B 5I8EA 3WL9B 2I9TA 1LO5B 2IPUK 2QQNL 5DJAA 2NTFA 5C0EB 1FZMA 3QFDA 3V5HB 2A0LC 2XWBA 3C09B 1UVQA 5HHXH 1S7QB 1BD2D 4DN4L 3STLA 4Z7WB 4NO2B 4Y88A 3EAKA 1NQBA 2F74A 4BFEA 4L29A 1WIPA 4ZFFA 3NAAH 4NKMA 3WJJC 3MGTB 4R97B 3GHEL 1OB1A 4KQ4L 3SOBH 3ZSSA 3B8SA 2BC4A 1YEHL 3DX9B 3K2UL 3KYNA 3L7FB 2A0LD 3BIBX 2UZYB 4TTDC 2VISA 3ARDC 5CSZB 3L3IA 4MQXC 4CNIB 1OSZA 3PE9A 4IRZL 5GGSY 2VTFA 4FZEH 5MI0C 5J6GA 1MRDH 3ELAT 4HKZB 5DURB 5HGAB 3GSNA 1YN7B 4O2FB 4NPYA 3KS0J 3MV01 5AG8A 4GG6B 1ZVHA 3G6AB 1XH3B 3QUYC 1MAJA 3ARGC 3MXWL 3D48R 3MYZA 3WL9A 1E4KC 1QSFD 4HLJA 1FBIL 4MZ2A 4YHML 2MQ0A 4TTDD 2QSVA 4S0TD 1NMBL 4KMLB 1H0DB 5C0EA 2BCKB 3I6LE 3ARDD 2P8LB 2YD4A 1DCLA 4MQXD 3DVNB 4NFBA 3BWUC 3V7MA 1X9QA 4DUWA 1HSAB 2VLKE 3O45B 5HVFB 1S7QA 4EDWL 4U3HA 4Z7WA 2XACC 4NO2A 5B8CB 1KT2B 3SDCB 3CX5J 5BCAA 3GDBA 1XF2B 1MFBL 1T80A 3V0WH 3QUYD 3GUTB 3QWRD 3ARGD 2OL3H 3L95B 1CG9A 3QUZB 1JZ3A 1YMME 4LHQB 4GW5B 2BDNL 3T0EB 1KCUH 4FFYH 2W9EH 3S36H 1U3ZA 3MRRA 3O9WC 2Z8SA 4OGYL 1OAQH 1D5MA 4YHOL 4JN2B 3EO9L 5D6DC 4CNIA 1NMCB 4GBXB 4OCXL 4LAJH 1OAUL 4Q97A 3MGAA 1RZJC 4F7CB 3HZKB 4J6RL 4HKZA 5HGAA 1YN7A 4O2FA 2BVPB 4J3XA 4QHLB 4GG6A 1F11B 1XH3A 4B7LA 1A7NH 3Q6GH 3ZDZE 4MJIB 1QR1A 3O9WD 4KTDL 3ZE2F 5HYQA 1YEGH 5DR5L 1H0DA 2P8LA 1T3FB 3DVNA 3FO9B 5F1IA 2EDKA 3QO0B 4X4MA 3OAUL 3MACL 4QNPF 3H9YA 4JRYB 3REWB 4MAUL 3WN5B 3LEYL 5ADOH 5B8CA 1KT2A 2YPVH 2UUDH 4ZO9A 3SDCA 1TFHA 4EI5C 2NNAA 3C60A 1XF2A 4Y2DC 1P4LB 4HKBA 5IUSA 4WTZG 3N9GH 1SM3L 3QUZA 5BZDB 4PRPD 4GW5A 3J8F7 4Y5VC 4XAKD 5TQ2L 4L9DA 1X5XA 3CDYA 2OX5A 3QJHB 4A2MA 4NBYB 5F9DC 4HQQH 3ARXA 4JN2A 3TJHC 5HYSA 2GW5A 4GBXA 2J6EH 5EO0B 1TITA 4XPGL 3IDXL 1FDLL 5H37H 2PW1A 4HWBL 4MNGE 3BDXA 4EI5D 4F7CA 2VZUA 4Y2DD 1OTTC 2X9WA 1M7IB 3HZKA 2FRGP 1F3DH 1IC5H 4QHLA 4FXGB 1F11A 4LHUD 5I73B 2G5BB 3ARZA 4MJIA 4NZUH 5HYEA 1CQYA 2J5LB 