1P4UA

Crystal structure of gga3 gae domain in complex with rabaptin-5 peptide
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
145
Chain Sequence
LSLASIHVPLESIKPSSALPVTAYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNMAPLPVKSIVLQAAAPKSMKVKLQPPSGTELSPFSPIQPPAAITQVMLLANPLKEKVRLRYKLTFALGEQLSTEVGEVDQFPPVEQWGNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords ADP-ribosylation factor binding protein GGA3
publication title RECOGNITION OF ACCESSORY PROTEIN MOTIFS BY THE GAMMA-ADAPTIN EAR DOMAIN OF GGA3
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1p4uA00
1IU1A 1P4UA 2A7BA 3ZHFA 1QTPA 2E9GA 2DWXA 1W80A 1GYUA 1KYDA 1KYFA 1B9KA 1KY7A 2VJ0A 1GYWA 2DWYA 1QTSA 3ZY7A 3MNMA 3HS8A 5CN2A 1KYUA 2YMTA 4BCXA 1KY6A 5CN1A 1GYVA 1NA8A 1OM9A
chains in the Genus database with same CATH superfamily
1JOIA 2BMKA 3ILQC 5IVXE 4G7QB 3WO3B 4FFYA 3NOIA 1ZHKA 3D69B 2IEPA 2PWEA 2VAAB 2Q7NA 2FL5B 5CJ8A 4GBXC 5KWYC 1N59B 4F7TA 3PDOA 3H0TB 5AVWB 4EZMA 5I30L 2F2HA 4FJYA 2GK0B 1A1OA 3W3BA 4O51B 1B2WL 5A2CA 2O26U 3K91A 4PRID 4HDIB 4W9GC 2KERA 2PYFB 4AUUA 3TN0B 4HKJB 5B7MA 1TCRB 4HJJL 4MQXD 3BAJA 2LABA 4PVLA 3H42H 2YOAA 4XWOC 1PNDA 4XN1A 5CEYA 1D6EB 3OAZH 2IJ0C 2HSIA 1UCBL 1V8HA 2XTJC 2Y7LA 3FN9A 3MLTA 3BIKB 1R3HB 4JQIA 1T04B 2GFBB 4B3VA 1E9QB 2ZZUT 1CFSB 2YPLE 1SVBA 2WJ7A 3PWLB 4OGQC 2EYTA 4ONGL 5LGKA 1H15A 1T7WA 4EIZC 4BBWA 4M1GL 3N43F 4H0GA 4UOW0 3WEOA 1D5IL 5BS0B 1KCUL 1JZ2A 1X44A 3C09C 4P9HH 2WXMA 5KAQG 3DROA 3L4CA 1P6AB 5IBTH 2AQ1A 3MV9A 3TBVB 5CUSL 1IEAB 4KAQH 1G1OA 2I24N 1K72A 4QNPF 1WZAA 4KQ3L 2MRYA 1MJ7H 1MXDA 5GS2H 3D0LA 1GS6X 4X6CA 3AGVA 5SX5K 3QUYB 2CKNA 2X40A 3B2XA 4AK1A 3O3AA 4YHNB 5FUCE 1II4E 1O5DT 3BZ4A 4LBEB 4LSRH 1DSFH 2BJMH 3GSUA 3QCUL 3MUUA 4LPVA 5BMFL 2QQNH 3RNQB 5DWPA 2N59A 1K8DB 4G8GB 4HIXH 4JDTL 4A2DA 3EHBD 2JWYA 3MX0A 4E9LA 3L1OH 4D9QD 4MDIA 1CVSC 2DLFH 2R0LH 2WKLA 3AMLA 1MWAL 3FRUB 4X50A 4P2AA 4BD4A 2WXLA 5KBPA 4GUQA 1M9SA 3QGVA 1AHWB 4XVTH 1ERNA 2I60L 2LAGB 5C0CD 2IBZX 3FRPB 5DD6A 4ELMF 4MBRA 3FT9A 3IF1A 4B27A 3SGJA 1BF5A 1COBA 4XNAA 2BNUA 2P7TB 2WSPA 1EZLA 3FJTA 4N0UB 4AOFA 5L8KB 5KEZA 3BP7A 3C5ZB 4P5TC 2PN5A 3E80A 4K7PY 2A74C 2MHAB 1DBAL 3C5JB 5ILTL 1IGML 2UWEB 3HZMB 2Z8WC 4FS0A 3NIDB 1RZ8A 1YZZA 4TOYL 4BFNA 2R23B 2V5MA 4KDTC 1C5DA 5D7IF 3GBLA 4HVBA 1ODAA 3K6SB 3OKDB 5DJDA 2CO4A 5D9SB 1FCCA 2OTUA 3ZGHA 4Z7VA 2AS5M 4PIRF 4NFDA 3U1PA 1EAJA 4G1MB 2ICES 3D5OF 4N90D 4KV5E 1R9FA 4MXWL 3ZE0F 1YEDB 4ELKA 2VT0A 4Z7UB 3UAJC 1UB5B 1CTMA 5DK3A 1PSKH 3REVB 3ZO9A 1FI8C 4KZEL 4BEIA 2IDTA 5GGUB 3MA9L 2D31B 4ZUVB 5TFSH 3V0HA 3MA7B 4IOSA 1A6WH 3N85H 1PKQE 4XN9A 3UJJH 1ZRUA 5LDSA 2UY6A 4DGUA 3BGAA 1QATA 3QWOB 5JR1H 2YS4A 1FIGH 5FOBA 4MDRA 4ENEC 1IAIL 5IHHA 3WELA 1FRGH 1NGQH 2N0MA 2FUTA 2R7EA 2JI3A 4YHOL 2XQYK 1RSYA 1RQ5A 2ORBH 3IDUA 1R34A 1SNRA 4PGBA 4UDUA 3A4AA 2NT1A 2AANA 2FQDA 3RZWA 2R9HC 4WF7A 1X5YA 2QL1A 5B3NA 1UCTA 1X6NA 2BX5A 5E4IA 2RTTA 2FTAA 4NDMB 3VRIA 4JKMA 4NUJB 5KN5B 2B77A 3UO8B 1BEXA 4BZ2L 3TZVA 2XZAH 1TUPA 3OSKA 1BW8A 3L45A 2R4SH 2JMRA 3SOBH 5D1XB 1OP3H 5I1DB 5EPMB 2I7SA 3N43B 1IBFA 1F1GA 4XO8A 4GO9A 4O2FA 4HP5A 4WI5A 3FULA 4Q58C 4IM8A 3QEQD 1HHKB 5HGBB 5I23A 1AXIB 4IGBB 1TTRA 3RVTC 4TQHA 3GXNA 2QKSA 5H37H 5EOQH 4EKJA 4F8LA 4WFFE 4HJEA 1S5IH 1ZIAA 4G59C 4LLVA 4P2QE 2YPVH 4TTDC 4JQVA 3GPSA 4X4ME 3DI2B 1XGPB 4JM2A 3S5LA 3QFJD 2L7UA 4BJLA 3HRZA 4WGVB 3QIBB 3RWHB 3MUGB 4K23H 1KYDA 2OMNA 4IBWA 1LO3L 5IQNA 1B0WA 1G6RH 1E6OL 2WBJD 2XVBA 1R17A 3QS3A 4YDVB 1KB5L 1GSMA 2BSTA 2JKXA 3LH2H 3IVKB 1IBZA 1I9JL 3FZUD 1TCMA 2VR3A 1MCPH 3KYOA 4PR5B 3HNSH 1AO7D 4AVIA 5I0VA 1UWFA 3ATAA 2NY5H 3FRPG 4FA8A 2VQ1A 3V0VB 2AQNA 1Y1UA 4IIZA 4H0LC 5GRJH 4GS7B 3S37X 1RVFL 4HULB 4OZGF 4Y19D 3MRBA 3FO1B 1UXSB 4DPAX 3LYRA 4DO6A 2KDYA 2E7LA 1CGVA 1NJ9B 2EDQA 2F5AH 1R33A 4PV8A 4LCWB 1EV2E 3GXFA 1V7ML 4L9LA 4YSSA 5B8CA 4IBTA 5I6XC 1S7WA 3TIEA 4OZIA 1DVZA 3OPZL 3ZVVA 1X9RA 1M3IA 2JXMA 2CHZA 4ELMB 3RZCA 4WK4B 3EKCA 5F6IB 1XF2B 2IQAB 5D6CA 5HJDA 4WEMB 4I88A 4QGYA 1DUYB 3P3TA 5FKAB 3SQOH 5I6PA 5E00A 3X12A 2DB8A 2VXSL 1L9NA 2ATKA 1IC5L 4AWJC 4HUXB 4LPXA 2YKKA 3UX9B 5ACZA 5GGTH 5D7IB 4NQED 3VXUB 1AKJB 1KXQE 2VLMD 2WWMD 4K94L 4Y4KC 4A7SA 4PRAA 2N01B 4WNJA 3IPEA 4HOXA 2JKSA 4Z0XA 1G9NH 4AZ8B 3ZE0B 3OJMB 2NXZD 4PJCA 1MWAA 3T0EB 5JQ6H 4K8RC 3M7OA 1TG8A 2PXYB 3GMOA 2XZCL 1HFUA 2DIEA 5C09B 4DFHA 4MWFB 3ULVF 5BZWA 4G6KH 2IFGA 4JFPB 3S36H 3UMNA 4GQQA 1UWXK 1OQXA 5D2NE 3GK8H 4UILL 3P4OB 4WHYH 4H44C 4J7RA 1FH5H 1UD6A 3NSJA 2BSSB 1RUQL 2I9TB 4KX8A 3RVXC 3K71B 1TLMA 4JFUA 2R0ZH 4EIUA 3FUDA 3ULUC 2VXQH 2OJZL 1UVQB 1FL6A 1OB1B 4NS0A 2OMYB 1N5YH 4KMTH 4WO0A 1N0XH 3U9UA 1S9WA 3I02B 3PU7A 1VGEH 4HUUA 3D85A 4WZ9A 3VVWA 1Q9KB 3QUGA 5HYEA 4QRQB 4UT6L 1MI5A 4KO7A 2DM3A 3M1CA 4CVZB 5E5MA 2Z3FA 3RUGA 4CVWA 4A2FA 1KELL 4MYPA 5JA8B 2HX9A 3BWSA 3UGXA 3RWEB 1NFDF 4PJIE 4Q56A 3PP3K 1OCOB 1XIWA 3CD4A 4AW4A 4FI8A 4TUJB 4J12A 3OKEA 3MJWA 4YHIB 5I6KA 3BLPX 1KLGB 3S5ZA 2A4EA 3ZTJG 3WIFB 2V0AA 3OAUL 4Y89A 5BQ7B 2EO1A 3OC8A 5CP7A 1F4YH 4ONFL 3GXDA 3NFPA 5D72L 4Y5YB 4BUHA 3JTBA 4FTVB 2NYYD 1RPQA 3JTTA 4GNKB 3DX7B 