5SX5H

Crystal structure of panitumumab in complex with epidermal growth factor receptor domain 3 mutant s468r.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
207
Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGGSVSSGDYYWTWIRQSPGKGLEWIGHIYYSGNTNYNPSLKSRLTISIDTSKTQFSLKLSSVTAADTAIYYCVRDRVTGAFDIWGQGTMVTVSSASTKGPSVFPLAPCSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSQTYTCNVDHKPSNTKVDKTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Panitumumab Fab Light Chain
publication title The Panitumumab EGFR Complex Reveals a Binding Mechanism That Overcomes Cetuximab Induced Resistance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system
total genus 40
structure length 207
sequence length 218
chains with identical sequence J
ec nomenclature
pdb deposition date 2016-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5sx5H02
2DQUL 5E94B 3FQRB 1FSKB 5FYKD 3T0DA 1S9YB 5HBBA 5F3HB 4P23B 3O6FA 3H9SB 2NLJB 4XVJL 5HHOE 2OTUB 4D0DB 3DXAE 3OF6A 2RR3A 5DJDA 1K4DA 1FFQA 1NC4A 4LOUC 5HPMB 4X4YB 1CXHA 5L2KA 4QRPD 4R96B 3KWWB 3GSOB 1S9KC 3CMGA 4L4VD 1JHTB 3V6OE 3B9KD 4CADB 4U1HA 4JLRA 4F7MB 4B50A 3X13A 5T3XD 3CLFL 5EWIL 4X6CE 5ICYB 4Z7UB 3AY4C 4H8WH 3V6OC 4EI5A 5C0IA 4HIIB 1FL5B 2PO6D 3QJHB 4G7YL 4PYGA 3P2TA 3CLFH 4TTDD 5EWIH 2A83B 3L3IB 4ORGB 4P5TD 3U48A 4G7YH 1A9BB 3DHJA 3HZMA 1MHEB 4WI9A 2HLFD 5CGYC 5HDBF 4XP4L 5IQ9B 3EYOA 1IGYB 4PB0L 2YPKA 4QWWC 5D1XD 4PJBA 2MQCA 4HH9A 2Z35A 1ZA3A 4XP4H 4YNYB 3ARTA 5KVGL 5MEND 1VEPA 3AXLA 4PB0H 1T22A 1M7DA 4RAUA 5DQ9A 3RL2A 5KVGH 2ESVE 3BN9D 4NC0B 5F7MC 3T0BA 5FK9B 4BJLA 4BZ1H 3P9WB 1ZA6B 4BFEA 2AJXL 4MS8C 1IZKA 4G8FB 4XVTL 2ZSWA 2FWOB 3K2MC 3OB8A 4U6HB 1J0HA 2E9IA 5GS1B 1R3LB 5IBLC 3ILQC 4XVTH 1HH9B 1A1MA 1EEQA 5IMKB 4DCQA 2EO1A 5TPWL 2E6JA 2N56A 3Q48A 2I9TA 4N0CC 5DUPH 4PGZA 1AO7E 3WIHA 4S2SB 1E4XL 5EZJB 5DYOA 2GIYA 2H2SC 3MGOB 1NCAL 1K2DA 3F8UB 2IJ0C 4M7JL 3THML 3D48R 3VGAB 3PV7A 2E7HA 4FXGA 3ZTNH 2A2QT 3MO1A 1WWWX 2C3GA 3GJFK 1UM6L 2BVYA 2NY6C 1F4YL 2VERN 1NCAH 2OZ4A 3THMH 1KSRA 4JO1H 1PZUB 2WIIA 3LS5L 3GMLB 4WI2A 2VNCA 3FQTB 2VSCA 3VDBA 1DBJL 2JJTA 2KDGA 3LS5H 3WNPA 4YUEL 3C8KB 2BRRL 3ARGA 3OKOA 1XF5A 5EPMA 3RNKB 2NPLX 3TBTA 4WU5B 5JXED 4NP4L 1I1AA 4YUEH 1XGQA 1HQRA 2GJ6D 3CUPB 4M5YL 4Z7UF 3AU1B 4NP4H 4OF3A 4JREC 4AK1A 3SBWC 3GJFH 1T2XA 5DEFA 2N1KA 1D6EB 2CKNA 1QA9B 4M5YH 1YNLL 4S10A 3W11C 1N8ZA 5JNYB 3DO7B 1B3JA 3STZA 5E8EA 1J05A 5INDB 2D7TL 1KXVC 4H1LA 3MRDA 1I7RA 1BD2B 1BZ9B 3ARBC 4HZAA 1MHHA 5J11B 2D7TH 5ETUB 5EC2B 1UWGL 2HN7A 1JUFB 2AXHA 4FQQA 5KJRL 2FYYA 5T1KD 3GI8L 5GGVY 3RIAK 1UWGH 2AK4D 2VXUL 4V1DA 5KJRH 3QHZL 4NQVA 4OLVL 5TGBB 1U91B 4GMTL 1F11B 1N64L 2OTWA 2PR4L 2VXUH 4A6YL 2DKSA 1I8MB 4LLVA 5FB8B 1I1RA 4PRNA 1HXYA 1ORSA 5IBUG 4GMTH 1MAKA 1N64H 2PR4H 2ZNWA 3WEXA 4U1JB 1ONQB 3P4NB 1TQBC 5HHOB 4M8QA 4FQLL 2WLZA 4Y0GA 1E4XI 3SDCC 2VQ1B 3WJLC 2EDYA 2H8PB 5J12C 2BOBB 1WZKA 4XP6L 1BVZA 1NAML 3ROOA 3KR3L 1L0QA 3I3EA 1EIBA 2R0WL 3KYKL 4LBEA 4N9GA 3ZDXF 4BKLA 5FFLA 5BZWA 5AYUL 1PDKA 3WSQH 5HYIA 3KR3H 3KNBA 2GTZB 3KYKH 2VZ3A 4I0PC 2XFXA 4NQEE 1MCWW 2QKIB 4ZFGL 3SE8H 1JGEA 4R8WH 3OWEA 5IVNA 4XCEB 1I9EA 1GRWA 5ALCL 3F7PC 1XT5A 4ZFGH 1QEWA 2HRLA 3M1BB 3QUZD 4D9LL 4E41A 3K74B 1FO0L 1BEYH 5T33L 3BN3B 1X5HA 4D9LH 2WUBH 1GOFA 3QHFL 3VFWA 1YY9D 2ED7A 5I0DA 4U6YB 1D5IL 2ESVB 2FECL 4N1HB 4JFDB 4JCLA 1FAIL 4QF1B 3QHFH 5E4EC 3UPAA 3L3OA 5I19L 5DK2A 5KTEH 1RZKL 5IWLA 5C3LD 4NWUL 4PJCB 5H37H 1P84K 5I19H 5ICZB 4PIRF 1LHZA 3O3AA 4ZAKC 2H45A 1JF1B 2FJGB 4UDTA 1RZKH 4GXUM 3W9EB 3MLZH 3QDJB 2P5ED 4NWUH 3WIIL 4N90E 4Y8AA 3CVIL 5JXAL 3OR6B 4CDHA 4Y4HD 3FOLB 4L4TB 1JZ3A 2DQGL 3W0WA 5CINL 3G08B 3MJ9L 1OM3L 4EVNA 4KI5F 2Z31C 1S78D 4WI5A 3PHQB 3U7YL 3T08A 3NACL 1FFPA 4PGEB 3TYFA 8CGTA 4PJHE 3U7YH 4Y5VA 4PJDB 2P8PA 4LASL 1OWWA 2Z8VC 3UPRA 2H3NB 1PSKL 2QSCL 1GGUA 4LASH 5CZKA 2HJKB 4L8SA 1DANT 3TN0D 1MCQA 2QSCH 4U05A 5F7DB 1FZOA 4OLWL 3UTPE 4NUJB 4BELD 3W5NA 1M7XA 4TPRL 5I1LA 3UBXI 3D85D 2R29L 5HSFA 4OLWH 2OCFD 5DRZB 1KCSL 1U2CA 1RULL 4X6CF 3KJ6H 4Z7VA 1BF8A 4TPRH 4HF5L 4JN1L 4NKDB 3VXSA 1IGML 4OF8A 1P84J 1KCSH 3CXHJ 4HT1L 1RULH 3T3PF 3IFNL 4AG4L 4K23L 1RK1B 4ONHB 4YHNB 4JN1H 2NW2B 1K3ZA 1KXTB 4HT1H 1QSFA 3IFNH 1H3XA 5EORL 4S0SD 2IAMB 1A3QA 3VXQA 5AAWA 3ARBB 5I1AB 1ACZA 5SWZA 5KVEL 1V8HA 1JBJA 2D7NA 5EORH 3QCVL 1UM5H 4QYOB 2X4NA 5CMAB 5KVEH 2OJZL 1WAAA 1ND0B 1I7ZB 3BGFC 5GRXG 3TPUA 5JIPA 1WBYA 2FECI 1IAKB 2GTWA 5BVPL 1J1OL 1U6AL 3N50A 1KB5B 2NY5L 4PJCF 1I8IA 2W65A 3ESUF 4JZNA 4GW4B 1RUAH 1CDGA 4YBLB 5BVPH 1UQSA 4R0LC 1J1OH 3T0AA 5IEHB 3WLWC 2NY5H 2WW8A 1BVKB 1KFAL 1TQBB 3NA9L 1I3UA 4QLRA 4DGYL 4G9FA 3T4AA 3EFFA 3EYQC 5I1CH 1WZ1H 2H6PB 3KPSE 3WMSA 3KLDA 5J12B 4DGYH 1MPAL 1IAMA 3U7AA 4XNZB 3ELAT 4UV4H 1T1WB 4GG8A 4U2ZA 2IFFL 4JO3L 4PJDF 1MPAH 2ED9A 2CDGA 3PG2A 4RMTA 3V6ZA 3VGDA 4XI5C 4EIGB 4JEGB 4JO3H 1UEMA 4UTAL 4DZ8A 3MNWB 4C83B 2NZ9C 4G6FB 3P9MA 3MLUH 1OHQA 2FX8L 2R4SH 2CUHA 5DMIL 1D9KC 4RIRB 5C09D 2QHRH 3T0XA 5K59E 1NPUA 4N1CA 4IS6B 2FX8H 2HTLD 3O3DB 5L9DH 2CO6B 1WVZA 4O4YL 5DMGC 3BKCL 3HRZA 3EIFA 4NQSA 4NRZA 3RKDC 5JW4M 2BNUA 4O4YH 4YXLH 3ZO0A 