3OZ9L 1INDH 4Z7NF 1T3FA 5C0CA 3TJHD 3QO0A 3T0DA 1U2CA 4PG9B 5ILTL 3EDKA 4JZOB 1IFHL 2V5SA 1U95A 3REWA 1LP9F 5D9SA 3WN5A 3I75B 1OTTD 4UAOC 4DK6A 2FX7H 1GGCL 1CTNA 1J86A 1T5XB 4Z6AT 5IESH 3O3BA 4HUXB 2MWCA 5L88H 4W6XB 1P4LA 3ULSB 4OB5H 4XC1L 1UCBH 3NGBB 5BZDA 1V7ML 3P40A 4P2RB 25C8L 5F89B 2CIKB 4RFEB 3QCUL 2MTPA 3MXVL 3QJHA 5SV3A 4QRQA 4UDTB 5CP7B 4ZTPH 3A0OA 4LVHB 4HUUB 4JQXA 2Y25A 5EO0A 2OYPA 2Z31C 1ZV5A 3BFOA 3P4MA 1M7IA 2FBJH 3V4VL 5SX5K 3VRJA 1QQDB 3U83A 1JTOA 4FXGA 3EDJA 3PXHA 2BVYA 4M48H 2BVUA 3W0WD 1E4WH 2A2QT 4A6YH 3FOMB 4K3JL 1HK6A 1LWRA 3TCLB 4GG8B 4MD5B 1FVCB 2JB5H 4MB3A 1FVEB 4U0QB 5C0NC 4PG9A 3TA3B 5C07D 4P4RA 2Z31D 4HIJA 4NZJA 3MRGA 3QT2A 4N0RA 4E42B 4UT6H 1T5XA 3R0MA 4PJ5E 3ULSA 4F37F 1HH9B 5SWSB 2WM0A 1UXWB 1GIGL 1KJMB 2GITB 3VGBA 4Y1AB 4I3RH 1H15B 4P2RA 3BJLA 5F89A 5L6YL 3M8OL 4RFEA 5C0ND 2XICA 1U58B 2DQDH 2FECI 4HJJH 4UDTA 3S5LA 1EERB 4F2MB 1Z2KA 1FN4B 1YJDL 4XBGB 1UACH 5D7SH 2VLRD 3KG5A 1EK3A 3MLPA 4HIIB 4Q9RH 3P0YH 4QTHB 4BQ9A 2PUQT 1WZMA 3GRWL 5J0BA 1IM9D 1JBJA 3FOMA 5FYKE 1D5ZA 2YC1B 4GG8A 4F37K 3PDOA 4BZYA 1FVEA 1D5XA 3TA3A 3AAZB 2XZZA 2E6JA 1TJIH 3O4LE 1FAIH 1T7WA 5T3ZE 3NH7H 4FZ8H 4GRWB 1IILE 1IGTB 3ZHKA 5F9WC 2I9LB 1ZA3B 5I1HL 1AI1H 5T5FL 4LSSL 1HH9A 1DE4B 2DMCA 1QBBA 4L3ED 4NC2B 5SWSA 4OZIB 4KHTL 1UXWA 1U3JA 3L3GB 1UT9A 2EIZB 3WIFB 2V7HA 4TNVF 4Y1AA 3OR7B 3BKJL 4N1CA 1BEYH 2NXYB 3JV4B 1ETZB 3Q5YA 1A8JH 2XPGB 1U3HB 1CDYA 2DWEB 2A77L 3GO1L 4F2MA 4GW4B 2QL1A 4PLNC 4X7TB 1G1CA 2GIYA 2HMIC 4YX2L 1VEMA 4XBGA 1BFSA 2NQCA 5I30H 2DM4A 1I9IL 3NFSH 4F7PA 1K8IB 4HIIA 1JZ7A 5ISZB 1FLRL 1ZAGA 4QTHA 1SBSL 5F7KC 3VGDA 1OW0C 1WEJL 2YHGA 2YC1A 5F3HB 5ACMA 1RUAH 5T3XL 1H3UA 2BK8A 3AAZA 2HMID 2BSRB 4TNVK 3X13B 5DHYA 3ZDZF 3MRNA 4GAGH 1AO7D 5AWNL 4AQOA 3NFPB 4WUUD 5IHZB 4L8CB 2AEQL 4NKDA 3MODH 3VFTB 2I9LA 1JRHH 3QNXB 5IB5A 