1P4UA

Crystal structure of gga3 gae domain in complex with rabaptin-5 peptide
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
145
Chain Sequence
LSLASIHVPLESIKPSSALPVTAYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNMAPLPVKSIVLQAAAPKSMKVKLQPPSGTELSPFSPIQPPAAITQVMLLANPLKEKVRLRYKLTFALGEQLSTEVGEVDQFPPVEQWGNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor binding protein GGA3
publication title RECOGNITION OF ACCESSORY PROTEIN MOTIFS BY THE GAMMA-ADAPTIN EAR DOMAIN OF GGA3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 25
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1p4uA00
1GYUA 5CN2A 1KYDA 1KYUA 1NA8A 1QTSA 1W80A 1KYFA 1QTPA 1KY7A 2DWXA 1IU1A 1B9KA 1KY6A 2VJ0A 1OM9A 2E9GA 1GYWA 4BCXA 3ZY7A 3HS8A 3MNMA 1P4UA 2DWYA 1GYVA 5CN1A 3ZHFA 2YMTA 2A7BA
chains in the Genus database with same CATH superfamily
3L5WB 4QXUH 1WZKA 4N2DA 2J2ZB 2GSGB 4IIQA 3MRRA 5BO1L 4K7PY 1IBYA 1C12A 2VLJB 4WV1B 3S5LA 5D7LD 5CD5D 3G9AB 3D30A 3QCUL 1MCDA 4O58L 3QUYC 1U8HB 2B1OA 1U91A 1YC7A 2HPTA 4DKEH 1KB3A 1ZS8B 1O6SA 2OR8A 1MJ7L 2VLJE 4NM8L 1B2WL 2KLTA 3QIUD 3WNKA 1TT6A 1KJ2B 1XCTA 3RX7A 1XGPB 2X7LB 3P4LA 3S37H 43C9B 3TBWB 1ADQA 1IB5A 3NABH 1JN6B 3AMKA 3EJQA 3DBXB 5CN2A 3KWWA 4XXWC 1HHIB 1NPJA 1WBZA 2EVFA 1N8ZA 2X38A 2IQ9L 4N2IA 4N28A 3NESA 4PJ8D 4S0SD 4TUOB 5E5UB 5TDOB 4KAQL 4X7EC 2DQFA 4CGUB 5HHOE 3L8QA 1TZ8A 2ZPKH 1YG9A 4F7EB 1QI4A 4ETQB 3O3BA 1P4IH 1G1KA 3EOTH 3V55A 4WFEE 1OOWA 3RZCA 2AV7B 2D31A 4DSYA 3R1GL 3WIIL 5KS9F 2P46B 5DD1L 2DJMA 1ZHBB 4PRPA 1B0RB 5F88B 5C9KA 2G3ZA 4WEBL 2HRLA 2DQGH 2PPEA 3QXVA 4QO1A 4ZPVB 5GJSH 1MJ8H 4YLQT 2J1XA 2WBJA 3P4MA 4M93C 4NQEB 4KVCH 5E6IA 3V0GA 1HILA 1KPUA 3SKJL 4F8TA 5IEHA 5IROD 4A04A 1KC5H 4O02L 4F2EA 1QKZH 4AQEA 5C6PB 1HI6A 2EDXA 4NQEE 4PCYA 4XNUH 2BVEA 4WJ5A 3V4PL 1AZBA 5C07D 2HKHH 4NZDA 2MOGA 3GI8H 5EFIB 2ENJA 3DTXB 3KYOA 1Z9LA 2XPYA 4KDTA 4HOXA 1LGVA 3IFOA 2BNQE 3V7MA 3AACA 1LWRA 4M8QA 1C12B 2E6QA 3QEHA 3S5LB 4FA7B 5CJ8A 3ILEA 5IZ7A 3K7UA 2EQDA 3ENEA 1DQKA 2M26A 3NH7H 5I76A 4X6DA 5EF0A 1U91B 3C75A 5E00A 1NDTA 2XY2A 3S4SG 1O6SB 2J55A 3ARFC 1VRSA 3ARDA 5B21A 2DQCL 1GRWA 2WIIA 4IHOB 4K7PX 1XCTB 2L3BA 3HBQA 1VGEH 1VZGA 1TJIH 3PCYA 4FTDA 2WQ8A 4KFMA 3NSFA 4HU2A 4Y8AA 1DANT 3KWWB 5FUZL 4PGJA 1Q38A 1WBZB 4NZTH 2JFCA 1PZ5A 4DAGL 4AKQA 1N8ZB 5DXWA 5JDSA 2EEAA 5ID1A 3EYQC 4DN3H 4MFHA 4J3WA 2Z65C 3LIUA 3U6XS 2BIHA 1WJ3A 1LO4H 5GGTH 2X40A 4XVJL 4F3FA 4LSSL 4G3YL 2E9GA 3O3BB 4EQ3A 5LXVA 1IE5A 4D3CH 3NIGF 3RZCB 5G4OA 1KTRL 2EXWC 4PJ9A 1X7TA 2D31B 4FNSA 1KBPA 4O4YH 4PRPB 3KLKA 1JGEA 1UZ6E 2IH8A 2VL5A 3FXIC 3T4AA 4QO1B 4M02A 2XTLA 3GRGA 4PRPE 5L4MA 2WBJB 1OTUC 2CALA 3P4MB 5I0ZA 5I1AB 1EIBA 4GH7B 4JFOA 2FUQA 5DQ9A 5DVNA 1HILB 3RTQC 3ULVE 1KPUB 3V0WL 4L05A 4LB8A 5IEHB 3NJNA 3QUZD 4MRBA 4CKQA 1IT9H 4AQEB 4JZJC 1HI6B 5D93B 2DWDA 4WJ5B 1BAWA 3P40A 5DZAA 3WD5H 3CC5A 3KYOB 4WNJA 2EILB 3WGVB 3NCCB 5DWPA 1RUMH 3IFOB 1QG3A 5JW4Q 2FX9H 1MCNA 5AW9B 2AEQL 4M8QB 2A4EA 3QEHB 2GTZA 2GVYA 3NEOA 5HGAB 2VISA 1LNUA 3VYOA 1RULH 2PNDA 3GNMH 3C8KA 3OMIB 3GMOA 3HE7A 1PJ9A 5I76B 4X6DB 3K4AA 5BV7B 5E00B 1P6WA 2HFGH 4RISH 4WV1C 3LD8B 5I18L 2RQ8A 4X9BA 1AZNA 2WIIB 5E8PA 4MZ3A 1NWOA 4X6DE 5AVYB 3KL3A 3UZEC 3ILQD 3ZQXA 1Q1JH 4PGCA 1J12A 5E2UL 5D1QD 2AI0L 8FABA 1PZ5B 2ICWJ 4V33A 4XPBH 5JQ6L 5K9KA 5JDSB 3ABZA 5ID1B 1OCRB 2ESVD 1MF2L 2V9QA 4K71B 4OJCA 2HKFL 2ZAGA 4F27A 4Z7UE 3TA3C 5INDA 1PY0A 5FHAL 3EF4A 1IC4L 4F3FB 3CXDH 1K3ZA 3PU7A 4XN8A 1KYOK 1QR4A 2JIXD 3NEXA 1JNNH 3JV6A 4M56A 3QFGA 4OFKA 4FZ8L 4AVJA 5E5MA 4AE1A 2NCMA 3PP4H 4WTZG 2ADFH 3RWHA 1N67A 2QQLL 2VL5B 2YD2A 4TLKA 2FYYA 4R7DA 4JQXA 2OL3A 4HEMA 3ZU8A 4NZ8A 3T4AB 3VGAB 4HGWA 5J6SA 2QPUA 1U42A 2FTAA 3S34L 3ZN6A 1K5WA 1TSRA 1I7TB 3C5ZC 2WO2B 5F7LB 3SZKC 3NK4A 1MLBA 2APVA 5LBSL 4FQ2H 2DICA 2X1PA 4C57C 4GW4A 4APQC 2DWDB 2QQNH 5D7IA 4XCEA 1D6VL 4EZJA 4XCYA 4M9OA 2ZP8A 4N2AA 4HHWA 5EG6C 1MDAA 3N43B 4X5XA 2E0PA 2WCPA 4L5FH 4XBPB 4AGPA 4JZOA 3V0DA 4BFBD 2FH6A 1MFAL 2OI9C 2GTZB 2NY4B 1XB8A 2VISB 1LNUB 4NLAA 1Q0EA 5FYJD 1B90A 3C8KB 3GMOB 3HE7B 4G6MH 3QWNA 2WUCH 4BK5A 1KEGH 1AAJA 4M5SA 4IIQC 4KY1H 4F24A 5M94B 3HN8A 2NT0A 5C0AD 4U4IA 4G1EB 3VG9B 4HWNA 2F1EA 1MRFL 1MZZA 2GQHA 4PGCB 2HVJA 4Q6YA 4F7PA 2E7DA 3PWPE 2WYZA 3IRZA 2LLLA 2RAMA 2CJSA 8FABB 2BS71 4YHYB 1VERA 4Z0BH 1RZGA 4PJXA 3B2VL 5K9KB 3QO0A 3QDMA 3SSGA 2X2IA 1N9PA 3VFGL 4X7TB 4ZW3A 5D7IF 5INDB 2V17L 3H6AA 2C1PA 1AOZA 3HG2A 3LEVL 3QEUA 3RIFK 2JJVA 4LSVL 4WGWB 3BP7A 1L9SA 3JV6B 4K5MA 3PV7A 5FA3A 5KTEL 3RWHB 1ZLSL 3B6SB 3I2CL 3SGDH 3TF4A 2FYYB 2R69A 4R7DB 1QSEA 2OL3B 3JYBA 4HGWB 4JKPH 1M7DB 1LDPL 1U8NA 4IRJA 1QLRA 3O2VH 4HEME 3QFDA 3WIHH 1MLBB 4OR1A 5JHAA 1YEFL 3G9VA 4KKCC 3G5VA 3KCWA 3PAUA 2VJ8A 1KDJA 15C8H 3LVTA 4GW4B 2E7HA 2WBJC 5D5MF 4XXDA 5D7IB 2OR7A 5E6IC 5ERWA 1G9MC 2QR0A 4XCYB 1CYXA 2W8CA 3SDAD 2AQTA 4M7LT 3ROLA 2J57A 4X5XB 4PJXF 3VA2C 3LEXA 3ABKB 1R3JA 4JZOB 1FCCA 4ZS6D 1KCVL 4OGAD 2ETWA 4RMUA 4L9DA 2PTVA 5MP6L 1VHPA 3WKYA 1JDDA 4QHKJ 3MO1A 3GI9L 4ZBJA 1CLZL 3L3KA 1OGAD 2Z4TA 3FBKA 3Q5YA 4HEPG 4IKLA 4MXQD 4XCNA 2VNCA 5DHVA 5LBGA 3NJFA 4FP8L 