5SX5H

Crystal structure of panitumumab in complex with epidermal growth factor receptor domain 3 mutant s468r.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
207
Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGGSVSSGDYYWTWIRQSPGKGLEWIGHIYYSGNTNYNPSLKSRLTISIDTSKTQFSLKLSSVTAADTAIYYCVRDRVTGAFDIWGQGTMVTVSSASTKGPSVFPLAPCSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSQTYTCNVDHKPSNTKVDKTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/immune system
molecule keywords Panitumumab Fab Light Chain
publication title The Panitumumab EGFR Complex Reveals a Binding Mechanism That Overcomes Cetuximab Induced Resistance.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 207
sequence length 218
chains with identical sequence J
ec nomenclature
pdb deposition date 2016-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5sx5H02
4OF7A 1EFXB 4AH2B 3OAUL 1DN2A 1J1XL 1WBXB 1KIQB 1MJ7L 4UOW0 1N59A 3MUZ1 5E8OA 2DLFH 1FIEA 4Z7VB 5DWUH 2XKNB 5JNYA 3B2UD 3H7LA 5AWNH 3ULVC 5F7HA 2JJSC 1T2QH 1CLOL 3QHFH 4KFZC 1L0YA 1DFBH 1I7ZA 2MHAA 4OZHE 1MWAL 3RWFB 3H42H 1MLCB 1PG7L 2HAZA 3KYMB 2VNCA 3KR3L 3C5JB 4WWKC 2VH5H 1YEKL 3MJ8A 3OX8B 1NC2D 3FT2A 3UJJL 5LBSH 1W72A 5ESVA 5CMAB 4TUOA 1K8DB 3ZKSD 4X6EB 3GMNB 4KHTH 4AENB 1PKOA 3RWIB 2GTWB 4WCYL 4YH6A 4R90L 2A6DA 2BDNL 4P3DB 5FO9B 4H1LH 4Y5VC 3V7AG 2FBOJ 3VFRB 2EYRA 4MB3A 3FQUA 1RUKH 1F90L 4NKQB 2EDBA 5DI8B 3UZQA 5JR1L 1D5IH 3KLHD 5SWZB 4NP4L 3TNMB 3QUZB 4MCZA 4K3DL 2ADJA 2BRQA 1WQVT 3TN0B 1HZHH 3V4UH 1JGVL 1Q94A 3HZMA 1QYGL 3U48A 4J3TA 5CBAA 1BOGA 4EDWH 4JDZA 2H1PL 3BT2L 2EDOA 4R7DB 1IFHL 1NCAL 4CKVX 5ACZB 4L8DA 2I9LB 3S4SB 3F62A 1LDPL 4PJDE 5BZDA 1EUUA 3CVIL 3N50A 3VXOB 1Q72L 3FJTA 5E9DE 5DQJB 1IQDB 1HWGB 3AREC 2ATPA 2CIIA 4K23L 2XT1B 5KS9A 4WGVB 4WWKD 2F5BH 2BXZA 5J56B 3K8LA 1Q0YH 3H9SE 2OR9L 2QADB 3PGDA 4OCWL 1G7LA 4O58L 1OAYL 2XZCH 3PWNB 5C9KA 2G2RB 1JZ6A 4G80B 4PJIA 1UXWB 4ZUSB 5EPMA 4P2QB 3TBWB 2BJMH 3QRGL 3KPSD 1MREL 2EDXA 4KDTA 1B6DA 3GSXB 3QIUB 2EO9A 4Q6IA 4EXPX 4U1GB 4WEBH 1TJHL 3MR9A 3ROOB 1Q8MA 1RZ7H 4M48H 5D1ZA 1NLBH 2HKHL 5IF0B 3LAFA 1L0QA 5JA8B 3U36A 2HTKD 3CNKA 3E6HB 5KVFL 2XFXA 5BV7L 1EGJH 4D94A 3MNZA 3O2WL 4PJ7F 1BZ9A 4U7KA 1NSNH 3MCKA 1FCCA 3WYRA 5I30L 4I4WB 4LKXB 1E6JH 1OARL 2OJZL 1T4KA 1ZWIA 2D7TL 1MLBA 5FYKD 1OPGH 5HHOA 4POYA 1YEGL 4NKOB 4PJ9C 5C0IB 1TVDA 3ARED 3HRZB 5EZOH 3GSQA 3RL2A 3HUJB 3OKEA 1AHWC 1S5HB 4AG4H 3STLB 1DVFB 3X11A 1I7TA 1BJ1J 5DMGD 4GKNA 4JO1L 4NRYA 5HDQL 4YAQA 1JFQH 2JJWA 2F9BT 4PB0L 5D1QB 5B38G 4BELD 1NMAH 2NY5C 4WW2B 3HI1A 3NH7H 3QIBA 1KULA 1D6VH 4OCYH 5E5MA 5GGUB 3BP4B 1N0LA 2OL3A 3GBLA 1P7QD 2NY6B 4Q0XH 4ERSL 4HJGB 3MRRA 3LH2H 1M7DA 1S7WA 1I9RL 1P4IL 2CMRH 5E6IC 2CRZA 4OGXH 5HI3C 5BVPH 4YPGA 5GZOD 3BO8A 3IDYC 3P0VH 2KQNA 1XGYL 1IJ9A 5C08B 1JNNH 1TPXC 1LMKA 2E7LA 1Z9LA 3FO2B 4S1DD 3VFOB 5KANG 2Z9TA 4UOW1 3VGDA 4PRPA 3T8XB 4PJFE 3OXSA 3D3VA 2DQCL 3ULVL 4NT6A 4PR5B 3KXFB 3STZA 4PJEB 1CXHA 4L4TD 2Q6WB 3RWEA 2JJVA 3RUGB 2IAMB 1P9MA 3QWOB 4XPGL 3O6LL 4OFYA 3K3QA 43C9A 3AMLA 5BOZG 1JGDB 3UBXB 1QRKA 5IGXH 2G9HA 1A21A 5FUCE 4EKXA 2VKWA 3LN4A 3U1SH 1UH2A 5FK9A 5I9QB 3GJFA 4QTIH 5FOJA 1A6ZB 2K9UA 4WW1A 4DAGH 3A67L 4DQOL 3ULUE 4X7CC 3ILQD 3OR7B 2QSVA 4E0RA 2BRRL 2APBA 4MWFB 1S9XA 1FSKB 4N90D 1JV5B 1HYRC 4PIRF 5CSZA 3MV7A 3ARDD 4M6OH 2VR4A 4XHQA 3WFHB 1A6WL 5KOVC 4PJ8D 2AJVH 2OJEA 5FF6B 4UILL 1AFVH 5E2WL 5TE4H 4JFZH 4HWNA 5KSBA 5HVHC 3OWEA 1T1YA 5KS9F 3T1WA 3S36L 5E6ID 4K8RL 1NAML 4RZCA 2DRUA 5J12C 2AJSL 1OHQA 5B21A 5F88A 4ISVA 4CDHA 3NFPB 4PJIF 1J9CT 3W11C 3FB6A 2F54A 5ID0A 4BK4A 4JFFA 2IH3A 3HKFA 1SJXA 2P42B 1CFSA 2B20A 1KELL 2EXWD 3B8YA 3SPVB 4RWYL 4MJ2A 4NKDA 4PGEA 2ARJA 3HMWL 1UQSB 4TOYL 1ZTXL 2CLZA 3O3UN 4AEIL 2Q20A 1SY6L 3MRDB 4Z8FH 4PJAA 3G04A 5CP3A 1YECH 1LD9B 5BMFL 2IALB 3P73A 4KRPB 3RZCD 3T3MF 1S7TB 1J8HB 3RWJB 1D6EA 3L3DB 3RX8A 4KJPC 4XB7A 1T7YA 2HT3C 1WZMA 2V5SA 2LE9A 5D7IE 4MA1B 3RDTB 3DO7A 3DVIA 3QDMB 5B39B 5EO9A 2I07A 3QXAB 2R0KH 1BFTA 4JZJA 2CXKA 5I15L 3EYUL 4JY5L 4P2OA 1IQWH 1U93B 1MCRA 3TC9A 3BH8B 1UADC 3X12A 5GXBB 4HFUH 5IVXE 2BVUA 1ZGLA 2BCKA 3T2NH 5I1KL 1F13A 5DFVC 4OCXL 2BFVH 3G6DL 4H0HB 3LRHA 3GSNH 4DN4H 1Y0LA 2Z4QA 3SGKC 1AIFA 3QA3B 1I7RB 3RFZC 5I1LA 2YPVL 5JO5A 2XA3A 5C0AE 2RCSL 1HHIA 4Y5XC 3MOAH 2YRPA 3GHEH 2C4FT 4D0DB 3W11D 1ES0A 1NC2B 1JHTA 5DEZA 3ARSA 1WIUA 4K71B 3NVQA 5FECB 1HQRA 1U91B 2XQYG 4JREC 3IFPA 3RIFF 3RWDA 5I6XB 5IVZB 1GGYA 2B1AH 2XA8L 2PNDA 5SX5K 3DXAD 1YN7A 4ZTPH 1UWGH 4PJXB 1F11A 2D7MA 3VD9A 1RZ8A 5IB4B 5GSRA 4L5FH 3EDKA 3MJ9L 4O5LL 4YR6A 2C4XA 3MGTA 3O3EB 1PD6A 3DNKA 5J8OA 3VXQB 1FLTX 4G6MH 4KJPD 3FQRA 2HT3D 4OIIL 4HIEA 4Y1AB 2UYLA 5GS2H 2XKSA 3MMEB 1RJLB 1GIGL 5FO8B 2NY0C 4GKOA 2NY5L 1IEBB 4GSDH 2Y36L 1A7QL 1YPZA 3BN9D 4C56D 5ERWA 5FA4A 4X4ZA 5MERA 3QDHA 4GQPH 4HPYH 3KYKH 3BEWB 5GGTL 4HMCA 1OOAA 5C0RL 1Z9OA 2H9GB 2QJDA 4QCIA 2RJMA 4EJ1C 2OYPA 1LEKA 1W8OA 1GJIA 1CK0L 4RGNC 3E8UH 3KNBA 3GSVB 4NQCD 4RGOH 3RGVD 5JZ7C 4LFHD 3KPNB 4HV8A 4L3CA 4P5TA 2A83B 3SKJH 4XNZC 4KK5C 2QL1A 5LQBL 3CFJA 5CD3A 4YHYC 2N7BA 1C08B 2IBBA 4NM4H 2P7TB 3HMXA 1HXYB 4DOHE 1NANH 