1DE4A 1MJ7H 2AS5M 1WITA 4OZIA 2WUBL 3QRFM 2XZCH 3BT2H 3L3GA 2EIZA 3WIFA 4MXWL 5DJ8B 4ZUUB 1B2WL 4KGLA 3ZKNC 2YPLD 5H8DA 3JV4A 2E3VA 4HW6A 4Z7WE 1U3HA 5C0JA 1X7QB 2IC2A 1KB5L 3IXAA 4X7TA 1LE9B 3FRUA 3LIZL 3RVTC 1TENA 1YYML 4Z0BL 1U9KA 4PB0L 5JIKA 1KLUB 1K8IA 1YEJL 1E6OH 3ZKND 4OM1H 1A6TB 4Q6IC 1HWHB 3VWJA 1KGCE 1T20B 1SVZA 4GH7B 2UWEF 2YEZB 2AV1A 3RVTD 4L4VD 1GC1H 1WF5A 2BSRA 4UT7H 4DZBB 4GG6E 4GKSA 2FB4H 2OSLB 3NFPA 4M6NH 2A74B 3MJ7B 4L8CA 5B38B 3O2DL 2DQEL 1Q38A 2WLYA 4L4TD 3VFTA 4M5YL 3QNXA 5LCVL 1ES0A 3FFDA 5C09B 4UB0L 3FOLB 1ZK9A 3OKOA 4X4ME 4YHZL 2ZUTA 3ILQC 2IPKB 5DYOA 5DJ8A 4ZUUA 4OD2A 43C9B 4GSDL 3TH2T 1MCRA 2DQGL 1DQLH 1RJZB 3UTPD 3V4UL 5H35B 1P9MA 2G9HA 2B4CC 3LRSB 3MNWB 1UM4H 1X7QA 1WFTA 1LGVA 5T33L 2FATH 3T4YA 4YFLI 1RJCA 1I8KA 1RZGB 2JELH 1OSPL 4AEIL 3MRBB 1JUFB 5GRZA 1KCRL 3RWFB 2DN7A 3AC0A 3RTQD 3QDMD 4M7LL 2ATPA 1KLUA 3ILQD 5DRWB 1RUQH 4YDKH 5HPOA 2JB6B 4H0HB 4CVZA 1BLNB 3JTSB 4NP4L 2VMFA 5IVXA 4U6XB 2D3VA 4V1DD 3LHPH 3QXTA 4WWID 5EU7E 1IKNA 2PCPB 5C0AD 3OPZH 1SYSB 5FHAL 4DZBA 1D5IL 1V3MA 3OGCB 5D2NB 3L3DB 4F9PA 1RFDL 5DQDL 3ARBC 2A74A 3MJ7A 4AK1A 1PG7W 3GMPA 4MJIE 4W6YB 4Z95L 3ZKSD 1EGJA 2XA3A 1JHKL 5K9KA 5CGTA 5C09A 5C0CE 3FAXA 2GT9B 2ZCLL 1JF5A 3FOLA 4JFXB 3KPRA 2IPKA 4UUJB 43C9A 5E8DH 5JO5A 3N06B 1OD9A 3CUPA 3MUJA 1DUYB 4FRWA 4F7MB 5H35A 4N90E 3LRSA 5DUBB 3ULUE 4W81A 3MNWA 3BISA 4AIOA 2OP4L 4DGYL 1V05A 4NUGL 2C4FU 2CR6A 4YNYB 1S7WB 1RZGA 3ARBD 4O02H 2A38A 3MRBA 1NLDL 4ZG1A 1AQKH 3RWFA 1BIIB 1J11A 1U8OB 3BP7A 5DRWA 4D9RE 3DRQA 2JB6A 3HNTH 4PUBH 3WIHL 2X4RA 1Z3GH 4U6XA 1LD9B 4DKEH 2RIKA 3DI2B 1FO0A 3O6FB 1E0OB 1PG7X 4DZ8A 5FYJL 1JPSH 2X40A 2PCPA 1SYSA 2CRZA 2XQBL 1OHQA 3FQTB 3OGCA 4ZUSB 1VFUA 3C87A 1TJHL 2VDRH 1T5WA 5D93C 5GGSB 4MD0A 3CVIH 1UFUA 5E2WL 5SX4I 3UO1L 2GT9A 1S5HB 4TYUA 1X5GA 2JJSA 5EZIH 4BUGA 1EXUB 