4FQ1H

Crystal structure of pgt121 fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
234
structure length
229
Chain Sequence
QMQLQESGPGLVKPSETLSLTCSVSGASISDSYWSWIRRSPGKGLEWIGYVHKSGDTNYSPSLKSRVNLSLDTSKNQVSLSLVAATAADSGKYYCARTLHGRRIYGIVAFNEWFTYFYMDVWGNGTQVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab heavy chain
publication title Complex-type N-glycan recognition by potent broadly neutralizing HIV antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 229
sequence length 234
ec nomenclature
pdb deposition date 2012-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fq1H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fq1H01
4OLYH 3TBWA 4LCYB 4BQ6A 5D7LB 4MXQD 5HGBA 4TQEH 1MIMH 4GXVH 3IFOA 2WIMA 5AYUL 4NSKB 1S7UA 3S7GA 3RZCD 1LP9B 1WZ1H 4E0RA 5SX4I 2DKSA 2QV2A 2A6DB 4HEPG 4LSSL 5EC2A 1B0GB 2JB5H 4Q9CA 2EICA 2GSGA 3ULSB 5IB3B 4E41A 4U6TA 1PZ5B 4K7FB 4MNHA 4LARL 2Y25A 2EZ0C 2J1KA 3ARDB 3RL2A 1Z9OA 3L9RB 3IDXH 4L5FL 5F1KC 1ZT4A 4DAGL 1LO2L 5HVHB 1HHIB 4FZ8L 4QRPD 4P2QE 4RAUA 1OP9A 1G1CA 3LDBB 5LCVL 4D3CL 1JPFB 1Z0NA 4H26B 1EZVX 2H6PA 2HH0L 4WUUB 5DD1L 2AEWA 2MSPA 1IGFL 5DVKA 3L7EB 5AYUH 3E0GA 3DX7B 5DJDB 1FCCA 3IETA 2HFTA 2DQGL 4LSSH 4UINH 4EVNA 2KPNA 1R5WB 5D6DA 3CVHL 3BRDA 4X6DA 1JYXA 1RVFL 1I9IL 4LARH 5DWUL 4XPFL 1G7QB 1TIUA 3FT4A 3O8XD 5EORL 1LE5A 3MLRL 4QXGL 2XZAL 4I0PC 4DAGH 4NN6B 4Y2DA 2JCCE 5EO1A 4IM8A 2MWCA 1PG7L 1YEDB 5DEFB 3WFEL 5IJVA 5LCVH 5E8EB 5FM4A 3C5SB 5E6ID 1G9ML 2KZWA 3NA4A 4JHBA 4LLVA 3KPOA 2HH0H 5DD1H 4JFFA 5JA8B 1A1OB 1H9VA 4OD2B 2R2BA 4G6JL 1S7WA 3WLWD 4Y5XA 3W0WB 1CE1L 3VXOA 4Z7WB 1MLCB 3S3JA 3TN0C 4PY8J 4G7YL 3ULUC 2DQGH 1G6VK 3CVHH 4P5TA 5CIPA 4Q6IC 3SY0B 5J6GA 4JO2H 5CSBA 1RVFH 3CLFL 4JB9L 1I9IH 4ENED 5DWUH 1T66D 5I0DA 4KROB 2VDQL 3IXAB 5EORH 4Z7NF 1T1XB 4QXGH 2XZAH 4XNXL 4Y4KD 3SDCD 1JRHL 1KB5A 3MBEC 4X7FC 5M7QA 2HVKA 5FGCB 1PG7H 5F8QC 3WFEH 1VKXB 5JHDD 3EIFA 1G9MH 1Z0MA 4PJDA 43C9B 5AG8A 2IBGA 5B4MC 4TTDD 3D85B 3RWEA 4G6JH 4M6AA 3RHWF 1C5CL 3T0EE 3ARZA 5D7KD 1CE1H 1DVFC 3O4LD 2VXUL 5C07B 4WW2F 4G7YH 1QO3A 5DGQA 1V5JA 4P2RE 1DBJL 5TGBA 4HKXB 2W9EH 3ZE2F 5BOPA 4JB9H 1WBZA 2C7UB 4HQQL 4F37F 4HGWA 3KLDA 3ES6B 2IAMB 4JN2B 1W8NA 2VDQH 4FZEL 4EDXB 1JNNH 1C5DB 4XNXH 4N90E 1AQKH 1JRHH 2W60A 4F7MB 3KPSB 5SV3A 3HZVB 5FGBC 1MJJA 2BVOB 4RQQB 1DBKL 2H8PB 1CVSC 2P8MA 4ONFL 2E9WA 5JIPA 2XWJB 4ZNEE 3KJ4C 1C5CH 4NZUL 2DIBA 4EXKA 2VNCA 4NQCA 3E6FB 3QXAA 2VXUH 5EZJA 2CK2A 3FQXA 5D2NC 1DBJH 5ADPL 3UTPD 4X0KA 4KK6C 4HQQH 2HLFD 2WLYA 1NFDE 2HWZL 5KVGL 2HG5B 3MRMB 4FZEH 4LCIL 3PQYB 32C2B 4LOUC 4P2YA 3U4BL 1OAZL 5C0DA 3V8CA 1SJVA 3U1SL 4Q97A 2OX5A 5DJ0B 3T4AB 2VYRE 4LSRL 3MRGB 1DBKH 5ICZB 4ONFH 2JELL 4ZUSB 5FDWA 4JQVC 1MWAA 3UBXA 1OQOA 4NZUH 43CAA 2D9QB 3RZCA 3VA2C 3OKLB 3OKMA 3PJSB 3MLPA 3VI4F 1LK3L 2D4FA 2YZ1A 1ZHLA 4P2OC 3MV9E 1QRKA 1D5ZB 1YEHL 1P2CA 5ADPH 1Q9KA 2HJLA 2V5YA 4QF1A 3X11A 1CQYA 4MA3B 4KVNH 4W6XB 4KVCL 4IDLA 4LCIH 4QRPA 1OAZH 4MAYB 4N1CA 1IKNA 3U1SH 4QO1A 1F6FB 4P9HL 4N9GA 3F6LA 4JJHA 4ZUTA 4UT9L 2Z8SA 4U6XA 2ZSVB 4HK3J 4XWGH 5DMIH 3P0YL 4TN9A 4AQ1B 3CH1B 3QAZB 3G04A 1IAKA 4OGYL 1VGKB 3JV6B 1DQLL 3O3EA 3IXTA 4G3YL 3MSPA 4ACPA 3AS1A 4F9LC 3WN5A 4PJDF 2H26A 4PJGE 2Q86B 1S7XA 4KVCH 3ARBC 2N1KA 1MJ7L 1PVHA 1T21B 4QLRA 5IFAH 5E6IA 2D0HA 4LLDA 3U46B 4UT9H 4KMLB 5D4QA 3QWOB 4ZS6D 3LHPL 1CN4A 5E00A 4FTVD 1HNFA 1SY6L 5JQ6L 2YHGA 4U6YB 4CAGA 4PY7B 3TNMA 1X44A 1P4BH 4G8GD 3RVWC 1D6EA 4QRUA 4QRRE 5F3HA 4XNYL 3ZE0E 1DQLH 4J3UA 3PWPD 3F7RA 4IOFD 4KC3B 3O2DL 4HIJA 3LSOB 1R0AL 2X4NA 1HDMA 1Q1JL 2B4CL 1XEDA 3RZWA 35C8L 3MRNB 3AREB 4MQXD 1T20B 1ZA6A 4OI8A 4WGWB 3KNBA 1J8HD 4Y4KA 3G08B 2KUTA 3SDCA 4LDOB 1KJMB 5C86A 4V1DD 1MJ7H 1XF5B 4P5MA 1MCJA 1OGAD 3IJSA 5JHDA 5FCSH 3ROLA 1YUHA 3DX9A 1C16B 1FLTX 1WTGT 3HS0B 4G9FD 3LHPH 5CP7A 3H6JA 4NJAL 1JWUA 1SY6H 4KTDL 5JQ6H 1AO7B 5FKAB 1AY1L 1JHKL 5L88L 5IK3B 3O4LA 5CSZB 2D7QA 4XNYH 4P4RB 2FJHA 2BXZA 1TVBA 4OBRA 3O2DH 5B8CA 4PGCA 2E8ZA 1R0AH 1DE4B 1Q1JH 1A4KB 35C8H 1SEQH 1A8JH 1KJ2L 1XGPB 4KZEL 2FX9L 3I84A 3VRJA 2LVCA 4GUPB 5IVZA 5GS1B 2VOTA 4UDTA 2ARJA 3S3SA 2GJZB 4YDLB 2OZ4L 3MREB 4BK4A 3W11C 5CP3H 1IGJA 2M1KA 1J0YA 5C0IA 3B9EA 4NJAH 4KTDH 1BQHB 3V52L 4PB9L 1JHKH 2PYEE 5L88H 5C0BD 4UIKL 3CZFA 3ORJA 3I50L 4D0CA 1CGUA 4DUWA 3PABB 5FYJU 1C5BL 3QO1A 1JP5A 1YN7B 1Y6NR 2UWEA 1KCUL 5J3HD 3MRJB 1KJ2H 3OAZK 2APXA 2FX9H 5FM5O 2VABB 1EMTL 1FO0B 2R29L 2P7TA 5DRZB 4CDHA 1IKFH 2OZ4H 5D1ZC 1OAQL 1S7QA 2Q7NA 2FDBP 2VLRE 1CIUA 3K81A 2DMBA 4M62L 4NO3A 4C4KT 5EO0A 1YEEL 3SO3C 3V52H 4PB9H 4R0LA 4Q7DA 4YHIA 5EBLB 2ADGB 3EGSB 5GS3A 4Y16C 3TCXA 4J6RL 1HHHA 4UIKH 3V6OC 1KPVB 2NY3C 4XVTH 1HXMA 3EKCA 3I50H 1J7VR 1U3HD 4MD0B 1I8KB 1JWMB 3WIHA 1MHEB 2FO4A 1YN6A 4F33B 2FHBA 3LZFL 3TFKD 3N85L 3T0AA 2R1YA 1KCUH 3SJVB 4R97C 4JPVL 1X9QA 5BZDA 4O2EA 4XXDA 3UTOA 1I1YB 1HI6B 1EMTH 2FR4A 3H42L 2R29H 4O9HL 3ZT7A 5TE7L 3LEVL 5DRNA 3GRWA 3NIDE 4PJBB 2AJSL 1OAQH 3FB8A 1Q9WA 4PBVC 4PJ5B 5E4EB 5FYLE 4P3WA 5IEKB 3O9WC 5FM5M 3TVMB 5DMJB 2N7AA 5F7YC 1RJYB 2PW1A 3QQ9C 4J6RH 2RCSL 1ACYL 3L3GB 3LKSA 1QSVA 2Z9TA 2X70A 3QFJB 2X1PA 