5DO2D 4IOIB 3CDYA 1L3NA 3NBNA 3OX8B 4IKNA 4BZ2A 1OPGL 4ZNEE 3NDZE 1T89C 2EDEA 1DDTA 3V4VH 4U7SA 1MH5B 2HZHA 1RZJL 4Q9QL 2HFEA 2B15A 1T1XB 2Q6WA 5HHOE 1J9CT 3SBPA 1SZNA 2E47A 5T3XH 1KWKA 4MMZB 4I13B 4NO0D 1A6TB 1GIGL 1J0IA 1FVDB 4DNLA 2EIBA 3E7JA 1L7TH 3BFWA 4IKJA 1TVBB 4AYID 1A6VH 4ZMOA 4JHAH 4QKXB 5CLYA 2F7IA 3WSQH 1T0MB 2L7EA 4PJHB 4XPAH 6PCYA 1KJ2B 3NVQA 3QRBA 4GRLA 1ZEAL 2FH8A 4M02A 5CEZE 1TSRA 1XSKA 5MP6L 3GFUA 3P77B 4PGCB 4QR7A 1JZFA 4LDEB 4CADB 5HHMD 2E59A 3PFQA 4IKLA 3G6DH 3QXAA 4ZBJA 1XX9C 3N41B 3TO2B 3DIVA 5I75C 1NCHA 1T5WA 4KGJA 1SYSB 3Q7JA 4NO2A 3UZVB 3CV5A 1XEDA 3GMQB 3V0IA 2NPLX 3IKCB 1RERA 4R7DB 3DNKA 4Y1AE 4UIMB 4KTDL 2APTA 3EO9L 1YEEH 3FH7A 4NO5A 1EIBA 1LO5A 4EOWH 2OX5B 3GLAA 5LB1A 2VM3A 1ZANL 3AROA 2RALA 3KYKL 4LGSB 1Z5LA 4RESB 1PG7X 3A22A 1D7BA 3IFNH 1VACA 5DZJA 5L2JB 1JZ7A 4NAJA 1JZ3A 2IWKA 5FWQA 3TXAA 4RZCB 4A2HA 1S3KH 3BKML 4S10A 4F7CB 4J3OC 3KLKA 1WZ1L 3WNMA 4Y16D 4XMTA 2D7NA 4XP9L 2QVMA 2V9UA 3FN0L 1I1YB 3H3PL 1KEGH 5B4MC 4L3EA 4XB8A 2F5BH 2GTWB 3C6EA 4UM9D 3F7YB 5C0BA 2FJSA 4L3AA 1LVEA 2VDRL 2B2XL 2B4CH 2XPYA 4AEHL 2J1WA 4KUCD 3T2PA 3N40P 2IH1B 2AW2A 4ERSH 4PCKA 1EO5A 4HK3N 3IJYB 4WV1A 4F8QA 1TOXA 4NB7A 4JMNA 3AT9A 2APBA 1U2CA 2VDPL 2HKHL 1QTYT 3DV6B 1YEJL 4IU3B 4CJ0A 5IIEB 1MRFH 4J5VA 4ATTA 1R19A 2ZPKL 2EIZB 3E3QC 4M8QA 1BQUA 1A6UL 1UZ6F 1NFDB 4H2CA 1WV7T 2IALB 1SOXA 2R0WL 3QZNA 3AXIA 4U2ZA 4BZYA 2Y1VA 2YXFA 1MN4A 4GRWB 4IBVA 4ZS7L 4UMGA 1GGIH 5FHAL 3QFGA 4X7SL 1TMCB 4HIHB 1TETL 2XA8L 1QSEE 2EIMB 3SZKC 4OFKA 3VE0B 1K5NB 3VFWB 5GZNC 1RD6A 1BFOB 3G5YA 1X5KA 2VLJD 3HBQA 3WTUA 1ADQL 2Z4QB 4L3ED 1NCAL 3IAPA 4M5TA 1YY9D 3VI4A 5C1MB 2X0UA 2R69H 3WTWA 1JWMA 1JTTA 4L3FA 4KRNA 3QFDA 3ME0B 4FMVA 4C83A 1X9QA 2W80C 3GT6A 3MNZA 1ONQB 4DKDC 1PMYA 3ZMRA 5E6RB 5C07A 5CZKA 3APDA 1QFUL 3OHXC 4E2OA 2PCYA 3A6BH 1FZOA 3SDAC 1NBVL 3VXRE 1NCJA 4WWID 2BINA 3OC5A 5TK4A 1DBML 2K4WA 3WY1A 4I1RA 5EF3A 1CGWA 1P7KB 3D51A 3JV4A 3PV7A 4PP1D 4MAUH 4KMLB 2E8ZA 1LDSA 1U3ZA 3S34L 4CBZA 1H3XA 3CVHL 5JIDA 3HAEB 1T66C 4NQVA 1XWVA 1V10A 1KSRA 3X13B 5CO1A 2EILB 1HEZA 2YAQA 1RZKH 1NDMA 1S9XA 3S98A 2NDFA 3KXFB 4Q2ZA 5HI4C 1M2VB 1EMTL 1QSFA 2Z7WA 3K2UL 1D2OA 3OGCB 1E4XL 4DEPC 1YNKH 2OSYA 4K0OA 3U1SL 3UBXI 2OMUA 1PZSA 2LV4A 2R83A 2NXYC 4CN1A 2GC4C 2DQUH 4OD1H 1IQWH 1FAIH 2DLIA 5I74B 5G4OA 4KK6D 1P2CB 4FA7B 4BUGA 3V6ZB 3CXDH 2DEWX 4J3XA 3GMRA 4Q8BA 2W9EH 4E9YA 2WM0A 4P59L 1X6LA 1YQVH 5C3LD 4FQXA 1N67A 3P3RA 2BP0B 1IGYB 4P4KC 4U1SB 3UYPB 3V5HB 4ES9A 3CK0L 2R56H 1NMBH 1I3RB 5HGGS 4PU2A 4NNPH 2DJMA 4G9FA 3DHUA 4V1DE 3KR3L 5LBSH 4AQAA 3OR6A 3VGEA 3VWKD 5IJVB 5KUKA 4LEOB 2HUEA 2QLVB 3RILA 3F3HA 3HC4H 4BSVA 1TKWB 1XQ4A 4JPIA 4X80H 1I7ZB 5HDWA 2CRYA 1MIML 3CC1A 5C0GA 1QSFD 3ROLA 1FFPA 4X6EB 3TO4A 2HLAB 3CPUA 4BELD 1ZE3H 3VFTA 1M57B 4QXUL 5E2TH 5B3SB 4GI8A 4I3SL 5E6YA 2ICWB 4LNVA 4QYOA 5LXVA 1QR4A 3B7RL 2AAAA 4URKA 1MIEL 1UXWA 2EC9T 4U6YB 4MA3A 2GBTA 3REWB 1NIEA 3DIDA 2FZ3A 2OJEA 3DOHA 3RKPA 4JLRA 4BZ1H 5DYOA 2MQCA 4AYEC 2XTJE 1I31A 4RMVA 5HYJE 5EEVA 1E2VA 1PY0A 2LQRA 2J1ZA 4G6AC 3BAEH 2HVJB 1G6RB 1AHMA 3KPRE 4BCXA 1KCLA 4G9FD 1CFMA 3HG1B 1T03H 1MF2H 5EO1A 8FABB 2X4SA 2AP2A 5DMIH 4K5MA 2KZBA 3W9DB 2NNXA 1QABA 5CJQL 3MRJA 3NP3A 2Q8BL 5B1BB 3H2PA 1YEKL 3QC6X 1U3YA 3DHJA 1P6FA 5F1NB 1OP5K 2QZ5A 3NZ8A 4GUPB 4H20H 4QRPD 3D3VE 3HAEG 2IANB 2OZ4L 3BQUC 2O6PA 5I73B 3DJ9A 5HHQB 1U3NA 2CJSA 3ZSTA 2OLDA 4WU7B 5HP5A 1GOGA 2WLHA 4WW1A 1RIUH 3MJ8A 1JNHB 4JFHE 4Z77B 4L9DA 3VCLA 2NOYA 1W6LA 3QQDA 3GZPA 4K55A 5KSUA 4PYGA 3VI3F 3WTSA 3LD8B 4ZD3H 1FYTA 5HI5C 4GLRH 3GJFB 1MREH 5LHDA 3LXBA 3O45A 2AEQH 3QHZH 4A38A 3P0YH 4LLMB 2F1BA 5AVUB 1ESOA 2CUHA 4U2YA 1JD9A 1RHHA 4JO3L 7FABH 4PY8J 3TPKA 3QUHA 1B4LA 3C60C 3L08A 4W6XB 4A6YH 3ZKMC 1WH0A 1AGFB 1J8HE 4XC3L 2FJHA 3KBHE 3N04A 4Z95L 3RVWD 4FMKA 4PP2B 2ZXGA 2XN9A 4G9DB 5HGDA 5KSBB 4RETB 3UIZA 1DL7H 2QTVA 5K9QI 1AGEB 3GSNL 2CBQA 5TDNB 3D7PA 3BP4A 5I71B 2X05A 4MAYB 3DX0A 4OLUL 4FZEH 3O11A 4Z3FA 1XAUA 5E8DL 3QCTL 3V52L 4JFEB 1B3JA 1ZHNB 2AV1A 3KM2A 1NGZA 5HXMA 3QJHA 3GBMH 4D8OA 5IVXA 3GSVA 3HVNA 2A9ML 1AR1D 1FQ9C 4GB9A 4MFHA 3MGAA 1I7TA 1DBJL 1JV5B 1Q0XL 3CN0A 1HHGA 2MPAH 3HVDA 4GQPH 1DFXA 3VA2C 4D3CH 4R90L 5I16B 2X4OA 1AY1L 4G7RB 4LAQL 3MV7E 4GMTH 5K69A 4PUBH 3HE7B 5CILL 1NUFA 2Y5EA 3QXUA 3PUCA 2P5EB 3D34A 4WWKC 3CC5B 3IWVA 1MNUL 5FO9A 1JPFA 3QG6A 3BUDA 3U0PA 3DK2A 1T7ZA 3L95A 4ODTH 3CH8A 3FC8A 5EZPA 1DQLL 4Q74A 4XP1H 4X8CA 4B5ZA 2J88L 5AWNH 3RWJA 4P3CH 1IRAY 4B9FA 4S1SL 1JGDA 1BREA 4UF7C 1LWRA 3VYNA 3QEGH 1NUNB 2FX7H 2XN9D 3NEOA 1PZDA 4PHXA 3PWNA 5IMKB 5TPWH 1HNGA 1HSAB 2Z0BA 3SO3B 5KYYA 5JW4R 1KC5L 2YPLA 3C6LB 2H2SC 3QZMA 5F0PB 1V05A 1RSFA 3ARDD 3RVUD 1NBQA 1VDGA 3GIZH 4NENA 5EU6D 3KPLB 5A6MA 1U9KA 1WFJA 3KPSE 4HAFA 5M94B 1T6WA 1PPIA 3HNTH 2QADD 1AC6A 4LCCA 5E51A 1KIPB 3BPLC 4FQHB 4YSQA 2UXGA 2ICCA 4CW1A 3PQYD 2MTAA 4TL4A 1RU9L 4OJFH 5JMOC 1AS8A 3BT2L 3CJJA 4JE0A 2H3XC 2NY0B 1HH9B 2MNUA 4LCUB 1T21B 1S46A 4UINH 2YN5A 1VFUA 4XMWA 4BV1A 4M6OH 3AM8C 3SDCA 5BJTA 1U6AL 3V4VB 1KV7A 4JL1A 2Y9RT 4LRNL 4HWUA 3VXMB 2Y7MA 3DXAD 3P2TA 3ZTNL 4W9HC 5D7SH 1U92A 5LWYL 