4FQ1H

Crystal structure of pgt121 fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
234
structure length
229
Chain Sequence
QMQLQESGPGLVKPSETLSLTCSVSGASISDSYWSWIRRSPGKGLEWIGYVHKSGDTNYSPSLKSRVNLSLDTSKNQVSLSLVAATAADSGKYYCARTLHGRRIYGIVAFNEWFTYFYMDVWGNGTQVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab heavy chain
publication title Complex-type N-glycan recognition by potent broadly neutralizing HIV antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 229
sequence length 234
ec nomenclature
pdb deposition date 2012-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fq1H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fq1H01
3K4DA 1QFPA 1QBMH 1FYHB 3IF1B 3IFPB 5D2LE 3QULA 2NY4B 1QEWB 5BRZE 5EC1A 3BISA 5BJTB 1J1PH 1J86A 1KIPA 2AJYL 4L3CB 3RJQB 4WUKH 4DEPB 5EUKB 2B4CL 3LQAL 5D2NC 1Q9OA 1JF1B 1YUHA 2HYMA 3FN0H 3GMLA 3RDTB 3BW9A 3DETD 3JZ7A 4K3DH 2OJEB 3ARBB 3LKNA 4PGDB 3BIKB 4HT1L 2MKWA 3UAJD 1SHMA 5DUML 1OAXH 2R2BA 1KB5L 5CILH 4AEHH 8FABB 2YRZA 1AKJA 2YC1A 5HHOB 2GIYA 5IB5A 1NBQA 4D2NA 3T0EA 3GMMA 3KPSA 3QQ3A 1UA6L 2XTJC 5IP4A 4RISH 4Q9QL 5EU7C 4UV4L 4WFFE 2IANA 4HW6A 4YXLH 5GGVH 1XGYH 4CN1A 2VMFA 4JFOA 3DGCR 1C7TA 1BZ7B 4GW5B 2YN3A 5D7IB 2QBWA 1Q9KA 1KTLB 5CKAA 3AB0C 4P4KD 5CMAA 4DTGL 2MHAB 2SEBA 4PY7B 3WUWA 1BFOB 1I7RB 1HXMB 3LQAC 4BSWB 2FR4A 1N5YL 3A6BL 3U46B 3RWIA 1GGTA 3W0WB 5MEPB 1QFWH 4FOMA 4JPWL 1CF8L 3BEWB 3QYCA 3AMKA 4HUWA 4U1LB 4OBRA 1BAFH 1D5BB 2ITDB 2VXTH 4PLKD 2OJZL 4RDQG 2OR9H 3RL2A 4NQEB 5HGDA 2N4IA 3O6KL 5DUBB 1G6RL 4X83A 5KW9L 4R2GD 5GGUA 4TNWF 4CL7A 3QBTB 4YK4B 3T8XA 5KSVB 1CDGA 1HHJA 3I75A 1DQJB 3QWOA 1R24B 5C08E 5I30L 5GJTL 4O2FA 6CGTA 3SJVB 1MWAB 3GSUB 4GW1A 5JQ6H 1KJMB 2GI7A 1XR8B 2P46B 2RGSA 3REWA 1OTSC 4NM4L 3ZE2F 4Q2ZA 5KOMC 2BXYA 4OD2B 5J1TC 5DRWA 5JXED 2A83B 4PJIB 1LK3L 2CIIB 2VL4A 4G80B 4QTIH 3M8OH 3CVHL 3TJHC 1KLUB 1UB6B 5CINH 3ROOB 5CJ8A 3EYSH 2XXCB 3TNNA 3BJLA 4V1DA 2J2ZA 5IF0B 5F7DA 1XIWA 1S7UA 2X6MA 3MTRA 3DI2B 1LEKB 3G5YB 1WFOA 2G2RB 1MI5D 4TOYH 2OL3H 4P2RB 4ZNEE 2HMIC 4X9IA 1TCRA 2H6PA 3F8UB 4UINL 5IMMB 1T3FB 4U3HA 1PG7H 4LVNC 3TEUA 4L1DA 2EDKA 3DX6A 4U3XA 3O6MH 1CFTA 1KIQB 1W72L 2DJSA 5D7IF 4Y0GA 5JHDE 4JFFB 4Y5XA 2VLJE 4NNPL 2DQFB 4LSVL 4LGPB 4HEPG 5FCUL 1NFIB 5TDNA 2BMKA 1NCBL 4K23H 3SKJH 1T83A 1FNSH 4I0PA 2VLKA 3P4OB 2DQHL 3PV7A 5CZKA 2CMRH 3MLRL 4ORGA 2C1OB 2VXQL 4YHMH 3QDHA 1U2CA 1UZ6E 4OFYD 5GS0L 4IRZL 1BD2D 3O2WH 4JKMA 3VG0L 3VXTB 4EVNA 1I7ZA 5E8DL 3EJYD 2LTQB 4DCQB 1GZPB 2BFVH 3AREB 5AYUL 1B0GB 1ADQL 2ZSWB 3S5LA 1JPST 3V0WH 1FLTX 4GRLD 1YMMA 4X6CE 3WL9B 2AKRB 4XNMB 4RFNB 3WE6A 1E4JA 1OF2B 2FYYA 4LRIA 1VKXA 1GGUA 1GOFA 5EDXA 3SDAC 3TCLB 2JCCB 3ZYIA 4G9FD 4PJIF 2HLFD 4KMTH 1ZEAH 4Y7MA 3NA9L 3QDJD 32C2B 5J13C 5KSBA 4DVRL 1P4LA 2IFFL 4KQ4H 3ZSSA 2WUBL 5B8CC 4ZOAA 4LCYB 4TVPL 1MCDA 1E28A 1CS6A 1U91B 2B1AL 5DURB 4DOHB 2WWMD 3V6OA 3OHXB 3FMGH 3RVVD 4W6XB 2IBGA 1XEDA 2DJ4A 2EXYC 1LE9B 3HZYA 2KQNA 1OTUC 4KPHH 1C08B 2ZSVA 4HDIB 3HC3H 3AXLA 3O3UN 3VFGH 2F74B 3ULUL 5FXCH 5C09D 1A3LH 3BRGC 43CAB 3P77A 5T3ZH 5D6DA 3VD7A 4HIEB 2DAVA 2E7BA 4WDIB 1AD0A 3SDYL 2J3SA 4PRHD 4U6TA 1WEJH 5TQ0L 2W0KA 4NP4H 3GSQA 4J2XA 3TGXA 1RZ8B 3HE6B 3EKCA 5IHLB 3GSWB 4OFKA 3IDNA 4N0YL 3DX9A 1OAKH 5HDQH 4YE4L 2IF7A 1J0HA 4Q0XH 2UYLA 1TETL 3E0GA 1J10A 4K71C 3BGFC 4WJ5A 4XXCC 1FLRH 1GHFL 2XV6B 5DRXB 5DYOB 4LAQH 2JCCF 1UXWA 4E5XA 4LF3B 3PP3K 4X80L 4Q7DA 2B8OT 5KVFH 2BVYA 3GMRA 2E7LC 4HH9B 1FJ1A 1CGSL 4PLJD 4FFYL 1FH5L 5IEKA 1ITBB 5KANI 3MR9B 3MV7D 4J6RL 1J05A 1SJEB 4QRPA 5E2WL 1KSRA 4FA8A 1T21A 1P5VA 4FP8H 1F3DH 3PJSB 3VD9A 3DVGB 1EFQA 1T22A 4A6YB 2CD0A 1XGQB 1BREA 1FIEA 1SBBA 3A67H 4Y4KC 1S7VA 1I8MB 4GG6B 3GRWH 2CIKA 1NCCL 3Q3GA 2ESVD 2VL5B 3O3AB 1A8JH 1GVIA 1G7PB 5KSAC 2IALB 1MHPH 3DX7B 1MJ7H 2HP4A 1FNGA 3QP3A 2ENYA 4Z18A 4JFDD 2BRQA 4YDVA 3IJSB 3JBG7 4JO4H 4LLWB 3MRJA 1TIUA 25C8H 4LSSL 1CXKA 5IR1A 4IDLA 3HFMH 5D72H 1RZGB 4RGNC 3WNKA 1FN4B 3MJ9L 4PJXB 1PKOA 4MCYB 4I0KA 4KUCD 4Y2DB 5CJXC 3MOBH 3MODL 5C2BH 4OCYH 2DQTL 5E5MA 4NRZB 4QYOB 4JFHE 5T3XE 4PJ8C 1OOAA 3PABA 2HJLA 4LASL 4X6EA 3BRDA 2BOBA 5I2IA 5E24E 2HH0L 2X4QB 3UTTD 2IH1B 2ZOKB 3SCMD 2VSCA 1WFNA 2XA8H 3BPLC 2H45A 2ATKB 3WJLC 5FDWA 1FL6B 1AR2A 5I8CA 4NHCL 1FPTH 1MJJA 5JW4Q 1A21A 3FAWA 1ULVA 2FATL 1HSBB 2PTVA 1IFHH 3B6SB 5GGSA 3TBTB 1F4YH 4NQCB 4OCSL 3ULUF 4OZFA 5HYQB 1QP1A 2FSEB 3E6FA 1AXTH 2F9BT 1A6UH 5FOBA 2R2EB 3JTSB 1DBKL 1HQ4A 3HA0A 3CX5J 1AP2A 1NCUA 3AU1A 1X6NA 2FLRT 1MFEH 1S3KL 5GRJL 3HI5H 1RJCA 1DBMH 2QKIB 3UYRH 2VTFA 1T0MB 4JPIA 3T3ME 4MXQD 3ZE1E 4XVTH 4X5WB 3FOLA 2HA1A 3NGBC 3VFUA 4GG6F 3BT2H 4XXDA 3FZUD 4JFZH 5E8OA 3BGMB 5DMYA 5KTEH 4DZ8A 2ICEA 3I50L 3T2NH 4XBGA 4OGZA 3CDGA 1N6QH 3MA7B 4Y4HB 3GJFA 5B3NA 3VI4E 1REIA 1MFBL 1WTGT 2XZQL 3QUYD 5ACZA 2WP3O 2OZ4A 6FABL 3DNKA 4OV5B 3PHQA 5D6CA 1KJ2H 4XAWH 2DI9A 4ZO8A 3QHTC 3MXWL 3I3DA 3QO1B 2R8SH 3O9WD 5B39A 1ZA6A 1PLGH 1VACA 4PJXF 1I1AB 2NXYD 4IIQB 1MJUH 2R23A 2YPLA 1NGQH 4DQOL 5DLMH 1K8DB 4NKQB 3MV8A 2CUMA 4N0CC 5M94B 4MJ6A 5D71H 1QBML 2GHWB 4UZGA 3LKSB 1I7TA 2BSSA 3QXTA 1MAMH 3ULVE 3VDCA 3NMEA 3WJJC 1QACA 