3BKCH 3JWNC 3VH8G 2B5IB 3GSWA 5E4EB 2IANA 4M1CD 1FNGB 3GJFA 3D25A 3ALPA 2C4XA 3FQUA 5I66A 1OSZB 4U6VH 1MCSA 1GPOL 3Q6GH 2B1HL 2VH5H 4ZSOA 4ZAKB 2X70B 3T09A 4MVBD 5E24E 3FT2A 4R4NC 1T5XA 1GPOH 3D2UD 4KJQC 2V5SA 2QLVB 3HPLB 3GJEA 1S8DA 4GSDL 2Z31B 4Y1AA 1IKNC 5JLZA 1I4FA 5DD0H 4GSDH 3UTTE 1V3KA 1JNJA 4S1DD 4UBDC 1L4IA 3TCLB 2ZUUA 3I75B 5DR5L 2V2TA 2OL3H 1H5BC 5CWSA 4PJHB 5HYQB 2F9BT 3NPSC 2EYTA 1AQDB 4NCDA 5AZEL 3QIBC 5DR5H 3G6AB 5FKPA 5D1QA 1CLCA 4LU5L 3MX0A 5DQJA 4ZDHB 3SGJC 3ZHKA 2DQJL 3AROA 2YPLA 1U8PB 3Q5TA 1J8HD 4LU5H 5D1ZB 3QO0A 2EDWA 2DQJH 4NPYA 3BP5A 1FV1A 3K2UL 3EO1B 5IW3A 4Z7OE 2XG5A 2VLME 2YPVL 5HDQL 4LVEA 4OD2B 1JNLL 3BRDA 4QXWA 5F1NB 3K2UH 3DHMA 3BZEB 2DLIA 1RVFL 4KJYA 5BXFB 5C2BH 3CVHL 1GIGL 3V5HB 1Q0XH 5IHBA 5DJCA 3O2VL 2CRIA 4YFEA 1JI1A 5EBLB 2FIKA 1RVFH 2DQTL 4RRPA 5DQDL 2IQAA 3NH7H 3EUUA 5ACZB 3FQXA 4QO1A 4KV5E 3CX2A 5LGJB 4G43B 4M1DH 5LXGH 4M1GH 5DQDH 4LDOB 5H94B 4RMRA 4ELKA 3HR5A 4XC1L 3SDAB 3KPRB 2FB4L 4JRXD 3ARRA 1JTOA 4PJ7E 1RFDL 3HI6H 1H3PH 4Y4FD 2FB4H 3NABH 3VFOA 3QDAA 4UT6L 1RFDH 5DD1H 1BP3B 3GHBL 4J3UA 2QEJA 4F9PA 2Q7YA 1OTTD 4ETQA 1MI5A 1BJ1J 4O58L 4KZDL 4UT6H 3RIFK 4R0LB 2EDNA 1UVQB 4P99A 4Y5XA 3GHBH 2VKXA 4GRMA 4HGMA 3WNMA 1FZKB 1EMTL 4O58H 4H0IA 4KZDH 1MHPL 4HJJL 2D0FA 1JN6B 2MKWA 3CK0L 2F5BH 3MUZ1 1EMTH 4RX4D 5A16A 4HK3N 1IGJB 1MHPH 1Q0YL 4HJJH 1I7UA 1X7QA 2VAAA 2IADA 3CK0H 3MLTB 4MX7B 1Y6NR 4X6BB 4HFUH 3QIWD 1Q0YH 1H15B 5DJ6A 1FYTB 2EXWD 3CFIC 4LARL 1KN4L 1AXSA 3RWDB 1R5WB 3SDXB 3SO5A 3MRLB 4PJHF 4R7NB 4KK6C 1KN4H 2A6KA 4IMLA 1HXMB 3MUHL 3OSKA 2ZCHH 5FKAB 5KN5B 4GAGL 1IKFL 2VJXA 1B0WA 1P7QD 1D9KB 3ZTJG 3QRFM 2P5WA 2CIIA 2X4PB 2C7UB 5I0ZA 1IKFH 2XKNB 4RNRB 4NBYB 1OGAD 3QG7L 4X83A 3D3VB 3QG7H 2R4RL 5JHDE 2FX7L 2Z0BA 3CFJB 2X4TA 1Q9OB 4BH8B 1NGQL 3UP1A 2FX7H 4Y16D 3FO9A 3SPVB 5IIEB 4C56D 2E8YA 4NQCD 2R0ZL 5IB1A 3L3GB 4ISVB 3O81A 2Q86B 5I1GL 4DOHE 5IB3B 2H41A 3T04D 4I77H 4QOKA 4RBPK 2Q8AL 5I1GH 5B39B 5CJQH 1NAKL 5EU6A 3ZDYE 3O4LA 3QWRD 4KROC 4M02A 5FUOL 3FONA 1CE1L 4X9BA 2KZWA 2NNAA 2JCCA 3REVA 4Z76A 1CE1H 1L9NA 1NJ9A 3GNML 1DTUA 4PRDB 1U3HA 2MNUA 2PYFB 4K2UH 2NY0D 3U36A 2VXSH 1J88A 1UENA 4JM2B 3QIBB 4IEFB 1FVDB 5CILH 2PYEA 1YUHB 3P77B 3RWHB 3P4LA 4CNIA 2CIKB 5IF0B 1HK6A 3TIDB 3I84A 2VIRA 1DE4B 5E8OA 5TDPA 2IMNA 4OB5L 1HILB 2HH0H 3SDXF 1FBIL 2Q87A 4XMPL 4WUUE 4E5XB 2CRYA 5CCKL 4OB5H 5F88B 4IRSC 2YWYA 4MMZC 5C0DB 4HXBL 1RY7B 1YC7A 5CCKH 2VLJB 5C07E 1NBZB 4GW5B 4KTYA 3SKNA 1QBMH 4HXBH 3MRHB 4FQXD 2A6JA 2YSSB 1A0QL 2R2HB 2X5PA 1JMZA 4M3KB 3MV11 4GJTB 3HMXH 3HAEG 5IB5B 5K9QG 2UWEA 4WWKD 3WFCL 4PJFB 4TUJA 1T21B 2LU7A 3D0VB 4RISH 4WUKL 4D3CL 4H0GA 1NKRA 3BEVB 4O9HL 3AAZB 3WFCH 3HZYA 1G7LA 1S9VA 2CQVA 2ZWLT 1KF9B 4D3CH 4BH7A 1C12A 4PTTA 4Y2DD 4X5LA 4XZUB 2HLAB 4HFWB 4DVRH 4JFPB 3LV3A 1DN2A 2BY1A 4H25A 3QXAA 4RFEA 3BIBX 4N5EC 1F3DH 3PF2A 2YZ1A 4FTVD 2BSTB 2PW1A 2X1XR 3HUJA 3IVKA 2HWZL 4MJIB 1KG0A 1JVKA 2HWZH 4X99A 5FGBA 3SDYL 3IDJA 3I6GA 4P5MB 3SDYH 2UYLA 5EBWB 5C0GA 1FLTX 1GGYA 2R2BA 2C5DC 1BWWA 1WQVT 3OF6D 5F6HJ 3V0WL 3WO4C 2HTKC 1SMAA 4P9HC 2B2XL 4MA8L 4AJ0A 1CD0A 4X5WB 4MCYA 4XCCL 1KC5L 5DURD 3V0WH 4F37K 4YBQD 5L2KD 2B2XH 3C5ZC 3K4DA 4MA8H 5IMMA 1F45A 1A7PL 1KC5H 2BNQE 5IFAH 4X4ME 3LN4A 1A7PH 2O5XH 2B1AL 3S36H 2OL3A 1J86A 4JHZA 3LN9A 4I18C 4RQQA 2B1AH 3V0AC 4G8EA 1RURH 4Z7WA 1GOGA 2ADJB 2WBKA 3NFPA 4GRLD 4E42A 4F57H 4NO0A 3KXFA 4L29A 2QQLH 2AAVA 5I1KL 5I30L 1TJGH 2FEEL 3OKNB 3MRQA 4AYFA 5EU4A 2FZ3A 3WXVH 4YIQB 1PKQA 2DJUA 4JDZB 1XGUB 2BOCA 4KDTC 5I30H 1MLBB 1PX3A 3MRRA 4GAYB 3DTXB 1KNOB 3OZ9H 3ZYOA 4JPKL 1N0LA 4JDTH 4UT7L 1QBAA 2D03L 4WTZA 4IRJB 5DJAB 4DOHB 3ARQA 3GBML 4KROB 4PG2C 5HHNB 1FGVL 4CRPA 1C7SA 1UKSA 5DMKA 4NO5B 4UT7H 3DX8A 3X17A 2D03H 2QADB 2QQQA 3UDWA 5F6HI 3GBMH 3DVFA 4P2YA 2BY0A 5FGRA 1MQKL 2W0PA 4PJ9C 1YMME 2AJ3A 4L8DB 1S7XA 5AD0B 1F6AA 4GS7C 1VKXA 4OUUB 5IFHL 4OFIA 4UDUA 1Y18B 2X89A 4I3RH 2XNAA 1RK0B 1XGTA 3O6ML 4I3SH 5C0AB 2QL1A 3O6MH 2A0LC 4NSKB 1U58B 5FUZH 3GK8L 1S7TA 5D6CA 3BDXA 3QH3B 4IRSB 4M00A 1YEHH 2V5TA 4ZD3H 3WKNA 2QQKH 4PRIA 1SJVA 1HSAA 1TVBA 1IAOA 3QUYC 1I1AD 3VWJB 3BUYA 4RZCA 4N8CL 1DDHB 4HGKC 2GK0B 2D7QA 1EEZB 1NFIA 3VXMB 4DKAA 5D2NB 3BT2L 5K9KA 4HKJA 4N8CH 2Z92B 4ONOA 2XN9B 2C1PA 3BT2H 1VFUA 32C2B 4RMVA 1T20B 1I7TA 1TETL 3ET9F 2XA8L 3MREB 5KZCB 4X0KB 5CBEA 3WIFB 2M8XA 2FEEI 3NGBC 2FHCA 1TETH 3BP7A 1NCBL 2R2EB 5L8JB 5DC9B 1EHNA 3HNSH 2OI9C 3QXTA 3U1SH 2VLRE 1DEDA 1NCBH 5FDWA 4BFIB 3ZKND 2GSIA 4MB5A 3GSVA 4RFNC 4YX2L 3VXUB 1MVUA 4FFVC 5EUOA 5DO2D 3MBEA 1U8OA 4I1NB 4NO3A 4V1DD 3FQWA 4GKSB 3U46A 4YX2H 1H3GA 1UB5B 1OVZA 2JK5A 2W0FB 1U8LA 5FF6B 2FL5B 3GUTB 1T7WA 3TO4C 4OTXH 4JFZL 4HCRA 5IOPA 4GLRH 3C87A 5BZDB 1C16A 3WDHA 1D5ZA 1E0OB 5DD5L 4ODTL 4OV6F 4MYWB 1RPQA 1WEJH 3DSNA 1PD6A 3DO3A 1VERA 5DD5H 3T77A 3BGAA 3GBLA 3WXWH 4GXVL 1FAKT 3OX8B 1CTNA 2QTEA 2R1WB 2HFFA 2BNQB 3QUXA 1CVSC 2DI8A 1KTDA 1LEKB 1ZTXL 1HKLL 4KTEH 1VACA 1TZGH 2IALA 2QV2A 2J12B 2VRAA 2LAAA 1ZTXH 1HKLH 2MSPA 2GUOA 2J8UE 1DUYB 1NBQA 5DUBA 4P48A 4YHIB 3MA9L 3GM0A 2Y6SD 3C60C 1SYVB 5JPMB 2EDHA 5D9SB 1U36A 3P73B 5E99L 1HDMB 4K94H 5E5MB 1IGTA 2DQFB 4NZJA 