3QUZD

Structure of the mouse cd1d-nu-alpha-galcer-inkt tcr complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 65
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzD02
4OLEA 1T04A 3NN8B 1H3GA 2MFNA 2EYTA 3QCUH 1VGEL 3DURB 4I3SH 2R2HA 2VQ1A 4CVWA 2QR0A 2XZQL 3MRRA 3O4OC 4PB0H 4WHDA 1HSBB 1KCRH 4MCZA 3HZYA 1QFOA 4MLIA 4OGYH 3WN5A 1T66D 2DD8H 4YDLB 2VDNL 4LPVA 5GGTL 1KPVA 2Z8RA 4Y4KD 5CSZA 2UYLB 1E4JA 5C6WH 3THML 4U33A 3LEXA 5F71A 3CK0H 5IBTL 2E7CA 2JIXA 2NNAB 4L3EA 3HRZB 1U2CA 3VFWA 1Y0LB 3OJDB 4PJ8D 1HXMA 4N9GA 4HKZA 3V95A 1V3MA 3HZMA 4LRNH 3LHPH 2Y5TB 1JGVL 1YEGL 2YSSA 4OQ1A 3WD5L 1FGVL 4U6YA 4U4BA 4P0DA 4TSAH 1ULVA 4YBQC 2VR4A 3H42L 3WMSA 1WQVT 2EH8L 2NYYD 4JG0L 4FQLL 4NWTL 4ZTPH 3DARA 4LGSB 1M6OA 3NIDE 2YKLL 4XBPA 2R0WH 2VLRB 3SDCB 5ENWA 4F3FA 1MJ8L 4IOIA 4GW1A 3QWOB 4WO4C 2VO5A 2V17H 1JZ2A 3HCVA 5JW4M 4QXGH 1IL1A 4BSWA 5DK0A 5IB1B 4PJHB 3RPIB 3ARBC 2UZIH 1IGCL 4LPYA 3MRLA 3PP3K 5D7IF 3BE1L 4M8VA 1WBXA 2W0FB 4YFLF 3IVKA 1CI5A 3IDMA 3T2PA 4XXCC 3RAJL 5I1GL 1T83C 4ACPA 2GJ6E 4L1HA 4UNUA 3UTTB 5BCAA 2IBZY 1VENA 4LASL 5IW6A 3TBVB 3TNMB 3S34L 1QNZH 4KXZH 1IARB 4Y2DA 2NY5L 1KCLA 4PJGB 4DTGH 2VB5A 5KSVB 2J8UF 3TNNA 5FYJH 4OLVL 1LK3H 3GKWH 2QADC 2B1AL 1NMCC 1OTSC 3RNKB 5BS0E 3GSNB 1IGJB 2GCYB 3HR6A 1SEBB 1HZHH 1BFOA 3ULUE 3VXOB 1NLDH 1KV3A 1INQA 4N1HB 3LKPA 4R2GD 4JY5H 4XXDB 2HMIC 4LLWA 1EHLH 5F9OL 2V7HA 1Z0MA 1P53A 3BZDA 4P2OD 3SDDC 3DX6B 3R0NA 1X4ZA 1RU9L 3S35H 4WEBL 3TWCH 3TJEL 5C07E 2X4RB 4YXLL 1D6EA 1EAPB 4KUCF 1RZKH 4P59H 4NQDB 1DQDL 5KSBE 3GIVB 3NPZB 5D9SA 4HG4K 3D39D 3O6FD 3FN0L 1KJMB 4N8VA 2IPUK 3H9SB 2EIEA 4KC3B 5FM5O 5K93A 4FNLL 3ZE0F 3MRFB 2ZUVA 4PLJD 1V3JA 2HH0L 1D3CA 2HFFA 3SKNA 1GAFH 5D7LA 2BNRA 3VRJB 1FZMB 2EYRB 4Z7UB 5L6YL 5HYJA 5MEOB 3SE4C 4ZD3H 5BZDA 3TBSB 4PRBA 3SBWA 1HHIB 2APXA 2OK0H 1R0AL 3L5XH 1NJ9B 1T0MA 1BWWA 3MTRA 2IC2A 4WO4A 5FYLD 2EO9A 1DP0A 4GBXB 3BUYA 3MODL 4YWGH 1K6QH 1NPUA 2HLFD 4P5TC 3VXSA 3QUMH 5ILTL 3PGCA 1T5XB 1MCDA 5JXAH 3SDAB 1TTUA 2K7PA 2W0LA 2BNQB 4ZOEA 2AV7A 3SN6N 5KOMC 3BPOB 4YDJA 3VGHA 4RFEA 12E8H 3P30H 2R2EB 4PJEB 3V0WH 4GW4B 2BSRA 3QUKB 1BQHB 2DBLH 1RZGB 1TTGA 1YEDB 3NFNA 4U1IA 1FLRH 2R1WA 3MCKA 2D03L 1PW3A 2NY1B 4L8CA 4KH2A 1XH3A 2Q86B 3QEHB 4L5FL 4F7MA 4YX2L 3HPJB 4QY8A 4E9LA 1TETL 5J6HB 1MCNA 2HT4D 4Y4HB 4I3RH 4DW2L 1G7IB 3BD4A 2XRAH 1TNNA 5DD6B 5CEZL 1MFAL 1NH6A 4K3JH 3CX2A 3NIGE 1HKFA 4PY7B 4EXPX 1D9KA 3PGDB 1JYXA 1YMHA 3BPCA 5GJSL 2DQDL 1YMME 2WM0A 3RIAF 4PG2C 1QR1A 1CG9A 3FFCB 1S78C 5FUZH 4K3GA 2F8OA 2R9HD 2AXFA 4LRIC 3T2OA 5IHLB 1MH5A 5DHYB 4DVRL 4KY1L 1A6ZB 3O6LL 1CCZA 1IEBB 1N2RB 3GGWA 1G9NH 2J4WL 4NCDA 4UBDC 2O5XL 4L8SA 5K33A 3STBA 2PYEB 3CDYA 2GITA 2P43B 3BKJH 2WUCL 4JY4B 3F5WB 1JF5A 4YFLI 1T1WB 1UWXH 3FT2B 4P23B 2PTTA 3C6LC 4TUKH 1W0WB 2ICCA 3N1MC 3IDNB 1N64H 4Z7WA 1CF8H 1WK0A 5DGQA 5E24E 1F11B 4QRTB 3MLRL 1K2DA 4XCCL 5C0JA 1FNLA 1XGQA 4HZAA 5KSAD 4P9HH 1OLLA 1CIUA 2GEEA 1DN0A 2N4IA 4HCRL 2XACC 3ELAT 2PW2B 3SBWC 1KYOK 2BVYA 2NY2D 4HLZH 4O2CA 3O11A 1BREA 4X6DE 4G9FB 5EOTA 1YMMD 4I4WB 1EVUA 4L4VA 2AQ3A 3MNVA 1JZ3A 4XMKL 1SEQL 2MSPA 2VC2L 4DFIA 3DROA 5I1KL 3H0TA 2D7PA 4R0LA 1D5MB 3FQRA 1HSAA 1WBYB 4G6KH 1OGAD 5CBEA 4WI4A 3FQWA 2SEBA 5F1IB 5B21A 5TDNB 2N7AA 5I30L 2EDTA 2VXSL 4XMPL 2ED7A 3F12B 4PGBA 1JL8A 4KRNA 4NQCA 3X3GH 2A0LD 3ARGC 4WY7H 1A1OA 2UZXB 5C0IB 4UV7H 3P4MA 3AMLA 4KDTC 2FBOJ 5MENA 4HV8B 5EU4B 1G7JB 2Q3AA 2NXYB 5JXEA 3GSQA 4JM4L 3S36H 4UUJA 3C6SB 4FQXA 2VDQL 3C5ZA 3SCMD 4DUWA 2H8PA 5C7XL 4WI5A 5I8CA 3QEQD 2VH5L 1NAMB 1QO3A 4OCYL 3W5MA 1FAIL 2E3VA 4K9EH 5HHMD 2VDRL 4PREA 2HVKB 5J9PB 1WUNT 3ARBB 3QEGL 3S88L 4BUGA 4HH8A 2X4UA 3PV6A 2FGZA 3K74B 2ICWJ 3QCVL 1VACA 1I9JH 3C09C 4M00A 1IRAY 4PRDB 4ONFH 1NGZB 4NRXB 2JJVA 1Q1JL 1RJLB 5CBAA 1C7SA 1Z9SA 1K8IB 3MLVH 4GBXC 4M93C 4OI7A 4N0CD 1KGCE 4KKLD 3X14A 2WK2A 4BQ8A 2J8UB 2BNUA 3B2UC 1XIWB 4RZCB 3B8SA 3UPAA 2D2OA 3SKJH 3K4AA 1IC4H 3KLHC 1LO4H 4XCYA 5A3ID 5GS0H 1GZPA 1VGKB 2KZWA 3I2CH 3VXUA 3P0YH 4QTIL 8FABA 5FUOL 2DJUA 3GBNL 2Z8VC 5EO9A 5C07D 4YX2H 5SWSB 3G5ZB 3MV01 2R4RH 3VWJD 5ICXB 5ICYB 3NZ8B 1E6JH 1I85C 4KK5C 5F7EL 2R0ZH 1VSCA 1YEIH 3WL9B 3F7VA 4BM7A 5JPNB 5FF6B 3RWIA 1CT8A 4I48A 5CD3A 4JM2D 5IKCA 1HE7A 2OL3L 3CFKB 1GZQB 4QTHB 2B7DT 5FGBC 1KCKA 1XF4A 4MA1C 1NANH 1YJDL 1IEAB 2J88L 4JRYB 4KY1H 4BFIB 3U0PA 4QWWC 4B5EA 2A73A 2XZAL 1ZLSH 1CXFA 1AGEB 3RA7L 5F9AC 4JFFB 5IMKB 4Z78B 2MQ3A 3DUSB 4DQOL 5LGKA 2R23A 3I6LE 3DI3B 3BKJL 4NRZA 3MGOB 3SQOL 5D93B 3ULUH 4HZLA 5ERWA 3FHQA 2QADB 1WCBA 3B6SA 1FO0B 1MWAA 4G8IA 4FHBD 5DSCA 3BP6A 5GGQL 1EDQA 4XZUA 2LV4A 4ONGL 5TJWK 3QAZC 4XI5D 1E28B 1FVEA 1RMFH 3SGEH 1DLFH 4JFYA 3MZTA 1RK1A 3KWWA 1QKZL 3WO3B 5IQ9A 2BSTB 4UI2A 4NO2B 1PKQA 5I1DA 5D1QB 4C83A 3OV6A 5F6HJ 4Y5XC 1OAZH 4S1QH 1CD1A 1QUNA 5TE4L 5M7QA 4NOBA 1PZ5B 5H37G 5C6TH 2YRLA 4NO3A 4JFOA 2DMBA 4PJ5A 4GKSB 2ADGB 2DQTL 5FM8A 4ZG1A 1SEQH 3AS1A 3PDGA 2DLFH 1AFVH 2WLZA 5IGXH 4LSUH 4JFPA 1JHTA 5ISZA 5IEKA 4HXBH 1GC1L 4JFFD 3MA7A 4J8RA 1UFUA 1A3RH 1G7PA 4S11A 4XHJD 3HR5A 4JKMA 3V5HA 3NH7L 