1WUZA 5I1AA 4OF8A 3U4EA 5GS3A 3BD4A 3GB7B 3MZTA 5C0AA 4TLTA 4UTBA 1OTTD 4S2SB 5DJ2A 4S1QH 2VQ4A 3CSYB 1X5ZA 3F5WB 3JQOB 1FSKC 2WV3A 3Q2WA 4S1RH 4I0PB 4PJFE 4UCFA 1JK9B 3AQDA 5KSAC 2HH0L 4UU9A 1FE8H 5HDLA 3MNVA 2JFCA 3OMNB 3IT8D 3DLQR 1EEUA 3FNKA 3QPXL 3IMVA 3LJ3A 2PYEB 4NHCH 4NQDB 4PGEA 2K7PA 2ZJSH 3ULSA 4F37K 1NGYB 3KG5A 2AEPH 4HAGA 3EFOA 3JWDH 2AJ3B 2WAQA 4FI6A 4MJ5A 5AUMB 4KVNL 5FM8A 5L0QC 4WFHE 2RIKA 5MERA 4KQ4H 4XMUA 4CDGC 1MEXL 2FEEL 4FXGC 4YXKL 4YBLC 1BYNA 1IGJB 2XA3A 2VNCA 1QKZL 4JHZA 2M2DA 1OY3B 1XGTA 4O9HL 4K3GA 1QRNB 3N9GL 2OZ4A 1X4ZA 4N68A 4FXKC 2G2NA 1FCGA 4G7VL 4GG8A 3KLAB 3LRKA 1JF5A 1OW0C 4Q4IA 3IXAB 4R97C 2Y2YA 5C0AD 1P9MC 3DX6B 5ISZA 3A6CL 3ETBJ 3TBWA 3O3DB 4FQ2L 12E8L 5AVXB 4MD5B 4UI2A 5DJCA 4B9YA 4Z7QB 1QUNB 4IBUA 4EDWL 1VZHA 4NLAA 4EKXA 4RBPK 2CR3A 5CHNB 2SODB 1U8QA 2O5XH 4E9VA 4XXDA 1XZ0A 1PKQA 1KT2B 3CH1B 3GMNB 2CMRL 3I6KB 2P43B 3IFLH 3QEHA 4IIQA 4PGDB 1AFVL 4RVBA 5EOCJ 5E4AA 5IBUB 1DTUA 4H88H 4PLNC 3QORC 1YJDH 3IJHA 3VMPA 4C56E 5LAPA 3PNWA 2CJUH 1B6DA 4XP5H 4JFXA 4KROB 5FYLD 3QE5A 4GIPD 1UH4A 1L6XA 3WJJC 4OI9A 3B3IB 3F7KA 2CALA 1ORQA 2VLRD 2QQLH 3DHPA 4R4FH 5GZOD 1OM3H 3GINA 3F6IA 2EE9A 1MCNA 2BRRL 3O41B 3EGXA 3P9LB 3PF2A 2XWDA 4O02B 2GJPA 1AJ7H 2DBLH 3GI9H 1KGIA 3IS0X 4YSAA 4XPFH 1WISA 3U79A 2VOTA 4S0HA 4EI0A 4KZDL 5ISZD 1PX4A 3NIFF 3WFHA 3ULUE 3AC0A 5J11B 2W38A 4Q97A 3ESOA 4HT1L 1BD2D 3AS2A 3EJCA 3CVIL 3IEAA 3LNEA 1H6TA 1MFMA 4JR9H 2AJVL 3WFCH 1GGTA 1CL7H 4P2QA 4ZUTB 2VR5A 4RFEB 5LCVH 4X4MA 5CLXA 3VYOA 1YPZF 2W0KA 3T6WA 4HPHA 5C0RL 1XBDA 3MCKA 4LOUC 3H9ZA 5E2WL 4NQCD 2M26A 4NBZB 4I0KA 3E9TA 3NESA 4N9OB 1IQDB 1V7NL 4RRPM 1UADC 1FJ1B 1QPPA 4XMPL 3W1ZA 4WQOA 4P48A 2F8VA 3D18A 5E8EA 4PBXA 3RRQA 4Q52A 2X87A 2DYPB 2G75A 2UY7B 4OFPA 3TBYB 4CMMB 1T4KA 4IQHA 4R96A 4FABH 3PREA 1U2YA 1DJGA 1A3LH 5E8NA 5B3JF 1YYMH 4FQCH 5I6LA 2A0LC 1RHFA 1XAKA 4UDTB 2X4PB 4PW3A 2WVSA 1NWPA 1NH6A 3SKNA 5J56B 3QIUA 1DQDH 2BS8A 3MRCA 4GKSA 1N5AA 3DRTA 3UTTD 4ALAH 1L0XA 1BG1A 4B41A 4IYKA 5C8JB 2BLFA 5E2UH 1RI8A 1YMME 3CE1A 2R15A 5SWZD 4CNIA 3MR9A 1HHJB 3TVMB 3W82A 3FT3A 2HVKA 3TFKD 1TJIL 4OZ4A 1KYFA 3D4GA 3HI5H 3LNFA 2XIDA 4JNXA 2YAPA 1CIUA 4BHUA 3BQVA 3ES6A 2VDLL 4NUGH 2EXSA 2WVVA 4A2LA 3QDAA 1D5RA 5EU5A 4N2IA 3RPBA 1M6OB 4KTYA 3W2DH 5C97A 3S88H 1HQRA 2VMDA 4K9EH 2J8UF 3ZKXC 1LXMA 4ZQKB 5DRWA 4MCZA 1E5ZA 1KXQA 1RMFL 4OZHE 5G4NA 4P3WA 5D1QD 5IBUG 3L48A 1UQSB 4BFJA 1M3JA 5AQ0A 1OAYH 3CQPA 1CF8L 3KCPA 3Q6FA 1NM4A 5DEZA 1CYWA 3QJFB 1C08B 4W6YB 1A6PA 4WCYH 4PJ5B 4N9GB 4GSQA 4NKDB 1JUFB 2SEBB 4POYA 3O6KH 5IFAL 1F2QA 5AYUL 1ZVSB 4WGKA 5D2NA 3I75A 4B9GA 3DVGA 4J27A 1NCUA 3LZQA 4GUCA 3KPQB 2EVFA 1DJXA 1ID2A 2KHAA 1FUNA 1SEQH 3JWOH 3BSZL 3WGUB 2MSPA 3SKMA 4Y1SA 1QX1A 1EZSA 3VB9A 4LP4A 3ML8A 2VC2L 5L2KB 1KUMA 5LXGL 2C4FT 2DJ4A 2DH3A 3ZQXA 2C3XA 5IBLD 1WFNA 3MRHB 3BZFB 4XCCL 2CBPA 4M9PA 3UO1L 3FK3A 1I53A 2LGNA 1QLEH 4WTZA 3HB3C 3NABL 2GSIA 2GTZB 1KGYE 1E4WL 5DUPH 4PJEE 1ZS8A 1TLKA 1OE3A 4GXUN 3AW5A 1URLA 2ZWNA 4QY8B 3WIAA 4PJIA 5F9OL 4F80A 3G04B 3DETD 5C08D 2GHZA 4QCIA 2RMNA 3U46A 4ILDA 3QPQC 4MQTB 5KVMC 3POHA 4PWJA 1KIQB 5FA4B 4RH4A 3SCMC 1KG0B 4YSDA 1L9SA 2XHNA 2YD3A 4NSKB 5T5NG 3QIWB 1YPZB 3ELQA 3TH4T 3SQBA 3O0RH 5T3ZH 3E3QE 3GQFA 2VLKE 4HKXB 3H4HA 1ZA3A 5FUZH 4HS3A 3WY4A 1A7PH 5FM4A 5AW7B 1TTUA 1AD0A 3KLQA 3U82B 2ITDB 4M48H 2NX5B 2VABB 4FG0A 6FABH 1IVLA 5I2IA 3MBED 2FYYB 4ZOAA 2BXZA 3BEVA 3BO8A 4DF9A 1IGCH 3IBEA 4U33A 5I8OL 3DUHA 1A1NA 1EUTA 2LW3A 3DPBB 3EH2A 4H1LH 4PW9A 2IAMB 4QHKJ 5I1KH 5HHOA 3F8UB 4ZXBA 1AACA 3DTXA 3RY4A 4X9IA 1TPXC 2BNRE 2JKWA 3BYTA 3EDFA 3EOYG 4L8SA 4D0DA 4UV4H 3SDDC 3O9WA 1WPCA 1TQCC 4XCFH 5F3HA 4B9PA 4M1CD 4Y1TA 2OFQA 5F3FA 3STLB 4A6YB 4E9XA 4LARH 4LF3A 2E75C 3MOQA 4Y88A 1NMCC 2YEZB 3UJTH 1J8KA 4JFOB 1JCVA 1NFIA 2A38A 5KVEL 2V8LA 1M56B 1JN6A 4HUWA 2UZIL 3KPPA 3EOAA 3O8XC 5HHXH 4N2BA 1I75A 5BOZG 1D5XB 4DQOL 3PWUA 2RJMA 4FCHA 2PPCA 4ZFOB 3VRLF 3RNKB 3T77A 1YSOA 3LKNB 1ZLVH 1D9KD 3K5SA 5C0NC 4GKNA 4Y1AA 1I1AA 5E94B 5FFOA 2Z8SA 5E1AB 2J8UB 4R26H 2A6IA 5EBWB 3OLGA 1JGLH 4OLXL 4DGIL 3DBXB 1AR2A 4RAHA 2DLGA 5DURD 3FO9B 3NEXA 4X8XA 1EAPA 1S9KC 3BVNA 3RGVB 1IL1A 4JDZA 5FO8A 3GSQA 4PJXE 1Q9LA 3LS4L 5CMAA 4AM0B 1BQHB 1ND0B 4BE5A 2WPGA 4UTAL 4DP0X 3O9WD 3NSXA 2DQEL 1XF1A 1JF1B 3QZPA 1GY2A 4KHTH 4Q6YA 2WQVA 3QUZC 5LAXB 3OB8A 2I5YH 1DLFH 3D39E 3OAWA 4LBAA 5CP3A 1MCRA 2F68X 2P42B 3MYZA 4KGLA 4EXKA 3M45A 1CD1A 4GAGH 5G55A 4YX2L 4HPOH 1E3ZA 3FQTA 4WI2A 3DBSA 5K9JL 2C7UA 5IB3B 3D6GA 4KXZH 4XE5B 1HDMA 4CVXA 5FUOH 3SQRA 5A3ID 3TCLA 1I1AD 4N8VG 3IU3B 3X1BA 2D7QA 3T3MB 4YMPA 3LV3A 3MDJA 3P11L 4EPSA 1RK7A 1KULA 4MMXC 1A2YB 2GQHA 2IOMA 1EDHA 3VFPB 4H25B 1A47A 3R4DA 1F4WL 3AITA 4PJBA 4QHKI 2X10A 3NCYS 5ICZA 1NLDL 5GRWA 1DVTA 3I3BA 4X4KA 2VW4A 1BDYA 1U58A 1U8MA 1OHQA 2XWCA 1T2XA 4GQZA 2DQDL 3KPNA 1JFHA 2DQMA 3ZDZB 5SV4A 2YSSA 4HCFA 3JT2A 5EEUA 5CGMA 1Q94B 1QSEA 4KK9C 4M5ZL 5DMYA 1OVZA 3BSZA 4FFYH 4JO4H 5D2LE 5E8OB 1PTZA 1JZGA 3AUVA 3DGDA 4XOEA 4PD4K 4TNFA 1O7DC 2CO6B 1B4JH 3ZDWA 1FORL 3D87B 2B9BA 4YHKL 1N3NB 4KKBD 3HUJA 2V3FA 2UXTA 4AL8C 3ALXA 4ZW6A 3M6DA 