1P4UA

Crystal structure of gga3 gae domain in complex with rabaptin-5 peptide
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
145
Chain Sequence
b'LSLASIHVPLESIKPSSALPVTAYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNMAPLPVKSIVLQAAAPKSMKVKLQPPSGTELSPFSPIQPPAAITQVMLLANPLKEKVRLRYKLTFALGEQLSTEVGEVDQFPPVEQWGNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor binding protein GGA3
publication title RECOGNITION OF ACCESSORY PROTEIN MOTIFS BY THE GAMMA-ADAPTIN EAR DOMAIN OF GGA3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 25
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1p4uA00
5CN2A 1GYUA 1QTPA 2DWXA 2E9GA 3ZY7A 1GYWA 1KYFA 3HS8A 3ZHFA 1KY6A 2A7BA 1KYUA 5CN1A 1NA8A 1OM9A 1KYDA 1QTSA 3MNMA 1KY7A 4BCXA 2YMTA 1P4UA 1IU1A 1GYVA 1B9KA 2VJ0A 2DWYA 1W80A
chains in the Genus database with same CATH superfamily
3D3VE 2HSIA 3EFOA 3LKSB 1LP9B 1MCQA 3O3BA 2X4UA 4ZO9A 5AOKA 3ZLQC 3WTXA 1PZDA 3N0PB 1OLZA 2Y3NA 5F88A 1NCWL 2IMMA 5E99H 3X3GL 3WFEH 3O4OB 4TN9A 3VFMA 3K2UH 1JTOA 4FQHB 2FD6L 2EEFA 1SDYA 4G8GB 1Q9LB 2R29A 3L3OC 3UFIA 1M71A 1WBZB 3RNKB 5BRQA 5KSAC 4MNQE 3HE6D 4WJ5A 3ABZA 3UZQA 4XNMA 3IPFA 3WFBL 4EXKA 4I4WA 5EULV 2CH8A 4FFZH 1OK8A 2WUBL 1EX0A 4AMKH 3F2LA 3S3CB 3PXHA 4NWTH 3R4RA 1JVKA 5DJ0A 5HHOD 3BQVA 1E6JH 1RMFL 4B7LA 5F7WC 5C9KA 3LNDA 4Z95L 5KYXB 4LASL 5EIIA 1GIGH 5KVDL 4APXB 5EN3A 4N3TA 2YA2A 4G9FA 1W0VB 5EU6A 1ZTMA 3NFSH 3TN0D 4YQXL 2KQMA 3F85A 4UT6A 4JO5A 4TKWA 3WS3A 4XB3A 1I8UA 4YK4B 1IU1A 2GJJA 1IGCH 5EZJB 5F1OB 3SODB 3VGEA 1D5XB 5A43C 4NYLA 2VJ0A 4R97B 1XCWA 3Q5TA 3ZR6A 3UDWA 2FECL 4K5PA 5DC2A 1DUYA 1SJVA 5JW3H 1X5MA 5EEZA 4Y1AA 4I0KA 3UAJC 2XIBA 4JPKH 1XSKA 4DUVA 2VWEE 5CSBA 3WUWA 5HHMB 3TS8A 2BP0A 3HFFA 2P8LA 3N50A 4FQXD 4M5YL 1M05A 2KKQA 2WLMA 5SX5H 3W9DB 4DNLA 5FF6A 2WB1A 4N0UE 4FYRA 2CJUL 1OT2A 4AYSA 1WWCA 1AVAA 4BKTC 4HCFA 2ICWB 4YSUA 3ZKXC 3EYVA 2CM5A 1D5RA 2EINB 2PPEA 2VDKH 5I5JA 4DTGH 2GPZA 3H9SB 3EUDA 4GKNA 3G5ZB 4UQ3A 4BDVA 2CJ3A 5BUGA 2CO7A 2F54A 2MNWA 4JLRA 3I02A 4POZD 5FYJH 5TDPA 4CVZA 3Q6FA 4KRLB 9PCYA 3ULUE 2OMVB 5IT2H 1IARB 4V11A 4XBMA 1Z9LA 2CBTA 3NZ8A 3ME0B 4UTBL 4X8JA 5I8CA 5KBPA 4LLYB 4GP5B 3QI9C 1JPGB 5I1CL 3LRSA 3O4LA 3C60B 3RB7A 1M7DA 3AT0A 4JFEE 1ETJA 4G59C 2JV6A 2GHZA 1YEDA 2WNXA 4X0NA 5F7BA 1MFAH 3CIQA 4WW1A 1I8IA 4I48B 1HE7A 1K9TA 2IOOA 5K33A 2K9UA 1KBGL 3QEHA 1ET8A 3LZFL 3BN9D 2PNDA 2Y7NA 3WXWL 2IQ9L 4Y5XC 5D1QC 1CF8H 2AGJH 2Y36H 5D7SH 1KT2B 1M3IA 3D0LB 4I0PC 1H15B 1GYWA 5LBVA 1M2VA 2B39A 5GIRB 2MNJB 1R24B 4LCYA 4MJIE 5SWZD 4XNXH 2BVYA 4BZ1L 1OHQA 5JLZB 2NY5L 2X4RA 4P59L 4EN3C 3BKJH 1CLCA 3ECUA 4ZXBD 5AAWA 4HIEB 3L4WA 3GSNA 1M57B 3FU3A 2B4CC 3HBZA 2BZDA 4JAMA 4RCAA 3BEWA 1NKGA 5K9OB 4Z7UE 4DJMA 4X6FA 2LLLA 3ZE2E 3KM1A 4JCWA 4OFYD 5DRXA 5GRXG 4WO0A 5JNYB 3U7YL 3RNQA 3HVNA 5TF1H 4WWNA 2XHNA 4TV3A 2N59A 5SWQA 3BIKA 3KPPB 1UM4L 4TUJA 4YDZA 3SDYH 3LQAL 2QGDA 4YPJA 4KK6D 1JWSB 4JREB 5MEPB 3O6LL 3TCLA 5IHWA 1TO5A 4X7FC 1DHKA 5I8EB 5BS0B 1DFBH 2XACC 3BVDB 2KUTA 3KPNA 4LHQB 5L4JA 1EGJA 1FZJB 1E5YA 1L0XA 1SGKA 5I0XA 5MEQB 1GJUA 1NCIA 5TE6H 3N41F 5ID1B 1KLFB 5DC0A 5BXFB 4JPWL 2G75B 5FYJU 2R2BB 3AB0C 4IDJL 4JR9H 2MOVA 1I9JH 1IQDB 3HPJB 3P02A 1OD7A 4B9GA 3G5WA 4GFXA 3WJJA 3L9RB 2AJYH 3QP3A 4AL8H 3N42F 5DMYA 1QOKA 1FG2A 5DHVA 3IWVA 3SDAA 2UX6A 1ZT7A 1FN4B 2VUOA 2ZXBA 4WI4A 4GW1A 4K73A 2EYRB 2EYSA 1F6LL 1A4JA 1PBYA 4JGJA 3ESNA 5JUEL 2YZ8A 1C16B 4HJIA 5D5MB 3IDNB 2PCPB 3RWIA 3VGDA 4JHWL 5D7IA 3B9KA 4Z77A 1NCJA 3H42L 4IJ3B 4XMPL 4RAUB 4XBPB 1V3KA 2JKXA 3EG9B 1JPSL 4QIRA 5EDXA 3HRZC 5LNGA 4PJHA 2K0RA 4IGBC 2A6JA 4IKNA 2AEQH 2UXFA 2EZ0C 2XV2A 3BQUB 4GS7B 5IHBA 1JTPA 1NFDB 4G6JH 3TONA 3SGDH 4F5CE 3G9VA 2VR6A 3CLWA 3A6CL 2N7SA 1J1XH 4IMLA 1KBVA 1NIFA 1PVHA 4CC4C 4KITB 2NXYB 3MNDA 3RBSA 5I5RA 4DP9X 4TPRL 3ZDYB 3KXFD 3ZO0A 4D94A 3FAXA 4JQVC 2VITA 3I3BA 3EJYD 3AREB 1HKFA 5D7IF 1CTMA 5CEXA 1XH1A 3G08A 4ORGB 1KMGA 4RESB 4R26H 3ARRA 4QD2E 1FGVL 4ZTOL 1JK9B 1OARH 1XGTB 2AZAA 3VO0A 2YXMA 3RVWD 1WEJL 4HA1A 4PJHF 2G4EA 3BP7A 2P47B 1CBVH 3SE8L 4HK3J 4P2AA 3VXSE 1NSNL 4UU9B 5GS2H 4KQ4H 1EJOL 5I73B 4ODVH 4LL9A 1ZE3C 2ZWKA 4HWNA 2J4WH 4Q9RH 4PHZA 1H6UA 3ZL4H 1AHWC 4TQ8A 2V9TA 5HYFA 4OLZH 1EO8H 1FVCB 4XPTH 1G4RA 1MH5A 3FCTB 3VACA 3VD9A 1BJMA 1CIUA 2CHDA 2ZQKA 2OLDA 5HHXL 2VXQL 5IUSA 5D7LE 4W4NA 3IMSA 4WWPA 3ZYJA 2VXUH 4ALAL 4QUOA 4X5LA 1ZANH 3F7YA 1BQUA 1SXSA 2BIIA 2I60H 3EDDA 3GSRB 4Q6YA 5E8NB 4KVCL 3PWPA 3IKCA 2FLBT 5DEJA 3ARDC 4BE5A 1OKEA 2PYED 1CC3A 3QRBA 5ADOL 4EPSA 1N59A 2E6PA 3V4LA 4JKNA 1JNNH 1WCBA 3ARFB 5GGRY 4ZTPH 3EGXB 2CBOA 3BO8B 4KXDA 1ROWA 2ADGB 2E7MA 3GS4A 1HCVA 2ZX6A 3VG9B 4Y8DC 3IJHB 2Q8AH 4NAMA 2QKSA 2PP8A 3RHWK 5EN2B 3WN5C 1JRHH 3EYQC 4JDZB 4F3FA 3QZLA 4BFGA 3MV8E 5HDRA 4HXAH 4UDTA 3CMOH 3LRKA 4XP4L 4FFYH 3V5HA 2E6QA 4UT9L 5L2KA 1PY9A 2IDFA 2NT1A 2Y22A 1UZ8A 5C0EB 4PJDB 3QDGE 1TVHB 4KOBA 4L9LC 4LSPH 1NCWH 3REWB 3X3GH 2Y7OA 1QSZA 3EFFA 4C56B 4DZ8B 3SE3A 4AGLA 4APQC 1XR9B 2GJRA 2YPLB 1CDHA 3GSWA 5D8JH 1TF4A 1XEUA 4G80B 3STLA 3A6BL 2P52A 2ZYHA 2FD6H 3CFEA 2C4XA 2WKGA 4NPYA 3X14A 1YQ2A 3DSFL 3EH2A 1B2WL 3C75A 