3QUZD

Structure of the mouse cd1d-nu-alpha-galcer-inkt tcr complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 65
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzD02
3J8F7 3WS3A 1FN4B 1DQTA 4HD9A 2ZNWA 5L2KB 4FXGB 2OL3L 2AJ3A 3TBVB 3ZYIA 1YYMH 4XCNA 3H6JA 4OF0A 2AK1H 4KTEL 5DC9B 5B38B 1FE8H 2QQLH 2XPGB 3RUGF 1CL7L 4RBPK 1XF4B 2DD8H 1GIGH 4HC1H 5TE6L 1E6OL 3PWPB 3IU4H 3HC4L 3JVGA 4UT7H 2D0HA 4C83B 2CRYA 3RU8H 3O3AB 1MFCH 4LGPB 5T1KA 5EB9A 2EYTB 2EDKA 3DI3B 4J4PC 3FL7A 3WLWC 4D0DA 3GMRA 3IRPX 1JPST 3MXVL 3T77A 3DBXB 5LAXA 3QDGB 1F4HA 4EDXB 2FSEB 1ZSDB 3BEVB 1B2WH 4M61A 4ENED 3HZYB 1JVKA 4GKSA 3MX0A 3VRLF 3IDMB 5EOQH 5EU3A 4N8VG 1OM3H 3JVGC 3OR6A 3FT2A 4HKJB 2V2TA 1MUJA 4KRPB 3WFHB 1BD2B 4OFPA 3MRPB 3O3DB 1SMOA 1QBAA 2VZOA 1RIHH 5IB3A 1NSNH 3QHFH 5LCVH 4IRJA 3WIFB 3ARDB 3D69B 1U8KB 4KXZI 1S3KL 1A1OB 1YEEH 3W2DL 1N2RB 5BW7C 3EO0A 2JCCB 2A77L 2FO1A 1ZV5A 1S7QB 4XP9H 4RFEB 3O2WH 3QNXB 1T0MA 2AGJL 3BWAA 5E6IB 5ESVB 4JG1H 3VXQA 2C4XA 3O6KL 4G9DB 3WN5B 1NBVH 3PWVA 4AYFA 3BZFA 4HXBL 5FYLE 4IRJC 1XCTA 5SWQA 1OAZL 4J4PD 4JRYD 3NIGE 3K8KA 3S5LA 3WLWD 5D2NB 5HYJE 1J1OH 3C8HA 3FRUA 5IR1B 2BY2A 4QRSB 4BKLB 1IZJA 1DQQA 3JWOC 1ROWA 1CLYL 1PYWA 4Y5XB 3V6OA 4P4KB 3LV3A 3QG7H 1OT1A 4NN7B 1S9WA 3P4MA 4JFEA 3PHOB 3L7FB 3IDYB 3WFDH 2VERN 1ZVYA 4HT1L 5EBLA 5KSBA 4GAGH 5CZKA 4DGIL 3WV0A 2QTEA 3JTSA 5EOCH 1EO8L 3U9UA 1K6QH 3SKNA 1JYVA 1T1ZA 5C2BH 4Z7UB 2O5YH 5ETUB 1JZ6A 4CW1A 1FJ1B 1F4YH 3LPFA 5I8CA 5ICXA 4XVTH 2Q6WB 2FGZA 4LMQI 3QO1B 3H9HB 3V6OC 4CADA 1JPGB 1P4BH 1YMHB 4WGWB 1L6ZA 1HCFX 2AK4D 2OP4L 4H8WC 5IW3A 1QLEH 4LVEA 3L3OA 5DQ9A 1FLTX 2I9LB 4LSQH 1MJ7H 4TUJA 2IMMA 3TZVC 4ZTOL 5HTSA 1FNGA 5CILL 2PTVA 2CLVA 2CDFA 4PB0H 2W91A 4KMLB 2VOTA 3L1OL 3R0MA 3DXAE 2NY3B 3R1GH 3IFOA 5F44A 5K9OB 1QYGH 4JY4A 1U3HA 1LP9A 1MEXL 5AYUH 3HE6C 2A83B 4QRRA 3BDYH 2XIDA 4XT1C 5KANG 2VL5B 3DX8B 1QFUH 4KTYA 4N0UA 4JDZA 3B8SA 4M6OH 4PJ5A 4EBQH 3L5XH 1HKLL 2VDPH 3P9MB 2FJFA 5E5MA 5K9KB 3TH3T 3T2NL 1IT9L 5DMKB 4Y4FC 2QEJA 5D2LF 4M6NH 2X4QB 3DIFB 5HHOA 3UO1H 5C0FB 3MV11 4S10A 4WHYG 3V5DA 2GIYA 1U3HC 3H9SB 2GJ6E 5D96C 1MQ8A 1FFPB 3MRQA 3G08B 4UDTA 4YFDB 1QA9B 3GUTB 3EYUH 2FX7L 1CBVH 1T66C 1ZVSB 5ID0B 1ZT1A 4MZ2A 5CIPA 4U6YB 4P4RB 2V17L 3TZVD 5GS0D 3FQRB 3CSGA 4PG2C 4HIIA 1JHTB 2ZUQB 2WBJA 1EHLL 1Q9KA 3H3PL 3GI8H 3DGGA 4M62L 3KPSD 3AGVA 1NGWB 5L7XH 5L8LB 3BYTA 4KTDH 1KENH 1F4XH 1LD9B 3TIDA 1HZHH 2O5ZL 4PJHA 1AD9B 4DVBA 1SBBA 4PJ7E 1KC5L 5C2UB 3NA4A 1KLUB 1NBZB 3OKMA 4NKIH 5HDLA 5SWZD 3HE6D 1LEIB 4JO4L 3KR3L 4J1UB 4BZ2L 3NABH 1R3LB 5EG6C 4D8PB 3T2PA 3S37H 2QQNL 5J1AB 5EN2B 4BFIB 1SVZA 4N68A 5BMFH 4MNGE 2ZUSA 3WBDA 2WBJC 1P7HL 1QD0A 2DLEA 5F6HJ 3EJYC 4RQQB 2W92A 4Y4FD 3NVQA 5IB5A 5JORB 3BZ4A 5ECJE 5GGUA 1OAUH 4WWID 2VLRD 1JK8B 1U3HD 5JR1H 2H2PD 1HDMB 4YEFA 4ODUA 4IDLA 4JO2H 3EOTL 5I74C 2R1YB 1CFNB 3QNYB 4R90H 4G5ZL 2QADB 1IM3A 5T1LD 1NDMB 1JPSH 2ZSVB 2J8UA 2ZCLL 5C07A 1WBZA 3LKOB 1EAPA 1U0QA 1A47A 4OGXH 4LLUA 2HJFB 4DAGL 2DS4A 1MHEB 5SWSE 5JW4R 2IJ0C 3LKSA 4NGHH 4RFNB 4RMUA 1RZIB 1LILA 1KPUA 1OGAD 4GKNB 4P9MH 5TE4H 4KZDL 3KXFB 2E27L 3IDNA 3O3UN 3U0WL 4U1MB 1AO7E 4HPOL 5MEPB 4M7LL 3BRFA 3QP3A 4OV5A 1JGLH 2WP3O 4NKDB 4MHHI 5CUSL 1UXSB 3Q6GH 3CFEA 2F58L 4G7YL 4MX7B 2G2RB 2DQCH 4H88L 1NFIB 1MRDH 5E4EB 5C0AD 4LAJH 3ZL4H 5E94A 4OLZL 4Q6YA 1R0AH 1FDLH 1KTLB 4XPGL 3RA7H 1S9XA 1CD1B 2WBJD 4FTVD 2EE2A 1GZQA 3EJYD 4JPWH 3BX7C 4M5ZH 1CCZA 3OXSA 1TPXB 4GKZB 3Q6FA 5E4IA 3MLRH 2Q1EA 5KSAB 1IAIM 3SE8L 5DQDL 2VDOH 3O4LA 5F7FA 3T09A 3MGOB 3TYFB 3RIAF 5D71H 1FVDA 3ZT7A 2BVUA 3CDFA 1T5WA 3P4OB 1FGNL 1RUAL 4X5XA 1MHHB 3NA9H 1VA9A 4RISL 4TSCH 3EJZC 4LCIL 3OAYH 3DO7B 3TM6A 1ND0A 1AY1H 3MRLB 1FNHA 5BS0D 5EO9B 5IFJB 5KW9L 1ULVA 1OTUD 2R23B 4NKOA 2D03L 5EU6B 4EI6A 4LCCA 3CFCH 1S7VB 4DGYL 4NNYB 3TF7C 3U4AA 4LLQA 3DHJA 1NCDL 4PJIF 1JF6A 3G5VB 1DQML 2OJEA 3SOBL 3B9KD 3MNWB 4N9GA 5CJQH 1QBMH 4UB0H 1K85A 3BPNB 2A6JB 1WBYB 3QH3B 2V9QA 4J12A 5AD0B 3QAZC 4M7ZB 5C09B 3TCLB 4QHLA 1EGJA 3DECA 5D7KE 5JXEC 3WO4C 2X4SA 3VI3F 3D5OF 3G9VA 3CFDB 2W9EL 1PSKH 3IRZA 4MQXC 4HKBA 2A9NH 1UZ6E 4KVCH 1A4JB 1UH3A 4M5YL 3THML 3QIWA 4LCCC 3V52H 1BZ7B 1KBGL 3P4LA 4QNPE 1KJ2B 1EGJL 4QT5B 3RGHA 2AAVA 4OI9A 5DFTA 5HI5C 1Z0MA 3MV7E 2PO6C 2LV4A 2BDNL 5E7BA 4X4ME 4JM2F 5DD1H 2PXYB 3TPUB 2EH8L 1BBJA 3ECBB 2XG4A 3HC0B 2HTLC 4OIIL 2QHRL 3W81A 2BZDA 3EJZD 2AI0H 1WFUA 4OZGF 3QIWC 3MV01 4JO1L 4WFGE 2YD6A 2BCKA 2BRRH 5LGHL 3KDMB 4R7DA 1AR1C 1I7UB 1MI5E 2EO1A 4OCLC 3NCYP 4JRXE 3HG1A 1CDJA 1CFTA 1I1AC 3P77A 5IW6A 1KJ2H 1Z9SA 5CKAA 4Y7MA 4G6AC 2V7HA 1TTUA 3P0YH 4OZHE 4KV5E 3RP1A 3VI4E 1AXTL 2P5EA 2C9AA 2Y25A 3KPLA 4JM2D 1FFOA 4XBGA 2CDGB 3SHSA 5T1MB 5DLMH 1KF9B 5E2JA 1KCUH 3PJSB 4JKPH 3F12A 4P2OA 5I1IH 1E28B 2LTQC 5JXED 4PJFE 3J7HA 4ONFH 4H1LG 2OL3B 4MQXD 4G8IA 2OR9H 1AD0B 4JHWH 1F58L 1UCTA 3FRPA 5FKAA 1MRFH 3AS1A 2VZ3A 3C6LA 3CMOH 4RIRB 1TVDA 3UP1A 4XMKH 4YO0B 3V4PL 3WS3B 2VO5A 3MC0A 5HI5D 5L9DL 4EQ3A 2AJ3B 2PO6D 4LHUA 3EDJA 1JF5A 4XCNB 3DSFH 2PYFA 4NO0D 5IVXF 1OT2A 1VERA 1H15A 1A14H 5C0BA 