1JMZA 3MROB 2NY3C 4NO5B 3AS2A 4YGAB 4NRYB 4UV7L 3MV9D 3BE1H 1JPST 4LLMA 3QBTB 4PJFF 1WZKA 5DUBA 3PWVA 2KKQA 2WZPD 2WBJC 5D7KE 1MCOL 1YMMA 1NCNA 3LQAL 1G0DA 3O2VH 4ZNEE 1C12A 3ZE1E 3E6HB 1T2JA 2DRUA 3V6ZA 4S2SA 4XI5C 1T6WA 4NUJB 3WFHB 1ETZA 2AK4B 1DCLA 5KVMC 1Y18A 1HKLL 3UTPD 2NX5E 1CFSB 1AGBB 3VXPB 5L8KB 5IEHB 4PJFA 2W9DH 3MJ9H 1HZHL 2RR3A 1LEKA 1U8JA 3S96B 5IUSA 2AQ1A 1EEZB 4OLZH 1IQDA 2NY0B 3RIAK 2HTLD 4QT5B 3U2SB 4U1NA 4K7FA 3GJEA 1WEJL 4XH2A 3CDCA 3DO7B 1KPUA 3HE6D 5A2FA 1LEIA 3GMQB 3S35L 4EVNA 3EKCA 2W92A 1IAIH 1Q0YL 3FZUC 3D0VB 3SGJC 2IH1B 1YNTB 3HMXH 4QXGL 4RGMC 5FXCH 1FZOB 1MHPH 2DM2A 2F54B 1VFAA 5DMYA 1E27B 4QHLB 4GS7C 5KN5B 3H6JA 3CZJA 5ESQB 1AQDA 4WJ5B 2VLLA 4XAKD 2W1NA 2B2XL 1YEIL 1JWUA 4ETYA 4XPTL 4LFHD 3AB0C 3OJVC 1X4XA 1AHWC 3SDXB 5AD0A 1DBAH 3NFPA 3L3IA 3LRSA 4P2RA 3QQ4B 2DKMA 5IVXE 1UB5A 3KPMA 4QXWA 5IBTH 1KJ2A 1D7FA 4X5WA 4JRXB 1ND0A 4NQCE 4ISVB 3PWPE 4ZUUA 1NGWA 3OGCB 3H7LA 5MEPB 1J8KA 4M48H 2GY7B 1TLKA 3ZHDA 3IAGC 5F1KC 2NY0C 1NDMB 2B1AH 5F7MC 4MCZB 1MQKH 3CLFL 2ATPA 1T20B 4AT6A 1AXSA 4MNGA 4XPBH 3ZTJH 3ARDA 2R9HC 1AY1H 1Q72H 4K2UL 4FQLH 2AXJA 3MGTA 4M8QB 1ZXQA 4K23H 4EN3A 1I4FB 3HNTL 2ZKHH 3WCYA 4V2CB 1DQJB 2DQGH 2E7HA 5AZEH 2VABB 4MA8H 4L3EB 3L9RB 4MX7B 2JCCE 4WUUB 1MOEA 2CDFB 3IXTB 5IK3A 4WEBH 3TWCL 5DMGC 4EEEA 4JPWL 4NP4L 3AU1A 2HJKA 3WIIH 3MUGB 2EDQA 5CKAA 4MNHA 4K8RC 4WDIB 3CD4A 2EDHA 1RZJH 3C8KA 3CPLA 3PJSB 1FYTE 4YHIA 2I26N 1BBDL 1CZ8H 4JO2L 1U3HD 1CD9B 4JPVL 5CWSA 4L4TE 4X9IA 1M1SA 4JGUA 2J6EH 4EUPG 2NY2C 2F54E 5TF0A 1NSNH 1P1ZA 1T1YB 5DK0B 5FYLE 3DRTB 4JB9H 5MERB 2HVJA 5T3ZH 3L5XL 4MHHI 4APQD 4HKXA 1IKFL 2ICES 3VFGH 1R3LA 3P73B 4LAQH 4HS6A 3HB3C 1FFRA 3TIEB 2HTKC 3P9MB 4HUWA 2EICA 1QBLH 5IW6B 3FB8B 4V1DD 3VG0L 5CEYA 1G7LB 4LP4A 3H9YA 5J12B 43CAA 1J18A 4NM8L 4TVPL 1XF1A 1FSKC 4PJ7B 5DMIL 1UB6B 5EH1A 2NY1D 4ZMAT 1L6XA 3QXWA 4UT9H 5K9OA 1FE8L 1TENA 5DJYB 3IU3A 1AKJD 3CXHK 1KFAH 5F7DB 1FO0H 1DFBL 5ANMA 3LKPB 2NX5A 5EU7E 3X3FH 3ZKMC 4EOWL 2P8PB 4EJ1C 3FQXB 5J1TC 1JNLL 3MV8A 1G7MA 4Y16B 4NHCL 3HZVA 4XMKH 1BJ1H 1L0XA 2GY5A 5L9DL 2R69L 1U8HA 5GGSB 2BDNH 3PXJA 3MODH 3KNBB 1XGYH 5E2WH 1MFCL 2RQ8A 4M43H 3DGGB 2NW3B 4ENEC 1OPGH 5GS1B 1I75A 2FLRT 4NN5C 4PJIB 3GBML 1GC1C 3ZO0A 1QRNE 3CXDL 3VGBA 1F58H 3HC3H 3PWJB 2BNRB 2VDQH 2WWMC 1H5BA 3D6GA 2X1QA 4X4ME 5EIIB 1MAKA 1YY8A 4M62L 3KYAA 3U83A 3AB0B 3BZEA 4U1JA 4UIKH 3MV8D 4K07A 1Q9WA 4P4KD 1NCUA 1HWHB 1MFBH 4QOKA 3FT4A 3QIBA 1PVHA 3NCEB 1TETH 1CS6A 3MLRH 3WFZA 2CRYA 4K3EL 1KOAA 2C3WA 4Q0XH 2EO1A 3LZFL 3IB4A 3L1OH 1P7QB 3VXSB 4EDWH 2AJSL 4OF5A 3TBYA 1QSEB 3HG1B 1AQKH 4HT1L 2HJLB 4NBYB 4MQXD 1BZ7B 3QEUA 4D0CA 2H1PH 1I9EA 5DA0B 1XGUA 4NNXB 2VN7A 2ZKHL 1MIEH 2ZSWA 4MVBC 5ADPL 1NUGA 1WGOA 2VC2H 2O5ZL 1HIML 4LLQB 3B2UD 1LO4L 3VFSB 4CDGC 2F15A 4LCIL 1ZLWH 4HK3J 4HQQH 1R3JB 2NCMA 1SY6H 5DO2D 4LRIA 4XTRD 3TYGH 5C0BD 1OF2A 5DD6A 1E6JL 2A83B 1BVLB 2FYYA 1HHJA 4FXKA 1IAKA 1DVFC 1OARL 1UYWL 1RZFH 3OXRB 4OZIF 5MI0C 1FORL 5FO8B 3V7AG 4ERSH 3HI1B 4WNQA 4YPGA 1A1NB 3HMXA 4JQXC 4ELMA 2UWEE 4QRPA 1NSNL 5SX4I 5GS0D 1W2KT 5E7FA 1QA9A 1PLGH 4MXQD 2CIIA 2WBJB 4Q9QL 1XR9B 3BGAA 4L8SB 5I75B 3OR6A 3VCLB 4PRHA 1FFOB 2H6PA 3D25A 5ACMA 3UTSD 1QQDA 2OI9C 4GRMA 5FA4B 1KGCD 5C2BL 3X12A 4ONFL 2JIXD 3DXAA 5I1KH 1NCDL 1OAQH 1I1YB 4RQQA 2NY3D 2YHGA 2XOTA 5L2JB 5IJVA 1C08B 2FBJL 4MVBD 2XQBL 5HYIA 2YN5A 5I30H 3QXDB 3RVWD 1FNEB 4RWHA 5IIEA 5BZWA 3AXLB 4CN1A 4PGCA 4U1GC 2JK5A 4PS4L 2Z8WC 3DMMD 3QDMD 1FNAA 3T8XB 4NO0A 3VI3F 4C56A 3C5ZC 1QFWH 4D9QD 5IW3A 4Y4KC 3KPPA 5IFHL 2PXYC 3GSOB 2R2HB 1DUZA 3BJLA 5DQDH 5KTEH 4I4WA 2F53D 4P46C 1R3KB 2ZJSH 1XF3A 4YO0B 4U6VL 1BD2B 4ZPVB 4Z7QE 5EZJA 5F1IA 4ZUWA 3VFOA 5DD5L 3NOIA 1KB9J 1DQMH 3MO1B 5DEFB 2Y23A 3BN9D 2AXGB 1UG9A 2VKWA 3P11H 5SWSD 3QDAA 4K7PY 4AIXA 1P4BH 2YA2A 2NYYC 2BY0A 3MUZ1 1MY7A 4WWKC 3FN9A 1FBIH 4Y19D 4UDTB 3DWTA 1V05A 2PXYA 1MWAL 1S7SB 3DV6A 4PJ9C 5I8CB 1I7TA 4X98B 4LFHG 3MNWB 3ULUL 4HC1L 3QO1B 4RSVA 5L88L 3AMKA 2Y5TA 1FVCA 1YEHL 4RMQA 4Z0XA 4PB9L 3UJTL 3TV3L 4NKMB 2HLAB 4KRMB 4GG8A 4JHWH 4JZNB 5F7FA 2VDML 5JA9A 2CDEA 1EA9C 2VQUA 2IADA 2EDBA 2CSPA 3C6LA 4YNYA 3KYNA 3OXSB 3DJ9A 3QFDA 43C9A 4GO6B 4LGPB 5FUCE 5C0GA 3QDGA 4OLZL 4NKIL 3T3PF 2YK1L 4BH8A 5ACLA 5IVOA 3WO4C 5C6TL 4ZOBA 5EA0H 1N5AA 4CN4A 4NC2B 4U1SB 2O5ZH 3X13A 3HE7C 3DI2B 2NW2A 3QPXH 1BIIB 1DN2A 2BVQB 1FAKT 2GSIA 5HDQH 5TQ2H 1ZGLA 4PRAA 4UT6L 1NEZG 2WP3T 5EO9B 2YR3A 3DYMA 5K9KB 1MHPL 1EX0A 1VDGA 4P9MH 1Q9KA 1RZIA 2OBGA 1BZ9B 2JJUA 5C09A 2BJMH 5DJXB 5DMGD 1OARH 1MAMH 2EXWD 3CVHB 5EU6E 2ZUQC 4WEMB 4NJ9H 4Z95L 4WI3A 5T3ZD 4HUMB 1ACYL 2HFEA 3QUXA 4PRPB 1ROWA 2A73B 2Y1VA 3FB6A 4WW2B 3H7BB 2CPCA 1X5XA 4OZGE 4CMMA 4XBGA 5DD0L 4ELME 5ISZD 4R97B 3VI3E 1LO5A 3SDYH 4BSVA 2W9DL 2K3TA 2M8XA 3VFUA 4H26B 4QHUB 1JF1A 3B8YA 5INCB 3UYPA 4OM0H 1BMGA 3DVFA 2FBJH 5D9SB 3C60A 5DJ0A 4EQ3A 3OBAA 4FQ1H 5D70L 4XZUB 4WW2F 5HYJD 2YPVL 5HGAB 2VITB 2DLHA 2H2SD 3DXAE 2NXZC 1NBYA 5HI4C 4JFFE 4OT1H 4ZPTA 2YPLA 2YXMA 3D3VD 4LVHB 1C5DB 1AR1C 2BOCB 4FQHB 5HYQB 4KI5E 1UEMA 4HH9B 4KHTH 