3QUZD

Structure of the mouse cd1d-nu-alpha-galcer-inkt tcr complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
total genus 65
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzD02
1A64A 3VG9B 4JFZH 1G6RB 1S7XA 1JPTH 1PDKA 1L7IL 4JFDD 1U2CA 32C2B 4OZHF 3EYSL 4EI5B 3GI9L 3RVXD 1CVSC 3WV0A 4BH7B 5C6WH 2NXZB 1KCRL 3L3KA 5KVFL 4JPKH 2EICA 4HK3J 3LQAH 4U1IB 4X7EC 3V4VH 5MENE 2JB6B 1IGTA 2J2ZA 3BDYL 4M62L 3ROLB 3WHXA 5C70A 2CIKB 4GT7A 1C5BL 4P3WA 4TSAL 1J0IA 1P53A 4HT1H 4YPGB 5DHVH 1CFVL 3IFLH 4AT6A 2EC9U 3GMLB 5C0CA 3C8DA 4JFHE 4C4KT 4GXUM 1MCBA 1WSST 1JFQL 4PTTB 1UXWA 3QO1A 5J57B 5MI0B 5D5MF 1T7YA 1IGYA 4KK6C 5C0JB 1EERB 1F3DH 3T3PF 3ZKND 4OLXH 2FEDC 1X5AA 2PTTB 3O2DA 1PLGH 5C86A 5JOEA 3TH2T 4NQCE 1MWAB 3QH3A 3A6CH 1WT5C 4UIKL 3DVGA 2PYEB 3L3HB 4XNQB 3WS6C 2HP4A 2B1HH 5E2UH 3T08A 4ZUWB 1CGUA 1FCGA 4PJXB 3MOBH 5JNYA 1T04A 5E00B 1GIGH 5BRZA 3IKCA 4FXGA 4YE4H 5JW4R 1QQDB 2VR9A 5GRXG 1OAXH 3MX0A 2KKQA 1FJ1B 1U58B 4KROC 3JWDH 5HGAB 1RZJH 3WCYA 1GH7A 1U95A 4PJGE 1UB6A 3ES6B 1JNLL 4RBPK 5AWNL 3LQZB 1YY9D 5T3XL 4QHMB 4HF5L 5H37G 3TT1H 5TH2A 3KGRA 4FQLL 1D5BA 3QFDA 3O9WC 4A2MA 1I9IH 3SDAD 1KIPA 5I1DB 3LDBB 3U0WH 5C9JB 4F8QA 2Y06L 1UWEH 2F5AH 3KPLB 1IAIH 3MLTA 4KQ4H 5DD3L 3VFRB 2DKUA 2YBRA 3ZE0E 1MCPH 1U8IA 3BW9B 3JV6A 4DGIH 1IZKA 1R6VA 4KTEL 4NIKB 1P9MC 2QSQA 4LLDA 5D7KD 4HK0B 2RGSA 5F3HA 4JHWL 4JFFB 3VG9C 2RCSL 3TIEB 3VXQA 4X8XA 1WF5A 4X7SL 3SQBA 4OT1L 1RULH 3OJDA 5T1KD 4J6RL 4EI5C 1AO7D 3EO9H 5CINL 3MA7B 3BISA 2XWBA 5GS1B 1KTRL 1WQVT 5I18H 1AJ7L 1OSPL 2C1PA 2V5YA 4WI9A 3FB8A 3DGGB 4DAGH 2NW2A 1AQDB 4N8CH 2GK2A 1AGBB 1MCOH 5IGXL 4E42A 1ZKAA 2FECI 4N90E 1PY4A 2WAHA 2ENYA 3H9SE 3WS6A 3ORJA 1TETL 2XQBL 1C1EL 4LSRL 3BE1L 4NC1E 1MRCH 1J86A 1M7IB 3V9FA 1JZ3A 5FXCH 