4W4NA 2Z9TA 1FSKB 2VISA 3OKOA 5FYJD 1BEYH 2I5YL 4PRAA 4RFOL 2HTLD 2GHWB 3G5ZA 5EUOA 3PWJA 2C3VB 3MLZL 5CJXA 3U9PL 2OJZL 4HW6A 4KJWC 5CEZD 3PWLB 2EDYA 1I3GH 3WKML 3C6LC 2OL3H 3QIWD 2ZPKL 5T1KB 4DOHE 2X4TB 4AT6A 1AR1D 3TYGL 3OKYA 3C87A 4KTEH 3RIFF 5MENE 3T77B 4EI5A 3W0WA 5LAXB 1I1AD 5A2IH 1CL7H 3D0VA 2FHFA 1PKQB 5D5MA 3WDJA 1RI8A 2VXQL 3PP3H 4GKSB 5TE6H 1E6OH 1KB5A 3SO3C 3HC4H 5DVOA 4RMRA 3SKOB 4QF1A 5JZ7C 3NBNA 2YUWA 5DFVC 5EU3B 5FYKE 1T6VN 2VLME 3D2UD 1D9KA 1GL4B 3ZDZE 4AQOA 1IGTB 3LD8C 3EOBA 3OR6B 3IS0X 2V2TB 1F6AB 1MUJB 1QLFA 3NTCL 1OP9A 2I9TA 1KB5L 1CT8A 1P84K 2EIBA 3LSOA 4KKNA 2XXCB 1JV5A 3VFRA 5IB3B 4K7FA 1MCHA 3GIZL 4EI5C 1N5AA 1PZ5A 4XI5C 3HG1D 5D4QA 4IRJB 4I4WA 4K7PL 3KYOA 3C09B 4UILH 1MCWW 4MNQE 1BAFH 2VUOA 3OGOE 2XY2A 3UPRA 1M7IB 1R3KA 1XGTA 2AQ2A 3EO0B 1LO4L 4PJAA 3U30C 4QRPE 4Z7VA 5TQ2L 3SE4C 3WDIA 3FOMA 2XACC 3PE9A 1D9KC 1T0MB 2G9HA 5DEGB 5DJ8A 3BWAB 2DQTL 1CR9H 3VXQB 1S3KH 1OB1A 1KEMH 4I77L 4ACPA 3NIFF 3PWVB 1MIML 2WW8A 4J23A 2A77H 1OLZA 3C6LD 5JUEL 1HEZA 1XCTB 3OWEA 5SWQB 1KYOK 3HE7C 2F19H 2GK2A 3S5LB 1RZ7H 4M8VA 3FRUB 5FCSH 2ADGB 1ZVHA 3RHWF 1DQQB 4LHUD 1TZHA 5HGAA 4IRSA 2P7TB 1JWSA 3O6KH 5CJBA 3P4MB 3JV4A 4JFEB 1JZ5A 3DX6A 1IAKA 4LNRA 3VXMD 3T0VA 2Q7NA 2EC9U 1AFVL 4HXBH 1U8HA 1I8MA 3HI5H 3TN0A 5JZ7D 2DOCA 5DFVD 3PDGA 5EBLB 1JTPA 1OAZH 3RTQA 3VXUD 4PJ9A 3V4VH 1MCIA 3JTSB 3U9UB 4TQEL 1T1ZB 4PRDA 1CLYH 1J8HD 4DKDC 1NCBL 4CW1B 1RIVL 2X89A 4XI5D 3W0WD 1T1XA 4C58B 1DBMH 3VXSD 3PGDA 4HT1H 3MRCA 4Y8AA 4OSUL 1S7SA 4IRSC 2X05A 4DGIH 4G6JL 1S7UA 4CADB 5GZOD 3QHZL 1EO8H 3TN0C 3L3OB 4OFDA 2FJGB 5CZXC 3ARXA 3SDAA 4PJ9C 4R4FH 2YC1B 4PJXE 4TUJB 1C8PA 3EUUA 3ZT6A 1H0DA 1FNGB 3FAXA 2WUCL 1SM3L 1UKTA 2CLVB 3WLBA 2OK0H 4KDTA 4PYGA 4U1NA 4Y4FB 3MBEA 2OP4H 3HE7D 3FFDA 3ZKNC 3IFOB 3MACH 3SDDA 4MB4A 1KIPA 4JY4B 5ESAA 1U3HB 5IF0A 1LP9B 4ZTOH 2OLDA 1V3KA 2YUXA 3I50H 2WQ8A 5CILH 4QRRB 4AK1A 5D96B 4NNPL 3SDAC 2ADFH 3L1OH 3SJVD 1Q9OA 3F6IA 3EZ8A 4JDZB 3EBAA 4MXQC 4N0UB 4PJ5B 2FRGP 2BVYA 4LSSL 3LEXA 2PETA 2FJFB 5E5MB 2A0LC 2XNAB 3WUWG 2OBGA 1A4KA 1MEXH 1JRHL 4YHKL 3MBEC 3KLSA 1JHKL 4Q9RL 3R8BB 4GAJL 5T3ZH 1YEIL 3B5TA 3SDDC 5HHOB 1DVFA 2LAGB 1OGAB 3V5DB 5BQ7A 4C54A 1HKLH 4X6DE 3BH8A 4Y8DC 4ZXBA 3DVGA 4P3CL 5GJSL 4NOBA 3MRQB 4Y16D 5EIVA 3T2NH 2P43B 2AEIT 1IT9H 3S3JA 4CDHA 5CZXD 3DYMA 3RZWA 5ISZA 4JHAL 1CE1L 1ZT1B 3KYNA 5CIPB 4MDJA 5KAQF 1YMMA 5H37H 1EUUA 4U7SA 2WBJB 1Q9KB 3OJ2C 5EBWA 4U7MA 3DGGB 1A7QL 1VEPA 4ONHA 1DVFC 5HY9A 4Y19A 2UZYB 4DCQB 3TIDB 2FX7H 3ZKND 2I60L 2VE6B 4PJHB 5GGTH 3VWKC 4K9EC 1ONQA 3OKMB 4OIAA 4FXKA 1H8SA 2V17H 2IQ9L 5I74B 1ZAGA 4RMSA 4DZ8A 3H3PH 2P49B 4O00A 4M62H 2ZG3A 1YNLL 1W8NA 3AB0B 4JFHE 5HVFB 4M7JL 3ILQC 4X98A 5CIPH 4NNXA 2O5ZH 4RAUA 1KC5H 4U1JA 2A0LD 1FLRL 1A2YA 1A3LH 1KGCE 5IB5B 3MBED 3BZ4B 3O3BA 4JO4H 3KR3H 4MNHA 4U7KA 4HIEA 2Q87A 5GGUB 3SDDD 1A6ZA 2QQNH 4JPVL 4WEUD 1EJOH 1Y6NR 4GXUN 3RWEA 1IM3B 4JQVC 3UBXI 5I15H 3HRZA 2XOTA 5C07B 1RZ8A 1WBZB 4M4RA 3LRGA 5GGRY 3TCXA 3VGBA 3LKSB 4QXGL 4G5ZH 3QWOA 3I9GL 3UPAA 1KPUB 1NC4A 2ZCLH 4U0RB 2EDBA 3IDNB 3SKUD 3VWKD 4F7TA 1IBGL 2NTFA 4U1SA 4OV5B 4PJIB 2X4PA 1U8LA 4DAGH 1U58A 5DRNB 4NO3A 3CFEB 2WLYA 3SGDI 4K3DL 5ISZD 2B4CH 4CBPA 3QYCA 2A73A 5HDBE 1L6XA 3W9DA 1PLGH 5E94B 1JIBA 1YMMD 3ILQD 3PHQA 2E27H 3U0PA 2GT9A 3ULUE 4WV1A 1X5GA 3S34L 1S7TA 4B53A 5I71C 3EGSA 3OXSB 1BM3L 4HBCL 3EYFA 3Q6FB 4Y19D 4XTRC 5CUSH 2F58H 3IFLH 4NM8L 2UWEF 4H88H 3RY4A 1CGWA 3TH2T 1OTSC 3RBSA 2D7OA 3UTZA 4XPGH 1S9KC 2GJ6A 3VD4A 1T5WB 2AJYL 5EOCJ 3QEQE 4X5XB 3CH1A 2FBJL 4YXHL 3QAZB 4F57L 4WV1C 4F58L 3WO4B 1WK0A 4HCRH 5B3NA 3SE8H 5DQDH 1HWHB 2D7PA 4F8QA 4NKOB 4EI6B 1FFNB 4LCCB 1NC2D 2DLTA 5CSZA 1C12A 1I8LA 4F7PA 4P2CG 1RUAH 4X83A 4LLQB 3VG0L 4RISH 4JFOA 3GBML 3DMMA 4DK3A 2VLKD 4NO0B 5T5NG 4N9GB 4U49A 1KEGH 3ARWA 3QDJD 1QKZL 1R6VA 1QFPA 1MNUL 3HN3A 3T0EE 5E8PA 1BIHA 3B2UC 3BZEA 3FQNA 3MLSL 2X4SB 4DGYH 5IHBA 4HKBB 4GRLA 4IEFB 4MNGA 1NCDH 1E4WL 3QT2A 5F3HA 3QIWB 4P23A 4I3RH 1DQMH 1I8LC 3SOBH 3TH4T 1XF3A 5F88A 3PWNB 2FWOA 4J8RA 4RX4D 5E95B 1HE7A 4X6EA 4D0CA 5IQ7L 3DMMC 5KTEL 5MEOA 1KXQE 1OTSD 2W9EH 3RWGB 1FL6A 3KJ6L 4C56E 4MYWB 2W0LA 5B21A 4OM1L 1U8QA 3BISA 4A2MA 1KBGH 4ZUTA 1EGJH 4Y5VC 2IPKB 4GRLC 2LTQB 4GQPH 2PCPA 3UTSA 3ZDYF 3RNQA 1MLBA 1M7XA 4TVSa 4P23C 2BSED 3VU2A 4RGMC 1AGDA 2BCKB 3CLFL 4P46C 2GW5A 4R7DB 3HG1B 3VH8B 1CFTB 5IW6B 2EH8H 5EUKA 4FFVD 2V7HB 4JHBA 5GS3A 1JYXA 2KQNA 1E4JA 4NC2B 1YEFL 5HYQB 3F8UB 4OIIH 2QHRH 2P5EB 1S7WA 1H8NA 3ZHDA 4ZFFA 3QPXL 5IFHL 1J7VR 4OLWL 1FFOB 1MH5A 4JO1H 4XBGB 5K9QG 5TDPA 4X9GA 5LGHH 3F12B 3B2UD 1OQOA 4L9LC 5LVEA 3QULB 4V1DD 4ETYA 3D0LA 4G8IB 4OUUA 4NOFA 4R97B 3C6LB 3JV5A 1H5BA 1L0QA 4WFHE 4PJCE 3IDJA 4NFBA 4L8CA 1DBJH 1F13A 3BQUA 2I24N 4GSDL 1HHKA 1Q72L 4LHUB 4ETQA 2BP3A 1J05A 2PYFB 1X5JA 3SO3B 1H15B 4NQCE 1CF8L 5C0BB 1F58H 4WUUE 4EUPG 1IGCL 3OKOB 3O8XD 5IVOA 1PAMA 3K3QA 4PRAB 3G5ZB 5EUOB 3V4PH 3PWJB 3LD8B 4Z7QE 1K8IA 3RVVC 5L9DH 3Q5YA 4P23D 1H5BC 4NPYA 3BZDA 4AT6B 4P46D 2D3VA 1NEZA 1X5XA 4ALAH 4EI5B 1XR9A 3W0WB 1AGBB 5CS7A 