2JCCB 3WFBH 4Z76B 4A37A 4OLWL 4KKQA 3QZOA 5DWUL 1I4FA 2J25A 4F33B 4UOW0 1HE8A 2DM2A 4PVNA 4RSVA 4Z0BL 2WUBH 2AEOA 4FFVC 3WNKA 2WGNB 1FYHB 1RMFH 4PI2A 5EPMB 4Z95H 4L29A 4LASH 1JVOA 5D1ZD 2WXJA 3SZ6A 5BQ7B 1AIFB 2VLKD 1E4XL 1ETZA 4FI8A 3WEXA 2EUXA 2XUWA 4YQXH 2HFGL 5HYQB 1JE6A 1CFNB 2FT8A 3JV5A 3HC4L 5H2BB 4G8IB 4MMZC 2D2OA 4O9HL 1M7UA 1U92A 2EDDA 3GJFA 3RILA 5KAQG 2CDFB 2C8NA 4KY2A 3X17A 3U79A 3EJPA 1QASA 3TPUB 5I1HL 2QVTA 4JRYE 3MRNA 5A16A 3S96B 1TO4A 2JIXB 2PKDA 2Z0UA 4F92B 4QTFA 3NK4A 1X5ZA 4MGXA 3D2TA 2VDPL 3AXLB 3FN3A 4B5EA 4AJWA 3OD3A 3S3JA 2XCMC 5TDNB 3RE0A 2QGBA 4R4BB 2F1BA 2RGSA 1NM4A 4M5YH 1OXYA 5FA3A 4XOBA 2JKRM 3FSOA 4JFOB 4G8GD 1FFOB 2CJUH 4PLJD 3PQYA 2FJSA 3LTVA 3VFPB 1ZK9A 3QNXA 4JL1A 5TDOA 1IFGA 4M3JA 4Y0GA 3AS0A 4MWFB 1VEPA 2BCKB 2BC4B 2BS9A 5IFHL 3ABLB 3J8F7 4AGPA 4OZ4B 3RGHA 4UTBH 1ZV9A 2EVJA 4GIOA 1OPOA 1TEGA 1SM3L 4X7EC 1JJUA 3GXMA 2OMUA 3CDFA 4WHCA 4L3EE 3O41A 4S1SH 4LCCC 4IHOA 3FT4B 5ANHA 1KPVB 1RURL 4GEIA 4WU7B 4U7SA 5CHNA 3QQ3B 1JCVA 2V9RA 5IF0A 3UROR 4L3CA 4PVMA 4WI0A 1KBGH 3WXWH 1IGFL 4PV8B 3ZE0E 1HILB 4KTYA 3MBWB 1T66C 1FYTB 4GSDL 3FRUA 1WA1X 4R4NC 3K6FA 1XB3A 3E38A 4Y2LA 4XZ4A 2IDQA 3B9AA 4AYDC 5CBAB 4N2NA 4JO2L 2VABB 4F8PA 3DTXA 1BYOA 1JZJA 2NY2C 4H1LH 2W81C 1ZMYA 2X4NA 2CWRA 1E9OB 4N6RB 2NY5H 4Z7IA 4MJJA 4N2EA 3ZDWA 3LN4B 1OIOA 2YEZA 4PRBB 3GEFA 4MJ6A 3MNVB 5G4NA 5HHMD 5LHDA 2NY4C 4MA8L 1DO5A 1CQKA 2BOCA 4HK3N 3DHPA 4QXUH 2IIJA 5F6HJ 4JFYA 3ETSA 5A2LH 1PZ3A 1ZT1B 2C5DC 3TP4A 1YN6B 4N85A 5DJ8B 5J1AB 5AOLA 4Q97A 4NN7C 5F1SA 5B1AB 3H9SD 5ICXA 3QJVB 3U7YH 3AGVA 4JNXA 3AWEA 2G9HB 3CDGB 1UM4H 4HUVB 2ZXCA 5E4OA 3LQAH 1EVTC 3C60D 4RQQB 1CN4A 4JE4B 2H0EA 1KBWA 4QT5B 4B3VA 3QIWC 4ZFFA 1K4CA 1ICTA 2Z35B 4KU1A 1TJIH 2QLVB 3NJLA 4OUUB 5KVGL 3G6AA 3GKWL 2X5PA 2FX8H 4Z7WE 3OPZL 1B6UA 1GYUA 1WYJA 1GGCL 3LRHA 4MS6A 2ARJB 4JPWH 4K3JL 1YEJL 4IDJH 4ELKB 2MQ3A 5AW1B 3DVNA 2GIXA 3UBXG 2HG5A 4ZW3A 5KAQF 2Y9RT 4XC1L 2OMZB 2LLGA 1YYML 3X1GA 5ISZB 1MWAB 3WAJA 1RK0A 5AW4B 3ALWA 3QEQB 5T3XD 3QYNA 5DMIH 4FLHA 3T8VA 2EDOA 2SEBA 5L4IA 3QR0A 4M7KH 5KS9A 3BAJA 4OJYA 1BFVL 3U2IA 1KCRL 1PGRB 5AB2A 2PTTB 1KCUL 2DTML 4NO2A 5IOPA 5J13C 1RUPH 2DWYA 2W80C 3DDGA 5JUEH 1U30A 3CFKA 4N2IA 4GKOA 3T0WA 4JHWH 4RIRA 3VFUB 1KBBA 2WBJA 3H42H 2YGNA 4XMPH 4HX1B 2P49B 3MYJB 2P48B 4BA0A 3CV5A 3KHQA 1JPSH 4KROB 5CJXA 1B4TA 1NBCA 2NY5C 4X80L 1KYUA 1UADC 5IB2B 1QMUA 2D73A 4KXCA 1T4KB 4UMGA 1GH7A 3F00A 5K9QG 1J12A 1DQIA 1K3IA 5ITFB 2Z93B 2ERJC 2OQJB 3JTBA 3U6RB 2UXGA 1O6TA 2OYPA 5LXGL 3IRPX 5BS0D 4FFTA 1BYNA 3B2VL 4F2MA 4YHNA 1UM5L 4HBQA 1UYWL 3A6CH 2J2ZB 4MHHG 3ORJA 4J28A 5E4AA 4WFED 5GS1C 5KS9F 4ZUVA 5EU7C 1FZKA 2ETWA 4N0RA 2PPAA 4GI8A 5HDBE 5MI0B 4LDOB 5IR1A 2X4QA 4X5XB 3LQAC 1IBZA 3K2KA 5DGQA 1MVYA 2UZXA 1FGVH 4ZTOH 2P28B 2DQFA 5I16A 4LKXA 1H6EA 1T1WB 3L8QA 3CPLA 4XAKD 5ES4B 5FO8A 2BSTA 1WEJH 4I18B 5DO2C 4BH8B 1R75A 2RJMA 1HQRB 4LIQE 4XCEB 2BHZA 4YSRA 3SE8H 5BOJA 4NIYE 2V9UA 4IQHA 4Y2OB 4KDVA 1NSNH 4Z3IA 3OKEA 1EJOH 1OGAA 1ZHKA 2ARJQ 4DT2A 2APTA 3B6SA 4S1DC 1MJJA 1NM9A 3UBXA 4ABVA 4HBCH 1VACA 3PU7A 3SJVB 2V2TA 2ESVA 5DWPA 1IKNC 2YFNA 2FT7A 1XCQA 4PJ5B 4N5EC 2ITDB 1O9VA 3V95A 3S4SG 5HHXH 2B2XH 3CZKA 3ECBB 1FNGA 2VXQH 1JV2B 4FQ2L 3VXQA 4TF4A 3VM5A 3BQUD 5FM8A 4TVSa 4ALAH 4M93B 1UD3A 2D03H 2IO5A 5EA0L 3IGAB 1YEHL 1T4WA 3SBPA 3DX7A 4UAOB 4HF5H 1ZLSL 1BDYA 1UH3A 3P0GB 4Y4KB 2R0WL 1U8KB 3DUHA 4HV8A 5CLZA 1DJZA 2O6CA 5AD0B 3NA4A 3QWQB 4UQ9A 2NXYD 1HL4A 4Z7QF 3BVWA 5J7CC 5JHLA 3QK0A 3NDYE 3BUQA 3T2QA 1AQKL 4Y4FB 3EJZC 3SKJL 3ARED 1UQSB 2LR4A 4CMHB 1NANI 4DGWC 1AR1B 2ED6A 5AEAA 3UO8B 3WS6C 3VFVA 4Q4EA 2G2NA 1KF9B 4NN6B 1HJBC 1BIIB 2DQHL 4N2OA 3V6FB 1P5VA 5ACLA 3QISA 2DWEB 5IWLA 2O61B 2BIOA 1TJXA 3C6EA 3IF1A 4LLQA 1FQ9C 4EUPH 4UT9H 1T04B 4NKMB 4PWFA 5M94B 2OX5A 1E4KA 2QVIA 5I2IB 1H8NA 4HLEA 4HIJB 5FK9B 4AV5A 2A9DA 4ADGA 5ICYB 5DQ9B 4LEEA 3ARWA 2QTEA 4UAHA 1XIWB 2A74A 3JVGA 3QVAA 1XGPA 3GHBL 3U0WL 3DSFH 1B2WH 3RWDA 4J3XA 3OSKA 4KDTC 2M1KA 4OLWH 3H2QA 5DWUH 3C09B 4CGTA 2MCMA 2ZX9A 2WQAA 5BRZE 1CGUA 4FNPA 5KBMA 1JHTB 4YR6B 1A4KA 2Y7QA 3HW7A 4Z0BH 43C9A 5B1JC 3MTRA 1CL7H 3LHPL 2CU9A 1UATA 2H6PB 1UUNA 2YD3A 3VQ2C 4Y89A 4Y2DA 1OB1A 4U1JA 2AABL 2YRBA 3IAQA 1E4XH 3ARFD 1A9VA 3S4SA 3GM8A 4OGZA 4MDRA 4ALAC 4CA4A 3C5JA 3N1FC 1HEZA 2HFGH 2V2WA 3P40A 2J43A 4P9HC 2WN3A 4M48L 4XNUL 2EABA 3FU8A 3HC4H 1OGTA 4ETYA 5C0NC 1NEZG 1YEIL 2LU4A 2VZSA 3S48A 1G43A 2J7LA 1YCSA 1ZLVH 5I1HH 1T80A 3NFPA 2Q9OA 4LGPB 4IBWA 4PJAA 2Q7YA 3S3PA 3GMNA 4Z3HA 1MFEL 4FADA 4QWWD 4X0KA 2JI2A 1WFOA 1RULL 2VLJA 3NCMA 4C56D 2YPLD 3WDJA 1NUFA 2B3IA 2O6PA 4FEIA 1HXKA 2WW8A 2AAAA 4YBHA 5SWSB 4M56A 1BQSA 4XN4A 2OZ4L 5KSBA 4MB5A 2IXQA 1CXKA 1KYFA 4D3CL 5LGJB 1QP1A 1F11B 2W59A 1X5YA 4HUUB 1G1KA 1K2DA 1TOXA 2CDGB 4KI5D 4TQHA 5IFHH 1UXSA 5C0GB 4PW4A 1D2PA 4ANKA 1X5FA 1TR7A 2BSDA 1SM3H 1IAKB 3LS5L 4A39A 4AI7A 4DQAA 4MX7B 2WZ6A 3GLAA 3MKKA 4G9DA 4PJAF 3BISA 3KXFE 3FCUB 1RURH 3GDBA 3HUJB 1XVSA 2HYMA 4ODWA 4ZK8A 1XF4A 4WI7A 1HKLL 3EW3B 5CEYB 2XN9B 1ZEAH 2M26A 3CZGA 4ONHB 2ZCKH 3ARXA 5K9QI 2ZJSL 3OMIB 5EOTA 3GD1C 3IJEB 1IGFH 3DRQB 3BPLB 3K71B 