5E9DE 1ZLWH 2HJKB 5CGYD 3LZFH 3ILPB 3N85H 3DBXA 2P8PA 4JPVH 1T2JA 4FRWA 3JWNC 3T0VA 4ZQKB 5ESAA 3QHTC 4O9HH 5TE7H 5L2JB 3LEVH 1WAAA 5EH1A 5MI0C 1W72L 3S35L 1A4JA 4A6YB 2AJSH 2F8XC 1BMGA 2OR9L 3O3BB 1QR4A 4YDJB 1KN2H 1VEOA 4G8GA 4OZHA 4Y19D 3AUVA 2AJ3A 4I3SH 3VGAC 2SEBA 5E8NA 1U0QA 1X5YA 3SDYL 5C0EB 2CDGB 2RCSH 3PWPA 1LEIA 1TNMA 4HUUA 4JO4H 5HHOB 1TQCB 3FKUS 1FL6B 1X6NA 3NFSH 5DEZA 3HG1B 3MRBA 3WHE1 4R3SA 5D2LF 3V6FA 2GJ6D 5A3ID 1J8HA 4AL8L 5HHPB 3GMPA 4V1DA 2X1QA 3CZJA 5SWZE 1OGAA 4N0FA 3LKRA 1YY9D 4A2MA 5F1NB 1W72H 4G9FA 3TYFA 1ZHNB 1KCVL 4BQ9A 2OR9H 1N8ZA 4RGMB 2PUQT 2XFXB 1Z3GH 3P4MB 1XF2A 4XCNA 1HOCA 3MBED 3ZT6A 2X9XA 5D96C 2Q76B 2UYLB 4IRSB 4PJHE 5I16A 3QNXB 1NCBH 3SDYH 3VW3L 3FB5A 3WFBL 1WWWX 4PRIE 5AD0A 5B4MD 1BWMA 2WM0A 3GFUA 2CD0A 2J8UE 4X8JB 2KZ1B 3QUZC 2BNRB 3TPUB 1KENL 4PRPB 4HD9A 3GNMH 4OCYL 4AL8H 5DA4A 5IVXE 4C59B 5GZOD 2FWOA 2BHUA 1DUZB 3QQ4B 4KJWC 1IEBA 3KR3L 3K8KA 1MUJA 4L4JA 3D3VD 1NCCL 2EIZA 4EIGB 5F9JA 1KCVH 4FMKA 1IAIM 3SDAB 1P7QB 4E41E 2DTSA 1KT2A 3MCKB 3QXVA 1E6OL 4OCRL 3MCG1 4JANB 3VW3H 2F74B 1BQLL 2W0PA 3SDXA 2A6KA 1TZHA 3ARGB 3BUYA 2GITA 3MGTA 4U33A 2YPKB 1M7IA 1TPXC 2JIXD 2V17L 4Y89A 3FAWA 5ENWB 1JF5A 4OCYH 4P57B 3NFPA 4XP6L 4DOHB 5C0NC 2EEBA 5KSAB 1BP3B 3VRLF 2YA0A 4JE4B 3KR3H 4KRPD 4OZGB 3DX8A 1NCCH 3Q5TA 3HLAA 2CLRA 1F6LL 2NMSA 3ZDZF 3H3KA 3TM6A 1KGCD 4X6DE 4LAJH 4L4TE 4PJXB 2QKIB 1E6OH 4OCRH 1MFNA 4F7TA 1U3HA 4Z78B 1YY8A 4J7RA 1WAAF 1XGQB 4JY6B 1WSST 1YYML 4U7KA 3TCLA 4AM0A 3JTSB 3P4LA 2CSPA 3WLBB 4HX1B 4D0BA 2VRAA 5F9WC 2V17H 3GSRA 4YBQD 3QUKB 3U4AA 1K8DA 2X7LB 2VAJA 4P2OD 1T0NA 2O5YL 3EZJB 5DSCA 2NCMA 4JFFE 5DJAA 4Y4HC 1K85A 3VFTA 4KKNA 1RIUH 3Q5YA 2BSTA 4GKSB 4RX4D 5IMKA 5T1LB 1MH5B 1EV2E 3RTQB 1OP3K 4OF0A 1OF2B 1NAML 2YC1B 1G7IA 2AK1H 3HR5B 2CGRL 4BZ1L 4P4KC 2EDBA 5T3XD 1YYMH 1MCPL 4FN0A 1NAKL 1JK8A 2Y9RT 5GGSA 4J23A 4AQOA 1BF2A 5DMYA 1HQ4B 5H8DA 5GS2H 1U58B 2O5YH 3UZVB 1T7YA 5FIEA 5EU3B 4X4YB 3SGEH 1U91A 3HRZB 3NA9L 4L9LC 1K3ZA 1JWSA 2DJUA 5FCUL 5FUCE 1U8NB 1L0XA 1P84K 5E1AB 4P3CL 2G9HA 5C3TA 1NAMH 2VR9A 5DVNA 3NCMA 3VFWA 4Y19A 3RNQA 3HZKA 1TNNA 3VG9B 3RP1A 2WWMD 1IM9B 1FIEA 2CGRH 1J05B 1AQDB 4BZ1H 3B9KC 4G6FD 1CTOA 2YBRB 1MCPH 2AABL 3VXSB 1NAKH 1G9MC 2GJ6A 5AAWA 4I9WD 1EHNA 5IQ9A 2DQUL 1E27A 1X5ZA 3C2SA 4GKNA 4K3JL 4H1LA 3D0VB 4Q6IA 2IBZX 1YNTA 2OL3B 2IWGA 2HKFL 3SDXF 2WW8A 1VSCA 5FCUH 4DGYL 3RIAK 4XAWL 5ERWB 1H3PL 1JPST 2NY4B 5SWQA 5FGRA 3MBEA 4WU5A 2YUZA 4GAGL 4ZFOB 1EHAA 4PJFE 4JO1H 5E5UB 5JNYA 4MQSB 1JJUA 2C1OB 3DUSB 5I1AA 5C71A 2AABH 3KXFD 2BVQA 2C3HA 3HNVL 3C8HA 2ZNXA 1IVLA 4MX7A 5DRXA 3FRUA 4ZNCD 5MEPA 2DQUH 4K3JH 3MUJA 1BIHA 5CLTA 1QA9A 2K7PA 2OS7A 3D5OF 5KG9B 1HHJB 3V5HB 4CVZB 1NBVL 5INCA 3D3VA 2C3VB 2HKFH 1JF1B 4DGYH 2BZDA 2CLVB 2GTZA 3BZEA 4LKCB 1XGUA 4GRWB 1HXYB 5I30L 1L4IA 4ZPVA 3T09A 2OBGA 3C60B 3NCYP 4U31A 1BFTA 5FGBA 2CDEB 5C0CB 4BA8A 5TH2A 4DTGL 3LB6C 1GZPB 5I66A 1XR8A 1VFAA 4PGBA 4M3JA 1BZ9B 4QRPE 4BH8A 2JIXA 5CMAA 5B38B 2I9TB 2R0LL 1KEGL 4ODXB 5JW4R 6FABH 4QRSB 1LHZA 2VZUA 2XTJC 3DVNA 1VFOA 5D2NA 5KAQG 3CUPB 3GMLA 3ZKND 2NY7H 1S8DA 4XT1C 1P6AB 5I1LA 5MEQB 4APQC 1ADQA 2AERT 4ZUVB 1EO5A 5IFHL 3RX7A 5KAQF 4U0RB 2FRGP 3P9MB 3OB0H 5I30H 4YGAB 3LKQA 2PN5A 3PHOB 3SCMC 1A6TB 4D9RD 4NFCA 2ATKA 1N5AA 1Q0XL 3IDUA 3HPLA 4GO6B 4GW4B 2HJFA 3L3OA 1BVKA 3TO4C 1T0MB 4JZJB 5ETUA 1RJZA 2DLGA 3LD8B 3J7HA 5ILTL 5EZLB 3HAEB 4J1UA 2R0LH 1KEGH 2B5IB 3M07A 4GT7A 4L29B 4P2OA 3TPKA 4CVXA 3HCVB 5C09D 3EAKA 4KI5D 3QYCA 2Q8AL 2VZTA 3RVXC 4EJ1C 1YMMD 4RX4A 1NLDL 3KG5A 5IFHH 2FIRT 5ITFB 3TO2A 4H1LG 4I77L 5IJKA 4PG2A 3V4UL 3FHAA 1YQ2A 3IFPB 1KF9B 2G5BA 4ZAKD 1NDGA 2VL5B 5I1IL 1LVEA 1U8JB 2EC8A 4XXCA 3PIQA 4ZO9A 4PB0L 1Q0XH 3CFJB 1C08B 3T0XA 2JJSC 3TBSB 1OLLA 3KLHD 1XCQB 1OVZA 3AY4C 2H3NB 1A6WL 4G8EB 5ILTH 3P0GB 3HZMA 5HTSA 1FVEA 4ONOA 2AK4E 1SVCP 3QEHA 4CMMB 3VWJB 2Q8AH 4C54A 4JGMA 3RGHA 4JKWA 4C56E 3O4LE 1NLDH 2BSRB 4I77H 1UADC 3V4UH 5A2IH 2DICA 2FEDD 5I1IH 5FOJA 3I6LE 4KKCD 4PB0H 4MXVE 2NY2C 1ES0B 3JSSA 4PV9A 2W65A 1A6WH 3TBYA 1LGVA 3GDBA 3S4SA 1BWWA 1MJUL 1P7KB 1WBXA 3MYJB 4I5BA 4U6HB 5D9SB 2NY6B 4JFHE 3BP7A 1T1ZB 3QNYB 3VCLA 2NY1C 4DZBA 4UOW0 4LGPB 2ITDA 2IALA 1OB1B 5GGQL 1SJHB 3FB6B 2WUBL 1D5MA 2LU3A 1A3RL 4Z7UA 3VA6A 3UTPE 4HXBL 4GKOA 2GJJA 4IOIA 1YECL 5SWSE 2R39A 2FECI 3I02A 4JRXB 2MOVA 2UWEE 5EOCL 5BW7C 3OKEA 1EHXA 3KXFA 1IGYA 2EE3A 1F3RB 1OY3B 4AIOA 5CKGA 1FIGL 1MJUH 3BSZL 1BEYL 3QFDA 1Z9LA 4G8FA 3K4DA 1W0YT 3UYPA 3T8XA 5CJ8A 3FOMA 1NMBL 4BKLA 5FO7B 5EDXA 5IG7A 3ARFD 3L5XL 2BCKA 1UCTA 3BO8B 1A3RH 3OG4B 4PGDB 1NGZA 4HXBH 3VXTB 4OQTL 4WI6A 2XYCA 1YECH 3B5GA 5DFTA 4KJWD 4P59L 5EOCH 2PO6B 1FORL 3ETBF 4X6BB 3E3QE 4PD4J 4PRBB 3BKJL 5FA3A 3BE1L 4GG8B 3LRSA 1FIGH 3BSZH 1BEYH 3DX6B 1UXWB 3MA7A 4FFYL 4NKQB 5EBWA 4PJ8C 1XIWC 1EVTC 2HN7A 3ESUF 3KLAB 3IFLL 2AQ1A 1NMBH 3KLSA 4E9LA 5D6CA 5DD0L 2NY0C 3L5XH 4XCEA 3VRLE 3OKNA 3V7AG 4I3GA 5KSBE 1KXVC 3GGWA 3EFDL 1BBJB 4OQTH 4YHYB 1MRDL 1RK0B 4EI5C 2HT4C 3MJ8A 1VCAA 4I2XE 4H5SA 4P59H 3PHQB 2DWEA 3BEWA 1AC0A 5DQ9B 2OLDA 5J12C 3D69A 4HWZB 4WHTA 4XGZB 5HI5D 4KAQL 3BKJH 4LQFL 3BE1H 