3D0VB 3VXSB 5D5MB 4XHJD 2I5YH 2VABB 3BHBA 4RFOH 2X7LB 2BNUB 2IANE 1KB5B 3MLZH 3WYRA 4X4XB 3U9PH 2OJZH 3U30B 4U6VL 1S7XA 3I02A 3WKMH 4MMXC 2HVKA 5CGYD 4EJ1C 1D9KB 3TYGH 3EOBB 5FGCE 4XCFL 1IC4L 5HHME 1QLFB 4HGWA 1CT8B 5I8EA 2ADJA 5INDA 5IB4B 4LPVA 1ZHLA 4M48L 1JV5B 2VXQH 3MNZA 3VFRB 5EU7E 4K7FB 1N5AB 1PZ5B 1DQDL 3JUZA 5F3BA 1NCTA 5E5UB 3RL2A 3KYOB 4BK4A 2CKBA 4Z7WF 5CD5C 3HE7B 4ZS6C 1WFNA 1LK3L 5DF0A 2NY0C 3UPRB 1R3KB 1XGTB 3FCTA 5D7IF 4PJAB 2YD8A 3R4DA 4M93B 4Z7VB 3NTCH 1I1YA 4HIJA 3FOMB 3ZKSD 5GJTH 4BSVA 4I5BA 4WI8A 3S5LG 3FFCE 1MCQA 3S4SG 2G9HB 2CKBL 2PYEE 4D0BB 1QHPA 2RHEA 2KDGA 5EDXA 3GIZH 3SJVB 2H6PA 4LGSB 1L9MA 2B1AH 4K7PH 4Z76A 3MRHA 4JCMA 5F1IA 2IBZX 2VSDA 3LN9A 1OB1B 4O5LL 2W07A 1JZ4A 3W5NA 1UACH 4LSRL 4NZUL 5LJYH 1LO4H 3RVVD 3RX8A 5TQ2H 1HEZB 1IQWH 1X5KA 2ARWA 5I30L 5CINL 1WTLA 1MI5A 2COQA 5B4MD 3QDME 2DQTH 5DWUL 1TZHB 5HGAB 1FNLA 4IRSB 1JWSB 4YHLL 4I77H 4XNYL 3JV4B 1EZVY 3DX6B 1IAKB 4LNRB 1A6PA 1OAKL 2HFTA 3MV8D 1MIMH 2A6KA 1I8MB 2X1PA 1U8HB 3TN0B 1GJIA 5JUEH 2AVGA 3RTQB 3NCMA 4PJ9B 4OCYH 4GUPB 4O4YL 5C9KA 4P9HC 4PJFA 1OD9A 4PRDB 5HGHA 1JPTL 4OQTA 2XN9D 3S35L 4JY5H 2KKQA 3RWHA 3TVMC 4DZBA 5I76A 1F3DH 1T1XB 5CLTA 5CD5D 4ZS6D 5M94B 2UZIH 4NFCA 3PGDB 3MRCB 3EYVB 1S7SB 5E0QA 5K59E 4WHCA 1S7UB 1FNFA 1F2XK 4OQTL 3DSNA 3DARA 1TMCB 3SDAB 1NCBH 2M8XA 4CDGC 3HZMA 2VKXA 1H0DB 1RMFL 1DZBA 5MERA 1KPVB 5ADOL 1T1WB 4OSUH 4LVOC 3WLBB 3GMMA 5D7SL 1KXTB 3QHZH 4RGOL 1VFBA 2BNQD 2P46B 4ZTPL 3MBEB 1M05B 4BM7A 5JA8B 3SDDB 3EAKA 5MENA 1CDBA 4OZIE 5H37G 1KIPB 3OB8A 5ESAB 2WUCH 1SM3H 3LH2L 3T2QA 2JJTA 2KUTA 4JG0L 1FNAA 4JPIB 1Q9OB 4J3WA 1A9EA 2ZKHL 3I3EA 3SGEI 3LEXB 1KB9J 3QFDB 1EXUA 3DUUA 3NPZB 3S36L 4KH2A 1A4KB 2XQYG 1MAJA 4KHTL 2X9WA 5FYKL 3TVMD 4YJZL 1DVFB 4ZUSA 3FO2A 2BY3A 3B9EA 5BQ7B 1VGKA 1FG2A 3BH8B 1AKJD 4LSSH 3VWKB 4U2ZA 2B0SL 2IFGA 3DVGB 5TF1H 3DTXA 4QRPA 1NGZA 1JRHH 1CLOL 5JLZA 2P8LA 5ISZB 4Q9RH 1Y6MR 4XCCL 4GAJH 3KYNB 4PGEA 1G6RH 3CXDL 3EDKA 5BRZD 4HEME 4MDJB 1YMMB 5HHNA 5EZOL 3GSQB 5EBWB 4ODHL 5KSBF 4P3CH 4YDKL 5GJSH 4ONHB 5HY9B 3V8CA 1QFOA 4Y19B 3WNNA 3H9YA 4JJ5A 2H2SC 3WD5L 3WFBL 3VCLB 1I7RA 5E00A 2WP3T 1JGDA 1N8ZA 4JHAH 1CE1H 1ONQB 2PTUA 1N6QH 1QFWI 1T1YB 4FXKB 4ZFOA 3MRRA 4G8GE 5DQJA 2XTJC 1QQDA 4JFXA 4DZ8B 4AG4L 4TRPL 3K2UL 3NAAL 1KIQA 3SCMA 2A74A 4AIXA 4PJGA 4P2RD 4NNXB 2NY2C 3LHPL 4ZFOL 4UTAL 2R4RL 1NANH 4U1JB 2CRZA 4ODTL 4UOJA 3GSNH 1A2YB 2IQ9H 3O3BB 5IMOB 4MNHB 1C7TA 4Z77A 1LO5B 2R2EA 1A6ZB 1QLRA 2FD6L 4M7JH 4OD3H 1VACA 3RWEB 1E4KA 4CJ1A 3HB3D 3CD4A 3P11L 4C55A 3MYJA 4RZCA 1FLRH 2AJXL 1FIGL 3MV9D 1G0DA 1RZ8B 1KTRL 1EFQA 2D7TL 2F5AL 4KRMB 5CJ8A 3R06B 3X13A 1AR2A 3MCG1 2V5TA 3NZ8A 1CXEA 4JPVH 4WO4A 1L0YA 4HHAA 4Q9BA 1PX3A 1OPGL 3QWOB 5DTFA 5JIKA 5I71B 4KGLA 1YN6A 1CVRA 3WHXA 1NC4B 2EYRA 4MJ4A 2H2SD 1YQ2A 2D0GA 1WT5C 1GZPB 2AJSH 4HUWA 2UZXB 1DEEA 1E4KC 1R24A 4ORGA 4F7TB 1F97A 2NTFB 1U8LB 5DK2A 4KKCC 3FHQA 2ATPA 3L3HB 1WUNT 1QFWL 5FUOL 2XTJD 4OGAC 5DHVA 3SKMA 2ADIA 4QXGH 2A73B 3I9GH 1LNUA 4ZOEA 3W9DB 1K4DA 4F15C 3PHQB 4M3JA 2GT9B 2NY2D 3U0PB 4GW4A 4WV1B 1N6UA 3QUXA 4LRNL 1IBGH 1S7TB 4MA1B 5GRVK 3KYMA 3EGSB 3EYFB 2MSPA 5IFAL 4HH9A 5DUBA 4XVSL 2YD4A 3GB7A 5SX4I 4QO1A 3CX5J 25C8L 5BVPL 5I9QC 5TJWK 1NUDA 2J5LC 4R4BA 3UTZB 4KI1A 4X6DA 5DR5H 3UTTE 1Z5LA 2GJ6B 5I1DA 1OQXA 3BKCH 4NKMA 4HBCH 1DSFL 4MHHG 4LLDA 3CH1B 1ACZA 2JJSC 1EEYB 4LLMA 4NM8H 3QUXC 1JFQL 4R9HA 3SDXE 5J57B 4IJ3C 1R5VA 4Z0XB 5T3XD 3FO0L 3GMQA 1D5ZA 5CSZB 3KHQA 1C5CL 4F7PB 2AJYH 5D1XD 3TC9A 1CGXA 3UROR 2YRPA 1WAAE 4JFOB 2K9UA 3RWCA 3QZWA 2VR5A 4F57H 5I16A 4PRIA 3DMMB 4F58H 2CPCA 2AXJA 4Q0XL 2LFGA 1TCRB 4L4VA 3DVNA 2ZUUA 2HKHH 4OGAD 2B20A 2EC8A 1PFCA 5E8PB 4POZC 4J3TA 3BZEB 1NCWL 3FQNB 5FGRA 5L6YL 4U31A 3FT4A 4CMHC 3KAAA 5CBEA 5SX5K 3VG0H 4GRLB 1RJZA 2J8UF 1WWWX 4MNGB 5F3HB 4P23B 3WSQL 4RGMB 5D6DC 3GBMH 5MHSE 1QRND 1XF3B 5F88B 5DT1L 4U1HA 1QKZH 4J8RB 1VKXA 3E8UH 1S5HB 1MNUH 2K7PA 2BOCA 4X6EB 4D0CB 3IDIA 4NQSA 5MEOB 3BAEL 2MMXA 5GGVH 1IFHH 3I6KA 1FL6B 2KL6A 2AJVL 4NN6C 3VH8G 4Z7NE 1INEH 1EPFA 1E4WH 1UH2A 4OF5A 5IMKA 3N9GL 5GRJL 1U8QB 3TBWA 2ZOLA 1EUTA 4ZUTB 4UUJA 2HYMA 2Y36L 4JLRA 3UTSB 2PCPB 3GFUA 4O9HL 3RNQB 1MLBB 5SV3A 4U33A 3JBG7 4LCWD 2P5WE 5FO8A 5I8KL 4KWUA 5SV4A 1AGDB 5IQ7H 5KTEH 1ZHBA 1ZA6A 4JFPA 1T3FA 3RWDA 4Q97A 1BMGA 5T5FL 3KJ6H 5EUKB 1LEGA 1WJ3A 5GS1A 5AZ2H 5FHAL 5AZEL 4RDQF 3IFPA 4E9LA 1X4XA 4ZFFB 4NZDA 2O5XH 5TDPB 3CLFH 2VR9A 5DA4A 2GAZA 4JEGB 4LHUG 4POZD 5JW4Q 5FM4A 1HOCA 1X5AA 4K8RH 4JZOB 3AUVA 4HF5L 1NFDF 3M17A 1YEFH 3D0LB 4OUUB 5IFHH 1H5BB 4WU7A 4OLWH 3OAZH 4GXVL 5HDOA 3QA3A 5GS1C 4L8CB 5DRZA 4GXUM 5AWNL 3BQUB 3LEVL 3CIQA 4KMTL 1PEWA 2W0FA 4ETQB 4UZGA 4L4VD 1YQVH 1NCCH 4YHNA 4QY8A 4GFTB 2CJUL 2B39A 5IBUB 3E1F1 3V2AR 1JPFB 3CK0L 5L2KE 1K8IB 1UWGL 4GSDH 3HI1A 2ZUTA 1FL5A 1R3JB 4IOIA 4NPYB 4PPTA 1PD6A 3QUYA 4XX1G 3C5ZD 5BZWB 1CF8H 1XR9B 3MRFA 4NJAL 1MY5A 4NQUA 1IGCH 1AQKL 4F3FA 3BHBB 2NY0B 3PWPE 5IBLC 3MLTA 1U42A 4GBXD 3U79A 2P24A 3I02B 5J7CC 4LGRB 5F93C 2GQHA 1WWBX 4AMKL 2HVKB 3C9NA 1DFBL 4DFHA 1NMAH 3IDXH 