1MJJB 2ZCKH 3QWOA 4NKOA 3DECA 3VFRB 3ZKMD 1T1YB 2OXHA 4DGIH 2F74B 4OJFL 2VLKE 3HMXA 3U6RB 2YKLL 4EQ2A 3ZT7A 1EVUA 4XPGL 1FL3A 1DQQA 2XRAL 1W0YT 4YDIH 4G7VL 4PREB 5CD5C 4TULH 5A3ID 1X4XA 4OJFH 4PJ9B 3U7WL 3D18A 5HYSA 1P6AB 2X09A 4XPGH 3D39A 3P4MB 1W8NA 3IDNB 4N8VG 5F1OB 3EO9L 1AH1A 4JY4B 4P5KA 4HJGB 2IG2H 1CDBA 1P4LB 4GS7B 1KIRB 3JZ7A 3D69A 1LDPL 3BZFB 1P2CB 3S98A 1QRNB 4PJXE 4BK5A 5C0FA 1QQDB 2NMSA 5KANG 1CLOH 4LPTA 2BNRE 4GBXD 1MHCA 4R2GC 3F7VB 2MHAA 1T7ZA 5C08B 3SE3C 4OI7A 4U3XA 3LS4L 1II4E 4PV9B 3ULVE 5ISZE 3MGTB 1CK0L 3HFMH 1QLFB 4PJ5A 3RUGE 1KB5L 3BGMA 1INQA 3HG1A 3ULVC 4MJ5A 1ACYL 1KIQB 1AHWA 1K3IA 1CK0H 3QUYB 5DZNA 3GSUA 1MF2L 5IBUB 1ACYH 3C6SB 1N3NB 1MF2H 3MRPB 4YAQB 4TSBH 5C7XH 4MNQD 2Y07L 1Q8MA 3GFUA 2NXYB 3KHQA 4ODUA 5EULV 2O61B 3NFNB 4KJWC 3BSZL 1T04A 2Y07H 4FG6D 4LEOA 1P9MC 1KCLA 5MERB 3NGBB 3BSZH 3DJ9A 3FOMA 4PB9H 5CEXB 1R6VA 4LLYA 4PLOB 3DX6B 1UYWL 1HSBB 1S9WB 4PD4J 1TZIA 2AJZA 1SJXA 5CEZE 5FO9B 2I26N 5C0RL 3BO8A 1G9ML 3F5WB 5D7IA 4UNVA 1YEFL 5GJSL 5C0RH 4MZ3A 4NKMA 1ADQL 4HKXB 3QFDA 1GH7A 4J3XA 3IS0X 4L4VB 4JKWA 4ERSH 3RWCB 4UU9B 4ZUWA 2J7LA 1ADQH 1JJUA 1MJ8H 3BRFA 3NCBB 3PP3K 2YD6A 5L7XL 1X9QA 1I1YA 2GCYA 2M2DA 3DRTB 4G8GD 3SGKA 5IHLB 2PO6B 1YN7B 4YC2B 4X7DC 3UYRL 1A6PA 2DRUA 1NFKA 5F97E 5A43C 5BS0E 3UYRH 4G9FD 4WENB 3MJ6A 5E8DH 3ROLA 3BHBB 2FGWL 2ZSVB 4LCUB 5HJ3A 5D1XB 5HI5D 4BFBD 1P7HL 4CBPA 3ZHDA 1HCFX 2FGWH 2KQMA 4DVBB 1PG7X 4CW1B 2I9LB 4NT6B 2W0LA 3NZHH 4XP1L 4JHWL 1MWAA 3PWLA 3RX5A 3NCJL 2CKBA 3LPFA 5FM5M 5BOZG 3TBYB 1WFOA 4XP1H 3MYJB 1DQTA 5EUKB 4JHWH 3RX8A 4TSAH 3C60B 4OUOA 1RJYB 3FB8B 4ZUTA 4QGTA 1IEHA 2P4AB 3OKLA 5E8PB 5DFVC 1KGCE 3EW3B 3FFCE 1A4KA 4JR9H 1FZJA 4EXPX 4LCWE 4PRAA 1MIMH 1Q9KB 1R3IL 3OGCB 3VXOA 3BH9A 1JP5A 1DSFL 1XZ0A 4I4WA 5TFSH 4WW2C 1EO8L 4JG1H 4DKDC 4Q97A 2IAND 5T1MA 5IW6A 3L5HA 2E7LA 2VB5A 4NFDA 3DXAA 5LGHL 5J4MA 2RGSA 2OM5A 2QR0A 5EO9B 1OB1B 2F19L 1U8IB 2IPTL 1C5BL 2YOCA 3C9NA 3JVGC 1KPRA 3RBGA 4AEFA 2FR4A 2PCPB 2F19H 4PJ8A 2IPTH 4JDVA 3SO3C 5C92A 4Y1AD 4NOFA 2ADFH 1ZWIB 3ZSTA 2XWBB 1HWHB 4PJXB 1ZHLB 5C9JA 1LK2A 2VZSA 2KZ1B 1UJ3B 4U7SA 3RI5F 4X5XA 1X5AA 5C0CA 2BNRB 3OTTA 5EU7E 1ZLWK 4U1SA 2BHUA 2YD4A 4XPBL 2CLZB 4X6FA 4CVWA 4NJAL 4XWOC 5EU7C 2E7CA 5ISZB 2EDRA 2MPAL 1NGYB 3O41A 3S5LA 1NSNL 1HHGA 2YPLD 4AIOA 1FGNL 1CR9H 2AS5M 2EZ0D 4PGCA 4U33A 1FGNH 1FVCB 3B6SB 2DIJA 1NGPL 4PRPE 1ZLWH 2J8OA 1IM3B 3WUWA 5FO7B 5JOFA 3QPQD 3EOYG 3F12A 1R3HA 4PJGA 2IBZX 5C8JA 2GJZB 3MOQA 2FSEB 1E4WL 1PZ5A 4PR5A 2R39A 4NUGH 4NO2A 3ZYIA 4P2QE 4L8CB 3FL7A 1AO7A 3MLPA 1AP2B 4P59L 1BAFH 2E27L 4FQ1H 2E27H 3VFMB 3LKQA 3KJ4C 2BP3A 3FO2B 2H32B 1DCLA 3SDDA 4KK5C 5IVZB 1K8IA 2BJML 3BP4B 5GIRB 5EU3A 5C0JB 2H26B 3R06B 3CX5J 1CQKA 4G6KL 1EGJL 1J1XL 3G9VA 3VH8B 3QZWB 4X8JB 1HIML 1CDUA 4M7ZC 2NYYD 4Q6IB 4R4BB 4GO6B 5GZNC 3DV6B 1EGJH 1OWRM 1HIMH 5I8EB 1X6NA 4JAMA 1U8JB 3QUZB 3RWIB 4PJXF 5F3BB 5JZ7D 4JFEE 4I48B 3W9DB 2OS7A 5M7QA 1M05A 2OK0L 1SY6A 1GGIL 2AI0L 1UACL 3RWEA 3VFGH 2VLLB 2AJYL 5GGSA 3SKJL 4LK4A 2HVJB 1H3VA 1F8TL 5C0BE 2AJYH 2NXZD 2YC1A 4NDMB 4QY8A 2BXYA 1FVEA 1MCNA 3LPGA 1F8TH 1R24A 1TQCC 3UTSD 2MOVA 4DUVA 3DV4A 1XCQA 1REIA 3PABA 1I8KB 1DBAL 4RMSA 5GRJH 4KJPC 1T4KA 5GZOC 1MCIA 3AM8A 3E6HB 2VDQH 1KB9K 2P5EB 5E2JA 3FFCB 2BCKB 3CU7A 3S96A 3LHPL 4WW2B 3QFJE 4XRCA 4NFCA 3GSNA 4F3FA 1YJDC 1BJMA 4JFFA 3RDTC 4OZ4A 2HJFB 4F15C 3NMEA 1T6VN 4OKVA 3KG5A 4GXUN 3QI9A 3IFOA 3PXJA 3C2AH 3VFSA 5SWSE 2ICCA 4WY7H 4NRYA 4GMSL 2BFVL 5KSAD 3MTRA 8FABB 3T1FA 1CICC 3GZKA 3S35L 5EU6D 5CLTA 1CXIA 4GMSH 2BFVH 1WFNA 4XX1E 3SO3B 1YDPA 3ME0A 5DRWA 5HHPA 4MXWL 3S7GA 3S35H 3SJVD 3TN0B 2AXFB 4I0PA 1ZT4A 3UCRA 1VFAA 5F89A 4XNMA 1U3HD 4NQEA 1CGYA 3RGVA 3VXRA 3I50L 4HLZH 4P2RE 3ARUA 4LSDA 4EJ1C 3P0YH 4PRHD 2C4FU 2VXTL 1KB9J 4Q9BA 3HE7C 4QCIA 5GSRA 4PBXA 1F13A 4Z78B 1RZGB 1G7JA 3BD3A 3OXSB 1DZBA 2JIXA 5H35A 4OF6A 5ACMA 2GAZA 4D0CA 2NTSP 1F6LL 1JNHB 5F6IC 3VFPA 1XFPA 4BYHA 3KPMB 2ZJSL 2HKFL 1NFDE 5I1IL 1A6VH 3KLAB 1H0DB 3TA3C 4BZYA 5I1IH 1MUJA 4R26H 2GK2A 4IIQA 1OAZL 4JRYD 3CU1A 4ZUUB 1Q94B 5MP6L 1DN0B 2AV7B 1YNKL 4WW2F 2PXYA 1OAZH 1NDGA 3K4ZA 2GEEA 5MP6H 5FM8A 3DGCR 3MRIA 3IS1X 3AFLA 3IXTA 4B53A 2RHEA 1MFBL 3KJ4B 3FTGB 1K5NA 2KQNA 2WBWB 2DTML 3CFEA 2WINB 4F7PA 5L8KB 1MFBH 4I9WE 1WCBA 3IAPA 1JL8A 3UBXG 3C5SA 4NZRL 4NYLA 3D9AL 4R4FH 5F7WC 4U1LB 4X7TA 1JK8A 2VDRL 3BPOB 3L6FB 1UT9A 4M7ZB 2IBZY 4NZRH 3F7YB 5IJKC 3ZT5A 3PNWA 1XIWC 4I0CC 1RZ8B 1U3JA 1H8SA 3L5JA 4BUHA 4S1SH 1S7WB 5ESAA 1OP5K 3SE9H 3X3GL 4YGAB 5DTFB 5CEYB 2NX5E 5D5ME 4HZLB 1FPTH 1X6LA 1S7RA 3X3GH 1H3WM 1CU4L 3GB7B 1DVFD 4EKXA 5F1SA 3PIQA 4PLJD 5C0ND 2VISB 4K9EL 1CU4H 4P3DB 4L3EE 2YN3A 3MC0A 2I27N 3GIZL 3QEGL 4Z0BL 3WBDA 2X4OA 4YO0A 3RPIB 2G5BA 3LN5A 4TVPE 1OP5H 1A21A 4U0RC 3ZZ1A 3FRUA 2A9ML 4ZPVA 1DLHA 4BQ8A 3D2UB 2WBJC 2CUMA 4E0RB 35C8L 4W4NA 5H2BA 3KXFD 2DN7A 2ARJQ 4K3EL 5FOBA 4UI2A 4KMLB 1ETZA 3O9WD 4JZJC 3RDTB 35C8H 5IEKB 4F15B 3QA3A 4BSJA 5GGSY 4K3EH 1BX2B 2F58L 1NCUA 3AS0A 4BSWB 5J3HC 3WHXA 1BQHA 4HK0B 2HJLA 4JY5L 4N0YL 3PGFL 2EYSB 3TVMD 1DQDL 3PWNA 1GYAA 2FHFA 1CICB 3EJJX 4YDVB 4OI9A 1JGUH 4ZQKA 1KLGB 4N0YH 3KPSA 5I74B 