2GFBA 2CO6B 4FFYH 1QACA 2YD8A 3DTXA 3QI9C 4HWEL 5DEGB 5C09A 3STZA 3EDKA 4KZDH 3HE6B 3IFLH 3S4SG 3GSOA 3L3JB 3X14B 3HKFA 1YMMA 4OZHE 5DD0H 4PJ7E 1A2YB 4HKBB 4LP5A 5KANI 4HJGA 5DJXB 1ZMYA 5JW4N 3S9DB 4LP4A 4XZUA 2ZCHH 4ZAKA 3WDIA 1I9JL 1NKRA 4ZG1A 1MRDH 4UDUB 1TJIL 5C0AE 1S7VA 1J8HE 2NTFB 1NLBL 2D3VA 4V1DE 2BC4B 2AXJA 5ANMA 3KPMB 3QIBB 2EXWC 4M7LT 4KAQH 4LQFH 2KQMA 2FHCA 5E2JA 2AXGA 5C1MB 2EH8L 4RCAA 4HWEH 3S35X 1CXLA 3BPCA 1ZA3A 3QH3A 4JRYE 3VWKD 5D5MB 5BRZD 5LVEA 5KSUB 2GKIA 2V9RA 1M1SA 3OR6B 1S9WA 4RMSA 5I17B 1R3LA 1AKJD 3QR2A 5FA4B 1KLUB 1T5XB 3ZO0A 4BSWB 3WCYA 3AROA 4YEEA 3SEPA 2OCFD 25C8L 1I9JH 4EQ3A 4QWWC 1TJIH 5L8LB 2XG4A 4LVOC 4HZLB 5EU5B 1HKLH 5HPMB 1MFAL 4XMLL 3SE4A 1NLBH 3DHMA 1N6VA 4K2UL 5IMLB 3BRFA 1CDBA 2VAAA 1UB5B 4RIRA 1GGYA 3FFDA 4MNGA 4PR5A 3VRIA 2X1WL 5AZ2H 1FNHA 1T03H 2EH8H 3BUTA 1MI5B 3EOBB 3V0AC 4XCYB 2XN9B 4R2GD 3B9KD 3VDAA 1OL0A 3PWUB 5F70A 2VLLA 2Z31B 1CLCA 1RZFL 3VXUB 1ETZB 1CGTA 4YHOL 4AJ0A 1IL1B 2XZCL 4QY8B 4ZPTB 3IJHA 2QQQA 5ESVA 3QUMA 4UTAL 2V6HA 3IT8D 5EZIL 3D1MC 3QUYD 1RUML 25C8H 4FQJL 1UJ3A 4NDMA 1XAUA 5DC4B 3OKKA 1IGTA 3MLTA 5DD3L 3UEZA 1MFAH 4XMLH 4U0QB 4XPGH 3KPPA 1FP5A 3G5XB 4YAQB 4K2UH 5FO8A 4NN7C 3A6BL 2V5TA 1Y6MR 4YHKH 4X7TB 2X4OB 4WENB 1Y18A 1TCRB 2YK1L 1PZUB 3T1WA 4YO0B 5DJ2A 3GJFA 3ARFA 1RZFH 4K3EL 4PLJD 4Y1AB 1RU9L 2HLAA 4YHOH 2XZCH 3MRFA 4X98B 1B90A 3SQBA 1FO0L 1ACZA 1QSFD 3L1OL 4UTAH 3TT1L 3QA3A 4GRLB 5EOTB 4FQJH 1R5IB 3WS6A 1QKZL 2CK0L 2FD6H 4LLYA 1AI1L 5B39B 2IF7A 2XACC 3EYQD 3A0OA 1MRCH 1VFBA 4KI5F 4WO4B 1RI8A 2DQJL 4P46D 5DD3H 4G9DB 3DYMA 4KGJA 3KYOB 5GGSY 4HLZG 3H7LA 4U1LB 5JOPD 5I1DB 3QDJD 5FYJE 4R4ND 3A6BH 3RPKA 5HPOA 2BOBA 4NQEB 1TQBC 3X3GL 4OD1L 4EZMA 1UWXK 2YK1H 3DVGA 5D7JD 4KRLB 5DQJB 5HY9B 4FQXB 3CMOL 2G2RB 5CBEB 5TDPA 8CGTA 1MNUL 4RFOL 2FX7L 1U41A 3ZHKA 5ESQA 4K3EH 3GSUA 4NT6A 1RU9H 3S36L 1KIPB 5I75C 4L3EE 4GS7C 4KXZH 2HT2C 5F3BA 1FO0H 3AS2A 1A21A 4RGND 3REWA 3TT1H 4Z5RB 3IDGB 1QKZH 2CK0H 4UIMB 5GS0L 2DQJH 3RKDD 4FQQB 3ZYIA 4K71C 4XH2A 1MCLA 1K4CB 4WEBL 1BJ1J 1IAII 5KZCB 3EFFA 5K9KB 1V8HA 3F7QA 3X3GH 4OD1H 4YHPB 3B8YA 1UZ8A 4S1DD 3MRRA 2FHFA 4JM2D 3CFBB 2I07A 2X4QB 2LV4A 4ZSOE 4Y19E 4ONGL 4MMXC 1CYGA 4RNRB 4RFOH 3UTTB 3CC5A 2FX7H 1CR9L 3WJJA 3PDDA 1AFVL 1I3UA 2P43B 3PG2A 4IIQB 4EN3B 2BNQD 5HYFA 3S36H 1WFTA 4XP1L 1NBYB 3GSWB 1NANI 1J5OL 3FB7B 4A6YL 2ITCA 5AYQA 5GS0H 1BVLB 3V4PL 5F7KC 5JDSB 3DO3A 3U2SA 1NMCC 3IDNB 4O51B 1FNEA 1IQWH 3O6FD 1P4LA 1CICB 4F7CA 4B53A 2VDPL 2GUOB 1ITBB 4WEBH 3KPLA 2X41A 2QEJA 3P4NA 5SV4A 4P4KA 2F19L 3D25B 3VWKA 5BRZA 4E5XA 4ONGH 2XWBB 3D48R 3WO3B 1CR9H 1N5YL 1G6RB 1X4ZA 3VXPB 1AKJA 3P73B 4N8VG 2DMKA 1DQQB 4U1NA 4XP1H 1G7PB 3GMRB 3CLEL 3MPCA 3MLZH 1LNUA 1J5OH 1C7SA 5F1IA 5E1HB 4XHJD 4A6YH 5J13C 2MCPL 5T33L 3QDMB 3V4PH 3CVHA 4LDLB 5HXMA 4EOWL 5JMOC 1KEMH 2QADB 3OWEA 4P2QB 3ULVL 1M7DA 4HHAB 1MELA 3D3VE 1UB6A 3P0VL 5FF6B 4RAHA 1S7RA 4UBDD 4OGXL 1S9XB 3HC0B 4M02A 3RU8L 2NY2D 3B9KA 3GSXA 2F19H 4ODUB 1JUFA 1T04B 4I4WA 1F58L 1N5YH 1K4DA 3QO0B 4ORGB 1KNOA 1UM6H 1B88A 1XF4A 4R4BB 2DQHL 4JFEE 3CLEH 3QUYA 3WFDL 5DK3A 1TDQA 2RB8A 1CXEA 3V2AR 1H3UA 4RISL 2JJWA 4HFWA 2MCPH 5T33H 1JYWA 5D2NE 4M93B 5EC1A 3LS4L 3C5ZC 2R1XB 1H3VA 3ULVH 4KK8C 3P0VH 3IVKA 5DTFA 3I9GH 3JTTA 4OGXH 4GW1A 5J1AB 3RDTD 1KGCE 4ELMA 5TDNA 3DUUA 5C0RH 3U30C 2P5WB 3QQ3B 1BM3L 1F58H 1N0XL 4JFYA 1FC1A 5D7IB 4I13B 4EUPH 1QSFA 4WDIA 4X7CC 5J6HA 3WFDH 4AMKL 2HVJB 4DUVA 1PX3A 3EW3B 4FQPA 2B39A 4P46A 4M9PA 4FQHA 3TC9A 3UC0L 3VDCA 2VMFA 4NRYA 2X4TB 5MEND 1FJ1A 3LS4H 4QHLB 3QDJA 4QXTA 4QHNA 4I18C 4WTZA 3QXDB 3GJEB 5EUOF 4NM8H 4GAFB 4BZYA 1JYNA 5D7JA 1I7UB 2JTDA 4NHUB 2DLFL 3HI1B 3RPIA 4RFEB 3SKUD 4OZIE 1BM3H 2OM5A 2WINB 3ILQD 2FIKA 3FQTA 3U0WL 4OCLC 2XQBL 3K80A 1FZMA 1ONQB 1U93B 2DYPD 3DXAD 5B3NA 5L2KE 5T3XE 2QQLL 5L6YH 3GSQB 1XIWD 4AENB 4AMKH 1I7TB 5CEYA 1KTLA 1H5BB 3LPFA 4OZFB 4MHHI 1JTPA 5E08L 3TBVB 1NANH 3UC0H 2HKHL 3FT2A 5ELIA 4F2MA 3ARDC 1HSAB 3LEXB 5DHYB 5HVHC 4FQLL 4Z7VE 3L5JA 1REIA 3O4OB 3TO4A 3TF7C 1ODAA 1BIIB 3MYZA 3G6DL 1U95B 4F7EB 4KJYB 1BQSA 3MTRA 3WSQL 2BNQA 4JFXA 3U0WH 2E7BA 3C6SA 4LRIC 2LE9A 5GISL 3SPVB 2IANB 1FYTD 1EGJL 3KPNB 4GG6E 2QQLH 1SEBB 1OD9A 3RHWK 4QTIL 3OJ2C 4LLWA 4NFDA 3EJZD 5E08H 1CXFA 1OW0C 2HKHH 4X6CE 3O6FA 4IHOA 1K8IB 2VZ3A 4R9HA 4PG9B 3UTSD 1U8QB 4LPTA 1GOFA 3BJLA 1Q94A 1K2DB 3GI9L 4NN6C 4G80A 3LRGA 4FFZL 4FQLH 2JJSA 5JXAL 2UY6A 4O2CA 4Z7UE 4PJCA 2F53B 3AY4A 4LEOB 3G6DH 5BVPL 3WFHB 3OGCB 2G75A 3WSQH 1ZWIA 1DVFB 3KPRD 3QP3A 5GISH 1EGJH 2CLZB 2A9MH 5E95B 4JKPL 4PJEB 4QTIH 2ZG1A 3BVNA 2KQNA 4ELMF 1G9EA 5KW9H 4PJAB 3L95A 3RL1B 3V5KA 4ETQB 2ENYA 4JLRB 5HI3D 4KROC 3ZKQD 4ZFOL 5T1KD 4L3CB 5IF0A 2FEEI 4QWWD 2ICWB 2AEPL 5JZ7C 4G6AD 3GI9H 3MUZ1 2IC2A 2Y1VA 2FGWL 4FFZH 2LAAA 1YMHA 5JXAH 1GC1C 3B3IB 3EDDA 1N26A 2BVPB 2OJZL 4YWGH 2EYRB 5BVPH 4X5WA 1DN2A 2VXQL 4XMKL 3ZTJG 1SY6A 4NRXB 2OL3H 4ELKB 1NC2D 3DYPA 1T89C 1CIDA 4QRQB 7FABH 3FZUD 1HE7A 3NABL 2WP3O 4O02L 4N0CC 5K59E 3GBML 4U1JA 4QHUB 2IAMC 1D3CA 3HUJA 3P2TA 1BZQK 4PV8B 3RDTA 1QRND 4HXAH 4OKVA 1BJMA 4XTRD 3F6IA 1IAOB 5BVJA 2OJZH 1B0WA 4ZUUA 