4EDXB 4UUJA 2XFXB 4LLYB 5IB2B 5DQ9B 3I2CL 1DUYA 4FFVC 2APWA 3PP3K 3X17A 2R0WL 3VXTB 5EWIH 4JRXB 2DLFH 4FXKA 4HZLB 2GSIA 4YNYA 1S7WA 5C7XH 2B2XH 4OLUH 3UTTB 3VXRB 3VCLB 5I8OL 2VDPL 4HG4J 4YWGH 1GJIA 4P2RE 2PYED 1Q1JL 2DAVA 4FQLL 1BAFH 2DQCH 3SKMB 3JV0A 3BDYH 4P5MB 4PS4H 4ZOBA 4GRMB 2GSGB 4FFVD 4OLVH 1VSCA 2R0KH 3ARFC 4OLYL 1LD9A 1HZHL 3O6FA 2MNUA 4HGWB 1GC1C 5B39A 4ODTL 5E2UL 3FQTA 4H88H 4ZUSA 3RWJA 3WFDL 3STZB 1RURH 4YQXL 4WVRA 2OTWB 4Y4HA 1ZLUH 1I7ZB 2CXKA 2CLVB 1JHLL 3ZTNH 5DJCB 2IAMC 2QLVB 4UNUA 2CKBH 2ZZUT 1S5HA 1DQDH 3X12B 3OAYK 1RJLA 1EXUA 3B5TA 3QPQC 4IRSB 4EDXA 3ARFD 4LLYA 1Q0XH 3H42L 5IB2A 4WFGD 3AVEA 3HFMH 5IBTH 3B4NA 1IT9H 1PY9A 4X6FB 5DMIL 3FMGL 4JG1H 4JRXA 4JKLA 4HIXH 3QWQB 4HZLA 3L5JA 4LRIC 3EOTH 3TF7C 5SWSE 1NGPL 5E0QA 4OLWH 3QHTC 3UTTA 3VXRA 3VCLA 4R4FH 4Z7WF 4Y1AE 3VXUB 2IAMD 5EORH 4J3WA 3OKKA 3VWKC 4DW2L 3QPQD 4YDLB 4MQSB 4GRMA 3L5WB 2GSGA 4X6BA 4QRUA 1NBQA 3IU4H 4FQ2H 2ZG3A 4LHUG 5IGXL 5ITBL 2VQTA 3VXQB 2OMNA 4HGWA 5DWUL 1RIUL 3V6OC 2KL6A 4R2GB 1V7NL 2OI9C 4Y7MA 2CR3A 4FQIH 3VWKD 3PG2A 2YD8A 4Y5XC 1BGXH 1WC7B 5DJCA 5D7KE 2UZIL 4JRWA 4GG6F 5FO9B 1RUPH 4PD4K 4MX7B 3T1FB 4ORZC 3FN9A 1IEBB 4KY1H 1AGDB 4X6FA 3RPKA 2JJVA 3E8UH 3GI9L 3WMSA 1BIHA 5TE6H 3UYOD 4OZIE 1S7VB 5DDHB 3PHQB 1UJ3A 2CK0H 5F9AC 2FIKB 3VXUA 1LO2L 3MLRL 5DTFA 4G6AC 5DK3A 3L5WA 3TBYB 3FHAA 4X7SH 4XMPH 4ZUTB 3KR3H 5BRZB 3FRPG 4LLMB 1N64H 2AEWA 3UZVB 2IADB 1KYOK 4KVCH 5ITFB 1GH7A 4Q0XH 3UTOA 1QFWL 4NIKB 3WIIH 4NQED 1H8NA 5DQJB 4MCZA 4OIIH 5E8OB 1ITBB 1XEDA 2JLLA 3EDFA 4G6AD 1WC7A 4Y16C 1R3JB 2E5EA 1RJYB 4KI5E 2VXTL 4AL8L 3GMOB 5FO9A 3U9UA 1TZHB 3SCMB 3FO1A 2W9DL 1YEFH 3O2VL 3T1FA 1Q72H 3U4AA 4Z78B 1A22B 2FD6H 2X44D 3E6FB 4U0RC 4WWKB 1UQSB 2BJMH 1MQKH 1WTLA 5DMYA 3O0RL 1A1OA 5DDHA 3PHQA 1EO8H 3ULUF 4WJ5B 2FIKA 4Y16D 2ZJSH 5CEZH 5I9QB 4UOJA 4ZTOH 5F8RC 