2E8ZA 4RDQG 3QFJE 4ONFL 4XCEB 3ZYJA 3MRGB 1UM5L 4JN2A 3QXUA 5E8DH 1N2RB 5H35B 4WI4A 3BPNB 4YHIA 2AQ3A 4DK6A 4MZ2A 1A4KA 1IBGH 2C9AA 2CLRA 3LN5A 1KEML 4XHJD 4L9DA 4XVUD 5F1IB 2M26A 3DUSA 1NL0L 3S5LB 2D31B 2IG2H 2AJYH 5GHWH 1IEHA 1I8MB 4KVNH 3R1GH 4YHZL 1YQ2A 5TQ2H 4N9GB 4I18B 1B2WL 2E9BA 3ARBB 2B39A 4J4PC 2NXYD 3EO1A 4MAYC 4PJAF 4UNTA 3AROA 5M7QA 4IMLB 3DI3B 3MLUL 2OL3H 3U82B 3GMRA 3PWJB 1GSMA 5F7YC 4PV8B 5KJRL 3HFMH 4RGMB 2EIZB 5DURD 5KSVA 1SJVA 3CLFH 4K9EH 5CINH 5T3ZH 3UPRA 1G1CA 4EUPG 3IVKA 1OY3B 4ZPTB 3O3BA 4RGND 5JZ7D 1Q1JL 3QUKB 3NTCL 1QBLH 4YX2L 4GBXA 4HSQA 4MNQA 1JMXA 2YZ1A 5DJ6B 3BP6B 4XNYH 4I3GA 4PJGA 3LKSB 1KPRA 2UWEB 2P8PB 4PY7B 4EVNA 1H5BB 5HGAA 5MI0B 5EO1A 3HPLB 1Z9MA 3O6KL 3VFMA 1OM3H 12E8H 4FN0A 2MKWA 2OQJA 4JKPL 3HC3L 3O6FD 3R0NA 4X6DA 4OM1L 4XNXL 4YHPA 1KJVB 5E2VH 2QHRL 4Z5RA 4CDGC 2NNAA 3CSYA 4KJYA 4BFEA 1ZVYA 4PJCE 1XH3A 5IQ7H 1FFQA 5E4EC 3PL6C 3QULA 2FX7L 5E99H 1DP0A 1QFUH 3L5HA 5DFTA 4JN1L 4XVJH 3H3PH 4X99B 1P1ZA 3LPWA 2OBGA 2YS4A 3FQTB 5GGQL 5D70H 3NCMA 2YA0A 3GMLB 3HE6A 3VI4E 1RD6A 1WCQA 4I48A 4PBVC 4GKSB 4GLRH 2BNQD 1NCCL 3IJHA 3QEGL 4QHUA 1NKRA 1PG7W 4IOSD 1BM3L 1GZQA 3QEQD 3SGJC 1U41A 1JWUB 4RCAA 5JUEH 1WJ3A 5JTWA 4BSWA 2JIXB 1IGML 5FUCC 1YPZF 1TDQA 4P9HL 4Y19E 1CGVA 1JTTA 5JQ6L 1YC8A 4AIOA 1LDSA 1ZT1A 1G7HB 1GXEA 5FDWA 4AY0A 1R5VA 2XIDA 4JHZA 4F7CA 3ARDB 1WBYA 3CIQA 3HI6L 5AG9A 3ARRA 2FLRT 3LEXB 4MXWH 2ZJSH 4NM8H 5CP3H 3CSPA 5I76A 2A77H 4JANB 5IFJA 5D71L 4JZNB 1P7KB 2AKRB 3KDMA 1JPSH 2A6IB 3WFEL 2BK8A 4NQSA 5IBUG 1DBJH 4P23D 4EI5A 2WBJB 3QDJA 4YBLB 5B3JE 3QZWA 4JFDD 5CJXA 3N1GC 5FHAH 5F9DC 4PLKC 2JB6B 1SYVA 3N1MC 1FAIL 1V8HA 1JGUH 3LSOA 4TSCL 3NCJL 1X5ZA 2FX9L 4ZAKA 5F7FA 3O4LA 1BZQK 1T2XA 4HH9A 2P24B 3EDEA 5HYIA 4CUCA 3SY0B 3FRUA 4JEGB 3RZCB 2J5LB 4HC1A 4P4KB 1HCVA 4U3CA 2ZCHL 1YUHA 4MS8D 1F58H 5C71A 1PZ5B 3UAJD 1E4XL 2RR3A 5EOQL 1MFCH 4LSUL 2HT2C 1EJOL 2PYEE 5HYSG 3VXTA 4Z95H 1CZ8H 2DS4A 2AXGA 4FFYL 3OKOA 4EDXA 4DN3L 2F74B 1HK6A 4Q9BA 4JHAH 4OGYH 1FZMA 4HKXA 5I1EH 1X5LA 1ZS8A 3OQ3B 5BO1L 2V5MA 4JO4L 3HC0A 1RJYA 1CFVL 3MV8D 5EUKB 5C0CA 4JO3L 1O7VA 3UDWA 4PJGF 1KCLA 3EHBD 5HHNA 1NGYB 1UM4H 3W0WE 5L88L 3RWGA 5C09D 3U4BH 2R0WH 4XPBH 3HE7C 1SBSL 3I6LE 3A0OA 4TVPD 4LLVB 4LCCB 4YDLC 3KYOB 4V1DA 1N5YH 3H9HA 1GL4B 3GO1H 1WTLA 3WLBB 3BVNB 4BFIA 5KN5A 4HLZH 3OR6B 4X6DF 1XGUA 4NC1E 2ZUYA 3RTQB 4KQ3L 1PLGH 1ZA3B 3GDBA 1RU9H 2EO1A 1RULL 4U1SA 3QUYC 5GISH 4TUKL 3LKPB 3QAZB 4JDTL 3S88H 3I3DA 3PWUB 3V7MA 2VXTH 3HNSH 2EDQA 1ITCA 5JHDE 4A2LA 1CF8L 4JCMA 4MJIA 2ZCLH 3L1OL 4NQXA 3GK8H 3QPQD 2DLHA 1E27B 2HRPL 4LNRA 3PHSA 1R3IH 2Q76B 3UTPE 4RMQA 2ZUSA 3RI5K 4LLWA 4Q9RH 1HSBB 1SVZA 4KUZH 5I74C 3T2OA 4QXGL 4HJ0D 3D39A 4J3VA 3VXME 4F80A 2D03H 3W9EA 2WUBH 1W0VB 5JPMA 2VDML 4XNUH 4XC3L 1R3HA 2AXFA 1KCVH 4NO3A 5FYLL 3TV3H 3C6LC 2OP4L 3HNVH 3I3EA 4G8GB 4OD3L 4R97B 4ODVL 2VAAB 4NDMB 3AM8A 3CZFA 5SWSD 4RAVB 5DHYA 4Z7WB 2FZ3A 4NQCB 3RGVB 4BZ1H 4P5MB 4FTVE 1F4WL 1T89A 1UYWL 4QF1B 4R0LB 1LK2A 1HH9B 2AK4D 3LS5L 4PJ7E 3W82A 2EDYA 3EGSB 1TQBB 3OHXA 4NGHL 5HYFA 5DK2A 3FMGL 4WV1C 3PDOB 1XF3A 32C2B 3QEHA 3CDFA 4OLUL 1LO5A 4Z9KB 2IBZY 1TVHA 3BPLC 2ICEB 5A2IH 3LHPH 4WFGE 1BECA 1T2JA 5IEHA 2P43B 1UM6H 2X4UA 4R8WL 4M9PA 2G75A 3LKOB 5HHQB 2R29H 2UZIL 5KVEL 5K9OA 1A1NB 1EAPB 1LO4L 1SYSA 2Y5EA 4I0PC 1OCWH 1F6AB 3HS0B 2BVOB 2DIAA 1M71A 4HS6B 4DGVH 5INDB 2COQA 4YC2B 2VZUA 3BAEL 2E27H 5DUML 4ODTH 3P77A 4Z7UE 1OB1A 3RVWC 5FHBH 5A16B 3WIHH 5HPMB 4MSWB 2CO6B 4MXQC 3FFDA 2NXYB 3TWCH 2Z8RA 4YFLF 1WZKA 5AZ2L 1A0QH 3MO1B 3VFUA 1S9YB 3UYRL 2Z91A 3TYFA 3WLWC 5BJTB 2P8LA 4LAQH 4UT6H 5JIPA 4RMSA 3C6LD 3SCMC 1FYTA 5MHSD 3MRPA 1AGBB 1JRHI 5GGSY 3MA7B 5CD5D 2ZKHL 4TVPL 1DL7L 3DIFA 4HGKC 4ONHA 3P9LA 4D3CH 3W5MA 1S78C 1MFBL 2I26N 3SO3C 4U1MA 4F9LC 3QUML 2V7NA 3CVHA 1ZLVK 1ADQA 3FRPA 4BSJA 1BIIB 4WI2A 4G3YH 5CZKA 4BH8A 4QXTB 4G8FA 1WFNA 3VXUD 4QRRA 4MD5B 1JHKH 2FSEA 1SBBA 5IIEB 4R26L 1IAOB 4F7PB 4WFHD 1E4WH 5CZXC 4X98A 1FJ1A 1H15A 2NQCA 3C87A 5BRZE 3TT1L 3C9NB 3WHXB 2DWEB 3O6FB 1UA6L 5DEFB 4NPYA 2VB5A 4LLYB 1XFPA 2X70A 4I0PD 3GBML 1MCPL 3SE4A 1OW0C 3OGOE 3UJIL 5E94B 2Z8SA 5T3XD 3MA9H 3NAAL 1HWHB 4C83B 4RNRA 4P46D 1CE6A 4FA8A 3EFFA 5B4MC 2O61A 2VSCA 2XY2A 5GS1B 3AB0C 1SEQH 3QO0A 1K3ZA 4OZGA 3HR6A 5LAXA 4XGZA 1YEEH 5F7DA 1CE1L 1OTSD 2WIIA 4EIZC 4ZDHA 2FX8H 5SX5H 3I2CH 3UYOD 5KS9E 3IDIB 3UC0H 3IGAB 3LV3A 4L4VD 1WCBA 1EEZB 1WK0A 1ZT7A 1NFDB 2OXHA 1AD9B 3QEQB 1NMBL 3A6BH 4JQXA 3VRIB 3D87B 4GJTB 4ZXBB 1ODAA 3PQYD 2YD9A 4LARL 1X3DA 4PJIE 1IZKA 4R2GC 5I66A 1H9VA 4LRNL 4JFXA 3L7EA 4JFEA 1QFWH 5KAQG 4DJMA 1KJ2B 4PREA 4Y4FB 3Q5YA 3T0EC 4OD1L 4QKXB 5F9WC 4FQ2L 3GI9L 4OGZA 4XBGB 1OAZL 1QNZL 5J3HD 1U3ZA 3W81A 1QR4A 2XTLA 1ZEAH 2BVQA 3BSZL 3VXPB 2X44D 3MLWL 3TGXA 3LPGA 3CFKA 4OCLC 3HB3C 1LK3H 3T3ME 2I5YH 3FQXA 4U6VH 3OL2A 1TJGH 4K94C 4NQED 1CIDA 1UCTA 4KTYA 1HCFX 4G42B 4ZS7H 5I1GL 2YD6A 3WS6C 2J8UA 1MCCA 1A3RL 3MNWA 4PG9A 5B4MD 4H20L 5HHOE 4RFEB 3T77B 4LAJH 1HEZA 4NZJA 2SEBB 5DD0H 2NY7H 3D6GA 1LEIB 1GHFL 1JGEB 1AP2B 3EJYC 1UVQB 1XIWA 2DIBA 3LD8C 1A7OH 4X5WA 1OP5K 4IOFC 4JVPA 3S35H 3KS0J 4P2QE 3I75B 5FAAA 5AUMB 5SX4I 