3OHXB 4JGJA 3RVXD 4GJTB 4KJWC 5I15H 3ARFA 3MOAL 1L6ZA 3FQTB 4KXZI 3N85H 3HNVL 2X4OB 4FZ8L 1I7ZB 5F8RC 1MJ7L 2ADIB 4I5BB 4N8PA 3IFNH 5F9WC 1S7WA 4KQ4L 1BQHG 2PYEE 4LHQB 3GB7B 2DQHL 2G5BA 2V7NB 2IPTL 3LPWA 3MA7B 2Q1EA 3RZWA 3FMGH 2Q6WA 2ADFL 3OSKA 1FIGL 1G9NC 4JKWA 3IJSA 3M07A 1NGYA 3IJYB 5J12C 4NO5A 1NFDE 3VFVA 4J4PD 2VZOA 1MEXH 4GW4A 3GSNL 4NRYA 4ZS6D 1BZQK 1U3JA 5E08L 4P4RB 3W0WD 4WTZA 1RZGA 1U91B 1YEDA 3U9UA 3VFMB 1H0DA 4PB0L 4DAGH 4K3DL 3E6FB 1N5YL 5E1AB 2IQAB 4JHZA 1RHHA 4JN1L 5FO7A 4NOFA 5DTFA 4KJYB 4PJ9A 1PKQE 2P24B 4LEXL 3T0EE 3RVUD 2DD8L 3REWB 4NNPL 2PR4L 3L95A 4LLAA 2PNDA 2W60B 2XWBB 3WHXA 5IBLD 1EGJA 4M7LL 5D7JA 1KTRL 1I7UB 1M7IB 3KG5A 4M6MH 1C5CH 4UBDD 2AK4A 2BNQD 2CKBA 1E6OH 4KMTL 3EO1B 4J3SA 1KLFA 1RVFL 4OFKA 2WWMD 3ABZA 3U7YL 1HHGB 4XPFL 5T5NG 2I07B 3W9DB 4Q9RH 2BY2A 4HXAH 4MCYA 3WXVH 2XTJE 2B5IB 5I8EB 5FB8B 1MCPH 3EO9L 4PJAF 3CZFB 1EEZA 3OB0H 4G6JH 4ZFFA 2ZCKH 4D9QE 3IXAA 3F6IA 4U0QB 1VFUA 5CILH 4I0PA 5KSAC 1A9EB 5D6CA 1KENL 1BBDH 1CZ8L 2EC9U 5MHSE 4XP6L 4OFVA 2UZYB 3D69A 3MRDA 4NZRL 3BDYL 1T03H 1KCRL 4FTVB 4RX4A 5FYLL 4K71B 1KT2A 3OAUL 1YEJH 4ZAKB 5HHXH 4ZDHA 3WJLC 5C9KA 1I8MB 3WIFA 4Z7WB 2EKSA 2CLZB 2MTPA 2VLLB 3FOMA 1WZ1L 1JWUB 1QR4A 3AAZA 5I1CH 1AO7E 4JM2A 1L7IL 1AD0B 1AJ7L 4LCUA 1SMAA 5TE6H 3LRSB 4P2RB 1NLBL 4X7TB 3HUJB 2ZSVA 3RVUC 2DDQH 1Z0NA 1DN0B 3A67H 4JR9H 1O5DT 1KTDA 1INEH 4U2YA 5I16A 5HI5D 2VL5A 1RFDL 3QFJD 4WU5A 4LVNC 4YQXH 1DVFD 5EOTB 1NGXB 3UEZA 5DQ9B 3KPOA 4L4VB 2HJFA 4EIZC 1T22B 3H0TB 5E94B 4BZ1L 4WVRA 3FQWB 3TJHD 3KXFE 4OF3A 5E8PB 2BVOA 4ODUB 5IB3B 3EFFB 3C2AH 3ARDC 1D5XB 2H32B 1DVFA 3NCMA 4Q58C 5FV1L 4G9FD 4H20L 1LD9B 2VISA 3AVEA 5DJ6A 4NN6C 1JV5B 3BP7A 1CYGA 5C0IA 5IESL 2YPVH 5JUEL 1IZKA 1TJGH 4LCCB 4C54A 3MXWL 4PG9A 3PHOA 4OBSA 3CC5A 3WXWL 1TPXB 4U49A 3G04B 4ZSOB 3C5ZB 1CL7H 3QQ9C 4LAQL 2PW1A 4HQQL 4Q7DA 5IR1A 3KPNB 1WIOA 5EOQH 4PREB 5J9PA 1MFDL 5C0AE 5LJYH 4WDIA 1H3TA 1ZEAL 4QXUH 4KKAD 3OG6B 4PJCB 4M7JH 2V5YA 5C0NC 4HS8H 3WJLA 5F3BA 4DKEL 4LCWB 4ODBD 3BEWA 4LCWD 2RJMA 3SGJA 4HIEA 4MAYA 3HI6L 3L3HA 1R3HB 1BQSA 1QZ1A 5F1NA 5D71H 5ACZB 2PO6C 5GJTL 3P0GB 2J8UA 1GHFL 5IROA 4EBQL 4YXHH 3CXHJ 5E6ZA 1TITA 5KSUB 1RV6X 1K4CA 4GRLC 5DEZA 4MDJA 4MXQC 3D87B 4NZDA 5GHWH 3LEVL 3ARDD 3IDJA 2YD1A 3FONB 8FABB 3BH9B 1JNHB 1WFNA 3G6DL 3TESA 2YUZA 3UBXB 1OTTD 1UZ6F 2F53A 5ID0A 2BSED 4YXLH 1NGQH 5ICYA 3VRIB 2XWJB 5F88A 4NPYB 3JTTA 1R5IA 3R4DA 4GKNA 3WV0A 5K9OB 1A0QH 1ZTXH 3IDIB 3OKEB 5IG7B 1RIUH 4JGMA 3ZKND 1QLEL 3MJ7B 1T0NB 5EBWA 1S7TA 5BRZD 3FFDA 4JFDE 2ZNXA 1H3UA 3BKCH 1T5WA 3HAEH 3GSUB 4X5LA 1FV1B 5L6YH 4LQFH 1T1XA 1AC6A 1CICB 2Y9RT 4JFFA 2AJVH 5T33H 1T2QL 1CBVL 4LEOA 5GIRB 5HHVH 4OLUH 2HN7A 2WIMA 5JA8B 4OD3H 3ZL4L 3V7MA 1YYLL 5I1EH 5F7HA 3L1OL 1RUMH 4QXTA 3RVTD 3OAUH 3IETA 3P77B 3PL6D 4R4BB 2DQCH 1IAMA 1Q38A 3CFJB 3D39A 3O6FA 4F7CB 4XVSL 3QWRD 4ZXBD 4HIJA 3ZTNL 1L9NA 5JORB 2DTML 5KAQF 3KWWB 3HRZA 4N8CL 2IQ9L 4XGZA 5CIPH 2FCBA 2C26A 3LD8C 4P2CG 4RBPH 5IVZA 3DECA 3T77B 5ICZA 3V4UL 1A6VH 4ODWA 3BGMB 1RUPL 2R4SL 4JAMB 1YEHH 2ESVD 5EORL 1KIQA 3GDBA 5A2LH 1PZ5A 4QRPD 3RKDD 2XI9A 4G8GE 1NBZA 1JZ5A 5EUKA 4JHWL 3MC0A 3ESUF 4PS4H 1AHWB 1DBML 3JVGA 1IJ9A 3U46A 3VA2C 4ONHA 1A9BA 2VLRA 3SDCA 4WIQA 4J8RB 3BN3B 1MCJA 2XN9E 5D96B 1XZ0A 2P5WA 3DSFH 5C0BE 4PLJC 2AI0L 1QYGL 3T0EA 1OW0A 4XWGH 4PUBH 2PF6A 5DF0A 2C4XA 3BIKB 4L4TA 5KTEL 4JVPA 1CDYA 4R7DA 3T4YA 4JFQA 5KSBF 1A7RH 3G6JA 1S5IL 3C8DA 2ITCB 5FGBA 5BMFL 2IG2H 1A5FH 3TBVA 5HDQL 2R1YA 2Z31B 3L7EB 3EYVB 3E2HB 4TVPE 4RFNC 3X3GL 4S2SB 1VEPA 1QLFA 4Q74A 3MMEB 4HS3A 5D93C 1UXSA 4V1DA 5HD8C 5FYKE 5GRJL 2XQBH 1ACZA 3HNSH 3U0TB 1ZHLA 1AGBA 4R97C 4HS8L 2NTFA 1N0XL 1Y6KR 4YPGB 5HGGS 5HGHB 3TZVC 3MNZA 3V0AC 2WNGA 5C0EB 4PB9H 1OQOA 1C1EH 5I18L 3TO4B 2K9UA 4OIAA 4MB5A 3DO7A 5FKAB 1N6QH 2H6PB 3BPOC 4G7YL 1QQDB 3NACH 4GRMB 4LMQI 2D7OA 3OZ9H 4YAQA 3QHZL 3SPVA 1NFIB 1O7SA 5HYSG 4IHOA 5T5FH 2DQFA 2A6IA 3KXFD 2F54A 4MB3A 2FHFA 5DD5H 4FTVE 2VUOA 5DT1H 5D5MB 4AG4H 4FP8L 2EH8H 2DM3A 3N1GC 4FFZL 4JG0H 5GGTA 5EWIL 2X1XR 1E4KA 4PJ8B 1OTUC 1AKJB 4PP1C 1FGNL 2OS7A 1MJ8H 1KC5H 1KJ2B 1UQSB 4X5WB 3FO2B 3LD8B 4JRXA 1AR1D 4X8JA 2X4QB 4G6FD 3QDHA 4LQ1A 3T0EC 2DWDA 4JHBA 5CD5C 1JK8A 2AEPH 1SBSL 4POUB 3EHBD 5GXBB 4P4KC 4YHLH 4HK0B 3CFBB 3PWLB 5EZJB 3K8LA 3S35X 2VXUL 4BK5A 5EB9A 5T3ZE 3TZVD 2FWOB 3S37X 1A2YB 5E8OB 3QNXB 3B4NA 2GAZA 4WHTB 3VWKC 2R56L 3QCVH 2AXGA 2R29H 3SDDB 1TVHB 3MRJB 2X4NB 3CSYA 2IWGA 3RDTA 1YUHA 4KUZH 1JGLH 2AERT 1ZLVH 3ROOB 1E4XL 1GGIL 5E9DB 2NY6C 4OCSL 4DGYL 4BUHA 4U1IB 4PRIA 2NXYC 1J0KA 5IB5B 4DK3A 2X7LB 5D1XA 3VI4E 4L8CB 4C56E 3REVB 3QA3A 4ZSOE 3PDOB 3ROLA 4NKMA 2R4SH 4PJBE 4FQQB 3GMPA 2HLAA 1OM3L 2Z4QB 4RIRA 1CDBA 3GMLB 4ONGH 4KWUA 2C1OB 4U0RB 1J9CT 1ORQB 4OCRL 1LK2A 1A7OL 5D2NE 4XP1H 3O6MH 5C2UB 4ZQKA 1AGCB 1Y6MR 5KJRL 3RWHA 5D7IB 4XCNA 5FOBB 1RUAH 1DR9A 3RAJH 3L3KA 4XNQA 2G75A 4CVUA 3HNVH 4ZFZA 4EI5A 3O8XB 3EHBC 3UAJC 5CEXA 2HVJB 4BK4A 5KW9L 1HYRC 3G5VB 1FL3A 5KZCD 4KTEL 3O3AB 4YHYC 1N2RA 4K94C 3IFPA 3X13B 3O41B 1I1AA 1U8QA 4XCEB 4QLRA 