4KHXH 3LS4H 3NN8A 1BF8A 4PJIB 1F4XL 2PETA 4HV8A 4JO4H 1G7PB 3KXFA 3VI4F 4POYA 1D9KC 4TUKH 4U1NB 1A14L 2D7NA 1HSBB 2AV1A 3O8XB 1XGPA 2P43B 1MIEH 3LKNB 2CIIB 3GSVB 1Z9LA 1YEKL 2XXCB 3MODH 4LEXH 4KJYB 4HFUL 4FXKB 3T2NH 2DLGA 4DQOL 3VMOA 4XBGA 1A4JA 3BQUA 3T2QA 2CLVA 3H7BA 4P46D 4X4ME 5IK3B 3FONA 5CCKH 3G6JA 1KIQA 4NO0D 5H37H 1Q8MA 1YY8B 1BF2A 1D7FA 4OLYH 1U36A 4P3DB 4Y89A 4E5XB 3PHOA 1E6JL 1WCBB 2UV3A 2CRZA 1P6AB 1P9MA 1QRNB 1S78D 2AI0L 4JKMA 3O6LL 4H88H 4N0UE 3UJJH 1GGIL 3WD5L 5AYUL 3WHE1 3T8XB 5HVGB 3L6FB 1G6RA 5JPNB 5FGSA 3ZYJA 1A7BA 4UT6H 5IFHL 32C2A 4EI5A 4BH7A 4R2GC 1ZEAL 2AP2A 3RVWD 2YC1B 4DGVH 3LB6D 2APXA 2RHEA 1AHWB 2XPGB 3FB6B 3LDBC 3QPXL 1IC7L 4U1IA 2VDOL 4JG1H 5D6DC 2JB6A 1P1ZB 3DURB 4JQVA 3ROLA 2BNQD 2CIKA 4HIEB 2QBWA 4MYWB 5TDNB 1BHGA 5FUZL 3EOAB 4YPGA 3GMLA 1HIML 4PTTA 1HWGB 3NA9H 2R0ZH 5GS1C 4F7TB 3INUL 1MCKA 2ERJB 5C0JA 5T1DH 4QNPF 5CJOL 4C54A 2PTTA 3QHFL 2BJMH 3EDKA 4N0YH 1MWAA 1QFWL 3BT2H 2ZG3A 1NEUA 3L3HA 2PYEA 4XNQA 1WWAX 5F9OH 1LE9B 4N8VB 3O2VL 4ZUWA 1S7RB 4ONHB 2P48B 3KHQA 3MJ9L 4PJXA 5D7LB 4OIIH 5E00A 2QADB 1KB9K 5J11B 4XTRD 1CLYL 1QQDA 5HHXL 3NIGF 1U8PB 1FJ1A 2VZ3A 2KZWA 1U58A 5HGAA 3ES6A 3DUSB 1IL1B 1RZKH 2PNDA 5JW3H 3LQZA 5CEZH 4LGRB 4QHMA 4Z77B 4LHUD 2EIZB 1Z5LB 4Z0BH 1F00I 2W65B 3EBAA 2WQRA 3MSPA 5I1DA 4FTVD 2EDEA 5C9JA 3G9AB 1PSKL 5JO5B 3RL2B 3KPLA 3VFRA 3UBXG 4U7KA 5D6DA 3BW9A 1X5KA 3QDAA 3MLVL 1T21B 2V7HB 4HK0A 5JUEL 4JFFA 5KSAB 3IJHB 3TIEA 2GAZB 4P2CG 1F3DJ 3R0NA 4QXGH 1LK3H 2W92A 3WNPA 2JF1A 2AJUH 3MA7A 5AZ2H 5GS1A 1UZ6E 3X17A 1JWSB 4U1JB 4PRHB 5SWZE 3DGGA 2F53E 2J6EA 1AQDA 5IBTH 3JUZA 1AGBA 2R0LL 5EG6C 5IJKC 2J4WL 3VGEA 5D1ZC 3UYPA 4O2EB 1G7QB 1M7IA 2YN5A 4LVEA 1UM4L 4K2UL 2W9EL 5DI8B 2VDLH 4RRPG 4PJIA 4S1QL 2X89D 1IVLA 1G7PA 