2JK5B 4GKNA 1J0YA 1J1PL 2DWDB 5IM7B 2VISA 4WUKL 4D0CB 2ZG2A 3U4EB 4X4XB 3HC0A 3FN0L 1WWCA 4K3DL 4JFXB 3ILPA 1HEZB 2E3VA 3QUMB 3KPNB 2PR4L 2VH5H 3WO3B 1MCEA 2EZ0C 1OAXL 4LQ1A 1WICA 5CILL 4AEHL 1NMCC 2LFGA 5A40E 4BM7A 1CDYA 2BDNH 4FQ2H 1YJDC 3D9AH 4JFQB 3MRPB 4EQ2A 3OJVC 1P1ZB 3KYAA 5IB1A 4LOUD 3DXAA 4PV9B 4RISL 3MRKB 15C8H 4MAUH 4P4KB 2Z8WC 1S5IH 4YXLL 1EX0A 5GGVL 5F72S 1XGYL 1A4JA 1BWWA 1DEDA 4K3JH 3PHSA 2NNAA 4BZ2H 4RFEA 1RVFH 3TO2B 2PXYC 4Z9KB 1XAUA 4ZTOH 4RFOH 2XY1A 4TUJA 3H7LA 4L9LB 4R97B 1UXSB 4UOW1 1KT2B 3V5KA 1QFWL 3RGVD 3KPRD 1LP9E 3HZMB 4QOKE 2YZ1A 4LCWA 1F13A 2IADB 1DLHB 3T1FA 4R2GB 5MEOA 1BAFL 1VDGA 2VXTL 2OR9L 2YR3A 3FN3A 5C0AE 3L3GA 2ZJSH 1QA9A 2L0DA 1UM5H 4PLNC 2OM5A 3MLTB 1P53A 3PHOB 4X7TA 4U6XA 1RJZA 1B3JA 3RAJH 2B39A 3PNWB 3ILQC 1MFNA 5T1LA 5CBEA 2HJKB 5IEHA 4M6AA 5JQ6L 3RY6C 3TBYB 4QF1B 4U2YA 1ITCA 2FJGB 4LIQE 3ETBF 3V6FA 4U6VH 1EHNA 3SDXB 4LLDB 4QTIL 2AI0L 2DLTA 3BZ4B 4GG8B 2VDNH 3L6FB 3IGAA 4LARH 3EYSL 1HQRB 1OD7A 3KPQA 3KG5A 1CXLA 4NBZB 4BYHA 3QIUD 4RAVA 1SEQH 3CU1A 1JIBA 4POZC 2OL3L 2YUVA 3SGJA 4IMKC 2VE6B 4UQ3B 4HLZH 5D1ZD 4KRMB 4YC2B 3RPKA 1PG7L 3IU4H 1HOCA 1KTKE 3LN4A 3ZMRA 3O6ML 1SY6H 5DI8A 3VWJC 4H1LB 1WWWX 3GSRB 4CADB 2BVOB 4WWKD 1ZLVK 2AJVH 3D2UB 4MD0A 1U93A 3O8XC 4P5MB 1Q38A 3J8F7 2Z91B 5DC0A 5IBLC 3NIGE 5J6HB 2YN5A 4K23L 1IC7H 3BH9B 2AK4E 2ZCHH 1BD2B 2AW2A 4BQ9A 2CMRL 2DI8A 1G9EA 3S37H 2ZWLT 1UWXK 4AEEA 4YHML 3QCTH 4GBXB 4XB7A 1KLFA 1T1XA 3O2WL 4GRLB 4OZHB 1KPRB 3C6LC 3UJTH 2BFVL 1RK0A 3ES6A 3EW3B 1BOGA 4EI6B 3U9UB 2QR0A 3DTXA 5JIHA 3V0WL 2CRZA 4K2UH 3BPOC 1T4KA 4DUVA 4F57H 3AVEA 4FQHB 1HNFA 2DIBA 1PW3A 3QDJB 4FMFA 3A6OA 4PTTB 1G9NH 4HPOH 3SDXF 4KMTL 4RX4A 2E9BA 1XCTA 1ZEAL 4P2YA 1ZT7A 1H5BC 2XTJD 3KYMB 4OTXH 3FQUA 2COQA 3FO2A 4LDEB 4G9DB 1MQ8A 4KQ4L 3VXRA 1RMFH 4ZXBA 1WF5A 5FGCE 4OV6F 4JZNB 3TZVC 2NMSA 3TIDA 4LMQE 5ID1A 4WW2A 5E8NA 3GMOA 3FMGL 5H94A 4AY0A 3WSQH 2C5DC 5C09B 1OSZB 1BQSA 2R0LH 3NACH 3ARDA 3VFNA 3K0WA 4KPHL 3KPMB 4HKXB 5C0GA 1JYNA 3VFGL 5CJOH 4ONHA 5FECA 4IOFC 3UBXI 4PRHB 3U7YH 1A3LL 5JPNB 5T3ZL 4Z0XB 5C07E 1JI1A 2UY7A 5IESH 3U2SB 1WEJL 1OB1B 5JORA 2BNQD 4NCDA 4NP4L 1PBYA 3PQYB 3HAEH 3OWEA 1RIHH 1CTNA 1FG9C 1HXYA 1XGRA 4ZFFA 1KCRH 1OAKL 3CFKB 5HDQL 3PWUB 4M61B 5FFLA 2EDEA 5FKPA 1OTSD 4OZHF 3DVNB 2YMXH 3VRIA 1K85A 1ACZA 4IEFB 4G8EB 3DX8A 1A6VH 3EDKA 1OQOA 3OTTA 4JFED 4Q6IC 3TJHD 3RI5K 2MTPA 5ENWA 5JIIA 5ICZA 3I3EA 1AQDA 2NY3C 4XAKD 1FLRL 2WQRA 4YHIA 5B3JF 4AMKH 1TQBB 4RA3A 3GIVA 4X98B 2B7DT 2CDFB 4LAQL 4F9LC 5CSZA 5BV7H 3HCVA 3PGDB 4BQ8A 4CAGA 5L2JA 3MV7B 5KVFL 5IQ9B 2HMID 4HUUB 4HWZB 1DQQA 1U8HB 4WVRA 1S5HB 1RV6X 4QRUB 1J8HB 1S7QB 4NHUA 4ONGH 2R2CA 3N06B 5I76B 3K2UL 4XX1E 5IW6A 4LK4A 3BP4B 1NH6A 5GS2H 5K9JL 4ZUTA 3FO1A 4FP8L 3AMLA 1ZHKB 3MLUH 3PWLA 3A67L 1VB9A 1DBBH 4I1NB 3GRWL 4JQXC 5JO5A 5LAXB 1XFPA 2F54E 2NW3B 1MHPL 1VPOH 3E3QC 2DIJA 3WFZA 1MJ7L 5LQBH 5C0EA 3UC0H 1L4IA 2AGJH 3WHE0 1EZVX 2FX8H 3WS6A 5MHSD 1F3DJ 5I1CL 1IQWH 3ZDZF 1SVCP 2DM3A 4JO4L 2GUOA 2WWKO 5TDOA 4JREB 3VXUD 1PZ5A 5JPMA 4NC1C 3QISA 2NY1C 25C8L 3DI3B 3T0AA 3QNYA 4F2MA 3STZA 5DD6A 1GYAA 3HFML 5D72L 3WUZA 2YOCA 3MGAA 3MOBL 4RZCA 3RWCB 4F7CB 3V5HA 5JDJA 3UTTB 5F6IB 1R5WB 3O45A 5C2BL 3SCMB 3EDEA 4OCYL 1WZLA 5F7EL 4D9RE 3SDAD 4YDIH 5DT1H 4WEBH 1FRGH 4XCYA 5F6HI 2FRGP 4KU1A 3GSNH 4PY8J 3GHEH 1QTYT 2WANA 1XZ0B 4RQQA 2XA8L 3WDIA 3BWAB 3VFPA 2X7LB 3D87B 4EUPB 1FPTL 4ZPTA 4LEOA 3ULVC 2DQGH 5GSVB 1IFHL 4MSWB 4PRPD 5TDPA 5ISZA 5BCAA 1F4YL 4M1CC 2DL2A 5L0QC 1AFVH 5H37H 4Z78B 3T0WA 4PJ5A 1ONQA 1NUDA 1AXTL 3U30B 2EXYD 1JYWA 5DSCA 4H20H 4G6JH 2G5BB 2IBBA 1YN7B 3DHMA 1OTUD 4AM0B 4Q97A 5FYJU 1MFEL 1LE5B 3LEXA 3RWHB 5JTWA 3HI5L 3IDMB 3CU7A 1DBML 3UYRL 4PJHE 3U36B 3IRPX 4CBPA 1BQHB 4XVTL 5J9PA 3VFVA 2VLLA 2JJSC 2MCG1 4F3FB 3BT2L 5CS7A 1OAUH 2AV1A 2BHYA 1U9KA 3QUYB 4JFZL 5KTEL 3BQUA 5E94A 2FEDC 3T2NL 3HG1E 1N6QL 3SO3B 1DDHA 1FC1A 4N8VB 1KIRA 3LPGA 4MA1C 4GAJH 4KK8C 3O9WB 4LLVA 4OZIF 1NLBH 1KJ2L 4XAWL 3PGCB 4DFHA 4ETYA 3PL6B 3X3GH 1XGPB 2MPAH 3BDBA 1IGFH 4BFGA 2R8SL 4G43A 1QBAA 5I73B 1PLGL 2A38A 2A73B 4MAYA 1FFOA 4GMTH 2P5EE 1MJUL 1RY7B 1NGQL 5DLML 4JFYB 4TRPH 5DK0A 4CVZA 5D71L 3H9SA 5E6YA 1I4FB 1MAML 1SYSB 1M6OB 4MQ7B 1J0KA 4I0CC 2V6HA 4BUHA 1NGZA 2HVKA 2I24N 3RTQC 2VZ3A 3MRIA 4JRYE 1MPAH 3IJHA 5F1KC 3GJEA 1R3LB 4Z7UE 3G08A 1X5KA 1I3RB 1FNEB 1U8JB 4NO5A 1UH2A 1GXEA 2VIRA 2H8PA 4JLRA 2ZNWA 4IRSA 1VFAB 3L5JA 2VH5L 2AJZA 4G42B 1NC4D 1KYOK 4WHYH 3T77B 4OCLC 3AC0A 4PJGE 4Y4KD 2CDEA 5ILTH 2EXWC 4KXZI 2BDNL 4FQ2L 4Y1AB 1IGJA 2R1WA 3D9AL 1U95A 4PJCE 2XQYK 1JRHH 5CEZD 3VXNA 4HHAB 5LG1A 3LMJH 4ZTPH 1TZIB 3V0AC 4WCYH 5KSAD 1GPOH 4RSVA 1ZS8A 2VQ1A 4HGKC 15C8L 4MAUL 4KY1L 1S5IL 3BMWA 3W9EA 4QHUA 4EN3B 1G0XA 2E7MA 4K3JL 2FZ3A 1UQSA 2XKUA 2W65B 4X4ZA 5IFAH 4NSKB 4NRYA 4LLQB 4P3CH 4RWYH 2BCKA 5DQDH 1KOAA 5GZNC 1ED3B 1RVFL 1XT5A 2CLZB 4QRQB 4HC1A 3B2VH 4ZTOL 3EJZC 4O9HH 4RFOL 5KVDL 4RGND 4LKCB 1G6VK 3VCLB 4TVSa 1JPGB 1P7QB 4PR5A 1QLEH 3S98A 4FFZH 4MDJB 1TTGA 1DEEB 1YEEH 4GUPA 1MQKH 1NGXA 1T7XA 3FQTA 3SDCA 4PJ8D 2X4SA 4UQ2B 4PGCA 1TTUA 5DJ6A 1NANH 3U79A 2DTMH 3ZYZA 