3BDXA 2GSIB 2ADFH 3BESR 4RDQF 4NZRH 5IHZB 3R1GH 3TZVA 3W0WE 2IAMA 5TQ0L 3CX5J 1KB5H 5CZXD 5HVHC 1LNUA 3LIZL 5KOVC 5CLTA 4FZEH 3D18B 4ZUVB 3OTTA 1KPRA 5T1LA 1N5YH 2UYLA 3NCJL 5C0JB 1I3GH 5F9JA 2UVEA 3LEXB 1KIPA 5JXAL 2YMXH 5LXGL 5ALCL 4HIIB 2PW2A 3EFDH 5C0DB 1YNKL 4JJ5A 3QUXB 4PRPA 1YEKL 3MRBA 1EJ6A 3FL7A 2VIRA 4A6YB 3WDHA 4CMMB 4RWYL 4U6YB 5IJKC 4L8BA 2C3XA 4HGMA 3OZ9L 2FEEL 3SDAC 4KQ4H 3FT3B 4R3SB 3HI5L 4H26A 4QHUA 5TDNA 2B0SL 1M6OB 1S9XA 2LU7A 1GAFL 4IRJD 4PGBB 4BH7B 1T89C 1JVKA 4IOIB 4K7PL 3UPRA 1LP9E 2OYPA 4XNYL 3LV3A 4FOMA 4PJDB 2B1HH 3P4MB 1A3RL 1NBYB 3CVHL 5CILL 2MNUA 5GRUL 1ADQA 4G80B 4O4YL 2JIXB 2NNAA 1YN6B 4UUJB 3N50A 4N5EC 5EZLB 3TPKA 1S5HB 4LPXA 3HC0A 2VZSA 4YDKH 1F6FB 4H5SB 3BUTA 1Q0XL 1K5NB 3SKMB 3FT4B 3QIBB 4JFEB 1G9NL 3MUHL 4HKBA 1IM9A 2WBWB 4XPTH 3STLA 1AJ7H 4KKAC 5JZ7D 3TBYB 1N26A 1PYWA 5E99H 1I1AC 3DUHA 4FA8A 1BPVA 5ENWB 2HJLA 4F3FB 5CBAB 3QWOA 1FLRL 3WLBB 1SEBA 5DC9B 5L8JB 5FGSA 4TUKL 3W0WB 4X80H 4O51B 3LPFA 3KS0H 5C0BB 4TUJA 4OKDA 1CF8L 1XIWA 4M48L 1QFWM 2A9NH 3VXUE 1E4XH 1GGIH 1X6NA 1OAUH 4XXDA 4I3RL 4LVOC 3WS6C 5E1AA 1U6AL 2V7HB 4Q9CA 2C1PA 3MRGA 4Z7NE 4KJYA 3NA4A 2EDJA 1OAKL 2E7MA 1AY1L 4Z0BH 5ETUA 3TVMA 2FL5A 2X6MA 3HS0A 3MUY1 3V4PL 2FIKB 3I6LD 3MBEC 4PJGA 1F4HA 2CUMA 2ARJA 4I3GA 3QH3A 3QNYB 3EOBA 5D7IE 3E3QC 3EO1A 1J86A 5D1QD 4Y4HC 4MAUL 2I07A 3W9DA 1I9RL 2AAVA 4KROC 4NQED 1KACB 1QSED 2CKBH 3HG1D 4ODHL 4XVTH 2VXVH 1P7QD 2EXYD 3D48R 2WANA 1CT8B 1GH7A 4L9DA 4OFYD 3BFOA 5D7LB 2AABH 1NGPH 4E41A 1MCQA 5EO1B 3RKPA 1RZ8A 1TVBA 1HEZB 2BHUA 2Q76A 2EYRA 4C59B 1BJMA 3U0PB 3P0VH 4YZFF 1INEL 1FRGH 3T0AA 3MGAA 3IKCB 2RGSA 1FFOA 4R4FL 3D25B 1S7RA 4OKVA 5D1ZC 2XY2A 4JDZB 5GSVA 4DKEH 2YD8A 2IH3B 3FQNA 3MRDB 4M7ZB 3MV7A 2X4RA 4RQQB 1OCWL 4OCXH 1NDGB 1NC2A 3BXNB 4K9EL 1FJ1A 3B6SB 7CGTA 4NIKB 3GIVA 5DSCB 4FFWD 4JRYD 4YHMH 1JHKH 1J11A 3BQUA 2BNQA 4FABH 4NT6B 1ZANL 3FOMB 4NCC2 1FVEB 4MD0A 4JM2B 4QRRD 2VYRE 1IC7L 2HFFB 3TVMD 1I8LA 3K46A 3ZE2F 3FFCE 4Z7UA 1MREH 4PRBB 4U6XA 5LAXA 5CZKA 4XPHH 1HHIA 2XPGA 3D2UD 4MNQA 4DZBA 1BVKA 1ONQA 2FX8H 2XN9B 2ED9A 3FCTB 2QHRL 5BRZB 3WIIL 4KHXH 2E6JA 1A0QL 4DFHA 4CUCA 1CDHA 3ZSSA 1S9VA 2BVOB 1ZHBA 4GRWH 2GYSA 4FQCL 2XA3A 2F5BH 5JW4N 1QR1B 1DLHA 2LQRA 4F80A 1BFVH 35C8L 3K4ZA 5DRXB 1JGUH 4JO3H 1GHFH 2X9XA 1FFPA 2KQNA 4NN7B 1KG0A 4PY8I 5JW5B 4LOUC 1IKFH 1X5GA 3CMOH 4X98A 3VFGL 3KPNA 3QO1A 5E8EB 4PJ7E 4YR6A 1KEMH 4HUXA 3F5WA 1DDHA 1IKNC 4ZYKA 1EFXB 5A16B 1HQ4B 1UADC 3FOLB 1WSST 5CJOL 1FPTL 2XZAH 1JZ6A 5D2LB 1G7QA 4KKBD 1Y18B 3IDNA 4Z8FH 3GSWA 4IIQB 4AEHL 3BEVB 4FMFA 5IJKA 4LCWA 1D9KB 3SKJL 1U3HB 4OD1L 4XPAL 1CGSL 4P5TA 3MRMB 2MCPL 2N1KA 1LEKB 3MLZL 4JO4H 3LKNA 5IF0A 5HGBA 1JGEA 3IYLW 5E9DD 3JUYA 4P48A 3OKYA 1FZJB 1I1CA 5LBSH 2NY1C 5DZLA 4CU7A 5HHPA 2EYTB 4OJFL 4AL8L 4Q0XL 1A6WL 4X4XB 3H8NA 3B9KD 4OM1H 3BVNA 2F53B 5ID0B 3LKOB 32C2B 1UWEL 3OAYK 3WN5B 4PBXA 4TNVK 3UTTE 4ODXB 4QKXB 4OFDA 5DT1L 5FYJU 2EKJA 2IALB 5H2BA 2DQCL 4KK9D 1YJDH 2J88H 5TH2B 1OWRM 4W4OC 3M1BA 4Z7UF 4W70A 3B9KA 1G7JA 2OR9H 1R3IH 5AYUL 1JZ8A 1FCCA 1FQ9C 3HAEG 3HB3D 4M7KL 1HXMB 4EI5C 4RNRA 3PG2A 4Y4FC 2AEPL 1VERA 1V7NL 5JDJA 4LPWA 2VXUH 2VQTA 3O4LD 4UDUA 4OCNC 2X4UB 3PV6B 5E8NA 3LQAH 4M1DH 2Z31C 3VFUB 3BI9X 2FX7L 1VACB 4YHPB 1B2WH 3P77A 2YZ1A 4NQCB 1I4FA 1V7ML 1F3RB 3QIWA 3QXUA 2F54D 3D9AL 1DQJA 2YBRA 1SYVB 1EHNA 4ZO7A 3T0DA 2EZ0D 3LQMA 5JHDB 5EZOH 5JORA 4S1QL 3FN3A 1X5HA 2AEIT 3MRLB 5AAMA 3E8UH 1A7QL 2BOCA 3QHZH 4O5LL 5HYQA 4GRWF 3W2DH 1F4WL 1S3KL 2I60L 2H8PB 5ICZB 3HE6B 3NBNA 2VZUA 3SO5A 5DXWA 3AU1B 1UWGH 4X7FC 2WSKA 1IGMH 4F2MB 2XA8L 4D9LH 1JI2A 4J1UB 3RZCA 4KK9C 1U42A 4IIQC 3VFNA 4HF5H 4PRNA 1NL0L 4FP8H 5I1AA 3K1KC 5DJ2B 5ICXA 3CH8A 3GB7A 2DLEA 4TSCL 3O6ML 2Y72A 1AO7A 2Z91A 1M05B 5E5UB 3RWCB 3F7VB 1WAAF 5DO2C 5IBLC 1IGJA 1CDCA 1P1ZB 4TRPH 5BV7L 1G7HA 3ISWA 4KFZC 4XP9H 1M71A 1XGPA 3OG4B 5CGMA 2DQEH 3WFEH 1GJIA 2FDBP 2H2PD 1CE6B 1W72L 2PKDA 2PO6D 1CFQB 4J4PA 3OAZH 3U1SL 4E42B 4U6VH 3EGSB 2YC1B 4YH6A 3SCMC 4M4PA 3F7QA 3KPLA 2OQJA 4GRLD 4EKXA 2YD7A 1OP9A 2F58H 1TJIH 1F6AB 4NRZB 3SY0B 2DQIH 2F8XC 4XHQA 1JPSL 4L4TD 1O0VA 4LIQH 5KVGH 4QOKD 2XZQH 4P4KB 4PJ7A 3STZA 3BP6B 4I2XB 1FL6A 3LS4H 3CU7A 1HHGA 4L4VE 1MQKL 1WFOA 4HGWB 3F7YB 3OPZH 5D1ZB 3CIQA 1MIMH 5E2VL 5I8EA 5FB8A 1U3ZA 3HKFA 2MCPH 4OZHA 1NKOA 1L7TL 1JTPA 1FGNH 5CJQL 4HJJH 1OM3H 4I18C 1KCUH 2VE6A 4JRYA 2I5YL 4M6OH 5BZDB 4QEGA 5B8CC 3JV6A 2IF7A 3C60D 3S5LA 5MENE 2HKFH 2F8VA 1HINH 4PPTA 4QCIB 1JPFA 5HGDA 2VLKE 2R23B 4RFOL 2RHEA 4UTAL 3LKSB 4GBXA 3TT1L 1UZ8B 4DJMA 3PABB 1KT2B 3LHPL 1MRDL 4ZDHB 2NW3A 1HWGB 4NKIH 2YK1H 4GMTL 1OB1B 1X5YA 2IPKB 1QRNA 2IANA 2YA1A 1DBJH 5D5MA 3S5LG 3CVHH 4TN9A 4R4ND 3U4BH 2QADD 4X6DA 4RFEB 1RULL 4PJEA 4XNZC 5GGVY 1JGLL 3UJJL 1RK1B 4ZTPL 3RGHA 4FQ2H 3T3ME 3V0VA 1C5BL 3HE6C 3MCKB 1DEEB 2E27H 1CFTB 3BWAA 3BKMH 5DQJA 5LCVL 4OGYL 3JWOH 3W39B 2XTLA 3EBAA 4PRPD 4ZFGL 5J6HA 5D7KD 1MSPA 3ARVA 1UM6L 4NUJA 3A6OA 1JRHI 2XXCB 1A2YA 5AZEL 4LASH 5IB3A 1LP9F 3EFFA 1TZIB 3VG0H 4CJ0A 5JZ7C 3UJIL 4I0PC 2WINA 3GRWH 4Q9BA 4K8RL 