5SWSB 3MA7B 2BVOA 3U4AA 1DQDH 4G42B 4KQ3L 3C8HA 1HHKB 2XTJD 3QXDA 1KJMA 1N5AB 1J8HB 4XGZA 1KJVA 2F53E 3OJ2C 4LMQE 3CFBA 4TOYL 3WE6B 5HHXH 1EXUB 1B88A 2W59A 1A7NH 4XTRD 4XH2B 5IROC 5EB9A 5C1MB 1NUNB 1Y6KR 2DQDL 1DLFL 1JE6A 1UXSA 3ZE2E 4CU8A 2F8OA 4KK8C 1JFQL 4P46C 5F72S 2CDEB 2DQDH 1DLFH 3HE7B 3V8CA 1JFQH 2A6IB 3OR7A 5EZOL 4M43L 3OGOE 4NNYA 4BK4A 1EGJA 3JV6B 4KKBC 1P5UA 4RMWA 2ZOLA 4M43H 4JRXB 1BFSA 4PRID 3SGDI 2BSRA 3M8OL 2BC4A 3E2HC 1T83A 3TA3B 1NUGA 1R3KB 4P9HL 4GKZA 4DKFL 3CZFB 4UTBL 2JB5H 3C2SA 3IB4A 5FCUH 3VG9C 2YUXA 5I76A 4DKFH 1S7UA 2VSDA 1MCFA 1PLGH 3DMMC 3QJFA 1BZ7B 1UXWA 2XYCA 1WV7T 3C5JA 2VDPH 1M6OA 1S5IH 4MQXD 1WC7A 2ICWB 1QYGH 2KL6A 5DD6A 5DMYA 5J9PA 3JBG7 3VFVA 5HYJA 3UTTA 5CHNB 4AQ1B 4OLUH 2RAMA 1H5BA 2ZCLL 4LLQA 2DMKA 3QIWB 2YD9A 1WZLA 4XCNA 3O6FC 3S4SA 3U2SA 4ELMA 4M93B 4GG6B 5BQ7B 2CDFA 1OGTB 5MEOB 3SGJA 4HV8B 2OMBA 2ZCLH 5KVDL 1D5MB 5I8KL 3UJTH 3NIDE 2CRMA 3Q3GA 3VXNB 5LAXA 5D7JA 5E9DA 2NY1D 3RVTD 4RA0C 1G7MA 1JV5B 1UM4L 4PJIB 3F6IA 2RQ8A 1I3GL 2PW2B 2X2YA 3MCKA 3VMOA 4FABL 3ARDD 4KWUA 1A9EB 4QHMA 5HGAB 1CGSL 1FNSL 1ZEAL 3QQ3B 3GSQB 1R5VA 2PETA 4EI5C 3T0EE 4K3GA 5IK3A 2SEBB 4GAJH 5JTWA 2G2RB 1E27B 5JORB 2NX5B 2DQCL 3EYVA 4J1UB 1J12A 4PJBE 4MQTB 4ZOCA 4L9LC 2A6DB 4MD5B 1R0AH 5C0EB 1B2WL 2V2XB 1FNHA 1J18A 1B2WH 1F3JA 4U0RB 2NY4C 4NHUA 2G75B 4NQDD 4OCRH 1IC5L 4OLYL 4P9ML 1G7PB 5KG9A 4PJ7A 1NLDH 2UVFA 2FRGP 5DJZA 2L0DA 1IC5H 1P7KA 4NJ9L 4YDJB 4OLYH 4P9MH 4LHQB 1DUZA 3L3JB 4X8XA 1QUNA 3BX7C 2DWEA 5DI8B 4NJ9H 1F4WL 5DRXA 1IZJA 2JJVA 4HUXB 3QEUB 4H5SB 2B4CC 3X12B 1AR1C 2NY0B 4KHTL 5EO1A 5D7LA 4BQ6A 1EO5A 5F9AC 1AKJD 4GUPB 1T1XB 5GQBA 3LEVL 1AFVH 1XGPA 4P23D 1JTPA 5L2JB 2AQ1A 2K1MA 1A6AB 3ULSA 2XQBL 3LEVH 5ANMB 1QSEA 2YUVA 3WFHB 1ZV5A 4FOMA 1ROWA 2EE2A 3AREC 1WIUA 4CJ1A 2XQBH 4LP4A 4GG6F 3IXAA 4KK9C 4HUKB 2P24B 3TWCL 1X5XA 5CKAA 3V5KA 3JWDC 2Y5TB 1FZMA 3TLRA 3U0TA 1GZPB 4AIZB 3O4OB 5MI0C 2F53B 3V5DA 5GHWL 2DQIL 4UILL 1EJOH 2JJTC 2GITB 2I5YH 4PJIF 1HNFA 2W60B 4QRRA 5I6XB 3ARGC 1CFTA 2ITDA 1FNLA 3OKKA 4POZD 4UILH 2FDBP 3RI5K 4O02L 1G7QA 2Y5EA 4N68A 5F7EH 3VE0B 5T5FH 2LV4A 4TQEH 5A1AA 4JANB 2F15A 1EUUA 1J1PH 1IC4H 4XXDA 4CVXB 4O51B 3MRKA 1T7VA 3MJ7A 4O02H 1LE5A 2W38A 5IP4A 4WWKB 5JHDA 3LSOA 3VFNA 5E2UL 3N85L 3EZJB 1JWUB 4PJ5D 2FLBT 1NGZB 3HG1D 4HPYH 5E2UH 1QP1A 2Y72A 2P45B 4YHLH 3SCMA 4OLZL 1K6QL 2X4SA 4MQSB 2CK0L 3VG9B 1YY8B 2EDQA 4YH6A 2A9NL 5CJBA 3ARFA 4LKXB 4OLZH 1JPGB 1FFOA 1X44A 3GGWA 3MFGB 25C8H 4KRPD 4FTVB 1QO3B 1OY3B 2CK0H 3DMMB 3X3FL 4HQQL 5F21B 1XMWA 1I9RL 5HY9A 3MRNB 4FFZL 3X3FH 5E5RB 1FG9C 1YNTA 4HQQH 4UMGA 1I9RH 4J3TA 4RGMB 3T2QA 4FFZH 3G5VA 3HZVA 1BM3H 3VRLE 2CGRL 2LU4A 3O6FB 2O93L 4LSPL 4F8TA 2CGRH 2DICA 1WTLA 4WO4A 5DJDB 3DLQR 1K4DB 4LQFL 4G6AC 1NC4B 4LSPH 4Q58C 4CN4A 5L2KB 4FXKA 4TNVK 2NY7L 3RTQC 4U1HB 5TDNA 3X13B 2NY7H 1V7ML 5DJ0A 4EI5B 1DBBH 5D7KD 4WUUA 1EUTA 5C0IB 1XR9A 4HDIA 5J1SC 5CUSL 2HKHL 4QHNA 5JHLH 4QKXB 5AZ2L 3MMEB 3HZMB 5GGTL 4E41E 2HKHH 3HN3A 4MDJB 3EYOB 1AC6A 5AZ2H 2YPKB 2XACC 2YD2A 4YZFF 5T3ZE 1VEOA 5GGTH 4HH9B 2Z35B 1ZA3B 3AXLB 4JZOA 1T22B 4F7EB 1AY1L 3QEQE 1M7DB 4RAUB 5DQ9B 3RL2B 1RUMH 3RVWD 2X9XA 3R8BB 4JVUA 4X7SL 2QHLA 1AY1H 1CL7L 3DRQA 4OFKA 1JNNL 2BY2A 5F93C 3LDBB 1BD2D 4X7SH 1DFBL 5CJOH 2ZSWB 1A14L 3R8QA 4K3JL 3O6LL 1DFBH 2PTTA 4NN6C 1HQ4A 1A14H 1A1MB 2AVGA 3GSXA 3ILPA 3O6LH 3D5OF 4DCQB 1ERNA 3W0WE 3CIQA 2I9TB 4OCYL 3ULVH 3BQUA 5DYOB 1K2DB 4FXGB 4O2FA 3MO1B 4LOUD 4YEEA 5HHOD 1EFXA 4O2EA 4KUCF 3C5ZA 2Q76A 4ODXA 3PWJA 4QTIL 2WIIB 2XTLA 4Y5VC 1NBYA 4D9QE 2LABA 5MI0B 2I60H 4LGSB 3MQIA 4QTIH 5IMOA 3PGCB 3DETC 1BF2A 3ARGB 4X4MA 4K3HA 3NIDF 3OKOB 1XF5B 3MROA 4L8SC 5EPMB 3TBTB 4I18A 4U3HA 3S37L 1I1AB 3BWUC 4JHAL 5EIVA 1MJ7H 1HQRB 3EYSL 2XZCL 4LCIL 5CGYD 3VI4F 5CEZL 3VXSE 5DEFB 4QWWD 3EYSH 2XZCH 5FYJU 4RAVA 5CEZH 2BVEA 5HYSG 2V6HA 1KIPA 4KDTA 1QSFE 4EN3C 1N8ZB 5MHSE 1BIHA 1ZLUK 2ZG2A 4PJBF 3STZB 5E8EB 4HMDA 3VMPA 5SWZE 1INEL 1Z3GL 4AZ8A 3DX7B 2WMPA 3MRDB 4RCAA 2O5YL 4MS8D 4PG2A 3BE1H 1I7RB 2ESVD 4DEPC 4GOSA 2PNDA 2BERA 4WFEE 1MHHB 1YZZA 1Z3GH 1QNZH 1SBBA 4DGVH 5J13C 3BW9A 2X4QA 4N0UE 3KPQA 4OM1L 1F6FB 5DSCA 5E00A 2D7PA 3ILQD 4FQQB 2FYYB 5DA0B 1CL7I 4OM1H 3TT3L 4V1DB 1YA5A 4OD3L 4N0CD 5A2KH 4EI6A 1ZLUH 2UZYB 5D71L 2EIZA 2OTWB 1IFHL 1YMMA 4IOIA 4LLVB 4L4TD 4UNUA 4EUPA 4PRNB 1HXYB 1ORSB 4W81A 5E6IA 3HNTH 1QACA 2H2SD 5D71H 3S3JA 3WEXB 1AO7D 1G9EA 4JPWL 1N0XL 1A1NA 2YD3A 4M8QB 1O7SA 1N0XH 4U31A 3ZKXC 3FZUC 4B0MM 4JFQA 4LIQE 4ZOAA 4I2XE 3ROOB 5HI3C 1KOAA 5I8OH 4LBEB 4N9GB 5TJWK 4BKLB 1KEGL 4HMCA 5BZWB 5K9OA 1CIUA 3QNXA 4RSVA 2C1OA 5IVXA 4R7DA 2Q8BL 3LOWA 3KNBB 2C3WA 1KEGH 2XFXB 1JGEB 2R23A 5KW9H 4B41A 1YEDA 3WNKA 6FABL 2IH3A 2EYRA 2EKSA 2Z91A 5B3JE 5MENE 1QEWB 4E41B 6FABH 5ERWA 3W11D 1IBGL 4OIIH 1SJHA 3QUMH 4HJ0C 3IFLL 4F8QA 1K4CA 4P4KA 1CD1A 1AGDA 3UO1L 3VFWB 2WV3A 4QXUL 4ZO7A 5DMJB 1ZS8A 1IQWL 3MLRL 5EA0H 2VE6A 3VD7A 3ARBD 3UO1H 3WFZA 3OKMA 4QXUH 3L3OB 3MLRH 2EICA 12E8H 5DK2B 4LFHD 2CSPA 4NN6B 4LVOB 4MNHA 5ACLA 3ZT6A 2P43B 2VLRA 3JV0A 3O3AB 1VGEL 4UDTB 5IKCA 1MY7A 3G5YA 1ZT7A 4CU6A 3W0WB 3N1QC 5JDSA 3GRWH 3P11H 1FC1A 3OAUL 3S8WA 