4LLUB 4TSAL 2DQTH 1E4XI 2E27L 5CP3A 5IUSA 4XMKH 2F54D 3QXUA 3MNWA 3F8UB 5C9JB 4M7JH 4QRTB 1WC7B 5JPMA 3HC3L 1AHWB 1VHPA 4U1KA 3FOLA 3VD3A 3I2CL 3VD9A 3NABH 4JM2F 3F7PC 4GRWH 4O02H 5GZND 3GBMH 1P1ZA 5MENA 1A7QL 4CADA 2ZUYA 3BHBB 4QYOB 5C09E 4QKXB 5IV2B 2HFEA 4WHYH 2X4RB 4GOSA 3L5HA 1KJ2A 3KYKL 3ALXA 4MVBC 1NEZB 4J3SA 5FECA 1FLRL 4JDZB 1FGNH 3MRIB 5HYSB 1RZJL 4XC3L 2OZ4A 1HWHB 4TSAH 2E27H 4IMLB 1N6UA 3BPNB 2Z35A 2DYPA 3DXAA 1I1FB 4G42B 1CK0H 1NCNA 1DEDA 2E6QA 4PJ8A 4Y5YA 1XIWA 1CFSA 4RMUA 3HC3H 4FMFA 4L1HA 5ANME 1FL3A 3QWRD 4PJ9D 1KLFA 2BRRL 4WEMB 5K9QI 4PJCF 3FONB 3PV6B 2CKNA 4HDIB 1UA6L 3GB7A 3MJ9H 1A7QH 2E7MA 1BBDL 4P49A 4Q6YA 4ZFZB 1QLRA 3O3DB 3NIFF 5HD8D 1WWBX 3MV8D 1FYHB 1M4KA 4MAYC 1PGRB 1FLRH 1X7QA 4RAVB 1FRGL 5FGSA 1WT5C 4HH9B 4LCUB 3QIUD 1RZJH 4XC3H 3HAEH 1G7LB 2NXZB 2VKXA 4JFDD 5KS9A 1U2CA 1HILB 4QOKD 4Z77A 4L9DA 3G5VA 5KVFL 3QI9A 1FYTA 3MACL 2DLEA 4KK5C 3QAZC 5BXFB 4DGVL 5J1TC 2V9TA 4P5KA 3EJYC 1XR9A 3CPLB 5LBSL 1A14H 2BRRH 3BDBA 1AR2A 3OZ9L 4YHNA 3F58H 1UA6H 4MGXA 4K7PL 4UT7H 2F5BL 3UTSA 2BSED 5I1HL 2NR6C 2XXMB 1OSZA 1M05A 1UKTA 3UAJC 3G6JF 1TJHL 3UPCA 3CDCA 1AIFB 1L6ZA 3ZLQC 5BS0B 1U8MA 2AQ3A 4BFGA 5HHMB 4WW1B 3KPRA 1QPXA 2WV3A 3G5YA 4OCSL 4MJ6A 3R8QA 3BZ4A 2CUMA 4YHML 1JNJA 3HUJF 4OGAC 3Q1SL 2ZUWA 5LBSH 4L4VB 3CJJA 5JPNA 4NPYA 4K55A 1I3RB 2OXGA 1T7VA 3OZ9H 2VR4A 4ONHA 4K7PH 3AREC 2F5BH 2YMXL 2ZUTA 4F58L 1C12A 1E6JH 3MRQB 5T1KA 3ZL4L 5IW1B 3MGOB 5I1HH 5CD3B 2VDLL 1R3JB 1A0QL 2JF1A 4JDVB 5JORA 3CFEB 3WDJA 3C09B 2DI7A 1W72A 3TP4A 5J4MA 1QSEB 3QB7C 3WL9A 4YE4L 5GSVA 1A9EA 4O58L 1NC2A 4YHMH 5E94A 1CFNB 1E4XH 1DANU 1FFNB 4NOFA 4P3DA 4XRCA 3Q1SH 3GHEL 3KYNB 5EO9B 1MFBL 1RUKL 4OLUL 2LABA 4XPTL 2YMXH 1RZKH 4LCCA 4F58H 5GRXG 3TBTA 4HEME 3IDIA 4ZTPH 5GS1C 2VKWA 3D0LA 1KPRA 1A0QH 3T2OA 1QRNA 4ZDHA 3VGGA 4YDLC 2Q7YB 2RJMA 1F3JB 1TVDA 3VXRE 4KKAC 5D1XD 3FCTB 3LN4A 1U8HB 2F54A 5IMMA 1SYVA 2IGFL 4FG6D 2NY3B 3ZKXB 4O58H 3OKDB 3WNMA 3GIVB 1U8PB 2M26A 3BQUC 1AGCB 1PYWB 4J8RA 1MFBH 1RUKH 4OLUH 3S34L 4XPTH 2Y72A 5KS9F 2PYFA 2PCPA 5SWZB 1OCWL 5J9PB 3NIGE 5IB4B 3U4EA 1JPTL 4UUJB 5CKAA 5T1MA 2IFGA 8FABA 1D5XA 5IW6A 1HH9B 1NC4D 4NUGH 1A64A 1ZE3C 2V7NB 4YXKL 1J1OL 4PJIA 2R2EA 3EYOA 1KLGB 4DZ8A 1IM3A 5EUKB 5BQ7A 4NKOB 2BERA 4MA8L 2IGFH 4P23B 3T1FB 2Y36L 3MUY1 4F15B 1OP3H 1A6ZA 1FFPA 2BK8A 5GRJH 5C8JB 3IU4L 4WW2B 3QWRA 4PJ9A 2RR3A 3EHBD 1X3DA 4N5EC 1J86A 4QEGA 5D7LD 1I3VA 1AJ7L 4LHUG 2J7LA 1BD2D 4D9QE 4HF5L 3S34H 3TBWB 1BOGA 3QPXL 3EYVA 3ZMRA 1CFQA 1CG9A 1OCWH 3MV8A 5BRZE 1JPTH 3TJHD 4HS3A 4S1QL 1GGIH 5MI0B 4E0RB 4HG4J 4OAWA 3QIUA 4JZOA 5KBNC 2GSGB 5C0FB 1G7JA 1CFTA 2NW2B 4NNXA 4JFDA 1CE6A 5ID0A 4MNHB 2ESVD 4QOKA 1GHFL 5E4EC 2P47B 4MA8H 4GH7B 3TVMC 4Z7OE 3HMXH 2J12B 4JN1L 1MCHA 1ZT4B 2B2XL 2AXFB 1JV5A 5LXGH 2YPLD 3GK8L 4G6KL 1J8KA 4NO5B 1AJ7H 1A7OL 1BX2A 4HF5H 2XOTA 3QULB 3QPXH 4K8RL 3M17A 5CEXA 4UT6L 4NQTA 2V7HA 3ABZA 3QJFA 4S1QH 1GVIA 3IETB 5DK2A 1YNLL 2HFFA 3BFOA 4AEHL 3QZWA 1LILA 2V2WB 2W92A 3OF6D 4TNVF 3C5JB 2GIYA 3F7YA 2H2PD 1X4XA 4UZGA 2QSVA 3H9SB 3PGCB 1ZT1B 4NKDB 2EDEA 5CD5C 1LE5B 1A6AA 2B2XH 1C7TA 5EO1B 1Z5LA 4NJ9L 3GK8H 2VISB 4MAUL 4G6KH 5IJVB 1TQCC 3QUZB 3VD7A 1A7OH 1GOGA 1GZQA 5F89B 4Q9RH 4LLVB 3KPOB 3OR7A 5DJ8A 4K8RH 3OSKA 1EPFA 4UT6H 2NY5C 2R2BB 1S7WB 5DMGD 4Y5XB 5GGRB 3MRKB 1AXTL 2GQHA 4HW6A 1CLOH 1T1YB 4G7VL 4WTXA 1A3QA 1YNLH 5GJSH 3DGCR 3O45B 5DDHA 1QSFE 4AEHH 1N7ML 5J6GB 4C83B 1EERB 2V2TA 1RAMA 5HI4D 4OV5B 3FFCB 2V2XA 3FO2A 4RGMC 1DLFL 5JZ7D 1D5IH 3GUTA 1MY5A 3IJYA 4IRSC 3VJ6A 1LDPL 4KDTC 3PP4L 4KJQC 4TVPE 5JOPE 4OJFH 3QDJE 2XWTA 4NJ9H 4IRJD 4MAUH 3L5IA 3I6GB 1WQVT 2NNAB 4PJDB 1RJLA 4LAQL 5DFVC 3DSFH 1CXKA 5M95B 2Z92A 5C07D 4UU9B 2PETA 1SVZA 4G7VH 3WNOA 3UO1L 3F5WA 3UDWC 1N7MH 2XTJE 5TGBB 1EFXB 5D1XA 3JWOL 5C08D 2MHAA 3O0RL 4K23L 1RPQA 3SDAC 2EIBA 4OQ1A 1DLFH 3UJIL 3MO1A 4JFPA 2O5XL 1LDPH 3PP4H 2ZZUT 5GIRA 5I19L 2DDQH 5DZOA 3ZYOA 1ZSDA 1I8MA 5F9WB 3ARGC 5JLZA 4NIKB 1BZ7A 4LAQH 4G8IA 3DMMB 1N64H 3TIEA 2BHZA 1ZS8A 1G9NL 3QRFM 1URLA 4IBLT 3WEXB 2A74A 4S11A 1BOYA 1LO5A 1MJ8L 1ZT7A 1NC4A 2BNQE 4NQCB 1FFRA 4QNPF 3UO1H 3FQXB 1SBSH 1WITA 4I18A 1WFNA 3ECBB 3H9YA 4X0KB 2XI9A 4NP4L 3O0RH 4K23H 4Z7QF 2CH8A 3PQYD 4JCLA 3SBWC 1EEQA 4WFGE 1HHGB 3V6ZB 3VGDA 3QZWG 2O5XH 1EVUA 3HNSL 5I19H 1LE9A 4UOW1 3IKCB 3DV4A 5C0DB 2LQRA 3BI9X 5E03A 4LCYA 3WO4C 5D7LA 2X4UB 4RA3A 3RX8A 1HHKA 1A7NL 1DTUA 1BD2A 3BKML 3BN3B 4JY5H 4YPGA 3VD5A 2VQ1A 1LP9A 4PJCE 5FDWB 1G9NH 4U49A 4X6FB 2A6DA 4EQ2A 1G84A 5E5RB 1CGSL 43CAB 5D71L 1FG2A 4HBCL 2A2QT 1VA9A 3NIFE 5DURD 4K7FA 1ZHLB 4LEXH 1MIEL 1P2CB 2HTKD 1Q9KB 2HJLB 3UXFA 3L9RA 2ESVA 3RTQC 1ZLWK 4QF1B 4NP4H 2FNBA 3RUGF 5I1KL 1K6QL 1RUPL 4TSCH 4MCYA 1G0XA 1JPFA 3HNSH 1MCWM 3BZDA 4QRPB 4H26A 4LVHB 2EXYC 1G6RL 2YPLA 4WV1A 2V5MA 1YPZE 3NCJL 4MXWL 3MRDB 4N9GB 4ZUTB 1A7NH 3BKMH 4WRLA 3L7EA 1U36A 4U6XB 3DX7A 3PDOA 5DJDA 2AJYL 3S97C 5A2FA 3CH8A 1M6OA 1CGSH 4H20L 1TZIA 5CHNB 3G9VA 1IAKB 2Q8BL 3HE7D 4ERSL 2E6JA 4J4PC 1OW0A 4OUUA 3TWCL 4UNTA 1MIEH 3O3EB 3NACL 1G7QA 3IXTB 3OF6A 4LLAA 5I8OH 3DIFA 3MR9B 5CJXA 4JPWL 3O8XB 1PFCA 4YBHA 5I1KH 1K6QH 