1A64A 1DDHA 3OQ3B 2ADYA 3F12B 4LFHD 2BFGA 5LGYA 1SM3L 3S48A 1OOWA 3FTYA 4PS3A 2XYBA 3MRQB 2VQUA 2V7NA 4PTUB 4XVJH 1GC1C 3PE9A 1N7MH 1NMAL 2NY4C 3GXTA 5EV7A 2CBTA 4LEXH 3VXRA 4AY0A 5FECA 1A14H 2Z8VC 1JGUL 1BPVA 1MVUA 4JQIH 3WCYA 2HA1A 1FVCB 2JB6B 2V7HA 3KLDA 4PWIA 3QUKB 3ARED 5G2NA 3FCGA 4X7EC 1AZVA 4XNMA 1F4HA 1BGXL 1MQKH 1ORSA 3IMRA 2I07B 5K39A 4X7TB 4NC1C 3PGCB 1MHPH 1WICA 1AQDA 3BGFB 1MRDH 3I85A 4GAYB 4U1NA 3EH3B 2HLEB 4XP6H 5I18L 3ZT5A 4OIIH 4PCSA 3AVEA 4ZODA 1A7BA 3EH4B 1U3HB 4U3CA 3WFEL 1BJMA 2Z64C 2H26B 4HIQA 4R5XA 2BVOA 4RAVB 1L3WA 4QAMB 4XPHL 1BVKB 4LKCB 3N2JA 1OSPH 2EIKB 3CX5K 4NZTH 4QHPA 5IEHA 4PB9H 5F9AC 3VU1A 4NLHA 1A9EA 1X5IA 2DRUA 4N2GA 3MNDA 3QUML 1NC2B 3RFZB 3ABGA 4JFYB 3OKYA 1S7TA 1XF4B 3QQ3A 4YBHA 2FQFA 3O6FA 2VQTA 4IRSA 4JREC 3VGFA 1K8IA 4TS6A 1J10A 2EH8H 1JFQL 2WLZA 4V1DA 1N6QL 3HS9A 1IO4C 1INDL 2OL3B 1QA9B 1ROWA 3F6JA 5D7LE 3U6RB 4M7LL 2KMWA 2X89A 4BSWA 3RPIA 4BQ9A 5A2FA 4P23B 1HOCB 1QMUA 5MI0B 3L5WA 2CO1A 3EUUA 2L8AA 4GMSH 4KJPC 4M6ML 4JKPH 4OZFB 1RUKH 3WEXB 1UH3A 2PO6D 1YN6B 4FTDA 1QWUA 4Z3JA 2FIKB 1XT5A 3EO0B 1CB4A 5IOPA 1UG9A 2OMZB 1MPAH 2HWZH 3RDTD 4AV0A 4ZYKA 4DKAA 2H1PH 1MCCA 1C7TA 1AE6L 5I66B 1A65A 4UM8A 4AG4H 4I2XB 1CXLA 2V9QA 5CGYC 4X4YB 5ITFA 1QACA 5CBEB 4UTAA 1KCBA 4KKRA 3SDXB 1GHFH 3C2SA 3WAJA 1C5BH 1DQJB 4H8WH 1GZQB 4KKPA 3CFEA 4HUVA 3KPRA 4L8CA 3AAZA 3GHEL 4YFLF 2ZXAA 3B9AA 3S5YA 2GAZA 3P0VL 4F7KA 4K3EL 7PAZA 5AW8B 3KW8A 2OXGB 2Q86B 3SY0B 3P0GB 3ARBD 4N20A 5FA3A 3KJ6L 3HS0B 2EVHA 4DP8X 1TDQA 4HCRA 1QI5A 1Q0YH 2YFOA 1GZPB 4OGYL 1ZLSL 4Y4HD 3K46A 1PCXA 4KY2A 2YAHA 1B90A 2YQGA 3D3VA 2DBJA 3AZUA 4AXWA 3M46A 4Y9BA 3FO2A 3LN4B 2W0PA 3PHQA 3NGBB 2ZXQA 2LTQB 5D1ZI 3VFVA 1KEMH 1ADWA 3ZIMA 1BQSA 1J5OL 3HMXH 4RZKA 7PCYA 4DWHA 4ETQA 5GS1B 5KS9E 4UQ2A 2WTRA 2ZP0T 1R24B 4JJHA 1WGOA 4A63A 2F53D 5GJTH 3DRQB 2BSRB 3GMMB 5DMGC 1OXYA 2QJDA 3AXLA 2XTJD 1N2RB 3MXVH 4GQ9H 1FN4A 1XBRA 4DN3L 4BH7B 4D0BA 1RK0A 3PXHA 4NO3B 1WD8A 5DK2A 5I30H 2HT4C 1WBZA 4OVUA 3GJFK 5D1ZC 5HGAA 1J8HA 2X2JA 3VJ6A 2WVTA 4MHHI 1B2WH 4K8RL 5ITBL 1LMIA 2V3EA 3HPJB 1FO0H 4H26B 1PJWA 4X5XB 3UL4A 1DQML 2W07B 5HHNA 3V8CA 4HJJH 5E6UB 4APXA 1ML0A 1JPSH 4FA6A 2F1AA 3CDZB 3D3VD 4KJQD 3X17A 5FYJD 3K0WA 3BMVA 2NZ9D 1UCBH 2CA4A 1W9XA 2IQ9L 3R06B 5KVEH 3PAYA 4BRJA 2X4NB 2A74A 3KYMB 3T8MA 4OZFG 1TZIB 3ULUL 1TO5A 1EGJL 3II3A 4JCWA 4M1GH 2YKLL 4KDTA 1K85A 1E4JA 1W80A 2GABA 3LKSA 1UOLA 3GJEB 5AAMC 4DGVL 4TTGA 3MV7A 1KCUH 5I76A 1T20A 3BVVA 3ZRCC 4QHMB 4XCEA 3V2AR 2DDQL 3L1EA 2H1LM 2IPTL 3BPOC 1NFAA 3L6FA 3UTQB 3G6AA 2DL2A 3QNYA 1F45A 2HT3C 5CUSH 1PZBA 1FC2D 5IB4B 2BO0A 4KRLB 1AC0A 3IBOA 1QLEB 1NC4A 5CKAA 4KQ3H 4QRSB 2F7OA 4G1EA 1XDTT 3MOBL 2ZKYA 1HZHL 2ZOUA 3QYMA 1ZA6B 3NCYP 3MJGX 4U0RB 4JFDB 2ALAA 4Y5XB 3LHPL 2E27L 4HEPG 2E4TA 3JWNH 3TA3B 3KPSA 5BZXA 2JCCF 1SDDA 4PJDB 3QCUH 5DZVA 1ES0A 5BMFH 2EKSA 1FZKA 4MJIA 2P80D 2WWKO 5ICYA 4JDTH 2IXQA 2K1MA 3V9FA 3G5XA 4WI9A 4X7DC 2GT9B 1E8YA 3OHMB 2R2BA 3QDGD 3FB7A 4DIXA 5E9DB 3HE6B 4F57L 2LFEA 3ARGD 4ZFZB 3L3HA 4LASL 3CZLA 3MV8E 5F7FA 3WGVB 3RL1B 3I6LE 3T6QC 3QK0A 1IM9A 2FWOB 4JFTA 1E2WA 5DF0A 1G43A 5CCGE 3ZX1A 4AVJA 1EHKB 1L0QA 2HJLA 3ZT7A 3MRPB 3QUYC 1L9OA 4W81A 5GRXG 5DD5L 1KIRB 4FOMA 5DQ9A 2VJXA 4N5ED 1DBBL 3OKLB 4NQXB 2R2HB 3D4ZA 3FU3A 5TF1L 4JFQB 3LS5L 2F54B 2H6UA 4JFZL 3FUEA 3WNLA 2X6CA 1ZGLB 4NN7C 1RAMA 4MZ2A 4AKPA 5ILTH 2CU9A 5I19H 4WJ5A 4PJFA 4F7EB 4TOYH 1DUZB 1B0IA 2XWZA 1VFMA 4Q9BA 3ISWA 3HRPA 1WIPA 2XWTB 1P7BA 4Y2DB 1W0WA 1HHHB 1S7VA 5F88B 4MJID 3MRNA 4NQQA 4MXWH 3X3FL 4QRRB 1AHWC 3L5XL 1FFNB 3QWRA 2WZPA 4KZEH 3U2IA 4TSCH 3C6SA 1S3RA 3G6JE 4TNVK 2EYSA 3MA9H 3NSCA 3WEBA 2AKRB 3DYMA 2VZTA 5T1DL 1AP2A 3GGWA 4RIRA 3CGTA 3LRLA 5D4HA 4E36A 4PRNA 1DVFA 4OUOA 1WBXA 1IAIH 3EO1B 4LPCA 3IJSA 4YHOH 3RVTD 1LNUB 2P8MA 2E4FA 2FIRT 5F7DB 3SIKA 1T22B 1EO8L 1JZ8A 2AQTA 5JUEL 3SE3C 3WDJA 2W0FA 2H9GA 4IEFB 3H9SE 3D0VB 2M8XA 3Q5OA 1IC7L 3OJDA 2WCGA 4OFYA 4WWPA 2G2RB 4BZ2H 5T1LB 4QMEA 2WSDA 4G83A 1S8DB 2MOQA 1Y7VA 3SJVE 3TN0D 2EZ0D 3E2HB 3K2KA 4HK0B 4L8BA 4PGZA 3ZDXE 1JPTL 1Z9OA 4Y4KA 4CN6A 1NEZB 1H0DB 5TDOB 3QWRD 1O6SB 4MXQC 3O81A 4AIXA 4WEBH 4FFWC 2OMTB 3PV6B 4C56A 3HG4A 1SLUA 2BIQA 4XODA 3D2TA 4BFKA 2DWEA 2VZUA 3N0PB 3QNZA 4WFHD 4YNYB 3DK0A 4R84A 1SY6L 4JY6A 1DVFD 5DK0A 5BS0D 4XH2A 4KUZL 1E5BA 3TBTB 2H3NA 1LO3H 2YGQA 3HHSB 3RFRA 4MMYB 3ECVA 1E6OH 4NUMA 5KBKA 3GXPA 4CVUA 4Q9RH 5I6NA 2Z35B 2GCYB 1KB5H 1I9JH 5J6GB 2QGBA 4Z6AT 3QRFM 2YPKB 1JHTB 3EJYD 4M4PA 4HX1B 3LTVA 1C5CL 1EGJA 3FAWA 3TIDA 2BMKB 4OFYD 3TWYA 1Q9OA 1ZHKB 1QLRB 4AM0Q 2GBAA 3MBXH 3QS2A 1RVFH 3W56A 4DZBB 4F7TB 1I8IB 3FUJA 3DO7A 3TJEL 5SX4H 4TQEH 4GEIA 1LO0L 1F1AA 1V7MH 4O2EA 3U36A 3T08A 2BNQE 3QIBC 3ESNA 3FFCE 3PJSB 5BRZE 4MVBD 1TYRA 5CSZA 4C56D 4K8RD 4XTRD 5EBMA 3EYUH 2FECI 2A9NL 1R5VA 1J0ZA 1UA6L 2WSKA 5CEYB 2ERJB 4DO4A 1GMEA 4KKAC 3VFRA 3VXPA 4R9HA 4WSGA 3TURA 3MLTB 3WE6A 2VXSH 4YVUA 4ELDA 5FGSA 3N1MC 5JQHC 1IC5H 4JHBA 1S7UA 2EYTB 3GRGA 1H15B 1U2HA 3FKUS 4WHDA 5A43C 4ZX3A 5EO0A 3WKQA 3ZOAA 4YDKH 2BRQA 1EJ6A 1BVLA 3MODL 4K94H 2BP8A 4B9KC 5E9AA 1PDKA 1T89A 3WXVL 1IUZA 1Z3RA 3DOSB 