3P9LA 1FFPB 3DPBA 5E0QA 3IDUA 3TYFB 3SDCD 5KSVB 5CP3H 1FIGL 4Y5VB 4HKBA 2P8PB 5DEGA 1FIGH 3CFCH 3OHXA 3UPRB 1PYWA 5D1QC 5E8NA 3PWVA 4L8SB 4UAOC 2GJ6E 1HI6A 4I0PD 1F02I 1FZOB 1RZFL 1YEEL 5DXWA 4JKLA 3MUY1 4YGVA 4OFYA 5KBNC 1RZFH 4BSVA 2IQ9L 4NQED 1IGYA 4Z7VB 4OCNC 4MNQB 2J8UA 4OGZA 1KELL 3QQ4A 5A2IH 4S1RL 1CFVH 1UCTA 3TZVA 3FO1A 2QQNL 4U1NA 4NN7C 4OGXL 2QQNH 3C08H 1CXKA 4DEPB 3L5XL 1ZA6A 4OGXH 5LBSH 1MFEH 3IDMB 5FGCE 1CXEA 3NVQA 1FCGA 2AK4E 1N4XL 2VDOH 3BIKA 5GGTA 2X4NB 3BI9X 4RDQF 1MCOL 5D6DC 4ZAKD 3TPUB 1MI5E 1K8DA 1WBYB 4JFYA 3RPKA 3GKWH 1MCOH 2GTWB 3A6CL 4NWTH 4XPFH 5DGQA 3UJJL 3QAZB 1I8IB 4F9PC 2W9LA 4JZNB 1HN1A 1UQSB 2EIEA 2LVEA 4N90D 2Z31D 3RZCA 2WANA 1FRGL 4RGNB 4G9FB 1UH2A 3EFFB 3SE3A 4OIAA 1JGLL 1FRGH 1FNAA 3UTOA 4UIKL 3RVVC 1SVZA 3MZTA 4GG8B 3WJJC 1AGCA 1WGOA 3G5XA 2IPUK 3IJHA 2CDGB 3V6ZB 3LCYA 1YJDL 1GXEA 3PQYA 3RA7L 3LEXA 3RUGA 3B2UD 2N7BA 3IU3A 1WF5A 4WU5A 4JVWA 4Z5RA 2HYMA 4DZ8B 5F7FA 1YJDH 3RWGA 4C4KO 4HWBL 3P9MB 3UTPD 1QFPA 4K7PX 3EOAB 1A02N 3FO0H 1MCKA 4JHBA 1N2RA 4HGWA 4Z7VF 3HRZB 4NRZB 4NQSB 4LLDA 3VWKA 2BNUB 5DJXA 5M94B 2V7NA 3BP6A 1KBGL 3GSWB 2IANB 3FFDA 3LY6A 1CFNB 3GJFB 3D25B 3IGAA 2FLRT 3FQUB 5I66B 4R9HA 3GKZA 4ZSOB 3LKOA 1OARL 2ZUWA 3LVEA 4L1HA 1MNUH 3FT2B 1T5XB 1AJ7L 2E3VA 1WAAF 4KRMB 4D2NA 5CD3A 2JCCE 1AQKL 5HHME 3QG6A 1AJ7H 3GJEB 3WLWD 1I8MA 4WDIA 4GH7B 4Y1AB 5JLZB 1AQKH 5FV2A 1I4FB 4WI4A 4KAQL 1CF8L 4U1JA 2APVA 4I5BA 3EYQD 5C6TH 3U4EB 4LFHG 3HS0A 1X3DA 4LCYA 5BS0A 2V2TB 2PYEE 5CWSB 4YXKL 2EYTB 3GIVA 1FYTD 3KPSD 3QO1A 5FKPB 5D1QB 3OPZH 2EDFA 1MRDH 5DQJB 4YXKH 4XI5D 2X40A 4YDKL 2YPLB 1T0NA 3CC5A 1RUQL 5GJTL 1CYGA 2VR4A 1TVHA 3QO0B 2NZ9D 4NPYB 1AI1L 3LIZH 4YDKH 1RUQH 1FV1B 5GJTH 3KPNA 2FGZA 1AI1H 2ZG3A 1D9KD 2EEBA 4XWGH 3MRBB 4KKAC 1WBZA 4JKPL 3Q1SL 1Q72L 2FIRT 2V17L 5DMGD 2YA0A 3SKUD 3L7FA 4NN7B 1WWAX 3RKDD 4QXGL 4JKPH 5DJCB 1Q72H 2FIKB 2V17H 2UWEE 5B3JF 4EXKA 2IQAB 4PBVC 4LCWA 1U95A 3FQXB 4QXGH 1UB6A 1IQDA 2X4RA 3FAWA 4HHAA 3RWJA 4PRBA 1CLZL 3I9GH 1U41A 4ELKB 3HR5B 3DYMA 4MSWB 1QSZA 3PE9A 2X1WL 5GGQL 4XHJC 1CLZH 4APQA 2ICWJ 2EIBA 4JJ5A 3QUMA 1Y0LB 4R4ND 5GGQH 2UUDK 3VFOB 5FDYA 1FFRA 4KJQD 1Z2KA 2R1XA 3HUJE 2Q7YB 4ETQB 3MPCA 5I1DA 2XXCB 5LJYH 4OCSL 2KPNA 4HXAL 4Y5XB 4GRMB 3O6KH 2CH8A 1HYRC 1LK3L 2ENYA 4WFGD 2DDQH 2HT2C 4OCSH 1BECA 4HW6A 3OG6B 3BJLA 4X7CC 4UBDD 1LK3H 3H6JA 3O3BA 5A16B 4ZFOL 2UZIL 1I7UB 1X7QB 3BKJH 2VAAB 2IADB 3UTTD 4YHPA 3TBWA 5FYLE 4U3CA 3U0PA 2UZIH 4J7RA 3QIBD 2UUDH 4TVPL 5DJ6B 3RAJL 2JJSA 5DT1L 4GAFB 5DDHA 2H3NA 1AXSB 2AABL 4KQ4L 3GRWA 3RAJH 4G5ZL 2LAGB 2A6KB 1YEJL 5F7DA 4IMLB 1S7SA 3KYNB 4G5ZH 2HT4C 1G7HA 5C09E 2PF6A 1MELA 1YEJH 3M17A 2ZKHH 4G3YH 5J8OA 5GS2H 1HHIA 2P5WB 2CIIB 4YXHH 5KSBA 3MODL 4HK3J 1PGRB 4DUWA 4ODHL 2VLJD 2NR6C 2ICWI 2OR9L 4PRPA 3BJ91 1IMHC 2G60H 1KENL 3MODH 3RIAF 1QOKA 3O2DA 4ODHH 2Y06L 2E6QA 2OQJA 2OR9H 1A6WL 1PKQE 1YYML 2X4TB 1KENH 4OSUH 4JFOB 5I1AA 3QQ9C 1A6WH 3FO9B 2NY3C 1AGEA 1YYMH 1HKFA 4P2QA 5IB1B 1E6JL 4QOKB 3PJSA 1E6JH 1TPXB 1URLA 3EDKA 3IETA 5EU6B 3O4LB 1TJIL 4HC1L 3PDOA 2FO4A 3BMWA 1WICA 2JCCB 2NNAB 3H3PL 5HHMB 3RVXC 3REVB 4HC1H 1NJ9B 4Z76B 1E4KC 1A3LL 3IYLW 1U3HB 3H3PH 3MRCA 3U36B 4WEBL 1A3LH 1KN2H 1LILA 4ZO6A 3QPXH 2J2ZA 1U8HB 4LSQL 3B5GA 2W92A 4C4KT 3IDIA 4EDXA 3OJDA 4WEBH 4O00A 2PYEB 4XBGA 1VGKA 4XT1C 4R6UA 2CLVA 5CZVL 3BAEH 4KK6D 4CNIB 4MAYA 3ZHLA 3ES6A 2VIRB 5E8OB 1HEZA 4M7KL 5CZVH 5F96L 5ESQA 3PXHA 1EEYA 4CGTA 5LGKA 2HAZA 5F96H 2VMFA 3PDDA 2XZZA 1MIEL 3GO1H 2B0SL 3SKNB 3LQAH 2V7HA 2OR8A 1MIEH 5L0QC 4RAHA 1U42A 1OAQL 1GZQB 5B38A 2UWEB 5JHDD 5CZXD 2KUTA 3QFJA 4FQJH 5BO1L 4TUJB 3FN0L 1OAQH 2A74A 2GI7A 3V6BR 4QXTA 3HZYB 3A67L 1S9VB 1R5IA 4XXCA 4BH7B 3FN0H 1C12B 4PTTB 1ITBB 3VGGA 4HPOL 4GKNB 4NCC2 1R3JA 3LV3B 3LKPA 1G1CA 4LMQI 4KROD 4NHCL 3MCLL 4H25B 4LVNB 4RFEB 2IGFH 4HPOH 1ED3A 2XQYK 5EUOE 2PW1B 3IVKB 4NHCH 1KG0B 1YYLH 3NTCL 3BH8A 2UY7A 3MBEC 4X99B 4F7CA 4IOFC 2JCCF 4HX1A 3IDJB 3I6GB 4FQHA 5AYQA 3HE6C 1YEKL 3K3QA 5TE6L 2UYLB 5C0GB 3SY0A 1AQDA 2I25N 2R2BB 4Z95L 3LEYL 4PLKC 4P2RA 3JTSB 4MCYB 2FX9H 3O8XC 3U82B 3JV4A 4Z95H 3TO2A 2DWDA 4MA1C 3LEYH 5IMMB 2B4CL 3WNNA 2VDKL 1TCRA 3LN4B 5I18H 4XCFH 4IRSD 2B4CH 3MBXH 5JO5A 3WIHL 2OL3B 4WUUD 3QUXC 4UINL 1W0WB 1YQ2A 3JTTA 3VDCA 4RQQB 4G8EB 3I02A 4Z7WB 1NFDA 3NFPB 5FYKU 3V5HA 4E42B 4UB0L 1X4ZA 4PJAA 3Q2CA 4QT5A 4NO0B 1CT8A 3KXFB 5EBLA 4L29B 1ZAGA 5C07D 2OZ4L 1IGFL 3JWDL 4UB0H 5T5NF 3T2PA 3MRQB 2FZ3B 5T1LD 4LSUH 1PKQB 4NZUL 2BOCB 3JWDH 3SDAA 4ZOEA 3D6GA 2UWEF 5J6GA 3MRRB 1YMHA 5K9JH 3G6JB 4KGLA 3CD4A 1A6UL 3ETBF 2WUCL 5IB2A 4N5ED 5DK0A 3QDMA 5DMKB 4H88L 4M62L 3LKSA 1UVQA 2J8HA 1DQLL 4QTHA 3D39E 4ONFL 1U8KA 1FZKA 3PWPE 2VDNL 4OQ1A 5IJKA 4HBQA 1DQLH 1XIWA 2APFA 4ONFH 2AJ3B 3HUJF 5IESL 2R8SL 1S7XB 4MZ2A 1BZQK 1V7NL 1F6AB 4YFLF 1ODAA 1VKXB 3MV8A 1KULA 2R8SH 4UDUB 1XCTA 3RJDA 2YBRA 1V7NH 3ZL4L 2FHBA 4WFHE 4AMKL 5EZLA 2XNAB 4H1LH 1XGTB 2Q1EA 1NH6A 1R5WA 5D5MA 1RIUL 4FS0A 3ZL4H 4NBXB 2DLFL 4LDEB 1I9JH 3C5ZD 2XG4A 3E1F1 3STLA 3O45A 3CSYA 1JMXA 2DLFH 5D6CB 5J56B 4OBRA 4WEUD 1W72A 1GC1C 3N0PB 4PRIB 2BNQD 4ZFOA 1HSAB 4Q9RH 1AHWC 5KS9B 1D6VL 2YRZA 2KH2B 1F90H 