3RX5A 4P23C 3VMNA 3FRPA 1RJZB 1V7MH 3VWJB 5DURD 3EDFA 5DMIH 3UZQA 5DRWA 3K4DA 1U8PA 3VXMA 3CC5B 4Y0GA 4LLMB 3U2SA 3TCLB 2GT9B 1J10A 2PW1B 1G9EA 2NLJA 1LEIB 1R3JA 1P9MC 1MRCL 5DJAA 3AM8A 4JRXE 1BQLH 2DN7A 4JPVH 4JY4A 3QPXL 3FO0L 1IGTB 3V6FA 4NHUB 2D0HA 5CMAA 1BFSA 4IDLA 1DBKH 1HCFX 1EHLL 3HA0A 4HF5L 5JLZA 4DWHA 1E27A 3LIZH 1YEFL 3HE7D 5T3ZL 1J8HE 4HMCA 4Z76A 2K7QA 2OJEB 5T3XL 4R9HA 4HFUL 1IAIM 2OLDA 4QRTA 3GBLA 3MRCB 4DOHB 4NQXB 1A1NA 5C8JB 1G9ML 2HRPL 1BF8A 4HFWA 2Z35B 4TOYH 1Q0XH 5LG1A 4N0FB 2R8SL 4NWUL 2UUDK 2CGRL 2OM5A 4H1LH 1CE1L 3M45A 4JHAL 4U1NB 4ZUUB 2GUOA 4G8GA 4O2CB 4KJQC 1QP1A 3QEQB 3JWDC 3ZHKA 4WFHD 4MDJB 1BM3L 4K8RD 3IDJB 1VEMA 1OGAA 3DROB 4G6ML 4JQXA 1JTTA 4N1CA 2ATPB 2F58L 2P5WE 3FQRB 3O6KL 4MNGB 1LNUB 1D9KC 2FEDC 2WWKT 5ESVB 1MHEB 4YHML 4M6AA 2FJGA 3PHSA 4QHLA 4RBPK 3JTTB 1A7NL 3BIAX 3AXLA 3NIGF 4OZFG 2JK5B 3QFJA 5TDOA 3TIDB 4ZOAA 4YWGL 2ENSA 1NCCH 4S1RH 5GRUH 2VLJD 1T0NA 4WUUA 2FJFB 1BD2D 4PBWD 1KN4H 3IJHA 1MREL 1S7TB 4M9OA 3MRBB 1X5IA 4WRLA 5CJQH 1I3UA 5HDBE 1NAMA 3OGCA 1XGYL 4YDIH 4F15B 1NCBL 4OZFA 3QO0A 3ILQC 1AI1H 3MYJA 2HVKA 1ED3A 3GHEL 3QDMA 4LCIH 4XPFH 5GIRA 2AK1H 2GJ6D 2VXVL 1MCEA 1WIUA 4ODSH 4N90E 4YK4B 1MUJB 5E2TH 1KIRA 3TT1H 4XP5L 4IOSD 3DIFB 2B39A 3HE7B 4PJIF 3V8OA 1GYAA 4PJHF 1X3DA 4HIHB 1EFQA 3ZT6A 3ZYZA 4AEEA 1TQBC 1OAXH 1P5VA 4OF8A 4MJIE 1MFBL 3QNZA 1MFEH 5ALBL 3UJJH 3JBG7 5BO1L 2QSQA 3O3DB 5E2JA 3BZ4A 4HKJB 4LSVH 2FEDD 3UC0H 4NSKB 4NQEB 2WUBL 3RL1A 3TBWA 4JZOB 5IWLC 3OB8A 3FB8A 5EG6C 3BAEH 1KJ2H 4UV4H 1PG7X 2MMXA 3NA9L 2E7LC 2AW2A 4HKBB 3V4PH 3CNKA 4L4JA 1JGDB 3FFCD 1A9BB 4A2LA 3OXSA 4KI5C 3Q48A 5EBLA 1G6RH 4F8QA 1HIMH 1XZ0B 2P5WB 2YD4A 1KLGA 3SGEI 1RVFH 1NCDH 3A67L 1J5OL 4MQ7B 5EULV 2APWA 25C8L 5D7JD 4S1DC 2NY4D 2C7UB 3EO9H 5ANMB 4ELKB 3SKOA 4NNYA 4U1HA 2EDDA 1CFVH 3VMPA 4U1SA 5E5RB 4LPCA 2C1PB 3MRGB 4MXWL 5E6IC 1TZGH 4K3JL 5FCSH 3VWKB 2Z31A 2EEAA 3UTPE 1CFBA 1U8HB 4MJ5B 3OJ2C 1LE9A 3QDJA 3RTQB 4UAOC 2DJSA 4HZLB 5ERWB 1TVDA 1FG9C 4MA7L 1TJGL 3T3PE 2OTWB 4P57A 1TCMA 5K9JL 5T3XH 2NTFB 1HDMB 3BWUC 3DXAD 5DMKB 4QHKI 4LSDA 1VPOH 4GBXD 3HPLA 5IV2A 4DVBA 4E0RA 5ADOL 1H5BB 3UXFA 2NX5B 4HSQA 2ATKB 3TO4D 5TFSL 1J05B 4O02L 1QRND 3VH8B 3FB6B 2XKSA 3FQXA 5J89A 2RAMA 4TNWF 4R6UA 3WDJA 5GSVB 4YK4C 4YAQB 3MOQA 2NR6D 4AIZB 2ADGA 2P42B 5DK2B 1EAJA 1RJYB 2QL1A 5BS0A 4KV5F 5TPWH 1A6TA 3KAAA 4UB0L 5D7JC 5KAQG 2Q20A 3TA3D 4D9RD 2UVFA 4GW1B 1G7PB 4L3CB 1RI8A 4ELMF 4FQIL 3NGBB 3P2TA 5D2NB 3I75B 5BQ7A 1HH9A 1U8OB 3WIHL 4YHYB 4PJ8A 2P48B 1A6WH 2HT3C 5IESH 3E8UL 3RBSA 3IRZA 1JMXA 3ALXA 5EFIA 4HH9A 2ZJSL 3MLWH 4U2ZA 2X70A 5C92A 3SGKA 4OZGF 3FO2A 5INDB 1SJEB 1P84J 3FQTA 1RAMA 4MSWB 3RGVC 3WFDL 4U6XB 5LAXB 4OGXH 4HUUA 1CL7L 4YFEA 5HPMA 5DUMH 1C12B 1KEML 4WWID 1I1RA 5BRZA 2EDXA 1P7KB 1S7WB 4F58H 3PWLA 4J7RA 3PGFL 1VGEH 4I3SL 3TNNB 5I1HH 5I1IH 5IBUB 1ZE3C 4FXKB 4KZEL 3AFLA 2Q6WB 2GAZB 4PY8J 3SDXF 4OTXH 5FUOH 2L4OA 3C87A 3K0WA 1MWAH 2YD2A 2COQA 3UYOD 1NCWH 3IJYA 1DLHB 4OD1H 1PX4A 4MD5A 4ETQA 5D7SL 5FA3A 4QRPB 2BRRL 5KZCB 4P4RA 5EU3B 3ORJA 1U9KA 5GGTH 3VFMA 1MCWW 4LLQA 4PRIB 2WMPA 2IQAA 1TZHB 3NCYS 1TPXC 5TE7H 5FO7B 5E5MA 5AWNH 4D8PA 5E8EA 1E4WH 4OJFH 5CP3H 4LSVL 3UC0L 1CLYH 3L95B 1IM9D 1GIGL 5D5MF 3BO8A 2IEPA 1KBGL 5HHNA 1ZAGA 1YNTA 1TMCB 2R0KH 3DNKA 2HT3D 3PL6B 1IC5H 1FNEA 4U7KA 5DUPH 4XNXH 4TSAL 2IQ9H 3MRQB 3QPQC 3MR9A 1OGAE 1EBPA 1N4XH 2UY7A 5D7IA 3SCMA 3WKMH 5I9QC 4XHJC 2APFA 5IF0B 4R26L 2C3HA 4P2OC 5AD0B 3I2CL 1ZA3A 5DEGB 1QRKA 1LO2L 1YECH 4FQ1L 4HJJL 1CICD 5DVOA 3B9DA 1A6PA 25C8H 3O3AA 1JWMB 4OD2B 2HFGL 2XG5A 4ISVA 2CIIB 2QLVB 1QVOB 1ZLVK 1XGTB 2O61B 4E5XA 1ITBB 4JQIL 5IT2L 1T4KA 4RFOH 3O4LA 3AUVA 3DSFL 4WUUD 2DYPD 3TZVB 3MRHB 2HT2C 1ZT7A 1B6UA 4CMHC 1T5XA 3VFRB 4GMTH 5GGRA 2ERJC 2CH8A 2CLZA 3SE8H 3U79A 1RUML 4FNLH 3TC9A 4IRZH 4FFWC 3M1BB 5FDWA 2ZOLA 3B9KB 3KDMB 4GXVL 1QTYT 3A6BH 2CK0H 2DYPB 3CK0L 4HMDA 2AKRA 5J57B 4MX7A 4JY6B 4HULB 4Q2ZA 1HILB 4LLYA 4TNVF 1Q8MA 5I1LB 3ULVH 2MKWA 3IU4L 4POZC 4YDVB 4X6FB 4ZXBC 4WUKH 4Y19E 3JWOL 3QEHA 1MQ8A 2P5EE 5JOFA 2ZG3A 3PHQB 1RUKH 3B9EA 2NY3B 5C70A 1PX3A 1K6QL 4ZPVA 1I9IL 5E8NB 1AGFA 2DIJA 4AY0A 4GG6E 4JPKL 2OL3A 1D5XA 2HA1A 1GCFA 1XR8A 4ODTL 1M7DA 1WTGT 5DJ6B 3UPRB 3RWEA 1C1EL 4FQJL 3LV3B 2F5AL 1UT9A 2ZP0T 3MLUH 5I73B 3RQ3A 2WP3O 2JB6A 4G80A 3GSRA 3OKKA 1YN6A 5JHLH 4MXVE 5FCUH 1C8PA 2PXYB 4M93B 2OXHA 3U1SH 3C5ZD 1S5IH 3ARGA 4X0KA 2IPTH 2XQYG 4G6JL 1GC1H 5IW1A 1UJTA 3NFSH 3FT2A 2ED8A 1MFAH 4MZ3A 5J8OA 2NY0D 4FN0A 4UU9A 1G6VK 3PL6C 2IADB 1R0AH 4U6HB 1U36A 3C6LB 1CLOH 2HTLC 3QUYB 3U7WL 2VZ3A 4LLDB 4MGXA 4K94H 4Y88A 1K8DA 1C5BH 3WLBA 2VLJA 1A14L 2X1WL 3DX9A 3RL2B 3QDJE 3QDGB 5JDSA 1N0XH 2AK4D 3QJFB 4L4VD 2AGJL 1NLDL 1FHGA 4LEXH 1YQVH 1CFQA 1L7TH 3DX7A 5IB4A 1KTLA 4JFDD 1CVRA 1PEZA 4PJHE 1OWWA 3VGAB 1AXTH 1T89A 2QR0B 1R5VA 4NDMA 4QYOA 4JR9L 5ETUB 3TVMB 1J0IA 3UBXA 4BSVB 4F7PB 5J13B 5GGSA 2DICA 4F7TA 2X4PA 1XGRB 3JSSA 5CAYB 3KNBA 3STZB 4XNMA 4HUNB 1NCAL 1DUYB 3DTXA 4GLRH 4AMKH 4IM8A 2IPUG 5HBBA 5J11B 1A7PH 5J1AB 1X5FA 3NVQA 4W68A 2JJWA 5DD1H 