3MV8B 4MA7L 2DQHL 4KRMB 3LS4H 5FECB 1OAKL 4HJGB 4MJ6B 4ZUTA 1J1OH 5BRZA 1CLCA 3IDJB 3TYGL 1T22B 2IADA 3L3OB 2HT4C 4FQJH 1RZ8A 5ITFA 2C26A 4LPWA 4G6ML 4Q74A 4N5UA 5HHMD 1QNZL 4MJ4A 1LDPH 2XI9A 1KBGH 5E8OA 2IFGA 3P0VL 5I76A 5J56B 4I48B 5IVXE 1DANU 2AI0L 4NQDD 5J9PB 4HBCL 4ZXBA 5BV7H 1RJYA 4KUZH 3RGHA 5L8LB 3GMOA 2Q7YB 4WFED 4PJBB 5TFSH 1TZHA 3HG1D 3SCMA 3IFOB 1DUZB 3K46A 3SDDA 3MLVL 3WO4B 1IBGH 2HT4D 2W0FA 3ARSA 3E6FA 3OXSB 3UZEA 5HDQH 4WWKA 4XP9L 3S88H 1CGVA 5KVFL 5C09E 1Y0LB 4JQVA 3BKYH 4CRPA 3KPRE 4PV8B 4WJ5A 3TN0C 5IQ7H 1JPGA 5KZCD 1YEKH 3V52H 2BRRH 1Z0MA 1KENH 2A6DB 3GB7A 2P4AB 5FECA 3NA9H 3V5DA 3LKOA 3WXWH 4K9EC 2WQ8A 3MLXH 3IDJA 2VR9A 2B1AL 3O6KL 5I1JL 1GPOH 1T22A 3MFFB 1KEMH 2P5EB 4D3CH 3L3OA 5ECJE 1SYVA 3WBDA 3ALXA 2ARJA 4NZTH 3TN0D 5CD5C 5IB1A 4NQCB 1A9EA 1WCBB 1JGUH 4F9LA 3UJJH 5HHOB 4JHZA 1QLEL 2ADFH 2AK4D 5HVGB 1T03L 4HUMB 3WJLA 1R3IL 5GGTA 2Q7YA 5MHSE 2WUCL 4PJBA 4XVSH 5IB4B 4JREB 1ZGLB 1X5JA 4RQQB 1DUZA 3TVMB 1FORL 4ZS6C 3VDAA 2ESVD 1NDGA 2UVEA 2EDWA 5CD5D 1F58H 1A6VL 1LO4L 1CK0L 5TDNB 4P23B 3OX8A 4PV8A 2ORBH 1VENA 3GM8A 5GPRA 4P5TC 5IIEA 1X4ZA 2A6DA 4CUCA 2X1QA 1GAFL 3CXHK 3GMRA 3V4PL 5I66B 4ZS6D 5EG6C 1KV3A 2CRYA 1IC7L 1G9NL 2PTTA 3MFFA 2P5EA 4BQ6A 1WZ1H 2AJZB 4WW2B 3VMNA 4LQFH 3HZVB 1UM6H 2BY2A 1IKFL 2AJSH 4P5TD 5BS0D 4ZOCA 4LSVH 5HSFA 5FYJU 5HHOA 2EKSA 5IW3A 1CLOH 1AIFB 1ZVSB 5CS7A 5FDWB 2QKIA 5L0QC 4EOWL 1ZGLA 1S9KC 5IHUL 5AZ2H 2D9CA 4XWOC 4NWUL 1CGTA 4XXDB 2PW2B 2K1MA 4O58L 4DGVH 1QLRB 4JM2A 3THML 2X70B 4ODHL 1U41A 1IGCH 5TDNA 4P23A 4WU5B 3ZO0A 1OARL 2BNRB 4HC1L 2C4XA 3FN3A 1JNNH 4GRWF 3AM8C 5FUCC 3I3EA 4JN1H 1QKZL 4FG6C 4IIQB 1FNSL 2H32A 2AABH 4JDVB 4OZIF 4JRXE 1YY9C 4XC3H 4BZ2L 4LDEB 4NO3B 4KGJA 1F42A 4XWOD 3PP4L 4YDIH 3RY6A 5I66A 4YHIA 2IALB 1MWAB 3UTTE 3VXRE 5BQ7B 5E00A 5JIIA 2P24B 2AJZA 4X80H 1G6RA 4DCQB 