3BUYB 2BHZA 2ZOKA 3VG0H 5L0QB 3P0GB 1NFIB 5JW5A 1EVTC 3H9ZA 5K9KB 4JZJA 4HKJB 3EDDA 4Z7WF 3CFKB 4I0KA 4LKCA 3X14A 3S3PA 2C1PB 4Y19E 4N0RA 4OF7A 1I7TB 2LVCA 4AENA 4GQ9L 5CBEB 5D7IE 1FP5A 1BJ8A 1F3RB 3BP7B 4GQ9H 5DWUL 5TE7L 5FDWB 3EJYC 2GSIB 3GSVB 5E7BA 5DWUH 1VPOH 1MVUB 4PJ9D 4W6YB 5EUOB 1VFOA 3MBEB 5TE7H 1U8OB 3VRIA 3FQWB 4NC2B 5T3ZL 4PRDA 5IROA 3U46B 3I6LE 2JK5B 3PL6A 4AM0B 3BZ4A 1YMMD 1U8LB 5GGUA 5T3ZH 4ALAL 1QRND 4JM2A 3RX7A 3ARVA 4P46A 3OXRA 1FG2A 3J7HA 1RUPH 5HHQB 3FB7A 1VHPA 3INUH 4MB3A 5IOPB 4ALAH 3RU8L 2DL9A 4H26A 4P2OA 1C16B 1D5ZB 3MV7A 2VWEE 5C08D 1BPVA 4NNXA 2A0LD 3UMTA 2OJEB 3WFBH 1ULVA 1I1FA 3T77B 43CAA 2VWEC 1BFVL 2HFFB 4PYHA 1U92B 3QUXB 1KTDB 1ITCA 4ZPTA 1B6DA 2GW5A 1LP9A 3P30L 3QEHB 3QUYD 4OT1L 1VACB 5B22A 1GL4B 2IALB 2R9HC 4QRUA 4GW5A 5TF0A 3P30H 4OT1H 1JYXA 3MLYH 2BX5A 2GUOB 3BEWB 3G6DL 2XA3A 2R2HA 4JY6A 2DAVA 5DUBB 5CJXC 1T0PB 3RY4A 5BJTA 3RIFF 1T5WA 2D31A 2VUYA 4PJFA 4K3DH 3MCG1 2LQRA 3V4PH 3AAZA 5I71B 1IGTB 4U0QB 5HGDA 2VC2L 1AKJB 3QWOB 4NKOB 2AP2A 4CVZB 4FMFA 1D5BA 3NZ8A 2VC2H 3QIUA 4PTUA 2WSKA 4HKZA 2E7BA 2DM2A 2E7LC 1FL3B 3EBAA 4OLXL 4XNQA 3LQZB 3WCYA 4ZMAT 5ID1A 2DYPA 4FFVD 4P49A 3D18B 2DTSA 4MLIA 5HYSB 2BVUA 3C6LA 4OLXH 4H8WL 4P5KB 3BRGC 3D69B 4TUKH 4WTWA 5EUOF 4PJ8C 3ECBA 1RJZA 4ZUSA 3TO4D 5C0FB 1ZKAA 5C0CE 3T0EA 1MHCB 5SX4H 5IG7A 2MHAB 4L9LA 2BMKA 1QPPA 3NBNA 3VGFA 4NFBA 1EFQA 1YECH 1QBLL 3GI9L 2YHGA 4ZYKA 4KRNA 4PJ5B 1WSST 1INQB 3HG1B 4MJ5B 5I8CA 4Z6AT 1QBLH 4BZ1L 3GI9H 1HOCA 5CIPH 3GSUB 3MNVB 1TITA 5C71A 1TXKA 1D3CA 3MGAA 2IH1A 3DBXA 4PUBH 4KRPB 5CBAA 3C60D 3BVNA 4WJ5A 4PJGE 4ODUB 3KPLA 5DUPL 4LHUA 4Y5YC 1KCUH 1T04B 4Y4KC 4LEOB 1IT9L 1FORL 1C8PA 4I8DA 3EYFB 2VZVA 1UWEL 3FOMB 1CGUA 4OZFH 2KBGA 4LLYB 4LIQH 1IT9H 3ZTNL 1FORH 1TZIB 2AJZB 1UWEH 1CDHA 1U9KA 3TNMA 3BO8B 4UQ3A 3R0NA 5D7IB 3V6FB 3AREA 4JO1L 1U0QA 3FHAA 4PP2A 5DFWH 5B8CA 5CD5D 1XF3A 4NKMB 1LDSA 3QFDB 2VLKD 3HLAB 2RB8A 1YEGH 4MHHI 4K94C 4Q2ZB 2R0KH 4XP5L 4ZUWB 3TIEA 4MNGE 43C9A 4M9OA 4P3WA 5DS8A 3SDDC 1T1ZA 3S34L 1I1YB 2GCYB 2FBJH 4XP5H 3C09C 3QDHA 5EU5A 1U8QB 4WCYL 3S34H 2Z93A 4LLWA 4R2GD 1RU9L 4JJHA 4WCYH 5C0AA 4J4PA 3MV9E 1JZ6A 3HKFA 2BNRD 2VL5A 1LO0L 5HJ3B 1RU9H 5SX4I 1OF2A 3FRPA 3O2WH 1LO0H 3UTZA 4XVSH 3ULVD 1ZT1B 3VCLA 5ISZD 5JOPE 4C58B 3BDBA 1MWAB 3PWLB 2J3SA 1CDCA 3VWJA 1OP3K 2GK0A 3WN5B 1EEZA 3VXMA 5D2NA 4ZUTB 3OKLB 2W1NA 5JMOC 1TZHA 4KJWD 1A4KB 3BXNA 5I17B 1FZJB 5GGRA 3CPLA 3AM8C 4PRAB 2Q6WB 5BRZA 4JFFE 2YS4A 3BH9B 3VXOB 1XZ0B 1X4YA 3WIFA 2NY2C 3RVUC 3TCXA 1NKOA 3IJYA 1OP3H 5T1MB 5C6WH 3LRSA 5IW6B 1JZ4A 1LE9A 4P3CH 5FA4A 4CN6A 4BFIA 5CEZD 1NUFA 1OD9A 3QI9C 3DXAB 4FHBD 1P1ZA 1DBML 5ID0A 2QR0B 2QBWA 5B3NA 5D7IF 2XZAL 4XHQA 3RTQA 1SYSA 3C9NB 4ZS6C 4F37F 1KPRB 1UG9A 5EOQH 3WSQL 2ZUYA 1DBMH 2FR4B 3TC9A 2XZAH 4PJ8B 3NCYS 3BPLC 1RJLA 3NN8B 1I3RA 4JDVB 2MKLC 3SE8L 1MFDH 2JJWA 2LTQC 4R8WL 2ITCA 5FM5O 1AR2A 4X6CB 1XGRA 2P8MA 5C9JB 1LK2B 1MSPA 5EZIH 3VXRE 3ZDZF 4POYA 1UA6H 4X5XB 5C0CB 5B4MC 1BEYL 4U1SB 5TQ2H 5CAYB 5BS0D 3S3SA 4TTGA 3RGVC 4X6FB 2WUBL 1OTUC 2ID5A 1Z9MA 3MFFA 2V5MA 1EBAA 4UZGA 2R1WA 4OAWA 1OLLA 3O41B 5ADPL 3S5LB 5J89A 1HHGB 3V2AR 4XNUH 3ZE1E 1BWMA 3GSRA 3QEQA 5ADPH 3SGEH 5KTEL 2V5RA 4PGCB 1KV3A 3OKEA 2D7OA 1HZHH 3Q5OA 5A2LH 5JPMA 4LDLB 5DFVD 3MLZL 4N0FA 3WUWB 5HXMA 1P4IL 1VADA 5JOFB 1GCFA 4PY7A 1R3HB 5DHYB 4PJGB 1DP0A 1KGCD 1L7IL 5C8JB 3BWAB 3FFCD 1P4IH 3KDMA 1HE7A 2VR5A 1PZ5B 4IIQC 4PR5B 4Z77A 1M7IA 1O5DT 3ORJA 4LCWD 4LVHC 1L7IH 3VFRA 3VD4A 4NO2B 4H20L 3VJ6B 1AO7B 5F9WC 2XZQH 1T1YA 5AAMA 1RIHL 2WAHA 2NY6B 4H20H 3WDJA 2PXYC 3WS3A 1RIHH 1KPUA 1T6WA 4OM0H 3LKQB 4OD1H 3K0WA 5ICXA 3SDDB 4U7KA 1K8IB 2XKSA 3C09B 5EU3B 2FEDC 3WO3B 4DQOH 3TM6A 2Z4QA 3LZFH 1YN6B 3FT4A 4OCXL 3MLXH 3KJ6L 2YN5A 3QNYA 4JREB 1SM3H 4PGBA 4PFEA 3QDGE 4OCXH 1A64A 4JAMB 5ADOL 2YXMA 1K9TA 1NL0L 1MOEA 4EN3A 2V2WA 4XWOD 5KOVC 5ADOH 4YBHA 1M05B 4AEEA 1TTFA 3RP1A 3RWEB 2AV1A 1IC1A 1NL0H 3TJEH 3UTQA 5JW4Q 5GGSB 1KIQA 4K07A 1LEIA 2YC1B 1UM5L 4QY8B 1FVEB 1CE6A 5CSZA 1GGCL 4HS8L 3DV4B 1XCQB 3SGEI 1IE5A 1ZK9A 1CTOA 3PABB 3VA2C 2FBOJ 1TMCB 1GGCH 4HS8H 3IJSA 1T4KB 4N0UA 1X5LA 5KVFL 4JM4H 4PRPD 1RUAL 4X9IA 5L88L 3RZWA 5HVGB 5CIPA 2OP4L 3S96B 2NY2B 4XRCB 2R56L 2CR6A 4J3WA 5KVFH 2DJSA 3GSNB 5L88H 1I8LC 1P69B 5SX5K 2OP4H 1S9WA 1GHFH 4PJGF 2ATPA 4JFFB 2R56H 1FJ1A 4M6NH 5I1CL 1WZ1L 5BV7H 4OKVB 2Y1VA 2FO1A 2J5LC 3IFOB 2ADIA 2AQ2A 4D9RE 1L7TH 1KPVA 3BPCA 3SDCB 4UV4L 2ADGA 3UC0L 1S9XA 4QRPA 1HHJA 3VFSB 3TBVA 3E8UH 4NRYB 2JKXA 1A7BA 3IF1A 4L4VA 3T1FB 4LAQH 3B9KA 3H3BC 4ODWA 3UC0H 4KK5D 5FECA 3U79A 3BPLB 4OZFA 3CDGA 4FQIL 5CJ8A 1YDPB 5DRWB 4HIXL 4LCCC 5HHPB 4I2XA 1SJEB 2VR9A 1F2XK 4PV8A 5GGRY 1XGYH 4FQIH 4I0PB 3HPJA 5SX5H 1ZT4B 5BOPA 3MLUL 5GZND 4HIXH 4P5TA 1VFAB 5I75C 2R4SL 5F89B 4XNMB 4AH2B 2QHRL 4NQEB 4ZXBC 3RGVB 5L9DL 3K81A 1JZ7A 3VXRB 4JQXA 5MENA 2UY6A 4OFPA 4YXLL 4JFED 4OF0A 1ZVHA 4YE4H 4QCIB 5GSRB 2MQ0A 3HI5H 1CBVL 1G7JB 5DHXB 1KJ2A 3QZWG 5D7SH 4U6VL 2JIXB 5H35B 3Q6GL 2VH5L 5C0BD 2GAZB 2O5ZL 3TBSA 4D0CB 1CBVH 3VFPB 3FB8A 2D0HA 4W4OA 1BHGA 4AEIL 4OCLC 4KJPD 2O5ZH 5GZOD 1RQ5A 1CIDA 3ZTJH 1IM9D 4XCYA 1T83C 5HDOA 2DF3A 