2HG5A 4F57H 3DYOA 4Y16C 2KBGA 4HX1A 1KN4L 1WVZA 5HJ3A 2VAAB 3FFDB 3OJDA 1EHXA 4UILL 4X83A 1FC2D 4K23L 3UCRA 3OGOE 3GJFK 1BFTA 2F9BT 4ZXBB 1AP2A 5GZND 4OIBA 4TPRH 5HHXL 2ICWB 3ZYJA 3IKCA 3MXWH 3Q5YA 1YPZE 1OTUD 4ESKA 3SE9H 1JPFB 5HGDB 5D7LD 2D7NA 3GSXB 4MDIB 2IH3A 3S36X 4PTTA 1VFOA 4FMKA 1LVEA 3MV7B 5M95B 5I1CL 2VXSH 4YHZH 1FSKB 4XAWH 2DKUA 1QSEA 3HG1A 5CZVL 5KW9H 4HWZA 2HWZL 2O5YH 3QUMA 4I0KA 3S3JA 5BRZE 3NPSB 4XP4H 3CUPB 2A1WL 5HDBF 4HJ0D 4RMSA 3JV0A 4KUZL 2X89A 3VWKD 3NMEA 3Q3GA 3FTGB 4L8DB 2R15A 1DSFH 3PWUB 3TPUB 5I1JH 5DTFB 2JB5H 3BWAB 3G6AB 2VDRH 2X4OA 4H0HB 4EBQH 1KJ2L 2A6DB 2UWEB 4KKCC 2Y7QA 3RNQA 5D7JB 3GUTA 2C3GA 4C4KO 3F8UB 4N0CC 4AENB 3DVNB 3BZFA 3Q2CA 1BVLA 3RFZC 1U92B 4HIXH 1IAKB 3SJVE 2BVPB 5IOPB 1Q1JH 3WL9A 5DFVC 3GMNB 1KULA 5DVKA 3VFPB 1QLRA 3ARXA 5ALCH 3G5XB 3IFLH 2GCYA 3TFKD 3BRGC 2NY5C 1NMBH 5KJRH 3WSQH 2A77H 3P9WB 4YDIL 4XMPH 3MPCA 4JFED 3CFKA 3QIBD 3ALWA 1U8PB 2BZDA 5DRXA 4DOHE 4RWYH 1NQBA 1P4IL 3G08B 3QXAB 2ZG1A 4BFIA 4NN6B 1KYOJ 1UH3A 5E4EC 1A9EA 3RVXC 1EMTL 3L3DB 1GL4B 3GMRA 5EC1B 5C86A 1K4DA 1GOHA 4HWBA 2WUCH 4ZYKB 1NBVL 2W60A 4GMSL 5CGTA 4CNIB 3F6LA 3BRDA 3QZWB 1EAPA 4Y2OA 1FAIH 4P49A 2AJUH 3IDGA 4RAUA 5F44A 3GSWB 3U30B 3WIFB 2AJYL 5I8OH 3QXDA 3ARFD 1WAAE 2QTEA 5IIEB 3NCCB 4IRJB 5BS0D 2R69H 3BP5A 3GO1L 3X17A 1VB9A 1JPGA 3MNZB 2GW5A 2CR3A 3L5WA 5C0EA 4P2OA 1OPGL 1S8DB 4UV4L 4NO2A 2FJHB 4KTDL 1PKQB 3W5NA 4LKCB 1A4JB 3RA7H 4QGYA 2VLJE 3QEQA 5FYKH 5D2NC 1DUZB 4PJAB 3T65B 3BKYL 3LY6A 1QSVA 1AXIB 3SOBH 1AC0A 4LDLB 4NO3B 3PWPA 2AS5M 1JNJA 2GJ6A 2I27N 4IHOB 4G9DB 3HAEB 4FTVA 5C0ND 5CSGA 4JFPB 4DN3H 4TYUA 4H8WC 1RURH 4EN3D 1DVFB 2P5EA 1JRHH 5D72H 3QFJB 3UDWA 5H94B 4XAKE 4PJBF 3CVIL 4DGIH 4XNYH 3MCG1 1OVZA 5I66A 4S10A 4EDWL 3EZ8A 2ZSVB 4EI6B 3NFNB 2AI0H 4P2RD 4UT7H 4RCAA 3O2DH 3Q5OA 3VXNA 5I6XB 3HHRB 3HC4L 1DBBH 3QO0B 3ARED 1RHFA 4Z0XB 3V6ZB 3RZCD 4UDUB 4FTVD 1KEGL 3LB6C 3IDYC 3RJDA 3C5JB 4HDIA 4OCWH 3BD5A 3QNXA 1IQWH 3KPTA 1U8MA 1F13A 1QSZA 3PGDA 1T3FB 4XBEH 3S4SA 3ZDYE 4HIHA 2X4NA 3CSYB 2NY7H 4O02H 2HWZH 5F1NB 3BHBB 5CGYC 3C08L 2AXFB 4P23D 1QFUH 1HOCA 4PG9B 4XTRC 3QIWD 2A1WH 1H3XA 1QSEE 3HG1E 5JIHA 3DGCR 3G04A 4ZSOA 5TE7L 2YD9A 5K59E 3RJQB 3VXTB 5EPMA 2EECA 4LAJH 1DBMH 1KPUB 4NSKA 1OCWH 2KQMA 3RL1B 3TBWB 4UB0H 4M5YL 5C0FB 5E4IA 4DN4L 1KBGH 2D7QA 1JNHA 4RIRB 4G6AD 1R5WB 1SVZA 1DANT 5AZ2H 1JGDA 4IRJC 5I1AB 4HC1A 2NQCA 4U0RC 1B0RB 3WKNA 1RZIB 3MRPB 2BNRE 1G6RB 3S37H 2Z91B 5C09B 5ESAB 4GKNB 1YYML 5L2KD 2DF3A 2G75B 2ZWLT 4RAVB 5GGVH 5ACZA 3NFPB 3MJ7A 2BK8A 4ZUTA 2FR4A 4DK6A 4MMXC 1SY6L 1CE6A 4Y4HD 2AABL 4PJGF 1F6LL 3OKOA 4Z18A 3VXSE 3H2WA 1P4IH 4AIOA 3SO3B 3OKDA 1ZT1A 3FRUB 2IAMD 2VLME 3MNVB 4KQ3L 1UACH 2AP2A 4MJ5A 2LU3A 1F6AA 3KPRA 1X9QA 3MV8E 4GSDL 3BOVA 5GSRB 3QULA 2F5BL 1DZBA 1YEEH 5INCA 1DE4A 1ZA6A 1ERNA 1R5IB 3D18A 1FL6B 1KPRB 5T1LB 3KS0J 3ARZA 1HNFA 1WFTA 3F7YA 5F9JB 5JR1H 4GXVH 5MENB 3UROR 1LE5A 1J0HA 2L7UA 3WIHH 1HNGA 4G7YH 3JWNC 5HYSA 5IHUH 2BERA 5I6XC 3MV7D 1H9VA 1OGTA 1EXUB 2BP3A 4XGZB 6FABH 4JJ5B 1FDLH 4JCMA 5BV7C 2VIRB 3HFML 1CICA 2OP4L 1IC5L 5DJ8A 4Z8FL 4GG6B 5CUSL 1BAFL 4Y8AA 4MNHB 1J1PH 3ARBA 5B3NA 4NM4L 3ILQD 4QHKJ 5KANI 1N4XL 2B4CL 1Q72L 2MKLC 4WTWA 4ONHB 5TDPA 5JOPE 5IWLA 3L3OA 4XT1C 4Y5VC 1CXKA 3UJTH 2IFFL 4L3CA 4FQJH 3QYCA 3WLWD 4PBVC 1K8IA 3EIFA 3IJSB 1NGYB 5DJDA 3V4VL 1IFHL 4WV1A 2VERN 3BIKA 3CVIH 4L4TB 2BNUB 2BRRH 1RIHL 5EZLA 3EYUL 3U0WL 5IHBA 4JZJA 3VD7A 2CO7B 5DWUL 3TIEA 1GZPB 1DEEA 4ODWB 5HPMB 2B4CC 5D2LF 4HWBL 2P24A 3SE8L 2PO6B 4JFEA 4DZ8B 1RZJL 4JQVA 4GAYA 1GIGH 4HLJA 3QCUL 4OBRA 4U1KB 2CKBB 2KL6A 2CK0L 3ARYA 2CLVB 3F7PC 1MJUH 3EYFA 2FH6A 1MI5B 4GW5B 1ZHLB 4WTXA 5F6HI 2WINB 1IGIL 3MJ9L 3QUYD 2CO6B 2XZCL 2DI8A 4JB9L 3WKML 4O51A 4HBQA 1ZVSB 3B2VH 4Q6YA 3ET9F 3DHJA 4OQTH 5K59F 1GZQA 5DRWB 4J3UA 5EZIH 4W6XB 3T0ED 4AEFA 1IEAA 5JOPD 2P8PA 5E5MB 3QDME 1G7MB 4Y16A 1AGEA 5JHDE 5IMKA 4D0DB 2BNQE 1JTOA 2MHAB 1AH1A 2FIKA 3SPVB 2ARJB 4AJ0A 2G5RA 2BSSB 3G5YA 2P8MB 1UXSB 4PJXB 1XCQA 5HHMB 2FHCA 3K1DA 3EZJB 2ZCHH 2EKSB 3GKZA 1GGUA 4NQSB 1CGXA 3SCMB 3MRCA 2QBWA 2Y07L 1FO0L 2OSLB 3MRIB 2NXYD 2DQUL 4L29A 4J4PC 1RZ8B 4MJ6A 4Y16D 5F1OB 15C8L 3SJVB 1IGML 4JFHD 3PP4H 3RIFK 5I16B 5I1DB 2GUOB 3R06B 4WEUD 4WU5B 5ELIA 9CGTA 1U0QA 3VGEA 2GK0B 5H8DA 4I9WE 5T3XE 2BX5A 3KJ4C 1OGAB 4K94L 3TT3H 1T2XA 3NCJH 3UP1A 1NDGA 2JELL 1ZT7B 4YHZL 1XF2B 2L0DA 5E8OA 3FO1B 2BXZA 3MBXL 1PSKL 2OZ4L 3QCTH 3GHBL 2FECI 1QNZL 3EFDL 5KANG 1B2WL 3UMTA 3UZVB 1GGBL 1LHZA 2G9HB 2MQ0A 1JHLL 1JV5A 4Z7VE 4CW1A 5DLMH 3UO1H 5I17B 1RSFA 1XGUB 2D7TH 4NNXA 1P84K 1VADA 2DQHH 1KUMA 2D9CA 2ZSWB 2OI9B 1ADQL 4DUVA 4WI8A 4MNQE 4RDQG 4UZGA 1J87A 4X6FA 4YHOH 1B88A 5IR1B 3EJJX 3L5JA 1CGUA 3ROLB 3TN0C 3FRPG 1WC7A 3ULVD 4YGVB 1MRFL 2CR6A 4KZDH 4C56D 1AGFB 3G6JE 4ZS6C 3MBEA 2H3NA 2FYYB 4C57C 4NHCH 5E2VH 1LK2B 1S9VB 3MSPA 4QRRE 4Z0BL 5J13C 3UTSB 4IJ3B 5FO8A 3VXPA 3BEWB 5E6IA 2P46B 5IEHA 3MXVH 4OZ4B 5J4MA 3LSOB 4L9LB 4C4KT 1D5ZB 3MOBH 2FB4H 4XVJH 3GRWA 1DANU 4RFNB 1ZS8A 4UTBL 5FHBL 1E6OL 4KMTH 2ICWI 3QNZB 3KLDA 2ESVE 