4EQ3A 4WW2A 4F58L 1BM3L 5TQ0L 3DECA 3HZVA 5F9OL 3G5ZA 2B5IC 3QEQD 3VFWB 4OUUB 3VFNA 5CEZD 1KJ2L 1MJUL 3H3PL 4LCCB 4X6DB 4NO5A 4WHTB 3JUZA 1P7QB 1YY9D 3ME0A 4IOIB 1AIFA 1ZVSA 3O6LH 1J8KA 3L3KB 4I3SH 4TVSa 3P4OA 2F19H 3QHZL 5FDWA 5DMKB 3DUHA 4M8VA 4HBQA 1DVFB 4K23H 1YEDB 4XXDA 2PW2A 4KI5F 1MJ8L 5T5NG 1QLRA 4KMQA 2MMXA 4BYHA 4HH8A 2X70A 3NN8B 1KCKA 4GMSL 4WU5A 2BNRA 1R5VB 1I7TB 2I5YL 2DWDA 4IIQA 5HHVH 2NPLX 2DICA 3QUML 3VDBA 1BREA 4NO3A 2OR8A 3P11H 5EU5A 2IALA 1MWAA 5DD3H 1V3JA 4LARH 3VXUE 3JWDL 2DM2A 2P24A 5FO8A 4DCQA 3MRHB 3SDAC 2HJLB 3QPXL 3VFWA 5FCSH 4OUUA 5A43C 4MA3B 3G04B 4LCCA 1MFAH 4X6DA 3CLEL 1C8PA 1JGLH 3PWVA 1MCPH 2FEEI 5EOTB 4IOIA 2P5WD 2OK0L 1UWEH 1YEIL 2NY7L 1EAPB 3L3KA 4C57C 1FCGA 4CDGC 1EO7A 1X5YA 3G9VA 1DL7H 2VERN 3EFDH 1YEDA 3SDAD 1JPST 4OQTH 5KTEL 2DYPD 1WZKA 3TV3L 4KTEL 2V17L 4NN5C 4YK4C 4RAVB 3H9SB 1R5VA 1I7TA 2IAND 1T7YA 5FYKL 4ODWB 1OOAA 4FMKA 4R4NC 1M7XA 2CMRL 4RMVA 3GKWH 2F54D 1MH5A 1B90A 1ODAA 4MCYA 1U93B 3BZDA 4O4YH 4TUKL 5JR1H 4AYFA 5T3ZL 4LIQE 3OJVC 5ID0B 4OZGB 2R1XB 5EFIB 4OV6F 2HJLA 4CJ0A 4K94C 3A6CL 3MLWL 3NZ8B 1KIUA 5FYLE 2XKUA 3G04A 5HJ3A 5BRZE 2AJYL 4R4ND 4FQ1H 5EOTA 4LCIL 4OCNC 2NY0C 4LNVA 5HYJD 4UV4L 3GMLB 1DQJA 1A7RL 1YECH 3MMEB 1KIPB 4FTVD 1B88A 2VN7A 4JFPB 1N26A 5EIQA 1M1SA 1FNEB 4UT9H 5F7NC 1D6EA 2BSSA 1MLBB 1MCWM 1MI5D 4RAVA 3TBVA 2OMBA 3LDBB 1JTPA 1XT5A 2VC2L 3H9SA 4K3HA 2X4TB 4HWUA 4ALAH 4WDIA 2LU4A 2NY0D 4NZDA 4UINL 4J1UB 1SBBA 3VXSB 3WXVH 3BN9C 4I4WA 5C1MB 3AS3A 2ZG2A 3GSNL 5I1GH 2CO7B 2WNGA 3PWLA 5IWLC 3OKLB 1C1EL 1PG7L 1QRND 3QCTL 1X6NA 2ZCHH 2F53D 1FG9C 4OAWA 5ID0A 1FFPB 1J12A 4OZGA 1G9MH 2R1XA 4YXLL 5EFIA 4XP6L 2DKMA 1ED3B 3BKMH 2V2TB 3NZ8A 3BP4B 4R90H 3NPSC 1ZA6B 3BN9D 4HLZH 4TTGA 3BVNB 4OGZA 3KPMA 1Q0YH 2X1OA 4WGWB 3T0BA 3GMLA 1OLLA 2F58L 2P7TB 3LQMA 2DQUH 4P2OA 4QRPD 3GMQB 1KIPA 4FQPA 