2GJZA 3OR7B 2ZJSL 4QKXB 1TJIH 3UBXB 3ALPA 1UM5L 3MFGB 5K9KA 4PRNB 1NJ9A 1KCUH 4U1IA 1GOGA 2J88H 2VXUL 3RAJL 3O3DA 3IVKB 1CFSA 4KJPC 3HN3A 3ARGA 3GSOB 4CMHC 4OLXH 3KXFD 4MDIB 4KQ3H 2VABA 2DKMA 3ZKXC 4ODVH 4H88H 4U6VL 3RIFK 5CEXB 4ZD3H 3QIUB 4X9BA 1AIFA 5B22A 5J6GB 4PGBB 1ACYH 4MNQE 4KI5E 4LARL 2CKBA 2JJTA 3IT8D 2X1OA 3IB4A 2ADJA 3K1DA 3QG6B 5HDBE 3OMZA 5EOTA 5F70A 5D1ZB 3RX5A 2YBRB 1SEQL 4X4YB 4Y16B 2NPLX 2YSSA 1TVHB 4RAUA 1J88A 1OL0A 4G7YH 2PO6C 3IU4L 1QSFE 2DMBA 4WFED 5E6IC 3G6JB 1SY6L 2V9TA 3TN0B 1INEL 3IDGA 3KAAA 1JZ2A 3ZTNH 3BEVA 2EE2A 3KYKH 1IAIM 4YR6B 5MEQB 4HS3A 4JZJC 4R96A 1SEBA 2AJVL 5SWZB 5I8EA 2ITCA 5B38B 3E8UH 4C56E 2X4PB 1IC7L 4HS6B 4N0CD 3H7BA 5L8KB 2GSGA 3EO1B 4PJ7E 3VA6A 5HVHC 4FZEH 3S37L 1K2DB 3QCTL 5F21B 2WIIA 4YFDB 5DJ8B 3QI9A 4S1QL 1GH7A 1RUKH 1CI5A 3X14A 5DF0A 4HD9A 1M05B 3V6BR 3WDHA 3KLSA 4XPGH 3QEQE 1K8IA 3UJTL 4C4KO 5D8JH 4JJ5A 4OGAC 4NJ9H 3KR3H 2ZUQC 1JFQH 4K2UL 4MZ3A 2QSCH 4NQDA 2NZIA 4JO2H 4ZFZB 4F57L 1FYTD 5T5NG 4HIXH 2EZ0D 1YMHB 2ZUYA 1S9YA 2XTJB 3BFOA 1G9NL 4HPOL 3MJ8A 3B5HA 3PP3H 3WFCH 1QRNE 3AY4A 1WITA 2CSPA 5BZDA 5IKCA 2L4OA 4OTXL 1Y6NR 1FZMA 3D69B 4ETQB 2JKXA 5GQBA 5D1XD 3KYOA 2NXZB 1RMFL 2PTTA 4WENB 3QUKA 3QWRA 4QRSB 4Q9RH 2ICCA 2PXYD 1T04B 1FL5A 4JPVH 1C16A 2EICA 3CFJA 3WSQL 4HUXB 1YC8A 2R0LL 3G6JF 3RIAF 4PJEE 4ZUVB 5IMOA 4P5TA 5CJOL 5DD5H 2VLJD 4FTVA 4PBVC 2DQIH 4HMCA 5FO8B 3U7YL 2BNQB 5IFJB 2FO4A 4UU9B 2P24B 5EO9B 4L4TD 4WO4C 3G5VB 1NBYB 4Y19A 3MRDB 3DRTA 1AD9B 1FVCB 2MFNA 3EFDH 3IFOB 4K7FA 1I1CA 4J4PC 3ILQD 1KCRL 2IMNA 3O4LD 2Z93A 3GMPB 1R5IB 4OT1H 4Z77A 3QIWC 2YMXL 3IF1A 3IFPA 2IBZY 3FHAA 5I16A 1NAKH 2JIXD 1IMHC 1A6VL 1H3UA 2HKHH 4I3GA 4JRXD 4XVJH 4L8DA 5BJTA 3PV6B 1OW0C 2C4FT 3H3KA 4L3CA 2QHLA 1D5ZA 5J89A 4AG4H 4JM4H 2EDDA 5EUKA 2Z35A 4TPRH 5CJQH 3CMGA 1JF1A 1YQVH 3BKYH 5BV7L 1I85C 2OJEA 2EE9A 3ARBA 4LVNB 1NANI 4POZD 3G9VA 1KG0B 5EWIH 5T5NF 2X40A 4WU7B 1AR1C 4KAQH 5HYJA 3NCYS 2XPGB 3FFCA 3HAEG 1EEYB 1YEHH 8FABA 4ONGL 3ZE0F 5HHOA 3E2HC 3VWJD 2R29H 3DURB 4X99B 4ZOEA 3D5OF 4UV7H 3MJ6A 4BK4A 1DVFB 2BRRH 1II4E 3MLUL 1JJUA 3O8XD 5IBLD 3IFLH 3DWTA 1DBBL 1IBGH 1EJ6A 5IROC 4LHUG 5D7IA 2MHAA 4U33A 2EC9T 4PREA 1VPOL 1BFOA 1I7RA 1I8KA 4PV8B 4PY7A 3ZE2E 5DMKB 1CFBA 5LQBL 5SWSD 3UC0L 1FNAA 4BSWA 4GT7A 5DD0H 2FX8L 2HFTA 3U46A 4F15B 1IQWL 4NBYB 3W0WA 2QQLH 3DOSA 1JZ7A 1AE6L 3C6LD 4FQXC 4I2XE 1CICA 4L4VD 4QCIA 3VG9B 1RUMH 1D5BA 3SDAB 2ITDA 1ZK9A 2HKFH 4NQEA 5IJKC 4YBQD 1ZLUK 1I9JH 5DUBA 4RRPG 1T5WB 2LV4A 1DQJA 5DWUH 4YDIL 5DT1L 4WEBL 2VR5A 5EO0B 5D93C 5J13B 1FRGL 3GSNL 4OB5H 2EKSB 2VDRH 3GHEL 1MWAA 3GSUA 4XMKH 4PRPB 1XR8A 2XN9D 3IRZA 3T2PA 4OD2A 2A83A 4PJIA 2CIIA 4G80A 3P4MB 2DQGL 4YO0B 2BHUA 2G9HB 4XHJC 3ORJA 1UB6A 1YMME 3T65B 3TZVD 1AFVL 5IF0A 4P23B 2BC4A 4H20L 4L29B 4G6JL 1IM9D 2H2SD 3LS4H 2R4SH 1WK0A 4M5ZH 1MFDH 4P2RA 4KKNA 4UT9H 4Q58C 1JF6A 4IOFD 4HX1A 5FAAA 2FJFB 1RZ7H 1NSNH 4HJJH 3DUSB 4ODTH 1KIQA 5SX4I 5I8OH 1LD9B 3HPLB 4NN6C 4K7PH 4TQEH 4JFFA 3SJVE 4S11A 3LKPB 3L1OH 1EBPA 2OMNA 1NFIA 3MJ7B 3TNMB 1GIGH 4CNIB 4GAJL 4TNWK 4M1DH 1NLBL 1MUJB 3P4OA 4K71B 1XH3B 5H37G 3MLVH 5ESAB 3BGFB 1BECA 3GB7B 4K94C 3X3GL 3UEZA 2MPAL 1T0NB 2C1OA 1IGFL 3ZO0A 3DV4B 1I1YB 3VFWB 4OF8A 4GMTL 2NY3D 3UPRB 4QLRA 3T3PE 1HKFA 4P59L 4LSTH 4TRPL 4UAOC 4DCQA 3K1KC 2PUQT 3F5WA 4CMMB 4ODWA 2E6QA 3L9RB 2ZSWA 5IVOA 1V3MA 5T3ZD 3TC9A 1DJSA 2AKRA 2Y1VA 3IKCB 4JCMA 5FK9A 3LAFA 4OJFH 4RGMB 5AUMA 3OKKA 2R39A 1MPAL 4LLMB 2EDOA 4KV5F 2JCCA 1NC4B 3HUJE 3MRCB 2NY5H 1JBJA 1W72A 4Y4KB 3JUZA 32C2A 2WBJC 4LFHD 1S9XB 5ANME 5FYLE 3CDCA 1C5DB 4M3KB 3LQZB 3VMPA 4KDWA 1Z9MA 4LVOB 1KC5H 4E0RA 1TNMA 3MLYH 1U3HC 4LSUH 4XP5H 1IAMA 1DBAH 3S4SB 1R0AH 1JRHL 2Z31C 2NX5D 5CIPA 3D25A 5E70A 2R0KH 3LMJL 4ZTPL 4UNTA 4WCYL 4RBPH 3OHXA 2ZG3A 1GPOL 1FV1A 3GJFH 1LE9A 4HXBH 5T1KD 4WI9A 3NIDF 1CFVH 4P49A 5IFAL 2J8OA 4P3CL 4RWYL 5IVXB 5DQDL 3RWGA 2LVCA 2NY1D 1ADQA 3ARFD 3B2VL 1JP5A 1ZLVH 4O9HL 3DYOA 43CAA 3Q5OA 5DJDA 1U8NB 2D0FA 3TO4C 4TTGA 3RPIB 1QLEL 4FFZL 3VDBA 5F9JB 1YEEL 4J8RA 1MQKL 4KK6D 4HKJA 4WHYG 3BPLB 2R9HC 3HE6A 2EEDA 1CQYA 3R06A 4G8GD 5IV2B 3DBXB 4YHKH 5D2LB 4FFWC 3D48R 1JUFB 1IZJA 5DTFA 2VKXA 3ZHLA 2DTML 4F8TA 4BUGA 5BRZB 2HN7B 2LU3A 3DMMC 5C0RH 4HUVB 4M7LH 2Y7QB 2VC2H 3KXFB 1KCUL 5KVMC 5J56B 2J88L 1TITA 1QR1B 1AGEB 4M1CD 4OLXL 3JV5A 4KTDH 1TFHA 4MHHG 2IQAB 4KQ3L 2XQBH 2NLJB 4YHYB 3BYYA 1K4CB 4ODVL 4H88L 5JW3L 3G9AB 3C5ZA 3H9YA 5HBBA 4ZD3L 4ODXB 3JWOH 1QOKA 1ACYL 1NCTA 4AT6B 2LE9A 4MD4B 4JKKA 4PRDA 4NYLB 4QRRA 3MR9A 1SJEA 1M1SA 4XWOC 4LIQH 1B6UA 3ZDXE 5E1AA 4JFPB 2PETA 2V9QA 2FEDD 1Z3GL 1V8HA 3DVGA 3KJ6H 3JV4A 5D1QB 4A6YA 2ZCLH 3EFFA 4G7YL 1XGQA 5JQHC 1ZLWH 2GJ6A 1I8MA 4KK8D 3B9VA 4GG6A 2VL5A 3O3AA 3ZTNL 3KYKL 4ODUB 1MY5A 5C71A 3EGSB 1BIHA 3LOWA 2DBLH 4G8IB 3IJSA 2MOVA 4LGSB 5DJYB 4DJMA 2D7QA 4PJAB 3E8UL 4JO3H 4LLWA 3EYOA 2FGZA 2ED8A 4QHMB 1CFQA 2PCPB 2A74B 1RZGA 1FQ9C 2YHGA 4FZEL 5I1EH 4ELKA 1BLNB 2WLYA 4MCYA 3TT3H 5D2LF 4WU5B 2E9IA 3QUZA 5EH1A 4PG9A 5C0AD 1EHAA 5C08B 1RUKL 1E6JH 3RTQD 1HWHB 3WUWG 4XPGL 4NRZA 1YPZA 4QYOA 3M17A 4Z8FL 1ZGLB 4YHPB 5D8JL 3EAKA 4KWUA 4NJ9L 