3G5VA 1TTFA 3KLHD 1IGCH 1QA9B 4J23A 4XVTL 5JW5A 5IB5A 4OLWH 3PQYD 2OMNA 3CXDH 3O9WB 3REVA 1BJ1J 5DWUH 2X44D 4JZOA 1NAML 4LLUB 3D85A 3KJ6H 5EIQA 5BVJB 5E99L 5HI3C 1OP5K 3FMGL 3GMPB 4PRID 5IHZA 4Y19A 5FEBA 3EYQD 4LCWE 5L2JA 3GMLA 5F89B 4CKVX 1FZOA 2DQIL 4NN5B 4R96A 1IGYB 3GSNH 1CLCA 4XP6H 3ECBA 5B8CA 5GS1C 1FH5H 1NC4D 4FQXD 5TGBB 4M3KB 1WT5A 4GKZA 4P3DB 1X5JA 3ARFC 2PCPB 1KJ3H 4NQDE 4DAGL 4LVEA 5AAWA 1SJXA 4FXLA 2Z93A 5BJTA 4LU5L 3BKML 4JPIA 4JKLA 1FZJA 1WFUA 2WWKO 5LGJB 1WLHA 4NNPH 4UILH 5AUMB 1F97A 5FV2A 1B9ZA 2E9WA 5A43C 5SX4H 5LQBL 3ZDZE 1QBMH 1NGWB 3O41A 4A6YA 1E4KC 5C2BH 4CU8A 1KCSL 4QYOB 1EO5A 2UV3A 4F7PA 3ULSA 1RU9H 2DS4A 2IAMB 3BVNB 4OZGA 3DMMA 1VHPA 2BXYA 1I1AD 1Q9LB 1ZK9A 4XRCB 4NC1C 3VH8G 3MGTB 1J7VR 4PGZA 5E03A 5H2BB 4D3CH 4ZUVA 4CVZA 5F7UA 4ZAKD 5T1KD 5EC2A 4NO0D 1HDMA 4KK6C 2EDFA 1BX2B 1SJVA 2DQJH 5L2KB 4UDTA 5FGRA 1RULH 3HPLB 5IV2B 4G5ZH 2DMKA 2OZ4A 2CDFA 4G8EB 1I7TB 2J6EA 1BWMA 1OTSD 2IBGA 5IVZB 1EZVX 1J05A 3VH8A 1HK6A 1S7XA 4OF0A 2JB5L 1FVCB 3K7UA 4OLYH 1HYSD 4XVUC 4POZD 4NQDD 4R8WL 2XZZA 3SKMA 5ISZE 1S9YB 4FABL 3AREC 4OCWL 3DHMA 2A2QT 1AE6H 3KYKL 3PJSA 3STLB 1D5BA 4MQXC 2H26A 3CJJA 4FFYH 4HEPG 4IRSB 1PYWB 5CZXC 4EUPH 2QSCH 4CJ1A 3WNKA 1DTUA 5CWSB 1MFDH 5GRVL 3U36A 3CFEB 5FO9A 1FPTH 2OTPA 3JV5A 4JQVC 1SYVA 3QI9C 4WFED 2BVEA 4M7JL 3WSQL 1GOFA 5GISH 4ZO9A 3RPKA 3EYSL 1N64L 3CH1A 5EFIB 4GAGH 1RZJC 4H88H 4H1LG 1R3LB 3P73A 4P5MB 2BMKB 4X7CC 5GZOD 3W81A 3B5TA 2PN5A 3P9MA 4H5SA 4XWOC 5CP7A 4ZFOB 2XT1B 3VMOA 4NZUH 2NTSP 3I9GH 1ZGLB 5LBSL 4J1UA 2FL5B 4S0SD 3RZCB 3EYVA 5SV4A 4CAGA 4ZFOL 3FB5A 5EOCJ 1AD9A 2NXZB 5DJ2A 1OHQA 1QLFB 4G6AC 1Q9KB 1J0ZA 4P2RE 5DQDL 1WT5C 1AO7B 4KMLB 4V1DB 1M05A 3RWCA 5IOPA 1NCCL 2QKIA 5KVEL 1IMHC 1UYWH 3UTQB 2PTVA 3HN3A 2P5WD 1BOGB 1KSRA 2GI7A 5GJSH 4U1MA 2E6PA 3D5OF 2X1OA 3W0WA 4MD5B 4WWKA 1UM5H 4APQB 1DQML 3M17B 4QRRA 1TVBB 1H5BC 3G08A 3GZKA 3QXAA 4TOYL 3ULVF 5IFJA 4PP2B 4DVRH 3LKQA 3LMJL 5AEAA 5DYOA 2CJUH 4KI5F 3O3UN 4YEEA 5EOCH 3WDIA 2VLRD 3SDCD 4OLWL 1NC2D 3C2SA 3HZVB 1CDUA 1OQXA 5SWZA 1LO5B 4I9WD 4XP5H 4I13B 3U30C 1NFIA 4P9ML 3BKCL 3LRGA 1YEEL 3QH3B 4AEIL 3PUCA 4LARH 2GTZB 1NFDA 2FGWH 5ECJE 2W65B 2ZOKA 3DV4B 2AJVL 3R8BB 1MFEL 1JRHL 4DKFH 1KXTB 1JE6A 2DWEB 4XWOD 2YPLB 2CLRA 5GRZA 4OD3L 3ZL4H 2H32H 4M5YH 2ENYA 3L5WB 3KVQA 2WUBH 1DL7H 4L3ED 5EO1A 4S1RL 4Y4FB 3ARFB 5AZ2L 3KR3L 4O58H 2DI9A 1A4JA 4XB7A 5E00A 3IT8D 3RWGB 4HWUA 4PGDB 1Q9WB 1M4KA 2G2RA 2DWDB 3WD5H 1QVOA 4DZBB 4FG6D 5JW3H 1QBML 3CGTA 4F8TA 2ADIA 3PWPB 4I5BA 1T4KB 1YYMH 5M94B 5DC4B 3MCLL 3MX0A 3O0RL 5GRVK 3HAEA 2EDEA 3RUGB 3PABA 5F9WB 1P2CA 4IRSC 3KYOB 4Y2DC 3VXME 5GGQH 4D9LL 1Z2KA 2BCKB 3C8HA 4PJBB 3GIZL 3AS3A 4OF7A 3DSNA 2JCCF 1IFHH 3RDTB 4OV5A 2R4RL 1P4BL 5CINH 1B4JH 5KS9A 2CK2A 3WNLA 3QUZA 4GRLA 3V5KB 3MREB 4U7MA 1H0DB 3I50H 1HILA 2X4TA 1EUTA 1RHHB 4IJ3C 1CN4A 1U8NB 2DQEL 5F8QC 4OCYH 1ONQB 1DDHB 3FCTA 4UINH 5DS8A 3S7GA 1BEYH 1HXYA 2C5DC 4ODVL 2I25N 4W4NA 5IGXL 5JNYB 1U3HC 2VOTA 5F7WC 3UTOA 4IBLT 1AE6L 3KYKH 5ITFA 1RK0B 3S37L 1IC1A 1U3HA 3MFFB 2I60H 1TQCC 5CCKL 4XNQB 5HGBB 1PD6A 4OLXL 4MQSB 1V3KA 1UWGL 4N68A 4U05A 4MS8D 4LHUD 1ZHNA 3LH2H 2EIBA 2GT9A 2HLFC 4P5TD 2F74B 1IC4L 1OT2A 5A2IH 5ITBH 3QG7H 4TSCH 1U8QB 3DVGA 3QUZC 1G1CA 3JZ7A 4KHTL 1ZWIB 3P0YL 4Y5VA 3EW3B 1KB5B 5A16A 5IW1B 3D3VE 4NHUA 2V17L 2GJJA 3NCFB 2GFBB 3UDWC 1ZSDB 5DRZB 4F33B 2YA0A 4TRPL 5BV7H 2QQNL 5IJVB 4XWGL 1CR9L 5D2LA 1EO7A 3MRPA 3CU1A 4JKPL 4Z7QF 5CHNA 1U8IB 1MJ7H 1RUQH 5C08B 4LDEB 3WFEL 5BOZG 4Z6AT 3OKMB 1DQLH 2IALA 3FQUB 3EO0B 5D1XD 4RMVA 1PG7W 3H3BC 4P46B 4LCUB 2R1XA 3SE3C 1NMAH 3I6KB 1JGEB 1IZJA 2BY1A 2D3VA 4N0FA 5IHUL 4YHKL 4PV9B 1DBJL 4HIIA 1KTDB 3DX7B 5IB4B 1RIVH 2PYFA 1BLNA 5EBGA 3WS3A 1NUDA 3ALPA 1JZ4A 1E0OB 4LLVB 4Z7WE 3OX8B 3DRQA 3LN5A 3UTSE 3BMVA 1R5VB 2ZUSA 4NDMB 1XF3B 3LS4L 4YO0A 1O7VA 2CMRH 1I8IB 2GTWB 1J1PL 2B5IC 3BQUC 4TTDC 1MHEA 4YHPA 5HDLA 2LFGA 2ZUYA 4ODUA 3U9PH 2MCG1 4OQTL 1YA5A 2PR4H 2ZUXA 4NFDA 1JHLH 4P3CL 3V0WL 3ZHLA 5BVPH 3KXFB 4M6OL 1NLBH 1E4WL 1N6QL 1HKLH 5HJ3B 3GRWL 1L0YA 4LCCC 4RA0C 4XC3H 2D03H 5CLWA 3DV6B 4HXAL 3L6FA 1HQRB 1NC4B 3C6LD 4L5FH 2FHBA 2F53E 5DJ8B 3NIFE 3VE0B 3BD3A 4HHAB 4FFVD 2AV1B 3N06B 3VFNB 2J1KA 3CLFH 1WAAA 4FFZH 3C2AL 4IMLA 2DQUH 4TVPD 3MACL 1ZVHA 1CGYA 43C9B 3PP4L 1TFHA 3QUMB 5J06A 5T3XD 4MA8L 4RMWA 3OKLB 5C0BA 4O00A 1H3PH 5E08H 3BIBX 2QQQA 3C9NB 2XWTA 4MWFB 1UCTA 5DHVA 3TT3L 2O5XH 3FTGA 3C5SB 1K4CB 5MP6L 1L7IH 2Z9TA 1G9MH 2HRPH 3D39E 3NCYP 2DDQL 1U58A 1A4KA 1FLTX 4NWUH 4DEPC 4PRAB 3HS0B 5EUOF 3MV9A 4PRNB 2R29L 4PJAE 5K9KA 4AENA 5DLML 2OJZL 1BEYL 2KZ1B 5FM4A 1C7TA 3EOBB 3OJMB 1N3NB 2CLVA 1BZ9A 3SDAD 2VDPH 1ADQH 1NAKL 3G5XA 1LDPH 1RZ7H 5IG7A 1S9WA 3WEXA 4YHOL 4LU5H 3WO4B 3VFTA 4TQEL 1I3VA 2B8OT 1M71B 1NEUA 1XGPB 1GVIA 2C7UA 1XIWD 3QZWG 5DR5L 1QBBA 5DD3L 3D2UA 15C8H 2XRAL 2BHZA 3LEVH 4WW2A 1T1XB 2YUVA 1PFCA 1B0GA 4XBGB 2OQJB 1S7RB 4OKVB 3WXWH 5ITBL 3QHTC 2DQDH 5ID1B 4ODTH 4G6KL 3SY0A 3BDBA 3LKSA 3DUUB 1PY9A 3IDGB 4I0PD 4QXTB 2JE8A 3W82A 2QHLA 1P69B 3O6LH 2OTWA 5E9DE 4I2XA 