2XTSA 1HXYA 3WAKA 1QNIA 1TQCB 3U1PA 4JFDA 1O5PA 1S7SB 4GW4A 4MHHI 2IWFA 3K1KC 2OM5A 4JO2H 4LVOC 4HWBL 5KSBF 2JIXD 3NSFA 5ECGA 3T0BA 4AYBA 2OJEA 3QZPA 1CBJA 4ODUB 2ROXA 2BLFA 2BWDA 4U6XA 4FXKC 2FQFA 3O3UN 4KH9A 5KUKA 2ZWNA 4AW4A 4MA8H 4MNQA 1A65A 1TU2A 1VCAA 5GGRA 1RAMA 3U9UB 1NEZA 1E9PB 2WP3T 1OP5H 4TTDC 1CICA 3DX6A 5INDB 4JFQB 2FTAA 4TULL 3VXNB 2WLHA 1LWHA 1JNLL 1F3RB 5E1GA 1UB6B 4R5TA 3TVMB 3WNJA 2DIAA 3VFRA 4X9FA 4PRIB 3E8UL 4Z5RB 3WIHH 2R51A 3GLZA 1SOKA 3FT2A 5EIVA 4V33A 5AUMB 1FO0A 4P23A 2F61A 4CJ0A 3POCA 1PQZA 1S7WA 2WXFA 5C97A 4L0ZA 3Q6GH 3EJSA 4KUZL 4H88L 3O2DA 5KVGH 4NQXA 1HC1A 5LG1A 5DURB 5AYTA 2Z65C 1HFUA 3EO0A 3MMEB 1GGCH 2A2QT 1IGIL 2JJSC 2OXHA 5GHWH 3WY3A 4E0RB 1I82A 3P3TA 2GC7C 4DEPC 4XC1H 4QRPB 1JZ4A 1YYMH 2XWTA 2UZPA 4HOZA 4MXQC 3BW9A 4HCRL 5FCUL 3WLWC 2NUPA 4CKQA 4M61A 1U21A 3T65B 4LF3A 4N0UA 4C83A 1CLVA 1S78C 2F7IA 3ZL2A 1ZV2A 3BYTA 3Q43A 5CMAA 3W39B 4JVPA 2A9NH 2YSTA 1HWHB 3WJMA 1BFVH 4UIKL 1KCUH 2DTMH 4HEME 2ZXAA 1J1PL 4ZS6D 4L4JA 1CS6A 5DDHA 3FZUC 1CVSC 2P24B 4FJZA 4HLJA 4HPOL 5IGXH 4M1CD 1T20B 5FO7A 2ZUVA 3BGFC 3W57A 3GSNL 2P5EB 4X5QA 3IM1A 3WU1A 2OMWB 1RHHB 3AAZA 3OXRB 4PMFA 4X80H 1ZJAA 4UQEA 3UJIH 3VAEA 1S7QB 1B0WA 3WHE0 3KJ6L 1J9SA 1ERNA 2ALAA 3QFJB 4P5MB 1CO1A 4QTHB 2V5YA 4IEFB 1COBA 1KXHA 5LXGH 4JANA 4NM8H 3B2VH 1EXGA 4H2AA 3O6KH 1B4RA 1YY9C 3FB8B 4NKIL 4K4KA 4MMYB 1MFMA 5LBSL 5JDSA 4G70B 1QSFE 2E7LC 4X4XA 4E68A 5JIHA 3S5YA 4MJIA 5D6CA 3E0GA 2Y06H 1G7HA 1PFOA 3MLUL 4BGLA 1TPXC 1FV1B 2B9BA 1EGJL 2HVBA 3VXRB 3VTTA 2Y5EA 3ULUF 2VNCA 5DJDB 3QEQD 4J8QA 5F3BB 5F6IC 1HU8A 4YBLB 3T0EC 5IM7A 2YAOA 1LP9E 4ZZFA 5LGYA 2EP6A 4LLMA 4RMRA 4B9YA 2DAVA 2WVSA 1T3FA 1YRKA 4FEMA 1FF5A 4GEJA 4LSSL 5HPMB 2FO1A 3SGJA 4JFHE 3W2DL 3GKZA 4Z7UA 2HUEA 4GG8B 3CXFA 2Z4QB 3QFDB 4KTEH 3UPRA 4BCYA 5H8DA 3EUUA 4RNRB 4EI6B 4G83A 5AG9A 1FHNA 4ZZKA 2I07A 4G8GE 2IAMA 4PPTA 3OMZA 1FAIL 4GAAA 1ES0B 3WIFB 3GMRB 3VFWA 4BE6A 2BVEA 3I6SA 4KROD 5E5LA 4ELDA 4XH2B 3H9HA 1A5FL 5HXMA 3MRGB 2K9FB 4DOHB 5KBLA 1C08A 1QLEL 2ATKB 2PWGA 2TSBA 5D7KD 1CR9L 3BXNA 4Z0XB 1YLBB 3L81A 5JZ7C 4I5BB 4YHOL 5EA0H 1YEHH 3VNYA 3HA0A 1SDDB 3OKOB 3IJYA 1W8OA 3FOLA 1ZLSH 4JPSA 3FQ2A 4U1NB 2R0WH 1U8MA 3LDBC 4E9RA 2HT3C 4YDMA 1CZ8H 5DJ6A 5EU3A 3R18A 5J57B 3VH8B 3CVHB 4Z7UF 3QUKA 3TEZA 4OF6A 1FLRL 2GBAA 5EBMB 3ZE2F 1AACA 2WIMA 3RIAK 3TZVB 1E43A 4QKXB 3KPRB 3M7OA 1N5AB 1AQKH 1UJ3A 3SKJH 1L4IA 1MG3C 3FFDA 5DJXA 4AXWB 1QUPA 2HX8A 1RZGA 2QDWA 2BFVL 4LPUA 1RLWA 3HRPA 4HIXL 4ZSOB 3EH1A 1NFIB 4HWZB 3RNQB 5IVNA 4J3WA 5EO1A 2EDXA 5C0JB 1BZ9A 3OKDA 4PJEA 1WG3A 4M8QA 4YMPA 2A4EA 4FTDA 1SZNA 2P8PB 2IOIA 1FBIL 5KVEE 4AV0A 1JUFB 2ZYRA 4LLDB 1PZ5A 1YN7B 3QORB 4LPCA 3SJVD 2P26A 1C12A 4WI5A 1JV5A 2Z91A 5BZWA 4IU2A 2EDKA 2ENYA 2EIZB 1SQ2N 1ZS8B 2GTZA 3MOAL 3N9GL 4FLSA 4PJ5D 3TIDB 2PCFB 1EV2E 2XWBB 2HH0L 3V0AC 4FI7A 1WZ1L 3KLHD 1JYXA 2GT9A 5KSUB 3GHBH 4AQZA 3ALPA 4F7TB 3U0WH 4WW2A 1F86A 3LY6A 1CFQB 3UMTA 1OAUH 1BMWA 5DJCB 4RZCA 4Q58C 5ESVB 1A1NB 4HGWA 3QPXL 4X4KA 3HS8A 4WFFE 4Y4KD 4S2SB 1R33A 4PTUA 2ADFL 3PABA 4L1LA 3C6LB 4XCNB 1QTYT 2AVFA 3LHPH 3C12A 1P1ZB 1S7VA 2HVKA 5HHPB 4FERA 4PJEF 1FVEB 2AABH 1R9FA 2VRAA 4Y4FD 2ENQA 4QHMB 3K2IA 4R90L 4X8CA 4HYTB 4LMQE 1AR1D 32C2B 2ITCA 2ADJA 3RDTB 3W5MA 1SJXA 2VAAA 4M48H 2VKXA 3KYOB 1YEIH 1I1AC 2OMYB 3MVSA 1E3XA 3RZCA 3DC0A 3GRWL 4HP5A 1INDL 1AGEA 1U8NA 4X6CB 2ZUQC 4WW2F 2UX7A 1D5ZA 1DJHA 1MFEH 3VD5A 3MO1B 5PCYA 2H26A 3RGVC 3AQDA 1DTUA 3ARUA 5D7LA 3KVDD 1BZOA 5E5MB 3FO0H 5KYYA 5I1KL 4PB9L 2L7JA 2X6BA 4QDGA 2GJZA 1LMKA 1XIWD 1FAKT 4OJDH 4HFWB 1PU0A 4JM0A 2NX5B 4XMWA 5DT1L 4C54A 4XXDB 2OZ4H 3FU5A 4XXCA 3ZDXE 1ZTXL 1WFTA 4R2GB 1PAZA 1GGIL 5T3ZL 4RGNE 3TURA 4D3CH 1WCQA 1HYSC 1GZPB 4GUOA 1SVZA 1T6WA 4UQDA 2CBPA 4ZFOL 1QNZH 2HJKA 5I6NA 3LS5H 3OR7B 3T8XA 2NUTB 5HGBA 1OAJA 2G60L 3KE0A 5BOZG 3WIAA 3QDAA 4MBOA 5E6YA 1HKLH 3GUFA 4ENEC 4LLVA 5EZIL 5EH1A 4Q4IA 4OQTA 1XGQA 3G5VB 2ZJSH 3WFHA 2LU5A 2Q2LA 5HD8C 2X2HA 4XAKE 5D4HA 3HPLB 4N0YL 5C6PB 1L0YA 2HVJB 1E2WA 3PWJB 1HHHB 3U83A 3KPQB 4E41E 2DW5A 3RUGB 3G04B 5JHDB 2WKLA 5E08L 2WANA 3O0LA 3OB8A 4WV1A 1YQVL 1LO5A 1BMGA 5HYSG 4HKZA 4Q89A 4FP8L 4R0LC 3LN5B 3IU3A 2JJUA 5E24E 2QTVA 3NCJL 5J3HD 1IGYB 1OAKL 5SWSD 4NKDB 5CEZD 4P5TC 2WMPB 2YO3A 3MI6A 4TULH 1EAPB 2E27L 1JNLH 2P5WB 2DM7A 2VXTL 4KRPC 4Y5VA 3VXOB 3PCYA 1TENA 1UC6A 1PNDA 3DIFA 3WKPA 1F4WL 4LL4A 4YN3A 3E8UH 4NRYB 3KYKH 4HMEA 1AXSB 3VWKD 5HJ3A 4XBEH 3ZPDA 3BDYL 1G7JB 3CZNA 4X98B 3LJ3A 3QDMB 4M8RA 2Y69B 3CZJA 3MXVH 3UMNA 3V2AR 4OZHA 5I5IA 1F3JA 4Z18A 1IBFA 4H88H 4PS8A 5JYLA 2XN9D 4XCYB 4PJIB 3VE0A 1HH6B 3CIAA 1KTDA 1IM9A 1IGIH 3SOTA 4JRYA 3FKUS 4K7FA 4U1HA 3IGLA 4OZGB 2JQMA 4QI3A 1E65A 1SN5A 1K5NA 4H44C 3ARBA 3FB5B 4HKBA 2QR0B 4H5SB 4HCRH 3FO9B 4NQDE 1AH1A 2YBRA 1J5DA 4OJEH 1T0MA 4HJ1A 1DVFD 4LOVA 2J73A 4MZ3A 5F89B 1AHKA 1JXKA 4OI8A 4UIKH 3C08L 4LAQL 2XIDA 1J1PH 4LLUB 4Z7VE 5I15H 2CR0A 5F0MB 5JPNA 2EKJA 4OZHF 4N0FB 1WAEA 2QQQA 4HIIB 1OOAA 1KYOJ 2CLZB 4XMUA 3TVMD 2FR4B 3GSNH 3BWAB 1J8HA 1FL3B 1IB5A 1MVFA 4PRID 1MI5B 3GJEA 4L3EA 4EZKA 1NJ9A 3D33A 4PYGA 4OLEA 1M7IA 4FKKA 5CZVL 3BLKA 4ZAKC 