2JLLA 1JZEA 2AEPL 2FB4H 4RESB 1DJHA 2NPLX 3ZRSA 3RHWF 3TBYA 2VDRB 3L4YA 5BV7C 2BDNH 1P4BH 2IWKA 1FQ9C 1NOFA 1TJGH 2HVJB 3KHQA 3NEEA 4F7PB 5HBBA 2WNWA 5C3IA 3ARDC 1EZSA 3BPLC 3OMAB 3VYNA 5LWYL 1RZGB 3FTYA 4JREB 4NHCL 6CGTA 3QO0B 4HWUA 3QDMB 3SQRA 4YDKH 1D7FA 4PYHA 2AZAA 4XHJC 4M6NL 5DUBA 4BFEA 1FPTL 1FZMA 5J3HC 1PLBA 2E76C 3GHBL 3QBTB 1ZA6A 2AXFB 5E23A 1JOIA 3DO3A 3A4DA 3WL9B 3BP7B 1E8XA 3NIFB 2HRGA 2GTQA 5FA3B 1SJHA 3TASA 2O26U 3I9PA 2WXFA 2DKMA 2DY2A 1KXTB 4BFRA 1QSEB 3OB0K 4AVHA 4H0LC 4IOFD 4PJ9C 3NIFE 2EINB 1T4WA 2WUBL 4DK5A 1U8NB 1KELL 2E59A 4IRJB 1QLRB 1OVZA 3QFDB 4MD4A 2G0KA 2PYED 4BK8A 4HK3J 4YN3A 3S35H 3VG0L 3VGAC 3ZZ1A 1BREA 3OLEA 5JQHC 3D39D 3LNHA 4LARH 4XXDB 5ERWB 3IU3A 1G9EA 4OF7A 2W0PA 2QR0B 3D4ZA 5FWQA 3ROLB 3F85A 3LEXB 1R3JB 4M7LH 2IGFL 4XPGH 2FO4A 2EC9T 5JIKA 5I23A 1K6QH 2LFGA 3WU1A 1F90H 4J3OG 3MO1B 4NN5B 4OW6A 2R29L 3U1PA 3L3KB 3MLSH 3O2DA 4JGNA 5CIPA 2J73A 3MLYL 4XCNB 4CU8A 1A9VA 2VDNH 5DHVB 3B56A 1R0AH 3FZUC 2NY4C 4POZD 4XPTL 3R0NA 4K7FB 1JD7A 3JZ7A 4JDTL 4K15A 3TBYB 3V4LA 3HE7C 1JRHH 2HG5A 1C5CH 3UG5A 1H3VA 5E0QA 1NCCH 5JUEL 4B6ZA 2GSMB 4GXUN 3II1A 3IRPX 1CBVH 3P4NA 1JGLL 3G3LA 4MJ4A 5DUMH 2EIDA 4HJGB 3VG9C 1I3GH 2EKJA 2GW5A 1SM3L 3GIVB 3SQOL 1U2CA 2ZSWB 4MCZA 1FZMB 4AGLA 1N3NA 3RE0A 2IALA 3EDEA 2AEWA 4YHYC 1ZA6B 4P9MH 4NUGH 2NY3C 2CK0L 4I2XB 2Z31D 4XWGL 3W82A 1ZTXL 1F4XL 3B2MA 4FTVA 3T3PF 1SJHB 4BDVB 3VXUE 1CLYL 3LZFL 3EJRA 4P3CL 4P46D 1T6VN 2CBMA 4R90L 4I2XE 2VC2B 4RAHA 1EUTA 1RZJC 3UYRL 4LLYA 4N2CA 3LH9A 5LNGA 1IE4A 3MLPA 4FNTA 4JQXC 4MD4B 4ZTOL 1A7PL 1GYVA 1KIRA 3QUML 4MXVE 5T3ZD 2NY7H 2LE9A 3N1QC 4XGZA 4XNYL 4F7KA 3SPIA 2YFOA 3KBEA 3N85L 3IU3B 4XMTA 3RY5A 3MZGB 3BYTA 5FLUA 3ZDYF 2XZCL 4YEFA 2UZPA 2A4ZA 2VW7A 2HVBA 2VERA 2FO4B 5EN2A 3IJ7A 4EPSA 1KB5L 2P5WD 4G7VH 1JXJA 3W9DA 1IMHC 2OW6A 1CICA 3K2IA 2EUZA 3MRFA 3HA0A 4QGTA 4FXGA 4KH9A 5CIPB 4H8QA 2NMSA 4L3EE 5F72S 1SDAB 3SJVA 3DK2A 3CSYA 4ATTA 2YGOA 3AQYA 4L4JA 3P73A 1OAQL 4QLRA 3T65A 4G1MA 1KIUA 4I0CC 2EYSA 5DWUH 2HH0L 3OQ3B 4BK5C 4KQ4H 2HG5B 4G9FB 3TS8A 5AB9A 1QBBA 1RSFA 1W8EA 3OG4B 1IBBA 1QTSA 1RK0A 1FN4A 3KH4A 3Q6GL 4OUUB 3CFNA 3P4NB 2FD6H 2DM2A 1YNTA 4Z7QB 4LP4A 4HMDA 2CJTA 4G9FE 1ET8A 4ABUA 3IJSA 2B5IB 4MCZB 2VDMB 1IBDA 1L9RA 1BMWA 1N3NB 4QRQA 3V6OA 3QAZC 4HU8A 2IALB 3JTBA 4Z7QE 1T1WA 2IJ0C 4RFEB 2APBA 3B43A 4I5BA 2RB8A 4WWKD 4XPHL 4AYEC 3SGDI 4BUHA 1UH2A 2WHVA 1FE8H 1IKNA 3LIZH 1MHHA 2C5DC 2VUOA 1T80A 3FRPA 4NDMB 3N1FC 4NO5A 1ZVHA 5AALA 1NL0H 5E1AA 3UIYA 1UKQA 3DX6A 4LLYB 1QA9A 3UABA 3F7QA 4TNFA 4OZ4A 5IHBA 4RGNB 5IJBC 1NGQH 3GSNL 2QADC 2R0KH 4BZ2L 1WAEA 4M5YL 1NMAL 3K72A 3TH2T 2G3XA 4JPKL 1KIRB 1UUSA 3HNVH 3LKPB 3DDFA 4XGZB 5DGQA 4F58H 4FFZL 2O5XL 4NJAL 1HKFA 2FWSA 4IRJC 2NY6B 4NN7B 1J0KA 3SE9H 3JYCA 3T2NL 12E8L 3OPZL 4JFDA 2DI8A 2IDFA 1TYRA 1JGUH 1UVQA 4OSUH 4QXUL 5EN2B 2B14A 1R34A 5E95B 4G42B 2IDCA 4UI2A 4Y5YA 4Z95H 2JE8A 3GTVA 3UMTA 1CICB 1CBJA 2HLFD 3MRFB 1SHXA 4FXGB 1OK0A 3SJVB 3D18A 2VKWA 3CSYB 5GHWH 4DERA 4WUKH 3P73B 3T65B 4DKEL 1SNRA 3U46A 4G1MB 1KIUB 3KM1A 4NN5C 2EYSB 3APNA 5HVHC 4ZXBA 5D1XE 1XL4A 2JI1A 1PX8A 4QRTB 2DTMH 5C0DA 3S37L 4YGAB 3BW9A 2VQTA 3QRBA 3NABL 3QNXA 3TV8A 4ABWA 3IDYB 4OU3A 3E8VA 2WLHA 5EO1B 1YNTB 1RUPH 3V5DB 2ZYIA 1FNFA 4N0UA 4L18A 4MJJA 3IJSB 4BWUA 1JZJA 4ZMTA 4S1DD 1LEGB 3HR5A 1IGTA 5CJ5A 2Z9TA 3RI5F 2ZPKL 2ZX6A 3SOBH 3U6XA 4FMKA 4I5BB 5BQDA 1D5RA 2VR8A 4NBYB 1P4IL 3L7EA 4F2FA 3EOTL 3W56A 5T3XE 5AAMC 4K8RH 1PCSA 1MHHB 5HVWA 4MJ6A 3UAJD 3PDDA 1PEWA 2CHXA 1XXDC 3FRPB 4NO5B 3IGLA 5IBLD 5T1KA 2VR9A 5C0FA 2WBWB 1GTFA 5INCA 2EE6A 3DX6B 3JTSA 1ZJAA 4OZ4B 5AVUB 2DQGL 5GJSL 5BUPA 1MJ8L 4HUNB 2JKSA 3LKRA 1R5VA 4N0CD 2IV9A 4KVCL 2BJMH 3K72B 3BCDA 2AJ3A 1FSKB 2C4FT 5CKGA 43CAA 4U31A 4JFFD 4XNMB 2G4GA 1KC5L 1TCRA 2JJTC 1QKZL 4C56E 4XNUL 2PO6C 2Z8VC 4LEBA 4B7LA 4LMQE 5HDRA 2HKHL 5JXED 4JFDB 5EH1A 4H44C 1UVQB 3N6YA 5D1ZD 1MCQA 4UUJA 3BZDA 5FDYA 2QPEB 3TH4T 1ZV2A 3L48A 4KKQA 1J9QA 4JFDE 5B3JE 1N6UA 1YMMD 3D18B 3NH7L 1G1YA 1HH6A 5BZZA 1SVBA 1JRHI 4MLIA 4UYQA 3U46B 4AH2A 3S8FB 3QQXA 5JIDA 2MCMA 1JYXA 1HXKA 3ARBA 3FS9A 5FEBA 3U30B 1BDYA 1HWHB 4OJEH 2FQDA 3FT9A 3NTCH 2AITA 3IBOA 4XVTL 1USZA 3T3MF 3ZTEA 5C0DB 3EG9A 1TJIL 3BW9B 3M17A 3QNXB 3LZPA 4GAFB 3QPQD 4G6FB 4HUUA 4I85A 1W9XA 3QR2A 4NZTL 3S3BB 2BP8A 4DGWC 1A65A 5EZOH 4ZDHB 4N0UB 4P07A 4X5PA 5DEJA 3HR5B 5J1SC 3T2LA 2EP6A 2C9QA 1XGTB 4DN3L 3WJJC 4J12A 3DX2A 2X9ZA 4NT6A 1LO4L 5GGTL 3JSSA 4OLUH 5J9PB 3ABMB 3FU9A 3L7EB 4ADJA 4D3CL 4D9RE 2B5IC 4UNTA 4MJ6B 5CN1A 4O4YL 2ICWI 4JRLA 3UGXA 4JHWH 5T1KB 4ZFOA 4U6XA 3BVVA 5C0FB 3CNKA 4H13C 5INCB 1IILE 4PRID 3UPAA 4HIQA 3BDYH 2XJLA 1K72A 3LKRB 1R5VB 3DK0A 4I9XA 1N4XH 1PEZA 2AJ3B 2BNUA 2XG5A 1IU1A 43CAB 1NIDA 1MCBA 1UWEH 4TOYH 2LTQB 2NUPA 1IT9L 4KXCA 4N1CA 4RGNC 3WNLA 3CZEA 4UQ2A 3KEDA 2IEPA 1CB4A 1FFNA 2R59A 4J8QA 1YEIH 1EGJH 5GSVA 5J6HB 3HI1A 5JYMA 3BESR 1TSHA 4Z76A 1RUML 4UUJB 2FX9L 2WXHA 2NY6C 3HBPA 3ZDWA 3FULA 3JTTA 2VMJA 1RULL 3GNML 4LCYA 1OT4A 1RPUA 3HLAA 2CO2A 1HH6B 2NW3A 1FLRH 2H6PA 4AH2B 4HC1H 4HIHA 4LAJH 1LM8V 1CICC 4RISL 1IZKA 3S2AA 3GUFA 4N3TA 1UYWH 1XFPA 1QMUA 