3CFJA 4NQSA 1RUQL 4HEME 5F7KC 5DI8A 4X5XA 5DMKA 2MOVA 1DQLL 5HSFA 3WNPA 1JPGB 5ABDE 1HI6A 4P2OB 1REIA 2D7MA 4FQHA 2H41A 3DOSA 4JDVA 4G6MH 3E1F1 4BQ6A 4Z7WF 4WFFE 4PJ8C 4O9HL 5GJTH 1FIEA 3ES6A 4LP5A 1INDL 4MNQB 4YXHL 3QEGH 1JUFA 5J6GB 1ZVYA 1PQZB 4Z5RB 1NMCB 3WFCH 4HBCH 4FQPA 5I1EL 3U46B 1A6TB 5CEZH 1LQSR 4WHCA 4FFYL 3PWNB 1VFBB 3BN9C 2CXKA 3ARUA 1C16B 1ZHBB 5DJZB 5E70A 3VW3L 4PLOB 4H20H 3WE6A 4Y5YC 3MJ8A 3RZCC 2HRLA 7FABL 1CXIA 3I75A 5BQ7B 1WICA 4DCQA 1UA6L 1CICC 4G3YL 1VA9A 3EYSH 3VRLE 3ME0A 1EBAA 3LS5L 3L3GA 4MD4A 4R7DB 2C9AA 3TBTB 1LEGA 4EI6A 1YPZF 4CVXA 5EO0B 5EBMA 2NZ9C 2J8OA 1CDIA 2DIAA 3QXTA 2NLJB 4B50A 3NCBB 5DJAB 4YJZL 4YR6B 4YE4H 3WFBH 4PTUA 5IQ7L 3O6FC 1UC6A 1IGTA 1P7KA 1Z3GL 1EFXA 5EU6A 2DM7A 1BECA 5DVNA 3O2WL 1A21A 1I8KA 1MPAH 1QFPA 2DQJL 2PUQT 1PKOA 1UJ3B 3CCHA 1I3RA 4GAJL 3LSOA 3ZKQD 2WIIB 2EEBA 2J5LC 1EUUA 5SX5H 3D3VA 5BV7B 3BHBA 5FK9A 4HFWB 3K2UH 2Z35A 2P7TB 5IM7A 2A74B 1YNLL 3VXMB 3LMJH 1H3PL 1EK3A 5I19H 3HLAB 3J8F7 1W0VA 3TA3B 3TO4A 4R2GC 3U7AA 5IVXF 4G8GB 4DKAA 5SX5K 5KVFH 1A22B 4QHNA 3V6OE 3VA6A 2FATH 3SE3A 1LO0L 5IVXA 3P4OB 3D69B 1W0YT 5HHNB 3ZDZF 3QXVA 5A40E 2V9RA 1RJCA 3UZEA 3M8OL 4ZAKA 3LKOA 2D4DA 3HNSL 4U1LA 5FYJE 1IGYA 1Z9MA 4R4FH 3SGDI 5C0CA 1I8MA 1G6RA 4B0MM 5B8CB 3AREA 4X4YA 4PJCE 3WBDA 1UM4H 2ZPKL 4K3EH 5TH2A 3LEYL 4N1EA 3O81A 1Q94A 3AGVA 1OD7A 5DEGA 1MCHA 2DOCA 4WU7B 5DRNB 2VR5A 4JPIB 1EEQA 1JN6A 1HH6B 2MPAL 3IJHB 1UVQB 4JM4H 4PD4K 4Y4KA 3S36L 1T04B 1DFBH 4OD2A 4X8JB 4RNRB 2XN9D 5D5ME 1A1MA 2VQ1B 5MEQB 1XGTA 4EOWH 2O61A 3OKDB 2Y06H 2OMBA 5CJ5A 2P5ED 1LDSA 4M61B 3MYJB 1HSBA 4GLRI 1MVFA 3CFBA 2HJFB 1OAQL 2V2TA 4CADA 4OZGB 4OGXL 5DHXB 2EE2A 2IG2L 5ESVA 3IGAB 5GGRB 3BP4A 3LN4B 2JLLA 3DX8A 3P3YA 2FJGB 4M43L 3NH7H 3MRNA 1SYSA 3CSPA 3N1FC 3EOYG 4WI7A 5D6DC 4PLKD 4KZEH 2DYPA 1IAOA 4W6YB 4CBPA 4HGKC 1FG2A 2L7JA 4PFEA 1EXUA 1QFWL 2NY6B 5DFWH 4N9GB 2V5SA 5FYJD 5F9DC 2ZUQB 3RKDC 3H9SD 4LHJB 1JFQL 5C08D 2BRQA 4HWNA 4O9HH 4PG2A 4FQQA 4QTIH 4GG6A 2FSEA 1ZANH 3WFCL 1ORQA 1D5BB 5TDPB 4IRSA 1CU4H 3LKRB 4KRPD 5JQ6L 3HE7A 4HT1H 5FO9B 2FO4A 3JTSB 3P11L 4AK1A 2AQ2A 5CJ8A 3NZHL 4PJDF 4R2GB 3RHWK 1FBIL 3GSRB 5JW3L 1WWBX 4ELKA 1GXEA 3TO4C 4ENED 1FFNB 2HP4A 3NTCH 2OTUB 4P5MA 2Q8AH 1AFVL 4KGLA 3UBXI 5HXMA 3KPLB 3LQZA 1SY6A 5SWQA 5GPRA 3VXQA 3FB5B 4X9FA 2Q87A 4DZ8A 1AD9B 1OW0C 3SGDH 1ZGLP 1HHHA 3SQOH 1NBVH 1PDKA 4U6HA 3LVEA 3Q1SL 3VRIA 4ZTOH 1IBGH 2OR8A 2P44B 5F21B 3VJ6A 2VLJB 5D1ZA 4FQXC 3OKEA 1MELA 3DYPA 4GAJH 3KGRA 4NZTL 3M17A 4RMRA 4U1HB 2ATKA 4WW1B 1T5WB 4LLWB 4XCFH 1FV1A 1U93B 2IAND 4XB8A 3FB7B 4YDLC 3NACL 1IQWL 4P3WA 4AEHH 3VWKA 4L1DA 4GOSA 4L8BB 4CMHB 1D6EB 4NFCA 5DK2A 5J56B 4LSSH 5E2UL 4J12A 4R26H 3BQUD 3GM0A 3TFKC 3SDXE 4BH7A 1WCQA 3TGXA 4XNUL 1Z5LA 3GIZH 4Y4FD 1WZMA 2E7BA 3ZYIA 4LPUA 3QG7L 4XP1L 4RGND 1QFWI 3TH4T 5HHOE 4DVBB 4L29B 4E0RB 1SQ2N 4MJ6B 3I84A 4N9OB 1CXHA 1SJEA 3TBSA 3VWJC 4PGDA 2QQNH 3BGMA 4X9BA 1RPQA 4TNWK 3V9FA 1PZUB 1F02I 4JREB 1KIQB 5EU6D 1FNHA 1SBSH 4MJIA 3QUXD 4WI2A 2Y06L 5EUKB 4AIZA 3TJHC 5SWZD 1SHMA 3RUGA 2YRPA 4RGMB 4BQ9A 1XF2A 4FXGB 3CFCL 3L3JB 4WI9A 3MLXH 3IDXH 3RU8L 2YKLH 3QR2A 4X4MA 1TZIA 5D70H 3T2NH 3GMMB 5KVDL 1TDQA 1RIVL 2EYSA 2RFXB 3FAWA 4TUOA 2E7LA 4K71C 5CS7A 2FZ3B 3W11D 3LB6D 5JPMB 4U3CA 4P5KB 3QUKA 5F6IB 4GQ9L 5HVFB 5L8LB 4KVCH 5IMOB 5INDA 4OZIB 1MAML 1F4AA 3CDFA 4P2QD 5JIKA 3EYOA 4XPBL 4D8PB 3EDDA 1PEWA 2Q86A 4TULL 4J2XA 1QEWA 2FD6L 4JFDA 2A6DA 2UWEA 1YQVL 4QRPE 3S34H 3BO8B 3C60C 1BVZA 1J8HB 1IAIL 4N0YH 3GUTB 3NAAL 3DVNA 2DM4A 1A3QA 5FYJL 2DQGL 3MMEA 4HS3B 4RGNC 2J7LA 1IVLA 4NKOB 1UZ6E 2BVPA 5ITFB 5DD0H 4RISH 4U7SA 1X44A 5K9QI 3RTQC 3MR9B 4OZ4A 3QHFH 1B0WA 1CG9B 1YC8A 1D5ZA 3FFCA 4K7PX 1OT1A 3ARWA 4BA8A 1K9TA 3QUXC 5DR5H 1HEZA 1A6ZA 2Q76B 5JQHC 5A2KH 1JWMA 3RIFF 2QJDA 2R2BB 2F74A 4LGRB 1MIML 2XICA 3AS0A 4BSJA 5EC1A 1A02N 3EOAA 3D0LA 4JDZA 2XIDA 4AZ8A 4LBEA 1KB5A 3EOTH 3MV11 5C3TA 4Y19B 1Z9OA 4NQEE 3MRHA 1N6VA 1UACL 5B39A 5F89A 2IJ0C 5E8DL 2A6IB 3PL6A 1ODAA 4N0UA 2IAMC 4NT6A 4JDTH 2EEDA 3EO0A 4KRLB 4GKZB 3EDEA 4P3DA 3WNOA 1YQ2A 4CN6A 1GGTA 5DDHB 4BKLB 3KDMA 4P2YA 3MRKA 1FNFA 4K3HA 3VG9C 3D1MC 4PV9A 5EN2A 5B39G 2GSGB 1MHHB 5T1KB 4LKCA 5I1LA 3OF6D 4Y5YB 3WS3B 2X4QA 4G43A 1YC7A 4N8VG 1FDLL 5SV3A 5C08E 4OLVH 3BJ91 1BVKB 2XN9A 1JK8B 4G6FB 2A9NL 1MCCA 1JGVH 1YEGH 2XTJD 4FQ2L 1ED3B 3JXAA 4HK0A 3H9ZA 4R4NC 5IVNA 3V52H 3QDMB 3BPLC 1U6AH 2Q8BH 3HZYB 4U1GB 2V5TA 3VXUD 3DMMB 4HCRA 2OL3B 3TVMC 4JO2H 4RMUA 5C0RL 2P5EB 4BQCA 4I8DA 4CVZB 1I1FA 2IFFH 1MIEL 4V1DE 3KPSE 1C5CL 5I66B 5EU5B 5TE6L 4M7ZC 3QDGD 3OKKB 3GSQB 4O4YH 1SJHB 3U7YH 5JXEC 1MF2H 1T7XA 4LLYB 2X2YA 4OCLC 1NC4A 1HQRA 1FVDB 2BOBB 5E56A 3TJEH 5GGUB 2A6KB 5C0AB 3L7FB 2APTA 3ARGB 1V5JA 2ZUWA 2WBJD 2WV3A 1P4LB 4KUCD 3ILPA 3PDOA 2W9EH 3PHQA 2AV1A 5KBNC 3FN0H 1F3DJ 2DLTA 3C5JA 4HDIB 1H8NA 5F96L 3GI9L 1EMTH 2C1OA 2ERJB 1U8MB 4B41A 4MJ2A 5I0ZA 4PRHD 1NGZA 1M7DB 1KLGB 1N59B 5FOBA 3RWHB 4XCNB 1TNMA 5BXFB 2E6QA 1LDPL 1RZ7L 4M5ZL 4LK4A 2E27L 1H3VA 4K9EC 5L0QB 2GK2A 1FL3B 1UXWB 2KDGA 3NPSC 1FCGA 4NNYB