3QUZD

Structure of the mouse cd1d-nu-alpha-galcer-inkt tcr complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 65
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzD02
5DO2D 5LAXA 4X4XB 3ULVF 5I1CH 5H37H 5MEOA 1A7QH 5KSUB 2W65A 1D6VL 1BD2D 5LGJB 5IFJB 4OZHB 1ZK9A 4M61B 5E5MB 4JHAH 4BFBD 3LAFA 4G8FA 1UKSA 1NKOA 3QIWD 4K55A 2DDQH 1K4CB 1B6DA 4HULB 2VLKB 2VLMD 3VFRA 4M6ML 4Q2ZB 1U8NA 2IANE 3AU1B 5F88A 4NZJA 1Q9KB 1HXMB 2BNRE 3IT8D 5F7DB 4W70A 5I2IB 1T6VN 2DIAA 1QTYT 4QHKJ 2DB8A 2VITA 5GIRA 3D85B 5EZJA 3UTZA 5HHXL 4C83B 4HV8A 3LSOA 4XCNA 3F7VB 3IKKA 3IFPB 5SV4A 1IGTA 2ERJC 3I2CH 4JANA 3QDJE 1JZ3A 1F4AA 2X2YA 1FYTE 1LILA 1JE6A 1N8ZB 4XPAH 1CGSH 3FT3A 1O5DT 2Q20A 2MCPL 5JPMA 1EO8H 5KANG 1JUFA 4JFXA 4HG4J 4P3DA 3WNOA 1AP2A 1U8QA 1CD1A 2R1WB 4WFFE 1A9EA 2ED9A 2J2ZA 1QA9A 3MRGB 4PGBA 4PJ9B 1NC2B 2BSED 1DANU 2JLLA 3DSFL 1KTRL 3WIHL 1NGQH 4Q6YA 1OWRM 4PJHE 5DEGB 3CLFH 3F12A 2XRAL 3IFNH 3RKDC 4XMPH 4ODTL 1X4YA 3H6JA 3NCJL 2VDNH 5F7EH 3L5IA 4JR9H 1TNMA 4GRWE 1TLKA 3BEWA 5CINH 5HHOA 4M48L 1HYSC 4YX2L 1JN6A 2Z91A 5IFHH 3JXAA 3PJSA 2MJWA 2DQUH 3HZMA 5ANMA 3KPLB 2IPTH 2X7LA 1CGSL 4EI5C 3BDBA 4J23A 2BVTA 3SE4A 2I9LB 2L7JA 2BHUA 4LAQL 5JHLL 4NCDA 2VQTA 3PXJA 4OFDA 5ICXA 4O58H 1JWSA 3C6LC 1YEFH 1BM3H 1YEEL 3ILQD 1JGVH 3GSNL 3NFNA 3ES6B 5I18H 3OF6A 3BEVA 3HPJA 1AE6L 3DETC 5IUSA 1ZGLA 3QXDA 4WUUE 2X42A 3HZYA 4NM8H 3LEXB 4Z7VF 3VXTA 1QR1A 1T83A 3WIHA 1J7VR 1IM9B 2VZOA 2F54B 3LKSA 2ZUUA 1PGRB 2IMMA 3QXVA 4J1UB 5I6XC 3LMJH 1D5BA 5DRWA 3EJZD 3WJLA 5ETUA 3IFLL 4UT6L 3ZDYF 3QDGD 4Y4HC 5MENE 4N8CL 1NCDL 4JHWH 1LE9A 4XC1L 4NO0D 4Z0XB 3N9GL 3V5KA 5HI5C 3WJLC 3ULUF 4YQXH 1N6QH 3LKRA 2FX9H 3D3VA 1CIDA 5CILH 1MRCH 2GFBA 3G08A 3ULSA 2AXJA 4G7YH 2OSLB 7FABL 1KV3A 1P84K 2WMPA 4HWZB 5B39B 4LCWE 5CZXC 3NZ8B 4D0CA 3QNXB 3EO1A 4U31A 1T0PB 4FQ2L 4KHTL 3QO0A 1FAIH 4OF6A 4U3HA 3O6FD 5E6ZA 2D9CA 2Y23A 5E2VL 1CIUA 3KPSA 1ZGLB 4UUJA 4RA3A 3U2SA 3SQOL 1NCBL 3C5SA 4APQB 2PR4L 4OCLC 4KMQA 3W9EA 3AUVA 1OTUC 3EYSH 3IDYC 5I30L 1N6UA 1FPTH 1QBML 5MEPB 3NIGF 4HJGB 2LVEA 4BQCA 4YJZL 3S8WA 4QRSA 1KIQB 2FCBA 1P7QA 1KEGH 1KPRB 3O4OB 4I13B 4Z95H 2XFXB 2XTJE 1F11A 3LH2H 3S35L 4UV4L 5IKCA 3VXUE 1T80A 5F7FA 4MYWB 2QQLH 5IWLC 1QSFA 3Q5TA 4PJFB 4FXGA 4CVUA 4TQEL 4GG6B 4I3GA 3F58H 3ME0A 2YR3A 4AIZA 2XNAB 4ELKA 3QDGA 4H0GA 1BOYA 4R6UA 4XP4L 1HHKB 2I9TB 4X6DE 1S7WA 4CN6A 3WJJC 3M1BA 4LU5L 3NPZB 4R90H 4OZFB 4PJXA 4Z5RA 4OCWH 4QTHB 3RTQD 4MDIA 1ZSDA 2ZCHH 1UZ6E 3BUYA 2IEPA 3G5VA 4ZQKB 3WFEH 1M71A 4N0FB 2LU7A 5HI3C 5IESL 1AGEB 1Q0XL 5I73C 4HS3B 4BH7A 5I1LA 3WIFA 4QOKB 4XRCB 4JLRB 4BQBA 1ZLSH 2HRLA 4TOYH 3VFUA 4AIXA 5K9KB 3BO8B 1RUPH 1KXTB 2JCCB 4HFUH 4OKVA 5TF0A 3C6LD 3RVTD 4P2QE 1TVHB 5ICXB 1RK1A 3IDNB 2UY7A 4XCCH 3BH8B 2FATL 1MVFA 2Z8RA 3QWQB 1YPZF 1OAUH 1A6VH 1I7RA 1IC4H 2EZ0C 2P7TB 3O4OC 5DD0H 5DR5H 2R0LL 4ZPVB 1LEIA 3RWHB 1DBJL 2HJKB 4OGAD 5DMGC 4ZUUB 3DBXA 3QDJB 1DCLA 3B8SA 4MD4B 1P9MC 3TEUA 3G6AA 3BUYB 3RKDD 3ZKXC 5CCKL 5MEQA 3RPIB 1G1YA 3V6ZA 5HXMA 2Y06H 3UDWC 5D7IA 3STZB 1DE4A 3HTLX 1J8HA 3H3PL 1PG7W 5HI5D 3RIFK 5ITFA 3KLHC 1DDHA 4H1LB 4YXLH 1QHOA 3ARSA 2W1NA 4YEFA 2R4SH 4LCUA 3VE0B 3GMQA 2CMRH 1TTGA 1I1CA 4HKXA 5DI8B 2X44D 3IXAA 4EUPA 1FQ9C 3HUJF 4ZFFA 2X09A 1T21A 4WUUD 3KHQA 4XPBL 1FAKT 2EDOA 4ODWA 3BIKA 3OWEA 3HI1B 1CD9B 1KB5L 1MCBA 1S3KL 1OAZL 3UTQB 5IQ9B 5F8QC 4HIXL 1C1EH 4QWWD 4XNUL 2AJYL 2HTLC 3QQ3B 2JCCA 4LMQI 4OKVB 1P7HL 2ZPKL 4PJBF 1N7MH 2VOTA 4Y8AA 2WZPD 5GGSA 4AIOA 1MHCB 3WIFB 1ZT4B 2DTSA 3QDHA 1TJIL 1NGXB 1GXEA 3RRQA 4M4PA 2AQ2A 2R56H 2AV1A 2XZZA 1I3VA 1OP9A 4NQCD 4HWBH 1RI8A 4NQDB 3VW3L 4MLSA 1NDMA 4P2YA 1A7RH 3SGDI 5C09A 1JHKH 5DHXB 2YSSA 4XWOC 3D3VB 3MFGB 3G5YA 3BZFB 2CQVA 3CU1A 3B3IA 1T1ZB 1KUMA 2AJYH 5FKPB 5CZXD 1KCSL 3FN9A 1A6VL 1EEUA 1BX2A 3H9SD 3QFJD 3HR6A 1MCPH 3BW9A 1RULL 2CKBB 4DKEL 5C3LD 5D1QD 1M7DB 2MQ3A 4F9LC 2AXGA 4FXGB 3QXAA 1O0VA 4LSUH 4TRPL 4ZDHB 4J6RL 3TPKA 1WICA 4JFFD 1F4YH 3IXAB 4EUPB 2XN9A 2DM3A 3TIDA 2J88L 4QOKE 2CMRL 3DGGB 3E2HC 4RCAA 1DDHB 2F9BT 2R4RH 3EZ8A 4N0YL 1TZGL 2QLVB 4S1QL 4HWUA 5SX4I 5I1EH 3T3PF 2C9AA 1ORSA 3V0AC 3ZHDA 1AKJA 3OR7A 3GIVB 4OZIB 2AEPL 2XZCL 1VACA 3V0VB 1FDLH 1JWSB 4ISVA 1ZWIA 1YEJL 4KXZI 4MLIA 5D72H 2DQDH 1V7NH 2YWYA 4XVSH 5E24E 1DL7L 5DJCB 1EBPA 1JJUA 4U1HA 3OPZL 3PQYB 2CLVA 2R9HD 3NFSH 2X4UA 2ZOLA 3LD8C 3P73B 1SEBB 4QXWA 4WWKA 1RZFH 1XH3A 3NFSL 4HXAH 3VXRA 3IYLW 4Y16C 1B0GB 2VN4A 3S34H 1E4KC 3VRIB 1G7JB 3FO0L 4ELME 1MFDH 5IT2H 1NGPL 1K5NB 3GMOA 2ADIA 1S9XA 4PJBA 1OF2B 2Y4SA 2IH3A 1CD8A 2R15A 4HFUL 4GRMB 3NCEB 4HQQH 3MLPA 3C08L 3W9DB 5HYQA 3QH3A 2B1HL 1F58H 1MH5B 3KPTA 4G6JL 1IC5L 1DANT 3J7HA 3MOAL 5DJ8B 1W8OA 1OT2A 4PB9H 3VDCA 3BRDA 4MQ7B 3QEQE 3PABA 4J6RH 1K85A 3VXSA 4XPTL 1F4YL 4P4RB 2GHWB 3WSQL 3GIVA 4UQ2B 3GMLB 4FXKA 1YC8A 2H32A 3R1GL 5D7JB 1NPUA 3SKNA 4PRBA 4X4ME 2OYPA 4GG6F 3ZTNH 3PGDB 3TM6A 43CAA 5DEZA 5SWQB 5B3JE 3NCCB 3UX9B 2V9TA 2F58H 4H25B 1LDPL 3IETB 3QQ9C 3OBAA 1BBDH 5DD1L 1MQKH 3HI6L 4ZXBC 2BOBA 3UPCA 1MRCL 2A74B 3U36A 1AO7B 1QSFB 3CVHH 1R5WA 1E4XL 4Z7NF 