1AGEB 1BIHA 1NGPL 4CU6A 2F5AH 4OZFH 3VG9C 3MLTA 2VDOL 3GSUB 4ZFZB 5HJ3B 3GBNL 4Y2DA 1LO3H 2JE8A 4R2GD 1RK1B 3WEXB 3ZKNC 1VFBA 1DQDH 1JIBA 5DVKA 2NW3A 4HIHB 1S8DA 5EOTB 2P49B 3HHRB 4NNYA 5DC4B 1YA5A 3C8DA 1G9NC 1DBAH 4PTUB 3P2TA 2GK0A 1FLRL 1SVCP 5IB3B 3FTGB 3IDJA 1KIPA 1RZKC 4F7MB 2VIRB 5C3LD 1FO0L 1EX0A 3HB3D 2VITA 3MV8B 3DURB 2XTJC 4QTHB 3V6ZB 1QEWB 1PQZB 3LKRA 5I16A 2FCBA 1J18A 4PRPE 2NY3D 5HDLA 2NY1B 1ND0A 1P2CB 2V2TA 1B0GB 4OQTA 3Q1SH 2V6HA 4X9GA 2FWOB 4KAQL 3CFEB 3MBEC 3SOBH 2V2XA 5DD3L 4NCC1 5E1HB 3PHQA 3C60B 5EBWB 4PBWD 4FQLH 3RY6A 3FN9A 2DOCA 1FH5L 2ARWA 2Y9RT 5GJTL 4F57L 2XPGB 4NZRL 3GM8A 4NZUL 4P2RA 1A9BB 1U8NB 1HOCB 3MACL 4XVSH 1N5AB 3L3OA 3RKPA 2DLEA 4IOFD 3DSFH 5DGRA 4MAUH 1HINH 3L3IB 1KCRL 1WWWX 1AE6H 1VKXA 4UBDC 3MV7E 5DMIL 3S3PA 4FZEH 2ZUQC 1TIUA 3RVTC 4OZGF 3Q6GL 1UWXK 4J3UA 1F3RB 3SGDI 3TF7C 4W4OC 5LVEA 4MDJA 3BD5A 1AO7E 5INCB 4QRPE 4ELMB 1XF5A 4LKCA 1TETL 2UY7A 5LCVL 4KK9D 1S7QB 4HPOL 3O0RL 4K3GA 4OFKA 2XRAL 15C8H 4KXZH 5FXCH 1JF1B 4FQCL 4J7RA 3V6OC 2FJFB 4YUEL 4L8CB 5KSUA 1VEOA 1I3GL 3ZT5A 1OLZA 6CGTA 3BP5A 4QOKB 3X13A 4IRSC 4NOBA 5T1LA 3F58H 5IR1B 1WZ1L 4LHUD 3WD5H 3ARFA 4JFFE 4BSVA 3RUGE 3CU7A 4TN9A 1AH1A 3BDBA 4HK3J 5D1XC 3P9MB 3GRWA 4NQDD 5I8KH 5TPWL 1WBXA 2B1HL 2Q3ZA 2AK4B 4Q9CA 4PJAE 4Z7VA 1KEGH 4E41D 2I60H 4ZO6A 2QKIB 5HYJE 3IETA 4P5KA 1RIUL 4X5XA 1Q9LB 5DHVA 2PYFA 4ZMAT 5C2UB 5ID1A 2F53D 3QI9C 2GITA 1ZVHA 3IFNH 3M8OH 2J8UF 3U7WL 4ODHL 4TNVF 1W0WA 3HRPA 3B43A 3OKKA 4X80H 4UBDD 5F6IC 4W6YB 5JIIA 2P48B 2ZCKH 4XBEH 3FL7A 5C0EA 3KLDA 4K3EL 2V7HA 5DC9B 2O5XH 6FABL 4FP8H 4RAHA 4QEGA 3O41B 2GTWA 5FYJH 4YGVB 1EPFA 1MJUL 1U95A 1GPOH 1DDHA 4K94L 5FO9A 1AY1H 1TMCB 2P5WA 3WBDA 4X7TB 5GGRB 4AIZB 4IRSD 5CP7A 1IGIH 2IANA 3NA4A 4WI9A 3ZHDA 5DI8A 5F3BB 5DZNA 3O2DA 3SDCD 4HWEH 1NC4A 5SWZA 2JCCB 3EYSL 1T66D 3ZMRA 1ZT4B 5K9JL 4GAJH 3F8UB 5GZND 2JELL 1HHJA 3SJVD 5J13C 2B7DT 1K5NA 2X4PA 5IB5A 4YPJA 2ED9A 3UBXG 4M8QB 4I77H 1XGQB 3G9VA 4PB9L 3HNTL 4X0KB 5ACMA 4NZTH 3VXUB 3S4SA 3QEUA 3OMZA 2L7UA 1FZJB 3ZO0A 4N8PA 2P5EB 3KG5A 4LLUA 5FM5M 5I1CH 3P4OB 3MUHL 2Y06L 3RU8H 4YDJB 3MODL 1Q9OB 3MXWL 1YPZE 3KJ6H 2GEEA 1JPGB 2DQFB 1AR1C 1N64H 2FJHB 2CO7B 1AJ7H 3C8HA 1G9NL 1MF2H 1X4XA 3QJHB 1GGUA 4QRQB 1UXWA 3S96B 1RZKL 4P46B 4M1CC 3DX6B 2ADIA 4MA8L 1N3NB 4M7LH 4Z78B 2FR4B 2DL9A 5JORA 2BHYA 1JPST 4DGYL 2R2EB 3KPRD 2X4NA 4LSSL 2DL2A 4QXUL 3QIUA 1MHPH 1BGXL 5C0FA 3WSQH 1QKZH 3DHMA 4XPAH 4ETQA 1BEYL 4PRHA 1F3DJ 2R69H 5EFIB 3L3JA 4K7PX 3RAJH 2A9MH 1B9ZA 1CTNA 1NDGB 5IV2B 3BXNB 2ITCB 3B9KB 1GGIL 4YFLI 3IXTA 1CICD 3E3QE 5BS0B 2FB4L 4Y1AE 5JDJA 2XZAH 1NJ9B 3JWDC 4Y5YB 2PTTA 4G6KH 3DWTA 1W2KT 5E2UH 3TESA 3UO1L 4W70A 1JNLH 4ONOA 4G43B 3FO1B 1MFAL 3LPFA 5B39G 2M8XA 2W60B 3V0VB 2C1PA 4NNXA 2V5TA 2VUOA 5JW3H 2HJLA 4U05A 1KN2L 3IF1A 1YMHA 3PWPA 4JM2A 3HRZA 3MJ6A 5D1ZC 5I75B 3CPLA 1U6AH 4TRPL 2F58H 5TF0A 4L9LB 2AQ1A 3CFBA 1OTTC 2VDRL 1AR1D 4HUXA 1J0YA 2H6PA 4LU5L 3AXLB 3TVMA 1MFEL 5D6CA 1XAUA 5KW9H 1ZKAA 4PD4J 5F7EL 2WUCL 5GJSL 3H9ZA 4HLZG 5B8CA 4ODSL 4DGIH 2A73B 2CJUL 3QXWA 4OAWA 4R4NC 5IB2A 5E0QA 3BGAA 4C58B 4WTXA 5DJYB 1DBBL 2BC4B 4KKLD 3BZDA 4HS3A 1RZFH 4TUJB 1GC1C 2OSLB 1HNFA 1QSVA 1EJ6A 3OB0H 4UV7L 4QT5B 1BVKB 3GMOB 4KUCD 3V5HB 2IPKA 4XCCL 1KC5L 1MWAA 3QIBC 1X44A 2W65B 4M1DH 1I1AA 4X6DE 3EO9H 2FL5A 4IRJA 2FEDC 1G7MA 1WGOA 2AEPH 1AQKH 4L3ED 2NZIA 2MWCA 1RHFA 1GYAA 4MX7A 4DFHA 1IGJB 2OMNA 2N7AA 5F1OB 1A6VL 4B7IA 1IC7L 4EI6B 4NBYB 3ME0A 1DJSA 2GT9B 2E7LC 2EH8H 2R0LL 4QRSA 3VWKC 4JO2H 3O4OC 4YWGH 2NY3B 1U42A 4F37F 4DW2H 3RVUC 4OM0L 4D9QE 1ETZA 5DJAB 2B8OT 3BGFB 4P3CL 3TJEL 1MCDA 4DKEH 1ZLVH 2E5EA 2R4RH 2ZUXA 5FF6A 3G5XA 4G9FD 1P9MC 1S7UB 1CDCA 5GGSB 4WVRA 3QDGD 2J88L 2CPCA 2DQHL 1W72L 1EO8H 4APQD 1RZIA 2HG5A 4ALAH 4IIQB 4LHQB 5SWQA 3ARPA 2PTUA 2OI9B 2BSTA 5E2TL 2W9DH 1RI8A 1RUML 3L95B 3B3IB 3MRHB 2OZ4H 3NFPA 1OAKL 1CS6A 3B5HA 1UCBH 3W2DL 1DUYB 3GIZH 4M62L 4PRAB 1CDHA 3G6AB 4L8SA 5DVMA 2R4SH 4LLMB 1YNTB 1PAMA 2VL5A 2CDEA 5DRWB 5JXAL 1P4BL 3FZUC 2AERT 2H32B 5A3IC 2FEDD 1F4YH 1LO0L 4HHAB 2Q7NA 2EE3A 5DTFB 2YWYA 4IEFB 1LE5B 1FFPA 2NX5D 5CZVH 3MRFB 5F1NB 1QSEA 4PV9B 3I9GL 1R3LA 5ANMB 5GSVB 5DJ2B 1D9KD 2R2HB 4HUUB 1D5ZA 4XWGH 3S3JA 1JPTL 4OCRH 5EWIL 5JOPD 5FUZL 4YDVB 1HI6A 1J86A 1FQ9C 5AAWA 3ORJA 5EORH 5J11C 4IRZL 3FCTA 1L6XA 1ACYL 4M93B 3RPIB 5SV3A 3NCEB 4ZOCA 1HHKA 1E4JA 1NBVL 2V5YA 4NQDB 3SDDC 4L8BB 5C8JA 4OJFH 3VMPA 3NCFB 2BNUA 1BFVH 3OTTA 3GMPB 1J1PL 4KV5F 4JM2F 4LCWA 2APXA 4E41B 4WO4D 4R3SA 2MNUA 1MJJA 1I7RA 2A6JA 1JUFB 3BE1L 4FQJH 1K8IA 2NZ9D 1OAQL 1M6OB 4W4NA 2IADB 3O2DH 35C8H 3ZSSA 5C6PB 3U0TB 4O2EA 3RL1B 4JZJC 1J87A 2D4DA 3JWDL 2DMBA 5ADOH 1NC2A 4P2OC 1F4XH 3MLSL 4QHNA 4MMXC 4IDJL 1U91A 5J0BA 3HCVA 5EOCJ 1GRWA 1UKTA 1KT2B 4WEMB 3VWJD 5A3ID 1MCOL 5C0CE 3V2AR 1AKJB 4ZUTA 3G9AB 5FKPB 3CFCH 1HSAB 4OV5A 1BBDL 1WBZB 1XF2B 1MJ8L 4D0BB 1CLZH 1ZXQA 2C3GA 4O2FB 4S1QH 4N1HB 3X3FH 3MPCA 4M7ZC 1IKNC 2Z31B 3TA3B 4I13B 1OP5H 4HDIB 4V1DE 4A6YL 4OBRA 5E8NB 3EDJA 4E5XB 4JGUA 4F58L 4KZEL 1TZHA 4OF5A 1UJTA 4Y88A 4K7PY 4R4FL 3MUY1 5T5NF 3HAEB 5IESL 4ZFOL 3VFNB 3SDDD 3MXVH 5F93C 5FFLA 5IB1B 1K2DB 1CLYH 