5GS1B 2R56H 1SEBB 4XVJH 2ADJA 2D03H 4PJ9C 4PJBE 1IM3B 5JA9A 4U4BA 4WFHE 3QXWA 4Z8FL 4XWGL 4TRPL 2H8PB 1YQVH 1DFBH 5C6WH 4I0PC 5IOPB 1BD2B 4J1UA 1FPTL 2VNCA 1SJHB 2IGFH 1WBYB 3IYLW 3BESR 4AEHH 1U8MB 4XCCH 2APXA 5GRYA 2J8UB 2PR4H 5GS2D 3OKLA 4RGMC 4NRXB 4CVWA 4EJ1C 1KN4H 1E4XH 4WV1A 5GRUH 1FFPA 5CBEB 2Q6WB 2FO4B 1V3KA 2F5AL 3SBWC 1TXKA 1S9VB 5BZWB 1ED3A 1CL7H 3QDAA 2V2TA 2FSEB 3BP4A 4I0PD 2XZQH 3KJ6L 1ZA6A 1GHFL 1AFVH 5IMKB 1J1PH 1L7TL 4G80B 1A7OL 2XZAL 4JPWL 1EHLH 4ZD3L 2P5EE 3MBEC 1SMOA 1I9JH 1B6DA 2QQNH 4NQXA 1GCFA 1OTSC 1ADQA 2P7TA 3WFCL 3GMQA 5GS1A 2VXUL 4NQCE 4QHMB 4PY8I 1SEBA 2O61A 1VEOA 1QSFB 1YA5A 5HHOE 1TNNA 4DN4H 2E9BA 1W8NA 1R0AL 3ARDB 1WAAF 5E8EB 1K4CB 3HB3C 4JY6A 4E5XB 1RMFH 5EB9A 5ACLA 5I1IL 2CDEB 1NFDB 3T65B 5MI0B 3GHEH 3MBED 1CQKA 4KQ4H 1YEHH 1OTSD 4X5LA 5C9JB 1WBZB 1C16B 1TTFA 2XN9D 5HI4C 3QUYB 3ARGB 4NRXA 4Y19A 2YR3A 1KCVL 4M7ZC 4L5FL 1AGBB 1ZTXL 2G5RA 3MUGB 4IRZH 5CBEA 2FO4A 5HGBB 3RWHB 3HB3D 3GSVA 1S9VA 4NFCA 3NZHL 4KKCC 2HH0L 1T2QL 3OJDB 4HIHA 3P9WB 3VGAC 4WGVB 3ULUL 3AU1B 5IMKA 1FP5A 4G80A 3B6SB 3MXWH 3OKMB 3CSPA 2D0HA 1FBIH 4YHMH 5DD5L 2QQQA 5HI4D 3WJJA 1NMBH 1MFEL 4UQ3B 1T1WB 4NCC2 3D85A 5DD6B 2ITDB 2H3NB 4Y4KC 2GQHA 1OAZL 3O9WB 4EDWH 5FDYA 4POUB 1IAKA 3BXNB 3P4NA 4KKCD 5E8EA 1M7DA 3KPLB 1K4CA 1K3IA 4E5XA 3B83A 1MFBH 2V9TA 5LGKA 1SVCP 1IAII 4DOHB 2EC9T 4JFDD 3IDGA 3CVHH 5C9JA 2BDNH 3QIUC 1WBZA 1C16A 4QXUL 5IB3A 1NAMB 4YUEL 2GJZA 4OGYH 1E4KA 2BNRE 4G7VL 4Y4KD 4YHOH 3TJEL 3EO9H 3CMGA 1OD7A 4PRPB 2Q86B 3LEXA 1AGBA 3MUGA 4OCXH 1HCVA 1OAUH 3F7RA 4GQ9L 4ERSL 5CJBA 3SE3C 5A2KH 2J88L 4J6RH 3OJDA 2FLBT 4RMWA 2YUZA 1N3NB 3AU1A 3X3GL 4XZUA 3QIUD 1D9KC 4OFYD 3OKMA 7CGTA 4EI5B 3GSRB 4Y2DB 4KTDH 5DR5H 3FQXB 4E41D 2ED9A 4OLZL 3PJSB 4UQ3A 2XT1B 3U7WL 3TIEB 4YAQA 2EH7L 4LHUB 3OAUH 4Y5VB 1JFQL 3MACH 5DD6A 4PJCB 4DVBB 5CJ5A 