2O5YL 5IGXH 3WEXA 3CFBB 4OT1L 1GSMA 3HB3D 5ADPL 4HC1H 1U92A 3N1MC 3QZWB 2I5YL 1BJ1H 3VH8A 2VXSL 3C09C 4AT6A 3ULUH 3C8KA 3W39B 2AABL 1SYSA 3MRQB 1PX4A 1IZKA 5T3XD 1E6JH 4XAWH 3PWJA 4PREB 5LJYH 5MENA 1U3HA 2I9LA 3EYSL 3MLSL 1BIIB 3UPAA 1XCQA 2AV7A 5KVGL 2F74A 2HJFB 4UBDC 4LVNC 3TBYA 4ZFGH 1VFBB 3SKNB 3O45B 5ANMB 2HVJB 2QSCL 4XZUB 3MLZH 5L0QB 1RZ7L 3N85L 2H32B 1JZ7A 4JZJC 1KB5H 3ZKSD 4DGYH 5BZWA 3KJ4B 4YHZL 4PUBH 1QLEH 4MAUL 5DC0A 1F90H 4X6CB 1B9ZA 2PXYA 3ZYJA 1GIGH 1KJ3L 4ODHH 4N8PA 1DQTA 1WF5A 4N8VB 1JRHL 5BS0B 3MRCA 4XVUC 3ARXA 43CAB 1SYVB 3U0WL 5HYJA 1T04B 2OP4H 1WFTA 4FQ1H 1MOEA 4PRBB 5TQ0H 5I2IA 4DAGL 2IPUG 4NHUA 1Q9KA 1IEAA 1HEZB 1CDBA 2IF7A 2QSCH 1MELA 1LWRA 5DFWH 1NLBH 5FOBB 3BE1L 1E0OB 4J3XA 3OV6A 3NABH 4YC2B 4GXVH 4J1UA 1UJ3B 3CZJA 4I5BB 1IM9A 1UGNA 1OB1A 4G8GE 3SKOA 1HCFX 3W81A 3P4MA 5IVXE 4AL8L 3F65A 5F9WC 1U3HB 3BRGC 1CT8B 4PJBB 3QEGH 1QD0A 5EUKB 1MFBL 1WIPA 1SYSB 2YK1L 4ISVB 2CDGA 1IQDA 2FEEI 1LD9A 5EBLB 3T1FA 2HJLB 3MLRL 4IOIA 5CZVH 5DJ0B 5GGVH 3HLAA 1DLHA 3CFBA 1UWGL 2X4UB 3HZVA 4R0LA 5E8DH 2OR8A 5CHNB 5J3HD 5C08E 1FZMB 4XP1H 2CRMA 2DKUA 3VGDA 5IQ7L 2CXGA 3MPCA 3MACL 3LKOB 4U3XA 1HHHB 4YHKL 1U93A 4HJGA 4L3AA 2A83B 4LPYA 1FE8L 5EBWB 3LCYA 2PW2A 3B2VH 4ODXB 3CPLA 4A2LA 3FB5A 5T1DH 5J11B 2X4PA 4WFEE 4Y1AE 3DXAE 3WFEL 1GZQA 4C56D 5C09E 1OD9A 4ZD3L 4ODUA 1LK2B 2B8OT 1XF1A 4KDTC 4R90L 5CP3H 1KBGH 3I3EA 5A40E 3OR6A 4WI3A 5DFVD 5C8JA 3RY4A 4EXKA 3RJDA 5GS2D 2A9ML 4LNVA 4UQ3A 3QEHB 4OLVL 2XQBH 4PJAF 4K7PH 1KLUA 3S3SA 1YDPA 5B21A 3UAJD 4M5YH 5I8KL 3GHEL 5FV1L 2HMID 4PJCA 4K94L 5TQ2L 3WD5H 4ONHB 3LS5L 3TVMD 1R3HB 3ULUE 4R7NA 3SOBL 4PJFA 4P9HL 1BFSA 3MBEC 4K3JL 3PF2A 4JM2B 1IL1B 3TJEL 1IT9L 3GUTA 4BSJA 2RGSA 1RZIB 2VZSA 3ARGB 1NSNL 3SQOH 1WC7B 5TDNB 3CH1B 2DQIL 1NL0L 4G3YH 5CGYD 2IADA 5CGYC 3K1DA 3RY6C 4FFVC 5EO0B 3KYMA 5CGMA 2CLRA 1A4JB 4I77H 1PKQA 1LP9F 4Y4FB 5F9DC 4B41A 4Q97A 4M7ZB 4NBYB 3OR7B 3H7LA 3MACH 3VGFA 4JHBA 5IQ7H 3VG0H 4XTRC 3QPXH 3LN4A 4I48A 1Z5LB 5E8DL 1OPGL 1HQRA 2LTQC 5EZLB 2A73A 3BAEH 2IPUK 3EJJX 3EW3B 4OB5L 1ROWA 1NDGA 2ZUVA 5KZCD 5FYLD 5CKGA 2XG4A 1KJVB 3UTSE 5FOJA 2VLJA 2QSVA 3BWAA 2FH8A 5GISH 4I0CC 3ZKNC 1LEIB 1FNFA 1D5XA 2NNAA 5DJDA 3QT2A 4NDMA 3BZ4B 4YZFF 1W0VB 1KXVC 1B90A 1QFUL 4ZSOB 3STZA 5C0AB 1YYLL 2ZUTA 4HV8B 3N1QC 3RU8H 3U7WL 4KI5C 3IAQA 2R1YA 3FTGB 4Y2DA 3IDGA 3FO1A 2OI9B 4UTBH 4JQXC 3MSPA 4ZS7H 5FYKD 3RVWD 3UTTD 5TQ0L 1A1NA 3VFUB 1X5FA 3U0WH 2BNQD 2HRPL 4LLYA 3B9KC 4P5TA 4JLRA 2F53B 4O2CB 4QNPF 3L3KA 3FFCB 4Y7MA 1A6UL 2NPLX 4CVZB 4FP8L 1C12A 1KJ3H 4BH7B 2X4OA 3HPLB 4G43B 3JTTB 5E03A 3KYNB 4LFHD 1XR8A 4G8IB 4YX2H 2BVUA 4JR9L 1DN2A 4NNXB 3ARDA 1A6AA 3JV4A 3IFNL 1JWUA 4GAGL 4M8QB 5EU4B 3GSWA 4WI6A 3KR3H 1R3JB 3RDTC 4U1GC 5CS7A 1ONQA 3CGTA 2P46B 1P69B 5D96B 3QG7L 4NSKA 4OUUA 3ROLB 3GSOB 4XXCC 3MA9H 1TCRB 4FOMA 4MA7H 1I7UA 3DVIA 4JG0H 5HBBA 2XTJB 4PG9B 3ULVD 3MFFA 1CQYA 2EXYC 4XPHL 4EUPG 4YFEA 4M7LL 2WBJD 4DQOH 3CX5K 3OB0H 4NRYA 4K8RD 3PWVA 4KRNA 2J3SA 1X4XA 4X9FA 4OLYL 3DUSA 4NKIH 5DWUL 3RPIA 1OAXL 3CFKA 1AP2B 1MHHB 4QHUB 5DJ6A 1Z3GL 4JKKA 3RP1A 5D71L 3ZHLA 1F2XK 4WHTB 3C5SB 3A67H 3D0LA 4K3EH 4YXKL 2FATH 3OKLA 4MVBC 4M6MH 5JDJA 1FYTD 3MLYH 3V5HA 3VMPA 3ZLQC 1DQQB 5BJTA 2QR0A 2A77L 4P57B 1NCWL 3C6LB 3HFML 3QEQA 5L8JB 4QHMB 3VWJB 1JTTA 1QBLL 5DJXA 2RQ8A 1YEKL 3BD5A 5GS1A 1FBIL 2I24N 3O4LA 1EA9C 5DD5H 3H7BB 3D39B 3S37X 5BOZG 1VFUA 3RWGA 1JPGA 1S5IL 3T2OA 4XNZC 4FQLL 4QLRA 4F7EB 3EYUL 2Z4QA 4H26A 5DEFA 3U30C 4XMLL 1J0JA 2WUCL 2NY4C 4PJ5A 4ALAH 3BYTA 2V7NB 3MLUL 3CFIC 3PQYD 3EDJA 4JGUA 2GJZB 3FRPA 1CXEA 4D9QE 4Y4HB 1ETZB 3K46A 5F7HA 1CL7L 5AG8A 5EC2A 5GRUL 1SMOA 4PJ9C 1BOGA 4HIHA 3WS6A 3IDMB 3QUML 2P47B 5C0EB 5A2JH 4NC1C 3JV0A 4NRYB 3SBWA 3DROB 1HILA 4GG6A 4KK5D 1JIBA 4ZOBA 3S35H 4UB0H 1PYWA 1PQZA 5E2UL 4Z76A 4YEEA 4MA3B 5HYJD 3VI3E 3KGRA 3VXOA 2FIKB 3AXLA 1NCTA 3HAEA 3RVUC 4NP4H 3LKOA 5C08D 2Y6SD 1R3LB 1OTTC 3H42H 4D9RE 1WTGT 1QQDA 3QG6B 5EIIA 1W72A 1RV6X 2Y7QA 3D48R 1AH1A 1OP5K 3NTCH 1XGRB 4Y19D 1MWAH 2YD6A 1KN2H 4OM0H 2OK0H 3JWDL 3GSWB 4Y1AD 3RZWA 1N4XH 3VGGA 1BEYL 1KACB 4M03A 1T2XA 4F57L 4PJHB 5FYJL 3UTPE 2EDWA 4YUEH 3DVNB 4TULL 1H8OA 3D69A 1I9RL 1UXSB 1L0YA 3CX2A 5JA9A 5AYQA 3MV7A 1LO5A 4QRQA 4EI5A 2BCKA 1JYVA 1B4RA 2ZSWB 3CZFA 4OGZA 4Y5VC 4E41A 5JXED 5BS0E 3KPLA 2P8LA 1JHKL 1MCKA 5E1AA 5FUOH 4XNMB 4YAQB 4Z7VE 5JTWA 4KPHL 3G9AB 1A1OB 1IKFH 3RWEA 5ALCH 4JKMA 5EOQL 1J86A 3DVGA 5ESAB 4ONOA 3VWKA 4M62H 5IVXF 2YXMA 1WAAE 1DUZA 1FH5L 5E08L 1JHLL 2F5BH 1KXQE 4L8DA 3ULUD 4EUPH 3EO9L 4FMFA 1BVKA 2JTDA 2ZPKH 3LPWA 4IDJH 1EFXD 5ESVA 2MQCA 2CKBH 1WGOA 5J12B 2A6JA 1CVRA 2AJUL 1BBJB 4L9LC 4I0PB 4I2XA 2AK1L 3SY0B 1OSZA 1FO0H 1ZLVH 2VDMH 4TSAH 4DFHA 32C2B 3KXFA 1QO3B 1ZVSB 2IBBA 3H3KA 2X4SA 4ORZC 4N90E 1X5JA 2YBRA 2EKJA 4W6YB 4XWOD 2HFTA 5C86A 1FRGL 2OLDA 5FYKU 4R3SA 2NTFB 1MCOL 4Q9QH 4M6NH 3LDBC 5HDBE 5D7IE 1YA5A 2IAMA 4RRPG 4ORGB 4TVPH 1FNSL 3RNQB 3TVMB 2Z31C 4P9HC 5EO9A 3SHSA 3TP4A 4NQXB 3GSNB 3O3DB 4PJCF 3NBNA 3L5XL 3K74B 4C4KT 4O02L 4LKCB 4JGMA 1QOKA 3W11D 1P84J 