4ZFFA 2BOCA 1I8KB 1MCBA 3QIWC 1NAMB 2R1YA 4LSQH 4O9HL 3TYGL 4I3RH 3GSOB 1GC1L 1LGVA 5DMKB 1I9JL 4ZTOL 2JJSA 1H8NA 3R8BB 1NCWL 1Q9WA 1AXTL 2APVA 3J7HA 4AQ1B 4AMKL 2O5YL 4MJIE 4L4JA 5TDOA 2W9EL 1TJIL 5HD8C 3JZ7A 1GH7A 2V2WB 3VFTA 4H25B 1A6UH 5DQ9B 4WWKA 5AZEH 3NZHL 4XP5H 3VW3L 1TZIB 1I7UA 4Z7QF 1JGLH 3U2SA 3PGCA 1CXIA 4GG6A 3CLEL 4F7TB 5L7XH 3TO4D 5D72L 2OTUA 2ESVB 3D39E 1WLHA 3DV6B 4S1RH 3MCG1 4TNWK 3H9SD 1N2RA 1BLNA 3KPSA 4WUUA 7FABH 3O3DA 4ZQKB 2DLGA 2DQJH 3DVGA 1T7WA 1O5DT 4JY6A 1FL6A 4Y5VA 1N4XH 3FT3B 3ZDZF 1JRHL 1LO2H 3S5LA 1MEXL 1VDGA 1ONQB 1KPVB 3LQAL 5JPNA 3QCTH 1YEDB 3GJEA 3CMOH 3U0WL 1EHXA 4OZFG 5EDXA 4D9RE 3EOAB 5CGYD 2BY3A 2VLME 4N9GA 1PBYA 4NWTL 1E6OH 4WI5A 2XN9D 4NCDA 4LVOC 2R8SH 2FEEL 4LDOB 1UWXH 4MNGB 1CICB 3QFDB 5C2BL 1I85C 1YZZA 4GMSL 4M43H 3PGFH 3MRIA 1ZSDB 4CVXB 3QIWD 4C4KT 3L5WA 3OAUH 3TPUA 2QQLL 1J1XH 4LSTL 5DJ8B 5AYUH 1MJ7H 4UUJB 2GKIA 4LVEA 3LZFH 1CQYA 2NY4C 3TBVB 4ZPTA 1T0NB 1KF9B 1KPUA 1R3JA 4UU9B 2YD4A 4OLZL 3AREA 1SY6A 4JCLA 3BN3B 1BQLL 4TQEL 1PGRB 2Z92A 2ZNXA 2YSSB 2AGJH 5I73C 1MWAH 3QNXB 3TFKC 3MFGB 2P8PA 1PG7H 3ZSTA 3KR3H 3P30L 4O2CA 2WINA 3Q0HA 1YEKH 1CFNA 3HPLA 3UJJH 5MEPB 1IAIL 1FYTE 4E9LA 5HHMD 1KV3A 5L2KD 4LP5A 4PTTB 3QQ3A 4U1KA 3ZTJH 3RA7L 4YXHL 1JI2A 1P7QA 1J05B 4HUVB 4YXKL 5I8CA 1ZVSB 5D96C 4JRXB 1IE5A 4GBXC 3KLSA 5J1AA 4WCYH 4ZS6C 1J10A 1YDPA 4NFCA 4R90H 4NUJB 2BDNH 2YPLB 3O3AB 3QUXC 4N0FA 5DS8A 3S7GA 5A2LH 5EO0A 4GRLD 4QRRE 5BXFA 1IC5L 1F90H 4Z77B 4LOUC 3ALPA 2IF7A 5JR1H 3LDBB 5FYJE 3QH3B 4U1NA 4K3DH 5F71A 5HHPB 3GMLA 4O02L 5TDPB 3DHJA 4MJ6B 3UJTL 3IU3A 3GGWA 1XCTB 4ZSOA 4L4TA 5IG7A 1QYGH 1G7PA 5LKNA 3DV4A 4L3EB 3K4DA 2H1PH 1JWUA 3BT2H 5EU3A 5D7JC 1QZ1A 3DMMB 1IFHH 1NCAH 4PJ9A 1FE8L 3D85B 1CU4L 3N06B 3V52H 1LDPH 3ZKMD 3T0AA 3CVIH 3DRQB 4RRPA 4PJBB 1U8QA 1EK3A 1KCSL 1AHWA 3S97C 4LDLB 2PCPB 5C07B 4K23H 1WISA 3AU1A 3VXNB 3QB7C 3MJGX 4OUUA 4I2XA 2GAZB 2HLAB 2OR9H 4OCWH 4MA7L 3LEXA 3ULUD 1XF4B 4O58H 4PJ8A 1KSRA 1OAYH 1FL5B 5HDBF 4KI1A 5GGTA 1GGTA 3QRGH 1NLDL 5E6IA 3KPOA 2X7LA 3WNMA 3ARQA 3NCCB 1HXMB 2WM0A 2HT4C 4HGWA 4JFEE 4GG6F 4HT1L 4GQ9L 4OGAC 3T1FA 3MCLH 3K2UL 3QCVH 1TJHH 5ICZA 3L3GB 5GIRA 1NCDL 4MB4A 2HKHH 2JB6A 3TIEA 3H0TA 1U8OB 1GGBL 1V3JA 3WV0A 5KVFH 5BV7H 2XG5A 3F6IA 3O2WH 3IXAB 2RFXB 4YEEA 3O9WC 4GS7C 5CJQL 3FONA 4O4YL 3MRKA 5I30H 3OZ9L 1Y18A 2H26A 1OARH 3RZCA 4K07A 2IMMA 1FGVL 3QQ4A 4EI5C 1YY8B 2D7TH 2PXYB 2J8UE 1BFOA 2FLBT 1KIRA 1T0PB 1JZ2A 4PRNB 3FAWA 1YEGH 3UTSD 1CD1B 4M6ML 4WI7A 4GKZA 1MIEL 4Y4HB 3FOMA 5L2JA 1UG9A 4CN1A 3DVNB 1T1ZB 3KPQB 1U8PB 3K1KC 1G84A 3VGEA 4NHCL 5F89A 3FO0L 4HX1A 1CDIA 5DRXA 4JO1H 1R5WB 3AS2A 5E00A 5HDQH 1F3JB 5KVDL 3B9EA 4RISH 5MEQB 1PW3A 3L3HA 2X6MA 4TULL 3KLAA 2ZG3A 3U0PB 4WO4B 2QR0B 3WL9A 1DUZA 5CILL 3HMXL 4ERSH 4HQQH 5LGKA 1ZHLA 1NGQL 5GS0D 4BZYA 4XP4L 2ADFL 3DBXB 1U8KA 4MYWB 5HSFA 1MH5A 1FIGL 4PP2A 5EU6D 2X4RB 2W0KA 4FQXD 3QNYB 1XGYH 5E4IA 4HD9A 3ZTNL 4Z0XA 3JV0A 1I4FA 2P47B 2YD2A 3JWOC 5EZLA 4G8IB 5C0AD 4OZHB 4P49A 1EEYB 3CDYA 3WS3B 4EN3C 3RWCB 3UTZB 4H88L 1M7IA 1A7PL 3DXAA 3O9WD 2DQCH 4PD4K 3ULVH 3MNVA 3HG1E 2AJ3A 3FQWB 1HILA 3B4NA 2AK1H 1A8JH 3LKPA 1QLEL 1UZ8A 1VSCA 5D2NE 5EZJB 3S34L 1IRAY 4UB0H 3O6LH 1A7RL 1QVOA 2R56H 3IDGA 3D25B 2X4SA 4XWOD 5KVGL 4UTAH 5ECJE 4M7LT 1TLKA 1TVBB 2Q76A 1DZBA 1A64A 4C56A 3A67H 3MLZL 4DQOH 4P2RE 4M7KL 4U1HA 3OKLA 3M17A 5CLTA 1T1WB 2BRRH 1CFQB 3B5GA 1DQTA 1U9KA 3NZ8B 5E8PB 25C8L 4LSRL 1NGWB 3IYLW 4DFIA 3AGVA 1BD2A 1A6WH 1QFHA 1TFHA 5K59F 2X1QA 4UILH 5E2WH 3SGKA 5DLML 2EYSA 4YHLL 3QP3A 3CK0L 4RAVA 5I1JL 1VGEL 3HAEH 3O11A 1HQ4B 1FNFA 4NQCA 3RGVA 4JM4L 4WHTB 2NXZB 3GHBL 4K8RH 1NAMH 2Y5TB 3LS4L 4Y5XA 5BOPA 1I3RB 4ZOEA 4PJDB 5T1KA 4KWUA 4JFYA 5ACLA 3QNZB 4ODUA 4F33B 2VN4A 2Z35A 5J89A 4PUBL 5E9DB 2HLFD 4X6FB 3TO4B 4EN3D 2G5BB 1VADB 3H3KA 4OLWL 2W9LA 4LCYA 2RAMA 1IC4L 1KELH 4S2SB 3AM8C 4RWYH 2LABA 3HMWH 3PDDA 1QA9B 1ZTXH 3TZVC 2X4OB 3TCLB 1BVLA 2B4CC 3PNWB 3HS0A 2EC8A 5IW1A 1BAFH 4WWID 1T89C 4XCNB 1DQLH 3QSKB 5FKAA 1XGRB 3WJJA 2VXQL 3DO3A 1KOAA 3FFCA 4PJ5B 4NJAL 2C4FU 4G7YL 1QSFD 3O45B 1J0KA 3PIQA 1I8IA 2GI7A 5I15H 3EYUH 4AM0B 4JY5H 2CDGB 4ZOAA 4N5EC 2DM7A 3C6SA 1VPOL 4NRZA 1AXSB 3VXSD 5I1KH 3U46A 1OWWA 1KB5B 2VLKD 4OCXH 1K85A 2HFEB 4PLJC 2GY7B 2HJFA 2B2XL 4QOKE 1FRGH 1JWMB 2D0HA 2NTFA 3CDGA 2IQAB 1TCRA 4GW4B 4QXTA 3P0YL 1E4KC 2Y7QA 2P5WE 1MRCL 1MCEA 2IANE 4CMHB 1ZA6A 4X9BA 5D8JL 1AXIB 4EXKA 5DRZB 4ZYKB 5I71C 4JAMA 3O6FA 3ZYOA 2KZ1B 3MBXL 4YDIL 1KCKA 4KH2A 5HHXL 3TZVD 4UZGA 1BZ7A 4UQ2A 3VE0A 5A2JH 5EIQA 1CDJA 3DX8A 3MJ9H 3FB8B 3CXHJ 3GSWB 3P11L 4U6HA 5T33L 4OIIH 4UI2A 4ZO8A 5IM7A 4C54A 5GS1A 4C4KO 1VHPA 3EBAA 5J1TC 1GIGH 1WFOA 3E2HB 5CGMA 3MREB 4HC1L 2Y36H 1A7QH 3RJQB 5DHXB 2NMSA 3IU4L 3C5ZC 3IAGC 3PL6B 4RX4D 3B2VH 2BNQA 3VFWA 3WXVL 3T0DA 1FVCB 4R7NA 4F8TA 4N5ED 5C0RH 1B0RB 4PJFB 4UQ3B 1NGXA 2IGFL 1IZJA 1F4HA 2V17L 3NN8B 4HZLA 3V0WL 1OSPL 4NKMB 5DVLA 5B3NA 3JWOL 2DQEL 3WE6A 3ZL4H 1HH6A 2ZPKH 4GW1A 1S9WA 1CK0H 2VUYA 2FO4B 2J4WL 4I3SH 4X7SL 1CBVL 3KS0H 3L6FB 1NUFA 1H3XA 4NN6C 1MCKA 4Y19D 3SBWC 5LQBH 3OKMB 1BX2A 5D7KD 3F7RA 4YXLL 3N85L 3VXPA 4PRHE 1SM3L 3DUHA 3OJDA 