1HL8A 5EHFA 1OAZH 2WXJA 2ZCHL 2PPFA 3C5ZD 3DROB 1YMMA 3CIAA 5HPMA 4NC2B 3MV9B 4ODHL 2CGZA 2XZCH 4KDWA 5DMJB 1XH0A 4IW4C 2Y24A 4DN4L 1NPNA 2K4AA 3MLXL 3HS8A 3TLRA 5JLZA 1JVLA 3MROA 4OCMC 4L8DA 4OJEH 3D0LB 4JZNA 3G7TA 3S3CB 1JGEB 4X6CB 4AGLA 3F7LA 4NZUL 4UILH 4ZFFA 4KVCL 4NKOB 2P52A 3O3AB 4QTIL 2IWEA 4ETYA 4L0PB 3BI9X 3BZ4B 1RUQH 2LU5A 4LCIH 3GSUB 2C1OA 4OZHA 4QOKE 1OSYA 2X9WA 1RIVH 4O4YL 1CGXA 4N2LA 2OJZH 3SKOA 4DPBX 4E5XA 3TPUA 2NRDA 4EQ3A 2V5RA 1Z0MA 1KJ2L 3OXSA 4NP4L 4ORGA 3CN1A 3H3BC 4HAKA 3MX0B 1XCQB 3OQRA 1K2DA 4MDIB 4P07A 5EUKA 4UT6H 4X2UA 1NIDA 4L5FL 3RYMA 2AEIT 1F11B 4ODVL 1KELH 4LB8A 2WNWA 3HCVA 1DQTA 4B7LA 1FGNL 5I5IA 1RZPA 2R39A 2MTPA 4DP2X 2J6EH 4E9WA 1NANH 5DD6B 1NL0L 1FP5A 3IF1B 1AGBA 4PAZA 3B7TA 3ZE2F 1IBDA 1CXKA 2AK4D 3OAUH 4RFNC 5CZXD 1E5YA 2GITA 4Z3IA 3BP7B 2VDNB 2J20A 1NIFA 5C0JA 4ONFH 5D72H 3V6OC 4QLWA 2QVTA 1R47A 4LDOB 4N8CL 4XBGA 1BIIA 4IGBD 3MV11 2FR4A 4LMQI 1C5DB 2X4UA 2YRLA 2YHGA 2OMVA 3JV6A 5DJDB 4Z7VB 1OPGH 2OTUB 3SGDH 4TNWK 1DO6A 1Z9SA 1RZJH 4Q9QH 2OMWA 2DYRB 2XT1B 5EOTB 1NDTA 3ZKQD 1RZGA 4G8EA 1GIGH 3AWFA 4AEFA 5INCA 1GW0A 3TBBA 1HZLA 2UY6B 2WN3A 3QB7C 1U0QA 1DHKA 3WKMH 5IROD 5DGQA 2VLKA 5DC2A 5IB5A 4G2AA 3GIVB 4MB4A 4GPVA 5F96L 2R7EB 2JIXA 5DEGA 3Q1EA 3F01A 4PGBB 2WBJB 1ZEAH 2BH0A 1JNJA 2NY2C 1JPST 4PD4J 4OF6A 1AYOA 2KL6A 1TR7A 2A9CA 2Z31C 3MCLL 2DKSA 5FYJU 5MP6H 1V3JA 3V4PL 4LVOB 3WHE0 1R46A 1TSHA 3MGOA 2ZWYA 3TU6A 2X9XA 1FVEA 4GAAA 4XNBA 3Q0HA 2IH3A 4FRWA 2AXGA 1IE4A 4AGPA 1INQA 5GZNA 4PRHE 5F6HJ 2I26N 1HSBA 3OKNA 3P9MA 1O7DE 4MMZC 4KTDH 5JDSA 1JHKH 2BNRA 3GM8A 3E6HA 2PR4L 1W72L 2OI9B 4O2FB 4TQPA 5JMRA 1DP0A 4I9XA 5FM5M 4CSPA 1SBBA 5IMMA 3PAUA 1ZANH 5HYQA 3KYKH 1SLVA 2FT8A 2WXRA 3WTTA 2R1YA 4LLVB 4HK3J 1DN2A 3OHXA 3OKKA 4HW6A 4JG1L 4JM2B 4KX9A 3SDAA 1WWAX 3KGUA 2X3AA 2J1XA 1KJMA 3BAIA 3VXUD 2VLKD 3BKMH 3Q43A 4WHTB 5F1IA 2VKWA 1WZ1H 1G9HA 4UQDA 2FBOJ 4XP9H 5I8CA 3FN0H 3H3PH 2V8MA 2Y6SD 1XH2A 3M17A 3T0ED 5IHUL 4PCYA 2BSTB 1RV6X 4WEEA 1JERA 4NC1E 4NQEB 2PXYD 1XH3B 3D09A 1H19A 4CL7A 1SXSA 2VDRH 5DRZA 2B2XH 2EADA 3A23A 3R19A 4AEHH 1C9SA 1HYSD 2VQ1B 3HW7A 2GVYA 1Y18A 3L7FA 1SXCA 5EZLA 3MRBB 5D5MF 3CX5J 3D8MA 4PJXA 3MLZH 1I9RL 1EAOA 2VDPH 2HKHH 5IQ7L 5DMKA 1MFDH 1YEJH 3L4VA 4PV8B 1YCSA 3AG1B 2YBRA 3QSKB 2ZPKH 4L9LB 4XBPA 2FHFA 3NZSA 1A6UH 3ULVC 1QSVA 4YXLL 5F7EL 3K7UA 5B8CB 1IIIA 1S7WB 1E9OA 4OZIB 3D39A 2ZICA 2JXMB 2R0WH 3L17A 4JDVA 4WHCA 2OPCA 2GIMA 3KBFA 4PJGE 1IAKA 1TJMA 3BKCL 3ZYZA 5D6CB 4ZS7H 2DWDA 4KUCF 5FHAH 1XTLA 4X7SH 5E00B 1YA5A 1TETH 3UBXA 3X12B 3IDGA 2ATKB 4Y0GA 5FS5A 2LVEA 3QNFA 1M7UA 2TSBA 1ADQH 1NCAH 1EJOL 2Z91B 3WNPA 3V10A 1L9RA 5ACZB 2EDJA 1B9ZA 1X5MA 1CFQA 2GTQA 4KX7A 4P9HC 3WMSA 1N19A 2NSMA 4PRAB 5ANHA 4Z0XB 2WTPA 4IRZH 1GKOA 4OV5A 1MWAB 1WUNT 4L4TA 5BUGA 3CXFA 3WHXA 3GMOB 1BBJB 4E9TA 4FTVD 4K3DL 5FB8A 1QFUH 3U7YL 3MACL 4GJTB 5G5DA 2ICWJ 1NBVH 2OSWA 1HS6A 3VD7A 1R3KB 5BZWB 4ZDHA 1DBMH 1VPOL 2FSEA 2UV3A 5D2LA 2R1WA 3NSFA 2Y36L 3QDMD 2LLLA 3S34H 2E46A 2WNKA 3CVHH 5IMOB 2AEWA 1R0AL 4FNTA 3ILEA 2N1KA 1FL6B 1J87A 4U7KA 3EBAA 4GW5A 2BIOA 4OFDA 3K2UH 4E41E 1E4XH 1S9WB 5D7EA 3F7VB 3S5LG 3D85B 3FQWA 4K73A 3W57A 1CDGA 1MI5B 3RTQD 1P5VA 3U1SH 2P44B 5BXFA 4GG6E 3VTTA 4HWNA 3VTAA 5E5MB 1TQUA 3V5KA 1WCQA 4PSRA 2EYRA 2OKMA 4UZGA 3RUGB 3U83A 1PBYA 2G9HA 2PCXA 4NEHB 4XZUA 4QJ3B 1XIWB 4L4TD 1AAJA 3BQUA 1W8OA 1WRFA 2ZUTA 4ZQTA 1Q9WA 4HLEA 3OKEB 3X3GL 4I18C 2WQAA 2P28B 4NGHH 4P59H 4PH8A 3SE4C 3MRKA 5HHMB 4JPKL 4E68A 1YN7A 1Z9MA 4KXDA 4R4BA 5CP7B 2YWYA 4AVKA 1KCVH 1IGTA 3CK0H 1RP8A 3F85A 3NFPB 3V5DA 3VDCA 3V4PA 1OV8A 3ZYJA 1MW1A 3JTTB 1HKFA 4F2ME 4HHAA 2X44D 3KR3H 1RZ7H 3CDFA 4A7GF 5H4ZA 4AW7A 2A6KA 4N22A 4F93B 2ZG3A 3K6IA 3GTVA 4G6AD 1UJ3C 5T5FL 3FQXA 1OL0A 1ZS2A 2YC1A 4MXVF 4RSYA 1CI5A 3LKOA 1SQ2N 5FV2A 5HJ3A 5DHMC 1MIMH 3C60A 4UNUA 3T2OA 2IGFL 2HFEB 3IFOA 5EZOH 4DZ8B 4NQUA 1TTGA 3WUWA 1H8OA 4U3HA 5I26A 2OA9A 1W72A 2DTSA 2G9KA 1MCEA 2HLFC 2NW3A 5D5MB 1VB9A 4ZK8A 1W0VA 4OM0L 4QXUH 5JXAL 4I3SH 5E6ID 1WYJA 5AZEL 2EXTA 4OH2A 2UVFA 4PJ8C 1MIEH 2CH8A 5FYKD 1BF8A 3CMOL 3RURA 4HEME 2D8KA 2QHLA 2ICWI 5GQBA 4EO5A 4UM9B 4DOHB 3QXAB 1HOEA 3S2CA 1T5WB 1O9VA 1T80A 1KB5B 3ARRA 4NO2B 5AW3B 2XN0A 3CNKA 4EDXB 2ZKHL 3PRZA 2JTYA 4G70B 5HI5D 4WWKA 1NPJA 2HJFA 2FWUA 5D7JC 5FGCE 5FYLH 5C0IA 5CJQH 4F8NA 1LE9B 3WNJA 2Q8BH 4JUSA 1YEKH 1OLLA 5CD5C 4NO5B 1LO5B 5CCKL 5J12C 3APCA 1IU1A 4OJAA 4GXUM 3SD5A 1KTBA 4APQA 3WDHA 2OZ4H 4WUUE 4AZUA 1JYXA 2X6VA 1PZUB 2XU9A 5L8JB 4PIBA 1NGXB 1MFEL 5JPMB 5IW6A 4NOFA 2WINA 2GEQA 5DR5H 3KHOA 5D55A 1E9PA 2VR9A 1OSZA 3EBHA 4LLWA 5ABAA 4I77L 4KITB 3L4UA 4KY1H 1KY6A 1HHIB 1AZZC 4L3EB 3LRSA 2NY5C 2QELA 3ISRA 4IMLA 1F6AA 9CGTA 1SXBA 4AI7A 4F33A 4JO3H 4HWEL 1N10A 2J8OA 1PYWA 3LNGA 5K1VA 1F13A 3U0TA 3UH8A 3HBGA 1S9YA 4Z95H 5C0EA 4TNGA 5I73C 4WV1B 5TE7L 4U1IA 3QO0A 2WQWA 5CFAA 3AM8A 5J57B 4BWWA 4YS4A 2ICEC 3GSNH 1MFAL 1KNOA 4PTTB 3L2MA 1EZUA 5KS9A 4OLUH 1EFXA 3LQAL 4M8QB 2XJKA 1ZVNA 3QCTH 3L3OA 4APQD 1E4KC 2EO7A 2GSMB 5EF2A 1RZQA 4EZLA 3BPNB 1UA3A 4M8UA 2OK0L 4HJIA 4HUCA 3IYLW 5ID1A 1LE5B 2A9MH 2ZX8A 2ZAIA 4G8GE 5TF1H 1DBJH 