3AAZB 3FONB 3MREA 5D2NC 1K4DA 1TPXB 4H25A 4G6AD 1VPOL 3EFFA 1N64L 1KB5A 4KUZH 3U46A 3QO1A 3VRLF 4DUVA 1QUNA 5F3HA 5GGVY 5EZOH 4P5KA 2IQAA 4JPWL 4UDTA 1JPSH 4MVBD 2OTWA 3K7UA 2EXYD 5DJDB 1OAYH 4F9LA 3CFCH 3WFZA 4XPFH 4OGYL 3FQNB 2OTUA 1U8HB 2CSPA 1UXWA 2EEAA 4NGHH 2ZCLH 5F1OB 4NHCL 1U3JA 2A6IA 4Y5XC 4XGZB 2HT4D 1G1CA 2D31A 1GAFH 3DOSA 1BREA 4IRJD 4KGJA 1KT2B 1Q9WA 5CKAA 4AMKL 5HSFA 5C0FA 1HINL 5DD3L 3REVA 5IOPB 4KROB 2H41A 4U1NB 4KJQC 4WV1B 4EXPX 1JPFB 3QUYC 4TVPD 1N0XL 3ARTA 1F97A 1U8NB 1VFMA 2HVKB 2Q8BL 3U4EA 5B8CC 5IF0A 3QIWB 4HK3N 4RMUA 2AI0L 3WDJA 2P8LB 2CUMA 4MDJA 2KL6A 2RIKA 4YXHL 1CICB 3FOMB 5JO5B 5DLMH 2B39A 4WEMB 2EKSB 1I8MB 2IMNA 3B43A 5F7UA 3FB7B 2ZKHH 4GT7A 5CBAB 1V7MH 4OZIA 2UWEA 1S5HA 5DJ6B 1PKOA 2AJVL 2VZVA 5JW4M 1AGDA 3S4SG 4X80L 5IVZA 5FYKL 3U9PH 3ECBB 5BRZB 2CIKB 4YDLC 1EEZB 3HG1B 4BZ1H 1QQDB 3PWLB 5J0BA 4JN1H 3ZL4L 4UAOB 3S5LG 3R4DA 2J5LB 2NW3B 4G9FA 2W92A 2PYFA 4AEHL 4OQ1A 3S88L 2HYMA 1KCVL 3GSVB 5I75B 4P23B 2CDFA 3NCYS 1XCTA 1CDJA 4S0SD 2FSEB 1EFXA 4LLVA 4LP5A 3BZ4A 1PD6A 3VXQA 4HXBH 1IM3B 4ODUB 1U41A 1JNHB 4EN3A 1UB5B 1JPGB 3RDTD 5IHBA 5BRZD 1X5IA 5GSVA 1HN1A 2X4PB 3QEHA 3QI9D 1CDIA 5FM8A 4PV9B 5EU7E 5I16B 3NIGE 2WM0A 2DQJL 4RZCB 1OGAA 2LV4A 1YNTA 1QVOA 2COQA 4X7CC 2GQHA 1MRDL 4YHPA 5TGBB 1KB9J 4H0HB 4QT5A 5DK0B 4YBLC 1ED3A 1JCKA 1LO0H 2RAMA 4XP6H 3RNKB 4LLQB 3WFCH 4X6BA 1EEQA 4QY8B 5I19H 1UM5L 5GGRA 3QAZC 3GGWB 4RMTA 3MXVH 5JDSA 2UZYB 4M7JH 1JNJA 3HA0A 2R1XA 1ITCA 1FC1A 5IMOB 2DYPA 2JELL 4XBPA 1Q1JH 1WC7A 4OZ4B 5DZNA 3G6JE 3SCMC 1FNGA 3OKMA 4NQED 4ODWB 2A9NH 1R3LA 3GUTB 3OF6D 4WI9A 3QIUA 2FJHA 3DV6A 5J1AB 1EBAA 1PYWB 2JK5B 1SJHB 5FO8B 1DSFH 2YRPA 4CDHA 4QF1B 4GXUN 5JHLH 4ZO7A 5I15L 5LGHH 3UZQA 4BFIB 5FHBH 1WBXB 4JRYA 4P2OC 5C0IB 1CGTA 3MBXL 5EZLA 5IBLD 3QR2A 2X4NA 4KV5F 4M8QA 2ORBL 4NM4H 2EICA 1WCBA 1JTPA 1S8DA 3KHOA 4P3CH 4ZO6A 4MZ2A 3DUUA 4BH8A 1D5MB 4ERSL 2ZG3A 1KJMA 5E6YA 2JCCE 4MA8L 5ADOL 1J1XH 3S4SA 1KOAA 2ADGB 1HH6B 3HKFA 5I66B 2QHRL 4O4YL 3W9DA 5HYQB 3FOLA 4Y2DD 3MLXL 3QO1B 3GMNB 4YZFE 1D3CA 5I74B 4HUWA 4OLZL 5TE6H 2BRRL 2GUOB 2R1XB 5J89A 4FQ1L 3DX8B 5F1NB 1FZJB 3CDGB 1YEGH 5K9KA 1KELH 1OLLA 5CEZE 5JPNA 4POZD 5D2NA 4FS0A 3FZUC 1VKXA 4JDVB 2UV3A 1U92B 4QXUH 5EBMB 2YUXA 2FHCA 2L4OA 2UUDK 1T5WB 3KNBB 3E6FA 5L2KD 1NMAL 1PSKL 5I1IL 1ZLWH 3PWJB 4JO4L 4NO2B 1QBBA 5C3TA 3D9AH 1VGKA 3LQAC 4ESKA 1NGWA 4UTAH 4FNLH 4R3SB 1CLZH 1L0QA 3UP1A 4V1DD 4ACPA 4HDIB 4TYUA 3EYFA 3EO9H 1B4JH 3G04B 1CTOA 3WMSA 4OJFL 1AGFA 1OM3L 2VXSH 3A6CH 2JB5L 1TPXC 1INEH 4H8WL 1YJDC 4PJIA 5EZIH 5DQ9A 3DI3B 4JFQB 2HFGH 2A0LD 1L4IA 1XF5B 3IRZA 4WU7A 3GSOA 3QUXC 3KYAA 2H45A 5JOFB 1E4XH 2EE2A 4N0UB 4Z7UF 1NFDE 3FKUS 1AY1L 3MRRA 4KI5F 3L6FA 3ZDZE 1INQB 3JV4B 4Z7WA 5CUSL 2QEJA 5BV7L 5FF6A 1IL1A 3ARDC 1FFOB 3MLWL 1MJ7L 4OCXL 1HIML 3DXAD 3I3DA 4YUEL 3KYMB 5FDWA 5F70A 4ODVL 4OZGB 5C09D 4GMSH 5ID1B 5FB8A 4EJ1C 1QNZH 2XZQH 2JE8A 1CU4L 5FXCH 4NO3A 5J13B 2Q3ZA 2ZSWA 3CZFB 5HHQB 4YHLL 1UJ3C 1BJ1J 4Y19A 1R5IB 3LKNB 3MZTA 2UYLA 3V6FB 4ZXBD 4RX4D 4CMHB 5K9QG 5D8JH 5EUOF 3TBTA 1FLRH 1Y18A 4CU8A 3RA7H 3K81A 5E8EB 2X4QB 1JHTA 5F1IA 4ZS6C 2BHYA 1W8NA 3EDKA 1F6FB 1J11A 4JG1L 4N5EC 2VJXA 2Y7QB 1MJJA 2I25N 4KWUA 1R0AL 5J9PB 4GRLC 2V5YA 3HI1A 1MCEA 2XWJB 5GS0D 3HHRB 5HJ3A 4IS6B 5GS0C 3GKWL 1MI5B 2E9JA 3LN9A 1N2RB 5CEYA 1RUKH 5F9AC 5KSBA 5F7KC 2VLJD 5C8JB 3QCTH 3OAUH 1AO7E 1DVFA 1T7WA 1NFIB 5EU5B 5D7IF 5CEZD 4P59L 4EEEA 3HMXH 3SKMA 5SWSA 4D8PA 3O8XA 4H1LA 1E4WL 4AYFA 1JGUL 3CUPB 1M6OB 5CLTA 3DIFB 4F2MB 3QUZA 3QCVL 3ARPA 3KYKL 1AQKH 5D70H 1F4WH 3TT1H 4DEPB 3VFOB 1DEEB 2D3VA 4QHNA 5L7XH 5E2WH 2VXUL 1BJ8A 1QFHA 3SO5A 1G9ML 3MUHL 1B0RA 1NDMB 5DA0B 5MERB 1S7VB 1XIWB 5T1KA 4P49A 4BZ2H 3HE7B 4U49A 2A77H 2RCSL 4U6VH 1F6AA 4KDVA 3QDAA 1MUJB 3AB0C 3UZVB 3CD4A 1FNLA 1EGJL 1PX3A 4XP9L 4KQ4H 1MNUL 2NZ9C 1FJ1B 1RHFA 4ZAKC 4D0DA 1AXSA 2FD6L 1A14H 3ZSTA 3MRFB 2E9IA 4P2QA 1SVCP 4L5FL 5F8RC 2JB6B 5IK3B 3MJ8A 2OX5A 1OL0A 4G6ML 1FVEA 4IMKA 3P4LA 1UADC 2ZNXA 5C6PB 1OQOA 4XPGH 4IEFB 4HKJA 3NACH 1NUFA 4JHZA 1F8TL 2CLVB 5BS0A 4RQQB 3X11A 4HCRH 2N7BA 1IGCL 2BSSB 1GGTA 3DMMB 1TJHH 4HWBL 4PJXF 4GBXC 3B83A 4N1EA 3UDWA 2VN7A 3HNTL 4BFGA 2PTTA 3KPNB 3HC3L 3M07A 3CCHA 1N3NB 4QXTB 5D1ZA 1TVBA 4Z7NE 4JPVL 3RVVD 4Q0XL 1G9NC 2C5DC 2CPCA 2Q7NA 1YY9C 2VQ1B 3RWDA 3TZVC 3RTQA 4UU9B 4FQJL 4PJXB 5TPWL 1RJYA 3EFDL 4GSDH 3X3FH 2N7AA 5C0RH 4PJGF 4GRMA 3BKYL 5FIEA 4XVUD 1NAKL 4J3UA 4NZUL 4JO2H 3WKMH 2E3VA 2WUBL 1Q8MA 3QISA 2CRZA 1EXUB 2P4AB 3UXFA 1YNKH 1JI1A 3LPGA 3QXAB 2M8XA 1J0KA 2Y07L 1AD9A 3BXNB 2CKBA 4AJ0A 1ZTXH 1TCRA 5J1AA 2MQ0A 1HKFA 1NLDL 1SMAA 2NZIA 3C5JA 3AVEA 4AH2B 3HE7C 1M05B 4ONFH 3W0WE 1G9NH 3AM8C 2OXHA 3FZUD 1VA9A 1AO7A 4L8SA 4YK4C 1WIUA 4U6HB 5IMKA 3CSPA 2BNQB 1S9WB 4GAJL 5KOMC 3TYGH 4L5FH 4K3DH 4MS8D 4MQSB 1MPAH 1A14L 1QRKA 5FM5M 2YHGA 1A5FH 4KQ4L 2Y06L 4PRPE 4WI4A 5AEAA 3U2SB 2LVCA 1NUNB 2H2SD 4F3FB 1KCRL 5D7JA 1IAIL 4YGVB 3O6FA 5HHMD 1KTKE 4U1IA 3SKMB 3FQRA 3ET9F 3OKOA 5JORB 4UT7H 3GMRA 2FWOA 1H3GA 5J1TC 1FYHB 4LKXB 4U1KA 2IQ9L 4DOHB 3FO1B 