5JW4M 3KR3L 4HS8H 1NMCB 4LCUA 1JFQL 5FO7B 5ALCH 2X4QA 2QSCL 2IH1A 3HC4H 4JO2L 4XZUB 2JB6B 3L3DB 1YNTB 4HIXL 2GSIB 1RPQA 1NUNB 4FQJL 3X13B 4ODBD 3U6RB 4YQXH 2EXWD 1UCBH 4DN4H 3HE7B 4LCIH 1HSBA 5EBLB 5I19H 5GGRY 3SGKA 2DI7A 5H2BB 5GGTH 3WFCL 2A6KB 2AABH 3TBTA 4NQCA 2NY7H 3I6GB 1EVTC 2AEIT 4I13B 2FSEA 1TVDA 5TF0A 2PXYB 1NAMB 3B8SA 4ZMAT 2YEZB 3QDMA 5CHNA 5BS0E 1CXIA 4PJXE 4AH2A 3S3JA 1Z0MA 3NCBB 5DJ2A 5GRVL 5GZND 4D3CH 4Q9RL 1DE4B 3OXSA 2J6EA 4NO3B 1JZ8A 3EJZD 5JHDB 4WI3A 4JPVL 1T0MA 4F9PA 2VLJB 4GLRH 3LRGA 1U2HA 4JKPH 5EUOB 3M1BA 1J8KA 4P2QA 4XH2A 4Y4FB 3BGMA 1C7SA 1XIWC 1FVDB 5DD5L 4PPTA 3LRHA 2DQIL 3MA7A 1H8NA 4Y4HA 4X0KA 1BJMA 1W0VB 3BAEH 2ATPB 1JN6B 1NCNA 3S34L 2E7CA 4I18A 4OCXH 2NCMA 2Q76B 5FCSH 1EERB 3EFDL 3MRGB 4QO1A 5C6PB 2V5YA 2JIXB 1I1AA 4X6CB 4ZS6C 4OT1L 3E6HB 4ISVB 1I1RA 4WNQB 2NTFB 3LKSA 1NAKL 3BHBB 4R26H 3MNVB 3L5WB 3LKQB 2HKHL 1T83C 4QXUH 4DAGH 4XVJL 4I0PC 1A6WH 4PBXA 5IM7A 1MIEH 2EC8A 1RUPH 3U4EA 4AG4L 4JM4L 3VGAC 4TPRL 5CJQL 3BKYL 1QLRA 1BF2A 1V3LA 1S7TB 3QUMA 5EWIL 3VWJB 4KAQL 4E41D 2VSDA 2PO6D 1YEHL 3T0BA 4MVBC 5DQ9B 5E6ID 3O8XB 1CD9B 4JFQA 3HI1B 2BSED 2R29L 3D3VD 3OKNA 4LRIC 5I1AA 2DLFH 3EOBB 4UV7L 3L3OA 4PV9A 2LAGB 2BRRL 2PYEA 4UIKH 1U3JA 3IFLL 3UTSA 1IBGL 3VXPB 4GKSB 4NO2B 3MA9H 5EUOF 1ZHNB 1XF5B 4GAYA 4XP1L 2CUHA 4D0DB 3TO2A 3QZWB 3CIQA 1U8PB 5FA4A 2VZOA 3C6LB 2Y36H 3P9LB 5DD0L 1FORH 4YAQA 1UXSA 2F53D 1KT2A 1UWGL 1G1CA 2QQLL 4WI7A 3KS0H 1UZ6F 3V6OC 1DSFH 1DLHA 2AP2A 1M71B 2CR3A 4OGAD 1RUML 3EOYG 1SJVA 4G7VH 1BVKB 2HKFL 4MQTB 2M26A 4XMPH 2DMCA 3IAQA 2K1MA 4X6CF 1H5BB 5F8RC 3MLTA 2XN9B 3P40A 5DWUL 1BJ1H 3LH2H 4KKLC 5D6DC 3PNWA 4GMSH 4OB5L 3QCVH 4YPGB 4Z7WB 2VDRL 4M6MH 2GITA 2HJKA 4XMKL 2ARJQ 2NW2B 3TBYA 3TZVB 1WIUA 5KZCD 1L6XA 3QEUB 1QSED 3ESUF 5C86A 1UKTA 1M7DB 5EU5A 9CGTA 3BMVA 3FL7A 5FHBL 1IM9B 3O4OC 1HQRA 4Y8DC 1OP9A 2OK0H 5IW1B 3GK8H 3DROB 3NCMA 2O26U 2HT2C 2CO7B 3ROLB 3LS4L 4OD1H 2R4SL 1I3VA 4M5ZL 5EO1B 3RL1B 3QT2A 1MFDL 5IK3B 3RY5A 2PKDA 4UT9L 2VE6A 1W8NA 2EO9A 3CSPA 3FOMB 3BYTA 4JJHA 5EZJB 1RZ7L 4R90H 1NSNL 4HJJL 4ODTL 4WO4D 4CDHA 5I8OL 4W81A 3QJFB 4K7PL 2R2HA 4BH8B 1UJTA 4E42B 3D39D 5TQ2L 1G0YR 3D2UA 3L1OL 4P5MA 4FMKA 1M4KA 4J4PD 5FYKE 5JOFB 1GIGL 3ZDYE 5J6HA 3D85A 4KTEL 1X6LA 4Q6IB 4M1DL 4OFYA 3SDXE 4P2OA 3BH9A 3UROR 5DGRA 3K2MC 3MLVL 3QIWD 2NY3B 2RJMA 2XRAH 4F7TB 2HRLA 1FCCA 1MI5E 2VLMD 1I8LA 4GBXA 5MENA 5D5ME 3SHSA 1MCCA 2KBGA 5IMKB 2Y25A 4DWHA 2EDQA 4OZHA 4HEME 1G7MB 3OAUH 2NQCA 1Q0YH 5GRXG 4LSTL 3K4AA 5FA3A 2PW1B 3U9UA 3LQMA 1AC6A 4LMQI 2OL3A 1P7KB 1H8SA 1IGYB 4WI8A 4Z7WF 4XNZC 3FB8B 2IBZX 4OJFL 4MJID 1HHKB 1AR1D 1AO7D 4FQHA 5GHWH 1RK1B 3QDJA 4PTTA 5FUCC 3ET9F 2ICWJ 3TLRA 3NOIA 4HZAA 2NY5L 4YX2H 3WXWL 1F58H 3I02B 2A1WH 4HMDA 2W0LA 3S36X 4OM0H 2P4AB 4JRWA 3EDDA 4G9DA 1KC5L 2V2WB 1BD2E 1JTPA 1T89A 1FL3A 3MLYL 3MXVL 5BVJB 5T1KB 4LSUL 4JZNA 1EPFA 4LHUD 4ZPVB 1R0AL 2BNUB 4JQIH 4NM8H 1RUAH 2R0KL 4PJBE 1X7QA 3B3IB 4ZSOA 3LKOB 2WK2A 1IC1A 5J11C 4HXBL 3KDMB 1OSZA 1SBSL 3FO9A 4HKZB 2OZ4L 1CFVL 3QJHB 3RP1A 1EAPA 5I0ZA 4HKXA 1JWUB 1RJYB 3EHBC 3BE1H 3FB5B 4FQXD 4G9FE 1YEGH 4MLSA 2DYPD 5C0BA 5B3JE 2ZNXA 4PB9H 5BXFA 3S7GA 3LN5B 3HLAB 4G8GB 3GZKA 5EC2B 5EN2B 3JV0A 3TVMD 3CMOH 3U2SA 5GS2D 3PIQB 1HINL 5TFSH 1OB1A 4MD5B 1LO3L 3PQYA 1JNHB 1T1WA 1KGCD 3LRSA 4KGJA 4AIZB 4YHKL 4XPHL 5I1LB 2W1NA 4N1CA 1OGAD 3CFKA 5HYSB 1X5LA 1EMTH 2P5ED 3QRGH 5D9SB 4N5UA 5DJ0B 2F15A 5C0RL 5HSFA 3MRLB 2CQVA 1X5GA 2QQNH 1JV5A 4M7LL 2VC2L 2QL1A 4NPYB 4PRAB 4U05A 4B7LA 3N85H 4G8EA 4FQ1H 1GZQA 3ZZ1A 4XHJD 1ORQB 1I7UA 1MHEA 5C09E 5J06A 1WJ3A 4KTDL 5D7JB 4JRYD 2XQBL 1T1YA 4X98A 2EDWA 2X44D 5CD5C 1NC2A 3MGOB 5FYJL 5F9DC 1HHGB 3JWOL 4HUUA 4NNYB 3ZDZE 5F7FA 1N59B 2X5PA 4M62L 3GIZH 5HVGB 3OR6B 1J8HA 4I5BA 3SGDI 3DGGB 4LIQL 3V7AG 3BIAX 4M9PA 4BA8A 3T3MF 4MA1B 1FNHA 5E03A 4GS7C 4HC1H 4LKXB 1S7SB 2VQUA 7FABH 4R0LB 3KJ6L 2VOTA 1ZHKA 1AGDA 1RZJC 1ORSB 2ZCLL 2DQJH 2D2OA 3VXQB 3FRUB 4U49A 3PWPD 3FB6B 5CZXC 5KN5A 1X4XA 5LAXA 2NW3A 2VLRD 1LP9B 2YK1H 5FGBA 4QOKB 5C9KA 5GGRA 1CG9B 1Q9LA 4WFGD 2VDQH 1H3XA 2DBLL 2DQUH 4OZIA 3BN9C 4JO3L 4UOJA 5C0AB 3IXTA 1HHHB 1UVQB 1NPUA 5I1EL 2EH7L 3MGTB 1FSKB 3TT3L 1JPTH 4OZGB 5LWYH 3GI8H 2P5WD 3RWCA 3WN5A 3ULVF 1E6JL 1SJHB 5FHAH 4BK5A 2AXGB 3UTTA 1R5WA 5LGJB 1YY8A 4HULB 4P9HH 3SKOB 3F58L 1OM3H 2ESVE 1A3RH 4HS8L 3MUGB 1R3JA 4LCCA 5ALCL 1ZT1A 1XZ0A 2VWEE 3HC4L 5CKGA 3BWAA 3TBWA 2WBJD 2X7LA 1IAOA 4OLEA 4YXHL 1WZ1H 2ZZUT 3AUVA 4JFDE 4ZYKB 3QDGD 3MO1A 1A1OA 5KVGH 3OX8A 4X6FB 3ZYJA 4YQXL 5I19L 1UCBL 4DN4L 2BY1A 1NDGB 4LCIL 4OCRH 4MSWA 1U3HD 5I1DA 4JAMB 5GGTL 3HNSL 2AABL 2Z31D 2NY7L 2YPVH 3RUGE 4Z78A 1IC4H 1HH6B 2ED7A 2B2XH 2AAVA 1KXQE 3EBAA 2G5BA 1E0OB 3WNPA 1QPPA 3I6LD 3B9DA 4JANB 4D3CL 4KROC 2X2YA 1A0QH 1WBYB 1N26A 2GFBB 3BUYB 1KB9K 4WHDA 4XRCB 2XICA 5E4EB 1QSFD 4W6WB 4WEUD 2MQ0A 2IPUG 3N50A 4H25A 4JKPL 3TO4D 4F3FA 2M1KA 4DKEH 4M7ZB 3QUYA 3TWCH 2I9TB 4LNRB 4OLZH 3B2UC 1TZHA 2R9HD 1LP9F 4N8VA 4FFWD 3OJ2C 1N8ZA 1QQDA 1H0DA 1CDUA 1YQ2A 3BAEL 3SGJC 3BKJH 1XF3A 4MB3A 4CGTA 2DOCA 3I6KB 5IB2A 3VXSA 4CMHB 3PL6A 5D7SH 5F88B 1XGPA 1U8MB 4OCXL 1KEGH 