2NYYC 4XVJL 5C3TA 4HG4J 3QDGE 4BH8A 4HGWB 3T0EA 5I8EB 2ADJB 2V5YA 1ZHLB 2EIEA 1SJEB 2HT3C 3QUYC 1WICA 4HS3B 5F3BB 3RL2B 5IW1A 2C3WA 2CKBB 4YHMH 1Q0XH 1NGXA 2NXZC 4QXWA 2DTML 5E2TL 3FCTB 2GJZB 4XCFH 1IC4H 1P2CA 4LHJB 1BD2E 1I1YB 4HIJB 4BSVB 4I5BB 4K3GA 2VDNL 4M48H 3U82B 2HJLA 1U2CA 2YRLA 3T3ME 1IAII 3BT2L 4C56A 1DQDH 2H6PB 5EC2A 1I75A 3BP4A 4Z76B 5C0NC 3MRHB 5F1IB 4JZNA 1LK3H 3ARGC 2Q7YB 1CIUA 3P30H 1RJLA 2HT4C 1NMCC 5KS9A 3TVMB 4P5MA 2CKBH 1MI5B 4JFQA 2EZ0C 2B8OT 3H3KA 3QCTL 4KKLC 2VXUL 4QHMB 1MHCA 2XZCL 4JE4B 4MA3A 4NIKB 4X6BA 5IBLD 4O5LH 1S8DA 1ZA3A 4LSRH 5CD3A 2A6KB 2VN4A 3MGTB 3KJ4C 1MIEL 5J6GA 4ZFZB 2PW1B 2M26A 4FQCL 5I30H 5CINH 2NYYD 1OAXL 5BRZB 3S37X 3BD4A 2LVCA 1CFSB 4PJFB 5DWUH 1SEQH 5HGHB 2HT3D 4LVOB 1RFDL 3RWHB 4YHYC 4DZBB 4JFDD 5EBGA 1OAKH 3AMKA 3VGFA 5F8RC 3K80A 5KAQG 1IL1A 2NXZD 2PTTA 3IGAA 1FC1A 4O4YH 4POUB 4OD2A 2ZUYA 4IDJL 5EORL 3WIIL 1ZTXL 3LOWA 5GS2D 3VGAC 1JPTH 4NYLB 1MCRA 2Y06L 5DMGC 2IAMD 2NMSA 4PGZA 5MERB 5C0ND 5J89A 2GUOA 2DAVA 3HS0B 4ZUUA 2AP2A 3ARGD 4QGYA 4OQTH 1VFBB 4P0DA 4XB8A 4PJEE 2APFA 2HT4D 3TNMA 3X3FL 4DOHB 3Q5OA 1CG9A 5MENB 2BX5A 3GIVB 2DIBA 2EZ0D 4Q9QL 4KKLD 2BERA 1RMFH 2DQDH 1FYTD 1R5WA 2IANA 4KAQL 5CEXA 5D7SH 4RGOH 4BFBD 1B6DA 1A9EB 4TTDD 4ZTPH 3KPRA 3MV9B 4WFFE 2GCYA 5JXAL 3FZUC 1FPTL 3K4ZA 3DUUB 1B3JA 5D9SB 5E9DE 1D5IL 3CFBA 2WBKA 1I7ZA 5KVGL 1ACYL 3LH2H 5J3HC 3O9WD 1F5WA 1RUKL 4JG0H 3CFJA 3RNKB 5D1QA 4ZUSB 3FO2B 5FM8A 5HGDB 1FG2B 3FN9A 2ZKHH 4TPRL 1P7QA 5J6HA 2J2ZA 4QRPB 2IC2A 2A6IA 1MAKA 3PV6A 1NGZB 1VENA 1XIWD 2XTJB 1IKNC 2C5DC 5JLZB 3FFCA 5TDNA 4KHTH 4X6CF 2H1PL 3C8KA 2XZQH 5FYKH 4PGEB 3MROA 3G6AA 3EDFA 1Z9OA 2NY1C 2J8HA 5HHNB 2NY2B 4QHKI 1NMBL 4N8VA 2B0SH 5C6WH 2AKRA 2YPLA 5D1QC 1MCEA 1X7QA 4JJ5B 3C5SB 3ZYOA 3B8YA 1CLOH 1RZGA 5E00B 1QBLL 4A6YA 1JGDB 1N8ZB 3I6LE 4XCCH 4M6ML 1AGCA 2X5PA 4L8SC 3CXDH 3BI9X 4ZFOB 2N56A 5DQJB 4NHCL 2Z35A 5EZOH 4JFXB 1QQDB 4HXAL 5IT2H 1EHNA 2I25N 3V7AG 4YDKH 2A74B 4A6YL 2YZ8A 4JAMA 1PX4A 4PJGB 2F54D 1G9MC 3QQ4A 3WD5H 3WFBH 3LMJL 3FZUD 2VL4A 4LDOB 4U0QB 3VXPB 3S8WA 2VMFA 4K71C 5J3HD 4P3WA 1RJYA 4AG4H 1CGVA 5ITBH 4Z77B 3ULSA 4TRPH 3K2UH 3NAAH 1QLRB 3GMNA 5JMRA 5F8QC 4DJMA 1VACB 3OKNA 3LHPH 4KJQC 5EFIB 4WW1A 2R4RH 1RIUL 1YC7A 4ODTH 4RZCB 3KPRD 3ARBA 2E7MA 5D72L 4PLNC 1ZLSL 1BVZA 4UQ3A 4U3HA 4OZ4A 4F15B 4HUNB 3NZ8B 2FD6H 2YKLH 2NY1D 3H3BC 4HHAB 3ZHKA 5DTFB 2DI8A 5D1QD 3P11H 4JREC 1MFEL 1QRNB 5DUML 3T0WA 3WHXB 4DUVA 2EYRB 2AJXH 1FIGH 3QFJA 2R15A 4MAYA 4HUWB 1R24B 4ORGB 1LE9A 1IAMA 2NXYD 4OZIA 3OX8A 5I9QB 3RDTA 3BGAA 1UKSA 2KZWA 3GNML 3VGGA 3MJ7A 2PKDA 1HXYA 1A8JH 2ATPB 1MCSA 4FFWD 4JDTH 5FKPA 3ARBC 5DHVB 3SKMB 2ADIB 3MLXL 4TVPD 1OPGH 3CU1A 4JCLA 1LNUB 3UBXG 1K4DB 3V6BR 5C08A 43CAA 4IM8A 3KXFE 3GRWA 4MZ3A 1ZXQA 2EDLA 4KK8C 4YGAB 4GW4B 2OZ4A 4LCWB 3QUXB 4AH2A 3QIBA 4HZAA 1GYAA 4IJ3B 3WNKA 1WFOA 1FCCA 1NCAH 1EHXA 5DUBB 2DLGA 1EEUA 1QFWH 5FUOH 3GB7B 3PQYA 4MAYC 4R0LA 1VFOA 1T04A 3GRWL 5DJAA 3JWDL 3L5HA 3RDTC 1FC2D 2OZ4L 4R4BB 5GRUL 4JM4L 4X6DB 1JWUA 1Z5LB 4YAQA 5I1DB 2JB6A 3K8MA 1TENA 4HULB 3VWJA 4LRNH 3NIGF 4NKMB 3IU3A 5DHVH 4UNTA 4HFWA 3BYYA 3RKDC 5IFAH 1M71B 2VC2L 2YZ1A 1TTFA 5C0RL 4LLMB 3OG6B 5JIPA 25C8H 2DLHA 1F3DJ 5BVPH 4PV8A 3P9LA 4ODVL 4CMHB 3HNVL 1R5VB 4NDMA 4JFZH 1ODAA 3IXAA 3KS0J 2APBA 4V2BA 1QPPA 3GMQB 3IVKA 1D5ZB 5IHUL 3D39E 3IF1B 1DSFH 5AAMA 4KHXL 3SQBA 3RWCB 1J9CT 5FYLD 5I16B 4KK9C 4PRIB 3VWJC 3OSKA 3SY0A 1IQDA 1BPVA 1JFQH 3GJFB 4G7VL 1W72A 1LDPL 3DVNB 4G8GA 4L4VB 5FDYA 4YHZL 4NN6B 3LDBB 3ARBD 3VXRE 3LN4A 5EU6E 4PRPD 1ZKAA 1C5CH 3SQOL 3FT4B 4HUXA 3Q0HA 5CBEB 4YPJA 3QISA 1RJZB 4KK8D 4NRYA 2O26U 1W72L 2RB8A 4PGDA 2Y23A 4P59L 3QFJD 1DEDA 4YNYA 1G1YA 5JDJA 3LKPA 1VKXB 2BOCB 5C09E 3SE9L 1MLCA 2KPNA 3IDIB 3RDTD 5L6YH 4WI7A 4BA8A 1J10A 3I6KB 4FFZL 2X1WL 2OTPA 3GMPA 3ZE1E 4RRPA 4X9IA 2BOBA 5IMKB 4K07A 3TBWB 2ZOLB 3WSQH 5EU4A 5C08D 3VFUA 4UUJB 5DT1H 1NUGA 4RAHA 1PVHA 5FO8B 4Y5YA 1I8KA 1ZHBB 1ZA6B 5JHDD 1N59A 3BGMA 2OXGA 1T3FB 4JFPB 3RWDB 2AJVH 3PQYD 4IIQA 4MMZC 2GITA 3S6CA 4I9WE 1LEGB 3N9GH 3RUGE 2MWCA 4OTXL 5GS1B 3K1DA 5HHVL 3AU1A 5JOEA 2Y36H 1PEZA 4FZEL 5DMIL 4O9HH 5I8KH 4WJ5A 4YIQA 2L0DA 2GAZB 3DURA 5T5FH 4HFUL 4AQ1B 2AEPL 4NQXB 5ICYA 3O6ML 5FHAH 4Y5YC 1XZ0A 4OB5L 3M17B 5AZEH 4QXUH 2YK1L 1C5DA 5ADPL 4MQSB 3Q3GA 5J8OA 4LPXA 4J3XA 4IIQC 3VRLE 3BD5A 4NM4L 3OHXA 2YHGA 3QA3B 1W0WA 3ULVC 5DRZB 1A6AA 2L7JA 2GY5A 2W0FB 3GO1L 5F96L 3FN0L 1HINL 2XWBA 4QCIB 2YD7A 1OAYL 3TIEA 1ZGLA 4HF5H 3FB6B 2HFFA 4YHNB 2DIAA 4QY8B 4K3JH 4GXVH 1OL0A 2OTUA 4PJ7F 4KJYA 5AYQA 2MQ0A 3SGKA 5AWNH 3MUJA 3LEVH 3HI1B 2ZJSH 1FL5B 4KMTH 1TIUA 2EH7L 2V2WB 1RK1A 4IOIB 3SDXA 4NZTL 3QUYB 3TJHC 2B1HH 3PDDA 4ELMA 3W9EA 1XF5A 3MRFB 5HPMA 3ULVF 4JQXA 1FVCA 4F3FB 2NXZB 1FRGL 3O81A 3QB7C 3G6JF 3CK0H 1I3VA 5ALBL 2Y6SC 2RR3A 3MLTB 3T0XA 1UWGH 2P24B 4ESKA 3PL6A 5IBTL 3BMWA 3C9NB 2FATL 4LQFL 3O3EB 3WIHA 3SGKC 4BH8B 1TQCC 5E99H 4NJAH 3K74B 1PKQE 4KPHL 3A6CL 3BP6A 4YK4B 4UNUA 3HPLA 3ARGB 1YY9C 1CLZL 2AK4E 5IW1B 4JQXC 3WIHL 4PGCA 1OOAA 4BFGA 4AMKH 3ULVD 1NMCB 1NGXB 