2XT1B 3EJZD 4AEIH 5FYLL 1MUJB 5HDLA 3SN6N 1BGXH 3GMNA 4IIQB 3OG4B 5DD0L 3CMOL 1T66C 3SHSA 4LGPB 5FYLH 3QNZB 3PP4H 3RDTD 2FH6A 4ZFFA 5F9WB 2DQHL 5T1DL 3QFJD 1QRKA 3CMOH 2PXYB 4NKQB 5HYJE 1NDGB 2DQHH 4G80A 2VZ1A 5T1DH 1G6RH 2OL3L 4ELME 3MRIB 2D9QB 1LD9A 4FQPA 2FJFA 3IXTB 4ZUVA 4TSCH 1BQSA 1OB1A 4X9HA 3VFTA 5DUML 1K5NB 1CICD 1FHGA 4QRSA 4F7PB 3CFEB 1KCVL 3QXVA 3EYUL 5F9OH 4JCMA 5SWSD 4CJ0A 1ZLSL 1WCBB 5DUMH 4QNPE 3C5SB 4NYLB 5E9DE 2W07A 2X1OA 4X7TB 1KCVH 1JK8B 3EYUH 3VXTA 1ZLSH 3EKCA 5JXEA 3ZE0E 5FHAL 4X7EC 5D7JC 2GJ6A 3PNWB 1UJ3A 2VTFA 1ZGLM 5FHAH 3O3UN 2I07B 5C2BL 5ESAB 3DOSA 2YD1A 1I85A 1TJHL 1Q0XL 5JZ7C 2CLZA 4WW1B 5DHVH 3K8LA 3QB7C 1S7RB 1UZ6E 4G6JL 1TJHH 1VA9A 3NH7L 3I6KA 3HE7D 4P2RD 2JLLA 3OB0K 4M1DL 3PIQB 5LXGL 4M1GL 3W5MA 1BBJA 4G6JH 5JR1H 5E4IA 4ZS7L 5JIKA 4M6OH 4KKCC 3HI6L 1H3PL 2P46B 4ZS7H 2X4OB 2ZUVA 4YO0B 3U0WL 3NABL 2YRLA 4LL9A 2G5BB 4OQTH 5HI4C 5D6DA 3LN5B 4Y88A 3BGFB 5DD1L 5T1KA 4YFLI 3FRUB 3U0WH 2AK4A 3TA3D 1A3RL 1DLHB 4ZPVB 4X98A 4R3SB 3LRHA 5H2BB 3R1GH 5FGSA 2GJZA 3CSGA 1A3RH 3EFDH 1Q1JL 3OB0H 4X7FC 5D4QA 5FOBB 1ETZB 3V7MA 1T2QH 2R15A 2F5BL 3DYOA 3QA3B 3HAEH 1Q1JH 1TENA 4HUWA 5D7LE 3WUZA 1CDJA 1A6TA 4D0BA 1H3UA 3HB3C 3PGDA 3WHXB 1BQHB 3HC3H 4HFUL 2Z9TA 2HJLB 3PWNB 3WJJA 1QSEE 5IMLA 4ZQKB 2EC9T 4HS3A 3KPSB 2BVOB 1P4BL 2EC8A 2DKUA 2IPKA 1T3FA 4LGRB 3QXDB 1KJMB 1RIVL 5TE4L 2ZCHL 4XGZB 1P4BH 4I9WD 4X8JA 1KJVB 5I75B 1BFOA 3CFBB 4WI3A 4Z7QE 1RIVH 1XIWD 4FQCH 5TE4H 4FRWA 3BUTA 4JO2L 3MRGA 1UZ8A 4QRRE 2WWMC 4JQIH 5F3BA 5MEPA 4JO2H 1UXSB 3L3HA 4KH2A 4Z8FL 5IJVA 5HD8C 5AUMA 2NX5D 4KXZH 1F4XH 5D8JH 5GSVA 1GJIA 3OR7B 4Z8FH 2CRZA 3UZQA 3MJ8A 4NNYB 2APXA 1Q9LB 4G8IA 2ZOLB 1OW0C 4L3ED 4I77L 5I16A 1GAFL 5DZLA 2BSRB 4P57A 2BC4B 5CJQL 3SCMC 1HH6A 1SQ2N 1GAFH 2AJVL 2WBJD 3LAFA 4GKZB 4HCRL 4XPAL 1SEQH 4TVPD 1FE8L 1PVHA 5I76B 3ARFC 4XPAH 2AJVH 4HCRH 5E1AA 1S7UB 4Y4HA 3AMKA 1FE8H 4XMLH 3QJFB 2EDKA 4JPIA 1UXWB 4K2UL 3C5JB 1M6OB 1WC7B 3I2CL 2VXSL 4OZGE 3RJQB 5CGMA 5GS2D 5J3HD 5DD6B 5TH2A 5J9PB 2E7MA 3I2CH 3VFVB 5HYJB 3UTTB 2EDDA 1H5BB 5CILL 5F70A 2BK8A 4LLQB 3NPSB 4XCNB 5ITFB 3S4SB 4ELMB 8FABA 4MDIA 3U2SB 3QSKB 1QKZH 4RBPH 1MCDA 5IV2A 4WO4C 4XP9H 3N1GC 2HH0L 3Q3GB 3TN0A 2R0LL 5D7JB 5E9DB 1G7MB 5IT2L 1MVFA 4TUOA 4YR6A 3D85A 2R0LH 2YD5A 3MCKB 3ZSSA 2F53D 3W81A 4QHMB 5IT2H 3DX9A 1EJ6A 2DI7A 1R5VB 1N26A 1QBML 4KK8D 1DQJA 4NIKB 4P46D 5IK3B 3H42L 5CP7A 1EHXA 1RJCA 2IPUG 2MCG1 5GRVK 3VD5A 3HMXL 4MD4A 3EYVB 3H42H 2P44B 4WFFD 1F42A 1NMAL 4RISL 1JGDA 3GMMA 4JFHE 1LO5A 3OXSA 4XX1G 4KKBD 5K59F 5EIQA 4KXZI 1QLRA 3QXWA 1NMAH 4NQTA 1JWSA 1F3JB 5D93C 1MAML 4DVRL 5C9KA 3OKDA 3NIFE 4NHUB 1CLYL 2HG5A 5KG9B 1MAMH 4PJ7B 4CMMA 5DJZB 1C08A 1CLYH 4KVCL 1P7KB 1DUZB 3LQMA 3NIGE 4Y89A 3DMMD 2DWEB 2YRPA 4KVCH 5DRXB 1Q94A 3P4OA 1EBPA 1GC1L 2AXGA 4G6MH 5DGRA 1NCWH 1BVLA 5EBMB 4V2BA 1MFAH 5D7LB 1GC1H 4WTXA 1XGPB 3O6FD 1AGBA 3BQUC 4KUCD 1B4RA 3ULSB 1JPFA 2XWJB 1QSEB 3IDXH 4OZHE 4BZ2L 4L4JA 4ELMF 5E70A 1NC4D 1F3DJ 5FO8A 4UIMA 5IFAL 3IXAB 2HP4A 4TNWF 3V5KB 4BZ2H 4F7TA 1FZMB 1U3YA 2O5XL 3S36L 1G6RA 3H7BA 4X80H 1OAKL 4QNPF 3BDYL 4IJ3C 2ED8A 2AKRA 1RURL 4EI5D 2ZG1A 5C09A 4QRRB 1BBDH 4F57L 1OAKH 2ICEA 2ITDB 3BDYH 3OKKB 3ZE0F 1Z9OA 1VB9A 2QQLL 1G7QB 2QJDA 3VDAA 4K7FA 2X41A 4Z7OF 4L5FL 1TJGL 4XXDB 3MUGA 3WXVL 3L3KA 3MRKB 3W39A 3MJ7B 1LE5B 5HGHA 1ZSDA 1C5DA 3H9HA 4P3DA 3EHBC 5JHDB 1Q9WA 4L5FH 1B0RA 3VFNB 4IMKA 3T3ME 2YUWA 3QUKA 4EZMA 1AE6L 3OZ9L 3BZDA 2NY4D 4JDTL 4HBCH 2IWGA 3LMJH 5DHVA 1AE6H 3HMWH 1JPSL 2XXMB 1J5OL 2X4SB 4JQVA 4KV5F 4M61A 3D2UA 3FQNA 3ARFB 5E2TL 1FFOB 3GGWB 1JPSH 3FKUS 4TVSa 1J5OH 1QFOA 1RD6A 4L3CA 4PJ7F 5E2TH 5HY9B 2Y25A 1DANU 5LCVH 4LHUD 1E4KA 1F4AA 4OQTA 1YNTB 1K85A 1PG7L 4WVRA 1AR1D 1MFCH 2EDJA 4YK4C 3G5VB 3HZVB 4DK6A 4WHTA 1MWAL 1PG7H 4OIBA 2CKBL 3B9VA 3BD5A 4I3RL 4PS4L 4I3SL 5E6IC 5GS0C 1MWAH 4WO4B 1UCBL 1MCPH 2CKBH 4PS4H 3ARED 1MCLA 3V4VH 1UCBH 5FUZL 4KK9D 3HAEA 1DQMH 4FXKB 1RAMA 1YEHL 5JIHA 4ZD3L 3MLSH 2QQKL 5IVXE 4NZTH 5TDNB 5HDBE 4DK3A 4AEHH 4HIJB 5DJ0B 4LP5A 4WUUB 3ARGD 1XR9B 3K4AA 4HDIB 4QHNB 4Z7QF 5JUEL 1IC7L 2F54E 5C07B 3H9YA 1KT2A 5KVMC 1PW3A 5JUEH 1IC7H 3A6OA 1CN4A 3L95A 4FFWC 3O0RH 4XBEL 5T1LB 1RZ7H 5BMFH 3IDYC 4NN5C 3Q0HA 4JZOB 3EZ8A 5A40E 4XBEH 4MAUL 4P4KC 4Y4FA 3HNSL 2H9GA 3K8KA 2J88L 5TDOA 1CD9B 1GOHA 4Z9KB 4MAUH 3DRQB 3U1SL 4PGDA 4KFZC 1B0GB 2J88H 3RNQA 4MJ6A 2GJJA 1T89A 1BIIA 2PTTB 1HQ4B 3ILPB 2JB6B 3ZMRA 1U8MA 4RX4A 5E95B 3GMRA 1DEEA 3H9SE 3W2DH 3ZDYF 2CMRH 2X10A 3HE6A 4OTXL 5CHNA 3V4UH 2NTFA 3BQUB 4P23C 4PJEA 5F7UA 3DUUA 3WO4B 1FN4A 2P1YA 3A0OA 4O2FB 4G6AD 5BVJA 1WT5A 4MQ7A 3O8XA 4LRIC 1WEJL 1EFXB 1BQUA 4WRLA 4O2EB 3WXWL 3C5ZB 1VFBA 2Q76B 4ODXB 2DQEH 3PWJB 1NBYB 4KHXL 3RTQD 3RHWF 3M07A 4Z7UE 4KTEL 1P7QA 4IJ3B 5IMOB 1BQLH 4KHXH 2RJMA 1TZGL 5FAAA 1MRCH 4U1GC 1OCWL 3FB5A 3WFDL 5JQ6L 5JPNA 3MROB 1JHKH 1OGAA 4I18B 1I1CA 5GRZA 2ATKA 2HFEA 3UJIL 1OCWH 3GM8A 4POZC 4UNTA 3WFDH 5JQ6H 4WGWB 5FHBH 5IB4A 1CD8A 1WCQA 4J1UA 1LO3H 3UJIH 15C8H 2Y9RT 4K94L 1ES0A 2FD6L 4RAVB 4Y16A 5C0EA 4E41D 2KKQA 4ZNEE 1EAPA 1KIPB 3TZVC 4QHLA 3KPPA 2ZCKL 2FD6H 4C56A 4NQCA 5T3ZD 2G5RA 2AJSH 1HHHA 2DBLL 