1RUPH 2OJEA 2VLKB 4PP2B 4XNQA 3W5NA 5E8EA 2YEZA 3C5SA 4DCQA 4HT1L 3EYFB 3L6FB 1G6RH 3NCJH 3EBAA 4MXWH 4OD2A 4PRAA 3W5MA 2A83A 1LMKA 5E00B 2AJYH 1T1WB 4OGAD 2OTPA 2H32H 1Y6KR 4QRUB 5J11B 4YBLB 2Q8BH 4ERSH 3JUZA 2AI0L 2JLLA 1FV1B 3TWCH 2XQYK 1PX4A 3NACH 4HIJB 1GPOL 2MQ0A 2C9AA 2X4NB 5ICYA 3LKNB 2NY4C 3VXQB 4JPWH 3ZKSD 2D0GA 3G9AB 4XVSL 1ZA6B 2WIIA 1MCCA 3KNBB 1VKXA 4Y4KB 4HT1H 5BO1L 3U7AA 43C9A 1A7BA 4P5MB 4IRJA 1ZHBA 2DKMA 5JHDB 3ROLB 3D85A 1YUHB 4P2RD 1JCKA 2KDGA 1L7IH 5CP7B 5FYJL 1JWUB 5C07A 1ORQB 3ARUA 1BFOA 4HKXA 2ICWI 4LPUA 4APQB 1NSNL 4N90D 2Z8RA 2AI0H 2N56A 2C7UA 1TVBB 4YLQT 1XGTA 3BT2L 4V2CB 3ES6A 1GPOH 4PGCB 5C08A 5K9JL 3V5DA 3SCMB 1U9KA 2R69L 1SM3L 2YN3A 4I8DA 5FXCH 3LMJL 2C26A 4XVSH 2WBJB 3GIZL 2C3WA 3DI3B 1KTRL 3HZVA 4NUJA 4RQQA 2BVOA 5IVZB 5BO1H 1MCKA 1EBPA 5E70A 3MROA 2ARJB 4NZDA 4OT1H 5DJYA 1ZOXA 1OTUC 4Q9BA 2QJDA 2XWJA 5A43C 3MFFB 4MA7L 3MV11 1IGJB 3QHZL 5C0IB 1FH5L 5D2LB 1KYOK 4GSDL 2E6PA 1TTUA 1MPAL 2M8XA 1U8OB 3VE0A 4NRZA 3CZFB 4JAMA 3HI6L 3U9UB 1FYTE 2OK0L 4MJ5B 1GGUA 4X4MA 4RDQF 2ZP0T 2HG5A 5K9JH 3MRMA 5C92A 3QO1B 4S0SD 3PQYA 32C2A 2R69H 1SM3H 4M1GH 4NQXA 2FATL 3LMJH 4LDEB 3GIZH 5DJ0A 3UTSE 3MRGA 5ICZA 2DTMH 5E8PB 2P7TB 4BM7A 2FL5A 3MV9D 1F4WH 4JZJC 3N1FC 3ULUL 1R3HA 3EYUL 3FRPG 3LD8C 4MA7H 5DJ6A 3RWFB 4U7MA 3QHZH 1RZJC 3OKLA 1DJSA 1FH5H 2B5IC 5EO0B 4GSDH 1MPAH 3AVEA 4OZFH 4R0LB 5IEHA 2BVTA 3FN0L 5JXEC 1HHHB 4N0UE 3N1PC 1NGWA 3HI6H 1HXMB 3N0PB 5F7DA 2OK0H 3RWJB 3MRCA 1KJVA 2FO4B 1YN6B 1F45A 1NH6A 4KTEH 5BZDB 1QFWL 5ISZB 2QQNL 5GS0D 5DRNB 4PJ5D 4YPJA 3ULUH 3EYUH 3FB8B 5T5NF 3CH1A 4F8QA 1BECA 4JR9L 3QFJD 4XI5D 3HE7A 2PW1B 3QEUB 1AR1C 3LKSB 1LEGA 3VWJC 2X70B 3OHXB 1OWWA 1H3GA 4HAFA 1HYRC 4X4XB 3MRHA 1CBVL 4YHLL 3CXHJ 3DBXB 2ZPKL 3MV7B 5IWLC 2P8PB 5DI8B 1QFWH 3U46A 4QRRD 2ZUVA 5ESAB 1NGQL 2QQNH 4ZYKB 1AGFB 3RWDA 2DD8L 4F9PA 4MNQB 4U6YA 1A4JB 4PY7A 4FTVB 2CJUL 4LPCA 5JR1L 1SMOA 3VFVA 2EC9T 2KBGA 4L8CA 2Y7QA 5CD5D 3B9DA 4WWKD 5EWIL 1CGYA 4G8GB 4QGYA 5FB8A 1HH6B 2AJ3B 4HC1L 2SEBB 5E8NB 2IBBA 2HFGL 3LSOA 2EDOA 2F54E 3NAAL 5HHOD 3PWPB 3IU3A 3WDHA 1JBJA 1P9MC 4OI7A 3BD3A 2ADJA 5FHBL 4HUUB 2HT3D 4WY7L 3G08A 3MRBB 4YHLH 2ZPKH 1RZKC 1MHCA 4XX1G 3BZFB 4Z6AT 3GMPB 4V1DB 1C16A 3DHJA 1N6QL 4QHMB 3SGJC 5GGUA 1OGAB 4N0FB 5ACZA 3A6OA 2DD8H 4TSBL 1QFUH 2W59A 1QFOA 4L8SC 1BFSA 2BMKB 4H88L 4G9FB 1VFMA 5IROA 4HIHB 2CJUH 5CSZA 5JR1H 4IRSD 3O6ML 4PJIE 1N8ZB 2CIKA 2D7NA 4P4RA 2IADB 5EWIH 3ULVD 4XCNB 1WGOA 4HC1H 2E7CA 2N7BA 5I16B 2MKWA 3NAAH 1AD9B 2AJZB 1UWXH 3FB5B 5FHBH 3CDYA 3MFGB 5AD0B 3H9HA 4WY7H 5GJTL 2OTUB 1I1AD 2P5EB 4PRPD 2Q87A 1CD1B 1HIML 3NH7L 4ZNEA 2HTLC 5CILL 3MREA 1T83C 1TJGH 2PYED 1OTTC 2FWOB 1N6QH 3ZDXE 3SGDI 4M5YL 3MV8E 1S5IH 5F7HA 1DQML 3GSVA 2ZNWA 1MUJB 1I7ZA 1RUAL 3PWVA 4QHKI 4TSBH 1FSKB 5L9DL 3AB0C 1BQHA 3BGAA 5T3ZL 2EIZB 1VPOL 1KOAA 2GYSA 5LGKA 3ARPA 3CVIL 4JFDE 1Q38A 5C0BB 1TXKA 2EDJA 2RFXA 4HPOH 4EIZC 3PABA 4GW5B 3ESVF 3LOWA 2VZ1A 3SDXB 1O0VA 3MRJA 1FC2D 5GJTH 2GITB 4DN4L 1M7IB 2VLRD 1FO0A 1HIMH 3NH7H 5KSAD 3DETC 4LBEB 3RWIB 5DRZA 15C8H 1IEAA 5CILH 3NFPB 1LO4L 5F7FA 4P0DA 3NN8A 4M5YH 2JCCF 2H1PL 3OJDA 1DQMH 3LY6A 1RUAH 3D2UD 2EDDA 5L9DH 4WVRA 1NBQA 3HLAB 3BGFB 2CLRB 5T3ZH 1VPOH 3EGSA 5ALCL 4NBXB 3CVIH 4FQCL 1X5JA 3RA7L 1I8KA 1JWMA 1MHEA 1RHHB 4F7TB 1ZXQA 1U3HB 2RQ8A 1YY8B 3TCLB 3P77A 4AM0B 4D0BB 4NBYB 4DN4H 1JZ4A 4DVBA 4L8DA 5BZWA 3GSRB 1HI6A 2PW2A 3VFNA 1K8DB 4WNQA 3SKNB 4KKBC 3WIIH 4PJBA 2QSCL 5JIHA 4RMQA 1KJ3L 2H1PH 4PJ5A 3VFTB 3RTQD 1T22B 4EEEA 3LKOA 2BSTB 3N1GC 2OR7A 4YX2H 1RJYA 5ALCH 2DI9A 4PJGA 4QTHA 3DLQR 4FS0A 3IDMA 3IYLW 3QFJA 1G7IB 2JK5B 2ZG3A 4HUVA 2X2YA 2GHWB 1KIQA 4RWHA 5JHLL 4EDWL 1T6VN 5F9AC 3V4VL 4FFVD 4HGKC 1AGBB 5HYJE 3VFSB 3B83A 3VFPB 1JK8B 4ZQKA 1QNZL 5TDOB 5L2JA 4PGZA 4OD3L 2MQ3A 4HMEA 3SQOL 4A6YA 4QRRA 1U91B 2QSCH 1GAFL 1KJ3H 1JWSB 1NDMA 1WIPA 3PL6C 3C8KA 2VWEC 4NC0B 2G9HB 2YOCA 4WWKA 2CDGA 4LHJB 3VFWB 2XXCB 1IM9D 3BAEL 3T08A 3HZKB 1BQHG 1Y0LB 5HHOA 3B2UC 2A9NL 2CKBB 4B41A 1FL6A 2Z31C 5JHLH 3SKOB 4EDWH 2VLJB 3C6LD 4JO3L 1LEKA 4AEIL 2GJ6B 1TMCB 5IQ9B 1E27B 1NFDF 1QNZH 5F1NA 1TZGL 1XF3A 4OD3H 4H1LB 5I9QC 3SQOH 3X13B 2FX8L 4GAJH 1ZHNA 1S78C 1A6PA 4TOYL 1QFWM 2XFXA 4PRID 1F02I 4IRSA 1S5HA 3SGDH 3KJ6H 3QNXA 3WIFA 4M7LL 4WU5B 2IQAB 3BAEH 4J12A 3QDHA 1GL4B 5EA0H 2E7LC 3RY6C 3WE6B 4GS7B 4X8JA 3BMVA 2IQ9L 3TPUA 1I1AA 5I1AB 4PRPA 3QCUL 1JZ7A 1N59B 4JO3H 3C2AH 4AEIH 5DRXB 5D7LE 4EUPA 3BKCL 3QQ4A 3FRUB 1YEFL 4GRLC 3LKPA 4K9EC 1QA9B 2NTSP 1TZGH 1ZVSB 4K71B 3HHRB 4WO4C 1LP9E 3HNTH 4JKKA 5INCB 4BUGA 3QEGL 3D3VB 4TOYH 3SDAA 3TZVD 2GTZB 3BZEB 2VB5A 1XGUB 3C60D 5D1QD 2CUIA 4JANA 1X4YA 4PLNC 4M7LH 5C0CD 4ZPVB 4XP9L 1KUMA 1RSFA 4K3DL 2OSLB 2W0LA 1V7NL 3GMNB 5TH2B 1PKQB 1XR8B 4PGBB 5F1SA 2IQ9H 3BXNA 3MBXL 4ZMAT 4JQXC 3QCUH 2VLRA 2W0FB 4WUUE 3LRHA 1NBZB 4PJGF 3BKCH 4WTWA 5KSAA 1YEFH 3OXRA 2O61A 4URTB 3GM0A 2AS5M 4OZGA 1ND0A 3DVNB 4L4TD 2OMNA 3GMLB 1S8DB 1IZKA 1FCGA 3D2UA 3OAYK 4KRPB 3GKWL 4XP5L 3RJQB 4K94C 3ROOA 3DOSA 4LVNB 3O3UN 3D6GA 4Z9KB 3UX9B 4PJXA 2QKIA 4OCMC 3GKZA 4YZFE 3U83A 3SO5A 4Z78A 4XP9H 1XGQA 4JY6A 4JPIB 