3HZVA 5D9SA 3QYCA 4B0MM 2EKSA 4JQXC 4ONFH 4LIQE 5FCSH 2OK0L 1LVEA 2EC9T 1U8HB 1UM5H 1ULVA 4XAKD 3I02A 1CGXA 3VGAB 1WFTA 3CU1A 3KJ4B 1QD0A 4P23A 1A3LL 1KEMH 4WU5A 5IWLC 2H2SC 3L9RB 4D9LH 1NMCC 1NL0H 3D2UB 4JQVC 1PKQA 1T04B 4JFDA 4YGAB 3T77A 3LKQA 2BVEA 4U33A 3IKKA 4YHZH 2CKBL 3BYYA 3V5DB 3HPJB 4YK4C 1UGNA 4IM8A 1B2WH 1HIML 5KOMC 3PWPE 4NO5A 3KAAA 1T21B 3C5ZD 2EDFA 2OTWB 4ODXB 4X4YA 2BSSB 3GMQB 2DI8A 3K74B 5A1AA 4JFHE 5E03A 1RHHA 3QUMB 3DGGA 5KJRH 3PHOB 5EIIB 1QRNE 5TE6L 3LQMA 3CC5B 2FH8A 3KPPB 4LK4A 4FNLL 4RAUB 3IB4A 5ELIA 3WEXA 4XRCA 3CX2A 3TM6A 3CUPB 5K9QG 4U6XA 4YX2H 1PVHA 3VFGL 4BUHA 4NRXA 2EIDA 1PJ9A 4XI5C 1XR9B 5DYOA 1XIWC 5D7IB 1X4YA 3FTGA 3LMJL 1ZHNB 1OT2A 2DIJA 2B4CL 1OGAD 3CFDB 5BS0E 2Y6SD 3O6KH 1JCKA 1G6VK 1E28A 3ZE0F 4G8EB 4Y4KC 2AJUH 2AJXH 4JKPH 2ID5A 3HC3H 5F1SA 2VH5L 5KVMC 4OM1H 4XNXH 1S7VA 5C09A 5LBSL 2QHRH 5IVXB 2Y1VA 2VYRE 5E1AA 3O8XB 4OSUL 2CK2A 2CIKA 2BOBB 1CL7I 5FO7A 1MHHB 3QDAA 1F6LL 1RAMA 2VZ1A 2YHGA 3D48R 2FECI 3CH1B 4XBPA 4JQIL 1H0DA 2FX7H 1C16A 3HE7B 2XPGA 3I6LD 3UXFA 5C0AB 1K9TA 3CH8A 4JN1H 4EZMA 5L8LB 4XH2B 3ZYIA 4Y89A 4CADA 4XAWL 2ORBL 3BKMH 5GGQH 1HHHB 5IROC 2ZOLA 1J0IA 2Q7YA 1DN0A 3JBG7 4FQPA 5E5RB 2BY1A 1WZLA 3QEGH 4MQXC 3F7YA 3SKNA 4Y16D 3KWWA 1BM3H 2VSDA 2QBWA 2AV7B 2RB8A 4Z7QE 5EH1A 1Z5LA 4PRBB 2YUWA 1QPPA 3SN6N 2ATKA 3EYQC 4HIJA 4WFEE 3EYOB 4P9HH 5I1HL 4HS8H 5JQ6H 2IFFL 4XI5D 2VLLB 5IFHL 1NQBA 1JYWA 1UZ6F 5TF1H 3FB5B 5J6GB 2H3NB 3CVHL 3EZJB 3EDDA 1ADQL 3HI6H 4UIKL 2DYPB 4Y4KD 1RUPL 3ZDZE 4F9PA 2GY5A 1JPFA 4YBQC 2EYTA 2F5BL 2YN3A 4MD4A 3V6FB 5SWSA 3L7FB 2X42A 5D71H 2EIBA 1JTOA 4PGBA 4JDVA 4WI3A 1OTUC 4WDIB 5I17A 1KN4L 3FO9B 2XZCL 3BW9A 3WFEH 1IL1B 5M94B 4MA3A 3RIAK 4GXUM 5IJVA 4HKBA 2WK2A 3EIFA 5CEYA 2C5DC 3ZYZA 43CAA 4FTVD 4RMTA 3THML 4JFQB 5HGBA 4X8JA 1J5OH 3ZTJG 3IFOB 4ODWB 1FAIH 3P0GB 1YNLL 2NLJA 3ARFC 2IFGA 4TSCH 4WV1B 3QUYA 4QHMB 1FFOA 3NCJH 4H8WC 2AV1B 2FX9H 3BRDA 3WO4C 3ILPA 3QFJB 3U4EB 4E42A 1VENA 3RHWF 3MROB 2W0PA 4WFGD 3BPLB 3BQUB 1REIA 4U31A 4ONGL 4X7EC 1FZKB 2J6EL 1VFAB 1ORSB 1NSNL 1IAIM 2VR5A 4NQVB 1RZGB 2ZCHH 4U6YA 3EYQD 4HXAL 4KROC 2YC1A 4LCWE 3MJ7A 4NHUA 4HF5H 1E4XH 4HWZB 2OXGA 2WLZA 5F97E 4G5ZL 1SJEA 3DTXA 5EOQH 4UT9L 4AYFA 2A1WL 4GMTL 5GRVL 3U7YL 1RVFL 2X4TB 1EJOH 5JOFB 2VDNL 1W8NA 4FFYH 3DX7B 3N1QC 3C6LA 4DN3H 2BVPB 5IHZA 1T3FA 4GAYB 1ED3B 5BO1H 5ICXA 4JO4H 1ZT4A 4GG8A 1CFVH 5C6TL 4IDLA 4UDUB 5FOBA 3KHOA 1UACL 1YEHL 2EXYC 5L88H 4BKLA 4NCC2 4CW1B 3GEWB 5AD0A 2YK1L 1SBSH 4UT7L 3MLVL 5DQDL 2D9QB 1F3DH 1C5CL 4Z6AT 5GRZA 3DGCR 1FORL 4UINL 3LH2L 5H94B 3BEVA 1FZJA 3BDYL 2AXHA 4G6AC 5IKCA 1CR9L 1MIML 3QUZC 1AD0A 3DX9B 3P0VL 4NSKB 1ZGLP 3G5VA 4POUB 1FL3A 3TN0C 4X5LA 1IAKB 5BRZD 4I0PA 1NKOA 1RULH 1K4DA 2HA1A 4P9ML 1NFKA 2Q8AL 5E56A 1FO0A 1FGNL 1Q9KB 5DO2C 4OZ4A 4TUKH 5L0QB 2P8MA 3KPMB 4JDTH 3DPBA 2MFNA 4WENB 4WFFD 5IBUB 4OZIA 4D0CB 4KY1L 3C09B 1CDUA 3TBYB 2FATH 3ULVE 1CF8H 3WIFB 1RJCA 4GFTB 5C0ND 4PJCB 3L1OH 5C9JA 2HRPH 1Z2KA 1IGFH 4XNQB 4WJ5A 5DJ0A 5JOEA 2GSIA 1JNJA 5HDBE 4FQHB 1OSZA 2WQRA 4HKJB 3SCMA 1CG9B 4L4VA 4QXGH 3C08L 4ZUWA 2QADC 1I1YA 1D5MA 1NDGA 2VDMH 1DE4B 4DAGL 1LE9A 4WU7B 4XC3H 5FYLH 4GG6E 2OP4H 3PQYA 4H1LB 3ABZA 1U8LB 1PX3A 4OD3H 4HCRL 1KG0B 4ODVH 5GS2D 2NYYC 5IMLA 2EXYD 1M05A 3FB7A 3VRJB 3ZE2F 3T65A 1RPQA 3SQBA 1YYML 3KPSE 1FN4B 4WUUE 2MKLC 4GUPA 1F4WH 1UYWH 3QIUC 4J3XA 4WY7L 3LS5H 4U1GC 4OQTL 5MENA 4U1LB 4GRMA 1XCQA 4NGHH 3FMGH 5EU7E 4G6AD 3QUZD 1II4E 4OCSL 3D18B 5HPOA 2C3WA 4YO0B 5CWSB 4JG1H 3WN5B 2WIMA 1UENA 2YPKA 3TN0D 4R8WH 4K9EC 4GW5B 4KMTL 4NQEA 1LHZA 1WICA 2UZIH 3ZZ1A 5KVEH 1F8TL 1OW0A 4ZUUA 2GUOA 3NFSL 1P4LA 1R3KA 1LO4H 1FZOA 2HRLA 5IHBA 1G6RA 3S3SA 3CSBA 1ZHBA 4MDIB 4FOMA 4N0YH 4CN6A 3BAEH 1VEMA 2F19L 5DUMH 4N8VB 4JPIB 5EC2A 4TTGA 2GCYA 4J6RL 1A1MB 3S37H 3OPZL 3CFIC 5DEGB 3TNNB 1NUNB 1IGYB 2ESVE 4LBEB 1CYGA 4GH7B 3BZEB 2QV2A 4NO2A 4MXVF 1DVFC 2FH6A 3VH8A 1KIUA 3UYRH 2QADD 4DCQB 1MVUA 3LRSA 5CEZL 2DBJA 1OF2B 2WSKA 5FA3B 2R0KL 4OLXH 3U6RA 1S7RA 5D1QC 1VGKB 2X10A 3I84A 4WW2C 1BBJB 2ZKHH 1DL7H 1XF1A 2D9CA 2W65A 2GW5A 4P2QD 1MFBH 1RFDL 3T4YB 2R2BB 2EDJA 2B0SL 5JIKA 2ICES 4MJ4A 2XNAB 2NY6C 5DK0A 1KTLB 3QUMH 5LG1A 3T0EA 3VG9B 4NFDA 2OLDA 4AZ8A 4JY4B 4DN4L 1BQHA 4Q6YA 4H8WL 1I3UA 1U8JA 4R26H 3GRWL 3H7BA 5HGGS 4EI6A 1EHAA 4MGXA 1QTYT 1U58A 3DYOA 4QWWD 3TT1H 4KZDL 1OVZA 2PYEB 3HAEG 1FNSL 5T3ZD 3GHEL 1EXUB 3D9AL 4FFZL 3SDAB 1UA6H 3F5WA 2HFFB 3UTOA 1CFBA 3GBMH 1OP3K 2FYYA 5MEOA 1MCPH 2R9HD 1TENA 3DYPA 4L4TE 4IRJC 4HKZA 4ZSOE 1TXKA 3JV6B 2IWGA 4F2MB 2XY1A 3C8KA 2IAMC 1V7NL 3NAAH 1D5BB 3W0WB 4EQ2A 3I6KB 3OKDB 4LLDB 1S9KC 3P4LA 4M3KB 3MBEB 3MOQA 5I9QC 1ZLWK 5K59E 3OJ2C 2MOVA 2C1OA 3MYJB 5LGJA 2AEQL 1FV1B 1BJ8A 1FSKC 4OZIF 2I9TB 5D1QD 3OKYA 1AGFA 5JXED 4I2XE 4JHWL 1NMBH 1XT5A 4JFPA 3H6JA 5EZIL 1MHCB 5DJXA 4LARH 1WVZA 3T04D 2XZQL 2HMIC 2NY6D 3CXHK 3ROLA 3R8QA 2YD8A 4X6BB 3E6FB 4LRNH 5JHDB 5J1SC 3CCHA 3WUWA 3SHSA 1NBYB 4XP9L 2W91A 2FGWL 4OD1H 1AO7D 4FQ2H 4CVZB 3B6SB 4QRPD 5C08D 5JW5B 2XQBL 3GI9H 1OAZH 1QNZH 3G5ZB 4HUUA 4KK6C 4N0UE 3X3GH 5J9PA 5EU4A 4LHUA 3BSZH 3OJMB 5AG8A 4MNHB 2R1XA 1KNOB 3SKJL 4CRPA 2CR3A 2XXMB 