3BXNB 2HN7A 5EIIA 3EG9B 3ATDA 1Q1JL 3M17B 4J3BA 3VD0A 5H35A 2Q7NA 4HUUB 1H9DA 5KJRH 3MLVL 3VQ2C 2BP8B 4QNPF 4XPBL 2NNAA 4Y7MA 5IQ9B 4PS4H 5JW3H 3ZZSA 3N42F 3VFUA 3IDYC 1QWUA 1PGRB 3NP3A 3ELAT 3L3OA 3K6SA 3B5TA 3CXDL 1PAZA 4BFIA 4LVHB 2WLKA 5E8NA 2EDYA 4BSWA 3R7RA 3V6OC 1JNNL 1ECYA 2NZ9D 1WITA 3LZRA 2H0EA 2XTSA 1UT1A 3PP4L 4N24A 2ADFL 4ZFOB 4HH8A 4U6XB 3FPXA 2UZYA 2M83A 4HKJA 4IEFB 5IB4A 4N2FA 1IKNC 5DMGD 5FW8A 1JZ8A 2H47C 1WS7A 2D3NA 5AVZB 4NOFA 2BMKA 4XWOD 2BNUB 3NGBB 2IO5A 2YXVA 1TETH 1Q1PA 2OZ4H 4FQ2L 2NUPB 4R7LA 2FATH 1KYAA 4UQ2B 4IKNA 4GNKB 2OBGA 1IAIH 2HYMA 3JVGA 4G6AD 2QQNL 1FFNB 4BRJA 4MA8H 1FSKC 3BAXA 4GO8A 3BP4A 3HI1B 3Q9PA 1ASOA 4X4ME 3FN9A 3BP6A 4Z76B 5C7ZA 2LOEA 4L5FL 2XFXA 1UACH 3MCYA 3QG7H 4FMVA 3BOVA 3JTTB 4H5SA 1X5GA 2PCPA 2VZUA 4DP2X 3QZLA 5GZOA 1FFTB 5JHDD 4LCYB 4G6ML 3CCHA 2IDUA 2WUCL 1Z66A 1KEGL 2NW3B 3HLAB 3FOMA 2H6PB 4KY1L 4Y5YC 2EO7A 1BOGA 3ARGA 4FNQA 1XCXA 2VLMD 4Q4IA 1CTNA 4IJ3B 3BDXA 4B27A 1ETB1 1S9VA 3W5NA 4PJEF 2HN7B 4OD3H 2FHFA 4MDRA 4CN1A 5EIIB 1JWMB 5H35B 5I28A 4X4ZA 5SX5H 3CDZA 2A9AA 3D2TA 3D3VD 4ZXBC 3FFCE 3U30C 3V95A 4Z0BL 2NNAB 4FGMA 2DPKA 5SWZD 2F1AA 1JJUA 3VFUB 3NBNA 2K8QA 3L3OB 3K6SB 2W94A 5AOJA 4BFIB 3IBEA 3MJ8A 3FH5A 2CUAA 3KPNA 4F80A 2ZUQB 5E8NB 3L45A 4BSWB 2Q87A 1DBAH 5DJYA 1PIFA 3LNFA 1T5XA 3QE5A 3ZW3A 5HYIA 4JFZH 1AC6A 1KGCD 2UZYB 4LIQE 4HIIA 4NCC2 3ZMNA 1TZHA 5IB4B 2YPLD 4JKPL 1HSAB 3VXMA 4QY8A 5BMFH 5F0PB 2BO0A 2WSDA 4PLJD 1DUZB 2BMKB 2LGNA 1HKLH 3VAEA 1Y6MR 4LPCA 4WU5A 2F9BT 3O2VL 3WIHL 5DRNA 2WNGA 3ZOAA 3CDFA 3SGKC 2H3KA 15C8L 4AMKH 2NY1B 1XSIA 2K70A 3BFWA 4MNQA 3BP4B 4I18C 1I8LA 3BP6B 3H9SA 2XFXB 4J6RH 3AVEA 1QFHA 4H5SB 1SXCA 1MFEH 2I26N 2ZCZA 1H3TA 2XZQH 1M4KA 2PCPB 2AAAA 4P23D 4XTRC 2VXVH 3KNBA 3LQZA 5BS0A 2CLVA 3FOMB 3C12A 3KDMA 1HEHC 1BOGB 3LEYH 3ARGB 4MVBC 4KTYA 4V1DA 3KPSA 4WWID 3US9A 4FXLA 2FB4L 2V4LA 3IJ8A 1S9VB 4EN3D 5AD0A 2BDNL 4GRWF 1P4BL 3C09B 1TJGL 4MYWB 4NWTH 5EO0A 3CDZB 2K7PA 3ARBC 3J07A 4ZFFA 1W0VA 2DQ6A 3BUQA 4PEEA 4YDKL 4OV6F 1GL4B 1CFNA 2CR0A 3FT0A 4KK9C 3WXVH 4EZKA 4HDIA 5I1LA 3M45A 1NCHA 1JNLH 4AYFA 3P2BA 3MJ8B 1X3DA 4GQ9H 4AJWA 4JY5H 4L4VE 2BIPA 1EBPA 3KPRA 5DJYB 1T5XB 3CZGA 1YMHA 3WUWG 2O30A 1WZMA 4HIIB 3IXTB 1TZHB 4K23H 5T1LA 2G3MA 4NUPA 3INOA 3VXMB 4A6YA 1SQMA 4QY8B 4WFHD 1KTCA 1YZZA 4XXCA 3RL2A 2F53D 5FUOH 5F9JA 3UC0H 3U2SB 5DRNB 4C58B 1DCEA 1BZEA 3S35L 3QC5X 1KCLA 3K5SA 3L3HA 3QYCA 1J18A 3KXFD 4LARL 4GPVA 1BSIA 2R2HA 5EHFA 4Z5RB 1OGTA 1XH0A 2EE9A 4FYQA 1HESA 1AD0A 4MNQB 1A2YA 4W9LC 3TIEA 2EDJA 3H9SB 1C8PA 4M7LL 3K2MC 1C7TA 2NY2B 3ZDXF 1MIMH 4XPGL 3O81A 5IHWA 4U1SA 1K6QL 3WELA 1RZKH 1SQ2N 4PYGA 1FO0A 1F90L 3KNBB 3H9SE 3LQZB 5E1GA 5AVQB 3MLSL 1NBVH 1ZHLA 2CLVB 2VDNL 3KDMB 1DQIA 2ODHA 3ZKQD 1R0AL 3QXTA 1T5KA 1WAAA 3KPSB 1L7TH 2H0JA 3O4LA 4OCXH 2IPUG 4PJGA 5AD0B 1JRHL 2XWDA 3CBKB 3OL2A 1C5CL 5EO0B 5IMMB 2MH4A 1DJWA 1NCCL 1WFUA 5C1MB 2BZ7A 3KPSE 1CBVL 5HI4C 1EWHA 1I1FA 5DUML 4ZFFB 2ICCA 2H32H 5IJDC 1W0VB 1NEZG 3TZVA 4G2AA 1I3GL 2G0LA 4G6JH 5D6DA 1TQVA 1CFNB 1FVDB 3ESNA 3ZKNC 5I1LB 2J5LC 5EDSA 4AEEA 4AYFB 2DQUH 4OZFG 5HI5C 4P9ML 4NUGL 3NJKA 2EJ1A 1NPNA 3RP1A 1C1EH 3QNYB 5I2IA 1L7IH 4N5ED 5KVDE 5JNYA 3L3OC 4JO5A 1XGRA 4L1LA 5T1LB 4Y2NA 2HFFA 4I1NB 4PJHA 4FXTA 3MUZ1 1CXFA 2YEQA 3GD1C 4A6YB 4Z7VA 3OTTA 5EZPA 1W6LA 1QUPA 2J1WA 3RL2B 1A21A 4L48A 5F9JB 2QHRH 4DIXA 1IAII 2NY7L 4JNXA 2WO4A 3L3HB 4KO7A 2DF3A 3EYVA 2R2HB 1ETZB 1R17A 1OGTB 5CLYA 1VADA 3EW3B 1AD0B 1MNUH 1A2YB 4P5KB 5DEGA 2JKJA 5CLXA 5J1AA 5TK4A 3TIEB 4W6XB 5CR1A 4PJ7A 1S5HA 1BD2E 3INUH 4HAKA 1AE6H 1B0GA 4EOWH 1SJVA 4U1SB 3OKEA 2ZXBA 2ZWSA 4G7VL 3QG6A 1V10A 2OTUB 3QWQB 4F1SA 2J72A 2X9YA 2HWZH 4LLWA 1NGXA 1WUZA 3HNTH 2JJUA 4R83A 1ZHLB 4N85A 4NQXA 1R19A 1AKJA 4XNQA 1H8OA 2MIZA 3LYRA 5DWUL 2H5UA 3O4LB 3IJEA 4PJGB 3VD4A 4KQ4L 2WLLA 5C3TA 2BSEA 3MU3A 4M1CC 2H2SD 1WAAE 3ARGC 3QI9D 3SO5A 1INQA 1QBAA 3FHQA 3NG5A 1HN1A 2FD6L 1I1FB 3MRKA 1CDYA 1F4YH 1HXMB 5C08A 2ZP9A 2SODB 3TZVB 4OZIA 2GITB 5HHVH 3WKMH 1W0YT 1TZAA 3FT3B 1BVNT 1NC2D 3QGVA 3V5HA 1SDDA 2A74A 5K1VA 3VH8B 2A73B 5I2IB 2QGBA 5CU9A 1FE8L 1KBVA 1G9NC 1SLXA 3LIZL 3PABB 5JNYB 1VFOA 4GUQA 4NEHB 1XGRB 4JG0H 3NA4A 2V3EA 2HFFB 3L1GA 4NZRH 4PJHB 5TD4A 4JRXA 1NL0L 1FAKT 2X6AA 4WO4C 4F8LA 5DGRA 4Z7VB 4Z3FA 2YGPA 3GHEH 2CWRA 1NGQL 4PJFF 4YHZH 2R0KL 1T7WA 5J5EA 3LNGA 1YJDC 4NC2B 4PJHE 3HS0C 3IFPA 3HNVL 3TN0A 4F58L 4Z7VE 5E03A 4W4OA 4WTXA 3EYVB 3QWRD 2ZX9A 5E5LA 1VADB 1GW0A 5D7LA 3JWDC 4PHXA 5DEGB 3SE9L 5J1AB 4PJ7B 1NLDH 4PVLA 4AX3A 5K9JH 3B7TA 3T4YA 1B0GB 1JGUL 1FC1A 4AI7A 3MLXH 1WUNT 1SF3A 3O3DA 3OKEB 3QIUA 1HZHH 5I6PA 3T6XA 3QG6B 4Z95L 5K33A 5E9DD 4PJ7E 3QYMA 3ZY7A 2CRZA 3QZOA 4LLWB 1NGXB 2XV2A 5KVFH 1KF9B 1T04B 2BOLA 2HLAA 5EDXA 3T0ED 4CSPA 4LPWA 3KM2A 1K8IA 5BZXA 1TJMA 5GHWL 4WUKL 4XNQB 3BWSA 5EEYA 1C5BH 3DXAD 3IJEB 2XWBA 3QHTC 5E2JA 3PQYA 1EJ6A 2XIIA 3V5KA 1GGIH 4E9VA 2DTML 5I5MA 3NSCA 5TJWK 1S78D 4DJMA 1G94A 1ZT7A 4XMPH 1INQB 1SVZA 1G6RB 2IH3A 1NFDB 3MFGB 3MRKB 5C08B 1RUPL 5AVRB 1JDAA 4OZIB 2ZQKA 1Q9LA 5H4ZA 3V5HB 1NFDE 4NERA 3LZOA 2X09A 1SDDB 2A74B 4N22A 3P9MA 4OZIE 3SOBL 4MTMA 