5HYSA 2NT0A 3KJ6H 1IC7L 3QUHA 1CXIA 3BUYA 4NC1C 1UB5B 2FGWL 2Y4SA 3F6LA 4NZDA 3V8CA 5GRWA 3WTSA 5DURD 1A21A 3O6FA 3FQYA 4RX4D 4DPRA 2DLGA 2VR4A 4PGDB 3MN8A 1VFBB 4W9IC 1VKXB 2R7EA 3KBHE 7FABL 4KJWC 3MLUH 5EOQL 3HLKA 1ED3B 2BY3A 4YGVB 1EGJH 3NCCB 3PWNA 3QH3A 4QRPD 3VD1A 2XA8L 1U8LB 1Q4NX 1S4IA 2KS0A 5I1EL 2C3VA 3V4UH 4B6ZA 2AJ3A 2HJLA 3C9NB 1XF3A 3O2WL 2VDLB 3NPZB 1OCRB 4LSSH 4D9LL 4X5RA 2TRHA 2ZP8A 2EIEA 5IVZB 1NC2A 3DECA 3JT0A 2F7RA 1EO7A 2VB5A 4L4TA 3TPKA 5DHVH 4XNZC 2K8QA 5JW4Q 1PIFA 2WTRA 1CXEA 4PM1A 3WE6B 1IEAA 1S7RA 1G7LA 1KTLA 2ZKHL 1FAIH 4PJ8B 2P5ED 2NW2B 2HRLA 4U3SA 1JGDA 1A5FH 1VSCA 2VLLA 3FSVA 3TEYA 4LNRB 4HOMA 1CFSA 1IEBB 5DGRA 1QLEH 4WWKB 1CR9H 4AKOA 2H6UA 1DQQA 3BUIA 3IN0A 3QFJD 4M43L 4YHOH 3RTQB 1P7QB 3I6GA 3T3MB 3ZUCA 4Z7WA 1OPGH 5FX3A 3AG1B 4ABUA 3A47A 1ZGLM 5ILTL 4FHBD 5H35B 4GO8A 4AUJA 3SQBB 4POZC 4HJJL 2HFFA 3L3HB 2R4RL 4BWUA 2RALA 5DYOB 2F53E 4H26B 2A4ZA 5T1DL 1HESA 1AXIB 2APSA 3HB3D 2EDBA 4DKEL 2Q86B 2BFVH 1HN1A 5CJOL 2HB0A 2I5YH 4HIXH 5C0AE 3EYUL 1EXUA 3MPCA 2ZP9A 3G6JE 5JPMB 3NSDA 1LJMA 1JK8B 4JFPB 4GUPA 5DMGC 1UT9A 3CZLA 4J8RA 1U4FA 2X3CA 4HHAB 3JT2A 5JIPA 4RMBA 1KNOB 4Z7WF 4IKLA 2NTFA 2UY6B 1FNFA 1OF2A 4GW5B 2ADIB 1UCBL 3F7VB 1L9MA 4RWYL 2VDRL 2XVLA 4ZMPA 5LGKA 1G9EA 3MOAH 3N9GH 2V5RA 2EDEA 4ZXBC 2HH0H 2YRZA 3A4AA 3OGCA 4K5OA 5DZJA 1WZ1H 1PYWA 3CXDL 1Z2KA 3HNTL 4F7PA 4UANA 3WJJC 7PCYA 1P2CB 5FUZL 3MX0A 2DTSA 1T1XA 4WSKA 3QZMA 3PJSB 3QPXH 5D2LE 1GHFL 1MAJA 2H1LM 1ETA1 2ADFH 2CHZA 4E9TA 5FXCH 2A73B 1KPRB 3NJFA 1W15A 5KSVB 1TKWA 7PAZA 3MA7A 1MWOA 2WZPA 1L0QA 1OSZA 4DKAA 2JB6B 3TZVD 4KK6C 3KPRD 3L3KA 3L4ZA 3TO2A 1FYTE 3V4VL 1CF1A 4R90H 1MCHA 3OAWA 2KC0A 3BJ91 3AQXA 4ZI8A 3DPBB 3O6ML 2QQLL 3K80A 3N1PC 1NGWA 3NJGA 3EO1A 3QCVL 4HXBL 2GITB 3NSCA 4FQXA 4DP4X 1X5AA 2EXYD 4NNYA 3HZKB 4ZMWA 1DN2A 3UCRA 3IETA 2AAVA 1Q9KB 1INDH 1Q8MA 4K0OA 3ASOB 3MGOA 4DGYH 1W0WB 3Q13A 1VFAA 1VLXA 3GSUA 1HX0A 1NOFA 2WYZA 3OR6A 3PE9A 3QORD 4L8DA 1JNHA 4XP1L 2MFNA 4A2DA 4XPAH 4YZFF 2G3XA 4UIMA 2GW5A 4I8DA 5HDBF 5IMOA 5I1KH 4PB9H 1GAFH 1MZZA 1PKQE 2XZZA 3IT8D 3PWVB 1OAZL 3DOIA 5DT1H 3EYOA 3OKNB 1UT1A 3VSQA 5IROD 1R3HA 5HGAA 5DA0B 3TESA 1BQLL 1S8DA 1ZTXH 2FWSA 3BEVB 4KJPD 4WFGD 5CINL 1GGIH 5T3ZH 5E9AA 4FJYA 3CH8A 3NN8A 4PLKD 4LPVA 3C6LD 4R96A 2X42A 3SCMB 5ICZB 1E5CA 1BJ1J 1M9SA 1SMAA 1WAAA 4PD4J 3ILPB 2V8LA 1QO3B 1BZ7A 3EOAA 5CCGE 1U8CA 2G60H 1QABA 3L2NA 3P9LB 1S3RA 2XWDA 2WNKA 4OT1L 2OK0L 2VDNB 3ESUF 5ISZE 4YEEA 3RDTD 2X41A 3PFQA 5D4JA 5DK2B 4A6YL 3BFWA 1P69B 4KKRA 3U46A 1JD7A 4QHPA 3RFRA 2H0PA 4H8QA 4N0YH 2ZOUA 4NC2B 2G5BB 2YWZA 4PS4H 1ZLUK 3TBBA 1SF5A 4PEEA 3RIFF 3DRTB 3NRFA 3WLBA 4F15C 4NQQA 4N22A 2B1AL 5E08H 2XFXB 2AQ1A 3E9UA 1EHXA 3UO1L 2FLRT 1YQVH 5FKAA 1LK3L 5AL8A 3RVWC 1KCVL 3S3DB 4FP8H 4JFXA 1AC6A 1WAAF 3QXAB 3NCJH 4KNUA 5E4EB 2EVGA 4O2CB 1GSMA 5AOIA 1OAKH 4L8CB 2NX5D 2CKNA 1R3KB 1S7TB 4GKLA 3EJTA 2E27H 4OD2A 4ELME 2VXTH 2WOYA 4ODSL 2WIIA 4R2GD 1IO4C 3B7RL 4RFOH 1F4WH 2D7OA 3CH1B 3ZJAA 3LZOA 1RUAL 1Q38A 5F93C 1KIQB 1E42A 2N01B 4QJ4B 3E1ZA 2XQYG 2ZKXA 3BDYH 3GB7A 4KO7A 4Y9CA 3QQDB 4JDVA 3SBRA 2CK2A 2O1AA 2BNUA 1UD8A 1B4JH 4MAYB 3ZHLA 1BXXA 5CD5D 2Y2YA 1TQBC 5F7EL 3B34A 5EU4B 4L2LA 4LVNB 2W07A 5HVFB 2EDNA 1OAXL 2D9CA 3ES6A 1TJHL 3E6HA 3OHXB 1QG3A 1YAZA 1Q72H 4WHTB 4X5WA 4PREA 4X9IA 1IV8A 4AYMC 2J5LC 3FQUB 3HC2A 5D2NB 5JHDD 2H1XA 1SVBA 4BK8A 4QNPE 5KG9A 4NO0B 1T1ZB 4IRSB 1MHHA 5D96C 3DTDA 1NPUA 5GJSL 4BD4A 3KL5A 4LAQH 3TIEA 1P7HL 4D8PB 1A7OL 1N8OE 3QJZA 4OFDA 4X7TA 4W9CC 1OP3H 4DP7X 3WO4C 2GHWB 2WINA 3FU7A 2FQEA 1TSHA 2O5ZL 2AXGA 5DTFB 3DMMB 2F5AL 4MA1B 1A6TB 5C07B 1HHGB 4AYFB 2P9RA 3AACA 2H32B 5TPWL 1ONQA 5A3ID 3CN4A 4B9ZA 2YRPA 4XP5L 3GI8H 4UILL 3KXFA 1ADWA 1T89C 3BH8A 4UUJB 4F80A 5CZVH 1QWHA 2BVOA 5J56B 1IC7H 5TD4A 3TYGL 3QDMD 4HG4J 3M45A 2FGWH 5IHZA 1IE5A 2C3WA 1FLTX 2ZOLA 2CO6B 1AZRA 1WZMA 4P4KA 2BNRB 2YZ1A 4MXVF 4QRRB 3SPIA 4LQFL 1QHPA 1X7QB 3FO1A 4HJGB 2XKUA 4DP5X 1A3LL 2AXWA 2NSXA 5IJVB 1WT5A 5F3FA 1BSIA 2O30A 3FH5A 3ILQD 2JKNA 5E6IB 3UTQA 3WFCH 7FABH 1ZDQA 4PQXA 3GMQA 4S0TD 5EOQH 2DYRB 3MJ7A 1K6QL 3F5WB 3KEHA 4GIPD 5E5RB 2ZOKB 3T4YA 2Y5TB 2XA8H 1ITBB 1QVOA 3PP3K 5B3JE 4NFBA 2XQYA 4XXWA 3TA3A 5IMKB 3OL2A 2WXPA 2V7NA 4D9LH 2AXFA 3O2WH 2M83A 4M03A 3MLXL 2RR3A 4FMFA 1A6AB 1UOKA 2AF2A 4M7LT 1XZ0B 3FRPG 4J3SA 3VD7A 4FQ1L 5LBGA 5I28A 3TBYA 1YA5A 3WGUB 4XO8A 2ZKHH 4YE0A 3T2NL 5A7BA 1ML0A 1EO5A 3NIGB 1HHKA 1MI5D 1UOVA 1SYVA 5GSRA 5LWYL 1AS7A 3DETD 3HI1B 1U2YA 4YDVB 4AMWA 2J5WA 2B1HL 4PLJC 4GQ9H 2KI6A 4M43H 2DQJL 3L3OB 3TBWB 5C6WH 5CIPA 4HS8L 4NBYB 4WENB 3MFFA 1Z3RA 1QSEB 2D31B 1KJMA 5ILTH 3OKMA 1EAQA 2G2RB 4JRXE 1KB3A 2XG5B 5DSCB 4HJJH 5I75C 4YUEL 2R4RH 2CKBA 3BH4A 3F7QA 3EH5B 1RUML 4Q0XL 4Q6IA 5T1DH 3X3FL 1DLFH 3TYFA 4AYID 2JKWA 1OD9A 3ZSTA 4FA8A 4DKEH 2CG9X 3BZ4B 4PJBE 4PV9A 2H3XC 5CJOH 3CHOA 2TRYA 4DETA 4WEBL 3CVIL 3EYUH 4D0CB 1IM3B 2FDBP 3EBHA 4HEMA 1DDHA 3RJDA 3VFTB 4G42A 5IQOA 3MRJB 3BZEB 3QUYA 5L6YL 2CJTA 3KL0A 3NQKA 4XOAA 3NYKA 4GAFB 3B56A 3LVEA 4U49A 4ZPTA 4ZFGL 3KMDA 4LHUD 1PZUB 5IQNA 2VLMD 2X70A 4B9PA 3RWHA 4F27A 1KXTB 4MVBC 1JGVL 1L9SA 4PJ8D 