3VXMB 3KXFD 1FG2A 4WNQA 5I2IB 5ICYB 2AVGA 4L1DA 4NQDA 3U83A 1TZGL 4XNMB 1KJMA 4JFFD 5I1GH 1MCWW 3H3BC 2AJZA 1A3RH 3A6CL 4KRPC 4PLNC 5C07E 3PWLB 4QRUB 1MI5B 5CJ5A 5D2LA 4H20H 3MV9A 2FO1A 2A74B 1FNAA 4FTVB 5KG9B 4MA1C 4I9WD 4PJ7B 3PABB 1GHFH 3VI3F 3MRMB 2F53A 4B53A 4X9HA 2IG2L 5HYJD 2AJYL 4S1SL 3NABH 5DD1L 4U1IB 4KVNL 5F3HA 3VDAA 3CDCA 2RGSA 4K3HA 3VGFA 1CFTB 5JDSB 3QI9B 1T1XA 1NGPH 2HTLC 1DTUA 4W4OA 2VDOH 4RMVA 3RNKB 1LNUA 4DZ8B 3B2UC 3IDNA 4AT6B 4WTWA 3BJLA 2GFBB 5FUOL 3MRCA 4J8RA 3V6OA 5JLZA 3FOLA 4H5SA 1N59B 4K9EL 1CLCA 4QLRA 1KGCD 2DQUL 5JNYB 5ISZA 1FLRH 2C3VA 3E1F1 2ADGA 2JK5A 4IRSA 4YQXL 3VCLB 2HVJA 3SDCA 3GMMA 3QBTB 4K71C 5D7LE 2VJXA 1FO0H 3TBSA 3EJJX 4C59B 1AGDA 2E3VA 5CKAA 5FGRA 1I7ZB 2KQMA 2MHAB 2PO6D 3EFDL 3SJVA 4JR9L 5I6XC 5D1XA 5J4MA 1E0OB 4UDTA 1BQUA 2XI9A 3MJ8B 3RIFK 3FT2B 1OM3L 2R1WA 3VFSA 4KAQH 4U0QB 3F6LA 5ESVB 2O5ZL 3SE8L 4PGDA 4TUOB 5DD3H 2IPTL 3STBA 1JK8A 4J23A 1NAKL 4OQ1A 5E2VL 3RDTD 1FH5H 3QDMD 1MCLA 5GJTH 2MCPL 4F57H 1HKFA 4NZRH 3IJYA 2A6DB 4H26A 5D93C 1LP9A 4LF3B 4HZAA 4ZD3L 1U8IA 4HMEA 2EYRB 4C56E 2PN5A 3FQUB 5E99L 3OGCA 4XVJL 5DUBA 4YFDB 3IFLH 1SMOA 2HTLD 1N6QL 4MCZB 5DMIH 1CT8A 3DV6A 5C0GA 5D70L 2ADJB 4MJ5A 4EOWL 1BD2E 1Q94B 2VQ1A 3HZMB 3KPRA 5CBAB 1BOGB 3GJFK 1NEZA 1XGTA 1TETH 5LCVH 4HPOH 3O0RH 4M7JH 3VGGA 3FT3A 2XRAH 3WNNA 5ABDE 3HZKB 4FQCH 2NR6D 4L8DB 4WTZA 1J11A 4YUEH 3GKZA 3FHQA 5BZDB 2E6QA 1JN6B 1WFUA 2ATPB 2CIIB 1WZ1H 3QPXL 4OIBA 4XTRD 1XGPA 1PZUB 3AS3A 5T1DL 4M00A 4HH8A 5KS9B 4FQQA 2H8PA 1JBJA 3QFDA 1T6VN 2WAHA 4BJLA 1AGCA 4LCIH 3PGDB 3PV7A 1G7LB 2BHZA 5TPWH 2B1HH 4UUJA 4PJIB 1PY9A 4Y1AD 4Q58C 4J3OC 5EU7C 5D5MA 1IARB 1IM9A 1RIUH 4G6JL 3FFCE 3IS0X 2HTKC 4PBXA 3SDXA 2H45A 2HFGL 3H8NA 4I18C 3ARBC 4ZUVA 4Q6IB 3P9WB 1UB6A 4KRLB 3VFVA 1GGCH 1C8PA 4HWBH 5CAYB 3MR9B 4LP4A 3U7WH 4ODHH 5D1ZB 4OKVA 3U36B 5D2LF 4CVUA 5IEKA 4RGMC 2XFXB 1X5JA 3MNZB 4XXDA 2Q86A 4K3EH 3MCKB 1ACZA 2WP3T 6FABH 4RGNE 4MD0A 1T4KB 5HGDA 3ZE0E 5IW6A 1JMZA 1MLBB 4KMQA 4XCYA 1BVZA 5HHOB 1MJUH 1F58L 4K94H 5BZWA 1JF5A 4K55A 5DMGC 2EEAA 5TDNA 3PF2A 5MI0C 1ZLSL 3GSQB 3RL2B 4LQ1A 3OKEB 3EYSH 2X4QA 1QUNA 3JV4A 5K9JH 1I7TB 4KKAD 4Z95L 2JELH 3T2PA 4GKNB 4MJ6A 2BX5A 4NRYB 4FABL 1X5AA 1A7NL 4YAQB 2DQIL 1F97A 4PJ5E 2VDKH 4G6FB 4L3EA 1UJ3A 5IOPB 3HI1B 5DSCA 1V3KA 4PB9H 3QIBB 3HNTH 4PYGA 5BQ7A 5E5MB 5GZOC 4ZNEE 1MY7A 2GJZA 4P4RA 2OL3B 5EN2A 4XPBL 4POZC 3Q6FA 5H37H 1M7DB 3ARBD 4IMKA 4S1DC 3V4PL 1WSST 3CMGA 1MCFA 3DYMA 4YPGB 3BO8B 1N5YL 3MODH 2KH2B 3ZDYE 3MXWH 1IT9L 5F96L 3BZ4A 3GO1L 4NUGL 4UAOB 4A6YA 3MLXL 1SJHA 2BNQE 2B5IB 1XF4A 4PRPB 4HK3N 1A2YA 2YWZA 4G9FA 1UZ6E 4D9QD 1RU9L 2BY2A 3ARGD 1RZKH 4QO1A 5CBEA 4BFBD 1LP9F 1G7IA 2AXJA 3QDGA 4MA8H 4ZFOA 4APQA 3RVXC 4QHLA 1NGZA 4DGYH 1CGWA 3RWEB 4QXUH 4Z7OF 4JLRA 43C9B 3OBAA 3MRNA 3GB7A 3ILQC 1SQ2N 3V8CA 2G9HB 1YNKH 3SKMA 1BEYH 2ZCLL 3LN4B 5FK9B 3ARDC 2A2QT 4YZFF 3GJFB 1WAAA 1DBML 4WW1B 4KKCD 3VRLF 4OT1L 4PJ8C 2FIKA 5GS3A 4R4BA 1FG9C 4E0RB 3IXAA 1S9XB 1INQA 3OKNA 2AABL 5CSZB 3MV7B 3VU2A 3BMVA 2FB4H 1IM3B 4XX1E 4NJ9L 3HNVL 2VOTA 2NX5A 2OJEB 5FYLE 2M2DA 3ES6A 3UO1H 1QBML 3EO0A 4O51A 2WBJC 3MGOA 1AO7B 1MFAH 4QRPB 4PRNA 4YBLC 1LEGB 1D9KA 4POZD 3SGEI 1PKQE 4Q2ZA 4JFDE 4PYHA 1KN2H 4RZCB 3VWKA 4TYUA 4WRLA 4TRPH 4GXVH 1T1ZA 4NN5B 2EXWC 1L4IA 2VDRH 4ISVB 5F88B 1CL7L 4Z7NF 4MQTB 2Z8WC 5CJOL 3LB6D 4LU5H 3E0GA 3FB6B 1QG3A 2F54B 5ID0B 3B83A 1MFEH 2FECL 2IH3B 4JFFB 4TTDC 4UTBL 3LHPL 4HK0A 5D5MF 4FQ1L 1CFSB 4HAGA 2WUCH 3RZCC 5GJSH 5ESQA 4WO4A 2J5LC 4P4KC 2JIXD 3BZFA 4M5ZL 1EV2E 3SDXF 4PGEB 4ODSH 4DZBA 3RVXD 1RSFA 1W0YT 2CJUH 4PJAB 3G04B 2FGZA 1K6QL 3P73B 1DBBH 5HYJB 1FDLL 1A9EA 2E27L 1D6EB 1U3HD 4ZPVB 1NDMB 1A5FH 3DROA 4G9DB 3QWRD 3DO7B 5F8QC 2E9IA 3R06A 5EO9B 2I07B 2YA1A 4NFBA 4OZHA 4UV7H 1R6VA 2VRAA 1T22A 3UTZA 4Z18A 4JZJB 3G08A 1IEAA 4XCCH 3M07A 1TTFA 3VWJA 2WBWB 4UT6L 4QHKI 5GGVH 4P2OB 3K80A 3HN3A 5F7KC 2GIYA 2A6KA 4PRDA 2AI0L 1OGTA 3X12B 5C09E 1ZGLB 2WBJD 2BCKB 5D6DC 2VL4A 4XX1G 4KUCF 4TVPE 3D0VA 1FNGA 1Y0LB 5HVGB 2Z4QB 1AIFB 3IDMA 5I1LB 1A6VH 1L7IL 3R0MA 1IC7H 3PV6A 2XWTA 1C5BL 2X41A 2EH7L 2M1KA 3OJVC 5FYKL 4R9HA 5JO5B 3UPAA 2PO6B 5DR5L 1JHKL 1QLFA 2R0LH 1HHIB 4RSVA 2XYCA 4MZ3A 2DTSA 4BQBA 5EBLA 1ES0B 4IS6A 4OM0H 3SDDA 3EYVA 3UZEA 1G7JB 4XMPL 1JHTB 4TTDD 1R0AL 2L0DA 5JW4M 4P3CH 3TJEH 1HQRB 1BP3B 5ITBL 3IFPB 3QAZC 1B4JL 4P4KD 3RWDB 3T4AA 1WV7T 4PJHA 1XR8A 1RZ8B 3TIDA 5JW4Q 5GSRB 2J88H 2DQHH 4YR6B 1W72H 3MGTB 3ZKXC 4B41A 2X1OA 3BN9C 4PJDA 4TSAH 1OT1A 1FPTL 4NIKB 1RUMH 3MQIA 4HIEB 2UYLB 3ZE2E 1N0XL 1OP3H 3W2DH 1YEEL 4XMKH 4M62H 3UTTA 1YPZB 5C0BA 5ERWB 5FA4B 5B38A 1DQQA 3H9SA 4NYLB 4R97C 1UKQA 5JXAH 1P4BH 8CGTA 2HYMA 5SWSE 4LGPB 3HC4H 2X4OA 3QQ9C 4QCIB 3HZYB 3RGVC 2QQNL 3OF6D 1ZLWH 2NTSP 5IMKA 2JJTC 1KENH 1IKNA 1LEKB 1RJZA 1VA9A 4R0LC 4D2NA 1WAAF 3I9GH 1TQBC 1H8SA 4ELKA 3KNBB 2CDFA 2NY2D 4HBQA 5FYKU 1DEDA 1QHOA 1JPTH 1NBZA 5EWIH 3RTQD 1MNUL 5FUZH 4UV4L 2XN9A 3BWAA 4HV8B 4IRZH 4L3CB 4P5TB 1RZJC 1ACYH 4CNIA 1L6ZA 5F21B 3CFJB 3D5OF 5CD3B 4RQQA 4AM0A 2VLMD 1S9VA 1NBVH 3TEUA 4F7EA 3QIWA 2HN7A 3WFCL 4NKIL 1LK3L 5ITFA 1TJGL 2X89D 2Q87A 4XHJC 4XVUC 1WF5A 1J1PH 