2F8OA 3PY9A 4PQXA 4K8RL 1T7XA 5HYEA 4FL4B 5IVZA 4DQAA 5IMKA 5IROA 4JRXB 4EIBA 2XN0A 1HTYA 1DQMH 1UH3A 2HLEB 5I0XA 3DGDA 4X9HA 5HDWA 1NEPA 4RBPK 4XNZB 3D48R 4LLQA 1W0WA 2BJML 4JRXE 3TN0B 3IFPB 1FVEA 1BIHA 1I9RH 2UVFA 1MFMA 4FI8A 3AWGA 3AXLA 5A16B 4XI5D 4MA1B 5CCKH 3G6JF 4AW7A 5D7LB 2RH0A 3OPUA 1QI5A 1OWRM 4FF9A 3QFJA 3T4YB 2CKBA 4Z7OB 5T3XH 4F9PA 4JFQB 3WNMA 3O3DB 4RDQG 3QIUB 5D7LE 1AKPA 4PB9H 2VJ0A 4RIRA 1UB6A 4GSQA 1WIPA 3BH9A 1SMOA 2HLAB 4Z7OE 3TBVA 4X6CE 1K8IB 3Q2WA 3M88A 1EBAA 4F8OA 1OT1A 2XWBB 2VLKD 3ZHNA 3PQYB 3NTCL 3BQUA 1UOLA 4I7ZC 5EA0H 4NBXB 4GXFA 5C3LD 3LXBA 3BN9D 4WUUD 5JHLH 2IH3B 4JVPA 4KO6A 2DTSA 1X9LA 5EZOL 1Q9LB 1FV1A 1OALA 1S7RA 1YCSA 3O6MH 4FMFA 2J6EA 1LWJA 1GSMA 4JQVC 4YSOA 4EUPA 3CZKA 2DQDH 3PIQB 4N2LA 3HPLA 3TZVC 1IIKA 4NNYA 4U6VH 4P8QA 1BXXA 1EFXD 2IWEA 4OLUL 5D6DC 2C3VB 1PBYA 1U2HA 1V55B 3VRJA 4G7SB 3U0TA 1AIZA 1KYOJ 4PJIA 2WMPA 4WWPA 5IVZB 3SE4A 4JHWL 5IMKB 5KBPA 4QKXB 4FNUA 1THCA 2NDFA 4BUGA 3BDYL 2P8LA 3X13A 4LLQB 1W0WB 2E74C 1IQWH 1K8DB 1N4XL 1XZ0A 4FEIA 4I0PA 2P5PA 2VWEE 2EUXA 1JD9A 3HE6C 5EB9A 3AXLB 1UWEL 4TOYL 1A4BA 1MWOA 2XXMB 5C07E 3UTQA 5CM1A 1QBMH 1YEIL 1EGJL 2YA2A 3NIDF 1AG0A 5TE6H 1LEIA 4P9HC 2CKBB 3ZKSD 5LG6A 4A68A 4JHAH 5E4OA 4P49A 2KDGA 1KBKA 1CL7H 3SKOA 3QNZA 5AB1A 1DVFC 1UB6B 3P3YA 4J3OD 3BH9B 1YHPA 4K4KA 2A9MH 2AABH 3ZT6A 1RURH 5DDHA 5B39G 3WLWD 1FLRL 5E70A 4CJ1A 1H0DA 4HC1L 2Z3FA 2PP8A 2EEXA 2V8LA 3KMDA 1CE6A 4ONHA 1UYWL 3A0OA 4P2RA 1H6FA 4L23A 3BZEA 4NGHH 4P2OD 3T0VA 3H7LA 3UZVA 4N2MA 3OZLA 1U3JA 4OF5A 1T2JA 4JDVA 5EWIH 5KJRL 1BJ8A 1YN6A 4JN2A 3BKYH 3TWYA 1FV1B 5I1CH 2OXHA 4PS4L 5C0ND 5JW3L 5CZRA 4EUPB 4J4PA 3MVSA 2QKIA 2FJGB 4ZFQA 5KSUA 3HPLB 5DJ0A 4NNYB 2AMUA 4Q4EA 2YGNA 3KYNA 3CH8A 3VRJB 5EFIA 3SBQA 3QJHA 2X6MA 4DP8X 2YLHA 3QDJD 1KGUA 4PJIB 3HUJB 3KPQA 2WMPB 2A74C 3QUZB 5H37H 1U9KA 3ESUF 2QTVA 5I30H 1RHHA 1XQ4A 3SPJA 2P8LB 2R83A 4X8XA 5ECGA 1ZHNA 4PJIE 3BYYA 3HUJE 2YXMA 3X13B 1JL8A 4X9YA 4G8EA 1XZ0B 1TMQA 3B2UC 3DSFH 4I0PB 5JOFA 3BD5A 4P4KA 1TETL 2OZ4L 3II2A 2X44D 2EABA 3DJRA 4XMVA 1CYWA 1AR1B 5GGRA 2FATL 4XNZC 3UTQB 3LZQA 2AEIT 1IAIL 4AYDC 4UTAH 2X6CA 4MA8L 5T1DH 4JPSA 3TN0C 2AW2A 2B4CC 3IGUA 1DANU 3RRQA 1LEIB 4W4OC 4AQ1B 3OXRA 3FQRA 3KS0J 1D9KC 3O9WA 1UACL 3BFQG 2UX6A 3QNZB 3QG7L 4LCCA 3SKOB 1X5YA 3S35X 4NNPH 1S9XA 2VXTH 5AYUH 2WQSA 1UM5H 3W0WD 1H0DB 1TQWA 2D7TH 2QMKA 5D1QB 5BZWA 1CE6B 2CZNA 3D69A 3KPTA 4P2RB 2AQSA 2ZT9C 3BZEB 4OD3L 3FTGA 3KWXA 4PJBA 3JV0A 3UZVB 3FCSA 4JQIH 4YDMA 5D1QE 4JDVB 4JCWA 4R0LB 4L8CA 5FM5M 2BFVH 5AKRA 1YN6B 3MLTA 4FADA 3PGCA 2ESVE 4E9SA 1HL4A 2OXHB 2V2TA 1TQSA 1XEDA 2LVCA 1F18A 1RPKA 4OLEA 3C2SA 4EVNA 3NRFA 3FO0H 3GK8H 5KSUB 5DJ0B 3S0PA 1FYTD 4NRZB 1HWGB 3IGFA 2EO9A 2JV6A 3QJHB 5BVJB 1A7BA 1V54B 3W37A 1DBAL 2DYPA 3KPQB 2F54D 1JNJA 1EAPA 1NBZA 3ZDZE 3LXAA 4JFZL 4TQHA 4KK5C 3TA4D 3BSZA 4UB0H 2J8HA 1RHHB 3SPHA 1B0IA 1KBGH 3MV9D 5FC9A 3TWCH 1ZHNB 5BMFL 1QLEH 4G8EB 3SDAA 1HKLL 1U41A 2GI0A 1SXZA 5IROC 5JOFB 1JXFA 3G5YA 3NFSH 4FHBD 4HPOH 5FB8B 2AGJH 3KL0A 4FYRA 3TTSA 2BXZA 2CO1A 4IYKA 5GS2D 3RVVD 1F8TH 5DMKB 5GGRB 4CN6A 2ZX5A 1VAHA 4AMKL 1QWNA 3CFTA 1HEJC 3E3QE 1V3LA 5TE7H 5T5NF 4AEIH 3DARA 3U2IA 3OXRB 2C9XA 4M5TA 3FQRB 3O9WB 4J6RL 2XPZA 5HGBA 4LCCB 1MFEL 2XQYG 5FYJE 3IT8D 4E9WA 4FD0A 5CGYC 4LLUA 2XZQL 2W9DH 3C60D 3BUBA 3JUYA 1S7VA 2BP3A 2VXVL 2JCCA 5C0AB 4WSKA 1S9XB 3CN4A 1EO7A 4QRSA 5BRZD 2IG2H 5L2KA 4F9PC 3DRTA 1U8LA 4A7UA 1M57B 3KLHC 5BZWB 4NIKB 4TNGA 2LAGB 3LEYL 3FN3A 1ASQA 4N8VG 4OCNC 5C0AE 4LASH 2V6HA 3D69B 3SDCC 5GZND 2VGLM 1MHEA 3FTGB 1RZQA 4PJBB 2A6IA 3FTVA 2GABA 3FCSB 4JGMA 3U4EA 4LMQI 4NWTL 1HU8A 4Q0XH 1NCGA 3GZKA 4D0DA 3MLTB 3PGCB 4KVPA 3BQUC 2WBXA 3VGGA 2CIKA 2V2TB 3WJMA 5FR3A 4QRFA 5CILH 5GGSY 3HHMA 4EVNB 4JGUA 3WXVL 1BAGA 2B15A 3P54A 1VESA 1J1XH 1JNLL 3RBSA 5IUCA 1LYQA 4GQ9L 4HALA 3AJ7A 1U93A 2DH3A 1UXLA 4IDLA 1OF0A 4JY5L 5CXPA 1GGYA 3WNOA 1EAPB 3TJHC 1VFAA 3O6FA 2AQ3A 5DEFB 1F00I 1NBZB 2OXGA 1DP0A 3OQRA 3MOQA 3S5YA 2ZUXA 4UTBA 5HYJA 4Q9BA 3ZE0B 1MCIA 1MVYA 4K23L 3U6RA 1RUQH 4YXKH 3SGEI 2YD8A 3V2AR 2DLGA 2ZOTA 1M1XA 1E9PA 3SDAB 1ITBB 4P5MB 5FUOL 1QSZA 2D4FA 3ZE0E 3UC0L 3G5YB 2N3JA 1PIGA 4IBSA 1B0WA 4FG6C 4NAJA 1O7DC 1MEXH 3BRDA 4P2YA 5AW0B 3CVBA 1J10A 1QZ1A 4S1SH 1UD4A 3B8SA 4I0PC 4EKXA 2WGXA 4WZ9A 3NT0A 3SGJA 1CL7I 5DHYA 4NQQA 2VLRA 1AR1C 2R9HD 3DI3B 3IK2A 1MIML 4NCC1 1DZ0A 1MVUA 2R2BA 4KRPD 1FHNA 1RZKL 4LLUB 7PAZA 2C3HA 1S7VB 4U3CA 2E3VA 2JCCB 5CEXA 2CBOA 4QRSB 5TDPA 1F6LL 1NOAA 3AY4A 5C7XH 5L2KB 3HC4H 1NBVL 3DRTB 1U8LB 5D4JA 1AZUA 4QOKD 3I9IA 1NC4A 3OAZK 1RPQA 5CP3H 3ILQC 1L7TL 4OCXL 1MHEB 1XEUA 5I8OH 2DM7A 1K3IA 2A6IB 4YS4A 5J12B 3KBHE 4Y19D 1J0JA 1P4UA 2F8XC 2K9FB 5KG9A 3RA7H 2Z31A 4FFTA 2CIKB 3BVDB 1RIHH 4G6JL 4FKEA 3WJMB 4NOBA 4I9WE 5IBUG 5E51A 3OXSB 1BVKA 4B96A 3FCBA 2DQUL 5ENWA 5IB1A 3IMWA 1U93B 4GUCA 2UXGA 5DLMH 5CLZA 4N2GA 1C1EL 1YEGH 4IGBD 4J4PC 3F00A 2QKIC 1L7IL 4PJAF 3O6FB 1A4KA 2OXGB 1WG3A 3CU7A 3BEWA 4K07A 4W9JC 1A9BA 5TK2A 5DVOA 1TQBB 3RWEA 3D39B 1U3NA 2XN9D 3TFKC 4GSDH 1M1XB 3VNYA 4MJID 1AO7D 1CGTA 2PYEE 1HL9A 3B9EA 4ZFGH 4E9XA 2QHRL 4KWUA 2WWKO 5DZPA 