2YN5A 1DFBH 3OAYK 5FM5O 1KT2A 4L8BB 3RAJL 1KIRB 1B9ZA 4XVJH 1P2CB 4YGVA 4EIGB 4Z78B 3UZEA 3TP4A 5MI0C 4R7NA 1FYTB 2X1QA 2HJLB 3QCUL 1GC1L 4WW2A 5EZJA 1MCOL 1BREA 3L6FA 5C92A 2JTDA 4C56B 3KJ4B 5F1NB 4JZNB 1TZGL 1FNEA 1SYSA 3G5XA 2DTMH 4R26L 5IROC 3VA6A 1T2QL 5AAWA 1FP5A 3QI9A 1RJLB 2VDNH 4YX2L 1QSED 3MRMA 5KS9B 4YHYB 4P5MB 4JGMA 3Q2CA 4JFQB 3BT2H 5D8JL 5K93A 1J8KA 3O11B 4U3XA 1MHCB 1C1EL 3S7GA 5JIIA 4MA3B 5BZDB 4GJTB 4X6BB 1VFUA 2BNRA 1S8DB 2Y6SD 5CD3B 5CSBA 3BH9A 3ROLB 4ZYKB 3L5JA 5J6GB 1DLHA 4BZ1L 1MWAB 3VGAB 3OBAA 2D31A 1WISA 3TEUA 1AO7D 3U36B 2JELH 5DK0A 3BMVA 3UYOD 2VXUH 4OD1L 4MJIA 2DM7A 4PBXA 4JFEE 4R4ND 1YY9D 4ZUVA 2ATKA 4YQXL 3CLEL 1A6UH 3MPCA 3T1FB 4LEXH 1IL1B 1P4LA 4FQCH 1OAXH 4OD2B 2ICWI 4RMVA 2NW3A 4PUBL 1WWAX 1CDGA 1RFDH 4KROC 4POYA 3FHAA 1JBJA 3U0TA 5D7JD 4OZFA 2JB5L 4FQIL 2GUOB 2VN7A 3OTTA 1OSPL 4ZUUB 1OARL 5SWZE 3AREA 4IDJH 5EORH 3WIIH 3N1GC 2VZTA 1O5DT 5DMYA 1ZTXH 1J0KA 3TNMB 4H1LA 2P45B 1CG9B 3CVHA 3LIZL 2Y06H 2PR4L 2XPGA 1XF4A 3KG5A 2FX9L 4EIZC 3PWPA 4ZQKA 1R5WB 4O2EB 2IANB 4C83A 4JVWA 4EVNB 5CEXB 3EZJB 4QNPF 4XPBL 3D3VA 1KELL 3CVHL 4D9QD 3KPRB 3X3FH 2GCYB 1RUQL 2VLRE 1WIOA 3EOYG 1DLFL 1JGVL 2K3TA 4GRWB 4U6HA 1T7YA 2FSEA 2NY1B 3CAFA 3HCVA 3CFBB 1I7ZB 2DQJL 2Q76B 3IDUA 5H94A 4KAQH 2DMBA 5D1QB 2VB5A 1CICA 4N0UE 2ICWA 4KRNA 2NX5A 4AEEA 1P7QB 3GSXA 3FTGA 5J6HB 5HBBA 4HIXL 2BNRD 5JXAH 4L8SB 1NEUA 3S3PA 1FPTH 2Q8BL 2A6IB 1FQ9C 3O3DA 1D5IH 1JZ3A 4LMQE 1ACYH 3FFCB 5TDNB 4G6FD 3C8KB 4WGVB 1RUKH 4KROD 5HHOE 1NBYA 4OZHF 4XCEB 1OGAE 3D69A 3G6AB 3TV3L 1ZHKA 4HWEL 1LO3L 4TPRH 4DW2H 4MJ2A 4N8VB 2OX5A 2AKRB 2YPLB 5LQBL 1UFUA 1P7KB 2DWEA 2SEBA 1CICC 1X7QB 2EDHA 4K71B 1A7OL 1RZGB 2J88H 3QNXA 4A6YB 2H1PH 1X5ZA 3NCCB 1AGCB 5E1AA 2YD3A 4ZO6A 1G9NL 2Z35B 3K46A 1NMBH 4XZUA 4JAMB 1C16A 3QQ4B 4QOKD 4PJHE 1P84J 1QBLH 3CPLA 4BSJA 4M6MH 1G9NC 3OF6A 4M1GH 4PBVC 2DMKA 4WWKC 2EE9A 4NHCH 4L3EA 4HXAH 4PBWD 5CHNA 4GO6B 4JREB 3ULSB 4XAWL 1A64A 4CN1A 3HR5B 3OKNB 1A7PL 1IGYB 4KC3B 4WW1B 1NLBL 4Y2DC 5CSGA 1EH9A 1A7NL 3D3VD 4JR9L 1YDPA 1XGQA 4UBDC 3ARBB 2VYRE 2FX8L 4EXPX 1FJ1A 4UQ3B 1NCNA 2ZNXA 1ZANL 2YD1A 5F7KC 2BJML 5F7EL 3H9HA 4PJDF 5DYOA 4OFVA 3TPKA 2X70B 2V9TA 1KYOJ 1YA5A 3ZDZF 1RIUH 1CFQA 1CICD 4PJEA 3QIUA 3QFJB 2NX5D 5C07E 4MAYB 2I9LA 5D72H 1WEJL 1LE9B 1ZLSH 4OZIB 3OX8B 4FQXA 4M1DL 4MVBD 3RDTB 3MTRA 1LK2B 5FKPB 1IGFH 4TSAL 2LU7A 4KU1A 5JA9A 4H25A 1MFEH 2OI9C 5DUMH 5C08B 1F3JB 43CAB 3GKZA 3NCJH 3NGBC 4DTGL 5ENWA 5B39B 2FEDD 4D9RD 4PJIE 4AH2B 5J9PA 5IUSA 2IF7A 3GGWA 5IP4A 3OAUH 5E9DA 2NY4C 2WIIA 1NJ9A 5ACMA 4WWKD 3NFNB 3PQYB 2HKFH 3MLUL 1T04B 5DJAB 4FQXC 4NKQB 1OP3H 4WI3A 5FYKU 2F53D 5T1DL 1BQSA 3S9DB 3SGJC 4P5KA 3P9MA 3ZE0F 1JWUB 4NO5A 3VI3E 4YAQB 2JB6B 3QQNA 3RRQA 3VWJB 4Y2DD 3IU3B 1R3IH 2QSTA 5C0IA 4MNQD 1U8IA 4UBDD 4K23L 4X9FA 2XI9A 5CLWA 3DIFA 4RDQG 1NDGB 5C0FA 4LCYA 3GRWH 3JWDH 4PV8B 5DZLA 3P9LB 1KOAA 5F9OL 3OF6D 4NDMB 2OZ4H 1D7FA 3IXAB 5GRUH 3ARVA 5KBNC 4L3ED 1A5FL 3NIDF 3IVKB 1JTTA 3QXVA 3ARZA 2V7NB 3WUWA 3VD7A 1QA9A 3GUTA 5DJXA 3TWCL 2VC2H 1R3HA 1DBKL 1ZVSA 5ID0A 1CZ8L 1BFSA 5JNYA 2JIXD 4P4RA 3SY0B 1IQDB 4ODVH 4OZGE 2CLRA 4G8GB 3ZDXF 3LN4B 1U8OA 5IESL 1DP0A 1SQ2N 4ZNEA 3X12A 1KACB 3IAPA 2DQFA 4HUXB 5HD8C 3T4YB 2W0PA 3P0VL 3KVQA 2EIDA 3L95A 3FT3A 4KHXH 4NRYB 5ALCL 1NBZA 2Z8WC 4PGDB 4D94A 5EBMA 2NY4D 4G7VH 5E2UL 5IB2A 4PJXF 2RQ8A 1LDPH 4J1UA 5M7QA 4YHZH 2MQCA 4PFEA 5FYJE 1INDH 4FQXD 1MLCB 4NZRL 1I1CA 3RVWD 5J1AA 4BFIA 3EFFA 5HYSA 5CEZE 3GMPB 5GHWL 4WHYH 2XFXA 5E03A 2BOBB 1IC5L 1W72H 1ED3B 2DKMA 4DGVH 4AIOA 3G9AB 5EU4B 5GGSA 3G04B 4Z7OE 1BHGA 3VFUB 3O6FD 3RJDA 1GGCH 2C1OB 2CR3A 2R0KL 4EKXA 1PKOA 2P44B 2PF6A 1L4IA 4LLAA 4K7PX 4AZ8A 2X10A 3F58L 4Y5YB 1I8KB 2XQYK 2FH8A 3VMOA 1N59B 3WNPA 1AGFA 4FFZH 1H3XA 4IIQB 2GITB 3GI9L 4W70A 3V6ZA 3ZMRA 5L0QC 2CUMA 1HXMA 2DYPD 1JNNL 3AU1B 2Q20A 3G6JB 4LFHD 1MHEA 4WJ5B 2BC4B 2D2OA 4YIQB 5A16A 3HG1E 3DURB 1MREL 3E6HA 3ARUA 4Q7DA 5ICYB 4OTXH 4LKXA 5HD8D 4ODBD 3QPQD 3UTPD 1C5DB 2FYYA 3Q3GB 5E8OB 5MEPA 4CN4A 3AM8C 4FZEH 1UWEL 5DMIH 3OHXB 4M3KB 2NY6C 1W0WB 1YPZF 2DJSA 5LGKA 4G3YL 2BHYA 4OCRL 5K33A 4NWUH 3QDHA 5JOPD 1WC7A 2XWBB 4HFUH 3RVUD 5JHLL 1E4XL 1OF2A 2AEPH 3CZFA 4HG4K 2VRAA 1V7ML 3TIEB 5M95B 4OB5H 3F62A 2YK1H 1AHWA 2DRUA 2HFFB 3HR6A 5ADPH 1J12A 1U92A 1J1PL 4NM4H 2OTUB 4KJYB 4BYHA 3QNZA 5KSAA 1TJHL 3ZT5A 1TQCB 4YUEL 2Y4SA 3GO1H 2WINA 3F5WA 3FN0H 1HINH 1RK1B 5F96H 2FGWH 3QBTB 4L4TD 1X9QA 1DL7L 3MGOA 4OKDA 3U46A 1OAYH 3VXME 3W9EB 4ELMB 4OBRA 1ADQA 4YBQD 5HPMB 5A2JH 1FVCB 1KUMA 2ORBL 3D39A 3N85L 1OTTD 3VXUE 1EO5A 4CAGA 4XP1L 4RMWA 1N64L 1JI2A 4EZMA 1Q9WA 5E6YA 4OIBA 4UINL 2EH7H 3F65A 3JSSA 1J8HE 1ADQL 3CSYA 2EXYD 1Y6KR 3VXRA 3W0WE 1UXWA 3C5JA 3Q1SL 3VXSE 2ZCKH 5GRYA 4OCXL 4XP6L 4NNYA 3BP6B 1FRGH 1G9EA 1BWMA 4OT1L 5DD3L 1MVFA 3OKKB 5I8OL 4PGCB 5I1KL 1CGYA 2NY6D 4GLRI 4UI2A 1JNLL 4XX1E 2GKIA 1KT2B 2A6JA 2FATH 4XP5L 5KZCD 3DNKA 4YGVB 4ZPVB 2A38A 4R7NB 5IK3A 4DN4L 4KPHH 3A6CH 4WW2B 1ZS8A 2HLAA 5EZJB 2OYPA 1CLZH 4PJ8D 1UADC 4LLVA 1BZ7A 3WIHH 5MP6L 3R0NA 1SYSB 3G5XB 