3S97C 2P47B 3ZKXB 4OZGF 3DSFH 1K5NA 2FJHB 4R7DB 1ZLUH 1L6ZA 2VDMH 1MHHA 1GC1C 2KQMA 1I4FA 4R26L 1SYSA 1M6OA 4QXUL 4DAGL 4P57B 2W60A 1A6WL 1HSAA 4YHNA 1JK8B 1MIEL 1RUPL 3N1PC 4W4OA 5ESQA 1R3LA 3VXOB 1ZWIA 5DO2C 1I3RA 5I0DA 2V2TB 4XWOD 3V7MA 4N0UE 5I75C 5JW5A 3IDJB 5E6IB 4G42A 4OZ4B 3D3VB 3IETB 3U7WH 2X41A 2EEAA 3T77A 2OTUB 3MRMB 1LMKA 2HTLC 4K8RH 5E5RB 3RBSA 1DLFH 4Y1AA 3IU3B 1HIMH 3ZKNC 5KG9B 2DLFL 1W0WB 1WWBX 4O02H 3LY6A 4MNGB 4UIKL 4EN3A 5HVHB 3S35H 2XWTA 5I1GH 4LLQA 3KPSD 3MA9L 2D03H 2F53B 5DHYB 3NIGF 3UYPA 5JXAH 3V4VH 4QRQA 1CTOA 4URTB 3O3EB 2IAND 4LKCA 3VCLA 3GHBH 2Y36L 4ZXBC 1FORL 5C0FB 2JELH 1JPGA 1P7QA 2ZUWA 1WBZA 2ZUQB 1Z0NA 3SPVA 1RURH 3SO5A 3G6DH 5LXGH 1H15A 2J8UA 4AIXA 3DECA 2Y9RT 3D6GA 3ARDC 2VQTA 1OPGH 4G7VL 1NGYB 4NUGH 4XNQB 1MRDH 3OR7A 3UBXA 3BP7B 1UM4H 2P48B 4XMPL 2OTWB 3NFPB 4HK3N 3PGFH 5CEYB 2DWEA 3TA3A 4PRNA 5KZCB 3KS0J 4QT5B 3LH2L 5AAMA 3T0XA 1QSEB 3REVB 1NBZB 1B0RA 3QCVL 4GMSL 2W0FB 5F7MC 1MCKA 4M6ML 1PZUB 4MDIA 4UNUA 1NEZB 3L5HA 1U3YA 3K3QA 5DZOA 2A6JA 3KPRE 1N3NB 4QHLB 5CEXA 2ZOLA 4BZ1H 4OBSA 4PGBA 5J6GA 1OWWA 1KF9B 1K9TA 2OK0L 1P6FA 4PS4H 3GK8L 3QG6A 4IOIB 4R4NC 4ZQKA 4LSQH 2WUCH 5DGQA 1FZJB 5F9WB 2VAJA 2X4OA 4OD1L 4X4YA 3V79C 4KVNH 5ITFA 2ED9A 1HNGA 4Y16A 2ARJA 4RCAA 4V1DD 1EIBA 1XIWD 1J7VR 2CRYA 4ESKA 1A9EB 1OTTC 1TVHA 1X3DA 1YY9C 1LO4H 1ZSDB 3G6JA 4R90L 1V7NH 1NGWA 3C5JA 3NFNB 3TN0A 3WHE1 4S0SD 3DVFA 2AEQH 4QGTA 1BZQK 4OAWB 4YR6A 5MEQA 2I9LA 2W9LA 5SWZA 3WYRA 4L3EA 2V5MA 5FUZH 5B38A 2K9UA 3MROB 5EU3B 2IH3A 3WFDL 1V3JA 4ZS6D 3P0YH 1QKZH 3EO1A 5I18H 4PFEA 2XRAL 3CPLB 4WUUA 5LGHH 1Y6MR 1JPSH 5DJ8A 1MWAH 4HIHB 4I0PD 2VLKD 3QEGH 2UWEA 1VEMA 1M05A 3OAUL 1Q0YL 5M95B 2CXKA 4CN4A 3MBEA 3WS6C 3DUUB 3LEVH 4BFEA 2VXVH 1JNLH 3WCYA 3CX2A 3AS3A 4NUJB 2HVJB 3E2HB 4ZFZA 5DK2A 5HGHB 1UM6H 4TNVF 5I6XC 5LCVH 4J1UB 1D6EB 2N7BA 1SY6A 1F00I 4YX2L 1F58L 1YMMD 2A1WL 1URLA 5F97E 3LVEA 2MQCA 4ZDHA 3RWJB 4OM0L 4NQTA 4LHUB 4ETQA 1RZKC 3RWFB 2EDHA 4H5SB 5A2LH 1PY4A 2EYSB 5EBMB 1JHTB 4E9LA 4F37K 3DRQB 4QRSA 3CNKA 4NNXA 4JQIL 2NY2B 4NM8L 4M8VA 1S7XA 5D2NE 1RUAL 2B20A 2I5YH 4FXGB 3T09A 5FIEA 3FCTA 4U1MB 1D9KB 5J12C 4RMRA 4HUXA 2D3VA 5DEGA 2D31A 4MS8C 4OGYH 5HHVH 4PJDE 2BP3A 4ZUVA 4I77H 1UACH 4O51A 3FQXB 2BOCB 3BE1L 1YEGL 4P3DA 4YHLH 2ORBH 3FT4B 4RWHA 2BNQA 5IFJA 4PB9L 3CCHB 2P24A 1OAYH 5D93B 5EO9A 3WLBA 2EDLA 3MLWH 3G5VA 5EU7E 1OGAB 3CMOL 2P5EB 5TFSL 1OVZA 3IFOA 2NYYC 4LGRB 4KKLD 3IAPA 3BVNB 1EMTL 3QRGL 3G5XB 1BMGA 3BQUC 2QQNL 3MACH 2EDNA 1RUQH 3LEYH 4XPBH 1GGYA 3N85L 4JRYB 1QSZA 1OSPH 4Z7UB 4FQ1L 1CD0A 1B90A 4U1KB 4G3YL 2Z8SA 3GGWA 4JVWA 1R3KB 3TBSB 1MCIA 2WINB 5DD1H 2HT2D 1H3WM 5HY9B 4OLUH 2H3NB 5J1SC 1V7ML 4PJGB 4MAYC 1NQBA 1CLYL 3KPOB 4BZYA 2J4WH 5IWLC 4X5LA 2RFXA 5K93A 1KG0A 1A6TB 4PJCB 4WU7A 3H9HB 5EIQA 4M48H 4NN6B 2IEPA 2QJDA 4QWWC 3GIZL 1EEYA 4ERSH 1FE8H 4KJYB 3RBGA 4YBLC 5IFHH 4PJHF 3OGCB 1PQZB 2BSTA 1XGTA 4PTUB 1JGDB 4YJZL 5AD0B 1WV7T 1ZVSA 3PWPB 4HC1L 2OI9B 3IXAB 4NC2B 7FABL 3HAEA 4JFEE 2AV7A 1DVFA 2D7PA 3FQWA 3F7RA 2FH8A 2DQJL 2VLRB 3BWUC 4QRPD 1WFUA 4XAKE 2NZ9C 2D7MA 4IRSC 1F3JB 3E1F1 3PXHA 4O2EA 3IS1X 2YK1L 4PV8A 5DMKA 3C5SA 4PRBB 1UJ3A 3QXAA 4I3SH 4OQTH 1X5JA 4UAOB 4PJ9C 2VDQL 1QLFB 2DQUL 4XTRC 3UPCA 3KJ4B 1PG7W 5DHXB 3Q6GH 1BEYH 3VGHA 3MZTA 4HUKB 1JPTL 5TGBA 5LWYL 4ZUSB 5FHAL 1RI8A 1DTUA 3O6LH 4P9HL 3MRFB 5EO0A 1O7VA 3MRQB 3WS3B 1DN0A 1S9WA 3QDGB 1OM3L 3C87A 1A3RL 4Z7UF 1CD1B 1DZBA 1TCMA 5DFVD 3UTZB 3OKMB 4EDWH 2EKSA 1D5XB 1ZT4B 5E00B 2X89A 5C6WH 1U3HB 4U1NB 4MNQB 5D70H 1S9VA 2Z31B 3VXME 4NO0B 1WZ1L 2HLAB 1OARH 3SDCC 5MHSE 1OLZA 3HPJB 4K3GA 1E27A 2WBKA 5C0DA 5KVGL 3P4MA 4YO0A 2Y06H 4PLOB 2G9HA 3VXUE 3GSVA 4OCRL 3VFTB 4PJGF 2YPVL 4MGXA 2F8XC 4P23A 4PJCF 1IC4L 4A6YH 3EO0A 3RZCB 4RIRB 3ZKSD 2B2XL 4KDTA 4L29A 3S3PA 1J87A 5DC9B 4NFBA 1O7SA 3ARGC 1QSFB 5E9DA 3OXRB 4OUUB 1S7WA 3TO4B 2FWOB 1DQTA 3EHBD 5JW4N 1MVFA 1A0QL 3VH8B 4N8PA 4OLWH 4XP9H 3X17A 4U1HB 3UZQA 1TNNA 2B1HH 2C3VA 5L2KA 1NDMA 3W9DB 4DKEL 1G0DA 4YFLI 3X11B 1EUUA 2JJTC 4QHKI 3TWCL 3DMMB 4OLZL 1IEAA 4PRPE 3LKPA 4PJ7B 3MJ7A 4CNIA 1MSPA 4CVUA 5KAQF 5F7YC 4XBPB 2Q87A 1MUJA 1XH3A 4DGVH 1MLBA 2CGRH 2V7NB 3GB7A 5D7SL 2BNRA 1KEGL 4HV8B 5HVFB 3DV4A 3QEQB 1I1YA 2G75B 2DTSA 5DXWA 3VFWA 5DJAB 5I66B 1KLGB 3DSFL 3PP4H 1FZOA 3UPRA 5INCB 3Q2CA 2VDML 3FO0H 4IJ3C 2APBA 5HHPA 4CMMA 3BUTA 2LU4A 5CD5D 3L9RA 1JGUH 1PKQA 1ZHBB 4JGJA 3QULB 4LVHB 2YPLD 2XI9A 3IKCA 3MV8D 4LNVA 3OB0H 1QRNB 1KIPB 4LLMA 4KI5F 5J4MA 2BK8A 4OKDA 1P4IH 4TVPE 3MOAH 3MRCA 1AY1H 1Q9WB 2EYTB 3ECBA 4KKBC 3QI9C 2EYRB 3GMLB 3BW9B 4RNRB 3HHRB 3LKNB 4B41A 3LQZA 5F44A 2QHRH 5HHMD 3U7WL 1F02I 3C09C 3G6AB 2R2BB 3M07A 5ECJE 5EORH 4K8RL 1G7LA 1DLFL 5F1IB 1HIML 5CZXD 3EYFA 1IM3A 5IB5B 3S36H 1MAKA 4PJEB 3QQ3B 4O02L 2Q7YB 3OKOB 3T0DA 3SE3A 4P3WA 5FYJD 3BN9D 5I1GL 2D03L 4UIMA 2APTA 4JFOB 1ROWA 5JXAL 1SQ2N 3DXAD 2MSPA 3V4VL 1Q9KB 5K33A 3UXFA 1K6QH 1UB5B 3GHBL 1U8NA 4PJ7F 2F8OA 3VGFA 2IPKB 4NQVB 4K7PY 2ZUXA 5DMJB 3LZFH 1L0QA 4CW1B 3WNMA 3UTQB 1RURL 3G6DL 5GRZA 5LXGL 3WJLA 5D2LA 3PWJB 3V8OA 1JUFA 4K8RC 1NMAL 1OPGL 4NZUH 2I25N 5BRZA 2HN7A 