5CILL 1UCBH 1KB5B 1H3VA 4RWYH 1Z7JA 2VDRH 1XTLA 4U1LB 4OGXL 1HIML 4YWGL 2Z6FA 4QHUB 3N6YA 3CXDH 1RD6A 1F8TL 3HNTH 3K81A 4WWKD 4DVRL 4M5ZL 5AW2B 1DJIA 2DM4A 1ADQA 4DIXA 3RTQD 3S37L 3PUCA 1R0AH 1P7QD 1T7ZA 2GABA 5FUZH 3MRLA 3ZKXB 3IVKA 2O5NA 2O4EA 3FW6A 4NQVB 2NZIA 3FRPA 4TNWF 4XOCA 1NAML 1G7QA 5H4YA 1ZA3A 4BFFA 1QFUH 3MGTB 3DVFA 3V6OC 2Z92A 4FQLH 2CMRH 4J3OD 2PW2B 4XVUD 1THAA 1F3DJ 1MWAL 3C60C 1LP9A 4JZOA 3FYIB 4UNIA 3OJDB 3V4VH 2HUHA 2EIMB 2DF3A 1JFQL 1MCIA 3KYNB 3OSVA 3O6MH 2QQLH 3UEQA 5B8CC 3ZDZB 5ESAB 3QCVH 4HXBH 3CGTA 1XL6A 2KDGA 1QRKA 4GXVL 5E8OB 4B60A 4G8GA 3ALXA 1Q9LA 4Y5XB 2PWFA 4X42A 1WBZA 1U8IB 4X9GA 5KVFL 3GM0A 4ZYKB 1F41A 4N86A 1I7UB 5GRVK 1KYDA 4OF0A 4EI5B 4J1UB 1TQTA 4FS0A 1TCRB 4XP1H 2LT9A 3S5ZA 4TVUA 3ROOB 5EC1A 1AD9B 3ATFA 5AFAA 1SFHA 8CGTA 1GXEA 1W72A 2ITFA 5E70A 1OAZH 5ABZA 1S9VB 4APXA 1P5UB 1CD0A 1LP9F 4X4YA 2B7DT 5E94B 1NPNA 1U2HA 1IVLA 2R1XB 3ZZLA 4UQIM 1BQLH 1GZQA 2YK1L 3C5XA 4H13C 4FTVE 1C7SA 4RAVB 2NQDA 3DK0A 4JKLA 5C70A 1A3QA 1D5XA 1KY7A 2AMUA 1MCOL 2YPKB 2WO4A 5D6DC 2A9MH 4FRWA 2DLEA 4KKAC 2Q7AA 2K78A 1SQMA 1XFPA 2MIZA 3NFNB 4AT6B 2YUXA 5IG7B 5A2IH 3Q06A 3APFA 2QBWA 3VI3B 3GXNA 5DK0A 4KHTL 4HOWA 4A6YH 4RBPK 2VDKB 1OANA 3I84A 3ABGA 1PSKL 2F9BT 2UWEE 3V9EA 2CUAA 4H0GA 2ICWA 3RG1C 3AB0B 2X6MA 4C55A 3C5ZA 5I1LB 4ZMAT 4Y9EA 3H9SA 2B1AH 3WO3B 5FV1L 1SJEB 3UX9B 3UO1H 1TXKA 5JTWA 4PAZA 1A4CA 2OMVA 5FFLA 1ZKAA 1NGZB 1KCVH 1BXUA 1JGEB 3EOTH 4UOJA 1EA9C 4HT1L 4LLYA 1JPGA 1T5XB 1U8OB 4M8UA 4NQEE 3GSXB 5D1ZI 3SBWA 3E2HC 3KPLA 2VQ1B 1UTDA 3QYCA 3ZZSA 2E9BA 3RZWA 1J5OL 2XTJE 1AFVL 2Z8RA 2Z7YA 4ODSH 4I48A 1QEWA 2QSVA 5I24A 5KYWA 1RUAH 4L05A 3OAYK 5E1HB 1BREA 2DZEA 3SCMD 3T71A 2J21A 4YSAA 1KT2A 4MD5B 2AQPA 5FM5O 4XMZA 2EO7A 4JX0A 3GUTA 3JV6B 2KH2B 2YARA 1WZAA 4IGBB 4TOYL 4JPQA 5GIRA 1R24A 1WA0X 3E6FB 5DJYB 3U7WL 1GS6X 3FQRA 3MJWA 3BRDA 5C0CB 1GS7A 5JLZA 2J1ZA 4UYQA 5F7EH 3VXRE 1QKZL 1Q94A 2JH2A 2J8HA 3GTTA 1OAXH 1YUHB 1MN4A 1TJHH 5C0IA 1DJXA 4BZ2L 1X5GA 3DWTA 4MMXC 2NXYC 4LRIC 4QY8B 3Q2WA 4XNYL 3R1GL 2EC9T 4BFIB 5EFIA 1MRDL 1QYGL 5BZDB 3HCVB 5DHEA 1GC1L 5CD3B 3QIUA 3FH8A 4EQ3A 5F1NB 1QFWM 4UF7C 1L0PA 4PRNB 3H9YA 5GJSH 2P7TB 2I32A 1A7OH 2FO4A 4N28A 1EBPA 4XHJC 4ZFZB 4WUUB 5JIKA 5BS0A 2O5ZH 1FZJA 4IMKC 5I0YA 1AHWB 3AC0A 5TPWH 2G0LA 5FEBA 3D51A 5FCSH 1KTBA 1KJ3L 3I75A 1KLFA 5ID1A 5BXFA 2WGXA 2G75A 4XNDA 1A1MB 4UILH 4F37K 2J12B 1NCCH 4LLAA 1IQDA 3HPJA 5JW5A 3FU0A 1HVXA 5ESQB 3TTSA 4DWHA 4R84A 1XSIA 1ZSDA 4J27A 4HD5A 4MAYD 5L2JA 5MERB 1G0XA 4MKTA 1FN4A 1ZD6A 1FO0H 2EXSA 3U4KA 1A3LH 4PJXB 3ARDB 2F18A 3TJPA 1MCRA 2Q20A 2YJLA 2PP7A 3ZDXF 2IFGA 4M6NL 1C16A 2IH3B 5D5MA 2PCPA 4J3TA 1K6QH 1JI2A 3TBSB 2BP8B 1X5KA 2ICWI 2XRAL 2CGRL 2RCSL 3LKPB 2ZCHL 4XBPA 5KVMC 1ZT4A 3DKHA 2IBGA 5DRNA 4NO0D 2X4PA 4Y5YC 5CEZL 1ZCRA 3MLXH 3WN5B 3BQUA 3OWRA 4B53A 4X7DC 2ZX7A 3UH8A 1NFDA 1R5WB 4P2RE 1LO3L 1GTFA 4LPYA 5E8DL 2YPVA 4FQ1H 1OM9A 4I3GA 1UWEL 1MJUL 4FXGC 1FDLL 3DMMD 1JZ7A 4X7CC 1A7PL 5C07D 5LNDA 1TLKA 4IRZA 3T2NH 2NNXA 1X7SA 3FSAA 4XBGB 4L9LB 1BFTA 4YSEA 4WJKB 4PUBL 3LIZL 4BFRA 1RP9A 5INCB 1MHEB 2VDQL 3NCBB 5LWYH 1XXFC 2VN3A 3EHBC 5D5MF 3AREA 3T4AA 1QW8A 1BVOA 4LMQI 2DQJH 3QCTL 1A6PA 1O5DT 1TNMA 4HS8H 3UL4A 4CVWA 1JK9A 2DEXX 1FZMB 4MB4A 3D85A 2BNRD 3FO2A 1ECYA 4QRRD 2C7FA 4XWGL 1PKOA 4XN9A 2C9QA 3D69B 2KDYA 3AT9A 3F12B 4KI5C 4YUEH 5DFVC 5IB5B 1U3HC 5E6ID 3GBLA 1E28B 5D7HA 1EAOA 5G5DB 4NQDA 2RB8A 3RX7A 2IQAB 4Q0XH 1NFDF 3DGDA 3GTVA 3UYPB 1KJ2L 1BFOB 3BI9X 3BMWA 4K5MA 5ABDE 1WE5A 3HI5H 3SIKA 2XZAL 3FCTA 4M6AA 2AJUL 2E7BA 4U6YB 3CVIH 4WEBH 4XMXA 2NMSA 2YUVA 2N1TE 1H5BC 4LBEB 4ZD3H 4MMZB 3T0DA 3ZDYF 5L6YH 2AV1B 4ZFGH 1HQ4B 2R1YA 1JZDC 1Y6KR 2CIKA 3FJTA 4OQ1A 3P2TA 3VD2A 2F68X 2W91A 4LFHD 1DVXA 3ZTDC 5IKCA 1SBSL 1QFOA 2DPKA 1WISA 2HLAB 2C1PB 2FIKA 1ZAGA 2XY2A 3DOSB 3E1F1 4GINA 5CILH 4OGXH 1HIMH 2CUHA 5C09D 3BT0A 5C08B 3QJXA 3FQTB 4F8NA 1BVKB 2Q7NA 3MRIB 3ARFA 3SYQA 4HGKC 3DX0A 3WOVA 4DVRH 2BS71 2VWEC 3DURB 1BG1A 4JQIA 2ADGA 3S37H 4FLQA 2D9QB 4W9LC 2W0FB 1QSED 2V3FA 3IJHA 4DKFL 3L3IB 3IFPA 4FXTA 5IBLC 4ZNCD 3CFBA 1NAMH 4FDWA 3S2AA 2FUQA 3FT0A 4FNUA 3TF7C 4AQOA 1CTOA 4MNGE 4JUSA 5E56A 3TA4D 1MHPL 2ALWA 1IJNA 4JDTL 3PWUB 3R4DA 3BHBA 2Q76A 4LCCB 1X9RA 1XGYL 3EJJX 1JFQH 4C56A 1S9YB 4G7YH 1RJLB 1IM3D 1G1YA 1OGSA 1UVQB 4GXVH 1JBJA 4ZO7A 1X5JA 3FUHA 4N20A 1UOLA 4A2EA 4P2QB 2MPVA 4QO1A 5KVFH 1ODUA 2RFXB 4Z76A 4KO5A 4PGCB 2DQDL 4OM1L 2VDOL 4JKMA 5AW5B 3BAXA 1I8MA 2NY2B 3QW9A 4LQ1A 4YOKA 3TBVB 3NIDE 2P5WE 3TCTA 2NQCA 1I3RB 4OM0L 3K6SB 3ZHNA 5FKPA 3MODL 4HISA 5EPMA 5JXAL 1NLDL 4J3VA 4ONGL 5BQ7A 2K45A 1AIFA 4XTRD 4JRFA 5I30L 2UXTA 4ZS6C 1NZRA 4DO4A 5I6MA 1XTMA 4FCAA 4JN2A 2VMJA 3NCYS 4M1CC 3KS0H 1E2VA 5HYQA 2JTDA 2LLNA 4JG0H 2OSLA 3ZTEA 3WTWA 1H8LA 4IIZA 3WFZA 5GZNA 2F53A 5DUML 2MOQA 4BWWA 3K5RA 1IBHA 4PJIE 2CRYA 3TPUA 3LNGA 1MCOH 1AQMA 2JCCF 3S96A 5I6LA 2P3YA 4UNVA 3ZQXA 2XQBL 3AXLA 3QIWB 3MBEC 2C4FU 4P48A 3D25A 1EH9A 2EEAA 3FQXB 4KHTH 1AZVA 2HLFD 3AU1B 3CFNA 4OV5B 2VL5B 5DHDA 4M7LH 3NDZE 3SZKC 3VRIB 3OVUB 4JFOA 1MFVA 2PN5A 5CJQL 4G7SB 3HKFA 4W9KC 4XVTL 1K72A 3UC0L 4LIQL 4I3RL 