1Q0XH 1T6VN 4P46C 1PJ9A 1CICA 2EDXA 1JPEA 4JQXC 2WLIA 1AY1H 4LAQH 1I8AA 1IFRA 4CKVX 2I9LA 3Q2CA 4G6JL 5DZLA 2NR6D 2YAOA 3BUYB 1MNUH 2EQDA 3T4YA 3RL2A 3VI4B 1TU2A 1G9NC 5J3HC 2WLJA 1DQLH 4LHUA 1WIUA 3O3EA 5E5LA 3QFDB 1I85C 2J88H 4MAYC 2DQTL 4C83B 3MNZB 2JV6A 1URIA 2DIAA 4ODXA 3EYVA 4FXGA 1UUNA 1T5XA 4WAFA 2H6PB 1KC5H 4EIBA 2P4AB 4AMKL 2C3VA 2XG5A 3U9WA 1JDCA 1G7LB 2EXYD 3QULB 1Q38A 2FAUA 4XC1L 1P84K 4EBQL 1U8PA 4FXKA 4Q6IC 2UWEE 4OGAC 4PJ7E 5ECGA 3NIDE 3OAYH 4EN3D 4X7FC 4QHLB 1OW0A 3JVGC 2NNAA 1A6ZA 5TDPA 3JV4B 2W59A 3JUYA 1RP9A 2HP4A 1P9MA 1IB5A 1LK2A 2N4IA 1S7SA 5I1LA 1WITA 4XAWL 3ROOB 5DCCA 4WWNA 1KXVC 1T5KA 3MRRA 4NQVB 4R8WL 5E8PA 3W5MA 1RU9H 3P73A 5AW2B 1HEZB 3BT2H 1CICD 2KZ1B 5D96B 1NPUA 3TP4A 2ADGA 4Q2ZB 2HRHA 1QSFB 1Y1DA 1N8OE 5FHBL 5JHBA 3CZFA 3ZQWA 1U6AH 1CDUA 2HTKC 3V0JA 4EUPA 3UTSA 2OMUB 4FNQA 3SO3C 2Y1AA 2PW1B 3C6LC 3DVNA 4LHUD 3P69A 5GGSA 4AMWA 1H9VA 5FC9A 1P7QA 5EZIL 3ZTNH 5LWYH 4FLRA 3KEHA 2RA1A 4YIQB 1UWYA 5IJBC 3DIFA 3AG2B 4A68A 1KJ3L 1ZD6A 3WFBH 5EO9A 1TITA 2OW7A 1D5ZA 4JRXD 2VITA 1HCFX 4A2GA 4PRDA 3WJLA 1XV8A 1RXLA 4QTHA 4X9YA 3MV8A 4U1LA 2ETWA 3S4SA 1ACCA 1T0NA 2J57A 4G9FB 2MQ0A 2C9QA 2FGWL 1U30A 4AQAB 1BZQK 3OR6B 3QPXH 3WJMA 4RDQF 1PL3A 4O02L 5IHLB 5IG7A 4JPIB 4C8XA 1SJHB 3BH4A 3QH3A 1D7FA 1LJMA 3DX4A 3GLDA 3WLBA 3WTVA 1QYGL 3COOA 3BAKA 3ISYA 4JFFE 1ZLUK 4KVNH 5C0GB 3ROLB 5DI8A 1FFPB 4JDEA 1VF5C 1MEXH 32C2A 4YXKH 5E1HB 5FDWA 3BE1H 4OLZH 3UTSD 1QKZH 1JCKA 1OZUA 2ROXA 1VADA 2J12B 4O9HH 5DLLA 3N9GH 2JJSC 3S97C 4QYOB 1NCIA 4G7VH 2VMJA 1HVXA 3BHBA 4MA3B 2MFNA 3RJOA 2OW6A 1DLHB 3VXSA 3MQIA 2FZ3B 5D7KE 2KLTA 1S78C 4NRZA 1A7QL 4L37A 4JLRB 12E8H 4XVUC 5DYOB 5M7QA 1NBZA 4NJAL 1ZPLA 3FT2A 1UGNA 3B5TA 5KVGE 4MA1B 1PU0A 3FSZA 1BAWA 4HG4K 2DMHA 3G6JA 5GSVB 1HK6A 5GGRA 2FT7A 1NBYB 2BVYA 3NJVA 5EEYA 4AMXA 2NQDA 2X42A 3PL6D 5ALBL 2CMRH 2VB5A 4Y5VC 4BWTA 2VDRB 1AFVH 5AG8A 4JFED 2EUWA 2Q3XA 3H9HA 5EO1B 2X4SB 3NA4A 4BQCA 3ASWA 3RE0A 5DZPA 1NAML 3VMOA 2APFA 3NZ8B 2VDPB 5I6OA 3H9SA 1PZ3A 3FCTA 4ELME 1TQBB 1CK0L 4HYTB 5KVDH 1UYWL 3IGLA 4YXHH 5EOCH 1UWXH 1F3JB 3HE7D 5G4MA 2BRRH 4WW1B 3SDYL 5IMLA 3MJ8B 3IJEA 2FEDC 1HN1A 3ARSA 3VCLB 3KLHC 4AQOA 3JYCA 1OGAD 2KZKA 5ERWA 4TVPL 3FCBA 3VXSD 1WBYA 1FYTB 1Z6JT 5D7IE 3S8FB 1U8NB 3IMWA 4IHOA 4XZ4A 2KQMA 2VISA 3WNNA 1DVQA 3PJLA 4TRPL 3O45B 4WENB 4HT1H 3IMBA 3CVIH 2A0LD 3VTMA 1HE8A 2BSCA 1RHHB 2ZSWB 1EEZA 5L88L 2AJVH 4HZLA 3T9WA 2DQIL 1DVUA 4A7TA 4N26A 3UFIA 4L1BA 5C0RH 2MWCA 2GI0A 2FJHB 4F1ZA 5E2WH 4AKOA 5C09E 2AJUL 3DMMC 2XN9B 3H54A 3ULAB 4ZSOB 1CD8A 4FULA 3WG7B 3B7UX 1V7NH 3LB6D 4Y2OB 1DJSA 3BP4B 3PP3H 4AV5A 1E90A 4XMPH 2R4RL 3ARDB 4MDJB 5ESVA 3O11B 5EU6B 4FEIA 3NRPA 2FX8L 5GRVL 3EIFA 2AV1B 3KM1A 3QJHB 2AQPA 3BP5A 1IC1A 2ARJA 2O6DA 3R1GL 3V6OE 3B4NA 5J11C 4F1SA 4MX7A 2WQSA 3EOTL 4OLYL 4C57C 1B0GA 1Q1JL 1KDIA 4AL8L 5EU3A 2AXHA 4GKZA 2X4OB 4CDHA 4M61A 1O5PA 2H47C 5FO9B 4TUOA 5EIVA 2BNQA 4XMXA 3QG6B 5SWSE 3U0PB 4UB0L 5BW7C 3L95B 2ZUQB 3FFCA 5BRZA 2UX6A 1F97A 4P3DA 4YL4A 5IQ9A 2HTLD 3NN8A 4CMHC 3OF6D 1AS7A 3RWJB 2JJUA 4KKQA 4Y9GA 4I0PD 1TJIH 3I9GH 1JGDB 2BP3A 1H8LA 1HWHB 3GBNH 2B8OT 4F58L 4TVSa 4POZC 3PWNB 4LMQE 3UTZA 1MJ8L 4HJ0C 4YHZL 5KYYB 3DOIA 2VDLH 1CGSL 2GJZB 3K81A 1ED3A 1QWNA 4GQRA 4X4XA 1KBGL 4TSAL 5LNEA 3MPCA 2IADA 4HIJA 4MCYA 4NQDD 5FYKU 3EXJA 4NENB 2DQGL 2JI1A 2YIHA 1GRWA 5IUSA 3CBKB 4S0SD 3GYRA 2YR3A 3GI8L 2GB2A 3FU9A 2CXKA 1FGVL 5CXPA 4LCCB 4ANUA 4ZT1A 1CF8H 1RZKC 1EFQA 4CW1B 1ETB1 1GGCL 2QSVA 4O2CA 1QRND 4QRTB 3B2PA 3UXFA 4OZGE 3EYFB 1KBPA 5JO5A 5IFAH 3UTPE 4NHUA 2EDRA 5AYUH 3SDDA 4PJAF 3SDCB 5BJTB 4M5SA 2HG0A 4X8JA 3CLWA 4EF3A 2FNBA 2JB5H 1CE1L 4LIQE 4EI6A 1REIA 1IE5A 1U92B 2CO3A 3MBWA 4QOKA 3U4EB 5C0AB 1RUPL 2VC2H 3O8XA 4K7FA 5MEOA 5LXGH 5DJ2B 1CBVL 4GSXA 3KBEA 5IWLC 4PI0A 5EC2A 1UATA 1SHSA 4DP5X 4K4KA 1QFPA 1HL9A 3I2CL 4XCCH 3UO1H 4DW2L 5ADPH 5EA0L 1U8KB 35C8L 4GW4A 4UU9B 3GSRA 3NABH 2H41A 2AJZA 3MNVB 1E4WH 4HMEA 4LLQA 8PAZA 4KROD 4A7UA 3QJOA 1I1RA 4BK5A 3TEYA 5F9OH 4PGEB 4NYLA 4WNQA 4Z5RA 1NFKA 4KRMB 5EZJA 5AKSA 3ULSB 2D2CC 3WY3A 4CC4C 4AJWA 2YD1A 1ZE3C 4H40A 4MJ5B 1KGCD 2X4QA 4NM8H 5MERB 3ZKNC 1S9VA 3Q2LA 3FBQA 2CIIA 2VLRB 2NLJA 3CBRA 3LVTA 1NAMA 3W11C 3ULVE 1XGTB 3L4YA 3QUZA 4JRWA 1CXHA 1D5MA 3SYQA 3D06A 5LNGA 4GG8B 4OQTL 1BXVA 3EDKA 3QXTA 1UEMA 5ISZB 1RURL 3TBWB 3VW3L 4PMFA 2NY1B 4RA3A 5DJCB 5I8OH 1MW0A 1BD2B 1X4YA 4QF1B 2ZUXA 3UYRL 2HKAA 3VH8A 1XZ0B 1PKQB 2IWGA 2FJUB 5EG6C 5DQDL 1LEGB 3IMTA 4NRYA 3QEHB 1L7IL 3QP3A 3QIWC 3QZWG 4IIQB 4NQCB 2OYPA 1GCFA 3MTRA 1D6VL 2DYPD 4QWWD 4AYMC 4GLRI 5DFAA 4YSUA 5KBMA 5SWQA 4BFFA 1MFBL 3IJHB 3VXQA 1NFDE 3PNWB 1L5GA 4FADA 2UZIH 3LNIA 3ARVA 4X9BA 5JNYA 1BWWA 1ORQB 1YAIA 5HI3D 4DQOH 2JKNA 2PKDA 1M42A 5C92A 1JD7A 2P5WD 3IE9A 5HVHC 3LNHA 4PRHA 1EDYA 2KI6A 2B5IB 4N6QA 5FEBA 5EWIH 4QDGA 1L6ZA 2W0LA 1XGYL 3TVMD 1JYVA 3WFHB 3UTTB 4TVPD 3NRFA 1KZYA 3V6FA 5GGQH 2NQCA 3DDFA 2APXA 3AU1A 4P2QB 3LS4H 1LLAA 1XR9A 4QXTB 2CLVB 3RKDC 1CLVA 3HI1A 3KWUA 2BVPA 3ECWA 1VEOA 3MCKB 1GYAA 4UTAH 5ESAA 1PG7L 3ECBA 2DQEH 1GMIA 4Q14A 1G84A 4FNRA 1IAOA 3ZZLA 2H3KA 1GS8A 5LLIC 3SEPA 1PZ5A 