5IB3B 3GDBA 4JGJA 4G6KH 1EEYA 4LRIA 4PJGE 1OT1A 4EDWH 2BY2A 3LKRB 4XCCL 4QYOB 3ZDYE 4Q9RL 1CFTB 2FZ3A 2J7LA 4H88H 1N5AA 4LSRH 5I1KL 3B4NA 3TESA 2GJJA 2JKXA 4JDTH 4N5UA 4LSTL 1DQML 4LRIC 4RWYH 4Y5YA 5IR1B 4PB0L 4P0DA 1KLUB 4LEOB 4AZ8A 3HE6A 2Y36H 4S0TD 4HFWB 3DTXB 1B0GA 1FORL 4UOJA 1UA6L 1ZT7B 1MH5A 2NW3A 4K94C 4OFPA 2CK0H 5EN2A 2DQTL 3WNLA 2R8SH 5IHUL 3PGCA 4LPTA 1G6RA 3R06B 3VDAA 2H6PA 3B9EA 5JQHC 4M93B 1MCNA 1H15B 4HJJL 3S96B 3WBDA 4E0RA 3ULVE 4WO4B 1KEML 2O61B 3HC0B 2EH7L 5E6IB 4BZYA 3WS3B 1A4JA 2NX5E 4ZFZB 3BP7A 1HWGB 1INDL 1XGRA 4H5SB 1KPUB 1FV1A 1WZLA 2CH8A 3D5OF 2NW2A 2YPLB 5DMIL 2W9EH 2L0DA 1ZS8A 3O6LL 5ECJE 3OZ9H 4PRDA 5HPMA 5K9OB 3IETA 1MJ7H 2FBJH 1MHEA 3RVWC 5E8NA 1XF2A 1D5IH 4OF5A 2HVKA 1OTTD 5T5NG 2P43B 3FN0L 5KBNC 3OJVC 3V2AR 3ALPA 3S7GA 1XF3B 1U8KB 1P6AB 4CAGA 3LZFH 3G5YB 3MRNB 4X6DF 3QIBD 1T22A 4KRMB 1DBML 4K8RL 4XMKH 1MFNA 3RIAF 4HUXA 5TH2A 2G5RA 3SQBA 5CD3A 2UYLB 5KZCB 1JZ8A 3MRDB 1UZ6F 1G6RH 5DT1H 4X7TA 4DFIA 4KHXH 2VDLH 4PBXA 5GS0H 3MLVH 4V1DB 4XTRD 5LXGH 1T1ZA 2BNRD 5FKPA 3VXMB 3SJVB 2EO1A 1T04A 3F7VA 3MYZA 1P4BH 1LP9E 3UO1H 2EDEA 2VXVH 4YQXL 4LQ1A 1UEYA 2OL3A 3ILQC 1QSFE 4G9DA 1KJ2A 5SWZB 1FZJA 1IGJA 3QJFA 1NCAH 1E4KA 3T65B 5EBWA 4YDJA 1DQLL 4NKOB 1SEQL 3LQAH 3SJVE 5ALBL 4AEEA 1MJ8L 5CJ5A 1LE5A 2GAZA 3LB6D 3I6KB 3CK0H 4XZUA 2Q6WA 4OFYA 1IGFL 3F7YB 3H9HB 3JZ7A 4YPGB 2PCPB 1T89C 3MRBA 5B38G 1Y6MR 1GPOL 4IIQB 5TE7H 4IHOB 2YMXH 3BIAX 3EGSB 1RY7B 1NAMH 4HH9A 4LCYB 5EBLA 3WDIA 5C2BL 5IBTH 2BP3A 1OAQH 1K3IA 3QA3B 1KC5L 3FQTB 4KKLD 4Y88A 4KJQD 1ZHNB 4FQXC 3VFGH 2ESVD 3KXFE 5TH2B 3ZDZF 1YNLL 2G5BB 5DJYA 4MB5A 5DHVH 3M1BB 4DW2H 2B20A 2MPAH 3ARRA 3OL2A 4YFLF 4EI6B 4JO3L 1IC7H 3TZVD 3X3GH 4JE4B 3FCTB 3MC0A 4MX7B 1P5UA 1UCTA 3UZEA 5FO8A 3IJYB 1HDMA 3PL6D 1JWMB 3MRJA 5F3BB 2R2HA 1VCAA 4JKLA 4L3CA 1VHPA 3E6FB 5JHDA 4OCRH 4PJ7F 2DQUL 3QHFL 1N5AB 2HKFL 4R4FH 3MBXH 4HHAA 4MZ3A 1KB5B 3K4AA 3RAJL 4ZFOA 2DYPB 2NXZD 4NWUL 5LGKA 1HHIA 5LGHL 3NA9H 4AY0A 4X6CF 3PDGA 1ACYH 1FGNH 3T65A 1WK0A 2DQFB 4F33A 1KJ2B 1GYAA 3KLSA 3U48A 3FT3B 3K8LA 3QZWG 2P5EB 4Y4KD 2XV6B 4B7LA 4MS8C 5IHZA 3LDBB 4OCYH 5IG7B 3VXMA 2UZIL 4YPGA 3RNQA 2Q7YB 5EORL 1IGTB 1OP3H 3B2UC 5E99L 3MRKB 4NUJA 5AZEL 2WNGA 1ZT1A 4DN3L 4KMTL 4KJYB 3GJFB 4OAWB 4TNVF 5BO1L 4C59B 2WINA 4YDJB 1UKQA 3DXAA 1ZHKB 3H9SA 3QFJA 1QKZH 5LG1A 1BBDL 5DD1H 4LEXL 4MSWB 1W72L 4L8SB 4GQPH 1ADQL 3BIKB 2W9LA 2DTML 2EE9A 5CFHA 5JHDB 3SDCB 3HNVH 2ZOKB 3O2DA 2QQNH 3IJYA 2V2WB 4OZHE 2NY2D 4MX7A 3D3VE 4OLUH 4S11A 4NRXB 3RDTB 2GSIB 3PWPA 4EN3D 3T09A 2A73B 5J6GB 5FM5O 2Q76B 4NKMA 3KYOA 1G7PA 4G5ZH 1RJZA 2NX5B 5D1ZC 1HQRB 2NY1D 2Y5EA 1JFQH 3MUGA 1OP5H 2BSTB 4L4VB 5GRVL 1GOFA 1T83C 2H26A 5JW4R 3BKJH 1JHTB 3SE3C 3TZVB 1KCVH 2NY4D 1UWEL 3IU4H 4FG6D 2YD5A 2BVPA 5GGRB 4RISL 1HCVA 5EA0H 1U8PB 4ZUWA 2UWEE 1JGEB 4JY4A 4JFYB 2I07B 4ZUSA 4MJ5B 3S37L 3UBXA 2AP2A 2Z8SA 3QH3B 1XFPA 4EI5B 4X7FC 1U6AL 4JVUA 4NZRL 1BX2B 1MJJB 2D7PA 3DI2B 4PJDF 3Q6FB 1QVOB 1RJLA 3HI5H 1T03H 1ZT7A 3DECA 1CFNA 4LVNB 4PRHE 5I8OL 3W2DL 3FQUB 2OJZL 3QUYB 2VDKL 4D0BA 3T08A 1RUMH 3BEWB 4I18A 3CAFA 3AMKA 3ZYIA 1T3FA 4Y5YB 5IR1A 3RUGB 3WO4B 4YGAB 2IANB 5LQBH 5T1LD 3ILPB 4ELMF 5CJOL 4PGJA 4M7ZC 4HS3A 2ID5A 1YEDA 1TVDA 3LQMA 3TVMC 3NVQA 3OGOE 5AUMA 3TJHC 1IEBB 1M71B 5KS9F 5EN2B 1XIWA 3MRPB 3N1FC 3TNMB 5JR1H 2PYFB 4YE4L 5DMKB 4HFWA 1PG7L 3GFUA 1JPST 1CD0A 1MVUB 4U1LB 1MIML 4DN4H 1EEZA 2C3GA 2DLGA 2A1WL 2DL9A 1ORSB 1WV7T 2EDYA 4CADB 3B6SA 1GGBH 1CK0L 2YPVL 5F6IC 5EOCH 4QGYA 3LSOB 4XCNB 2D0GA 4JRYD 3NGBC 4YBQC 3U46B 5C07A 4P4KC 3P30H 1J0ZA 4JFDA 4YDKL 2QV2A 1WBXA 5B39G 2XY1A 4BJLA 5FYLL 1MIEL 3RWFA 4LNRB 2VL5B 4PJEB 4Z18A 4FFZL 3QWRD 4NQEE 2JK5A 3MJ7A 1FO0A 5I1JL 2D03H 1CFQA 2NZ9D 3SE8H 5DJ2A 2HVJA 4TUOA 3HZMB 3VGHA 3H9ZA 4HGMA 2F5AH 5CJXA 5D2NB 3FRUB 1YQVH 4L8BA 1NH6A 4PJEE 1AI1L 3VI4F 4FQJH 1T7YA 4WV1A 4NO2A 15C8H 3EKCA 3RIAK 3C8KB 1C1EL 5D7SL 1CLCA 1BFOA 4LHUD 4P2RE 4QY8A 1RJYB 1T5WA 3KNBA 5L0QC 4JREC 1JNNL 4XWGH 3WFDL 4FZ8H 3DHMA 3C60B 4W6WB 5FA4A 1TJHL 3LD8B 3RGHA 1NGZB 4NC0B 2DF3A 5EOTB 5C08B 4G6FB 4W6XB 4ZOCA 3V6OC 1ZLWK 3WUWA 4WCYL 4KZEH 2FGWL 5J56B 5DQDH 3ZE1F 1C7TA 3MYJB 1RUAL 4OLXH 4OI8A 2ERJB 1WCQA 1G7IB 4KVNH 4YXLL 4CRPA 2VZ3A 4IOSD 2F19L 3Q2CA 5ETUB 4ZTPH 4I3SL 2ATPB 5IB3A 3NN8B 1E27B 1IGIL 2OXGA 1X4ZA 3GBNL 3WJJA 2G9HA 4G6FD 4JFQA 4KK5C 3SO3B 4JFOA 3U4AA 1D5MA 3OHXB 4YHMH 1NCNA 5K9QI 4UOW0 4D0DB 4TVSa 4G9FB 5DD6B 2VAAA 1DBJH 3LEVH 2K7QA 1A3RH 1NGYA 5IB2A 2NY7L 5IWLA 2YC1A 5DD0L 3O6ML 4LQFL 1FNGB 2VXUH 4JRXA 4PLJC 5FV2A 5KSUA 4MXWL 5HHQA 3R0NA 4PJEF 5DJYB 2P45B 3D39D 4OSUH 2UVFA 2OMNA 3L3JB 2NY0C 1YUHB 3AS1A 5FGBC 1CDCA 1I8LC 5B22A 4GBXA 2Z31A 3FJTA 1NCUA 4KY1L 2UWEB 2H1PH 5HHVH 3ESUF 3F7RA 2C3VB 2YA1A 3RWJA 2IH1B 5JXEA 4B7IA 4NUGL 1UH3A 3FFDA 1QEWB 4JFDE 3P11H 2B2XH 4LASL 3NZHL 1SBSL 1A1NB 4QOKD 4NBZB 1FP5A 5D5MB 1MFEH 4KKCD 3NCBB 4QRSB 3RVXC 4JZJB 1H8SA 5DK2A 3ZE2F 1LK3L 5HY9B 3RVTC 2J8UE 1CBVH 1JF1A 4ZNEA 2D4DA 1EZVY 4S2SB 3V4PL 2R0KL 5MP6L 4P48A 4MCZA 1A7NH 4BSWB 3C5ZA 2K7PA 2IBZY 1WSST 