2EDEA 3WJJC 3RVVD 4F3FA 1KB5A 2I25N 4JN2B 4YC2C 1IGTA 3LRGA 5DJDA 1J8KA 4YHIB 4ZS7L 3VMNA 2OR8A 1A4KB 3LN5B 1OAQH 4GRWF 4WHCA 5I1DA 2AEIT 2NXYC 3DUSB 1MHEA 4NZDA 2PW1A 1F00I 3JWDH 3MLSH 3F7VA 4IDJH 1D7FA 3RWHA 5HI5C 4D8PA 5MHSE 1B6UA 3QWQB 4G8GD 1O7SA 3EO1B 5E70A 2Z8VC 5L2KA 2MMXA 3LEYH 3GI8L 4B50A 5JHLL 5LJYH 1MCOH 2DICA 5GRUH 4QRTB 5IJKC 3QQ9D 3SEPA 3GMRB 5ADPH 2PUQT 1BBDH 2F5AL 5KSVB 1MJ8H 3OG6B 4R96A 2C7UA 4UIMA 3UPRB 4RMUA 5C0JA 4PGCA 1JWSA 3IVKB 4GRLA 1SEBA 3O3BB 1F02I 5E6ZA 4HW6A 5KSBF 3VXRE 3C5SA 3RBGA 5DT1L 3VDBA 4PJGB 1QR1A 5TGBA 5EULV 1KPRB 4F58H 2Y23A 1I85A 4QRRD 5HYEA 3O6FC 4WUKL 4EVNB 3IT8D 5HGAB 2DBLL 1X6NA 3O2VL 5TE7H 5EO1B 1I9IH 4PJFA 5FYJD 2ICWA 2RIKA 3VFMB 4XPTL 1SMAA 2VXSL 1QLRA 1J12A 1IAMA 1U92A 2OQJB 4O9HH 3GUTA 3TYGH 1X7QB 5T3XE 1GC1H 1MPAH 1I9JH 4X6DB 1KLUA 4ZTOH 4OZIE 2NNAB 3CSYB 4KJYB 1AXTH 5GS1C 5EUOA 3I6GA 4AMKH 1LILA 2W9EH 1S7XA 5HYQA 2WP3O 3BP7A 3NZHH 2ENYA 3VW3H 2XWJA 1I8LA 5HI5D 3CLEH 3TBTA 1JYVA 4L4VE 1P1ZB 5KZCD 4PJHF 4J3WA 4LLAA 3G5YA 4XVSL 3PJSA 4ZXBC 3ARGB 4MAUL 3HE6B 4I48B 3MRQB 1A6AA 2ZUVA 4Z76A 1CD0A 3IJHB 1MCSA 4PJDF 4QHUB 1FNEA 5CCKL 3F12A 1FNLA 4NBZB 3MRLA 3T3PF 1GZQB 4X4XA 2KKQA 3QUXA 1D5XA 2IBZX 3EOTH 4NOFA 4OCMC 4Y4FC 4BSWB 1JRHH 4JE4B 3DECA 1MEXH 3LQAH 3EZ8A 3BRGC 3U0WH 1QPXA 4GRWH 5MENE 4JFED 3SQOL 1UEYA 4P57A 4NWTH 1ZT1B 2C26A 3B9AA 4QYOA 4HIIB 5FDWB 2UV3A 2F8XC 2DLIA 5EB9A 1R5VB 5I1AA 4F7CB 4NQEE 3ZLQC 4GMSH 3GSRA 3GJFH 4YHNA 3VI3E 2VXVL 5D7JA 2QQLH 3BHBA 4LSTH 4LPWA 1UKSA 3CXDL 5I76B 3VFPA 4P23C 2VLJE 1YMMA 3U9UA 5IFJB 3UP1A 5DJCA 1QO3A 3D69A 3UTSA 4MB5A 3KDMB 4DVBA 3K2MC 4NQSB 4OLZH 2ZSWA 4LRIC 1BQLH 4TQEH 4DVRL 1KEGL 4W81A 3QZWB 2YXMA 3IDXL 3IRZA 2YRLA 3CFDA 4KGJA 4Y8DC 2F15A 3P30H 2ILLA 3QG7L 1SYVB 4QY8A 1QOKA 4ZXBD 3QO1A 3LSOB 4JKWA 5TFSH 4YDKL 2VZVA 4FXKA 4MS8C 5A2KH 5FCUL 4ZAKB 3RA7H 4YXHH 3O4LB 1A6TA 3UAJC 4HH9B 5BW7A 3TO2B 1NBQA 4YXKH 3FRUB 1RZJL 4Y4FD 4MMZC 4X7DC 2BOBA 3T0EE 1U3HB 1YUHB 4HWUA 5EU6A 4Y2DD 4JVWA 4UNUA 5DD6A 4FQXA 2VABA 4GAGH 4ORGA 1IC5H 1P5UA 1KLGA 5ETUA 1GPOL 1P69B 5H2BA 4P99A 2GSGA 4V2BA 1AY1L 2DI9A 4I1NB 4BH7A 4K3JL 3QXVA 4KKBD 3O9WA 1T5XA 1HHHA 3VXTB 2H41A 3LKNB 3V5KA 3EHBC 2AXGB 2NY1C 3OKOB 4O02H 1BWWA 1XMWA 4BZ2L 5I18L 1DQJB 1FZMB 4HKXB 1EH9A 1ZS8B 3WXWL 5GGRY 3EAKA 3VJ6A 4DEPC 3HC0B 4EEEA 1RJYB 4GAJL 5F6HJ 5C0CB 4YE4L 5L6YL 2AV7A 3Q5OA 4M4PA 3HG1D 3C60C 5HHNB 4FG6C 1FE8H 1CU4H 3RWGB 2V9QA 4JZOA 5TH2A 1HYSD 3EYOA 3K46A 1MQ8A 2Z93A 4OZFB 1KCSH 2GTZA 5J6HA 4XT1C 3DOSA 4FRWA 4XVTL 4V1DB 3H9HB 3PXHA 2DM4A 3S9DB 4H1LG 2H3NA 4BFIB 1XGUB 3WDHA 3GZKA 4YHKL 4MA7H 3WJLC 4P2RD 1QSZA 3DUUA 3KJ6L 1DLHB 4Y7MA 5EUOF 4DKDC 4M1GH 2OX5A 3QCUL 4U1SB 4EUPA 1RIVL 2GJ6A 2CQVA 4AQOA 3BGMA 1NLDH 5HGHB 3QPQC 1JHLL 2X9WA 5SX4H 3TH2T 2D0FA 1C12B 4HT1H 2FBJL 4GQ9H 5KSAD 4MJIB 4CMMA 3K2UH 4HJ0C 1ROWA 4U0RB 4EN3A 4NQXB 4JFOA 5DUPL 1BPVA 1NCDH 4LNRB 2QSQA 2EICA 1GGBH 2XTJE 4IOIA 4KPHL 3WSQL 4F9PC 5GRVK 5L9DL 2EE6A 2NY1D 1KJ3L 5IK3A 1HHGA 5GQBA 3D39B 4XB8A 3W9EB 2A9ML 5CJQH 1N7ML 5JPMB 4JPKH 5T1LD 4O4YH 2AXFB 4NO3B 5IMMA 5LWYL 2XWBA 4N68A 3S98A 4N8VG 3C60D 4FG6D 4K2UL 2LU7A 5ILTL 4OF0A 3CZFB 1OAUL 5DHYB 2IH1A 2DWDB 2FZ3B 2NY2B 3MV9E 1NEUA 4M6MH 5E2UL 2BHUA 5IQ9A 2UVEA 1YY9C 1S7SA 1MIEH 2VISA 1QSFA 3EJZD 2QSTA 3DRTA 1LK2B 1NFIA 1NCBL 2F53E 3OHXB 3W39A 5JW3L 4PS4L 2BSRA 2EDWA 2OCFD 1XF3B 3FO0H 3QEHB 1LO5B 3ARYA 2BVPA 2CKBA 3BUYA 1KJ2L 1ED3A 1VACA 1L9MA 4TULH 5IEHB 4TNVK 2RBLA 2X4UB 1T5WB 3P4MA 3VXSA 2VLRE 5H37G 2VLKA 4YNYA 1XZ0A 3IJSB 3MRJA 1SYSB 4KJQD 4TVSa 5CILH 3HMXH 1M71B 1NGQH 2LTQB 3V6OE 4XP4H 3OAYK 1FIGH 4OUOA 4N0CD 4QOKD 5ISZE 3P77B 1ZAGA 1OB1B 3SGDH 3FFDB 2Z0BA 5CD5C 1RZFL 4NSKA 4H88H 4AK1A 4LPVA 3VFUB 1A7PH 2Z91B 3TZVA 3TYFB 3SJVE 5GRWA 2P8LB 1MI5E 2IAND 4XZUA 4X6CA 1FYTB 3QHZH 3MRPB 3TP4A 4XP1L 1QLEH 1PYWA 3ELAT 3DIFB 4ONHB 4YHML 4NNPL 3S34H 1UB5A 4M1DL 4D0CA 1CXLA 2CK0L 1A7RH 3OV6A 4DUXA 5KVGH 4U1MB 1HKLL 1YY9D 2V7NB 2AEPL 3CVHB 5CUSL 3MSPA 1RIHL 2DJSA 3REVA 5IBTL 4BH8B 2ICCA 4G8FB 4QRRB 3MLZH 1LP9E 2FSEB 4PLOB 4M7KH 3AAZA 1J7VR 3OB0K 1H15B 3N0PB 2Y25A 4HUKB 5FEBA 3BI9X 3OSKA 4Z7OE 1PFCA 3INUL 25C8H 4LSRH 2Y4SA 1KTDB 4DW2L 2FJGA 2PETA 1HN1A 4P46C 4NPYB 1JI1A 5DLMH 1J1OL 1NH6A 2HWZL 2X70B 5CHNA 4YHLH 5I1JH 1VGEH 4YZFE 5F9JA 3VRJA 1X5HA 4DKEL 3NIDF 4M02A 4JM4H 3VRLE 5A43C 2R4RL 1EMTH 3KPRE 3GHBH 1OTSC 3LS4H 5F44A 4RNRB 3KPTA 1MRFL 1E4KA 3RNQA 3W5NA 1CE6B 3EFFB 3MYZA 4W68A 4Y19A 2O61B 5DMYA 4PUBH 5HYSA 2E6JA 3QO0B 3X14B 4OZGB 4BYHA 5KZCB 3REWA 1RMFL 4OLWH 4XGZB 5F7DB 5LAXB 5CWSA 4M6NL 1QQDA 4ZDHB 3VA2C 1IC4H 5F72S 2CUMA 3B9KC 1EIBA 1KYOJ 3LV3B 2IQ9L 3VD7A 4Y5YC 2FEEI 1BF8A 1SHMA 3BPCA 4XXCA 1UXSA 5DD5L 2Y72A 2BMKA 3QXTA 4Z7NE 1FC2D 2VXQH 4LPTA 4Q97A 2BNRA 2ITDA 5J3HC 1F4YL 4JFXB 3L7EB 4NJAH 4JFEB 1S5IL 2P5ED 5D5ME 5E8EA 5I75C 1EAJA 1RURL 4PREB 5IFAL 5CSGA 3C5ZA 1T0MA 4G7YH 4MQ7B 4L9LC 4XP6L 5DFWH 3SDXE 4M61A 3BIKA 5IHUH 2BVQB 1INEL 4YK4B 4FXGA 4JM2D 3JTTA 3CFKB 1VGKA 3FQXB 1VPOH 3G6JA 2HVKB 3IKCA 4LQFL 4JFHD 3FQNA 5EBMA 3T4YA 3L3KA 5FV2A 5HVFB 1IAII 2UZYB 2CGRL 4WEUD 3TVMD 4MCYB 1QRND 1BFVL 2J8UB 5J06A 2J6EA 