2VUOA 3JTSA 3OB8A 4K3DH 1HYSD 3WLBA 4HX1A 3ZE0F 5B3JE 3HPLB 1V7NH 2HJFB 3L3OB 4GKZA 4EN3C 3BW9B 1DSFL 3MBXH 2X7LA 3NZ8B 2R2HB 4Z95H 1RJZB 4OM1L 3TNNA 5F7NC 1OP5H 3RWCB 4NQVA 5BV7B 4CVXB 1WIOA 2VQUA 5GRVK 3W0WE 3ZTNH 4GKSA 4Z7WE 2ZOKA 1TLKA 3WUWB 3RTQA 3ZDYE 4LVEA 3GKWH 2MQCA 4XWOC 4XP5H 1LD9A 1V3LA 4OSUH 2YC1A 1AGEA 4HJJL 4YJZL 3TO2B 2X40A 3R1GL 5C3LD 3VI3E 5DT1L 2GY7B 3HR5A 4OLEA 4O5LL 4XBGA 1X5KA 2IJ0C 3DROA 4XPHL 3PIQB 4M5ZL 4ZXBB 4CMHC 1OT1A 2GK2A 2WQRA 1AD0B 5FGCE 5GRUH 3RVVD 2QQKL 2D03L 1DSFH 1RZ7L 4JFZL 1HQ4A 4OM1H 2H2SD 4KKLD 3PWNA 5EU3A 1EGJA 3FQRB 3K0WA 1KACB 1S9VB 1FVEB 4LPXA 5E1AA 1Q9LB 3KPQA 3QEHB 5C07E 4EUPG 4QXWA 3TV3L 4W4OC 5BMFL 1Q72H 3CU1A 5I15L 2QADC 4HJJH 2NX5B 3PGDA 4Y2OA 1WWAX 3R1GH 4DFIA 5KN5A 2AV1B 5EPMA 3MZGB 1A3LL 3GMOA 5DT1H 1IM9A 2MFNA 1J05A 1AQDA 2X89D 4O5LH 4TVSa 5C08E 4N9OB 2Y6SD 4M5ZH 3WJLA 3KPSE 3IGAB 1OOAA 2QQKH 4PV9B 5I1CL 2D03H 1WV7T 3M8OL 1QFHA 1RZ7H 3C6LA 4JFZH 4JRWA 1ZLSL 4GMTL 4UAOB 3T65A 3D0VA 3LH2H 3QG7L 2NY6D 1WBXB 4Z0BL 1ITCA 3PHSA 4PJHA 2JJTC 3BP7B 3QIWB 3VCLB 5DC9B 1INEL 2EO1A 1QEWB 3Q5OA 3EOTL 3TV3H 2OXHA 1A1MB 4PRIA 5BMFH 2ZCLH 5HVGB 3BP4B 2J8UA 2X10A 1DL7L 4D0DA 4X4ME 1A3LH 3AGVA 4XX1E 1E4KC 4IOIB 1YEKH 5IVXA 5HHQB 3PQYE 1CGVA 4ZUWB 5A16A 2I24N 3HB3D 3RRQA 1S7SA 1RK1B 5I1CH 3OKEB 3KXFB 3M8OH 4UINL 4KFZC 1ZLSH 4GMTH 5DHVA 5KG9A 3QG7H 1YJDC 3V5HA 4CVZA 2APVA 3QFDB 4Z0BH 2MMXA 2C3VA 4JPKL 2AXHA 1JF1A 3T8XB 5IB2A 3FOMB 4TUJA 4BKLB 1INEH 1HXYA 3C08L 3EOTH 3KPTA 3TZVA 4QGTA 1T2QL 3NIDF 4OZ4A 5GQBA 1ZGLM 3KYMA 3C60A 4OLVL 5D1QA 2VZOA 1DL7H 5HJ3A 1UH2A 2CDEA 5C0CA 1JHTA 4FXLA 1GZPA 2PO6D 3B43A 2IPTL 3C87A 3BISA 3A6CH 5T5FH 3BOVA 4ODXA 5JIIA 4YQXL 5I8CA 4POZD 4FFWC 3CUPA 3LRSB 3OQ3B 3LN9A 2B0SL 2XZZA 4XBEL 5IOPB 4PD4K 4JO2L 4L4TA 4JPKH 5MEQA 1H5BC 1NGYA 2HN7B 4HIXH 4EXPX 3P9MA 3C08H 4NWTL 1T2QH 1JPGB 1YEGL 1VDGA 3OKNB 4OLVH 1A6TA 4BSVA 2IPKB 4M7KL 4NCC1 3O4OC 1T0MA 3HA0A 3MJ8B 5CINL 3NGBB 2IPTH 1INQB 4EI6A 3P4OA 4ZFGL 3BEWB 3HAEA 1UEYA 1EXUA 3D69B 3L3DB 1HZHH 4YQXH 1WCQA 4Q58C 3SDDD 2FLRT 2X4SA 5H35B 2B0SH 2GFBB 2W9EL 1WZMA 4XBEH 1ED3B 1IC4H 3HE6D 1R24A 3F62A 1PAMA 2K7QA 4MD4B 5J0BA 3GSOB 4HMCA 3BP5A 1YMMB 1MVFA 5FO9A 1FAKT 1JNNL 4NWTH 2FYYA 1AQKL 2GTWB 2VL5A 4HJGB 1YEGH 1U8JA 1CZ8L 4C58B 1GSMA 5I1JL 3CFJA 4M7KH 3SE3C 3TBSA 3UTZA 4LLMA 5CINH 1XCQA 3JV0A 2Z0BA 4PJHF 2AK4D 2H3NA 2YKLL 1A5FH 1WUNT 4MB5A 1S7VB 3MV01 5D93C 2IEPA 3QIBD 4M6ML 4ZFGH 2APBA 4C56D 4L8BB 2J8UF 3S3PA 2AXGB 3IAPA 3PGFL 2W9LA 4CMMA 5FV1L 4TVPL 5IVXF 3TA3C 1ZA3B 2BSRA 3I6LD 3WNPA 2QHRL 2VH5L 4XC1L 2P1YA 3QDGB 1S9WB 4DVRH 1R3LB 4TNWK 1CZ8H 4K8RD 2X89A 3OJMB 3JBG7 5I1JH 1U8IA 2BX5A 2AV7A 1ES0A 2AJXL 4JVUA 4JFHD 2YKLH 4OBSA 1WIUA 1WICA 4PY8I 1E4JA 4KU1A 3V8OA 4M6MH 4NYLA 3UTQA 5FOBA 5DO2D 5D9SA 1T1ZA 3QNYA 5TQ2L 1B6DA 4MNGB 3FFDB 3PGFH 3VRIB 2H9GA 4PTTA 4NHCL 5SWSD 5SX4H 4TVPH 1SJHA 1RHFA 4KVNL 2QHRH 4PJFA 2VH5H 4X9IA 1W0VB 2VLLB 4XC1H 3CK0L 1IC5L 2JJVA 4Y4FC 2DMCA 4UQ3A 1WEJL 3FJTA 3IJHB 1PLGH 5MP6L 2J6EL 1F3DH 1KSRA 4X6DF 5D70L 2DBJA 3VG0L 3DWTA 1UJ3B 3VMOA 1CL7I 5DUML 5I8KL 2AJXH 1S78D 4XWGL 5DMIL 3SE9L 3MLTB 4HJ0C 5DXWA 3M45A 4PRHD 3KPPB 3ZE1E 1CDIA 3KS0H 3IFNL 5JQHC 4IMKA 3Q6FB 5FO8B 1MHHA 4CGTA 3X12A 1JZ5A 2FSEA 5DS8B 2PXYD 5TQ2H 1U3JA 1AHWC 2XA8L 3U6RB 1Y18B 4N8VB 4NHCH 3VGFA 4Y1AD 3BO8A 2D7TH 2NZ9C 3DURA 1IRAY 5DJ2B 3CK0H 3MXWH 1IC5H 3VXTA 2WK2A 4NQSA 3MRFB 1WEJH 5MP6H 5IFAL 1T83A 2YUWA 2J6EH 1KB9K 2F8OA 3QNZA 4OF6A 3QA3B 1H15A 1GIGL 2PO6A 5D70H 1GH7A 5GXBB 5I71B 3RVTC 1CDYA 3VG0H 5DUMH 5I8KH 4M1CD 1VFBB 3SE9H 2P45B 2VN4A 4GG8A 2YD5A 1P4BL 4K3GA 4KJPC 4U3CA 4C57C 3O3AA 4DQOH 2D7MA 4PJBE 3IFNH 3BPNC 4F3FA 5IBLC 1PEZA 1JMZA 3B8SA 4PJ5E 5HDLA 4U6VL 4FQXD 2XA8H 3MOAL 1OTSD 1A1NB 3DVGB 2FH6A 5CZXC 5TDPB 4CJ1A 3H2WA 5HGHA 3QFJE 2DLHA 4GAYB 5ESQB 4ZS7L 1BBJA 4NT6B 2R9HC 3OKOB 5BOZG 5DJCA 1RK0A 5C6PB 1X5GA 5F3BB 5F1OB 1AP2A 3REWB 1MLBA 1GIGH 5DQ9A 4WGVB 1MVUB 4HWZA 4XGZA 2YXMA 3BH8A 4PLKC 2NXZC 4XH2B 5KZCD 3VDBA 1T4KA 5DEGA 3SDDA 1Z2KA 3RGVD 3MODL 3HE6A 3EFFB 4U6VH 1I7RB 3L3JA 5EFIB 4CVWA 2I25N 3MOAH 4NCDA 3LPWA 1UZ8B 1SEQL 3FQUA 4HKBA 3UTTD 3WIHH 5CJ5A 3MRRB 5DJXA 2I07B 2ZJSL 5C0AD 4RMRA 4ZS7H 5HHOE 4HUWB 1AGDB 5EUOB 3MJ7A 3HG1E 4WI3A 2X05A 3BIKA 3UJTL 1WBYA 2NTFA 4XCFL 3PWJB 2AK4A 1BJ8A 2ITCB 1RFDL 4PRDB 2BC4A 1CICD 1J0IA 4KK9C 3QIBA 4PJFF 4JRYD 1XZ0B 3U2SB 5F96L 1FNEB 4C56A 4HK3N 3WHXA 3FTGA 3L7FB 1VGEL 1I8LC 2NXYD 5KTEL 1P4IL 3MODH 3UBXG 3WBDA 3GEWB 5HGDA 4Y5VC 3S37X 3VWKB 5I17A 3ULVE 1W2KT 2ZJSH 5FA4A 4E5XB 4BSWA 2D31A 1I4FA 2C1PB 4KH2A 4YHZL 1LO0L 2E9IA 1AKJB 1JHLH 5DR5H 4U1NB 3GI8L 1IKFL 1XGRA 4DN3H 5EU5A 2BNRE 2YA2A 3UJTH 3RX5A 5HPMA 4PRPE 4XCFH 1UFUA 1RFDH 2YA1A 5I76A 5IMLA 3C09C 4TULH 3QJHB 1UB5A 4LCWB 1ZKAA 4FXKB 5F96H 2ZCKL 4MA1B 1CL7H 4XVTL 3EOBA 1VGEH 5E2UL 3SKMA 2XN9A 1FVDA 5KTEH 4U4BA 1P4IH 3QRGL 3BQUB 5E2WH 3EO0A 3FO9A 5SWSA 4F7PB 5FK9A 4R2GB 3VXUA 3WD5L 1ETZA 4QY8A 4ZPTA 5DLML 4LSPL 2VDKL 3RVUC 1MREH 4YHZH 1LO0H 1DEEB 4I0CC 3GI8H 5E24E 3QUYB 2XKUA 4OFDA 2V5RA 2WUCL 3SGKA 1JF6A 4DOHE 5DRWB 3DV6A 3G5XA 4FXGA 4YAQA 4Z76B 