1G7PA 4DGIL 5J6HA 3U83A 4HIHA 4YDIL 2DBLH 3QWRA 1V5JA 4TULL 1NCNA 1QVOA 2X4QB 3BW9B 3L3JA 3K8MA 3KPQB 2EEDA 5E00B 4JG0H 5DSCB 2P7TA 4X9GA 2CXKA 4ODVH 2HFTA 2IG2L 1SY6L 4EI6B 3PWPA 2EIZB 2PN5A 1SY6H 1YMMB 4IOIB 4EUPB 1CLOL 3W0WD 4WV1A 4HWUA 2PTVA 1NGWA 1F2QA 3WNOA 5L2JA 4QRTA 2K9UA 3RZCC 3FHQA 5GISL 3ZDXE 4F33A 2LU3A 1JTTA 3CH1B 1U8NA 3VGAC 1A1NB 2D9CA 2WM0A 4B7LA 3JXAA 5DD3L 2DIBA 4GLRI 1KUMA 3HFML 5GISH 3PUCA 4LSSL 1S7QA 4LHUG 4JFQB 3TESA 5A2FA 4LSTL 5DD3H 3PQYE 4U1IA 3DETD 1PX4A 1RUKH 2GT9A 4D9QD 4LSSH 3B83A 2X4UA 5K9OB 3QNXB 3GSNL 4LSTH 4HUVA 2C1OB 5IVXB 4R7DB 3HZKA 3SOBL 4XAKE 3WDIA 2YWZA 1B4JL 4NRXA 1XF1A 4TSBL 1AD0A 5C7XL 3GSNH 1T2JA 3OAZK 4FQXA 2R23B 3SOBH 2D4DA 1IGIH 3MYZA 1YEDB 1B4JH 2IH3B 2EYRB 2EKSB 2Z91B 2VABA 2Y36H 2APBA 5EOTB 3IDYB 3VXSD 4EN3D 1FFNA 5ERWB 2MMXA 1SJHB 4LAJH 4PB9L 1QLEL 3PV6A 1K4CB 3CAFA 1CD1B 4Q9QL 1AGDB 3AB0C 4BA8A 3MOBL 4Y19A 3CSPA 1QSFD 2OYPA 2AJUL 4Y2DA 3VWKC 1BD2E 1QLEH 3V52H 5MHSD 4Q9QH 1ZS8B 4K8RC 1NC2A 3MOBH 2VITA 2OI9B 3X11A 2AJUH 3OKMB 5SWZD 3OAZH 3BISA 1CFQA 1NEUA 1W2KT 2B39A 5J11C 5GPRA 4MNHB 4RFNB 3EO0A 4ERSL 5JDJA 2VXQL 4KI5E 2VLRB 1MJ8L 1MRFL 1N6QH 1WBXA 2VDLH 1U93A 3G5YB 1ZT7B 2AEPH 2VXQH 1ZANL 3UXFA 1MRFH 4KI5C 1Z0NA 1WITA 1F58L 5JDSB 2DQUH 1ZANH 4YWGL 3TO4B 4H1LG 4N1EA 1F58H 3T0WA 5E8DL 1A47A 3P9LB 1INDL 2V9TA 1WFUA 5F1IA 1FIEA 4YWGH 3E6FA 4RGND 4XVJH 5DC4B 1MCRA 4KMTL 4HKBB 1INDH 3FZUD 1WK0A 3OJMB 5DEGB 4KMTH 2R69L 5HI3D 1Z0MA 4JGUA 3NZHL 2R1YA 1L9MA 1PYWB 3OHXB 1RHHA 4DZBA 4U1GB 3N1PC 1JPST 5E8NB 3PWVB 5J1AA 2R69H 2COQA 2NW3A 3PP3H 3WFEL 1HI6B 4CDGC 2Y7QA 4TSAL 3T3PE 2X05A 3L9RA 5KSUA 4GRLA 3WFEH 1QFHA 5I9QC 4YGVB 3MMEA 5IVXF 3NA4A 4BSVB 5CJXA 4MDJA 4JR9L 1B6UA 2J8UB 1A2YA 3QQ4B 1MIML 3TZVB 3FO1B 1FNEA 4HJ0D 4U1NB 3VXPA 5F9DC 1QFWL 4N8VA 5TFSL 4F7EA 2ZZUT 2W0KA 1L6ZA 4JG1L 4JFDE 4NM4L 1QFWH 3I3BA 4GQPH 4WIQA 2YMXL 4QRQA 3ARXA 3DVIA 4NM4H 2EDXA 4PJCE 2YMXH 2AJXH 2YA1A 3BIKB 4J23A 3QDJE 4APQC 2VLKB 4D8PA 1K8DB 4UV7L 4JFYB 4J2XA 3QCUL 4L4TE 1KJ3L 4IDJL 4LLMA 4PP1C 2MTPA 4FNLL 4JO4L 2ADFL 4UV7H 1IEBB 3QCUH 5TPWH 1H9VA 1KJ3H 4IDJH 3CCHA 4FNLH 4JO4H 1BLNA 3RZCB 2WP3O 4RDQG 1E4XH 1ZXQA 2FJHA 4PJDE 4R2GB 2Y23A 2RIKA 4G9DA 3DUSA 5KAQF 4M7JH 1NLBL 3GMOA 5DK3A 1UM6H 1F4YH 4JN2A 1AGCB 1AD9A 1B9ZA 1NLBH 3G5XB 2JJSC 5D1QD 3PGCA 3IJHB 3AC0A 1CR9L 2G9HA 3PQYB 3TJHC 1C5CL 3LEXB 3RUGB 1MLCA 3IU3B 1DBJH 4Z5RB 3A6BL 4LPYA 2BRRH 4BQCA 3RWGB 1C5CH 5C2UB 5KSBE 3LKNA 3A6BH 4K71C 3CFDA 5D2LA 1NCTA 3ESVF 3IKCB 4Y5YA 1N2RB 3OMZA 4L8BA 1YC8A 4HGWB 1YNLH 3AB0B 4Y4KA 3EDJA 5EO0A 4LLDB 3VWKB 2J8UF 4NUGL 1Y6MR 5DJXB 2V7NB 3MRJB 4ZG1A 2AEIT 3SEPA 3DX7A 3BP6B 5IBTL 1BAFL 4FQ1L 1MCBA 2IAMC 5CSGA 3FFDB 4E9LA 4MHHG 1QFWI 9CGTA 5AG8A 3IGAB 5IBTH 2A73A 2CR3A 5INCA 3LH2L 5E6YA 3D87B 1ZVYA 2BHYA 3LKOB 3H0TA 3BFOA 5IM7A 1VSCA 3LH2H 4TNVF 5HGBA 4OBSA 3GI8H 3PHOA 1MI5D 5CD3B 5DVKA 3REWA 1NUDA 3QG6B 3HI1A 3QHZH 4OLVH 4WDIB 4DN3L 4MNGA 4YBLC 2GHWB 2ERJC 3EOBA 3U9UA 1G1YA 4A6YH 5J1TC 4DN3H 1LEGA 1FNFA 4I5BB 1MQ8A 1PQZA 5EG6C 1G7IA 3HS0B 4I13B 2APWA 4LCYB 3RVVD 5BS0B 2GQHA 4ODSL 2E6PA 3VFGL 4FQLH 3GIVB 3MV9A 4XNZC 3PWUB 3QO1B 5LWYL 4ODSH 4GT7A 2UV3A 4XP6H 4TNWK 1NAMH 1T0NB 3CC5B 1RZJC 1YPZA 4MAYC 5LWYH 1CDYA 3VU2A 1TVHB 2R0WH 5LVEA 3DUHA 3ULVF 5I9QB 5AYUH 1LVEA 2XPGA 3KPNB 4LEXL 3RUGF 1XH3B 2VKWA 5GRJL 4JGMA 1G9MC 2VN7A 4Z0XA 4DUXA 4K55A 4U1MA 2P5WD 2VDQL 4LLAA 1WBZB 3VGBA 4LEXH 2Q7NA 4X4ZA 5ALCH 1GVIA 5DZOA 1WFTA 3L7FB 4A2MA 2V9RA 5SWQA 4OZFG 3G5ZA 1FO0H 5T33H 4U6XA 5FYJE 2DLGA 4LCWB 1U95B 3WHE0 3GMQA 1UB6B 4JB9L 4MD0A 1IQDB 2X4RB 4WWID 4HHAB 3RWJB 4PRBB 4X6DA 1PEZA 2B5IC 3BKYL 1FL6A 4JB9H 1D5IH 3C2AL 4WY7L 5ESVA 3BKYH 4UUJA 1FAIH 4APQB 4PG9A 4Z7NE 4XXCC 3JWOC 4JJ5B 3QUMB 3CXHK 1KLFA 4QOKD 1NEZA 4RWHA 3C8DA 4BUGA 1IRAY 2R1XB 1OTSC 2OTPA 3DGGA 2HFGL 3O4LD 5I1DB 4HS6A 4HH8A 4HIEA 1MCJA 3WIIH 2HVKA 2H2PC 2HFGH 3CVIH 5JXAH 5HHMD 4JFXB 2DQGH 4GBXA 5CINH 3MJ9H 3O3BB 1OM3H 4LLUA 1M4KA 5KSVA 1P53A 4LF3B 3NACH 4YHPB 3P0YL 2AEQL 3TBWB 3E3QE 4DAGL 3U0PB 4O2CA 4AY0A 3HR6A 5DDHB 3B3IB 1PJ9A 2PYED 4OV5A 2AEQH 4W6XB 4DAGH 1T0MA 3E3QC 3RRQA 1G0XA 2JTDA 4DN4L 1PSKH 4IHOA 3B2UC 5D1ZC 1S7SB 1OP9A 2EDTA 4KKLC 1G7HB 4K71B 4DN4H 3M17B 5DVLA 4MNQA 1HHIB 4KKAD 2P48B 1A6VL 5KSBB 1LGVA 2R29H 4PJAE 4R26L 1LO2L 2LE9A 4PRPB 2VQUA 1RZIA 4HF5H 1NDMA 3DYPA 1IGMH 1F00I 2OLDA 5FUCE 4AG4H 1LO2H 2OQJB 4K23H 4KZEL 4GRWE 2MWCA 3KPRE 5EFIA 5F9JA 4JE4B 1AGFA 3IDMA 5FUCC 4KZEH 1AGEB 4XHJD 3SDAC 4P2QB 2DLHA 3VRJA 2WP3T 3QCVH 4OGAC 3PJSB 3QDME 3S97C 4R4FL 2OJZH 3IETB 2X44D 1JZ8A 5IHZA 1VESA 3MXWL 3PDOB 1KLUA 4RRPG 3K80A 4G8GA 5ENWA 2FO4B 2ERJB 1U6AH 3STBA 2HT2D 3MXWH 1OT2A 4S1SL 3MV8E 3SE9L 1KFAH 2J1KA 3MRCB 1FPTL 2PTUA 1FYTE 3NA9H 3B9AA 4M6AA 3UZVB 4KGJA 4IBLT 3E0GA 3QDGA 4OZIA 1O0VA 3IDIB 3SDXE 4EDXB 3OJDB 1S3KL 4WU7A 4JFEB 4WI8A 4XBGB 1VGKB 2AK1L 1OAYL 3WL9A 5FYLD 2CLVB 1QPXA 4MAYB 2IFFH 1S3KH 4KDVA 3RHWK 3RWFA 3ES6B 3VA6A 2AK1H 1OAYH 1HEZB 2XIDA 2XOTA 2HT4D 3DIFB 5DVMA 1TQCB 5ESQB 4UTAH 1AXTL 2HA1A 5C0BB 1EEYB 5H37G 4MA3A 5JW4N 3EOAA 1UC6A 3D3VE 1A4JA 1AXTH 1CGXA 2NR6D 1IM9B 2GFBA 5DMIH 1S7VA 2K3TA