3MNWB 4PG9B 5LXGH 2R2CA 3SBWA 3OXRA 1FNHA 5C86A 1NEZG 1HEZB 1OGAA 3EYFA 5K93A 2C3XA 5HXMA 2CRMA 1MRCH 5D8JH 3I3BA 5C3TA 1XIWB 3K0WA 2YXFA 4X5WB 5DDHA 3NFNA 3B9KD 1RUAL 3MBXH 5BS0D 4YDIH 1F4XL 5HHXH 5CEXB 2YD1A 5BVJA 5IWLA 4I5BA 3MLTB 1MRDL 3BX7C 3NCYP 4JQVA 4AEFA 1CTOA 4Y2DB 5IT2L 3GM0A 3P11H 1DEEA 1VFBB 1I1AD 5T33H 4L1HA 3NGBB 2NW3B 1S8DB 4NNYB 4HUMB 4HC1H 2W0FA 3MYJA 4X6CF 2I27N 2NY3C 5EA0L 3NBNA 1DBKL 1KXQE 2FDBP 2ZSVA 4FS0A 3WXVH 3BGFC 2XACC 4Y16A 4F37K 1B90A 2VITB 2IGFH 3MZTA 3PDGA 5HI4C 5EU5A 3B5TA 4XPHL 2V17H 3LKRB 5I16B 3HG1B 4G9FE 1GOHA 1ND0B 1OSPH 2V2TB 1H3TA 3JWOH 2DQEH 5D2NB 4RMWA 5JMOC 3QDGE 5FGSA 2VDPL 2V2XB 2J4WH 3ZT6A 3PHQB 4HEPG 1NBYA 3PWVB 4IIQC 2OI9C 3VD5A 4X7SH 3RQ3A 3T0XA 1CBVH 4BUGA 5DJZB 4M8VA 2ERJB 1JNHA 5KANI 3N85H 2X9XA 5TQ0L 4Y4KA 4MNHA 4P2RB 3BKJL 4LCUA 1WAAE 3VMOA 1A6UL 1A4JA 3L3OB 4ESKA 1X5IA 5CSBA 3ZDXF 5I2IA 4U7MA 3TH4T 3Q3GA 1MUJA 4PRIA 2JTDA 2CRYA 4XNMA 2NW2A 1VKXB 1K3IA 4KK9C 1A7BA 4PPTA 4RIRB 1A3LH 2NX5E 4JRYA 4HCRA 5KSAB 4MDJB 7FABL 4FTVA 2WBKA 2DQJL 1XF5B 2R23A 3DLQR 4LKCB 1WWBX 5CIPA 3V7AE 1VESA 5T3XL 1AQDA 2CKBH 3AMKA 1YEIH 3P4NA 1A1OA 5IROA 1HIMH 5IP4A 4M93C 5KSUB 4OF3A 4U1IA 3D3VE 1KXVC 3BP5B 2DM3A 5C0DA 3SKOA 3X13B 1U8MA 1CGYA 5T1LB 1FVEA 4GRWE 5HI4D 3B9VA 4JJ5A 4OI8A 4F15B 3ARFB 5KTEL 4BSVB 5F8RC 1J0HA 5TE6H 3MLYH 1HDMA 3HR5A 4FNLH 3WO4B 1ZHKA 4U3XA 2ZOKA 5AYUL 2VDQL 3VFGH 3LZFL 3V4VH 4YIQA 4LCWD 4NQUA 5FB8A 4KROB 4Z7UA 3IETB 3G6JF 3LMJH 3WNPA 4P5KB 4X5XB 3SE9H 3VCLA 3CD4A 2B4CH 5DHVB 1CD8A 4OD2A 3KYAA 4Z0BL 2PYFB 1A14L 1C1EL 4YLQT 5ID1B 2AGJL 2CLVA 3QXDA 5DC0A 2GITB 3QHTC 3NA9L 5K9KA 5I1IH 2ICWI 5KSBE 1W0WB 1INDL 3OKKB 3FN0H 2YUZA 4OSUH 1T03L 5C0EB 4JKKA 2V7HB 5DRNA 3M45A 5LGHL 2Z31C 3TA3C 3LEVL 2WWMD 4JQIH 1EZVY 1G6RL 3SDCC 2F54E 1WC7A 1K4CA 3GIVA 4LF3A 1T66C 1U95B 1DDHB 3UYPA 3GSNA 4LEXL 1U3YA 2P5WB 4XAWH 2ORBH 5GZNC 1TQCB 5BRZA 2NCMA 3PE9A 2APTA 1EFXA 5CP7B 2IANB 4AH2A 1KIQA 4IHOB 4X83A 1NC4B 1MELA 1U3JA 3DI2B 5FDYA 4K8RC 4KKNA 2XKNA 1HHJB 4FFWD 1K5NB 3AS0A 2X4PB 5IB5B 2UVFA 1PSKL 4PJHE 5I1HH 2DDQL 2IFFH 3HZKA 3RWFA 1MLCA 3KYMA 1T83C 5T5FL 5IFHH 3QEUB 3V52L 3WFDL 3ULVD 4YEFA 3C5JA 3OX8A 1JN6A 4HEME 3T3PE 3CVHH 4LLUB 2AS5M 1ADQH 1CVRA 5CMAA 4UIKH 4LSVL 1RUPH 1VFMA 1K8DA 3UTTE 4X6EA 3GMNA 4FZ8H 2VE6B 4FMKA 5C0BE 4AENA 1AKJD 3RWIA 2K3TA 1WWCA 5C7XH 2I24N 3M1BB 1AR2A 3D1MC 1KN4H 2CXGA 4P3DA 3VFRA 2ADIB 2Z31D 3TA3D 3WFBL 3SE3C 1OAXL 5JORB 4WUUD 3JSSA 2X4NB 3THMH 3TNMA 3QUZA 3Q2CA 2DKMA 5FGBA 3TN0A 1VEPA 1YNLH 3MCLL 5C0FB 2XN9E 4MLSA 5HHVL 3KYNB 2WV3A 3QCVL 4ETQB 1NPUA 3LN9A 4PRHB 1CICC 2D7OA 5DMJB 4Q9QL 4LSPL 3L3JB 3GKWH 4K8RD 4NN7B 2AQ2A 3SDYL 4R7DA 5ACZA 4LGSB 4ONGH 2I9LA 2J6EH 4XCFH 2AAVA 3KHQA 5MP6L 3ESVF 3IXTB 3VXOA 4HXAH 1T7VA 3GNML 5DQJA 1IQDA 2PTTB 4GXUN 4CGTA 4G5ZH 1MFDL 1WEJL 4UT9H 2A1WH 4GMTH 3U7YH 4P48A 2C1PB 1RVFH 4NNXB 4X7FC 1KBGL 2HJLB 2VDNH 2ESVD 3IF1B 1YMHB 3PWPB 4JM2B 3PWNA 3CPLB 2G2RA 4G80A 3CFBB 5D7SL 4ZUSA 3BIAX 4P2QA 4HUXB 5C6TH 3TBWA 2H6PB 5HHME 5L2KE 3TVMB 4RISL 1UACH 5D6CB 3SKUD 2OR7A 1YEHH 1QRNB 3GSXA 4Z7UF 5IOPA 3WIIL 2YK1H 4KKLC 4UT7H 1VFOA 2D4FA 3MLVH 5B8CB 5DQDH 3ROOA 3S37X 1C5CH 2HJKB 2VDLL 1ZANL 1FORH 4OAWB 5IF0A 4HQQL 3I85A 4UINH 2MQ3A 5IB2B 1X5YA 3E6HA 2GYSA 3BDYH 3FHAA 1JJUA 4RFOL 1CR9H 1H3PL 1MIMH 3LDBC 4HS3B 1PDKA 4ODBD 2DF3A 2EDRA 4AJ0A 4I4WA 4LKXA 5KAQF 5SV4A 1YEJL 4P9MH 2Q8AH 1FGNH 2IPKB 1UJ3C 1URLA 1GOFA 1MWAB 3DMMC 4NKOA 3OAYH 5C0IA 4AEEA 4KY1H 1I1AB 1O0VA 3ZE1F 2AK1L 2FL5B 4IRJB 5E2JA 1B3JA 1G7MB 3HUJA 1S5HA 4IMKC 4UB0L 5EUOE 3STLA 1DVFA 2R56L 4MX7B 5IUSA 2VWEC 4PJ9D 4UTAL 4LVNB 2X09A 4JG0L 4Z7VF 4KU1A 5D1QA 3P3YA 3C08H 5JXEA 4WW2A 4QRSB 1EBAA 5GGUA 3BP4A 4KI5C 4HCRH 1ETZB 1FHGA 4BFGA 4HJGA 2W0LA 2FIRT 1V5JA 4JRXD 1IVLA 5CIPH 1IM3A 4APQC 1J0JA 1YYMH 1FBIL 2MPAL 2P45B 4MNQE 4C55A 2AP2A 3G5XB 1ZE3C 4PJGE 4GO6B 2YPLD 3RY5A 1AO7A 3BKCH 4WY7H 5C08A 4QRPA 1LEGA 4BM7A 2PW2B 4OQTH 5FIEA 3FO2A 3VFOA 4YHOL 1RZIB 2HG5B 4FQIL 5HI3D 3T8XA 5SWQB 2XXCB 1CD9B 4OCSH 2BSTB 4PR5A 3KXFA 5FGCB 1Z0NA 1BJMA 4KMTH 1JP5A 4PJEA 2YD7A 2Q6WA 1F8TH 3AY4C 3NFSH 5F7MC 3RUGA 2ENSA 2IAMA 2LV4A 3QWOA 4L8SB 4RFNB 1CQKA 1JGDA 3DMMD 3UBXA 2VL5B 3D85D 2CDEB 2PXYC 4S0TD 1YMME 4HJJL 3MUJA 1D9KC 2F19H 3UTSE 4J6RH 3JUZA 1A6ZA 1BAFL 3OPZH 4TPRL 4Y4HC 1DQLL 1FFPB 5C07D 3OR7A 5HYJA 1QSEB 2X2YA 4MWFA 1R3LB 4JKLA 1JV5A 4ZPVA 2VXUL 1NDMA 2H2PC 1B0WA 2CD0A 1D5ZB 4PGZA 4G9DA 3WFHA 1KB9J 5ALBL 5CEZH 1HI6B 3FCTB 1N6UA 5A2FA 4L29B 1KYOK 4KI5D 1HHKB 1R24B 4WO4C 1MY5A 3CSGA 1RFDH 2B0SH 5C8JB 4ZFGL 2NZ9C 2QSCL 2BNUB 5BV7B 4LCWB 4R3SB 4H8WH 1MJJB 5EU6E 2A6JB 4LVHB 2W38A 3GRWH 4OTXL 4HGMA 1K8IB 1FRGL 1EHLL 3BPOB 1JZ8A 1V7ML 4KZDH 1H3GA 2PO6A 1FNSH 3EUUA 2WZPD 4O2EB 3SPVA 5F9AC 2X1WL 1UQSA 2E9JA 3D9AH 4FFZH 3VWJC 1UEMA 5DA0B 4FXLA 1G7JA 5D7LD 3MRDA 4QHNB 4P9HC 3WKNA 1LD9A 2IALA 5DHVH 5HTSA 1EEQA 3HCVB 4RBPK 1S7TA 2EIEA 1J8HA 3RWJA 2PXYD 3L3DA 1V7NH 4KVCH 3QDJE 1WITA 2D7PA 4ZUTB 3RDTA 3QDMA 5B39A 1DR9A 4OV5B 4Y4HD 4K7FB 3QXAA 1OL0A 4KHXH 1DLFL 4DKAA 4ZODA 5BCAA 3JVGC 2H2PD 2AEQH 1U93A 1QACA 3NIDE 1CWVA 3BH8A 5DA4A 4LASL 3O4LE 5D93B 4P3WA