4HFWB 1MHPL 4PRHA 2ZOLA 2YD9A 4OZGE 2E7HA 4X7TA 1P53A 1PDKA 7CGTA 2ZCKH 1HK6A 3ZKXC 1TCRA 2PXYA 2VC2L 5E2UH 3I6KA 4ZFFB 1J9CT 3QRGH 3KDMA 3IVKB 4N0RA 4AIZB 2E7LA 5DTFB 3JTTB 5JDJA 2P5WD 4GW1B 4YNYA 1TENA 4PJXE 4Y1AA 3WD5H 1ERNA 4BUHA 4ELMB 3DUUB 4JGJA 4X98A 5DLMH 4M4PA 4LSPH 3L3KA 2VDKH 4JFYB 4NC2B 2GT9B 2F58L 1F4AA 5IR1B 1R5IA 5I8EB 2DOCA 3D18B 4UILH 5FYJD 5J6HB 5GHWL 4KMTH 2EZ0D 2WUCH 3KYOA 1KELH 5AEAA 3VXNA 1KN2L 1EX0A 4U1LA 3B5HA 4P46B 1MHPH 5I1DA 5JO5B 4FQHB 4I3SL 1LDSA 2BSSA 4NRYB 5I2IA 1FJ1B 1QBLL 5DQDH 4P23C 4QXTB 1DLHB 4F15C 2VC2H 4TNVK 5DQJA 3RI5K 4L3ED 5KSBA 4FQXA 4JO4L 4WW2C 1NCWH 3NFSL 5D7JB 3LQAH 4I2XA 4MJIB 4GFTB 5C7XL 3BN9C 4M6NL 5DVOA 2FIKB 2F58H 5F8RC 1GOHA 3IDGA 2OR8A 3AU1B 2KH2B 4HKZB 4UIMA 2DS4A 4RGNB 1RY7B 2C4FT 5GHWH 1JGDB 4FQQA 3CXDL 5CEYB 1UM5H 4R4FL 5MEOB 1K4CA 1KTLB 3L3IB 4I0PD 4MXVF 1Z3GL 2Z4QB 4IDJL 4PJ7A 1NCBL 1QBLH 2A6IB 2VXSL 5GGVL 3KYAA 3RGVA 3CDGA 1U92A 5L7XL 3VFGL 2F15A 1LK2A 3BD4A 5CWSB 3CFBA 3HZYA 3TESA 4LSUL 1UZ6E 4RNRA 3UTTA 4R90L 3MNVA 1YQVL 3IDJA 3W9EA 4IIQA 4JM2B 1PW3A 5C0AA 5C7XH 5F97E 3DRTB 3K1DA 1RQ5A 3GNML 1N3NA 4M6NH 3GSWA 3TN0D 3ULUD 3FB7A 3C6SB 2NYYC 1FBIL 3LQZB 5FKPA 3RJDA 1KPUA 1Z6JT 1ZAGA 3WNLA 3QSKB 3CXDH 4NO2B 4O51A 2IH1B 4R4FH 4LLWB 4OIAA 5D6DC 1CICA 3PWLB 4M7ZC 2UWEF 4JRYA 2EYTB 1TVHB 3TJEL 5EOQL 1ZHKB 4IDJH 4HKJB 1QSZA 2VXSH 4LASL 5GGVH 2OI9C 2CKBL 4U3XA 4E42B 2XKNB 5L7XH 4HUXB 3VFGH 1Q94B 2F53D 4LSUH 4Y2DC 2XWBA 5EBMA 4R90H 4JY4A 1YQVH 4O2CB 1G6RA 3VXPA 4PJCB 1DVFD 5DVMA 1G7PA 3GMRA 3ZKMC 4R26H 1FBIH 4M03A 4Y5XC 2HP4A 3OX8A 1F4YL 2H32A 3WKML 5HGGS 1J0ZA 4ODVH 3Q48A 3TJEH 5EOQH 2EEAA 4HHAA 1E4WL 5FF6A 1XGYL 4HWBA 3V5KB 4MJ4A 1G0DA 4LASH 1QTYT 3HC0A 3F7VA 2CKBH 1EK3A 4GRWE 1YDPA 4JFED 3MLUH 4NQDB 1NL0L 1YMHB 4ORGA 2FO1A 3VFUA 4R4BA 5C0CE 3EOAA 3N06B 3V6BR 4X5WB 4KDVA 5AUMA 5JMRA 2I60L 4H1LH 4U7SA 4C55A 4X99B 1RIUL 3UPRB 5KSBF 1F4YH 3WKMH 4KK6D 3G6JB 1S7TA 1BPVA 5IBUG 2VSDA 4CKVX 4N1EA 4NN5B 2R1XA 2X1XR 4LOUD 4MZ3A 1E4WH 2AK1L 1XGYH 2RBLA 5J1AA 3INUL 3WO4B 3HUJB 2BP3A 3TH4T 2P5WA 3QQ3A 5K33A 1NL0H 3RDTB 1B0RB 5BVJB 3GHBL 1O7VA 4ZUUB 3DMMC 4OZHF 4PJ7F 2ZKHL 2I60H 2Y5TB 5IQ7L 4MS8C 4LNRA 3I75A 4HAGA 4U1KB 3FOLB 4LMQE 9CGTA 3BGMA 3QXDA 4Y7MA 4W6YB 5GPRA 5MENB 5E6YA 5F72S 1MQKL 4X83A 5DVLA 2HFEB 2UUDH 4H0GA 4L3EA 4RA0C 4Z8FL 3STLB 3RVTD 3INUH 1N2RA 3HI1A 5FECB 5L2KD 1BGXL 4JREB 2P44B 2WINA 3GHBH 1OGTA 1CF8L 1ONQA 1PG7X 1RV6X 4K7PY 4MXQC 4U1MA 4OLWL 1ORSB 5T3ZD 2ZKHH 4NZRL 1KIRA 4AENA 1I7TA 2DIJA 4YIQB 2Z35B 2DYPB 3DXAB 5IQ7H 3RZCC 4Y5YB 5B22A 4OZFA 3DARA 4NFBA 4QCIB 5CZXD 1ADQH 2Z8VC 4I0PA 2X6MA 3BWUC 3OAUH 4ZSOA 3ARBD 5DHYA 1MCOH 2QR0B 2YRZA 1MQKH 1QLRB 1IILE 2LFGA 3U0PB 4JO1L 4Z8FH 3EO1A 2ICES 1GYAA 5CUSL 1BIIA 4OI9A 4F7EA 1BGXH 4LVHC 3RWGA 2A73B 3CFCH 1IKNC 2NW3A 2YPVL 4CN4A 2NXZD 2FB4L 4PYGA 3RVWD 5TPWL 4OF3A 5GSRB 1CF8H 4Q2ZA 1HSBB 3SPVA 3TN0A 2APFA 3H0TB 4OLWH 5KS9B 5LQBL 1SEBA 4NZRH 3REVA 3AXLA 3BIAX 4WJ5A 1LQSR 4P5KB 4R7DA 1XR9B 3OMZA 1K8IA 5DZLA 1FZOA 4RBPH 3QEQB 4PG9A 4Z0XA 5E8OB 2DM3A 3WN5C 4YHNB 2RAMA 3AC0A 3O8XC 4ZOCA 5KVEL 2F53A 4LEOA 5CUSH 5BS0D 1M05B 2IG2L 3WFHA 3OGCA 1A6VH 5HHMD 2YPVH 1JGLL 3FO1A 5E6IC 5L8JB 1DVFA 2FB4H 3ARQA 5TPWH 3LN5B 3QHFH 6FABL 3NCCB 4LHQB 3KPRB 3WLWC 3QG6A 5LQBH 1KTKE 1RURL 2FGZA 2NY7L 3E2HB 4MJ6B 3BZ4B 4LHUB 3V0VB 4DW2L 5J11C 3K4ZA 4YBLC 4PJAA 3O11A 1F6AB 2CR3A 3T2PA 5JPNB 4JLRA 4HWNA 5HHNA 3B4NA 4ENEC 2EDHA 4L3CA 4BQBA 1T66C 2EDLA 1OARL 3W11D 5T1KB 1VADB 5E4IA 5KVEH 4JFEA 4Y4KC 3SDCC 2X09A 2BVPA 1A6UL 2EYRA 2IG2H 3UROR 3FN9A 1GCFA 1HCVA 1XH3B 1JGLH 4RGOH 4DK6A 1JL8A 4V2BA 4TTDC 4NRXA 1RZ8A 4ELKA 3PV7A 3WL9B 1RURH 5EULV 5GSVB 3LAFA 1A9EB 4GBXB 4DW2H 4HC1A 3M1BA 1JNLL 4G43A 5B8CC 4QHUA 2GCYA 3VH8A 1FNGB 5F88A 4KGLA 2DQCH 1PQZB 4LCCB 4PV8A 3TBTB 1OARH 4NC1C 2WBJC 3IDIB 5D1ZD 1IAOA 2LAGB 5H94A 1MCEA 1A6UH 4JQVA 4LLUA 1QRNB 1EAPA 4LIQL 5EIIA 1A9BB 4Y16D 5C9JA 2NY3D 1WC7A 3DRQB 2W1NA 4TUOA 1NFIB 3U48A 5IMMB 4N8CL 2CIIB 5F7UA 1DQTA 3VXMB 4HS8L 4XP4H 5IHUL 1JNLH 3VU2A 5EG6C 2E9BA 1FQ9C 5IV2A 3QBTB 2P49B 4OZIA 1NEZA 2HLFC 4M00A 2PCPB 4JDZA 2AJVL 2UV3A 5L2KA 5T1MB 3Q3GB 3PP3K 4Q9QH 2P42B 3O9WD 4LIQH 2QTEA 3MLSL 2OP4H 4BFIB 2R2EB 4DZ8B 1F5WA 3QQ9D 4G42A 1IM3B 4X5XB 2WZPD 4P23D 1DDHB 3CMGA 5JA9A 5BQ7B 3I3EA 4N8CH 4F9LA 4I0KA 4R0LC 2J4WL 4HS8H 2DKUA 1A6ZB 1FFPB 3O2VL 1CI5A 5IHUH 1CQKA 4Z7VA 4PJ9B 2J5LB 2DF3A 3ARBA 1GC1L 5D5ME 4IS6B 2D2OA 1WK0A 1CFQB 1CG9B 2Y23A 2AJVH 3OV6A 4HH9A 4N0YL 4GG6A 1QD0A 4LCUA 4HS3B 4XB7A 1ZEAH 3AFLA 1G7LA 3DI2B 4MCZB 4OAWB 1HILA 3MLSH 2WP3T 3QIUB 2FJGA 5HBBA 4NNXB 1CE6B 4X6CA 5BXFA 5ID0B 2EYSB 4QOKB 1JGVL 4D9LL 5DUBA 4U2ZA 5JW3L 2J4WH 4TTGA 2VWEE 3NVQA 3O2VH 1QOKA 2FZ3B 5LAXB 1MI5E 4UMGA 1JV5B 4PREB 2XN9E 3MOBL 4JFQA 1UVQA 2DM2A 1BX2B 1GC1H 4HIIA 5KJRL 2VSCA 3VXUE 4HLZH 2Z91B 1I9RL 5CEXB 1FGVL 1AIFA 5BS0A 4N0YH 3QJFB 3VH8G 4L8SB 5JOEA 3F12B 2ZWLT 3RY4A 2HFFB 5CZKA 5DGRA 4WFFE 3QZWB 2R1WB 5IVOA 2VZVA 3H9SD 3QDAA 3F7YB 2BNUA 3S5LA 4CDGC 1JGVH 4D9LH 1T3FA 2NLJB 3BWAB 1GGTA 3T3PE 5JW3H 1OAXL 3CNKA 4PRHE 3AM8C 1O5DT 2I9LA 1A6AB 2YSSA 3CFDA 