3TEUA 4EI5D 3VFPA 4OD3L 4ES9A 1EHAA 4AIOA 2BVQB 2PXYD 5I17B 3HG1B 1ID2A 4MWFA 1L5GB 2BCKA 2BC4A 1NCOA 2UYLB 5LG6A 4OY9A 3CZEA 4NNXB 1PZCA 3KWUA 3ZY7A 4OZ4A 5FHAL 3JV4A 4U1SB 4HT1H 5GGQL 1N3NB 3FQNB 4F8OA 2XVGA 1BX2B 1KPVA 3BVXA 2O5XH 1J5OH 4AY0A 1GZHA 1AFVH 2IG2L 3N43B 2W38A 1QAWA 1ETB1 3FQ4A 4ODXB 2CRZA 1CGYA 2P80D 1P4UA 2EIDA 1IE4A 3PAYA 5FYKE 3QC5X 3RY4A 3L7EA 4H1LB 1LEKB 1LWRA 2DRUA 2B59B 1FYTA 2WP3O 4NXKA 4ADJA 3L9BA 5CBAA 4FQJL 4KX7A 3WY4A 3UG4A 1WBXB 2VABA 4LP5A 5CBEB 1ZGLP 3U7WH 4PJ9C 1QKZH 5DD6B 5L9DH 3LN4A 1ZHNB 2OCJA 3KBPA 4PRBA 2R1WA 4X2UA 3ZE1E 1XF5A 3MNVA 1RJZB 4BZ2H 3MRKB 4YHKH 4D7PA 5GS1B 1NIBA 3EJUA 1ZT1A 1GY1A 4XNYH 5MI0C 1J9TA 2JLPA 3A22A 3R1GH 5DJ8A 3DO4A 5J1AA 3F7LA 1KWGA 2NRDA 1E5AA 1QYGH 1W91A 5AVYB 5I0VA 3KLKA 1NCDL 4U7KA 4KV5E 5AKVA 5I18L 3MLSL 1GC1H 4JO3L 1PKQA 1XCTB 4HPYL 4QR7A 3CDGA 3KBEA 4I18C 3X11B 4HUVA 1WTLA 3LS4L 4FZ8L 1HXMB 1KGCE 5DJZA 4AYEC 1GGUA 2X88A 2VT0A 1ZA6B 4EE2A 3RRQA 4UINL 2Z35A 4Z7NB 5HGDA 1KN4L 5GRVL 4TM9A 2ICEC 4YLCA 1KGIA 3EZJB 1KJ3H 1NMAL 5IVXE 1IZJA 3RZCC 1I7ZB 1G94A 4ELKA 2HZHA 2PYFB 5IMMB 2VLRB 5ISZA 1L6XA 2ZX5A 4IGBD 4DVBB 2EZ0D 1PDKA 3QEQA 4NPJA 3WKML 5SV4A 5C0CD 3SD2A 5FUCE 2NR6C 4UAOC 3MJGX 5JOPE 1MEXL 4Y4KC 4P06A 5DUBB 3ZKQD 4ZMLA 2PTTA 5LLIC 1FJ1B 1BBDH 4HSAC 4N2KA 4F7MA 2R69L 4AVJA 3IYLW 4G5ZL 4PG9B 2LABA 4Y4FC 2XRAH 2RCSH 4AMXA 4HX1A 5A6MA 3JWDL 1AR1C 3GMMB 5HDQL 3MCLL 1F90L 2EXWC 3BCFA 4Y19E 3L5JA 1T7YA 3S6CA 2NQ3A 2X2JA 4B96A 4DGVH 1T4KA 4KJYB 1XH0A 1UWGL 4ELMA 5ITFA 1Z9NA 3TASA 1LO3H 4LVEA 4WUUD 5DA4A 1ZLUH 1WBYA 2VMDA 3T3PB 1UWEH 1MJUH 1NUNB 1I8KB 4DESA 4W9FC 1FDLH 2X0WA 1A7PH 2J2ZA 2QQNL 1GC1C 2YFOA 3NA9H 3TCXA 2DBLL 3GBML 3APDA 1F58L 4BSJA 3OZKA 2E9GA 3LIZH 2DH2A 4GO6B 2Z8SA 2VDQH 4DPCX 3OZ9H 1ZLWK 3SO5A 3NAAH 5DZ9A 3IGUA 2NNAB 3K8MA 1QLRA 5CGYC 3VMPA 1RPUA 3SY6A 3QCTH 4CSTA 4FYSA 1R5VB 1VADB 4WUKL 4PBVC 4XWGH 1T1WA 2HG0A 4BH8A 4CU8A 2CPCA 4BKSC 2E7CA 2XG4A 3ARDD 1HQRA 1J8RA 1UEYA 3SPVB 4K3EL 1QQDB 4OZFB 4ELMF 5LAXB 5GGTA 2FSEB 5EWIL 3NIFE 3ZW3A 3DV6A 2B3RA 1KJ2H 1ECZA 1FUNA 1LMIA 1NBZA 2DWTA 2IALB 4H4NA 5TK2A 1O75A 3FSWA 1EZVY 1TFHA 2XZAH 3CZFB 2AJUH 3AJ7A 4OGQC 4PJ5A 1ASPA 2ITDA 3N06B 3QUZA 4J4PC 5G2NA 5E8PA 1NGYA 3H55A 2IV8A 3QULB 3RL2B 1JV2A 2X9YA 4V1DB 2DYPA 3M1BA 3R0MA 2C3GA 1UXWA 2HX9A 4EDXB 2XX0A 1DBAL 3IGAA 4GXFA 5F7DB 3TH4T 3P73B 1NBVH 3QDJB 5JQ6L 3N1MC 4GG6E 3IDJA 2WLIB 1SBSH 3F01A 4KC3B 1U8KA 5DFAA 3CN3A 2K4WA 3AZUA 3NG5A 3CPUA 5AD0A 3U0PA 4Q8BA 1L7TL 3IE4A 2BS8A 1QFWI 3LXAA 4K3DL 5J3HC 2A6IB 1UQSA 3RI5K 4QNPF 3DSNA 4PLOB 1LE5B 1HL5A 4HUKB 4R7DB 2JI1A 4G8EA 4NI3A 5GS2D 4DKFH 2ZICA 2H6OA 4EUPB 4M7JL 2VQTA 3AY4C 3V6FA 1JWUA 2MHAB 2W92A 1DL7L 3NGBC 3PPEA 3WYRA 1ACZA 2BPBA 3BSZA 4JZJA 5FYLE 2AQQA 3VWKC 5GGVY 1VA9A 1WFIA 3BLPX 4NKMA 1BLIA 3P9WB 2XICA 1KDIA 1FVDB 2AXJA 1NLBH 2QPSA 2ZOWA 5DC9B 4BCZA 3VYPA 2X2YA 1DSYA 2NNFA 3O11B 5FK9A 2WXKA 1JZEA 3RKDD 5DQ9A 5EBWB 4GNKB 4B41A 1G1CA 1XIWA 1A2YA 5B38B 3L54A 1RHFA 2J1YA 5IQMA 1RQ5A 1TQCC 4JRLA 3O3EB 3V0EA 4W9GC 3LKNB 4Q56A 4AQ1B 1KENL 1CU4L 3LRLA 3WSQL 2DQDH 4LVOB 4OM1H 2IANE 2VDOH 4P4RB 4B3EA 1Z9SB 1I1YB 1WFUA 1JHTA 3PXJA 4L1DA 3VW3L 4PGBA 4F58L 3FT3A 3FU6A 1DVFC 2H6PA 3ZHDA 4FXKB 3MODH 3T6VA 5JXAH 5C08D 2Z3FA 1NLDH 1H0DB 5F1IB 3FBKA 3I2CL 3D2UA 2EYTB 5I30H 3DBXA 4JRXA 3CD4A 3SKOB 1I7TB 5MHSD 1D9KA 3PV7A 5CR1A 4EKXA 4M6ML 5IJBC 1BVLA 2ED7A 3D34A 3WNMA 1AO7B 4MYPA 3AVEA 4XCFL 3ZHKA 1XCXA 1Q1PA 1SEBA 3FT1A 4FA7B 4PJ7E 1CYXA 3QA3A 4TVPE 4ZRGA 4KTDL 3T09A 1J88A 1CLZL 3V5DB 4HQQH 4MSWB 5F9AC 4U4BA 4IK6A 2WOBA 5I1AA 3UAEA 1SUJA 1CFTB 1SN0A 2R0ZL 4IJTA 4YLQT 2XQBH 1OAYL 3B9DA 3UTPE 1KN2H 5DJAB 4AQAB 3O2VH 1J5CA 1JNJA 2C7UB 1PZAA 1MXDA 5AW7B 1MZYA 4JFUA 2KHAA 5SWSA 3PHAA 5CJQH 1JF6A 3QJFB 1CWVA 2CDEB 1T66D 4P2QD 3UC0H 2NYKA 4LIQH 2WN2A 4I3RH 4DEPB 3L4CA 4OD3H 2HPTA 1F11A 1MLCB 2NY2D 1AQDB 3V55A 1WH0A 4W9ZA 4HUWA 1LEIA 5SX5K 4ZTEA 5BQDA 3CBJB 3FC8A 4LGRB 2HLEB 3P77B 5C7ZA 3GF8A 4MX7A 5GGQH 4JDEB 2VERN 2YAEA 3L95A 2BMKA 5CU9A 3BGMB 2QV4A 1QA9B 3S37X 4GKZA 2IG2H 4MD4B 4XAWL 2XN9A 5CS7A 5D93B 5CEYA 5KYUB 4ONHA 3VGBA 1W72L 5CGMA 1QUNB 3EXJA 1MFDL 3VA6A 5IJCC 1BAGA 2FL5A 2YR3A 1OT1A 4EZLA 2V7HA 4KDWA 4FQJH 5LN8A 2WO3B 1ID5I 5IEHB 1M1XA 1VERA 4PN6A 1X5IA 3LPWA 2BP5M 5K9JL 2WVVA 4KXZI 4ODUA 3QIWD 3NABH 1BVNP 1HH9A 5AZEL 5F7UA 4BH7A 3K0YA 4X6DB 3UEZA 2VR5A 4AKQA 3U9UA 2GBUA 4HH9A 4R9HA 4JFQA 2QPFA 3J7HA 3QR2A 1CXLA 3VXNA 2NYYD 2WSDA 3BN3B 1TPXB 2E4TA 4KVNL 4TUKL 4XX1G 3HB3C 4L1TA 1MVUB 1DSWA 3TVMA 5KVEL 4HZLB 5C2UB 3HG1D 1W6WA 4YAQA 4HPYH 3R06A 3O4LE 4N68A 5F6IB 2XWEA 2QQKL 4Z5RA 1G9HA 1QBLL 1X7TA 2R2EB 4FZ8H 2OFQA 4H40A 1XBRA 1CD1B 3KCPB 4K9EL 3D09A 3BH9B 4FTVA 1HWGB 4OJCA 1WHPA 3WNOA 3MR9B 4UINH 4PBDA 2GCYA 4N8VG 3KPSB 1KN4H 1FORL 4IBUA 5I19L 3E3QC 4RX4A 2FBOJ 1NMAH 1FP5A 4OCXL 1X3DA 4E0RA 3DXAB 3DGGA 2EDJA 1FNLA 4QRPA 1SMDA 2IC2A 5HJBA 4BELD 1MUJB 2XBZA 4JO4L 4QRFA 3WKMH 3CK0L 4JHAL 3T65A 4GSQA 1UG9A 3HS0B 3V10A 2B77A 1MEXH 5I1GL 5FWQA 4ZW6A 3W39A 5E00A 3A24A 3MV7B 3LDBB 5HTSA 1VPOL 4M6OH 4QJ3B 5T33L 4JQXC 4OLYL 4BM7A 2APWA 2A6DB 2R69H 4PW3A 2ZSVB 