2CIKB 2J2ZA 2C1PA 3D18B 2BOCB 3B2VL 3HEIB 5E8EB 3VX1A 43C9A 1H9DA 2ZKXA 2Z92A 4YX2H 1U33A 2WXIA 4NPKA 4PJ5D 1NCWL 2KQNA 5D1QB 3WKNA 4X6BB 1UT9A 1T4KB 3EOBA 4L4VD 1XGZA 3NZHL 4C59B 5K9JH 3FHQA 3A4EA 1EJFA 4W9ZA 2HKFL 4N2OA 3KXFE 4J4PD 3EJQA 5JZ7D 1KGXA 3RGVC 2BDNL 5F9DC 3MXWL 3L4TA 5E1QA 1INEL 2YN3A 5K9OA 5IY5B 2DQJL 2X1XR 3IDJA 3L9EA 3P11H 5FYJH 5B1AB 3MRCB 3POCA 4GKSB 1M1SA 3DRTB 1F4WH 2YUVA 3SY6A 4DO5A 1K4CA 4J3UA 4OAWA 3RVVD 3KWVA 4CNIB 4AEIL 3MR9B 5HYSA 4JCLA 3FT3B 2HVKB 5EUOA 2A1WL 3J8F7 1MWOA 3KNBA 4ZUUA 2DQDH 2BFVH 3OR7A 4AQZA 2GG1A 1Y6KR 4YGVA 4U1KA 1G1YA 3ES6B 4M5ZH 3OMIB 3H56A 4OV6F 2WVVB 4PY7A 5EU5B 3PIQA 1QI3A 2AERT 2PCPA 3B56A 1HQRB 4K7PX 3H2QA 4Z8FL 5DRWB 2CPCA 2HYMA 4MCZB 5MENE 2DEYX 1FORH 5B1JA 3THML 4YHKH 4OW6A 1FG2A 3WN5B 4R4ND 4A7QA 2VUOA 5EFIA 3WKPA 1PW3A 2EE2A 3KCPB 3Q6FB 2VIRB 1E28B 2VRAA 3WIIL 4UTBL 5F0JB 2M1KA 1R3IL 1SM3H 3TV8A 2CUAA 1R3LA 5KUMA 3TTSA 3T09A 5DRXA 4A2EA 1NMAH 2BW4A 2JJTC 4AE1A 2NX5D 1JGUH 1ZAGA 4OT1L 1NLBL 5D2NB 4ZMVA 3I75B 3DVGB 5JORB 5BOPA 3O6ML 3MLRL 3NJNA 4DGWC 1UZ6E 5KYWA 2A83A 3OLEA 4N2HA 3U6XA 2IAMD 3DX8A 3SKMB 2UUDH 2YD0A 1UEYA 4K5LA 4RAUA 4G6ML 4JN1L 2ZYRA 2NY6C 4OQTA 3RIAF 2OR9L 2KYIA 1DEEA 5AB9A 1KTLB 3MAWA 3R0MA 4OLWL 5DHVA 1TVDA 4XI5C 4YSTA 5I18H 2HFGL 4GG6A 4X6DF 1YEFH 4HSAC 4NM4H 2GSIB 3WFEH 3X14A 25C8L 3GPEA 1KF9B 1ZS8B 3EZ8A 4PJBF 4XPHH 3KE0A 1G7MA 3K2IA 3BD3A 2EXWC 3TBSA 3DECA 3JWDC 1BQLL 4QCIB 3U46B 2DJUA 2IANE 3TEZA 5AVQB 2ZD0A 2ZQKA 3TEUA 3L9RB 5C0FA 1HXMA 3QUMH 5JW4Q 2ZE0A 1QLFA 5KTEL 3G9VA 4JANA 3EDDA 3PAZA 4FFVC 3FTZA 2DQ6A 1ZA3B 4PJ9C 5KJRL 4DEWA 4KFZC 5FM5O 4HS3B 4DUVA 3BIAX 4F2MA 3J27A 1AD0B 1N6QH 1JFQH 1HKLL 2VM4A 2E9WA 1NUDA 5I2IB 1INDH 2UZXB 4UOZA 2QVFB 3LDBB 4KVPA 1U3HC 4K3HA 3HUJF 3BEVB 3BO8B 1FNHA 2WP3O 2Q2LA 4KI5E 4M7LH 1FL5A 2XXGA 5DURB 4M6MH 5D1ZA 3HMWL 5JHLL 3QI9D 4MB3A 5HHOB 4P2OC 4XRCA 3GRWL 3DTXB 3I9PA 3IJ8A 1FNFA 4D0DB 4PLJC 2EJ1A 2XTSA 3EJJX 3O9WB 5F3HB 3K4DA 4WI7A 1AGCA 1P84J 1YJDC 2GY7B 1W8NA 4ANXA 4RRPA 2NUTA 3CZEA 4LF3B 1FNGA 4QYAA 4HEMA 2Y07L 4L2LA 1UKSA 1IV8A 3MHZA 1NFIB 3EJZC 4HUWB 1JN6B 3STZA 3KPPB 1CL7I 3EOAB 3LPOA 2IC2A 1OPOA 3IK2A 2DI8A 5FGBC 2VW7A 3MRLA 3PWUB 3S96A 4N1CA 1QBML 3GHEH 2WUCL 3T77B 5C9JA 5AAMA 5MI0C 3P0VH 2WWKT 4K3EH 5DMGD 1MFCL 4N2KA 4DP9X 2BY1A 1WC7A 4Y1AB 1I1AB 1JTOA 4DKEL 2VXTL 2YQ2A 3LZFL 4N2FA 2P5EE 4OCLC 1TEFA 3CU7A 4RQQB 2A6IB 3KJ6H 4D7PA 5E23A 1WDAA 4NI3A 1SHMA 4HXAL 4NQSA 4OGYH 1TCRA 1EAPB 3G5ZB 3H6AA 1BOGB 2JSFA 1HNYA 3BH8A 3N06B 1IL1B 4JDZB 4CN4A 5FO8B 3GSQB 4QPEA 1YYLH 2AJSH 2XY2A 3MMEA 1D6EA 1Q9LB 5CMAB 1MVYA 3V0FA 3Q6GL 1R3HA 1CFNA 1U8IA 2GFBA 1E9QA 4ANKA 3J07A 4RGND 3PWLA 4YH6A 2HRPH 4UT9L 2AEOA 1CU4L 5F7AA 4UANA 1LWJA 3L3GA 4R7XA 3LRGA 1CD1B 4GRMA 4NI6A 4XBMA 2VDLB 4DN3H 2PTVA 4PW4A 1H3PL 1OAKH 2XTLA 3LEYH 2FDBP 2IH8A 1MCBA 2X4RB 3HS0C 5LGHL 1CD0A 2R2EA 1Y6NR 4OLVL 2EECA 2UX7A 3L2LA 4HJ1A 5DDHA 4TPRL 3QA3A 1HDMB 4CVXB 2G2PA 5AOKA 4K8RH 3GO1L 5I1CH 3TCLB 5EBLA 2VTFA 1VRSA 3UG3A 3X1NA 5CBAA 4YSCA 2BVTA 4MSWA 4N2EA 4R3SA 1U93A 3LV3B 1A8JH 4N85A 1KCSL 3NGBC 2XFXA 3QUYA 1DQMH 1NM9A 1UOKA 2LTQC 4NCC2 2IPKA 4OB5L 3RU8L 5GS1C 3VXME 4WFGD 2WXNA 4PJBB 1F56A 4FCAA 5ICZB 5DC9B 4B50A 5HDRA 1J7VR 2IQ9H 2XVKA 3X11A 1U58B 1U8MB 3NEEA 4FFZL 5IW3A 5TE6L 2Z7ZA 3RNQA 3KPNB 5BRPA 4G8GA 2YSSB 2EC8A 4H0IA 4D8PA 4F8PA 1EGJH 4HG4J 4AH2B 1LL1A 1QSEB 5ANME 4DGVH 4K9EC 4NOBA 3ZK0A 3TT3L 7TAAA 5E2VL 2E7BA 2VC2B 3FMGL 2DDQH 4ZTOL 3VI3E 2IPTH 3GHPA 4UOW1 4J6IA 1AHWA 2VDML 2VSDA 2PYEE 4J3TA 3HUJB 4LHJB 3B8SA 4WW2A 3TV3H 4CGUB 3BCFA 3NJLA 4MD0A 1ZWIA 1DDHB 2Y7QA 5IOKA 3F7RA 2K0RA 1DE4A 1I9IL 2FD6L 1CCZA 4FHBD 3MOBH 3ZZ1A 1HZHH 1CG9A 4LOEA 2I7OA 2Q10A 3M7FB 3MO1A 1H3UA 5L4MA 3Q1SL 2EDMA 5FECB 1RJCA 1AZBA 1MVUB 2UWEA 4PJ7A 3LHPH 3SE3A 4AYSA 2E27H 3T0WA 2A7BA 4AGQA 4IJTA 5AKRA 3JWOC 4P23D 4MLIA 4XNMB 3OKDA 4DKFL 1WEJL 1JMZA 2IBBA 1ORSB 2ROYA 5K39B 5AD0B 3ZR5A 4XWGL 1F4XL 4J3SA 1G1CA 4KK8D 5CZRA 4GIOA 1LO4L 2V4LA 5AW0B 1AQDB 5F1KC 1YNLL 2EE3A 4D9LL 3HG3A 5GGUA 2X09A 4WKXA 4F57H 1BMWA 4LASH 4ZUVA 5GS0D 2Z1KA 3QQXA 5C9KA 4YDZA 4DSYA 3OB0K 2E76C 4N0FA 4ADIA 2ZIDA 4I1NB 4ABQA 4LRIC 4YVNA 5DD5H 4YFLI 2QHRL 4OCRL 4U0RC 3ZLQC 1DBBH 3HJ0A 3FTXA 3G08A 5IEHB 4NNXB 4W70A 3LS5H 2QEJA 4JFZH 4BKSC 1Y6MR 1A9EB 1SGKA 4B9CA 4NDMA 4MZ3A 1ZKAA 2YGOA 2ZXCA 1ZTXE 4C4UA 1GPOL 4WEUD 2QV2A 3WL9A 1S7TB 1IT9L 3MRMA 1XXFC 3QQ3B 4D7BA 2AQRA 3O6FB 4IRSB 2ARWA 3AGWA 1K8IB 5KAQF 1ZVHA 4Q89A 4J8RB 1VCBC 3QUXC 1MQ8A 4V1DB 3O3UN 5HDQL 3X3FH 3CVBA 4CSSA 4AENA 3MLSL 3L5XH 1QNIA 3ARBB 1M4KA 2Y23A 3ZL1A 1ZVYA 4XPBL 3RPIB 2H4EA 4BSWB 4JFFA 2VSMB 1ZIBA 3L5WB 3MJ9H 4H8HA 4NZRL 5EF0A 1NCBL 5T1DH 3ALWA 2AV7B 1XGPA 3OGOE 3ZTJH 1CLYL 3EYOA 2PF6A 4KJWC 2X28A 3BDYL 3RWHA 5KJ4A 1KTRL 4RMSA 1EO8H 3IKKA 5JUEH 1TO4A 5I8EB 1Z32X 4ZYKB 1YNTA 1HE7A 4Z7NF 3MUHL 1NKRA 1JXGA 3S3BB 2WXQA 3J7HA 4IJ3C 4WRLA 1LO2L 3UAEA 2HRGA 4TVUA 4Y2DC 1IC7H 3KDMA 2CCLA 2XTJB 3GBDA 4D2NA 2WD0A 2WQUA 5EEXA 2AMUA 1IGFL 3ALPA 3IRZA 4YOKA 5BRQA 4BFBD 3CFEB 3Q2NA 3ZZSA 2LFGA 4L8CB 3AAZB 3FO1A 2TRYA 1JNNL 2GAZB 1NJ9A 1JPTH 5DHXB 3MJ7B 3O6LL 