4QT5A 2XQBL 3S3SA 5BV7L 2W9DH 4K3EL 4Z7VE 3RAJH 1X4YA 3WFCL 1BQLL 5LG1A 4IMKC 1BFVH 5J1SC 3MRMB 1YEDA 2XT1B 4FS0A 5HDBF 2IH1A 4MQ7B 3SJVE 1GC1H 4BUHA 1MCOH 1QR4A 1TQBC 3RUGA 3ULUF 3HC0A 1KN4L 1CXFA 5BV7C 1TZGH 4PGJA 2BNRB 1R5IA 2FL5A 3C8DA 1BLNA 4WFED 4R26H 3BP7A 2FDBP 3BH9B 3HI6L 3LVEA 1T2QH 1ORQA 2E7LA 1DLHB 2Z31D 4LPUA 5D7LD 2DL9A 4PRHA 4YX2H 4WENB 3BE1L 3GSWA 4KROB 3UJIL 2D31B 1ES0A 5EC1A 2ZP0T 5ILTL 3L3GA 5D8JH 1MCBA 2EEBA 3GDBA 4MJIB 3AROA 5KVFL 4WHTA 2VQ1A 4NFDA 3QQ3A 4HK0A 2B7DT 4ZUVB 2Q3AA 2ATKB 1RURL 5T1MA 3UTOA 1P4LB 3QSKB 2FH6A 1S9VA 1E28A 5F6HI 2ENYA 3CZJA 4RNRA 1KXVC 4OD1H 5E2WL 1FO0A 4YWGL 1V7NL 4RIRA 3U0TB 5GRXG 1Y0LA 4YQXH 4JRYA 4OZFB 4UDUA 3CLEH 3X3GH 4I0KA 4QHNA 1MCKA 4DN3L 5I1AA 1ZGLP 1NAMA 1RZKC 1FO0L 3KYAA 2HFEA 2OSLA 3AREB 2XTLA 4Y4HD 5MEQA 3VG9B 4NP4L 5JO5A 5D1ZC 3KNBB 4BQ9A 4H1LB 4KQ4L 4PUBH 3CVHB 2HT2C 4I13B 4LLWA 4FMFA 4D3CL 1IC7L 1NAML 3U7YH 2JB5H 4S1DC 2C3VA 4FQIH 4ZQKB 1G7LB 1OSPH 2EDOA 3PWLA 4YXLL 1OARH 3D3VB 1I9RL 3FOLB 1MCFA 2X4TA 4NQEA 4U1IA 4PJBF 5GGRB 4OZFH 4LRIC 3I2CL 2PR4H 4U6HB 4EUPA 4PR5B 5IQ9A 1PKQA 1G7QA 2FX9H 1DUZA 1JE6A 3HCVB 4X99A 3REVB 2YPKB 4YBHA 3LPWA 5BW7A 4XMPH 4DEPC 5H94B 2BSSA 3REWA 2F74A 1CICB 1U8MA 2HH0L 4H1LH 2AK4A 2ICWB 4XPBH 3SKOA 3TO4D 3JXAA 1KELH 3CVHH 4I2XA 2NX5B 3GMLA 5TPWL 4N5EC 3GSXB 3FTGB 2DJ4A 1IGTA 1RUQH 2UVEA 1DLFH 1JGVH 5F9DC 1F6AA 5H2BA 1TCMA 2DQHL 4PRHD 3MOAL 3OXRB 1NBYB 1GGTA 1F11A 1BZQK 4PRNB 1C5BL 1ZHKB 4XWGH 1IVLA 1E0OB 1M7IA 4HIXH 5ABDE 2L4OA 2DWEB 2SEBB 2Q8BH 4QYOA 1FZOA 4WWKB 3CDYA 5D1ZD 4EOWL 5ISZE 1URLA 3K2MC 3LKRA 1TJIL 5DEGA 4GG6F 2HT2D 5E1AB 1SJHA 1YMME 3TV3H 4URTB 2X42A 4HWEH 3UTQB 4ZSOE 2AABH 1LO2L 3JWOL 4S1DD 3VFWA 1LO3H 4N1EA 1WIUA 4PJCF 4Y2DB 4XZUB 4M43L 2XRAL 4Y19E 5LQBH 1UYWL 4J3VA 1C16B 5DJCA 4GKOA 3S4SA 5KVDL 2ADGA 3CPLB 4FG6C 5LBSL 3RKPA 3NZHL 2XKUA 4N0RA 2IPTL 5J13C 2P7TA 1G9NH 2W0KA 4Q58C 4L3EB 3TT1L 2CRMA 3DX9A 3PABA 5CHNB 5DJ6A 2H9GA 3LQAL 3AXLB 2P48B 1ZLVK 1MCPL 3QCVL 4N5ED 4J2XA 2IG2L 3TZVA 1CQKA 2VZ1A 4YDIL 4WFHD 4U1LA 1YDPB 1XGQB 1UEMA 1BECA 5JDSA 2D4DA 4H8WL 5D2LA 2ZG1A 4NQED 5IV2A 4OI7A 3KPSA 3LQAC 3F7VA 3ZZ1A 3V7AE 4AJ0A 1EFXA 3QXDA 4OJFL 2OI9B 3S98A 3NGBB 1ZLWH 3CVIL 3U83A 3WHE1 5GS0L 5DYOB 4NQCD 1A7PH 2VSCA 5A43C 2VLKE 2ENSA 1FL3A 4DVRH 1JN6A 1CFQB 5SWZA 2NY4B 2ESVD 3HE6A 3I3DA 5F7DA 3HC3L 4PJEB 5AUMA 3QIUB 4JR9H 3KLHC 2FJGA 5B39G 2XZAL 2FX8H 4W6XB 2YC1A 5B3JF 4FQXB 1XF2A 2FHCA 1J0IA 1ZANH 5GS0C 5JQ6L 2BJMH 1I7TA 5F7EH 5A3ID 1MCJA 1OAQL 3EYQC 4Y4FA 3BRDA 4H25B 4LLYA 3GSOA 5ENWB 4FG6D 1WEJH 2VLRA 5J9PB 4M1DH 3GGWB 3MRNA 5E9DB 2WIIB 1NJ9B 4I0PC 3HUJB 4TSAH 5T1LA 1WBXA 2P42B 1GPOL 2YMXL 4LDEB 5I1EL 3G5YA 2Y9RT 4P5KB 5E56A 4NO5B 1NUFA 2J1KA 2XNAA 4HIHA 2MCPL 2DIJA 2YD9A 4PG2A 1QZ1A 5C0IB 4I8DA 4JKKA 1U8IB 5F7UA 3MLPA 3PDOA 4K7PY 3MLUH 4LCYB 3WXWL 1OGAA 4HV8A 2H2PC 3RY6C 5T1DH 1LDSA 3QJFA 4CJ0A 5FGSA 4Y4KD 4YR6B 4FQLH 3WUWB 5C6TL 5DJXB 3KLHD 4UV7L 2OMNA 3KGRA 1R3HB 4K23H 2RFXA 4NC1C 4UOW0 1JNHA 5JNYB 5C0AA 4L9DA 3GSVA 4ELKA 5F9OH 2CLRB 5I1CL 5A2KH 1B6UA 1JYWA 4FTVA 1U8OB 3DUHA 1A5FH 3VFGH 3X12B 3EYQD 1EFXD 1RSFA 5K59F 2DQFB 7FABL 4DCQA 4G8FB 3UJJL 3VD5A 3MA7A 4HJGA 3TWCH 4X9BA 4RRPG 2VE6A 2D7NA 3L95B 3FT3B 1DBKH 1CZ8H 3ELAT 3V5KA 2DF3A 5C7XH 1G84A 4L4TB 5EBMB 4A2LA 2WANA 5IB2B 5HHXL 4I0PD 2IMNA 4L29A 1F4WL 5L0QB 4HWUA 2DLFL 3EFFB 1ORSA 1IRAY 5HYSB 4UU9A 5ELIA 2XFXB 1CTOA 3P0VH 1NL0L 5ALCH 5BS0A 5GGSB 1AGEA 4Z9KB 5E2UH 4H20L 5F21B 1J5OL 2RGSA 1AE6L 1JUFA 3ARFC 4LPYA 3D85A 2R9HC 5E24E 1AGFB 3T0BA 5GHWH 3QEGH 3UJTH 1IC5H 3V6ZB 3B9KA 4OQ1A 1HXMB 1OWRM 1S7RA 3UTSE 2R0KH 4HS8L 2G5BA 1AC6A 1EBPA 1NLDL 1X44A 2VDQL 3ALXA 2YA0A 3TFKC 1VHPA 5A16B 1QSFA 1OTUC 2ED8A 3V5HA 3NMEA 3E6HB 1PY4A 2ICEB 4LKXB 3WNMA 2EDDA 2FYYB 2R1WA 3BIKA 2YD2A 4C57C 4PJIA 4KVNL 3DUSA 3B9KC 4R2GC 1S5IL 4TOYL 5DRNA 1N0LA 4HJ0D 3RX7A 3PF2A 2WNGA 3RWJA 4EN3A 2R0WL 1VEMA 1MREH 1WC7B 1FZJA 4UNVA 3CZFB 1OF2B 1MFDL 3BD3A 1G7HA 1K4CA 4PLOB 1AHWB 1U92B 1UWEH 5JOFA 4XH2B 5DC0A 1O7SA 3IDGA 1V3MA 4BQBA 4Z7WE 5CGTA 3EOAA 1WWCA 1XGUB 3QNZB 3S35X 4G3YH 3GKWL 1AQDB 3U4BL 4OCRH 2WINB 3F5WB 3ZE2F 4ZAKC 5JHLH 1E4XH 2M1KA 3ARFD 1QSZA 1Y18B 3U46B 1V7MH 1P9MA 2DQEL 2R9HD 1D6EA 4JM2A 2J3SA 4EN3C 4W6WB 4QTIH 5E6ZA 3D39B 4ODSH 1INQA 1Q9WB 5JMOC 2DN7A 5JXEA 4X0KA 4LF3A 5ANMA 4YUEH 1RUPL 3HA0A 3H42L 3CSYB 1DQJB 2CIIB 2XN9E 3TFKD 3OB0K 4OZGA 1DL7H 3F7QA 3VXRB 1UXWB 3C5JB 3QWRD 4DKEL 4NRXB 1FFNA 3SE3A 2R0LL 2ORBH 3N85H 4XP1H 1N64H 3D85D 2VLJA 1P9MC 4JM2C 2PO6A 3HMXA 4R2GD 4NO0A 1ADQH 3IKCA 1BZ9A 1H8OA 5I19L 2IPUG 1TQBB 3LCYA 5IK3B 2VDML 4NCC2 4OCXH 4ZS7L 2ZUWA 3HMXL 5BV7B 3HHRB 4XP6H 1ZS8B 2HLAB 3CFKA 1QSFD 4OT1H 2BNQE 5DD3H 4JB9L 3SE3C 3P40A 4LLVB 3S36X 5I8OH 3NCEB 4HK3J 2WSKA 5FYJL 1BGXL 5DRXA 3PWNA 3LQMA 3TA3C 1I1AA 4XP5H 4RGNC 5CEZL 4ZAKD 4DN4H 5I18L 2CD0A 3RWGA 1YEDB 5IVXA 1TXKA 2IH1B 5F72S 3OJDA 1FG9C 2FHBA 4PY7A 4EN3D 5BJTA 8FABA 3RUGB 4X80L 3D2UA 2GI7A 5MP6H 5HVWA 4E41D 3NACL 2ZWLT 1R5IB 2FL5B 1CD0A 1G7MA 2LU3A 5AG8A 1BLNB 2IPKA 5K9JL 4K3EH 