2Z92A 1MRDL 3RL2B 4HUVA 1BWMA 5GRWA 4ELME 1UM4L 4LCWD 3PGFL 5HGDB 4S1RL 4C57C 1F6AB 2EIZB 4Z7VE 1QZ1A 3I75B 4O5LH 1QR1A 4G6FD 3QWOB 3CXDH 3QUMH 3MREA 3BP6A 2FBJH 5CWSB 4RGNE 2ADIA 1CDHA 4GW1B 3OF6A 5IVXE 4NJAH 3BDXA 2D9QB 4Q2ZB 2C4FU 5DRWB 1WAAE 4RMTA 1BBJB 5E95B 3ABZA 5T1LD 2YUZA 2VDPH 3U4BH 5FGRA 4KROD 1EDQA 4MD4A 5GS1C 2D7TH 4V1DB 1ND0B 4PS4L 2Q8AH 4NYLA 5KS9E 1XIWB 1S7UB 2NY4C 1LVEA 4AQOA 4LSQL 2WUCL 4U7KA 4M93C 4U6HA 5LJYH 4JFPA 4KVNL 2CR6A 3PUCA 3INUH 1TJHH 4X6BA 3B2UD 4PJEF 2AEWA 5D1QA 2C7UB 2AK1H 2UZXB 4JDZB 3W39B 3KXFE 4HWBH 1BF8A 3VFMB 1XR9A 1BP3B 3Q1SH 2AEQL 4JZOB 5J1AB 2CK0H 4YIQB 1YNKH 2FIKB 4G6MH 1VCAA 4I2XB 2XFXB 2EC9U 4G8IA 3PWNA 5FUZL 4OF0A 2LABA 1OY3B 5HHNB 5TDNB 1XF2A 2BMKB 4ZO6A 3P0YL 2X4NB 4I0PB 2VLKB 5CSBA 1QKZL 4N0FB 5IIEA 2I07B 5I18L 1FZKB 2A74A 3FB7B 3H3BC 5LGHL 3G5ZB 3VGAB 1JPSL 1MWAL 2L7JA 3MRHB 3NTCL 3QEGL 1OHQA 5C08A 2A6DB 1U58B 3VD4A 4XNYH 1GGIH 1E4XL 1WIPA 4WFEE 5DO2D 1ZGLA 4YHPA 5K9QI 5E2JA 5KJRH 2OP4H 1C12A 3LEVL 2VXVL 3C2AH 1JNLL 2H26B 1FAKT 3S5LB 4AEFA 4XZUA 4IDJH 1YMMB 2JB6A 2B4CC 3FONB 3L3DA 4KJWC 4B7IA 1UM6L 1CICC 2GSIA 3WE6B 2FYYB 5LCVL 3X13A 2DQEL 5GSRB 2HTLD 1MFCH 3HE7A 1TLKA 3QUXA 5H2BA 5ADPH 1WC7B 3ZKND 2A6KA 3ZYOA 4KKCC 1OAZH 3O6FB 3UO1H 3I6GA 1CL7I 4IRJC 2JJVA 4PJAE 2AXFB 5FGSA 1CGUA 1P4LB 4RX4D 4H1LH 1IL1B 2BY2A 3SOBH 5IGXH 3Q5TA 1YA5A 2EDTA 4NO3A 5JHDA 2I5YL 3MJGX 4R8WH 3VXRD 2JB5H 4ZXBD 4CU7A 4HWEH 1CDCA 2O5XH 1SYVB 2EEBA 1FYTE 5GXBB 4OGYL 1L9NA 5HHVL 3LPWA 4Y4FA 4I77L 2J5LC 1C1EH 1FVDA 4DZBA 2WAHA 3BD3A 3AXLB 4AJ0A 1ERNA 4YHLL 2ORBL 4UBDC 2ENSA 1TXKA 5FYKD 3ARDD 5HVWA 1OAYL 1F4WH 1Z5LA 5DEFA 3MLWL 2ATPA 2OXHA 1KEMH 3AS1A 1JN6A 1JF5A 1FGNH 2ZP0T 1MCOH 2Q76A 4UOW0 3RWDA 4JCLA 4NWTH 3WFEH 1CLOH 4OF6A 3IDNB 2EH8L 4CU8A 4X6CA 3MACL 3TPUB 1A4KA 3E6HA 3O4OB 2IFGA 4ISVA 1RUQL 2DQDH 4WNQA 3NIFF 3LEYL 1I8IA 3BHBA 4XPBL 4RMVA 3ZKQD 1EZVY 2UYLB 3MNVA 1OSPL 2WIMA 3L5WA 3LKQA 3NFSL 2FHBA 3HUJB 5BZWA 2VAAB 3KHQA 5EUOE 3ZL4H 3C6SB 4XGZA 4WJ5B 5DR5L 3ZHKA 1RIUH 4YH6A 1JZ4A 4R4ND 3ZHDA 4PRIE 1EFXA 1CZ8H 5DD1L 4L4TE 3T04D 5ANMB 4K3HA 1LK2A 4OLUL 4M7KH 2FEEI 2HFFB 1UXWB 4E5XB 1S7TA 1AGCA 2J4WL 1CWVA 4XPFH 1OTTD 4M48L 2YWZA 1CLCA 1FJ1B 1YY9D 4XCEB 3O4LE 4ERSL 5DQ9A 5IEKB 1FE8L 2ADGA 3NPZB 5IFHL 3C2SA 3OKYA 4RFNC 2GTZA 5F1OB 3RKDC 2YD1A 5IHBA 1C8PA 1KPVA 3EYUH 4JRXE 1G9MH 2Z4QB 1T22B 3F6LA 2MCPH 1JGLH 1QBBA 1ZHNA 3CZFA 1CT8B 4D0DA 3QZWA 1A02N 2YRLA 3QFJE 3VRLF 4I3SL 3P9LA 4OQTL 4PP2A 1PYWA 3LKRA 3ZSTA 4YDVB 4FXKA 4EIGB 1P4BH 4XNZB 3GM8A 3MRJB 3Q6GL 1BEYL 5AWNH 5IR1B 5GS0C 3T3PF 3MRBB 4R7NB 4ODSL 1BVKA 4NRXB 4YFLF 3B9KC 3EYVB 4M6NH 4N8CH 4OIBA 5E2VH 3CLFH 3O6LL 3TESA 1T20B 1E4WH 4LL9A 4IS6B 3PABB 4EDWL 4WY7H 4EXKA 1ZTXH 2BOBB 3HUJF 5BMFH 4EI5A 5SWSE 5D70L 4ZNCD 3HE6C 2C9AA 1OARL 5CUSL 4JY4B 5J11B 2Y06L 3U48A 2WW8A 5HYFA 3QFDA 1AI1H 3U0PA 4L4VE 1ETZA 5IW1A 4A6YL 4OZFB 4K9EH 4AK1A 1R5VB 3E6FB 2EE3A 3FQRB 3ROLA 5F89B 4MS8D 5EO1A 3IS0X 4X5XB 5IK3A 4YHZH 4PJ5D 4HFUL 3L95B 4JVPA 4OLWL 4XP9L 5EZJA 3C5ZC 1A2YB 3GM0A 1DBJH 2B1HL 2XN9E 4EXPX 4NOFA 1MEXL 3ULUC 3QJFA 4OCMC 1AGFB 2L7UA 1BM3H 2HG5A 3VI3F 4XXDB 4Z7WE 5E8OB 3VFOB 3ULSB 3UX9B 4XBGB 4WI6A 1MOEA 2A2QT 4GRWB 2NYYD 5JOFA 1CR9H 1MLCA 4YDJA 3LS5L 4JN2B 2C3GA 3BD5A 4NOBA 4Q6IA 5IBUB 5ACZB 1IVLA 1N64H 3BQUD 5FUOH 2CGRL 3PHQB 3MV9E 1DUYA 3FHQA 1IRAY 1FDLH 4S2SB 4F7TA 3UCRA 4BKLB 2IAMC 3ZT7A 3B43A 3O81A 3V4UH 2LAAA 5IMKA 5IMLA 5B39B 1ZA6B 1IT9H 2VN4A 3TP4A 2YPLB 3FO0L 3GKZA 5IOPA 1K3ZA 4EUPH 4NKDA 1AQKH 2PW1A 4WWID 1XCQB 3KHOA 1JGUL 2BVEA 4LQFH 1I7TB 4R6UA 2BSSB 1P7KA 4MAYD 3SKUD 2C26A 3AFLA 1HILA 1UEMA 3H9SD 2DN7A 4GS7B 4AL8H 5HYIA 1P4IL 4QWWD 3MOAL 1AY1L 3D0LB 5HHMB 1J9CT 3QXVA 1IJ9A 3I02A 4JHAH 4APQA 3QUZC 2BVPA 1WQVT 2EO1A 1ZVHA 2OSLB 1A6AB 5BS0B 2J6EL 4JQXA 3ZDXF 1IKFH 1MVUB 5ETUA 2QHRL 4HH8A 3ALXA 3K80A 2V2WA 3GO1H 3WXVL 5EORL 1RHHA 5BVJA 5E7BA 5T1KA 1QYGH 2NZ9D 3L3IA 4CN6A 1HCFX 2AERT 1FP5A 3OKDB 4IRSD 2M2DA 4MJ2A 4ZPVA 3S36L 1KBGH 5IB1B 5IVZB 5T3ZE 2OXGA 3DXAB 1BHGA 3LD8C 4PJ9D 3SGKC 2ERJB 4UNVA 4HKZA 5GJSH 2ICWA 4XTRD 4Z7NE 1JWUA 4RFEB 4JR9H 3KWWA 1K6QL 4GRWF 5IQ7H 3LN5A 1BQLH 2X4UB 5K9OA 3V5KB 3QQ4A 3V6ZA 1LNUB 3HS0B 3LZFL 1G7JB 3QPQC 1JNHA 4X6DE 1VSCA 4AIZA 3T1FB 3TF7C 2FEEL 2ZPKH 2NX5E 5I1LA 1YEDA 2XZZA 4UILH 4NZUL 3JV6B 3E3QE 5D9SA 4G6FB 5DJ0A 1X5HA 3MRLA 3L3GB 4NPYA 3SDCD 1EO8L 4PRAA 5T1DH 4IOSD 2Y5TA 1P84K 4X7CC 4V2CB 1IAKB 4O5LL 3VE0B 4FQIH 1ORQA 3CXDL 3P73B 4NC1E 1T2QH 3QUML 2FBJL 1L0XA 5T1LB 5CBEB 4KJQC 5D7JA 2FH6A 4I18C 3GFUA 5HPMB 4JKWA 4NJAL 4KROB 2ZUVA 4JHWH 4QXGH 2BVUA 3V6FB 3MGOA 5MI0C 4HG4K 1I1AC 3IJYB 1HHGA 3ARGD 4KRNA 2VDPL 2Q86B 3U4BL 4GKZB 2JJSA 3L3JB 4NNYA 1HZHH 3IGAB 1A6ZA 1A1NA 1N59A 1P9MA 4G8GE 2D7TL 3PF2A 1RQ5A 2Q8AL 4NN7B 3K74B 2G60H 4Y5YB 1B6DA 3OJDB 3DGGA 1Z9LA 5DVOA 3WV0A 1G1YA 1TJHL 4IHOB 1S7SA 4R0LA 2EDJA 3TFKC 1ORSA 1IGCH 5L7XH 5HGAB 3VXQA 2AK1L 4B0MM 4HWBL 4JGUA 2F5BH 4P4RB 2ADFH 3X12B 5DI8B 3Q1SL 1LP9A 3R0NA 3S9DB 2CK0L 4Z76B 3FN9A 4QOKA 1NCDH 1YNKL 3LPFA 4G6ML 3JTTA 1VA9A 1WWAX 1CG9A 3DO7B 1V05A 1U93B 3QG7H 4JM2A 5FB8A 5DK3A 3DV6B 