3QFDA 1IBGL 1MEXH 1CD1B 1NMBL 2R1WA 1IM3A 4JO1H 1ED3B 5I1GH 3RWCA 4P4KD 5D1ZD 2X4QA 2P48B 5JXAL 3KPOA 1ZE3C 3BP6A 1LO2L 2ILLA 4M7KL 4J3VA 4RZCA 1RMFH 4JM2F 4QTHA 4UZGA 4KJWD 3RI5F 4XX1G 3VGAB 4HS6B 3FRPG 3CXHK 1EJOH 2OTWB 4JRXD 1XF3A 4O51A 1UWXK 2W0KA 4GO6B 4PJHA 3DMMD 3TJHD 5DZLA 3U82B 4OGAC 1FPTL 2J12B 1AXSB 5BMFL 3P40A 3MRHA 4X9HA 3MLUH 1H0DA 4EQ2A 1NBVL 1AJ7H 4UMGA 5F97E 3L5WA 1G84A 1F6AB 4S1RL 4Q9BA 3OX8A 1ZV5A 1FZMA 4ZOEA 4XBPB 4U2ZA 1G7QB 4H8WH 3B9AA 3PNWA 3ARFA 4RAVB 3O4LD 4PLKD 5MERA 3HZYB 3KS0H 3SE4C 5ID1A 5DJ0A 1PEWA 2OZ4A 3ARZA 3LV3B 1RURH 3E8UH 3BISA 2C3VA 2XYCA 4AEIL 1EJ6A 2VMFA 2X6MA 3MV8D 5DQ9B 3WS3A 4D9RD 1BQUA 4HLJA 2Q3AA 4IRZL 1IFHL 3B5GA 4FNLL 1NC4D 5F9JA 1A9BB 5C0AD 3TF7C 4HC1A 4E0RB 2O5ZL 1M4KA 2RFXA 3FB6B 3D39E 1CICA 1HZHL 3CNKA 4UQ3B 4PRHA 2NY2B 4XVTL 5EWIH 1IAIM 4NOBA 4LLUA 5DUBA 5C0BD 4U6YB 2LU4A 3ARBA 1KFAH 1C7SA 3GK8H 3R8BB 2AXFB 4NBXB 4XNYL 2ATKB 2XKNA 3UPRB 3AROA 4PTUB 3LRGA 5KSBF 5F3HB 1G0XA 1QRNA 3GSRB 3WHE0 5GRZA 3WUWG 1YMMA 4WTZA 3RQ3A 4PGBB 4QRUA 4MJIA 1D5BB 5KAQF 5DS8A 5GGSY 2EYTA 3K8KA 2VH5L 4R2GB 2APVA 5KW9H 2DMKA 3ARVA 3E3QC 3LIZH 5D5MA 5C6TL 5J3HC 4Y5VA 5GXBB 2PYEA 4J4PD 1K8DA 5EUOA 2P5ED 1WEJH 5C92A 3OKLB 5GGSB 2PKDA 3DGCR 1JMXA 5C9JB 3HNSH 3L3HB 4LVOB 4YHPB 2CLZB 4Y2DC 5E2JA 1G7LB 1HKLL 2SEBB 1T1YA 1P4IH 2WW8A 4PLKC 5F7EL 5DRNA 4XB8A 5I17A 1OGTA 4XMPL 4K7PY 2FB4L 3TT3L 3CSYB 4UIKL 1AI1H 1GZPB 2CDEA 4TPRH 5CP7B 4I5BA 5DUML 2NXYC 5KW9L 1FGVH 2WIIB 2VAAB 5ILTL 4B0MM 4HWEH 1CFQB 4LDEB 4POYA 3TCLB 1NC2D 5KN5B 4F9PC 1Y6NR 1CXIA 1N26A 4FMKA 4OLWH 3P0VH 1PG7X 1RIHL 3QHZL 3BMWA 3ULVH 5E94B 1N59A 3GSXB 4O2EB 1A2YA 3VD3A 4NN6B 5KSAA 3GO1H 3REVB 5HYFA 1IC1A 4HK0B 3DARA 1RHHB 2EEBA 4HLZG 1BD2E 4R26L 2I9TA 4ELMB 2DQGH 4PJIF 4TNWK 4NNPH 2YD4A 4JRYB 4XNYH 3EHBD 3QDGB 1AGDB 1DFBH 3KPRD 4RMRA 3OKNB 2W0PA 4HKZB 1BFVL 3S36H 1FL3B 2BVQA 2FJHB 2V5MA 3DV6B 4NPYA 4LLMA 4PP2B 5GJSH 2LAAA 3CMOL 5L9DL 3PP3K 1K8DB 4CL7A 1CF8H 1GGIL 5FUCC 3UO1L 4TUJA 3IFPA 2AKRB 1X5KA 4JM4L 4KVCL 1KJ2H 1UKTA 1DUZB 3BJ91 4IRSD 2VWEE 5EZJB 3UTZB 4ZAKB 3U4BH 3NOIA 3CMGA 3EYOB 4QTIH 4I2XE 1FVEB 4D3CH 5L2KB 3BQUD 5JNYA 4POUB 3NCFB 3V4UL 3WUWB 3BH9A 3SPVB 1JYNA 4PJ8C 5LQBL 1GJIA 3O6KL 1UYWL 5D5MF 1DBKH 2HT2D 1KSRA 5EUOB 3QUYD 2R0ZH 1YMME 2DQIH 4GH7B 3F6LA 1UM4H 4PS4L 5C0GB 6FABH 2IFFH 4HIJB 4UDUA 5KG9B 3MXWH 4KAQL 4M61A 4QT5B 4KTEL 4JM2D 2H32H 5BMFH 1IT9H 1EMTL 3D18B 4PJFF 4R96B 4LRNH 2EDBA 3BMVA 4X7DC 5D9SB 4F7TB 3P4OA 5LBSH 4L8SC 1CE1H 1FFRA 4Z7UE 5IIEB 1MFAH 2ZZUT 3D0LB 2CJUL 4OZGF 2Y72A 3ARUA 3C8HA 3PGFL 5I75C 1UB5A 2AERT 5JQ6H 5KSAB 3MXWL 1A7OH 1T66D 3DIFA 4RIRA 2QADB 3VFMA 1RIHH 3QHZH 3GBMH 2W9EL 4AIZB 1BOGB 4HIHB 4KUCD 4JZNA 2VABA 3OB0K 3ARBB 1MWAA 4X4YB 1R3KA 4HWEL 2ZUSA 5EO0A 4MQ7A 2B5IB 2YUZA 2CD0A 1F3RB 3PDOA 3O9WD 2BY0A 4NN5C 3T1WA 1FVDA 3TO4B 3B8YA 2VWEC 1IEBA 2V5TA 3OTTA 4I8DA 1SM3H 5MP6H 3LN5B 4L9DA 2HTKD 2AGJH 5CHNA 3T77A 1MCLA 4HUVA 1BGXH 3BOVA 3LEXA 1A9BA 5GJSL 3QXDB 5L9DH 3VXUA 3H7BA 3EAKA 4U1MA 5IW1B 3B2VL 4L4VE 5D1XC 2JIXA 2H9GA 5IEHB 1QBAA 3VXRD 1MREH 3VFTA 5EDXA 3U4EB 4X0KB 1ADQH 4ZO8A 4GKSA 3IXTA 1GHFH 2E5EA 1U36A 4M9PA 4NHCH 4P57A 3AM8A 4FZEL 4PJFE 4QRRA 4NUGH 2FX8H 2AJSH 3SGEH 4UDUB 3VWKD 5C71A 4MNHA 1RFDH 5C0NC 1ZT4A 4XPFL 2OJEB 1JGEA 3OB8A 3D39A 1CXHA 2OSLA 1EZVX 3VFNB 1RIVH 3AY4C 3BH9B 3SPVA 3WNKA 2FJFA 3KDMA 1VADA 1AHWC 4U1SA 1YEHL 1NFDA 1DN0B 3VFPA 1A3RL 4PLNC 4BUHA 1U8MB 5GRXG 2DM4A 4HS6A 3L3IA 4U3CA 1EH9A 3CU7A 5A16B 4MNQE 4IRJC 4JFFA 4NWUH 3O4LE 2VLRA 3GBNH 3ARWA 3H3BC 2AXHA 4CMMA 1F4XL 4JCMA 2YEZB 2R2HB 3MRJB 5CIPA 3DRTA 4X4YA 4OZFG 5GS2H 2J8UA 2ZP0T 2BC4A 5KVFL 2OTUB 5F71A 3PL6B 3QDME 3SDXE 3O45A 5K33A 1AC0A 4ZUTA 2VXTH 4GFTB 4P23D 1MCOH 2Y1VA 3CXHJ 3ROOB 4XC3L 1J8HB 3EYFB 1R3JA 3GSUA 2GTZB 1CFVL 3O41A 3V52L 3MUZ1 3W0WA 3SDDD 2J8UF 3TCXA 1LNUB 1UCBH 1K4DB 2EDQA 4PRNA 2D7NA 2MKLC 2Y07H 3PP4H 4DZBB 2NY3C 5INCA 3GSNA 4NCC1 5D1XD 3HPLA 4G43A 3V5DA 2H3NB 1AJ7L 5HDBF 4QCIB 2PCPA 3MRBB 4OZHA 5C0RL 4M3KB 5D7SH 5I71C 1SY6H 1JWUB 2VL5A 4PJEA 4PG2C 1FSKC 1BBJA 2D9QB 1X7QB 3U0TB 3SDAB 5DHYA 1WBYB 4N1CA 4OM1L 5GGRY 2ARJA 1H8NA 2BVYA 5HYSB 3N0PB 3HC3H 1L7TL 1RZ8B 1WZMA 1PVHA 2X89D 3L7FB 3D1MC 4RMWA 1QSFD 4IRJA 2A2QT 4UT9L 4ZUTB 1QYGH 2VXVL 1RK0B 4U1GB 4Y5VB 1OQXA 3INUL 2KQMA 3LHPH 4GQ9L 1W0WB 1V3MA 5F7MC 4I0PA 5L6YL 1WZ1H 2DICA 43C9A 4DGVH 5ESVB 1CK0H 5D1QB 4MDIB 5DT1L 4TULH 4ZUVA 2X4RB 1WCBB 4UILL 5IB4A 3GNML 4RMSA 3THMH 5ITBL 2GK0B 3AS2A 3OSKA 3QIBB 5HGAB 4Z8FH 1BQLH 1LK2A 3BN9D 3WUZA 2P24B 1HXMA 4DWHA 4MD5B 5E94A 2XOTA 4JQIH 4J3SA 4YWGL 4EIGB 2UY6A 5DK2B 4Q2ZA 1RZKH 3KPQB 5CEXA 3AREB 3CH8A 3V4VL 2OTPA 4GXUM 3EYVB 3QXTA 1MHEB 5EOTA 3TCLA 5EO9B 1LMKA 4FQIH 2OJEA 3BIBX 4NP4L 4ZPVA 4KZDH 1YN6B 3Q6FA 2DQEL 3P73A 5IKCB 1ZS8B 1WFOA 3CSYA 5T3ZH 5DJZB 3DPBA 5DJCA 4JZOA 2J8OA 4JFYA 4AEFA 5DMIH 4N0UE 3ZSSA 4JVPA 1XZ0A 1A7OL 1E6OH 3K2MC 4HZAA 4OM1H 3TIEB 1R3HA 4XH2A 1RZGA 3DROA 1G7HB 4CNIB 1SY6L 3O9WC 5C0EA 3B9KD 3G6JB 4QRTA 4P5TB 3OPZH 3CH1A 5LWYH 3GMLA 4HIIA 5IB5B 1DL7H 1H3VA 