3D39E 3HZMA 4QMEA 1ETJA 3CFDA 4PREA 4R2GD 5EO9A 4XNAA 5FM5O 1E6OH 1I53A 2P5WA 4HFUH 3SYCA 2FAUA 4KY2A 5DFVC 4ZMNA 1ET5A 1MNUL 3O4OB 4P4KC 3V9FA 5DHYB 4XT1C 5FM4A 4HUCA 4AV5A 1P7QD 3FCGA 1Z3GH 5FV1L 5IVXF 3INUL 4DP1X 2VLRB 1AE6L 4B9KC 4EOWL 4P2QD 3HPJA 1MVUB 2HKAA 4LL1A 3M07A 5CP7A 3WIAA 2WKOF 1JVKA 5CEXB 3DO7A 4NKIH 4TUUA 3R0MA 1MFCH 1QFWI 2HWZL 2VLRE 3HNTL 4Q89A 3O9WC 3V7AE 4LCCC 1PMYA 1NFKA 1NC4B 3MZTA 1TNNA 1AQ8A 3WY2A 5ISZA 2YN3A 4UQ9A 5IJKC 5F9OH 1GMEA 1N10A 5KBDA 1JFQH 1F2QA 3VMNA 4OI8A 1ID5I 1QVOB 1MNNA 1CDCA 5A2AA 5KG9B 5EOTB 1FJ1A 1VKXA 1F4YL 3JUZA 3O6KH 2Z31B 4LZKA 5L8JB 1OAXH 5KYWA 2J43A 4MJ2A 2G2PA 5HHVL 1VPOH 3WKML 1QO3A 4ODTH 1BVKB 1SFHA 2O5ZH 5ENWB 3MV01 5IB1B 3BZFA 2ROXA 1NCIA 1U3HD 3X3FH 1U4EA 4JMXA 2EC9U 3VWKD 4JG0L 1ACCA 3BEWB 1QOKA 3ALXA 4NZRL 3RWEB 1A9BB 5CAYB 4IRZH 4PG9A 2OZNA 3GHEL 2Q0ZX 1ZAGA 1CU4H 3LN5A 1Y6NR 2VITA 5FM8A 2ZOLA 3X1BA 1U3ZA 4YHZL 1LE5A 5T3ZE 1I1RA 1RLBA 1NKOA 1ZD6A 3HZMB 3OBAA 1QWHA 2WZ0A 3CFDB 4PREB 5EO9B 5AZUA 1WGOA 2WVVA 2P5WB 3VI3A 1QD0A 4CSTA 2IWGA 3FAWA 1FZKB 4JUSA 1JGDA 2A6KA 1NLDL 5LCVA 3Q43A 5K9JL 4UINH 2XG4B 2MRYA 3HPJB 2P5WE 5DHMC 4JK0D 3MYJA 4L1HA 2XCMC 3MLXL 3SHSA 5CZVH 1BJ1J 5KJ4A 2GG1A 1HZHL 1YEWA 4AGOA 5HYFA 3DO7B 3FO2A 3DI2B 3FUDA 3IN0A 2WXIA 4RMVA 4YR6A 2C9PA 5KVFL 3F84A 5AOZA 2EDWA 3VDBA 1A1OB 2BW4A 2GHWB 1C5BL 3H9HA 3MBWA 5ISZB 1GZHA 4WGVB 2WOYA 3I6LD 3VI4A 5M7QA 2FWOA 1SYSA 1YRKA 1XVSA 1GGIL 3FCUB 2EIEA 5ISZE 4XMPL 5BVPH 1FJ1B 3CXFA 1VKXB 2APXA 5KYWB 4GLRI 3UTPD 4UF7C 3JWOH 2EYRB 5E08H 1EEYA 1CGUA 1KFAH 1ZXQA 4LP5A 1P1ZA 1QASA 3VX0A 2P1YA 3WO3B 4QGYA 3ALPA 4OIIH 3BZFB 1EJFA 2EXSA 3BLBA 2VAAA 4HS3A 1MW2A 3EJYC 2QFRA 4OFVA 1Z5HA 4JW3A 5GSRA 3D6GA 3EJUA 4KUCF 3CFIC 2EIZA 3FCTA 2PUQT 3MRHA 4FYTA 3MJ9H 3PGFH 5I1EH 5K9QG 1E30A 5KAQF 2JKIS 3FQ2A 3DIFA 1U8MA 3NA9H 4OCRH 4ORGA 2HT2C 1DQML 3O3EA 4IBTA 1I85A 3U7WH 1TG8A 3O6FC 3LN5B 2VITB 3OGOE 2ZOLB 5J11B 1LE5B 3DBSA 1YLBB 5EC1A 4POUB 1S4IA 1TQBC 1I9RL 3OR7A 5D1ZA 2PCFB 2OM5A 5CCKL 2WVVB 4MAYC 4MS6A 3VI3B 1Q90A 1JGDB 4XPFL 5I16B 5I5JA 5C0JA 1G6RH 1I8AA 4HJEA 3VUAA 3AITA 1JF1A 5E9AA 3VI3E 3MYJB 5T3XL 1JZ7A 2GPZA 3N04A 3BHBA 3APMA 4PB9L 3TURA 3FO2B 1JCKA 4DF9A 4HS6B 4L1TA 1KTDA 3OPZH 5DC0A 3S36H 1YPZA 4F93B 1KGYE 4TQIA 3VFNA 4QRUA 4O51A 3TNNA 1DVZA 5EZJA 4YSRA 3H9HB 3MBWB 4BUQA 2NR6D 4MCYA 4N4YB 1FBIH 1A6ZA 2DJUA 3VI4B 1WHPA 3ULAB 1HL5A 2FWOB 1J1OH 1SYSB 2EDHA 1TFHA 3AZUA 4BFGA 4K8RD 4N8CH 5EA0L 3WFEH 5GS0H 2BWQA 2KPWA 1UXMA 4LL4A 1CXEA 2CD0A 3B2PA 1FGNH 5FYLE 3ZK0A 5JHLL 4OM1H 5D55A 3VI4E 2V9TA 4O02A 2UWEF 1A7OL 2FNBA 2Y3AA 1CIDA 1OXYA 3O6ML 1EEYB 4EO5A 4LVOB 5EOCJ 3V6BR 1GVIA 1CXKA 2DQDL 1MRCH 5JHMA 2VN6A 4HS3B 4U6VL 2ZF9A 3MCKA 4NRXA 1QSFA 1LP9F 1N2RA 3U1SH 5GSRB 1T66D 3FCTB 3MRHB 2P52A 3RAJH 4FABH 1A8ZA 2DEYX 2C34A 3DIFB 1U8MB 2BVPB 4JEGB 1R75A 2QFPA 4ORGB 4WAFA 2CLRA 1YPZF 1L9PA 3ZXAC 4E9QA 1RIUH 4PLNC 4UDTA 2YAFA 1FP5A 4WI5A 5EC1B 1IQWL 2PPFA 4JFFE 3THMH 5I6NA 4M1DH 5TTRA 1AHKA 1KNOA 5D1ZB 2H1XA 1I4FA 5HDBF 2Q1EA 5GISH 1FZJA 1H3XA 2Y72A 4ANWA 3KR3H 5CNHA 5C0JB 1XIWD 1QBML 4Z7IA 2FNWA 4GRMA 2FZ3A 5DD3H 1JF1B 3V4VH 4AXWA 4BE6A 1JF6A 2WVSA 1KY7A 3QARA 4JHAL 2XSKA 4AGMA 1CL7L 3BHBB 1C16A 4GIPD 4BWTA 4UQBA 4CDHA 5LDUA 1KTDB 1YMME 1MWAH 1ZE3C 2A9ML 1YPZB 2Q20A 2AABL 2VCOA 4M7KH 4WI9A 1I3RA 1RURL 3VFNB 3SBWC 4QRUB 4O51B 3KJ6H 3TNNB 5EZJB 4XVUC 1ECZA 3DIDA 1QYGH 4MCYB 1A6ZB 4DUVA 4B53A 4HQQH 4G80A 4Y4FD 3RURA 4RNRA 1KTKE 3R7QA 4NGHL 5MENA 3FMGH 2WQRA 5EWIL 1KXVC 3WAKA 4O02B 3ZKXC 3QYNA 2C4FU 3BKYL 1DFBH 1I8IA 3US1A 5I1CL 2E6PA 3GBDA 2CA4A 2ISDA 3T3ME 3WEOA 3W9EA 5IFAH 4OCYL 3MLRH 2ZCHH 3CGTA 2E7LC 1AZCA 1OSEA 3V8OA 1IAKA 1KG0A 2CDGA 3MCKB 4NRXB 1KLFA 1T0MA 1N2RB 2H1LM 1CFQB 1TZIA 3BKCH 4ZOEA 3F7RA 4F37K 4P05A 3EFFA 3WDJA 4XOEA 4BRVA 2CLRB 5I30L 4ZUSA 3GLEA 4UDTB 3CMOH 5KSAD 5I75C 1XH2A 3UXFA 4HZ1A 3WMPA 3DSFL 1FNLA 3T6ZA 4BHUI 4B60A 5C92A 4LHUG 1I4FB 3VGDA 2QBWA 2J8UB 3WE6A 4PWEA 1FZJB 4WKZA 4J6IA 3UTTD 4UTAL 1ZT4A 1I3VA 3HNSH 5T1DL 4GRMB 1KYDA 1WQVT 5KVMC 1UD3A 2J8UE 4AXWB 1QZNA 3VM5A 4QR7A 2ZOKA 5DSCA 3UDWA 3BAJA 1K5NA 4B3VA 1C16B 2WTOA 4MMXC 2HUEA 4UBDD 1HE7A 1X9RA 1XGUA 3BGFB 2IWFA 4WHDA 3U82B 1NDGB 1QHQA 2VXTL 5AYUL 7FABH 1FCGA 1TTAA 1UM5L 4G70B 3RLSA 2D7TL 3RVWC 1GC1C 3D3VA 4MHHG 1MVFA 1VACA 4XAWH 4YVNA 4LL9A 3UJJH 2H6UA 4G80B 5IMOA 2QDVA 3SO3B 3DJTA 5SWZA 3RWDB 4KXDA 5MENB 3ALWA 4MMZC 2D73A 2N0MA 3A47A 4JQIL 3RDJA 3TNMA 3HJEA 1GZHC 4C4UA 2BFVL 4EI5D 4DOHB 5LBSA 2B59A 1ORSA 1N7MH 1TTCA 4OCWH 1I8IB 3VXRA 2CR6A 2EDEA 3KE0A 4W9GC 5L4JA 4E36A 3B9KA 3W9EB 4TNVK 4E9TA 1KFGA 5MEPA 2WN3A 3BAYA 1MCJA 3FO0L 3GK8L 1IAKB 2H1PH 1KG0B 2X42A 3IDUA 2CDGB 4QAMB 4DOHE 1KLFB 1OPOA 1T0MB 1CF1A 1CXHA 5JIPA 1IQDA 2MCPH 1H8SA 3EFFB 2V5MA 3QISA 4UB0L 1Q9WA 1NICA 3RDTD 1KBGL 2JI2A 3TWCL 1BYOA 4N0CC 2R1YA 1QLEL 2C9SA 1F0LA 2OS7A 2P24A 3BDBA 3SDXF 2AKRA 4H8VA 3UEQA 3NFSL 1JI2A 5CEZD 4HPOL 4YL4A 2AGJL 3WE6B 3GB7A 2E56A 1F8TL 2FK9A 1JWUA 1TVDA 5EUKA 4WKZB 1ZT4B 4P23A 5TE7L 4CGTA 4AEIL 1J7VR 2IAMA 2ZOKB 3F01A 5DSCB 1K5NB 1IM3D 1DJIA 5CZXD 3C9NA 1A66A 2W9DL 1XGUB 5JHDE 4DP5X 