1SMOA 2KDGA 3R8QA 5C0AA 1HHHA 1B2WH 2RQ8A 1J18A 1QHOA 1UVQA 2BHZA 4OIIH 43C9B 2APFA 3MGTA 2IG2H 1N5AA 4I48B 3WKNA 5MERA 1ODAA 3OGOE 1T1XB 5LGJA 4KDVA 3HNTH 5D1XC 4XNYL 1GGIL 1OP5H 3V52H 3SKOA 3BSZH 1QR4A 4FHBD 5KJRL 2OP4L 4KKBD 3QI9D 3C2AL 1B9ZA 4HIJB 3H3PH 5JA9A 4HPYH 4YGVB 4IDJL 4RGOH 3SDDA 1T80A 3CGTA 4ZYKA 3VWKA 5E08H 3HR6A 4X6FA 1MFCL 4LPWA 1NDGA 4ZOCA 4UB0H 4X4ME 4NQDD 5ADPL 2P8LA 3HZVB 1XCTB 3UO1L 2LQRA 4MA3A 1HH6A 2CRIA 3B83A 3EJJX 1F4HA 5AG8A 3FO2B 2CXGA 3JVGA 5F9OH 3MUJA 3VXRB 4ZXBB 4U1SB 4OZGE 3MYZA 5IGXL 3UTOA 2GFBA 5ID1B 4XRCA 5E8NB 2JB5L 3GMOB 2YD6A 4HWEL 5H94B 2O5XL 5KOVC 5HDLA 3QWRD 3AAZB 1P7HL 2J7LA 4PIRF 3VFNB 5HI5C 1GRWA 1C1EL 4GAFB 2I9TA 4H26A 4LNRA 5C0GB 1ZXQA 3M8OL 1F90H 2AK4A 4JY5H 4ONHB 5FECB 5CINL 4MX7B 5D7LE 4K8RD 1F4WL 1MI5B 2DKSA 5GS3A 5D5MB 4W4NA 4D0BB 4P5TD 3I6KA 5C0IA 4FTVD 1FGNL 3V0VA 5F88A 1MCOL 1U8MA 4PD4J 5GIRB 4RA0C 4TOYL 4FNLH 4K7PX 5GGTA 4NBXB 2VZTA 4NWTL 3WFEL 1CLOL 4H1LG 1HXYB 1H8OA 2VJXA 3PWVA 2FL5B 4N5EC 4P2CG 4Y19D 2R15A 4FRWA 3QR2A 4R7DA 4P46A 1Q94A 5KANG 4LEXH 5FKPB 4WHTB 2HJFA 3QIBA 4LPVA 1DN2A 2CRMA 3DX8B 1H3TA 1JMZA 4P57A 2IQ9H 4L5FH 4P2OC 5DD3H 1P6AB 1JK8A 3O41B 5ICZB 1ZE3C 3ZL4L 1AQDB 4WTWA 1RIUL 3RJDA 2P44B 4YHIB 5J3HC 2NY4D 3VXOA 1CZ8L 3GIVB 1I8LC 3SKJL 3LQAH 1FNSL 3ME0A 3H8NA 4GBXC 4WRLA 2O93L 2A0LC 2V2TA 5CSZB 3ARPA 3S96B 1WBXB 2X1PA 3CK0H 5L2JB 4A2MA 4D94A 4XPFL 1SJXA 3IETA 4BFIB 2DKUA 3MRMA 2OTUA 4PJBB 1UADC 4I9WE 3CFEA 4R4FH 4FQLH 2X9WA 1NUGA 4NHUB 3SKMA 2ZKHH 5DFTA 3CFIC 5HYJD 1W0WA 1UA6H 3FFCD 3NH7H 1BBDH 4G9FB 4Q9QH 1G9ML 1CE1H 2UUDH 2CLVB 4YBQC 1ZOXA 3TH4T 2MCPL 5HHOD 1JGLL 3EOTH 2GY7B 3MZGB 2BSRA 1IILE 1PGRB 4HWUA 4F33B 5DHYA 3ARRA 5C07A 1W8OA 3ZDYF 2Q6WB 3FT3B 5JO5B 3Q6FB 1N7MH 1T89C 5C0FA 5CBAB 4E41E 1RZIA 3L7FB 4TSAH 5CGMA 1KB9J 5D5MF 2AQ3A 4Q74A 1P4BL 2C1PA 1VGKB 5AWNL 3QNYB 3STZB 3D3VE 4WV1A 1MAJA 3W0WD 3OB8A 2YXMA 1NGYA 4XNQA 1FO0B 4M6NL 4N8CL 4RZCB 4KJWD 2IGFH 3NFPA 3P0GB 1RSFA 5CEYA 5E2VL 3V5HB 2H9GA 3CLFL 1CICD 1G6RH 3H6JA 3GI9H 2H2SC 3QCUH 1E4WL 3HC3L 2RR3A 4XCYB 3REVA 4FQQA 4NQED 4WY7L 2W0FA 4AEIH 4MNGE 1ZTXL 4KKCD 5DZLA 4X9HA 5BMFL 2XIDA 4IRJD 1AH1A 5E4IA 3KLHC 4RQQB 4LLYA 3VFPB 4O4YH 2F53E 1K4DA 2XACC 1LK3H 3B9AA 4HJGB 4ZPTB 3EDJA 5I1JH 5J12B 2XT1B 4M43H 4Q6YA 3D18A 1CGTA 4K9EL 1ONQB 2QSQA 1WGOA 3U82B 4PJBF 3BJ91 5I8KH 4JVUA 3KPPA 1KNOA 4Q0XL 4IBLT 1KIUA 3FTGA 5IB4A 1TQBC 4YHZL 1A9EA 4KXZH 4XC1H 2F54A 3C60A 5FO9B 1E4KA 1ZGLM 4UBDD 4M9OA 4AENA 1KPUB 4M1GH 1ZSDA 1DBJL 4POUB 3IDUA 4P2RD 3NFNA 4J4PA 3VFVB 2GY5A 3QSKB 1BM3L 1CGWA 1QSEE 3IDYC 4G6KH 3L7EB 5F93C 2AV1B 4OAWA 3RNQB 4NDMA 3BQUB 4OM1H 5E94B 4R4BA 4UUJA 1AHWB 1CR9L 2IC2A 1GGBH 3MROA 1DUZB 4JQVA 1YEKH 4JFFD 1N64L 3WIHA 5FUOL 1FDLL 4Z95H 3RA7H 3WIFA 3CPLA 1W0YT 3V4UL 2ESVB 1IT9L 1I85A 4U3CA 4MAYB 1FFOB 1E6OH 2VDKH 4WTZG 1UWEH 1AQKL 5DK0B 1Y0LB 4CVZB 3H9SB 4JFDB 4GRMB 5F9AC 4RMUA 3DUUA 4LQFL 1A7BA 1FFPA 2YXFA 4JREC 1BFSA 3D39E 4MXVE 1JCKA 4YBLB 2HVJA 5HGHA 1PFCA 3LDBC 1NGZB 5GRUH 5FOJA 3VXMD 4OFVA 2YD8A 3RUGB 4PG2A 3G08B 4KZDH 4JHAL 2ZUUA 4CKVX 4XI5C 3VDAA 3WN5C 3ARFC 4NO5B 4PJFA 3PDDA 3RWJA 4JLRB 3RKDD 1NMBH 2VLME 1IKFL 4IRSB 4BSVA 4C58B 3FQNA 4BELD 3GO1L 1PEWA 4H5SA 4DVRH 2EYSA 1LILA 3LSOA 4PJHA 3DYMA 1JHTA 3K81A 4TULH 4LCCC 2CDEB 5CJBA 1QYGL 3G04B 4PJ9B 4KK6C 1VESA 1WZKA 2N56A 2BERA 4MQXC 1EK3A 4EUPG 5TH2B 4FXGA 1YYMH 2DLIA 3NCFB 4G5ZH 4HGWB 2FLBT 1ZS8B 3BXNB 1D9KA 2UZIH 3HG1A 4MJIE 1RULH 5GJSL 1AO7E 4QHNB 4KTYA 3PXJA 1G7IA 4NRYB 2WP3T 2BCKB 2BOCA 3UZVB 3C9NA 2KKQA 1YEJH 3R4DA 3FT4A 5GS0D 3CCHA 5IQ7L 3TJEH 1CVRA 5K59E 4HF5H 1JVKA 2AJ3B 3B9KD 4L8CA 4UTBH 4YHOH 1I9EA 1A6UL 4PR5B 3F12A 4O2CA 1JL8A 1N2RA 5C9JB 5CLTA 1VADA 1ES0A 4GUPB 5CP7A 1BQHG 4L8SC 3SDCB 4YDLB 1I3GH 2ZPKL 4PP1C 1NFDE 1JGEB 2X4SB 3BRFA 4UILL 4PGCB 4TNVK 3G5XA 3WMSA 4PGEB 1CGYA 4YEEA 3HE6D 4N8VG 3SO3C 5T1DL 3NZ8B 5K9KB 4KI1A 4Z7UA 3QHFH 4U1IB 1TVBB 4FQIL 4U1KA 1T2QL 1YN6B 1ZA3A 4NCC2 1R3KA 5DJCA 4KFZC 1CFSB 1MCLA 1VGEH 4N0UB 5CEZH 1RIVH 3P9MB 3PL6C 4M00A 4X7EC 2FDBP 1X9QA 2WINA 4TVPD 4JHWL 1OGTA 4QXGL 3RUGF 4J3OC 4D9QD 4PJGA 2NXYB 4KUCF 5C8JA 1CQKA 3KPOA 4TSCH 5L8LB 2VUOA 5C0CA 1HZHL 4PJCA 1KGCE 3O3BB 3H9HA 2CKBB 1KCVH 1CGSH 3VU2A 4H0GA 1OGAE 5ESVA 1JWSA 1KTRL 2ADJB 2C3XA 1UG9A 3C5ZD 2G60L 4KJYA 3OGCA 1Z9OA 3ULUD 3MNWB 4I4WA 1JGDA 5I1HH 3IXAA 2X70B 3GUTA 2YSSB 1R3IH 4QRRD 4MJ5B 1IGCL 5L7XL 2VO5A 1F11B 1F4XH 4HUNB 2OR7A 5E8PA 3OPZH 2F5BL 2GK0B 5DHVB 4EJ1C 2ADFL 1A6PA 4ZFOB 3MCKB 1KV3A 2D4FA 3OSKA 1W2KT 3B8YA 3BEVB 3BZFB 4IJ3B 1NCDL 2IAMD 2GJ6D 5L2KE 3QG7L 3EDFA 4NKMB 2ITCB 5JDSA 4QY8A 1FHGA 2D0HA 4G6AC 3HNVH 2GSGB 1UEYA 4OIIL 4EN3C 4DK3A 2IG2L 5CD3B 4ZUSA 4J3SA 1LDSA 3QI9B 1NLDH 3UZEA 2DLHA 3HNTL 3KGRA 3F7QA 3V52L 3MRFA 3MUZ1 3BSZL 3PWPE 1U8KB 3MRQA 1SM3H 4BZ2L 4JJ5B 3C09B 5EZIH 2IJ0C 3UTZA 3OKMA 2OCFD 3QUZD 5E8EA 3H3PL 3RGVB 3KPRB 2VLRE 4HPYL 2ZUTA 4FQPA 1U92A 4RGOL 4U1NA 3TIEB 4MNQA 4XP6H 4LPCA 4NO0A 4WFGE 2HLAA 3CXHK 3HPJA 2PTUA 1S9YB 1PKQE 3TM6A 5E08L 5ALBH 1S9KC 5HD8C 4MNHB 4UB0L 1Z2KA 1IKNA 2N1KA 3MJ8B 3UBXG 5I9QC 3TA3C 4H0HB 3JXAA 5T5FH 1U6AH 