4OCSH 4V2CB 4N0FA 5DGRA 3T4YA 4LSQL 1FDLL 3IDXH 3BYYA 3S3PA 1EHLL 1U8IB 4G7VL 3VRLE 2AS5M 4N9OB 4LOUD 3MGTA 4I0PD 3QP3A 3TA3B 3K2UH 4BYHA 2J88H 2P8PB 4GMTH 2VXQL 3QQNA 4X7TB 3BPLB 3C60D 3Q1SL 4PYHA 3NIDE 5DJXB 3QDMB 1YMMD 4DTGL 4ODVH 2VERN 4FQXD 2VE6A 3MRPA 4LLUB 1OCWL 2PO6C 5DUBB 3CMOH 4OCXH 2DN7A 3KPOB 1IRAY 3VXTB 3WS6C 4MXWH 4QRQB 2UZXB 4O5LH 2B1AH 4OTXL 4QEGA 2RFXB 4X98B 5JW5A 4HIJA 4K9EH 5CZKA 4S1SH 5C0GA 4K2UH 1QKZL 5I1HL 1ZANH 3OQ3B 3WCYA 4PJDA 2YKLL 3HC4L 4NFBA 2K9UA 3BPNB 1JTOA 4F7PA 5CBAA 4WO4A 3FB7A 4YHIA 5C7XH 3W39A 2C4FT 4RAVA 3S3JA 1INEL 1AR1D 3TBVA 4ZSOA 1DLFL 1NC4A 4WEBL 1MIEH 5DVNA 2EXWD 1QLFB 5D7LE 5T5NF 5K59F 1H0DB 4UV7L 1JGLL 5FCUL 5I1DA 1CGYA 1JWMA 3UMTA 3RHWK 2ZUXA 1OGAE 4P46C 1MREL 3UYOD 5JOPE 1G9EA 4MD5A 1VFAA 3FCTA 2F8VA 3IRPX 2LAGB 3UC0L 4ELMA 1CFSB 4M8VA 1UJTA 3HUJA 5HYJB 1LEGB 3Q3GA 2B0SH 4FFYH 1CYGA 2VLKE 2MKWA 3QRGH 2A6DB 4L4TB 3TYFB 3WHE1 2HWZL 5ICZB 1N59B 3GSXA 5HVGB 3GRWL 4HBQA 1T2QH 5B4MC 4HF5L 1ZGLP 4OQTL 4HPYH 3MMEB 1F02I 4JFZL 3WIIL 5F1SA 1L6XA 3EJZC 3X3GL 1KLGA 2IAND 2N4IA 2PN5A 1BLNB 2CGRH 1E27A 3ROLA 3VGAC 2V9RA 5IG7A 1GZPA 3HS0B 5E7FA 4R4ND 4WFED 1JGDA 3FB8A 4GG8A 4N9GB 5E8OB 5I8OH 5KSBE 1J1XL 4OFVA 1S9XB 3QDJD 3QEQD 5HGHB 3EUUA 5DJAA 1MFAL 3IAGC 1OOAA 3HG1E 3H9YA 4HF5H 2VUOA 4TSBH 4XPGL 5EPMB 3OG4B 3GKZA 3GI8H 3O3DA 4G6MH 5GRYA 3GRWH 4LRNL 3BDXA 4YGVA 5E9DB 2ARJQ 4IRSA 5HYJE 4NM4L 4V1DA 4X9BA 4KTEH 5LGJA 3PIQA 3HLAB 1IEHA 4U0RB 5IFAL 4U6XB 3BWAB 4XCFL 5IROC 1Q72H 3BKJL 3G5VB 4ZQKA 3OKNA 3O2VL 2YD9A 1D9KA 1TNNA 5TFSL 4KTDL 2A6DA 4L4TA 4Y2OA 3OR6B 4F7MB 3ARBC 5D4QA 1RJZB 2NX5A 3OAZK 1JGLH 1NANH 1LO4H 4LARH 4XB7A 2YBRB 1T7XA 1Z5LA 4NWTL 5ESQB 3RTQC 1ES0A 3U36B 3STBA 4JFXB 3REWA 3T3PE 3CFJB 1J18A 4LNRA 3W5MA 2GY5A 2YPKB 4YHNA 5GS3A 2OJZH 4U7SA 3NCYP 3IU3B 1MHPL 4CU6A 1YJDL 2Q6WB 1T4KA 3WE6B 1XR9B 2KBGA 3PE9A 3EOTH 1MI5D 1YN7A 4I0KA 1YEDB 4FQCL 4NJ9H 5FUZH 3WFBH 4YHIB 3FN0H 1BVLA 3MOQA 4JM2A 2WP3O 2V2TA 2ADJA 1QACA 3GM8A 5L88H 4X6CA 3LEYL 4RISH 4PJBE 5E8EA 5FO7A 2PTTB 5E99H 1EUUA 1KYOK 3VXRB 1U8JA 5HD8D 4ONGL 1RZJH 1T20B 3QO0B 5D8JL 2D7OA 1H5BA 4CJ1A 3MV9B 1I4FB 1KBGL 2FB4H 3RL2A 4ONGH 2FO4B 4RGNC 1KEMH 3TV3L 4DGIL 4M5ZH 3GJEA 4QHLA 3O0RL 4H0IA 3CDYA 3MNVB 4LDLB 1X5AA 1TQBC 5A3IC 3Q3GB 2IC2A 4QXGH 3UBXG 5AG9A 1FFPB 5IFAH 4KJWC 3JUYA 3P9MA 2DLHA 5I1AB 3WYRA 4Y89A 1M6OA 4F2MA 2FRGP 4KHTH 2EE6A 4LSPL 3OAZH 4FABH 4LK4A 3NFPA 5IJKC 3WO3B 3LKPA 1BZ7A 1CE1L 1UA6H 2A74A 5FGRA 2BRQA 1I7ZA 1FORH 2HA1A 4MXVF 5CEYB 2YPKA 4DW2L 3FHAA 3VFOA 3DYMA 4OZGE 2C4FU 1DBAL 3QUKA 4MWFA 4RIRB 2AW2A 2HN7B 4GRLA 1VSCA 4G8EB 2Q8AL 1OAQL 3DGGA 1KIPA 5SWSB 4KXZH 1HSAB 3SGKA 4D3CL 1LD9B 3T1FB 1OGAD 4HZLA 4HUUB 2RJMA 3ZYZA 1F6LL 2F54D 4TUKH 4HX1A 2AEQH 4PP1D 5D2LB 2C1OA 3RL2B 2DJUA 4FFYL 4P99A 4KK9C 3RAJH 2V7NA 3GHBH 3OX8B 4F37K 4LPUA 3RGVC 4NM8L 3WNMA 4KKBC 4YNYA 4ZAKD 1DQLH 1U58B 4IRSB 4LIQH 4U1JA 2H2SC 5A2IH 2P5EA 1GAFL 4X6DA 3BT2H 3JVGA 5DJAB 2AEQL 2P8PA 3RVUD 1Q9LB 2DQGL 2X5PA 4PP1C 3VWJA 4HBCL 4JFEE 2DBLL 5IEKA 1GIGL 3UTOA 4OIIL 1H3PH 1ZT1B 3DSNA 1G6RL 1U9KA 2GEEA 2APXA 1EUTA 5E2TH 4OBSA 4ZTOH 5C7XL 4XI5C 4LAJH 1OAKH 3QUXD 4K23L 2I60H 5GQBA 4KRPC 4PTTB 4X5LA 1P6FA 3OXRB 1IMHC 3BWUC 1U3ZA 4HS8H 1FGVL 2DQFA 4U1IB 4MJ2A 4QHUA 2E9BA 4MXQD 4KKNA 4GKZB 3WKML 1J1OH 5IVXA 4GKOA 4OF7A 1CR9L 2F8OA 3K4DA 2YWZA 4HAGA 4ZFOB 1MJUL 1CLOL 1QHPA 4NQCE 5AZ2H 1FNSH 1ZA3A 1EHNA 1LVEA 2ARJB 3TN0A 5HYSA 4P46B 4XI5D 3DYOA 5HVHC 1VFAB 4GLRI 2MCPH 5KJRH 1RUQH 2F8XC 3Q1SH 2V2WA 5KVDH 3G5ZA 5DI8A 3ZYOA 4HK3J 2LQRA 3A0OA 4WV1C 1AKJD 1A6ZA 2EEDA 1XF4A 4YPJA 3MNWB 1VGEH 1RU9H 2FHBA 1A64A 2ADFL 4LCIH 3C09B 2HJLA 4IOIB 4JB9H 4QHKI 2F58L 4OIAA 2VDLL 3EYVA 4V1DE 2XKUA 5JPNB 5DTFA 3MV01 5FYJD 5T1KB 2VLKD 5I9QC 2BOBB 3VA2C 3E6HA 3KJ6H 4MNGB 1S7UB 4YDVB 4G9DB 4JKPH 1QPPA 2KZ1B 2UVEA 2D0HA 5CMAB 3LZFL 1NGXA 1N5YL 5C2UB 1ZLUH 3FQWB 3VDBA 1EO7A 3KPRE 3X17A 3S4SB 4NJ9L 5HHNA 3MV9E 3GK8L 4BZ2L 3WHXB 1BLNA 1A4KA 4WTXA 2CKNA 1LE5B 1HOCB 5DURD 1EIBA 1U3HD 3RX7A 5EOQH 5F21B 1HQ4A 2YD2A 5ALCL 4W4NA 4LSRL 4H88L 5CJOH 4KPHH 1GC1C 5SWSD 2GFBB 3SE9L 3GSQA 2QQKH 5T3ZD 1VFOA 3L7FA 3FFCE 4H20H 2VDKH 1FG2B 3RWIB 4DTGH 3EOBA 5JW3H 4MD0A 2C3XA 1RZFL 1NBZB 2NY7H 2PXYD 3MODH 1PY4A 4RGMC 4P2OA 4P59H 1VEPA 1UQSB 4RGOL 1HSBB 3IJSA 4M1GL 4PJCE 5DRWB 5JLZA 1NGZA 2XZAH 1JZ4A 4LHUG 3TNMA 3RZCB 3UJJL 3BHBB 1CDHA 3PWNB 5ITBH 4PBVC 1YY8A 1BFOB 5CSZB 1K2DB 5SX5K 4RFOL 1GC1H 5BW7A 4JJHA 4XBEL 2AEPH 5E9DD 4BQ6A 2DIJA 2OZ4L 3QHTC 4RDQF 1NAMA 3TH2T 3O0RH 5C0CA 1WISA 4JQVC 1ZWIB 2WWMC 4YBLB 1VGEL 4HH8A 1FCGA 1CQKA 3W9EB 5DMGD 1E4XI 4PJGA 3HC0A 3ZT7A 5T1MB 2BFVL 3LOWA 4GW5A 5I1KH 4Q74A 1AQDA 1IGYB 4LP4A 5FK9A 3MJ6A 5TGBA 4KJPD 4PV8A 3SKJL 1JNLH 1L7TH 3U7AA 3MRMA 2CIIA 1T4KB 2ITDA 2KPNA 4NNYA 3T0XA 1UT9A 1YNKL 3T2NH 3I50H 5GSRA 1YNTB 2PUQT 3N50A 4H8WC 4LLWA 1XF5A 1HIMH 4TNWF 1CDGA 5MEPA 5BV7H 3QDMA 2GIYA 4JFZH 2VC2H 2EIZB 3B9KA 1NJ9B 4HPYL 4OQTH 4IOFD 4JVWA 3BGFB 5D7KE 3I85A 5I8CB 4OD2B 4JPVH 4DK6A 1A6WH 3B3IB 3L5JA 4JJ5A 4Y4HD 4X5XB 5DYOA 5D1QC 