4EN3A 2HX9A 1QHOA 2AJZA 3HC0A 3K6FA 4YFLI 5DMJB 2IOIA 4YH6A 4G5ZH 1T7YA 5EMYA 2ZKWA 2IG2L 4FJ6A 2VMFA 2VLME 3D3VB 1WRFA 3K6NA 1VACB 5CJQH 4LASL 4MMYA 2HX7A 4J3SA 5IMOB 1F3JA 2QDWA 3D7PA 5SWZB 4XODA 1RERA 3QS3A 3D3VE 4Q0XL 4HFWA 5KSVA 3TNMB 3N9GH 2PWEA 1TQTA 4PS7A 3NCYP 4KTGA 2B59B 4F1ZA 1ORSB 3EDKA 3VXRB 1E9OA 5SWZE 2EH8H 2YEZA 3LXCA 3NCWA 3B9KB 1KLUA 5ESQA 2MJWA 2X4PA 5CILL 5MEPB 2HFEB 3CZSA 4EDWH 1NINA 1J1XL 3KZ8A 3OHMB 4LPTA 3NDZE 1P6AB 1XF4A 4TTDC 5F0JB 1IQDB 3GSWB 3CZLA 2EDBA 1KGCE 3ES6A 5KBLA 2YPLE 4Z9KB 1FL6B 3WSQH 5SWQA 3CFCH 4PW3A 1Q9WB 4LRNH 1OW0A 1RUQL 1GKEA 4YXKL 5CCJA 2QVIA 2OMWA 4FLQA 1JXKA 1DDTA 3DUSA 1P84K 1RZJH 1SPDA 2CDEA 2P24B 3TEYA 5BXFA 2AKRB 3T77A 2MOVA 6TAAA 3OKLA 3GB7B 2EDKA 1RK1A 5ESAA 1MEXL 1JWUB 4BCXA 4KKBC 5EUKB 2OMVA 1ED3A 4P23B 5IGXH 4RETB 4S1SL 1UA7A 4N0FA 2R0WH 4EZLA 5BQ7A 1PX4A 3FU6A 3K6OA 2IAMB 2WVTA 3PWJA 2VXQH 4M03A 3QZWG 1QHPA 1BVLB 4Y0GA 3C9NB 2CQVA 4Y2OA 5IF0A 1SLVA 4EN3B 3WEBA 2PXYD 2AJZB 3HC0B 1FGVH 5G5DA 3K4ZA 2WKGA 5C7XL 3HC4L 1N68A 4KQ3H 3ECUA 3MBEA 1UM4H 1YN7B 3BGFC 4MMYB 1R3IH 1UD5A 1DQLH 3W57A 3CK0H 1F3JB 1ORQA 3QO1A 4RZKA 5I8OL 1OTSC 1RP8A 2F68X 5KSVB 4HFWB 3KWVA 2CGYA 4UNIA 5T1JA 5DA4A 2P8PA 4WHYH 4Y89A 1MFVA 3QNFA 3RA7L 1WFJA 2YQ3A 2XQBH 4W9IC 2DLIA 1E9OB 3SO3C 3MNVA 4YSDA 2YEZB 1RIHL 5E2VH 2EO1A 2VR7A 1M71A 1KLUB 5ESQB 3UADA 4KKAC 2X4PB 1XSJA 4L37A 2YQGA 1UXSA 3SZ6A 1I7RA 3ISWA 3UPCA 4D7PA 1O6TA 1O9ZA 1MY7A 3IPFA 4HP5A 1H5BA 1XF4B 5DLML 3BD4A 1MCPH 1YEGL 5HI3D 2F53B 4U3SA 2I07A 2Y07H 3ES6B 5DFAA 1HE8A 1JPFA 3HN5A 5L4IA 2R29A 2R4SH 3AG1B 4WFHE 3RVXC 4MSWA 2OMWB 3KXFB 1M7IA 2F53E 3DUSB 1SXAA 3ZE2F 4ZW6A 1OAYH 1S8DA 2CDEB 4ZFGL 5BXFB 1SJXA 1XR9A 4HF5H 3T77B 4UT6H 3OKLB 2V33A 3GT6A 3KXFE 3QB7C 1RK1B 5ESAB 3N40P 3QJZA 3CSFA 3DO4A 4PTTB 1HOCA 2LW3A 2OMVB 1ED3B 1E6OL 2J4WH 4HFUL 5CLWA 3RVTD 3WN5C 2KKQA 4N0FB 5F7BA 3JWNH 5CGTA 3PDOA 1DYZA 5BQ7B 4QT5A 4PJCA 3QRFM 1Z3GL 2E75C 2ILLA 3PWJB 5PCYA 1M3JA 2CR3A 4KNTA 1A3LH 1CTOA 3MGTB 3S4SB 2XWEA 1QW9A 4N6RA 4Y2OB 5IF0B 1T6WA 4NKIL 5G5DB 1MFCL 1GH7A 1JZDC 2VZVA 4LEXH 3UDWC 2GC4C 3EJZC 1Z5YD 4X9IA 3CFBA 3D4CA 3ZDXE 2K6ZA 3QRGH 1EZUA 3D07A 2XICA 1SMDA 1MREH 3RU8H 1HHGA 1ORQB 3QO1B 5F9OL 1O9WA 4GEJA 4XBEH 1J0HA 3CVHB 1UQSA 1JFQL 3P30H 1E7VA 2NY0C 5TPWL 1BFSA 2P8PB 5FUCE 1IBGH 1VZHA 3LRHA 1KJVA 3QUMA 3MNVB 3O6KL 1IFHH 1OAXL 3QQ9D 1VPOL 2XLLA 5ABDE 4E0RA 1UXSB 5BNXD 2X89D 2I9TA 4ODTL 4Q9CA 3UTSD 1I7RB 1HAWA 2O5NA 1NAMB 2IXQA 2O5ZL 2YAOA 1C9SA 2CJ3A 1H5BB 3VXQA 2HP4A 3MREA 2J7LA 3B9KC 2P28B 3X3FL 5CSZA 2HA1A 1KB5A 2I07B 2YMOA 3E0GA 1JPFB 1U8JA 4DKAA 5JIQA 4R4ND 1ROCA 2OX5A 4UMSA 3ARSA 2OJ1A 3DYOA 4GSXA 2WQUA 4IRZL 4MSWB 4YE0A 1M7IB 3QWRA 1CK0H 3EH3B 1CU4L 2VJXA 1S8DB 1EERB 1IAOA 5GGVH 4JPIA 1XR9B 4HUXA 3F5WA 2IOMA 5LUMA 4AIZA 5FV2A 1QPPA 2WWMD 2VSKB 1HOCB 2DOCA 4TNWF 4YQXH 1HX0A 2BP0A 1YY9D 4IBQA 4M6OH 5E9DA 1KPRA 3IGAA 1XD0A 2HT3C 3PDOB 4M48H 4GB9A 1CFSB 4PJCB 1M42A 1PS3A 3IMTA 3MOAH 4UINL 4X98B 3MGOB 3RY6A 1XR8B 4WWOA 1CQYA 3DXAA 4N6RB 5CZVL 2W80C 2WC7A 2CM6A 2ZKHH 4PJCE 2MTAA 3OKDA 2IAMC 4R6UA 2YD4A 3CFBB 1CLCA 3QI9B 2CDFA 4HIEB 5F3FA 1QTPA 4O9HH 5I71C 5FF6B 1F41A 1SLWA 4XB7A 5LBVA 1GA2A 4YEEA 4MCNA 4Z7NF 1HHGB 3PHOA 4RMSA 4KOCA 1N0XL 3MRMA 1UQSB 3GSNA 4BZ2A 2BHYA 3Q8BA 2J6WA 4LHQB 5BVPL 1KJVB 3QUMB 3LB6D 4FFZA 1CDGA 2Z0UA 4R8WH 2K3HA 2Y1VA 3JWOL 1EDHA 1WDAA 4OJAA 4E0RB 3TBSA 1G7IB 5E08L 1KFAL 3DURA 4BEIA 2I9TB 1T22A 4Y2DD 2IXQB 4OIIL 4KV5E 1AD9A 4KVNH 2J44A 3VXQB 1IAIM 1X5AA 1D2PA 2OMTA 1KB5B 1DSWA 3L81A 3N40F 5I1EL 1U8JB 3MJ9L 3PGFL 4ZOBA 2OX5B 4ZMVA 2G5BA 1UOVA 1I9JH 4IMKA 3RPIA 4GINA 3NA9L 4OCRL 1U2YA 3H55A 2H2PD 4K94C 3U7WL 2VIRA 3ZHFA 1IAOB 2CXKA 4JPIB 2CKNA 4LQFH 5AVWB 1ZLVK 1OW0C 3F5WB 4AIZB 3D52A 2C9VA 4ZO9A 4MQXC 3IJHA 2QGEA 5FGCB 1FVCA 4AEFA 5I82A 4ZD3H 2BP0B 5E9DB 1KPRB 3IGAB 5FO7B 5KBKA 1G6RL 3X1GA 1NZRA 1AYOA 2P5ED 2V2WA 1QRNA 3DVIA 3HMXH 1L0YA 1U92A 4HEPA 5KUMA 5BJTA 1YUHA 5FGCE 2XBZA 1M9SA 3DXAB 4OJFH 5E9DE 3OC5A 5EBLA 5LB1A 4LSRH 5KANI 3ESMA 5FKPA 3OHXA 3S36L 4LFHG 5I0YA 2CO7A 1BCIA 3DXAE 4K3DH 2CDFB 4WUUA 3NVQA 1I9EA 1OGPA 1ROWA 1RJYA 3VRLE 4XPAH 1P0SE 5C09D 1FBIL 5HYSG 5JA9A 1E90A 3PHOB 1IBZA 2IPUK 1J1OL 3GSNB 2ZSVA 4UQDA 3MBEC 3WFEL 4N8CL 5GS0L 4O5LH 5FUCC 4K3EH 3TO4D 1FGNL 1X5IA 1UEYA 4OM1L 1EFXA 2YXWA 4YDLC 3I9AA 3HB3D 5H94B 1AXTH 2W59A 3TBSB 2XA8H 3DURB 3HKZA 5ALBH 3CLFH 1KWKA 4K2UL 3P9LA 5C70A 4YHNA 1MRCL 3WMSA 1AD9B 5F7YC 4BZYA 2QGCA 4TLSA 4Z3HA 3P3UA 3ELQA 4UZSA 3U1SL 4PP2A 4RGOL 4RRPG 3NCFB 3RAJL 3QEQD 1LJMA 1ZLWH 4FABL 3RPIB 3BKJH 4IK7A 2CG9X 2HXAA 1G7PB 5A2IH 4O00A 3AXIA 1KN2H 3HC2A 1AZZC 3BPOC 1TVHB 4WVRA 1RIUL 2VIRB 2XWXA 2WQVA 2VW4A 3BJ91 3THML 4OZHE 1MAKA 4M1DL 4IRSD 4ZMYA 3IJHB 5KANG 4XO9A 3AY2A 1T0NA 5GISL 1FVCB 4F2MA 3KR3L 4FAAB 1JWSA 3S3SA 3VB9A 4H8HA 5DD3L 2V2WB 2Q8AH 4CMHB 1QRNB 1QABA 4ZSOE 1U92B 3V4VL 5BJTB 1YUHB 5DC2A 1E67A 3ESPA 1ONQA 4WHYG 4YK4C 3MJWA 4N9OB 1MCLA 1PCXA 3G6JE 5GGTA 2IQAA 1MWAL 5FKPB 5C8JA 1MCWM 3OHXB 1ZHKA 2DWYA 2WZ6A 3I6KA 4M7KL 4P2OA 4BSJA 2CO7B 1Z9PA 2WLYA 4R7NA 5SV4A 3KJ6L 4WUUB 2EUVA 1TEGA 4YC2B 3MV8D 1RJYB 