3C09B 1FBIL 1OP4A 2WKOF 1T4WA 4PS8A 4X9GA 5JHDE 4OFQA 1Q72H 5FA3B 2UYLA 4G82A 1OCRB 3U30B 4W93A 3H6JA 3H85A 4JFFD 3ULVL 3MN8A 5B1KA 5DWUL 3D3VB 1CO1A 2YMXH 2OM5A 3H42L 1SY6H 3IGUA 4KXZI 4AXWB 2IQAA 3VA6A 3FO2B 2H2PC 4RMTA 1IJNA 3PHQB 2ODIA 3VFVB 3FCSA 3MOAL 4OCXL 1FNSL 2CZNA 4ETQB 4HMCA 4UQ2B 2UZPA 4Y9CA 6PAZA 4FFZA 4A37A 5D7KD 3VFMB 5D6DC 5D7IA 3H3KA 1GAFL 3E2HC 2VRKA 5BCAA 3AXLB 5I1GL 3VD1A 4G5ZL 1C5CH 4LHQB 4XXWA 2DS4A 2V2XB 2VDOB 1FN4B 3BUIA 5ACMA 15C8L 2QKIA 3ILPA 3KZ8A 4D0BB 1I9EA 1RK0B 4HV8A 1CDJA 4AZ8A 1PLGL 1UT2A 5DK2B 4P2RE 1LYQA 1WBZB 3FB8A 1KENL 4XVOA 3TJEH 5KZCB 4JFDD 1LO0H 4KAQL 5HGAB 3VJ6B 1BFSA 4JY5H 4XAKE 1DSYA 4M00A 5DVMA 4JFPA 2ZAHA 4AQ8C 1W6WA 1A7OH 3P4OA 5HHNB 4ANWA 2A9NH 3PXJA 4M6NL 5J1AA 4APXB 2H5UA 4RGOL 3APFA 1UA6H 3QQ9D 1ZDQA 5E9DD 1SF5A 2GIXA 4DVBB 4TSBH 3FXIC 4WLCA 2K6ZA 1TEGA 1Q1PA 5KBNC 3PG2A 3V6OA 5L2KE 5KSVB 3CSBA 2DM4A 5LGJA 1DCLA 5L4FA 3QDGB 3LSOB 4NWTL 4CBPA 3SPVB 3CZUB 3I02A 3K80A 4PVMA 2Q7YA 3MV7B 5I76B 5FO7A 3MODH 4XCEB 3KS0H 4CSTA 4U6HA 1IFGA 4WFED 3FFDB 5AVZB 5SWSA 2ZCHH 3L3IA 3NIFE 4P99A 2WOYA 3RWEA 2F54D 1G7IA 1ZJAA 2ED9A 3QNYB 4ODHH 4DN4H 1HWGB 3IU4H 3MLXH 1CGYA 4MNQE 3E1ZA 1NC4B 1I7UA 5ACLA 3EADA 1KBKA 3WNIA 4F37F 2DW5A 2P47B 2ERJC 4G1EB 4HH9A 3DJSA 3WKYA 1YPZE 4NZUH 2AI0L 4YEFA 4KVCH 3CU1A 1M9WA 5DFTA 3BW9A 2ESVE 3EHBC 2A9DA 4B97A 2BIMA 1WAEA 2YAEA 2Z31A 3KPSB 4IOIA 4UZUA 1JSYA 5TQ0L 4Z7NB 1QD0A 1SDDB 4O4YH 4A7VA 1ES0B 3ZT6A 4ENZA 1FZKB 5I0ZA 4MJIB 1GJUA 4R2GD 1WD9A 1PCSA 1KJ2H 4NP4H 3G5XB 4OM1L 3DX2A 4YBQD 3EXLA 1L9MA 2R2BB 4E42A 3FB7B 5C0DB 5JXEC 1MY5A 1PSKL 5B3JE 1J0HA 2F8XC 1PFCA 3L3HB 4Q0XL 4OZGA 2XV2A 4L5FH 2RQEA 5AB1A 4OR1A 1WZKA 3CN2A 4F2EA 4ODVH 1BZ7A 1ETJA 2HXAA 5F9WC 3V7MA 2VN3A 2X6BA 5DFWH 1DJIA 2HJLB 1FGNH 1TVBA 2IOIA 3BN9D 3PWPD 4Z7UF 1ZSDB 1NGQL 1U41A 5DQ9B 2LLGA 5T1LD 4M5YL 3LXCA 3SD2A 2X9YA 4PMEA 1QO3B 4PGCA 4C4BA 1E7UA 1A1MB 3VFNA 4FKKA 2AJXL 1KB3A 3WENA 4LSTH 4N8CH 1IBHA 1XR8A 4WJ5B 4PJFB 2WY3B 2XZAL 3GD1C 2R27A 4P2CG 1LK3L 3LCYA 5LQBL 3L4XA 4Q6IB 4WSKA 1W0WB 4M7KH 2WKGA 4N2NA 2J8UE 4KPHL 4EN2A 3MRNB 1PIGA 4J39A 3C6SB 4F5CE 4FNLH 5FYKH 1HL5A 2Z8RA 1S5IL 5IREA 5L2JA 4XNYL 2YPVL 3ZIYA 1AP2B 3AUWB 3GGWB 4QEGA 4RIRB 4JKNA 1DVFB 1KPUA 1WBXB 1Z5HA 4X0NA 3OVUB 3RB7A 2VWEC 3BD5A 5F96H 3NA9L 3KGRA 3TF4A 3CHPA 4F7CA 2P8MB 5F97E 5K5YA 4FYTA 4PWEA 3NJGA 1BWMA 2W0FB 2H9GB 3MCLH 5EIIA 4UYPA 3T04D 2DMBA 3LH2L 5L4IA 3CFCL 5DGRA 1AOHA 4H8WC 3OJDB 5T1MA 2TAAA 3IDMA 1OD7A 1T7XA 4V2BA 5AAPA 2CNZA 3QZLA 3SE8L 1AD9B 1FHGA 1S4IA 4FNPA 4RMWA 5T33L 5E70A 4EQ2A 4GRWH 1AMYA 1ODUA 2PR4H 1W72H 4Y4KB 2BM3A 1UB6A 1X5AA 3K5RA 2EIZA 2VN6A 3RIKA 2NNFA 3RLSA 2ZOOA 1JDDA 4IMKC 4C56B 1NFDA 4JM0A 2IALA 4ZRGA 2CRMA 2WNXA 5D70L 2DWEB 2WBJC 2DD8L 1RK1B 3QNZB 3WLWD 4JG1H 1RUMH 2YZ8A 4HXBL 3FZUC 4JY6B 4LVOC 3LIUA 1N68A 3FCUB 4WGWB 2ZYIA 1VCAA 5DK0B 3ULVD 4XH2B 5IFJB 3CPLB 3GM0A 2H3NB 3VE0A 3U48A 2DKUA 5CU5A 1BFOA 1XF5B 2H32A 5IHUH 3ARTA 3QJVB 5DO8A 4BQ6A 3FUFA 4NN5C 3MV9D 5EF1A 5GGTL 3VG0L 4HF5L 2NY3D 1YY8A 3TIDB 4LLYB 2YRZA 2B7DT 4HLJA 1ET7A 1D3CA 4I0CC 1Q9OB 1IEHA 2B0SH 3HAEH 3NPSC 4ZUWA 1BZ9A 4PWGA 5JQ6L 4BQBA 4WKZA 1UWEL 4JQVC 3SGKC 3BDXA 3UZQA 1M7DA 3U36B 4CUCA 4NPJA 4YXLH 5F7EH 2R8SL 3ARFA 3V4UL 5CSZB 5JW5B 3DARA 5I9QC 5DHYA 1OANA 4I9WD 2TSAA 5EBMB 4OF5A 2VCOA 1ZJBA 4OJCA 4I18A 1R5VB 3SE4A 3BKCH 3MYJB 2OAAA 3EYQD 3ZZQA 3VFRB 3VXPB 2WWMC 3X13A 3WE6B 5DA4A 3VGAC 1YUHB 2WXGA 4N0CD 5DQJB 1AXTL 1S7UB 1V3MA 4LAJH 4A1RA 2NXZC 1OK8A 3VRLE 3FSWA 5EO0B 3T0BA 5E0FA 3OAYK 1BVLB 2BP8B 1UJ3A 2O5YL 3BH9A 1WAPA 2FT6A 1J0KA 3MSPA 2P49B 3V6ZA 5HPMB 5EEZA 5C2BL 3MI6A 2XVLA 4HIPA 4K3DH 2C5DC 1CGUA 4QIRA 5JLZB 3U7YH 3UOAB 3HG0A 1LEKA 2AK4B 1NCCL 4L8DB 1F0LA 4JZNB 4N28A 4JJ5A 5EC1A 4PJ8A 5PAZA 1F4YL 1KACB 1VPOH 3ARFD 3S6CA 3K3QA 4UOQA 4ZFFB 4FP8L 3JWNC 1SJEA 4L2YA 1C8QA 2Y36H 3A47A 1TQSA 4KXAA 3ETTA 2COVD 2LHAA 3CSPA 4NFBA 1QBLL 4R0LB 2C1OB 4OZHB 5MENA 2ENYA 4IOSD 3TYFA 4YC2C 3SKOB 3TPUB 2PETA 4ORGB 1J8SA 4LESA 3OXSB 3WBDA 4NX0A 3T4AC 2BOBA 3VSTA 3X1GA 4X6EA 2G3XA 2J73A 1K2DB 5EUKB 2MJWA 4RDBA 4ICWA 1BJ8A 2FGZA 5D7JA 4HS8H 3B43A 5I0WA 1EVTC 4PQXA 2O6FA 2ICWA 3HCVB 5H37A 2YK1L 4K3JL 4FXTA 2X2UA 4OGXL 3P2DA 2YPVA 3UROR 4JHAL 1T83A 1UM5L 1DJZA 4GKLA 2NYYC 4I2XE 3X3GH 1AGBB 4YDLB 5FX3A 3GDBA 2JK5A 3TZVD 5DO2C 1XGQA 1VESA 2OZNA 1JS4A 1CVRA 4JPKH 3BAYA 2GITB 2WZ6A 2H6OA 3G6DL 4HALA 4MS8D 3TH2T 4JHWL 4XBGB 3EYSL 2FR4B 4XN7A 2X4UB 4LKXB 4PJHF 5IJKC 3N6YA 4GXVL 5DJ0A 3FH5A 2XZQL 3JV6B 4YL9A 8FABA 5T5FH 4YZFF 3EDJA 3W9DA 2H8PA 5C71A 1JZ5A 4YHLL 4JM2D 1N64L 1Z9SB 3N41F 1UD2A 2OMWB 1DJYA 2IGFH 4EOWL 4HA1A 3GJFH 3KYNA 3CN4A 2IANA 2R0KL 1RZGB 2F58L 4NBYB 4BE6A 4OM0H 4DT2A 3IFNL 1YC7A 1AH1A 5INCB 5D7JD 5C3IA 2ICEA 4JAMA 1E43A 5AZEH 2EIEA 1BM3L 4Z77A 5IK3B 1CXEA 4JO1L 2VLKB 1MNNA 5F1SA 5IB5B 3L54A 5FV1L 3US0A 1MHEA 1S3KL 5ICUA 1ZV2A 1E4KA 5K93A 1HTYA 2DOCA 3VQ1C 3G5WA 1DQKA 4K5PA 1SN5A 2D3JA 3TF7C 2PCFA 1FG9C 3FUIA 2D7OA 4P46A 3FB6A 2IH3B 2AXGB 2ZWSA 4JQXA 1INQB 2NYZA 1HCVA 2ZKHH 2KPNA 5GGTA 4ZX6A 1M7XA 4PM1A 1MLCA 2XKUA 4WTQA 3DX9A 1HSBB 3FQRB 3OKNB 3GSXA