3BP7B 3M8OH 4WIQA 1BQLH 5JW5A 1ORQB 1ITBB 1CXKA 5DEFA 4PRHB 2LQRA 1UVQA 4P49A 2FB4L 3GSWB 3DRTB 2CKNA 4JN1L 3WKNA 1ES0B 2DQUL 3MRKB 3QRGL 5EC1B 3VH8A 5HSFA 3L3GB 4WHTB 2VQ1B 1KN4H 5HYQA 3QQ3B 4HK0B 2FIKA 4KDWA 3RVXD 5I73C 4QHUA 4OZFG 5D1ZB 1V3LA 1Z3GL 2P8MB 1OCWL 3VW3L 3BE1H 3UJIH 3SDXF 3UC0H 5BRZE 1S9VB 4HWZA 4RNRB 3C08L 5ILTH 2FLBT 4OFYA 2DI9A 3QULA 5KVFH 1FO0B 2HMID 4LQ1A 4LU5L 3DROA 4ODXA 1A1MA 1WAAF 1Y0LB 1JP5A 1RURH 4JRYB 3DO3A 2R1XA 4JFFD 4UDUB 3O6LL 4QHNB 5I1AB 3TA3D 2VLJD 1NAMB 4RGND 5C0CA 2HFEB 2OSLB 1NGQL 5MEQB 5JO5B 1QSVA 3NFSL 4DEPB 4YWGH 3VXMA 1EEQA 1C7SA 1V7NH 4HWBA 4LLWB 1CGTA 4P2RE 3VXUA 2C4FT 4DN3H 4MWFA 3OAZK 1YYLL 1FO0H 4HWBL 5ACLA 1J8HA 3B9DA 3BVNA 3MUHL 4NP4H 4NQEB 1F90L 4U1IB 4KQ4H 4HC1A 1AGBA 1BQHG 1WGOA 1F00I 4EUPB 3VXSA 4HPYL 5IQ9B 4S0SD 1G7QB 1DUZB 4X99B 2ARJQ 2VABA 4I48A 2QLVB 2X7LA 3DI2B 3M1BA 2BNUA 4PLKC 5I1GL 4X4XA 4WHDA 2BSSB 5DD6A 3REWB 1I3RA 2F74B 3CJJA 3SE4A 1U8MB 4YXLH 2AK4B 4HC1L 3E3QC 4I2XB 1I9RH 3MV9E 3GMLB 4XC1L 3JV0A 4WDIB 4OLYL 3MXVH 5H2BB 2YXMA 5GGVY 1VESA 5IB4A 3IETA 4U3CA 1XH3A 1DQLL 2VIRA 1F11B 2H26A 2F15A 5IB1A 5E7FA 4G6ML 5DHYA 5DVLA 3HE7A 4GH7B 3WFZA 5TPWH 4EUPH 2Z93A 5GZOC 3QUKA 1A21A 2B5IC 5J13B 4QYOB 1FZOB 2XTJE 2DQHH 4XXDA 4M7LT 5IMLB 3LKRB 4D0BA 3MOAH 3SJVA 1I9EA 1SJHB 3UZQA 4JHZA 1C5BH 1REIA 3D25A 4OFYD 1AXSA 1P4IL 2NLJA 3D9AL 3VFWB 2VH5L 3IKKA 3W2DH 1YEHL 2YA2A 2D9CA 1GGYA 4NQTA 3BJLA 5DJCB 1YUHA 4EOWH 4G9FD 3S4SB 1TJIH 4HLZG 1KTKE 1H3WM 3LAFA 2AGJH 5C0CD 1DBBL 1P69B 1CDHA 2V5MA 3IAQA 4PLKD 3JWOH 5DUPL 3MJ6A 3DX9B 3PABB 4Y16A 5DJ6B 2H9GB 4JG1L 4M43H 2XRAH 1UYWH 4PJGE 4CVXA 4EQ2A 4GUPA 4BQCA 5LBSH 3BPLC 3TZVB 4OV6F 5H35A 3NZHH 2IPTH 4U1LB 3AS3A 3VD3A 4I1NB 5TGBB 5T3XE 5JDSB 5D2LB 5IV2B 4IOFD 3KPSB 4X4YA 3F7VB 4KRPC 1FYHB 1EFXB 3LS5L 3QXDB 4XAKD 1CDIA 1MCPH 3EYVA 3QCVH 2Y1VA 5FOJA 2JJWA 4UTBL 3WFDL 1A3RL 4Y16C 2WM0A 1U2HA 2IG2H 1FL3B 1JN6B 5SWZB 1MOEA 4ZNCD 4YDIH 3HE6B 5F7DB 4I0PB 5AUMB 1X5YA 1NBQA 5EOCL 4PG9A 4H8WH 1XF2B 2ZCHL 5C2BL 2UYLA 3VGHA 1KPVA 4TNWK 3CVIH 1I7TB 3DYPA 1T1WA 1A22B 5GS0H 4KXZH 1QRNE 3QO0B 5A1AA 4LLYB 5DD5L 3GSOB 1M05A 3CDGA 3HC3H 4YBLC 2XZAH 2W60A 3IS1X 4LFHG 2VLRB 2EKSA 3MRNB 3FO9A 5JQ6H 4KKBC 5T1LB 4JPIA 3QDGD 1OP5H 2HTKC 1WBXB 3MODL 1P5UA 4Y5XC 2JCCF 5L2JB 1UZ8A 3G5YB 2X44D 5JTWA 3QFDA 4ORZC 4MCZA 3NCBB 4LCWE 4X7DC 1XAUA 4HIHB 1A6VL 1W8OA 3V0VA 2JK5B 5ACZB 1BIIA 1A6WL 4R3SA 4KJPC 3PDOB 1WIPA 2VZSA 1U41A 3CU7A 4KRPD 2OR8A 2XV6B 4HV8B 5E1HB 1GPOH 2YMXH 3MXWL 5I1EH 4L1HA 1T2XA 2BHUA 3QJFB 4OGYL 3VWKA 1N5YL 1RU9L 2Q86A 3ARDD 5DD0L 3ZTJG 4EBQL 4OF7A 2RFXB 5HYEA 4X9HA 1JNHB 3WFEL 1KCRL 5C0AB 1VFMA 3VFSA 5I2IA 4K9EL 3WXWH 3GSVB 4ELKB 4LIQL 4LEOA 3GSQA 4ZSOA 4FTVB 2DDQL 3ARQA 3EO9L 2MNUA 2R0ZL 3MA7B 5HYSG 4K55A 4HJGB 4UV7H 3VCLA 1UB5A 5CJOL 1A0QL 2ZOKA 4Z7UF 3V5KB 4PRIE 3EYUL 1T1YA 3U6RA 3ARFB 4AM0A 4L4VE 4KKBD 4MA8L 3VDAA 3B2VL 2UUDK 4U05A 1EHLH 1H3TA 4JQVA 4L29B 2HTKD 3O2DA 4UV4L 4JKWA 7FABH 3UJJH 1ORSB 3STZA 4UU9B 1NFDE 3LKNB 2MCG1 5BS0B 1AGEB 1O0VA 5HHXH 3O2DL 4CRPA 1GH7A 4KJPD 4P2QA 4PGBA 5IMOA 1YECL 4Q74A 3U7AA 4HAFA 4BZ2H 2BK8A 1KJVA 1NC2A 1TTGA 1LO5A 1JUFB 2UWEA 2DLFH 3U2SA 3D85B 5EO0B 3LRSA 1J0ZA 2BY1A 3FQXA 3GM0A 1NL0H 3B9KB 4R2GB 1II4E 2VLKA 5BMFL 1S7RB 3QDJA 3BSZL 4OLEA 4EEEA 5J4MA 4H20H 1J5OH 2G5BB 1U8JA 1AE6H 3R06A 3NFPA 1SEBA 1Z2KA 1W2KT 3JZ7A 3EOTH 1QSFB 1DN0A 3V5HB 5C0GB 3ALWA 5EPMB 3ZKMD 4K94L 4RAVA 1U36A 4RX4A 1GZPA 2JJUA 2R1WB 4HS8H 1OHQA 3BIKB 1SVCP 3DUSB 1P6AB 2VDQH 3RI5K 5FO9A 4Z8FL 3H2WA 1AP2B 3L3HA 2NY3D 1HHGA 1HH6A 4OGXL 4NRZA 3RWJB 4K94C 4EN3B 1FZJB 4CNIA 4E41B 1G0YR 1D5BA 1EVUA 1G7HB 4KZDH 1K4CB 3VDCA 3WJJC 2VQUA 3U0WH 4HPOH 4NJ9L 4M7LH 3WCYA 5JOFB 4KVNH 3IDGB 3RL1A 4TOYH 1X3DA 1ZEAL 4KI5C 3EOAB 4G7YH 1G0XA 5J06A 1JGLL 2R0WH 4CL7A 3L9RA 2LABA 3UBXA 4OLZH 1MFDH 4B5EA 4XNZC 1D6EB 2DQCL 4JM2B 1MRDL 2XWTA 1R0AL 2QSCL 1FDLL 4XP4L 3H9SD 5DVMA 4NHUA 1INQB 3GKWH 1EEYA 1S9YA 4X0KB 4LF3B 5ANMB 4Y1AA 5KOMC 4OZGB 4V1DA 4WI4A 2AXFA 4Z0XA 5A40E 4Z95L 2DQEH 4P2QD 2WZPD 3I6LD 5CWSA 4LPWA 4KI5F 2E7HA 2FECI 4FFVC 4JFFB 1FGNH 4OAWA 5B22A 5D71L 3OJVC 5DJDA 2VLJB 4RGNB 2PO6B 4LCIH 3ZHLA 4LP5A 1RUPH 3H42H 1TCRA 3C2AL 3IKCB 4FQHA 1BZ9B 4G42B 3UMTA 5L8JB 3L3IA 5KW9H 3HAEG 2AQ1A 2EDXA 2GY7B 2D03H 2NQCA 3BN9D 4DKEH 1MJUL 2R0LH 3O8XA 4RA0C 3FQTA 4Y5VA 1HI6B 3CFKB 4F2MA 4C4KO 4U6XA 1G1CA 4X8JA 4P46A 4KI5D 5DRXB 1I1AB 1S5HA 5I19H 4PY8J 4HKZA 1LVEA 1DDHA 1FYTE 1HNGA 3H0TA 2VDMH 4ZS7H 4DUWA 5IVXB 3OJDB 2XA3A 4PY7B 3THMH 4M5YH 1L9NA 5BJTB 4MB5A 8FABB 5I73B 4JB9H 5DZNA 3D2UB 3O8XC 3P73B 3QXAA 5FYJH 3GHBL 1BGXH 1G7MB 5FB8B 1CD8A 3V52L 1H3UA 5BXFA 5JW5B 4L9LA 5CEZH 2BDNH 5DEFB 1P53A 2EDFA 5EWIL 5KS9E 4N90D 1UVQB 3MUY1 4X80H 4UT6L 3GJFK 4XHJC 5CZVL 2FECL 3NACH 4XCYA 2X4NA 1HSAA 2FIKB 5K9JH 4QHUB 1YNTA 5CGYC 4NO2A 3KXFD 3D48R 4KGJA 5HDQL 2AI0L 3VRJB 2FB4H 4JN1H 4YHIA 3QRGH 2DQUH 4HWZB 4MXVE 2BRRL 1CL7I 4Y1AD 4JZOA 1AXTH 3DROB 4TULL 4ODXB 1A1MB 4YHOL 1YEJL 1MCNA 2R1XB 5HVGB 1U8NB 4G9FB 4Z7WA 1Z3GH 3GSUA 4MLSA 3IJSA 4O2FA 