5LB1A 3VJ6B 4FCHA 4G5ZH 4YSOA 4DQOL 2P24A 3S97C 4NENB 1SEQL 4PY7B 1T20A 3SN6N 1A9BB 1FCCA 1TYJA 3DUUB 3CQQA 3JWDH 4YSDA 2P5EA 5ACMA 5BUPA 2OMWA 3HC0B 1RHHA 3FL7A 4NQEA 4OD1H 5HDQH 1OQXA 1EJ8A 3MCLH 1F90H 2EXYC 1DJSA 3ZGHA 5DO2D 4RBPH 4FL4C 1RZIB 5BW7A 1UWGH 2O26U 3GSVB 3BZFB 2ZIDA 5DS2A 3MNMA 4JFFB 2O6EA 4OFPA 2MKWA 3EOYG 4XE0A 1N4XH 3U6XA 4C8XA 3CFJA 2DH3A 4JY5L 1PY4A 3QORC 3FB8A 1JGUL 2FLMA 1URIA 1JVLA 2QQNH 3I3DA 3GBMH 3TH3T 4D9RD 3L3JA 5HYJB 4N5ED 3PL6B 1GKEA 2VLRD 4B9FA 3VXRA 4N9GB 1ZXKA 5ID0A 5IROC 3O3AA 4LRNH 2MCAA 5F3BA 5DYFA 4CU6A 1S5IL 4Y88A 5BZZA 4ZMZA 5HPMA 3U30C 4RETB 3PIQA 2YMTA 3BP5B 5GGSB 4PLKC 1DBKL 3C6LC 4N8VA 2K6YA 3QO0B 1MQKH 5C2BL 1A7NL 4GG8A 4JO8A 4K3EH 3QAZB 3OAYH 4RNRA 1PLAA 2OTUB 5EWIH 2IJ0C 5FHBL 4YSQA 1HJCA 4L8BB 1B0IA 4CADB 5D1QE 3RFZA 4E9YA 3EJZD 4TLSA 4HK0B 1ES0A 1TEYA 2R4SL 2CSPA 3RDTC 1A02N 4EJ1C 3L9EA 3MRGA 2CXGA 2PCYA 1F4AA 1MSPA 4GQRA 4NXSA 2C1OB 4OAWA 3K6NA 3GXIA 4I5BA 3BESR 1DBAH 1V55B 1SDDA 4A2GA 3OKOA 5E1QA 2ZUQB 1NPJA 4KI1A 1SBBA 1OP4A 4PRPE 3GMPA 5D7JC 3JWDC 2H1PL 4CMMB 1U36A 3RGVB 1L7TH 1X6LA 3CVHA 4N2DA 1EAJA 2D3VA 4JY4B 3WMQA 2PWDA 5HPOA 3TZVA 4K3DH 1NKOA 3KWVA 2VUYA 5A40E 3PPSA 3FPYA 3UTSE 1YEWA 4PCSA 4W68A 3ATEA 2OMTA 5AVWB 4R2GC 4DEUA 4M7JH 4U4IA 3JWNC 4B97A 2ZCZA 3CHSA 1DL7H 5C0JA 1BBJB 2HN7B 4ZUUB 3FTGA 3BAKA 5CIPH 2QKIC 1AZCA 5IW3A 2JWYA 4GY4A 2K6ZA 3F62A 1YN7A 5FYJE 2Y0SA 3NZUA 3VXMB 2RBLA 3GPEA 5TH2B 4ZMQA 3UJJL 3NCYP 2CKBH 3FFCB 2EIZA 1ZS8A 1UD6A 2BSED 5JORB 3ARVA 1YYLL 3QWOB 4P2RA 1FFNB 5C0ND 3K72B 5IFAH 4V1DD 1E5UI 5ELIA 4LSUL 2ZX8A 3RWJB 1PEWA 1XEDA 1MRCL 1WIUA 4I2XE 4AH2A 4D7BA 1CFQA 3EFDL 1KENH 1KXVC 3RWFB 1CU4H 4YGAB 1Q0XL 3EBAA 3CUPB 3TNMA 3WSQH 1A1NA 1T1YB 4PR5B 3FTXA 3I9IA 4S2SA 1DFXA 4UM9A 3VW3H 1HSAB 4KBPA 4XCNA 4K55A 1P1ZA 5C7XL 5HHPA 3GMOB 1FVEA 3FSZA 3W0WD 3EADA 5L0QC 3MRHA 2CALA 2FCBA 1AOZA 1AD0B 1KCLA 3QUMA 4QHMA 2J56A 3DO7B 32C2A 4P5TB 4M6MH 3AM8A 3I50L 1OF0A 4RMVA 4KRPB 4WO4D 2MQGA 3QG6B 3KYOA 3IWUA 2R56L 3S34L 1AYRA 3U1SL 1ADQH 1OCWH 5E1AB 1B6DA 2G5UA 4KTDH 2MCPL 4HC1L 2QHRL 1CLZH 5IEKA 2WXRA 3FTUA 2FJGB 2XWJA 4F57L 3VDCA 2R0ZH 3L3DA 2JELL 4GQPH 3ZVVA 3MO1A 1OAYH 3KWXA 4ZFQA 5CCHE 1B3IA 1ZHBA 1INEL 2Y3AA 2OS7A 4WJG3 3RU8L 5IBTL 4JFVA 3HMXA 4UOZA 4FFWD 5FGCE 3ILQC 1HNGA 4GO9A 4QF1A 3IKKA 3NEOA 4HFWA 3VFMB 2FVNA 3AS2A 3FFOA 3KWTA 1TCMA 3OAZH 5JIQA 1IC0A 1VHPA 1M71B 1HT6A 3D4ZA 1QWUA 3UZQB 1IAOB 3F6JA 1RY7B 4XNMB 5DHYA 4I4WB 3LVTA 4HCIA 2DQCL 4NKQB 5HHQB 3KW8A 2FWOB 3NUKA 3D12B 3OLGA 4H8HA 3B5TA 5IW1B 1S9KC 4XHQA 4GT0A 4Q6IC 1BZQK 2Y7MA 2Z1KA 1KYOK 2NUTA 6PCYA 5EIIB 4AVKA 3I85A 1IKFL 2XXCB 1SVCP 2JQAA 3MJ9A 4G9FB 4AV4A 5EU6B 4XAWH 1FGNH 2Q3ZA 4BFBD 1W72H 1AO7D 3QS2A 4LKCB 3G5VA 5IFJA 3FCSA 4R4FL 1Z6JT 2OYKA 4J3OH 4MNGA 4YHML 1MFDH 4NDMB 3HPLA 3GO1L 1DQLH 1RIUL 4NYLB 5E4IA 3DETC 5L8LB 2HVJA 3PWJA 3JZ7A 3TBTB 2GFBB 3KPQA 1U9KA 3W5NA 4ZAKB 3ARSA 3PNRB 4GXUM 5T1JA 3G04A 1N0LB 3AROA 5K9JH 3QRGL 3EJQA 4Y16A 2EUZA 1YUKB 1PNCA 2NOYA 4DO5A 3LN5A 3WUWB 1MF2L 1YO4A 6FABL 1V10A 2BP0B 1HHJB 1BEXA 1ACYH 2EE2A 3MTXA 1BQKA 5FF6B 4FN0A 3DVIA 1ZWIA 2WMPA 3EYVB 4M00A 1EAPA 3GS0A 4KVNH 2P5WA 4TUKH 3ELAT 1GPOL 2LVCA 4KFMA 1ZHLB 3FTVA 5KVEH 4BDVB 4MXQD 4XX5A 4GAJH 4ZDHA 1J9CT 5H4ZA 3WLWD 2F54B 4JLRB 3I02B 4NRYA 2QQKH 3Q6FB 4CNIA 1RZQA 3P9MB 1S78D 2B08A 12E8L 3CAFA 1QBLH 1N2RA 2DQTL 5K39B 2L7UA 3FT9A 3OC5A 3OKKB 3QDHA 3T04D 3VQMA 5I8CB 1T83C 4X98A 4PCTA 4JB9L 3EH3B 4K9EH 1M7DB 3IK2A 3L1OL 3RUGF 4XNZB 3GHEL 3D50A 1YEDB 2I7OA 1XAKA 5A6LA 4XCYA 4PJIA 4WW1B 1I8IB 1FORH 3GDCA 5I19H 2EDMA 2RH0A 4JG5A 4OCXH 3I3EA 1J05A 3R7QA 3WFEL 4BYHA 1J86A 2G4GA 4OCYL 1RZKL 2E86A 2YN3A 4CW1B 1WUNT 1A1OB 4Y1TA 4JO4H 3NIDF 4K15A 4X83A 3RTQC 4LCYB 3CK0H 2ATAA 3BUTA 2OKMA 1CGSL 1XH3A 4JHAH 3MLTB 4AEIL 3MRBB 1UASA 3WJLC 2X4RB 4NHUA 3L45A 5I1GH 3QIBA 5C0FA 5F89A 3BAIA 1KELL 1YY9D 3N41B 5E5UB 1RP8A 3K8LA 1VPOH 4J3OC 1TTBA 4AMKL 4NWTL 3GSNB 4XVUC 5DI8A 3B43A 5T33H 3SPHA 2V0AA 5EO9A 2ZE0A 2NXZB 3BEWB 4DQOH 1SEQH 4NZFA 1GIGL 3DV4B 4DSYA 1I9EA 3NQIA 4HIIA 1LE9B 1NGPL 5CXPA 4PJIF 3D08A 1MI5A 2BHUA 2EVFA 2VL4A 2E7HA 5HDOA 3BIKB 3UTTB 1IGCL 4TUJB 3G6DL 4H7VA 1UB5A 4GMTL 4DKTA 2J8UE 4RA3A 1ZY9A 2VISA 4ZUWB 5I0DA 1LM8V 3OV6A 3VXPB 3KPSD 2X2UA 1JGUH 4B27A 5C9JB 3VFOA 3IDIA 1QR1B 3FF7A 5D72L 4MJ4A 1VKXA 1E5ZA 3BSGA 3DXAD 3ASNB 4ZXBB 4HAGA 4YL4A 4YGVA 3C5ZC 3DIDA 1IAII 1U8LA 2DLIA 1RIHL 3ZN6A 4YHPB 4K9EC 3MV9E 1KZYA 3KLSA 2V5SA 5FM4A 4YHZL 3MRDB 1S5IH 2E8ZA 3LV3A 5DHVB 4EIZC 3IMUA 3DVGB 1T21B 3SDAB 1DQVA 4OKVA 1ZT7B 5I6XC 1G5AA 1II4E 2OBGA 4Y8AA 2ZG2A 2D2CC 3MV7D 1DBKH 1DBML 5IVZA 4GW1B 1TZHB 5BMFL 5C2BH 3CE1A 2GY7B 4JY6A 3QGVA 5EO0A 4ISVA 4QKTA 2EYSB 1A4JB 3CVCA 5FHBH 4U33A 3WE6A 2DLHA 1QLEB 3D05A 4Z77B 4P9ML 2X89A 2R4SH 3T6XA 2DMBA 2NW2A 4TUOB 4GQZA 4HHGA 4NSKA 5DVLA 5KVDE 3FOMA 4PJHB 1IEBA 4X8GA 4P5RA 5DD3L 3MCKA 4WWKA 2A6JB 4F8QA 2GJ6E 4F2ME 4G6ML 5D7SL 3N91A 1P7QA 1CCZA 2I25N 3ZE1F 3PDDA 3JTTA 4K23L 5HJGA 5IVXA 3VNZA 5GS0H 2ID5A 4LEOB 3MLWL 3CJJA 5AOZA 4YHIA 3SQBA 3BZDA 2H1PH 2X4TA 3L3HA 5T5NG 3QXVA 2X05A 3KPTA 3GQFA 4LDLB 4QOKE 5HYJD 