3QUZD 4IOFC 2KL6A 2BJML 1Z5LB 4ODWB 2O5ZL 3MOBH 5GRZA 5C9KA 5IW1A 1GZQB 5KJRH 3QXWA 4MQXC 5DJ8B 1R3JA 4Y1AE 3RUGB 5E6ZA 1I9RH 1XCTA 3CFEA 1F2QA 4CRPA 1FGVH 1DBBL 3WYRA 5H2BB 3RBGA 3AB0B 1G7MA 1BREA 1ZGLA 4RMWA 1V3KA 4PYHA 3B2VL 3FL7A 5DDHB 1QBMH 1JGUL 1UCBL 3FFCD 1CD9B 1P6FA 2W9DL 4LF3B 4H0IA 4P2CG 2V2TB 4OZIF 4LSVL 4KZDL 1NKOA 4RMTA 1OAXH 3KYNA 5H37H 4NQEE 3BDYL 1CLZL 2BJMH 2ICEA 4ODTL 2O5ZH 2ZCHL 3T3ME 3VXRD 5C0ND 3VFOA 1RJLB 1ROWA 4OFPA 4DUXA 2Q6WA 5D1ZA 2Z92B 4XBPA 1DBBH 4H25B 1EFXD 4BH7A 4CVUA 3D9AH 4RWYH 1EHLH 3B2VH 4Z7VF 4UNUA 1U8HA 5GRVL 1JGUH 1FSKC 1UCBH 4Y16A 3V6OA 2W9DH 1SJEB 4JHWL 3OAYH 4ZODA 3EYSH 2MHAB 3OKDA 4LSVH 1NUDA 3KHQA 3MO1B 3U82B 4JFPB 1AGCA 4LPWA 1U6AL 4GG6F 3MQIA 3BDYH 1CLZH 1ZSDB 3ZYZA 2GSIB 1I8MB 4ODTH 1MAMH 4RFNC 4ISVA 1G7HA 3LQAC 5J9PA 5JLZB 1OAKL 4NNYA 1A22B 3K8MA 3AMKA 4Y4HD 5J3HC 4X6CF 3UTTE 4W81A 2WSKA 1Q0YH 1UYWL 2L7JA 1HKLL 5HYQA 2V7NA 2IPUG 5FEBA 1OD7A 1ZT7B 1KLGA 1NC4B 2FECL 3O9WA 5EUKA 1JRHI 1J88A 4Z7UF 2DQFA 3VFRA 3BGFC 4P23A 5DC0A 3GBNL 4QT5B 5AZ2L 4JM4H 1T03L 4U3HA 4JHWH 1UQSA 1JGEA 3W81A 4D9QD 2ADFH 5I6XC 1CD8A 1QHPA 1CD0A 4P4KD 2Z93B 3BYTA 4WW2A 4KV5E 1K5NB 4H0HB 3WV0A 3S96B 1U6AH 1B2WL 3S5LG 3DV4B 1U3HC 1DBML 1HHKB 1BD2B 3TFKC 1OAKH 4YPGB 2VQ1B 3N9GL 4L3AA 1J0HA 1UYWH 3WFCL 1KCRH 2J2ZA 4XPGL 5C0FA 1KIUA 4NZTH 1FG2B 2NW2A 3PL6B 5AZEH 4YHKL 3DUHA 4D94A 3GBNH 1KTDA 3QDME 3J8F7 1OM3L 2ESVB 5JOFA 5IMOA 2VDRL 1T2XA 3SOBL 1F4HA 5L0QB 1UXSA 2AXFA 4OIBA 4LPYA 3B9VA 3NOIA 4MCYB 4WI2A 1UKQA 4NO5A 1RZGB 1B2WH 3SN6N 2LU7A 2YPLB 4WV1B 3QULA 2X4PA 4AT6A 5CGYC 1DBMH 3B6SA 4YDKL 5K59F 4B50A 1BQUA 2FD6L 3N9GH 3PDOB 1MRCL 5I9QB 1MCRA 3WFCH 1FNFA 1R3KB 2ZUXA 1M6OB 4HS6B 2V2WA 1TZIB 4F8TA 3C5JA 4OUUB 1YNKL 3EDEA 3H9SA 1R5VA 3PGCA 1ZT1A 4NKDA 4XVUC 1CXIA 3DIFB 1JNHA 1BF8A 1OM3H 2VLKD 2VDRH 2EIEA 4L5FH 3SOBH 1LO2H 4FZ8H 2CRMA 2UZXB 5F21B 3CSPA 2OJEB 3GSNB 2VISA 4XNQB 4D3CH 2YEZB 5EB9A 3QUZA 4DCQB 5BJTB 1EA9C 3FAXA 5F89A 5MERB 2APWA 3EO9L 2WMPA 5AWNL 1IGFH 2P5WE 4PRAB 4YDKH 5GRWA 2A83B 5GGRA 3MRKA 5IFJB 5D7IE 6CGTA 5A3IC 1T1YA 4ZOEA 4YUEL 5IIEA 2PTUA 3O45A 1YY9C 4C83A 1AH1A 2L4OA 4OV5A 4TVPD 3FQWA 3MUGB 1YNKH 3FFCA 5EU6B 5KVMC 5KVDL 4XPFH 5J56B 1XFPA 3JWDC 5ICYB 2CO7B 3MLRH 2JKXA 1D6VL 3LB6D 2B20A 4Y88A 1IQDB 2ZG2A 3N1QC 2WIIB 4I48A 3I6GA 4W4NA 1XMWA 2NNAA 4IRJB 1ZHBB 3EO9H 3VXRA 3U0TA 4D8PA 5AWNH 2XTJD 1W8OA 3N50A 5EN2B 3BDXA 1T5WB 4UU9A 2W07A 3V9FA 1AC6A 4APQD 4YUEH 5GZOC 4PBXA 3FQNB 5AAMA 1EFXA 1BFOB 5F7MC 1IQWL 1O7SA 2DQEL 3CLFH 3FT3A 4Y0GA 2DLTA 5HGAB 1SHMA 1XGTB 5HHXL 3SCMD 5KVDH 4YFLI 5C08B 3V5DB 2WBJD 3CSYB 1D6VH 1HN1A 3TO4D 3LQMA 4AH2B 3MRLA 4NUJB 1QLFA 4M8QA 1DUYA 1U8KA 3MROB 3DMMA 5DJYB 1CDJA 3MLZL 4BQ8A 3FHQA 3OXSB 4Y4HA 3WEXA 4XNUL 3RVXD 2HAZA 3JUYA 4NKMB 4MQTB 3MRPA 4WFGD 3ULUE 2IANE 5DD5L 3VE0B 4KUZL 3E8UL 1KEML 3ECBA 1H0DB 2DQEH 4JAMB 4KRPC 4NRZB 2YRLA 2OTWB 5HHXH 4LVNC 3V6ZA 5J57B 1HHGA 1OAUL 2VLMD 4MSWA 3L5WA 3IKCA 3ZTJH 4NQXB 4MZ2A 4CMHB 2VN7A 2X4UA 3HPJA 2NY5L 1UM6L 4J3OC 2FL5B 2F53E 4UI2A 4L9LA 4X6FA 5HDBE 1R3HB 2R23B 3KHOA 1D5BB 5DJ6B 4XNUH 1BFVL 4YBQC 1NFKA 5JUEL 3ZHLA 1ZLVH 5LWYL 1NUFA 5BV7C 3VFMA 4HMDA 4KQ3L 5IEHB 1TETL 1N4XL 5DD5H 3E6HB 5DURB 4KUZH 2NPLX 4R96B 3E8UH 3ARXA 1NGWB 5F7DB 4PJEE 4PGEB 3AAZB 2HWZH 3I9GL 1KJVB 3MRCB 1OAUH 5KVGH 5IJKC 3PUCA 4PJAE 4PG2C 3U4BH 4X9HA 3DVIA 5CEZL 4LNVA 3S8WA 5C0RL 5ISZD 3DECA 1MCFA 3MRDA 4XXCC 4DK3A 2NY5H 4ZXBC 2FCBA 4LSRH 4B5EA 2N4IA 3KWWA 4U1SA 2JELH 4YH6A 5E5MB 2NY1D 2VIRA 2EECA 1BFVH 1MCIA 1PY9A 2DLIA 2VXVL 5CHNA 5JUEH 5LWYH 4M9OA 1LK3H 3CSBA 1EJ6A 4KQ3H 3S6CA 1JI2A 1TETH 1N4XH 3HE7B 1YEHH 4DKAA 2JCCB 1B4JL 2XT1B 3MR9A 4PTUA 1LEGB 1KG0A 5I74B 4U05A 3O8XA 4NM8L 2VLKA 3MV7D 4PP2A 3MRHB 5EU4B 4ZOBA 5CEZH 3EYFA 3L6FA 4YFDB 4MQ7A 3CX5K 1IAIL 1FG9C 2WWMC 3SKJL 4P9HH 1F4XL 2DIAA 4MNQD 5F6HJ 3CXHK 1NCDL 3RWDB 3JXAA 3UP1A 1T1WA 3P0YH 5L6YL 4O2FA 4UAOC 4L8CB 2VXVH 3P9LB 3VFVB 4OGYH 2Y7QB 4PRNB 3NIGF 5FB8B 4GLRI 3UMTA 1FV1A 4GRMB 1CTNA 3QIWC 4HV8B 4G3YH 4HWUA 4YR6A 1H3XA 3DO7A 1B4JH 3IU3B 1VEMA 3LKNA 3VXQA 3IF1A 4FQIL 2ADJB 2VITA 5I18L 2C5DC 3CDFA 2B1HL 2J88L 4X7SL 2J8OA 1IAIH 2WWKO 1MHCB 3T0EB 3SKJH 1QBBA 2MJWA 1F4XH 5GGUB 5ACZB 4P2RB 1NCDH 4PJ8D 1ORQA 1V7ML 4FABL 1FL5A 1CFVL 4APQA 2CIKB 2NY0D 1FZJB 4MDJB 2A6JB 5T3ZE 3NFNA 1S9YA 5IHBA 2FLBT 2P5ED 3SCMA 2B4CH 5HYIA 4EI5D 4FQIH 1RIVL 2HT4D 5M94B 3H9HB 1DQJA 5I18H 2WBJA 3O41B 2B1HH 4WI7A 2J88H 4X7SH 5F6HI 3IB4A 2J6EA 1J18A 4HK0B 2FJFA 4Z7OF 1KYOJ 2Q3ZA 5C6WH 3MFFA 3GMQB 3GSVB 4JZNB 3QI9D 1I7ZB 5D2LA 3PWVB 2Z8WC 2A9ML 1V7MH 5DD6B 4FABH 5JW4M 1AY1H 1U8OA 4XAKE 1CFVH 3AS0A 1NFDB 3K3QA 3U9UA 5E7FA 5KW9L 4MJ5A 3ZKNC 1U3YA 4ZOAA 1MSPA 2RFXB 1DN0A 1C1EL 1W0WA 4KZEH 1RIVH 4KY1L 1BJ1H 4F37K 2XA3A 1U8LA 5FV2A 3TYGL 1FVCA 4TYUA 2E9JA 5E8PA 4YWGL 1L9NA 1RZIB 1IEAB 2DWDB 5D93B 1OP5K 2XV6B 2EXWD 3NGBC 2XNAB 3RWFA 3NN8B 3MV9B 3OJDB 1DR9A 2EKJA 3MMEB 1I1RA 2OL3L 5BS0E 1IE5A 4BSJA 4TUKL 5HHME 7FABL 2WAHA 3TA3B 5LGJA 4LKXA 4CJ0A 1VACB 5C0GA 4CNIB 5I0ZA 4KI5C 3RWJA 2P4AB 4MWFB 5ID1B 3IAQA 3DSNA 5IB1A 1C5BH 1YPZA 1C1EH 1X5XA 4L4VE 1UWEL