3PWNA 2CK2A 1WUNT 3OXRA 1P1ZA 1EEYB 1T5XA 1MPAL 1REIA 2APWA 5DJ8A 1UZ8B 4OIIH 1YEKH 2C4XA 5JLZB 1R5VA 3CJJA 3HE6B 5IV2A 4ZYKA 4P4KA 4HKJB 3C5ZB 3GMMB 1PW3A 3F7QA 5ELIA 1ZVHA 2X9XA 5KVFH 1BWMA 1A0QL 4R97C 4R8WL 4Z7QF 4M43H 1QYGL 2XY2A 4HPOL 3FB5B 5HGHA 3UYRL 4Z0BH 1TVHA 3TC9A 5GJTL 1SEBA 1PSKH 2HG5B 5DGQA 1JYWA 1OTUD 3PWLA 4X7EC 1JGDB 5AZ2L 1TETH 3F5WB 4PV8B 3ARGC 5I1HH 4PR5B 5M7QA 3TVMA 3P0GB 4H5SA 4ZUSB 4KUCF 5GGTL 1WLHA 2EYSB 1J1OL 3WFHB 2R0WL 3O3AA 4N90D 4Q6IB 4F7PB 2EDFA 5AAWA 4QHNB 1AD9B 5A2KH 1F4WL 4KRLB 3TZVA 4KI1A 5BW7C 3QDMD 5DHVA 3VCLB 3SKJH 5KS9B 4FTVB 4JG0L 3W2DH 4P9MH 3SO3C 5B8CA 2FH6A 2EKSA 1OLZA 4LPCA 1I8MA 1RHHA 4M6NL 5D96C 1NGYB 5IB2B 5IP4A 2NY5H 1B6UA 2PXYC 1U6AH 4J12A 1A9EB 2X7LB 3MNWA 2W59A 3BHBA 4HBCH 5TJWK 2Q86B 2E6JA 5DFVC 2IPKB 2RHEA 3B9DA 4YHNB 3G08B 3ULSB 4MNGE 5D6DC 5HHOB 5FOBA 3KPQA 5CEXB 3UTPD 2FD6H 1MJ8H 3QWOA 5AWNH 1MRFL 3P3YA 5ID0A 4HWBA 3BPLC 1GH7A 2P24A 3UC0H 3ARYA 1TZIB 4NJAH 1NEZG 4XT1C 5A16A 5HGAA 5ACMA 5E9DA 2GK0A 2AGJL 1EV2E 4BKLB 4YC2C 1I3GL 2OL3H 1KT2A 3MROB 4IDJL 2R29L 5JNYB 1VGKB 1YQVL 3H9SB 3IF1B 3QFJB 4XXDB 4GKZA 1ZLSL 3D6GA 5ACLA 4NQCA 2Z9TA 5GZOD 5F44A 2FWOB 4J7RA 3ZZ1A 2VH5H 1E6OL 3ETBF 1RZJL 2ENYA 1IAKB 4L3ED 4NUJB 3FFCD 3MNZA 1QRND 4PTTA 2D7QA 2DLFH 5T5FL 1CU4H 1U8LA 3UJIL 3GJFK 5H37G 2EC9U 3EJYD 4RDQG 3HUJE 4JCLA 4BK5A 1MHCA 4OGXH 5JQ6L 3UTTB 1RFDL 1RIVL 1KPVB 3FT2A 4UINL 5ISZE 4QO1A 1CE6B 3SDXA 1BIIA 2FLRT 5JIPA 5KTEL 1RSFA 3NZ8A 4D0CB 2VSCA 3O8XC 1XZ0B 3WFCL 1EDQA 4K71B 5DHYB 5INDA 1RD6A 1BVLB 1P2CA 4P5MB 1CGWA 2ZUQC 3TYFA 3ARED 2ZCKH 2JJSA 5GGUA 1YN7B 1XGQA 2XPGA 3L6FB 4HIEB 1RZKL 4XP6L 2ITCA 1FN4A 1LO0L 4DN3H 5DJ2B 4BFIA 3IGAA 2W65B 4NWTH 1A6ZB 1H3UA 2GK2A 4YE4H 5HGBB 3O6LH 3VJ6B 4OFKA 4M4RA 2B5IC 3A6CL 4PRNB 1I1RA 4H1LG 4D9LL 1R24A 1UACH 1FFNA 4JFDD 5TE4L 5TFSH 1FGNL 4LARL 4WUUB 1KENL 3GSUB 3OGCA 5IMMA 4LLAA 5FUCE 1I3GH 4O00A 5KVDL 4D8PB 4WY7H 3IDXL 1WWCA 3U9UA 1J9CT 2D7TL 5E8NB 1ETZA 2YA0A 1IARB 3VFNA 4CN4A 1DFBL 1N8ZA 4I3RL 2EYSA 3WFHA 5C1MB 2DD8L 1I7ZB 1UFUA 2Z8VC 3B5HA 5BCAA 1QPXA 4E41B 1SJEA 1ADQA 1J1PH 3ZT6A 4FQCH 2AJVH 1XGPA 1AGCA 1V7ML 3GHEH 4WU5B 2VITB 3MTRA 3ZHKA 2NY6C 1OF2A 4Q6IC 1WBYA 1WIOA 1KB9K 4K23H 1VADB 1IAII 4YHOL 2FJFB 4KAQH 4K71C 2A9MH 1G7JA 5E2TL 2FL5A 3SDYL 5C2BH 4HEME 5EFIB 3F12B 2NY4B 3DUHA 4LCWD 3OKDA 3GB7B 4WUKH 1GPOH 1T89A 2JJWA 2ZSVA 2AI0H 1IGFH 4LPWA 4BK4A 4XC3H 3RFZC 3HFMH 3V4VH 1U8JB 2D31B 1AGBA 3IFOB 5LAXB 4UTAL 4KTDH 4TVPE 2HWZH 1B0RB 5CD5D 1FYTB 1FL3A 2BVQB 3D9AL 5KSVB 4HX1B 4Z5RB 4HJ0C 4Z0BL 1LEGA 3HNSL 3O81A 1LK3H 4EZMA 5DSCB 5FF6B 3VXSD 3WXWH 4D2NA 3MUGB 4E42B 1Q0YL 1W72H 4TTDD 4LEXH 1SBSH 4GAJH 1PJ9A 4S2SA 1OAXH 3MRRB 4MAYC 3VXME 1IQWH 4TSBL 1UENA 2PO6B 4WEBH 5BO1H 3HR5B 1C5BH 4LKXA 4U1KB 4LVOC 5I0ZA 4WU7B 2H1PL 2F54A 3G6DL 4PJIB 4FQXA 5KN5A 5EU3B 2XTJD 3ECBA 1GRWA 4KRPD 1AGFB 2VL4A 4MCYA 3WLBA 4OLWL 2BDNL 4M7JL 4QCIA 4NC2B 2CDEB 1N64H 1S5HB 3N1GC 1HWHB 4JO2L 4X6FA 4O02H 2EDLA 3FO9B 1EHAA 4E5XA 4X4XA 5IIEA 2NY6D 4XVTH 5JXEC 3KJ4C 3WO4C 4OD3L 4GS7C 2OR9H 1MRDH 1HKLH 5CIPH 1XGPB 1VENA 3U0PA 2YUVA 3EO1B 2X1PA 4ZTPL 3PP4L 1VEOA 2YD1A 2PNDA 1HNGA 3CSBA 3K2UL 2YPLE 1K6QH 1ZEAL 4PV9A 2MCG1 3OHXA 3TO2B 4WUKL 1LEKA 4GMTL 4YBQD 3V7AE 4NQSA 3OJDA 3DX8A 2W60B 4PRPB 3EYOA 2Q1EA 1JK8B 2X1XR 5IQ9A 1D7FA 3T0BA 4NYLB 5AAMA 3DJ9A 4AK1A 4LPXA 3DX7A 4PRAA 3QNZB 1GC1L 5F9OH 2W07A 3MCLL 3T2QA 1NUGA 4P2QD 5D1QA 4PD4J 1IAOB 3C2AL 3IU3A 3OAYK 1P9MA 2YS4A 2ATKA 2BK8A 1A1OA 1B3JA 3UJJH 3GMRB 3WKNA 3KLAA 4LHQB 3VU2A 3DX9B 3HC4H 4G8GA 5KAQG 1ZANL 4X6EA 1FNEA 5JIIA 4RGND 4K2UL 4O9HL 1FH5H 5E08H 3MRIB 2OMBA 3RKPA 5F96H 1YEHH 5D7JC 5DK3A 4B50A 5ADPH 3EO0B 3T0ED 3B2UD 5ISZA 3PV7A 4HPOH 5TDOB 4PRIB 3QCVH 3TT1L 4Z7VA 2B4CH 3BUTA 3S5LA 1E4WH 4QF1A 2VLKA 4E5XB 1NBQA 2J6EA 3NPSC 4X7SL 4Y16A 5FGSA 5DLML 3NPSB 4CDGC 3L3HA 1KNOB 2GSGB 4IHOA 5BVPH 4UT7L 5KG9A 5D6CA 1AO7D 4I77L 4NKDA 4YDIH 5BZDB 3CFEA 1KJ2L 3HCVB 4IMLA 3HE7A 5GRWA 4IIQC 1I9RH 1OSZB 5F7WC 3L5WB 3Q5YA 5FECB 2A6JB 4X4MA 1Q72L 3VXNA 1S7VA 4YWGH 4DUXA 4XAKD 4JKPL 4G8IA 2P5WD 5DVKA 4U1NA 4L29A 5K59E 1G7LA 2SEBA 1A6WL 2RB8A 2DBJA 5C0AA 4L3EE 1B0WA 4EQ3A 3BESR 2VKXA 2HKHH 2BNQE 4TTDC 2VKWA 1TZIA 4MJ4A 3SCMB 3IDMA 4QRRE 3HE6C 4DGVL 4Z7QE 1YYMH 3X13B 5JOEA 3KDMB 1JUFB 3MMEA 2JF1A 4OV6F 1BWWA 5IT2L 5CAYB 3FO0H 2EC8A 4F37F 5HDQL 4HUXB 4M7KH 2A0LC 5ABDE 2FHFA 3AFLA 1G6VK 3MGOB 3PGFH 1D6EA 3L95A 2WUBH 4WNQA 4I9WE 1P4LB 3BKYH 1YYML 2Z35A 2CRIA 5CSGA 5EFIA 5HVWA 5I76B 3IKCB 3LRSB 4HMDA 5I8CA 4TPRL 4KZDL 3DX6B 2YPLD 3O3EA 4RRPA 1GOHA 4D0BB 4ETQA 1GOGA 4X6FB 2VLRE 4PGDB 1FJ1A 2W9DL 2Q8BH 4NO5A 2R0KH 4OKDA 4L4JA 2P5WB 3VXNB 4ZAKA 1CGXA 2Y25A 5JMOC 3T4AB 1W72B 2E6PA 2ENSA 1HHGB 2PYED 4IMLB 4J4PA 5L8KB 2XZAL 3VI4E 1MQ8A 3HZVB 4R0LB 1CFVH 4I48B 3V52H 4G5ZL 5D2LA 1UCBL 1G9MC 4XP1L 3BQUB 3BRFA 2Q87A 4JRYE 1S7QB 2BERA 4XCYB 5HHVL 1BD2B 1H3WM 1GGIH 1NAMB 1JZ2A 1RULH 1JPSL 2XWTA 3G5XB 4I4WA 4N68A 1CDYA 4HGWB 3ZE2E 2AJUH 5F7LB 5E56A 4U0RC 3ZE1E 3RUGE 4N0UA 1FNEB 5JOFA 1Q9OA 2HLFD 2EYTB 1DBBL 