2ITDA 3ET9F 4X6DE 2NYYC 2QR0B 1JF1A 4MAUH 1Q94B 5KANG 3K1KC 3LEYH 3BXNA 1AXTL 2QQLL 3KPLA 5D6DA 2IBZX 4UIKL 2W60B 2X41A 2EDRA 4WTXA 4B50A 5EUOA 1D9KD 3ZTJG 4PP2B 35C8L 5TQ2H 1NUGA 2MHAB 2YD7A 4U3CA 4J12A 5GS0L 5CEXB 1NAMA 2XOTA 3IFPB 1MEXL 2OJZL 1FYTD 3IAGC 2NYYD 4JO3L 3T09A 2Q86A 4YFLF 3EYSL 3D0LB 4XPGH 3IDXH 1FDLH 5FHBL 1P6AB 4HWBH 2DBJA 4RMSA 1QFPA 3AS1A 5DGQA 4YIQA 1N3NA 4P2CG 4UAOB 5E9DD 1REIA 3GSRA 3G5XB 4Y2DA 3HUJB 1PD6A 3FQXA 3JSSA 3OZ9H 2A73B 3MPCA 3TIEA 4ZFGL 4OJFL 3ZE1E 4LHUA 2RJMA 4Y5VA 1DJSA 5ILTH 3W0WB 4DVBA 2ZKHL 5E24E 7FABL 1IFHH 2QR0A 1KXVC 2ICWJ 1Q94A 3HNSL 4ZNCD 3HR5B 1JGEB 1B3JA 2EEDA 3WFHA 1GGCH 3SKUD 4NDMB 2W60A 5FIEA 4LSTL 5C07B 1FRGL 5AG9A 2Z31B 4XC1H 4PP2A 4EIGB 3KPSD 4TVPE 1V7MH 3BHBB 25C8H 2MHAA 4W4OC 3P9MB 4PJBF 5FYKU 1TETL 3C8KB 3QCUH 4JGUA 3MXVH 4M1GL 4ZODA 3FQUB 1MJJB 4JE4B 3H9SE 3NABL 2PXYC 5DSCB 2EEBA 3D0LA 4HUVB 5E4EC 2W65A 5IT2L 3V4VH 4NQVB 5EC1B 4JFZL 2NX5D 3AREC 4QRTB 1BOYA 4OZGE 3G5XA 2VLRB 2VSCA 3HUJA 4K3JH 4QT5B 1CD9B 2E27L 2A73A 3RWDA 2PXYD 4KJWC 3W0WA 1MUJB 1CICA 3ULVE 1IM9B 2QV2A 4YR6B 1P7HL 4QOKD 3MOQA 3QXDA 1U8HA 4NDMA 3ARED 1K85A 4XT1C 1KTDB 4JPIB 5D5MB 5C07A 3B9KC 5F96L 1GIGH 2EICA 4X98B 3KPOA 2FH6A 4OFDA 3UX9B 3LZFL 1JZ8A 3P9MA 5L6YH 3M8OH 4KJWD 4L3EB 1MJJA 5ENWB 1C08A 2IWGA 2MOVA 4HUVA 1YJDH 1RHFA 2VRAA 4WIQA 1I1YB 1OP9A 2E7BA 4NQVA 3B9KD 3D1MC 4YDJB 5EC1A 2I60L 2RFXB 3B9DA 1LNUA 1F97A 5CILL 4MVBC 1H3WM 15C8L 3FAWA 5F9WB 3VXNB 3TNMB 4ZPTB 3GRWH 2K9UA 2FYYB 3AY4A 2H9GB 4QT5A 3VG0L 4OI9A 1B9ZA 3OB0H 5DD1H 1MFNA 3HZYB 5H2BB 3RL2B 3BIKB 4XP4L 5EPMB 1EEQA 1MUJA 5I8CB 5A2IH 4HUNB 3DV4B 2D0FA 1IM9A 1O7VA 3P77B 4OFIA 4WW2F 4C59B 3FB7B 4IS6B 4J4PA 3U79A 5I1HH 3ZE0E 3KVQA 1KTDA 5T5FH 4LSSH 5D5MA 4KHTH 4HXAL 1AO7B 1XR8B 1T4KB 2ITCB 1K5NB 2NW3B 4X98A 3TZVC 4WUUB 3AXLA 4ZFZB 1KOAA 3BKJH 4NOFA