3QUXD 4HJ0D 4BSVA 1QYGL 2XV6B 3CE1A 5E4EC 3K91A 4P48A 3TU6A 4B3EA 4ZTPH 3N3EA 1AGFA 4HQQL 4WI2A 3RGVA 1XB3A 2ZSVB 4NQCD 4WUUE 3RYMA 2E7BA 3S97C 1PDKB 5J4MA 5ACZA 1DJGA 3WS6A 1AZRA 3FMGL 1N12A 1E9QB 4Y1SA 1CF8H 1EFXB 2K1MA 5DUPH 1XV8A 5EF2A 1DFBL 5EUOA 4CRPA 1BAFH 2DLFH 3HAEH 1MI5A 1J86A 2Y1ZA 5E8OA 4B5EA 2FX8H 3ETBF 5B22A 3MLRL 2ZCHL 3HW7A 5IB5A 5IFAL 4TUKH 2A4CA 3IETA 2CK2A 1L4IA 5DHXB 1CJYA 3MC0A 3T71A 4PP2B 3BKCL 2FUTA 5IUSA 4JM2F 4TV3A 3JWNG 3L4VA 1DLHA 3ARED 4ZNEE 2WWOA 1P7KB 3CMOL 3QPKA 4MAUH 1JV5A 2XTJD 3LVEA 3Q2LA 4P5TA 4ZUVB 4JVUA 4JX0A 1T0NB 2Z34A 4GQRA 4FKHA 4BA0A 4F2MB 4IIZA 1ADWA 4X5WA 3OWRA 2C3WA 3KGRA 5HDQH 1WFTA 3HCVA 3HNSL 1ZPLA 1A0QH 1ZLDA 3MA7A 5EUOF 1R24A 1ONQB 1TO5A 4F2ME 4FFVD 1RIVH 4J2XA 1LLAA 2FECI 5D7JD 5SX5K 2VM4A 4OBRA 2HTKC 2IQAB 1URIA 1INDH 1W2KT 4J7RA 2FT7A 1ZHKB 4P2OB 3I6KB 4HCIA 3BEVA 7FABL 3RY6C 5B3SB 4R7NB 4JKWA 2YLKA 1A14H 5CHNB 4TQEH 4XAWL 1IL1A 2EYTB 4BSVB 4MB5A 3UJJL 1AJ7H 1AGFB 1S7UA 3KYMA 3ZT5A 3RGVB 4ZAKD 4FQPA 1W15A 2EC8A 3TEXA 4UQEA 3S8WA 5A2LH 4K3GA 1GS8A 5DO2D 2XWRA 4L3AA 4N2BA 3TEZA 2H41A 1N7ML 3BUIA 4OCWL 3FB5A 2F15A 1B6UA 1MI5B 2DIBA 4CJ0A 2F54A 5E8OB 5IB5B 1H6UA 2Y7SA 3GM8A 3Q8FA 1NBQA 2H1PL 2NYYD 3L4XA 4J3TA 3T8VA 1Z5LA 4UIMA 5F71A 1MI5E 3QDJE 3MKGA 3OAYH 3D0VA 4YX2H 4DKTA 2MCPL 1BFOA 3TFBA 3F58H 4ONOA 3QDGA 1T7VA 1QFOA 4IBWA 4ZOCA 3EO0A 1OGSA 4Y16C 1URLA 1FIEA 4L2YA 5E56A 3K81A 2ZKYA 1JV5B 5DJCB 1QAWA 5IHUH 2X4TA 1E27A 4P5TB 4DN4H 3KHOA 4DKFH 2XY1A 2X3AA 1MCWW 5H2BA 4JFYB 4X5WB 3C60A 2P9RA 5I17A 5I74C 3HCVB 4GBXD 5EULV 4ELMA 3EYSH 4U2YA 5CUSH 3MA7B 4GG6A 3CSGA 3K71B 1R24B 4F37F 2JKWA 2QLYA 2Z7WA 3C6LD 5KYYA 5EEXA 4PTUA 2YZ8A 1AY1H 1QFUH 3BN3B 3PG2A 4PJDA 5C0BA 2OTPA 3POHA 1JZ3A 3AU1A 3BEVB 4G5ZL 1DJSA 4OIBA 1QX1A 2FIRT 1IL1B 3SYAA 1G7HB 1PZCA 4JN1H 4AM0A 3EHBD 5CJQL 5E2WH 4NBZB 2PKDA 5ES4B 2TSBA 4JM0A 1S7UB 3KYMB 2PETA 3QUKB 4WW2F 3CFMA 1AVAA 4YC2C 2YAHA 4DP0X 4KZEH 4PBWD 4NXSA 3C5JB 3N9GL 2ZOWA 3U7YH 5DC9B 5F1IA 2P42B 3WIHA 1FYTB 1EEQA 3G6DH 5LLIC 3GDBA 4PJ6A 3FB5B 2EH8L 3FSAA 4HVBA 2HT4D 1QP1A 4Q6KA 2F54B 1OAZH 2PW2A 4WGKA 1JTOA 2ZICA 1FYTE 2A99A 3AU0A 4EDWL 3WS3A 4A7SA 1Z5LB 2IIJA 2YK1H 4UIMB 3MV9B 1V3MA 2F54E 4UNUA 3D0VB 4OD2A 3F2LA 1BFOB 4NPKA 3QDGB 5AENA 3WSQL 2WYTA 2K78A 3GMPB 3MV9E 3CFCL 4WK0B 3EO0B 4LRNL 5L8LB 3ZBMA 4U7KA 5KYXA 1DDHA 2IDTA 2I85A 3FF8A 4AGQA 3GSQA 2EEFA 3E8UH 1R3KA 3PWUB 2W0FA 1CDUA 2GI7A 1E27B 3O41A 5GS3A 2VR5A 2BSDA 1V3KA 5H2BB 4BQ6A 1MLCA 2BS9A 2QMJA 4NO2B 3C60B 4ZPTA 2AV1A 4GRLA 4M6AA 5TQ0H 5IGXL 4Q74A 4ELMB 1MFUA 4A7GA 5BRZB 1AXIB 2R0WL 5IMLB 4GG6B 2ID5A 3L4WA 5KYYB 3II3A 2VXQL 4E9YA 4FLSA 3R8QA 4KNSA 4X5RA 4ELME 4ODXB 3D5OF 4MS8C 3NSXA 4PJDB 1LO3H 4LKXA 5C0BB 5BRZE 1FGVL 1BVZA 3AU1B 2WTRB 1PG7H 2P43B 4FQXD 4JM2C 1K2DA 4KQ3L 3EOBA 4U4BA 5SX4I 3ULUF 4PJDE 4AM0B 1UM4L 3F7LA 4LOUC 1R3IL 2EIBA 1DQLL 4B9IA 3CK0L 2ZWKA 3PGDA 4OLVH 5JORA 4BFJA 1M7UA 4YPGA 3US0A 2DMGA 2F7OA 2A9NH 1IJNA 4ABVA 1F02I 5D1ZI 5F1IB 5L2JA 4KDVA 2XQBL 3RGVC 5IKCA 4IGBA 5E2VL 1HC1A 2PW2B 2AJVH 4H0IA 2FH8A 4JFHD 5DHDA 3UYPB 1N5YH 1MXDA 3WS3B 3A4AA 4A7GF 2OPCA 5GRWA 5AAPA 4Q6IC 3MUHL 1Q94A 1NGZA 3ZYJA 5I0DA 4OD2B 3T5WA 3SYOA 3PAZA 1MCPL 4MJIA 1AO7A 9PCYA 2Y07L 1SFDA 2OYKA 4L1SA 1Q72H 4PGEA 1JZ4A 4U49A 4JY4A 4JRWA 2IPTL 2R4SL 4LT7A 1UATA 5KJ7E 3LRLA 1AS7A 4LEOA 4NB7A 4X42A 2WP3O 5KYXB 1DDHB 2BVQA 3LOWA 3NJIA 2A9CA 3H1ZA 2ZUYA 1OAYL 1R3KB 1W72H 2VDOH 3SCMD 2W0FB 2HMIC 1A3RH 1EAJA 1JHLH 4HF5L 4AZ8A 2EUWA 5EEUA 4UT6L 4QRRD 2O72A 2V3FA 1J8HA 3V0VA 1YJDH 4P2QA 4KRPB 1JBJA 1MLCB 2FRGP 4ZPTB 2AV1B 4GRLB 2J4WL 1EZLA 4GRWH 4XMLH 5D2NA 5IVNA 5C0RH 1I7ZA 2IBGA 4P5TC 3IDJA 2EXYD 2F19H 3LS4H 4HETA 3VFMA 5IJVA 2QPDB 2FJFA 2VXUH 4HV8A 3C6EA 4QOKB 1A3LL 3A6OA 3IPBA 3QXWA 2V7NA 4ENEC 4LKXB 3IDNA 1MZYA 5CBAA 4D0BA 5I0WA 3HAEG 2F1BA 4LEXL 4Q56A 4QOKE 5J8OA 1K2DB 4P2AA 2BY1A 2WLZA 4Y19B 3T6QC 3EOBB 3QRGL 4KJPD 4HJ1A 3K1KC 3RB7A 2P8MA 4OFDA 3VGEA 3Q5TA 2AQRA 1J5DA 2FLRT 1MREL 3LKQA 3PGDB 3RU8L 4GQZA 5JORB 4YDIH 4YPGB 4Y19E 4U1GC 3FUJA 3N41B 4XBEL 4FQ1H 2WB1A 3P30L 1KV7A 2WO3B 2NXZB 1L6PA 3KW7A 1P9MC 1IBGL 2CXGA 5L0QC 5L2JB 3DC0A 4RSYA 3S36X 2H8PA 4X0KA 2WIMA 4QJ5B 2HRHA 5IKCB 5T1MA 4PJ5A 1IFHL 4IGBB 3RKPA 5ID0A 3LRSA 4G5AA 4NO0D 3RIKA 3SDYH 5IB2A 3WTVA 4ENZA 3VWKA 3V79C 2GJRA 4KU1A 2VOTA 2JKTM 2VQ1A 2XBTA 3PAYA 3SYQA 1Q94B 1NGZB 1KB9K 1XT5A 5EU4A 4H2CA 4MJIB 1AO7B 1KXHA 2Y36H 5I9QC 3FNKA 4RWHA 2WN2A 5DT1H 4PGEB 1XZWA 4KX8A 4ODWA 5DZOA 3CSTA 3DECA 4W1TA 2EACA 4JY4B 3X3GH 2XN9E 1COBA 4LEOB 3PDGA 2VDNB 4PW9A 4M7ZB 5CINH 3ZL2A 2OMUA 1AO7E 1VCBC 2BVQB 2R2CA 4MJIE 1CK0L 1G7LA 2VDPH 4ZMQA 2X53A 4QHNA 5GGVL 4AZ8B 2EIKB 3NZHH 2Z93A 3BFOA 1J8HB 2W0KA 4GUPB 3V0VB 4NAQA 1FL5A 1GAFH 4P2QB 4LHUD 4PW4A 2RTTA 3CVHH 4HBQA 2KLRA 2CJUH 5D2NB 4YQXL 1WA1X 4KTDH 3QUYD 2W5PA 4M6OL 1I7ZB 4MX7A 4LP8A 4M48L 3IDJB 3CFEA 1J8HE 2YD5A 1JP5A 5C0CA 3C5SA 4P2QE 3VFMB 5IJVB 2FJFB 3MI6A 3MOAL 1ZVSB 2ERJB 4HYTB 5D2NE 2HRPH 1EJOH 2Y2TA 3WEXA 3BE1H 2V7NB 2XQYK 3LNDA 3IDNB 2ZKHL 2JJWA 4OLZH 3KGTA 5CBAB 2FECL 4D0BB 3NCYS 1WK0A 4DPBX 3LIZA 4TL5A 4GKLA 1OLLA 2G4EA 