2YPVH 4FYTA 2EH8L 2YD6A 2NCEA 3PL6D 3PYCA 4KV5F 5DRWB 1JZGA 2HTLC 2VITB 2XKNA 2YEVB 4IRZH 3QJHA 4E2OA 5IHHA 5CEXB 5IP4A 1QPPA 2F19L 2KPNA 3MCYA 5EBLB 4A7UA 4Z7QE 4MS8C 4D0DA 1QI3A 3QZWB 1YNTA 3I74A 1JL8A 3HLAB 1OGAE 4A68A 5JPMA 3SCMC 4P49A 2UY7B 3DX4A 3OLIA 2W94A 4PG2A 3UG3A 1WLHA 1JK8A 3BP7B 2RA1A 4U3XA 4G6KL 4HHAA 3TO4A 2ESVE 3DX9A 1KNOA 2CHWA 2A5UA 4GRLA 2YA1A 2RIKA 1P4LB 3IXAA 4K2UL 5IVXF 4PIBA 1X4ZA 3NVQA 4Y19A 5IJKA 3UJJH 3CCHA 3CSPA 3D30A 1DFBL 1MDAA 1MH5B 2A99A 2BOBB 2VR8A 5ECJE 3VRJA 1JZ8A 3QJSB 5MENB 1YYLH 2XWRA 4S0SD 4WFHE 5TE6L 1M6OA 4I87A 1G6RA 4I9WE 2F74B 2ZAIA 35C8L 4PWGA 3EFDH 3F7YB 4I85A 1I9JL 1B3JA 3PAZA 1A6WH 3Q1SH 4F15B 3TL5A 3PWPB 3IKCB 3V52H 4AL8L 2AJZB 3S3BB 2F8IA 1YNTF 2J6EA 4UB0L 1DE4A 2A73A 1KPRA 1SLVA 5C7XH 2E6JA 3ML8A 3MOBL 1BD2E 3ARPA 5E4EC 3QQ4A 4NOFA 1ZVNA 1WCBB 2XBTA 4ANWA 1LEGB 4TUUA 5AKRA 2CO2A 1NFKA 1DQJA 1LNUB 3I50H 4F7CB 4LNVA 2GITA 2W60A 4BQ8A 3HC3L 2R56H 3S34H 1C5CH 3IJ8A 1HYSD 3U1SH 1XO8A 2IWEA 4F3FB 2MCPH 4Z78A 4HC1H 3A5VA 4UDTB 1MY5A 1R34A 3MREA 4F57H 2AEQL 5L2KB 2JELH 1L9TA 3L1GA 5CZKA 1UZ8B 1ZLWH 3VXMD 2B15A 2WSKA 4AQ8C 2OI9C 3SEPA 1AS6A 3FYEB 4PFEA 1INEH 1KEML 4LVNC 3QZNA 3FFCD 3RU8H 1TQBB 5IBTH 2VXSL 3P3UA 4OJFL 3X12A 4ENED 2Z8WC 1UACL 2RQEA 2VZ3A 5CNHA 2OL3L 3GSWB 5B4MC 3PWVA 3SE4C 5CKAA 2PYEB 1ZLVK 3STLB 2AC0A 4GG6A 4KGJA 2F08A 3OJVC 3X14B 4OH2A 1U91B 4B95C 3UBFA 4ZX3A 1AE6L 3US0A 2J5LB 4BSWA 3EF7A 4FD0A 1JAEA 3CDZA 2VR7A 3UAFA 1D7FA 1I4FB 1YDPB 4PRDB 3BVNA 3DX1A 1UJTA 2DQCH 4R26L 5ICZA 4FNTA 5TE4L 4URTB 1NUDA 3KYMB 3NIFF 5CSZA 4KK5D 4QHKI 3HHSA 3QHFL 1QO3A 1CDYA 4NC0B 4L29B 5D96B 3VWJA 5T5NF 3OF6A 4MQ7A 1MIEH 5AZ2L 1CBVL 3DHUA 1IKFH 3LKRB 3P9LA 1ETZB 3HZVB 3PXLA 3UIZA 1CGWA 1V3MA 3MUZ1 5GZOD 4P5TD 1F2QA 5A2JH 1YHPA 1I8LA 4MA1C 2X0VA 4KRPD 5IREA 4R4FH 2WAHA 4YHMH 1T7VA 4HG4K 2VE6B 1QHOA 2ZUUA 3CSTA 3WDIA 1SY6A 1HSBB 2F8VA 1YMMB 3DJTA 3GO1H 3I6KA 4F9LC 2D0FA 2G5BA 1RIUH 3ZXAC 3DNKA 4GG6F 4PVBA 3WTTA 4OKDA 1Q9OA 1PCSA 4NZTL 2BRRL 2K7PA 3MRNB 4TMPA 2AK4E 4GRWE 5A16B 1CT8B 3QRGH 4CKVX 4NP9A 4IKKA 1R17A 3VX1A 4FAAB 1MF2H 6FABH 1WZKA 3QXAA 5FA3B 4UDUA 1RJYA 4L8CA 2IANA 4FULA 1JDAA 1KACB 1JZFA 3D1MC 4ABQA 3PQYB 4ZG1A 1GPOH 4WTQA 3S7GA 3QNXB 4JM2C 2JKTM 1OE1A 3V0FA 2AV7B 1PAMA 3O45A 5DEGA 12E8H 1U8JB 3D0AA 2DQTH 2BSRB 3COOA 4UTAA 4GMSL 4ZBJA 4JB9H 4N25A 1KV3A 3OG4B 4MAYA 4LCVA 3A21A 2XN0A 4IHOB 2DQ6A 3GHEH 4GLRH 1EZSA 4G9FD 4PJ7A 4X6EB 1H3WM 5EU6D 5EU4A 4BEIA 1E7UA 2B20A 4A2MA 4KHXH 5EF0A 5IF0B 4JFDE 3OHXA 4L3CB 3MOQA 5B3NA 3D06A 4LSPL 3UG5A 3TFBA 3MQIA 4LFHG 1D5BA 1BYPA 3FRUB 4F7EB 5D8JL 4OCYH 3FQUA 1RZKH 4ZAKD 2FEEL 4PBWD 5D2NA 4TTGA 1CGSH 2X4NB 4FMKA 4U1MB 4FLOA 4AEIH 4AUUA 4IRSA 1RZ8B 5IY5B 1KELH 2Q8BL 4MJ6B 2GI7A 5I75B 3WKQA 2BOCB 4YHLL 1CGTA 1NQBA 2VTFA 2IH9A 3W1ZA 1EFQA 2WQSA 3KNBA 3OHMB 4JFYB 3U9PH 4KJWD 2JFCA 1LK2A 4QRAA 5DTFA 3DMMA 4PJ7F 3OLDA 5ICXB 1CG9A 1NGPH 4OZIE 2H32A 1L9QA 1VFOA 3QDJE 1J8SA 1ANUA 2F54D 4R3SA 4RGMB 1AMYA 3UYOD 3VMOA 1SYSA 3FHQA 4GBXC 1CYGA 3LB6C 1J0KA 3P2BA 4G2AA 3RVUC 2EICA 2XNAA 4RAHA 2YD7A 2ZWSA 3G6DH 4DUWA 2HKAA 4GMTH 4NCDA 3J2PA 2IPUG 2VO5A 4ZFFB 3T1FB 2KZWA 3ARGC 4N2CA 4PY8I 2YGQA 3CNKA 1X7QA 3P11L 4HJGA 2VCOA 4N2MA 4MYWB 5IJVA 5D72H 1FNEB 5E6IA 5JOEA 4IRJC 2J71A 2ZPKL 3GTNA 4S1QL 4XTRC 4CN4A 4CN1A 2HG5B 2ZOKA 3AABA 5F0JB 3BUBA 1RIHH 1ODAA 3INOA 4JFTA 4YHZH 1RK0B 4XNBA 2GK0B 5DJ2A 1NC4B 4ABWA 3OB0H 4I9XA 4PRHE 4QJ5B 1CDCA 2KQNA 4E5XG 3SDCC 5KS9B 1DBMH 2H9GB 2PMZA 2XPZA 5F7MC 5BMFH 1CFMA 5CU5A 5IOPB 3O9WC 2PWEA 2NXZD 3CFKB 4L8SA 4GOSA 1RZKC 2MPAL 4S1SL 3JTSB 1E90A 4P9MH 4IBZA 2FX7L 3VD4A 5KN5A 5A2FA 1VENA 2FBJL 2D4DA 1G4MA 3ULSB 3QR1A 5B8CB 2HLFC 3HI1A 5DD3H 3UTTD 4YDVA 1QRNB 5B7FA 5IK3B 4G6MH 3LQZB 3L3OA 2LAAA 3TBWA 4BK5C 5KSAA 4NHCL 4K23H 5DMGD 4LL1A 4EI5C 1QSEA 4P5SA 4NBZB 5CF3A 3KCWA 3KLDA 2PXYC 2G2RA 3D39B 4J7RA 3MLWH 4YHNB 5DSCA 2XG5A 4R7LA 1RZJL 3L17A 5EUKA 2D7PA 2W0KA 4LCWE 5FIEA 3TWYA 4J2XA 4KZCA 2BIPA 3TJEH 4ECNA 2J1KA 4IBQA 5EDSA 1QBML 2FJHB 2EH8H 5ADPL 5TTRA 1TT6A 1P5UC 3O8XA 4QXUL 4XR8C 2X4QB 3GGWB 4KPHL 3GRBA 1TZIB 2F19H 4A55A 1EIBA 2CPUA 1NBQA 3OG6B 3SDAD 4D0CA 3NIGF 2DQFB 5I16B 1IM3A 5DVPA 5FO8B 4PGZA 1E67A 2BSTB 4G5AA 3MRJA 3S3SA 4WSJA 3I6LE 1UA7A 2NDGA 1XHHA 2BNQB 4G6KH 2VDRB 3IMTA 3ATBA 2VO8A 4NPKA 5C0BE 3OKEB 5FB8A 4N26A 3B6SB 4K2UH 5IBUB 2APFA 3UBXB 1KXTA 4FOMA 3HMWL 3UAJA 4Z1PA 1VACB 1UZGA 4L0PB 2ZXWB 1TJIL 4DP2X 1WC7B 3Q8BA 4QHUA 1XCQB 5GGTH 5IB4B 3VCLB 2Z31C 5F7YC 2FX8L 4WHDA 5F7FA 3RQ3A 1FNGB 3VXQB 3KJ4C 1KIPB 4E5XA 35C8H 4TNVF 1AHMA 1QATA 4CC0A 2BX5A 4NQVA 3DX7B 1KGUA 2ZKWA 3IBOA 5ETUA 3QZBA 4HWEL 3V4VB 3ABKB 4AM0B 3MGTA 4UB0H 5DMIL 4AUYA 3VG0L 2PW2A 3WI9A 1I7RA 2ZUXA 3PGFL 3MOBH 1AY1L 2W65A 2COVD 4M7KL 1MIML 4W4OC 1GMIA 3QI9A 4L1HA 4QHLA 4HSCX 1K4DB 2XXGA 1OQOA 1RUPL 1PD0A 3IXTA 2VSMB 3E2HB 1GJIA 3KYNA 4PJEE 4KUCF 5ESAA 2CZNA 3KGSA 1VFUA 3VFVB 3S8WA 3HC3H 4FFZA 5E8OA 4AE0A 3PDOB 1JG9A 2V17L 4Y5XA 5D1QA 1MCLA 1Q9WA 1FH2A 1NICA 3CC5A 4JPIB 1U8IA 1KXQE 4ZYKA 4I0PA 4N1EA 1I7UA 1SDAB 4P3DA 1G7MB 4I0CC 1M4KA 4E9SA 5TFSL 4ATWA 1TCRA 5FECA 5AVXB 5ANME 1KEMH