2VDOH 3O11A 4EOWH 4GW4B 4OLYH 4CMHC 1G9MH 3LVEA 1S78C 5ESAA 5I76A 3V9FA 4Z0XA 4AM0B 1CFTA 2FZ3B 3QNZA 2FO1A 5TE6L 2XKNB 3UPRA 3KPPB 2GITA 3D0VB 2MFNA 2P8MA 5GS1B 1A0QH 2WBJC 4JY6A 2EIZA 3QYCA 1J5OL 1M7IB 2HFFA 3MLXH 3TO4C 3FQUA 2GJZA 2VDRH 3TBTB 2CDFB 1C5BL 2OP4L 5BS0D 2X41A 1N7ML 1ZHLA 2G2RB 1W2KT 3MV8B 3FT4A 4PGCB 3V6FA 1U93B 43C9B 3VFVA 3QCTL 3T4YB 1WFUA 5D7LA 3S98A 3KR3L 3MOBH 4FFWD 4JREB 3AB0B 2QL1A 2DM7A 4HIIB 2CIKA 4RFEA 1QR4A 4W81A 5F89B 1I1AA 4KKAD 2F53A 4O2CA 4LLYB 1FIGH 1GZQB 3DLQR 3VFTB 5IEHA 2BHZA 4MQXC 2W9DH 3CC5A 2X9YA 3ZKXB 4MQXD 4HG4K 1Y0LA 1FFOA 4FFVD 3VXUB 3V7AG 5EO1A 3V0WL 3QSKB 3AAZA 3FONA 3MREB 4W4OC 3X3FL 3HMWH 3FAWA 4L9LA 2IWGA 5DJZA 2YRLA 4JRXB 4WGVB 2F5AL 3BVNB 3WE6A 3VFWB 1UJ3A 3ESVF 3SGKC 3VXOB 1YN6A 1MCHA 3QPQD 5A2LH 2EDDA 4R2GD 1RUML 1U91A 4R4NC 4JN2B 3REWB 2X05A 3CFKB 5IBUG 2BVOA 1HEZA 2HMIC 4Z7VB 1QSVA 2K3TA 4FFZH 1CT8A 4N0CC 5T3XE 1F3DH 12E8L 4M6OL 3EOBB 5DEGA 3QIBA 1YPZB 5FYLH 2DMBA 5FA3A 2FYYA 5J12C 1NMBH 4YHYB 4P5MA 3BT2L 1AIFA 1ZVSA 2W60A 1D9KD 4YHYC 1JRHI 1EK3A 4M93C 1V3JA 3VXSB 5C0BB 3QUXA 1Y0LB 4DN4L 4Z8FL 2WQ8A 4C4KO 1YC7A 3IGAB 5C9JA 4HD9A 1RUPL 1WAAA 3NIFF 1BQSA 5EU6D 5IM7B 4WI5A 4HAFA 1BF2A 2LFGA 3SGJC 2XA8L 3C5ZC 3U0PB 3NZHH 3V4UH 5MI0C 2EDRA 3IDIB 4L9LB 3D85A 1A3LL 1B2WH 1UACL 2OS7A 3MV8A 1Q9LA 1TQBB 3E6HB 4MNGA 4QHMA 4WFFD 2C7UA 5JW3L 1IGJB 5H35B 3VFRB 1LEKB 4A6YA 1T1XA 3QJHB 3SJVA 1Q94B 2B4CL 2N1KA 3G9VA 3DHJA 2WBWB 2H3NA 1GGYA 1YDPB 3Q0HA 3OJ2C 3SOBH 5ANME 4G9FD 4PREA 5MENB 2UWEF 2BSRB 4GAYB 4K3JH 4OCNC 1A1MA 4G42B 3F58L 1EAPB 2HT4C 1YUHA 4NNPL 3WD5L 2V9QA 2YA2A 1R0AH 1T22B 5ISZB 1PQZB 5L2JB 2QQLL 3MCLH 2DS4A 2G5BA 1CFBA 1KIPB 3MA7B 4O2EA 4RMQA 1NEUA 4GAFB 4QXGL 1JFQL 3STLA 1EX0A 3AC0A 5DD5L 4JN2A 4JB9L 4LCIL 1INDH 1RU9L 5I1DB 3LV3A 1RAMA 2R29H 4APQC 4X4ZA 2EDXA 4JFDB 4JFFB 3ARFB 2VXTL 5MHSD 4WJ5B 3BKML 4OBRA 5HGBA 5J9PA 4JDZB 2B0SL 3VXUD 1P7KB 3QHFH 3B6SB 4XAKE 4C56E 1JL8A 4LHUB 4OD3H 3HNVL 1JV5A 3KYNA 3TPUA 5FGBA 4MNQB 3KWWB 2DL2A 5C0DA 1FZKB 2XIDA 4U1JB 2EYRB 3IKCA 3EYQD 4WWKC 2FX9L 1I1AB 2ZOLB 1Z2KA 3MR9B 5IW3A 5DRZB 1A7RL 5KTEH 1L7IH 1LO5B 4PLJD 2VDRL 3LIZL 4Y16D 3JVGC 4F7EA 1J5OH 1SJEB 4W68A 2P49B 3ZDXE 4NO5B 2BX5A 3U7WH 4OCYL 1OAYL 5ERWB 2CXKA 3DVNA 5FDWB 3JWNC 4WI7A 1OTSD 4YR6A 5EORH 4Z7UB 4JY6B 1QRNB 1W0VA 4LQFH 4NN6C 4U0QB 1VPOH 2H26B 4YDKH 1JVKA 3P30L 1D5XB 5I19L 4NQVA 5DUMH 1Q0YH 1WBZA 5HGDB 3R0MA 3PWVB 4LHJB 1I8KA 4UIKH 2VZ1A 5EOCL 5J6GA 4C55A 3WNPA 5KANI 2YD8A 2AK4D 1SEQH 2GI7A 3D25A 4CVWA 4ZDHA 4Y1AA 5IROA 3VGBA 3C9NB 4XCFH 1MSPA 1OCWH 4KDWA 1HHHA 3V8OA 3LKPB 1YEFL 1IFHH 3QULB 2Y5TA 3BW9B 4P2RB 4X99A 2O5ZH 3BKMH 4TUKL 5D7LD 3E8UL 3PP3H 4UIMB 1GGUA 2NR6D 2NY5L 1DE4B 3TIDB 2IPTL 3PHOA 3E3QE 1CLYL 1TXKA 2FX7H 4FRWA 4G3YL 5C0ND 3SDYH 1QFWM 3QEUB 1AGBB 3IFOA 4U6HA 1OARH 1S7RB 4BSVA 3DRQB 2X9WA 4UNUA 4EVNA 3SKOB 2CGRL 5MEND 4OCSL 1NEZB 1DP0A 1NANI 3J8F7 1I7RB 3ILPA 4X6EB 4ERSH 3MLSH 5FYKH 3M8OH 5GGQH 4FQHA 2XPGB 4MSWA 2VC2L 2CDGB 5FGCB 5GZOC 4XHJC 3S9DB 4KK6D 1P2CB 2ADJB 3QRGL 1ZHKA 3UTSB 4GKNB 4NHUB 4I3RH 3VD7A 5TDOA 1J10A 2VB5A 5EWIL 5EU6E 5HDQH 3BAEL 2D03L 3LQAL 4FG6C 3ZTJH 5HDOA 5E4EB 1KTDA 4R8WH 1NCAL 2NY1B 4NQDE 3GMMA 5E4EC 1X44A 3PWPD 5EU6B 4NPYB 4JO1L 4OUOA 3RJQB 5I1GL 5DMKA 2PTUA 5DQJA 4C56B 5GS0L 2YPVH 4WEUD 4L4VA 4HJJH 5DA4A 4ZS6D 2WP3T 2DJ4A 4JQIL 3SDCD 1KYOJ 1NL0H 4XMKL 2Q76A 1HNFA 4NKMB 2DQCL 5IHUH 2H2PC 2R8SL 1BQLL 1WAAF 3CPLB 1KULA 3I6LE 4U6VL 3KLHD 4LASH 1IC5H 2JB6A 5IK3A 2YKLH 2WK2A 4RGOH 1A47A 5DUPH 1CGVA 2KH2B 4POZC 4LCYA 2DQHL 1MHPH 3MBEA 5GGTA 1PAMA 2P7TA 4LCCB 3I50L 2HJFA 4EVNB 2CIIB 1KTLA 3SDAD 3MJ7B 1IGYA 5FK9B 4QRPE 4MJ5A 2DLEA 1IQDB 4DZBA 2UZIH 5DRNB 1MFBH 5C9KA 3MRQA 1Q38A 5E6IC 3O6MH 1LO2H 2ED8A 3ZTJG 5H2BB 5JXAH 5E8OA 2P1YA 4Z77B 1HSAA 4RGNB 2VYRE 5BVJA 2X4OB 1MI5E 2Y6SC 3F8UB 1I1YA 3L5XH 3LEVL 4APQD 2D0FA 5JMRA 1N5YH 4K07A 2OL3L 2VTFA 4K7PX 3H0TA 3QULA 3RX8A 1EHLH 1G0DA 4J8RA 1V7NL 3F5WA 5AWNL 1QRNE 4LSQH 4NJAL 1JYXA 3MX0A 4MQTB 2VE6B 4WFHD 2DOCA 2P5EE 4PJAE 4NKQB 4OLXL 3QI9A 1K3ZA 4M1GH 2IG2H 5EIVA 4X80H 1P5VA 4HGKC 2YD7A 3MOBL 5ACZA 1G7MB 1RUAH 3O3BA 1PFCA 3P11L 7FABH 3MODL 4ZMAT 1SHMA 3VXQB 4NN7B 2ADIB 2NCMA 2AEIT 1A8JH 1LGVA 2PXYB 1N6QL 1QLEL 2GT9A 4F8QA 4LSTH 5IV2B 5IBLC 1SQ2N 1XCTB 1KJVA 4X9IA 4LL9A 2X89A 3I02A 5BXFA 5GS1C 4ZFGL 2IQ9H 4NQDA 4DKEH 4LGSB 3O3UN 3E1F1 4KJYA 3U6RA 1UVQB 2GYSA 3CSGA 4YXHH 3FQRB 4HMCA 1MJUH 2R0WH 3PQYA 1A4KB 1KCSH 1IM9D 4PG2A 3MRLA 2NXYD 3PWPE 4XNXH 3QA3A 4JFFE 3VWKC 1RZGB 4X6DB 1JBJA 3FRUA 4Q6IA 1NLBL 3MZGB 2PW2B 4OT1H 4PY8J 3RI5K 1U0QA 3UYRH 5C0JB 3KS0J 4NT6A 4M43L 5MHSE 4M7LT 2QR0B 3OGCB 1OM3H 3VXMD 3DWTA 2R9HC 3LN5A 4XHQA 4R7DB 4Y4KB 1CL7I 4OF0A 5HPOA 1YPZE 3T0AA 4I0PC 3MBED 1GGBL 3QI9C 2X70B 2W0FB 1UQSA 1PEZA 2XWJA 4GLRH 1AKJB 5IF0B 2DYPD 2NXZB 1EGJH 3N85H 3MLZL 3DO7A 5F1IB 4OCRL 1MWAL 1IILE 1I3UA 1HE7A 5CSZA 1F5WA 4HUKB 3PWPB 3PGCB 4HIEA 2QJDA 1BQHA 4Y4HA 3ARBD 5B4MD 2R23A 5E8PB 5BXFB 4PIRF 4Q0XH 3SN6N 3JV5A 1BZ7B 1U3HC 1D5IL 3MUY1 4MD4A 3VJ6A 2X1WL 4LCWB