2P8MB 4O9HL 5I6MA 5I15H 3IDGB 1VEPA 1YSOA 1B88A 1TJHH 2IC2A 3D08A 3LKQB 5CU5A 1OTTC 1DJYA 1ZS2A 4HXAH 2ARJQ 3B83A 3KH3A 5DQJA 1HCZA 1JZFA 5FCUH 1L5GB 4ACTA 4URKA 2DQJH 2X88A 1BZ8A 3BVUA 4JO3H 2CO6A 4X0KB 4U3HA 5T1MB 2JQZA 4Y4KA 4R8WL 5ID0B 5IB2B 1ZSDA 1FYHB 2CUMA 4WHTA 3VWKB 1BBDH 5A2KH 4OZGB 1NLBH 1FNGA 2AC0A 2BRRH 4LCWD 2BIMA 2VQ1B 2AK1H 3QQNA 3ZGHA 2VUYA 4KVNL 3WTUA 3KLSA 2K4AA 1PLCA 5EU4B 4LPXA 3UO1H 3BIBX 2VZSA 4OZGE 4ODWB 3SDDA 1I9JL 1CIUA 3APDA 3BZ4B 3GMRB 5SWSA 4ATWA 2ENQA 4H1LH 2IDQA 2OMUB 2WKLA 1DVQA 3ULUC 1G7LB 2BSSA 5JIMA 4LQFL 1KGIA 3DTUB 2Z93B 1H3PH 1OZUA 3NFPA 1T1ZA 3UROR 1FL5B 4K3JH 3D4GA 1JTPA 4ZD3L 3K8KA 4MX7B 1AS6A 3LTVA 2Q9OA 5DLLA 5C0CB 5GGSA 3C5SB 4UU9A 3ARFD 3VFTA 1JMZA 3HMXL 2XT1B 5DJ8B 3GPSA 3WEXB 3PWVA 4GRLC 4OJFL 4GI8A 2GBVA 3VSQA 5ICYA 2NR6A 1ERNA 2P47B 4XOCA 4LSRL 4TUJA 5C0CE 3VFPA 1D7BA 2DM4A 3VSUA 2ALAA 2J8OA 4HAFA 4ONFH 2J2ZA 4K3DL 2Y6TE 2COVD 3FQNA 1J0IA 1ET7A 3I6LE 4XPAL 3EYQD 1ZSHA 2KQNA 3K8MA 4XO4A 3NCBB 5DVMA 2Q5BA 1ZS8A 4O5LL 4AYSA 5AVSB 2I25N 4QCIA 4K3EL 2D03H 2LU5A 4W9ZA 3WLBA 2EXWD 3UTPE 4DEWA 3Q5OA 3KYKH 1FG9C 1ZSDB 4KI5F 1AXTL 5KSBA 1MELA 2NXZC 2XA8L 4H8WH 4WHTB 2NNCA 4XOBA 4N2HA 3BMWA 3IPEA 3CLFL 4ZQKA 5ALBL 3WUWA 1FNGB 1CO1A 3UMNA 4WI8A 5GGRY 1A1MA 3NPSB 3FK3A 3FUNA 1OTUD 5AYQA 1EMTH 2EDFA 1BGXH 2LR4A 4YSEA 1E4XH 3C2AH 3I50H 2XNAA 4LPVA 5HHMD 1DHKA 5EC2A 1DO6A 1MFDL 3BKJL 3SDDB 5SWSB 4ETQA 4BJLA 1KN2L 2I7OA 2COQA 3LAFA 4H0HB 1IEBA 2O1AA 1TTRA 2RD0A 2BSSB 2GYSA 4J8RB 4YVUA 3MDJA 2C3GA 4C59B 2J71A 5J13B 3MV7D 3AB0C 3NFPB 4YFDB 1T1ZB 4M7ZC 1HQRA 2DLEA 3FF7A 4PRBB 1M53A 4BELD 2WXKA 1LWHA 5FFOA 5T33L 1MOEA 3M1BA 1A4JA 2ICES 2DS4A 3ISRA 4DCQB 4UU9B 2Q8AL 4ZX3A 2BSRA 3UCRA 3BUTA 5EZIH 2QSTA 2XN1A 2BNQA 3PWVB 5D2NC 4E5XG 4EBQH 2YZ1A 1X9UA 3VFPB 4TUJB 3P3TA 2YWZA 4Y4FA 4Q9QH 1DZBA 2P4AB 3O6LH 2ERJC 5I73B 5F89A 2PYFA 4CC4A 3VMPA 1U0QA 4OGYH 3VVVA 3FJTA 3AAZA 3FQNB 1KSRA 3ZTDC 1J48A 2ROYA 2CCLA 3K3QA 4XP5H 5DS1A 3WFCH 3PUUA 4ZTPL 1NEZA 3TA3D 3QIWA 4G6KH 1KZQA 1JUFA 3JT2A 4QCIB 5FECA 4R5XA 4ESKA 3WLBB 1CF8L 2E7MA 1SOXA 2VZ1A 4IHOA 5DUPL 5I24A 2K8MA 2XIDA 4WI7A 1BAFL 5KSBB 2DLFL 2XV0A 3PL6C 4M6MH 5HHOB 4IBVA 4ZQKB 5I6LA 1OB1A 2AVFA 2FX8L 4S11A 3VO0A 3WUWB 3X11B 1OCOB 1EGJA 1EO8H 2ZNXA 4K3HA 4XP4H 1A1MB 4TUKL 1TQCB 4Y4HA 1E43A 1L0QA 2ZXGA 3B7SA 5KSBE 3C5ZD 3MQIA 4PBXA 3RNKA 2XETA 5KSAA 5IQLA 2XNAB 1SF5A 4XMWA 5EC2B 3VWJC 2YOAA 5DJXB 4KK8C 4APQD 4AL8C 4NQED 1FH5H 1IEBB 4M43H 2Y7LA 1NDMA 4HC1A 3UTTA 3WNNA 1XCQA 3VXNA 4I48A 2Q3XA 4MAUL 5CR8A 1JZ5A 2FBRA 3FT2A 2J1KA 2CE6A 2ADIA 1OV8A 1AANA 1HQRB 4D9QD 5JPMA 3PP3H 2X0VA 1CXIA 3H0TB 4I0KA 1EXUA 3RJOA 5I1AA 3AMLA 3M1BB 4JRYD 1M05A 1A4JB 1U95A 3CZFA 5GRYA 3T09A 5HDQL 5LGYA 2BSRB 4DTGH 1A0QL 4HMEA 1HYSC 5MERB 5FGRA 2BNQB 5HDBE 4QYOB 4XX5A 3E7JA 1RIVL 3QORC 2FVNA 1DCLA 3U9WA 1INDL 1D7DA 4Y4FB 1UOWA 4XB8A 3CIAA 2MQCA 5F89B 2PYFB 4H8PA 5JW5A 4MBRA 1AQKH 1A14L 1KT2A 3AAZB 4TQEL 5HGAA 3P2DA 4NHUA 2Z4QA 4GQQA 4U1KB 4X6EB 1BM3H 1AJ7L 1NEZB 2APTA 3QIWB 5ANME 4Z77A 4JFPB 1P69B 4A7TA 1JUFB 2D9CA 3LQMA 5FECB 2ZYRA 3RJQB 2R27A 4OZFB 3ULVF 2OZ4A 1KTBA 4U1NA 32C2A 2EEDA 4PS8A 2RJMA 5ECJE 2GFBA 5GJTH 1OB1B 4GUOA 2OJEA 2FGWH 4Z7UA 4J3OH 4Y4HB 3Q13A 4Y4KC 1MPAH 1F45A 1NOLA 4Y9EA 2OR9H 2PCXA 3RNKB 4B9GA 5KSAB 4OLWH 2DV6A 4YX2L 3FONA 2FEEI 3DTDA 5AQ0A 3OLIA 4KKCD 3F58L 1OWWA 3BISA 4X5LA 4UQCA 2WBJD 4XO8A 5E6ID 9CGTA 1NANI 1PZ3A 3OD3A 3TXAA 1NDMB 3UTTB 3HS9A 3S8GB 1XCQB 3VXNB 4I48B 3AGVA 3SDDC 5IHUL 2IAAC 3FT2B 1S6NA 4OCLC 5D4IA 2ADIB 3CWGA 3VQMA 2IDSA 1XTMA 4DN4L 1P84J 5JPMB 4X6DF 4DKFL 3UTTE 2ITFA 1EXUB 3UACA 3EIFA 2Z92A 1I7TA 2MMXA 1M05B 4B97A 1HCYA 1U95B 3CZFB 3D0LB 4N2NA 3EYSL 5CUSL 2YD1A 4KI5C 4P5SA 2AANA 2P7TA 1DBJH 3TPUA 3K2KA 1ZPUA 5AFAA 1AY1L 1QFUL 1J9CT 4WI6A 1WEJH 2VUKA 4CNIA 4C4BA 2HAZA 3ARDD 4XBPA 5JW5B 2FX7H 3GXDA 2LFEA 1KT2B 1U8QA 4NHUB 2Z4QB 3DRQB 2NOYA 4JN1L 3VGBA 4XHJD 5E2WL 2GSIA 4QHPA 3TBCA 5J3HD 5FHBH 2D7OA 5J89A 4FX5A 5I73C 1UZGA 4Z77B 5JW4R 1BQKA 1N5AA 4O2CA 5CGBA 5L6YH 2R8SH 1GS7A 2WCGA 4KZEL 4TULL 5MEOA 5E4AA 3PWPA 2YKKA 3M1CA 1PZBA 3U7YL 2G60H 3G6DL 4KC3B 4U1NB 4H1LG 4G1EA 2IBBA 5CLTA 5ABAA 4KO5A 3DDGA 1MRDH 32C2B 5GGUA 5CFHA 1HS6A 2GFBB 1UENA 3K74B 1OAZL 2OJEB 4Z7UB 4PJ9D 2NX5A 1UA3A 2VDLB 3ATBA 1E4XI 5HPMA 5HGGS 3HVNA 2YK1L 4X7TA 3FONB 3ASWA 4K0OA 1KEMH 4MZ2A 4WHCA 3RFZA 4YZFE 3SOTA 2YUVA 4KXZH 1D5IH 3N43F 2A9DA 5KOMC 4PB0H 1JVLA 1RKRA 2AERT 3OSKA 5A3IC 2P3YA 2YD7A 3P0VH 2VXSH 3B6SA 4GP4B 3E8UL 4KRMB 4NQVA 1DQJA 3G7TA 3LN9A 5F1SA 4KJQC 2CH8A 3ETTA 4I89A 4XNDA 1M7DA 2ZG1A 1IM3B 4JJ5A 5AUMA 2Z92B 1BWMA 4OQTH 4BA8A 3PUCA 5TQ0L 4ZFZA 2PXYA 1CURA 3FZUD 2NY4D 5KOVC 5IB3A 4ZMOA 1XAUA 5JPNA 2P7TB 4TRPH 3TPUB 4A37A 3SIKA 2YA1A 1A25A 3GZOA 4LDCA 3HE7D 1HHJA 2D3LA 3GF8A 5FYJU 2XWZA 2X2JA 1LO3L 4CNIB 4NC1E 4BM7A 3VU2A 3P1VA 5LGHH 1PG7L 4LFHD 3UBXG 2BWDA 1C08A 4OLYH 1CI3M 1U8QB 1ZOXA 5I1DA 3VTAA 1RU9H 4ADIA 5E7FA 2GSIB 5B1AB 4OLVL 5GS2H 4PU2A 4CC4C 1N5AB 4TNEA 4O2CB 5KBNC 2A9NL 2NY3D 5MEOB 3PWPB 3L95A 3D25A 2WSPA 1OCCB 4EN2A 3CD4A 4HJIA 1OKEA 1VF5C 3Q3GB 2QHLA 1QSVA 3HHSA 4XP9H 3QIWC