1DANT 2DM3A 5C0CB 5IOPA 3JV6A 5E70A 4NT6A 3C08H 3GJEA 4TUOA 1CIDA 5I1IL 3VXMB 4XXCC 3MV8A 4LU5H 4IMLA 3VMNA 4X6CE 1X5FA 1V3JA 2F54E 1YNKL 3E2HC 1JPFA 2OR9L 1MPAL 3VXUB 4NWTL 3OZ9L 4NQDD 3O6LH 2PXYC 4MWFB 1VB9A 4X6FA 1ETZA 5L88L 2ICCA 4FHBD 5FUCC 5EU5A 1NGQH 1R3JA 4KK6C 1J8HB 3BVNB 2XN9A 3OJMB 5J0BA 3NFSH 5BZWA 5B4MC 1JGEA 1KFAL 2EDNA 1MHPL 4XPAL 3FONA 1A02N 5EIIB 4FNLL 1A14L 4I48B 3M1BB 4NUJA 3V7MA 3CFIC 5T5NF 5DD6B 2B5IB 1I3RB 1YYLH 3FB7A 2ZPKH 3KPRE 5HHQB 1Z0NA 3K4DA 1LO0L 4XBEL 1F90H 5DJZA 1I3GL 3P0GB 4GRWE 3W5MA 2X4UA 1PG7X 4KUCF 4XRCB 4HPYH 2PUQT 1SJEA 3IETB 1XH3B 3IYLW 5I1GH 2VIRB 4HS3A 5E8NB 5C09D 1XGRA 3NPSC 2BNQA 2H26B 2IBBA 5IB1B 1A1NA 5DHYB 5I0ZA 3TJEL 1PZUB 3AS2A 4XC1H 4OLYH 1QFWM 2Z93B 3HTLX 2GJZA 3QUKB 3BUYA 6CGTA 1KB5H 2X09A 4XXDB 2EE6A 3VJ6A 3PGFL 4TVPE 1DQLH 5EZLB 3QJHA 8CGTA 1T5XA 3H9ZA 3D25B 4G6MH 3CXHJ 1AXSB 2NLJB 4KUCD 2IGFL 2PXYD 1ZLVH 3T2OA 3BPLB 1FSKC 4UILL 2YPLE 2EDEA 2C3HA 3BPOC 4I9WD 2RAMA 2Q7YA 1BAFL 4KK6D 1YUHB 1KV3A 1QHOA 2WWKT 1MF2L 3TVMA 5GXBB 1T80A 5LGJA 4U6TA 3TLRA 1FORL 1UQSA 4KDVA 2BVPA 4QHMA 4P9HL 1TNNA 2FBOJ 1AKJA 1P4IH 4JDVA 3VFVB 1H3GA 3D9AH 4CVZB 5C1MB 2VH5H 4Y16B 1YEHH 5F1SA 4O58L 1CR9L 1CYGA 3MGTA 3BW9A 1T7XA 1KEML 4CVXB 4ZFZA 1BP3B 2PW1A 2OTWA 3V6FA 3RBGA 5GISL 4PREB 5BRZA 5H35B 2F19L 1DBBH 1CN4A 3ABZA 1CFSA 1RZ7L 2Z91A 1D6VL 9CGTA 4X4YB 5DUPH 3UXFA 1I9IL 1IGML 5C3LD 3E0GA 1AFVH 4YBLB 1G7JA 3BWUC 1HHHA 3H7LA 3HI5L 2MKLC 4LKCA 3C09C 4MS8C 3V4VL 4TQEH 1SHMA 3B9VA 4NYLA 4PG9B 4PRPE 1U6AL 1BWWA 4MAUL 1RIVH 3LS5H 4OKVA 2UYLB 4P2RA 1WV7T 1XGYL 4YDLC 4G6JH 1DBML 4UTBH 4U1GC 1A3RH 3HS0A 3QFJE 3CDGB 3RVTC 2W60B 3GIVA 2EKSB 5FAAA 2ZCHH 5T1KD 3FO9B 2BMKB 4R4FL 3BIBX 1BVLA 3QEUA 1MSPA 1CDCA 5C08E 1MVUA 5DD5H 1UZ8B 3MV9A 3TBSB 2OK0L 3GMOB 4MCZB 5B8CA 3V0VB 2ICES 2QHLA 5D9SA 5KSUA 5JHDE 1KULA 1BIIB 3MACL 1ZOXA 4R3SB 3PQYE 1TVHA 4NNPH 2RJMA 1WLHA 3RNKA 4DUXA 1SMAA 2EIZA 4N1CA 3I50L 5HGDA 1SYVA 3MODH 2MKWA 2ZUVA 2ADFL 5GIRA 3HB3C 4IRJD 4S2SA 2Q86B 5E8DL 1A6VH 1MELA 4MS8D 1FBIL 3QG6B 1A6WH 2CXKA 4YHKH 2E5EA 1JHKH 1Q38A 4LBEA 5LKNA 1YEIH 5B8CC 5CP7A 5A2LH 3VFSB 5I2IB 5FIEA 4LEOB 5T3ZL 1FZKB 3MXWH 4ZSOB 4WTWA 4OGYH 2DICA 1I8IA 1N5YH 1RU9H 2ZG2A 4GG8A 5DD0H 2X2YA 1BOGA 4ZODA 3C5SA 4HZLA 3RVTD 1IGJA 1UB5B 2JLLA 2CK2A 2ZOKB 3WFEH 1KCRH 3U6RB 4K9EH 3BKML 2AQ3A 4LIQH 4AM0B 4O51A 4EDWL 2ID5A 3F7PC 2DDQH 1DE4A 3EO9H 1A7QH 5GGTA 1CXIA 2R0ZH 1KJMA 2XICA 3STZB 4JFED 2I60H 5CJOH 1A0QH 5FA4B 1T4KB 3VXPA 1BJ1H 1K5NB 1IGIL 4X7CC 5GGTL 4PGBB 4MA8H 4P2QB 3B2VH 5GZNC 5IEKA 1KJVB 1H3PL 1NC2B 3B6SA 5D1XA 4NBYB 1YNLH 2P8PB 2DWDA 3MRBA 2UWEB 4UV4H 1CK0L 3VRIA 3U2SB 1WT5A 4TYUA 4H0HB 4OFKA 1LGVA 3LRSB 2KBGA 3FQXB 2EECA 4PTUA 5EFIA 5T3XL 2VLKB 3VFMB 3QDJB 3VFNA 3O2DH 1LP9F 1YECH 4G43A 1U8JB 3VXOA 1A3LL 1ITCA 2HAZA 3NFPB 1SEBB 4ZOBA 5I6XC 2FZ3A 1T2JA 1KCSL 3I85A 1TETL 1DN0B 5JQHC 1HIML 3DV4A 2EDTA 2EE3A 3ULVE 1EJOL 1QRNA 5D1XC 4RAVB 4YO0A 3BSZH 2Z4QA 3MO1A 5INCA 1BVKA 2DQGL 3G6JE 5I15L 5T3ZD 5FO9B 4XNZB 2I07A 4TTGA 1HHGB 1HH6B 4NRZB 3V0WL 2GEEA 4CNIB 1X5HA 4K94H 5HGGS 4CVUA 1A7RL 1QO3A 1D5BB 4QRRD 2JJSA 2LAAA 4TN9A 3T08A 2MOVA 3V79C 4LCWA 2QJDA 4WTXA 4YFEA 1F42A 3AB0C 2H45A 3L3KA 4PJ5D 3RL1B 1QSEE 1PBYA 4Z8FH 1T66D 2V6HA 1GOFA 3QHTC 4PD4J 5GZND 4K3DH 3OB0H 3MBXL 3OGCB 2EDJA 3L9RB 3WL9A 3RZCA 1FZMA 3UBXB 2B4CL 12E8L 2C3XA 2NTSP 5HHOD 1PLGL 2XWTB 4NJ9H 3S34H 4PJHF 1BM3H 1ZEAH 1M71A 3B43A 3DWTA 4NHUB 2C7UA 5EOTA 1S9YB 2YWZA 5F7LB 5EZIL 4Y1AB 3X11A 2B4CC 1LE5A 2DLIA 4V1DB 4WTZA 2J4WL 4ELME 3IFLL 2AXFB 1OP3K 3QUZA 5CWSB 5D6DA 4AL8L 3N06B 2R2HB 3IF1A 1BOYA 2QSCH 3RZCC 4OAWB 4HCRA 4XP4H 4P5TA 2BSRA 2GJJA 2FBJH 3MJ8A 4RSVA 5DJDB 4HUKB 1J0JA 5H8DA 4YXHH 6FABL 2X4RA 3GJFA 4U0RC 4FQHB 3CDCA 4JGUA 1T0PB 3A6OA 3L3IB 4Z95H 4KZEL 1RK0A 4HCRL 1KNOA 3O8XB 5F7MC 1OGTA 2C4FU 3STBA 4NQDB 4S1QL 3FQTB 4Y5VB 1JI1A 4FRWA 1T22A 5HI4C 4YE4L 3QUZC 4F2MB 5AG9A 1NFDA 4NC0B 5D93C 1F8TL 1YY8B 4BSWA 4U6XB 5F9WC 4X8JB 4P46B 3C2AH 3C5ZA 4P5TC 4JKMA 2B2XL 4HKZB 1KEGL 1CI5A 1DDHB 1MJUH 2BVQA 3SGDH 3MLSH 4E5XA 3H0TB 2E3VA 15C8L 2FCBA 4GBXA 2CXGA 1IEHA 2F8XC 5CAYB 2W38A 2DM4A 2QQQA 4D9QE 1TDQA 3QR2A 2AV7A 1LMKA 2VUYA 3QXAB 4F37K 1XF1A 5ITFA 3ORJA 1XGPA 1EMTL 3KPPA 1M7DA 2HA1A 4I3RL 4J6RL 5BXFB 4GOSA 1QVOB 4WU5A 4L9LB 1HH9A 1Q9LA 3AAZA 3SN6N 3ROOB 5C07D 3C5ZC 1GGBL 4P48A 3X14A 4D2NA 1T83A 4LPCA 2DTSA 4OM1H 3P9WB 3RZCD 5HYFA 2BNRE 3GHBH 2JE8A 4XCYB 2X4NB 1HSAB 4GBXC 2Z0BA 4ZFGL 4MD0A 4M9OA 1YNTB 4NO2B 1F6FB 3WDHA 2BFVL 5EWIH 4GS7C 2H32A 3UPCA 4YHIB 3UEZA 1WF5A 3E2HB 4Y89A 5EIQA 3KHOA 4NQXA 5DURD 4MJIE 3DLQR 4UT6H 5CZVH 1U91A 5HI4D 2IALA 4HX1A 3QUZD 1I3UA 1T83C 3QPXH 2CDEA 3BEWA 4ZOAA 2J12B 3IT8D 1M6OB 3U1SL 4Z7WB 3GSUB 5HDQH 4P5TD 3IJSB 4O2FB 1F6LL 3DHMA 5IOPB 3JV6B 4NT6B 5D7IB 3OPZL 3GJEB 4QCIA 4TUOB 3MJ9A 3FB6A 1IM9A 4RWYL 3MV8B 4IMLB 1GSMA 4TULH 3P3YA 4UT9L 3MLVL 2IBZY 3O4LD 5C71A 1WZKA 1YEJH 4QOKE 4YHOH 4MB3A 4H26B 2VXTL 4GRMB 4X6FB 1ETZB 1JNJA 3MJ9L 2V2WA 5EU5B 1Q72H 2QL1A 1DBJL 3GM8A 2XN9B 3OKDA 1D5XA 4JFDA 1N0XL