1SMAA 3BH8A 3HR5A 3RZCA 1FZMB 4RIRA 2P5WE 2DICA 4LSDA 4EZMA 5F9OL 3SE9H 3KYOB 4NQCD 3V8CA 3QUKB 4HCRH 3TO4A 2FWOA 4Z6AT 4LBEB 3VH8A 2PNDA 2X1XR 3LCYA 3WNOA 1CXFA 3QDMD 4U1HA 4XP4H 3DIFA 3W9DA 3VGGA 3QDGE 3X11A 4NGHH 4G8FB 3DMMA 5ABDE 3QPQD 4C56A 1F90L 4JY5L 2A6IA 4FTVB 1FFRA 2VDNL 4PJ7A 2FHFA 4P2QD 1EHLH 4Y16C 5DS8B 4Y19B 3FFDB 4Y4HD 2X42A 3QEQA 2G75A 3I6LE 4FNLL 5DJAA 4K7FB 5A2FA 1KJVB 2AJSH 1YJDH 2YPKB 3TN0C 1LDPH 3RWEA 4WWKB 5GRYA 4KJQD 1UH3A 4D8PA 4LEXL 4ZO7A 2X4RA 2W9DH 5ACLA 5GS1B 3OQ3B 1ZHBA 5B38G 5I16B 3QEHB 4TUOB 1I1AD 4F37F 1BZ9A 3BZDA 4M93B 4JO1H 2IQ9L 2V7HA 4L5FL 5DD3L 4L8DB 5E99H 1QRNA 1D5ZB 4HWNA 3P2TA 1NAMH 1A3QA 3CVIH 1LEIA 2Z35B 2EYTA 1Q9WA 4N9GB 3OG4B 2EYRA 3MC0A 2ZCHL 3WEXA 3RNKA 3UPAA 1WUNT 2AXJA 2XWJA 4RNRA 5IJVB 3CK0L 1CN4A 3K8MA 5E2UH 3WFHA 1JTTA 2FHCA 4W68A 1IGTB 2PR4H 4DVBB 5D2NB 3TFKD 4MWFB 3MBEC 3G6AA 5HYJB 4QTHA 5F6HJ 1QD0A 2E6PA 3FFCB 3FRPA 4R4FL 4FQLL 5EU4B 4NKIH 2PW2A 3QHZH 5F1IA 2DJUA 4HLZG 1J0IA 2ZKHL 4PJDB 4PJEA 2HT4C 3NH7L 2C3WA 2KL6A 2Q7YA 1BBDL 3OKOA 1CE1L 1CDBA 4EBQH 5J0BA 3EOTL 1HH9A 1LEGB 4JPKH 5F1NB 2Q8BH 3QO0B 5ICYA 5SX4H 1N7ML 2PYED 2NXZC 4PREB 1I8KB 1UB5A 3UTSD 1KCLA 5GGQH 3F6IA 5AZEH 5C3LD 2IPKA 2D9CA 4NQVA 2DBJA 2I60H 4BH7A 4M7JH 4TSAL 3MMEB 4CW1A 3AB0B 5H35B 2XY2A 2DRUA 3UTQA 3BIBX 3LV3A 1PX4A 3QAZC 5EU6A 1YC7A 1CICB 5HHQA 3PWJA 4QCIB 4HXAH 4IMLA 1C5CH 2VZVA 2O61A 2IGFL 5CJ5A 1KB5B 2Z0BA 3GI9L 3OKEB 1F6AA 2EIZA 3NACL 4IRJB 3T0EE 2CLRB 2FO1A 1XMWA 3KPSE 3QCUL 4QRTA 2WMPA 1MHCA 4CVXA 4AEIL 3T4YA 1S8DB 1GSMA 3QXDB 5CWSA 2IANE 3DSNA 4JHZA 4FN0A 4JDVB 1G9NC 4PRID 4O4YL 1U8OA 5DJZA 4IM8A 2NY0C 1L7TH 5IESL 1N0LA 1BBJA 4JY6B 1BIIB 5I1JL 4U6YA 2AI0H 4M43L 5F3HA 4Y5VA 1RIHL 1JWMA 1ND0A 2J5LB 4F7EB 1I9IH 3N1FC 4XCNA 4P5KA 4JFEB 2BC4B 5DRNB 5I8KL 1DQDH 2VNCA 5HI5D 1FGVH 4PJDF 1QEWA 4XC1L 2C7UA 1JNNH 2R1YB 4JDZA 4HX1B 3W39A 4M1GL 3GBNH 4AMKL 4YFEA 3VFMA 1BX2B 2CO6B 1PJ9A 1G6RB 2WV3A 4G6KL 4JZOA 3RDTA 5J1AA 2WWKT 4GSDH 4OM1L 4YIQA 4PGDA 2FIKA 3QFJD 3BIKA 3QQ9C 4I2XA 2XFXA 1T7WA 1U8QB 4V2BA 4KK5C 1GGBL 4N90D 5HHNA 4N5ED 5FM5M 1YEKL 2X4NA 4N0FA 1DVFC 2I07A 4Z95L 3RA7L 3D2UD 1FZKA 2AJXH 3FB7A 5BQ7B 3CVHB 5SV3A 3G5ZA 4V1DE 3D85D 5IG7B 3MRHA 3HMXH 5LGKA 4P2OD 2A6DA 4LLUB 1U58A 1E6OL 4R3SB 2VDKL 1BFTA 3NCEB 5J3HD 3A0OA 1UWEL 1UJ3C 2H1PH 2O5ZH 4GW5A 1BZ7A 3VXMB 3F5WB 4GBXD 5MEND 4ODWB 3W5MA 3OV6A 2A0LD 1KTLA 4F15C 5A43C 3BZEB 2H26A 2H32B 4RDQF 3VXUB 4BQCA 4JG0H 1HXMA 3FONA 4NCC1 2AGJL 3THMH 4DW2H 5FK9B 5AAWA 5GRUL 1WIOA 2MKLC 4LHQB 5B4MC 3LIZH 5AUMB 5BV7C 3OKKB 3VG9C 5MEPA 5GSRA 4LPYA 4KZDL 5T33H 3BEWA 4MB5A 1WC7A 3K4ZA 1W72B 1FNLA 3O6FA 2XTLA 4OUOA 4U1LA 1NMBL 2AXFA 2X10A 3BKCH 1G7QB 2VLKE 4E0RB 3TVMC 4TULL 4GXUM 4OF7A 5KSVA 1IL1A 1I3UA 5AZ2H 3MLPA 1F3RB 1R24A 5CIPB 3NPSC 3D25B 4LPTA 1YYML 2YS4A 4G5ZL 5B8CB 3SJVA 1FV1B 3NIFE 1KJMA 2UZIL 1SYVA 1RULL 5F1SA 4MMZC 1NKRA 4P23C 3B9KB 2JF1A 4LPUA 3MFFB 3RWGB 1KLUA 1YEJL 5F71A 5T3XH 4LSRH 4KDTC 4OGXH 3ROOA 3TJEL 4HF5L 5DJDB 5BVPH 4UTBL 4YHOL 3MV9D 1DQLH 5C0BD 1ZHLB 1LEKA 4J8RB 1BOYA 1IZKA 3G5YA 4HKJB 2G2RA 1HHIB 3SE4C 2QADC 1I3GL 3R06B 4ZAKC 5IMMA 5KSBE 5DTFB 1T3FA 2E8YA 3HTLX 3TPUA 2VXSH 3KLHD 3PQYD 1JZ5A 4MA7H 2E9JA 3QHFL 1OAUL 2BVTA 3HUJA 3V6OE 2EDBA 1VGEL 2DQFA 1LHZA 2VAAA 3CLEH 5CEZL 1YEFH 1RIVL 1QFWI 3C6SA 5IT2H 1LO5B 2QEJA 5ANMA 5INDB 2HFFA 3AGVA 4H8WH 3VRLE 4M6OH 3C5ZB 4TSCL 1QO3B 4P99A 3VGEA 1KCVL 4J3VA 4XCEA 1NC2D 4PRDB 3VXTA 4QRRB 3B9EA 2GKIA 3IYLW 4KRPC 3K2UH 1GZPA 5LKNA 1M7XA 4WHCA 3AREA 5E1AB 4RGMC 1B0GA 5GRVK 5I1HL 1HN1A 5K9JH 2FNBA 1R3IL 3WL9A 1J8HD 3JV4B 1VEOA 2Z4QA 4XNMA 3EFFB 1OF2A 1F4XL 2IAMB 5A1AA 2GJ6B 3OPZL 3WIIH 4ZO9A 3P11H 1CT8A 2VERN 4RMWA 3O11B 3TCLA 1G84A 5HGBB 1CLZH 4LVOC 3ULVH 3S4SG 3CSYB 3TT1H 5I1CH 1CIDA 1HCVA 1H3VA 5KSAB 3D0VB 2XWBB 3EYOB 5ILTL 3HNVL 5I71C 4LCYA 3RVWC 1CFQB 4ELMB 1LO2H 1U0QA 3S35X 3SY0B 1HYSC 3ZT6A 4KHTH 4K07A 5F7NC 3SE3C 5D96C 1U91A 1MCBA 3MRBA 1MFAH 4TUKH 4R7NA 4C83B 4ELKB 4Z7VB 2J1KA 2P8MB 4NRXA 3EYVA 2MJWA 3AS2A 1NLDL 3QUZB 1U8LB 2YUXA 4PG9B 1EXUB 4QRPE 3R1GH 3WHXB 4RGNB 1TQCC 3SKNB 4M4PA 1TPXC 1C08A 1YPZB 5F7EH 1T20A 3M17B 2VITB 1SM3L 4HDIA 4IS6A 5TE4H 5EZIL 2F74A 4XI5D 3SQOH 3F62A 5C3TA 2Z9TA 4LCUB 5DVMA 2A9NH 3JUYA 2EDYA 4XP6L 4PJ8B 3VI3E 4HIEA 3TV3H 1WT5A 2RIKA 4JY4A 3N9GH 4WDIA 4D9LH 4HBCH 4OI9A 1G7HB 5ALBL 5KS9B 2WNGA 3LD8B 2PN5A 1RZ8A 1FVEB 3GSWA 4MQXD 1BFVH 5T5FL 1UWXH 1T5XB 1U6AL 2BY0A 4OQTA 1R5VA 4Z7OF 4EOWH 5SWQB 3GBMH 3FQRA 1TJIL 5F89A 3SE9L 4UDTB 4X5XA 1EGJH 3QDMB 5CHNB 3ARXA 4HCRL 5FUCE 1UYWH 4AH2B 1B88A 5DJ2B 4YHYC 4ALAH 3OXSB 2R69H 3L95A 1UGNA 1A2YA 2K7PA 1HYRC 4XP4L 5DRXA 5DYOA 4ACPA 1AGFA 3M1BB 4WFHD 4P2QB 4XH2B 5DA4A 4NGHL 3VFOA 3ULSA 4LF3A 5JW4R 4HH9A 2X9XA 3NGBB 4PP1D 4X0KB 1KJ3H 4JN2A 1EHLL 5AG9A 4WEMB 2IWGA 2PYFB 5D1QC 4S2SA 4BKLA 4YZFE 4I18B 4ELMF 2F8VA 1KELH 4C4KT 2AJSL 1YJDL 3PJSA 4Z7VF 1J1XH 5MI0B 1DANT 1LDPL 3VXSD 3PL6D 5C0ND 2W9DL 3ARUA 3WO4C 1XCQA 5JR1H 1YPZF 1D3CA 5IVXF 3QWQB 5EG6C 1G7PA 2IALA 4JO1L 3DX7A 1NCWH 4KMQA 1WAAF 5E99L 5LBSH 4GJTB 5I15H 2JLLA 3EIFA 1NAML 3T0EC 3CVIL 3V5DB 3D0LA