1RUPL 4KMQA 3CDFA 4U1NA 5L2KD 1FL5B 1HSBA 4WFHD 1CGTA 3RAJL 3O8XA 5DEZA 3BIAX 4M7KL 3LKNA 2CIIA 4TULL 3GSVA 1DL7L 1V7NL 2JELH 4KJYA 3FT4B 3IDGB 4FXKA 2GJJA 3NAAL 3L5WB 1MREH 3ET9F 2BY3A 2QKIB 1OVZA 3U4BH 3AUVA 5IK3A 3O0RL 2C3XA 5L2JB 2QADC 3OHXB 4NFBA 3VD4A 4HDIB 1YY8A 5DJ6B 3N1GC 1BFSA 3QXAB 2ZCHH 4P3DA 4E5XA 4MJIB 4O58L 3CJJA 4G5ZL 2ZWLT 1WCBA 1KGCD 1QRNA 1GZPB 4JG0H 1LDPH 3T8XA 1RQ5A 3L6FA 4RAUB 1KN4L 5JPNA 3F62A 4JY4B 3B9VA 4U1KB 1OGAD 4NO3B 4KK9D 1J8HE 4NFDA 4WTXA 2YC1A 1AHWA 2XPGA 3FB6A 4XX1E 1MH5B 3E8UL 4D0BB 1HHKB 4R7NB 2ZJSH 2APBA 2ARJQ 4P5TC 4NQEE 2NY6B 1P1ZA 5I2IB 3DURA 5DUMH 3WMSA 4QXWA 2VLRD 3VFTB 1A7PH 4DJMA 2W1NA 1ZT4B 3H3BC 1ZE3C 4HIEA 5TDNA 4OFIA 3EOAA 1WGOA 2IFFH 2AJZB 3VDBA 1R5WB 4KI5C 4ZMAT 4I9WD 1IAIM 4W70A 2I9TB 1YNTB 3FN9A 2QSTA 5GGRY 1QBML 4BJLA 4F7TA 4XWOD 3MCKB 1UJTA 5IHUL 5DK2B 4NQDE 3EYFB 3WO4B 1KJ2H 5EO0B 4GXVL 1GAFH 3S88H 1XT5A 2FX9L 4S1RL 1JRHH 3AS1A 4FQXC 4M6OH 4NM4H 4QRTB 1LE9A 4N8VA 1S7RA 4ONHA 5D7LA 4AIZB 1YEFH 4KV5E 2F5BL 4XAWL 3S35X 1NMCB 1PEZA 1U8PA 3ZLQC 3B9DA 4PJDE 4D3CH 1JWUB 3DSFH 2AXHA 5DT1H 4NHCH 4BM7A 3DUSA 1IL1A 2VLMD 3HN3A 3ZSSA 2D0HA 4XVUC 4G6MH 4X6DE 3T0VA 3VWKB 4Z77A 3BKJL 2EIZA 3WFDH 1Z5LA 4FZEH 3DI2B 3LKOB 2D9QB 4HXAL 2ZSWB 4OIAA 2FJGB 5C2BH 1NBVH 2W65A 2QV2A 4GRWH 4LVOB 3I6LD 4PJ7E 3VD3A 2VERN 3W9DB 5E9DD 1NGZB 5JO5A 2AJVL 3RL2A 1K6QL 4NUJB 3FOMB 1RUAH 3BESR 5HHQB 3CX5J 3EDFA 2VLLB 1T21A 6CGTA 5L7XH 2V7HA 2VWEC 1GC1H 5IW3A 5KSAA 3IJHA 4J3XA 4L5FH 4PR5B 4UMGA 2GAZA 4ZOBA 3TJHD 2X4OB 2BVEA 3NGBC 1V7ML 3PQYB 2F74B 1QFOA 2E3VA 2NX5D 1JWSA 4U1JA 4PRHA 1QFUL 4MVBD 5D7IB 2DM2A 4ZXBB 2FL5B 3C60D 4U0RB 5I30H 1CE1H 4JFDE 2FX7H 5I8OH 2ESVB 3L5XH 4G8EB 2GYSA 4WW2B 5IMKB 5FF6B 1A9EB 4OZIB 2CDEB 3UTSD 1LK2B 4HGMA 1FIGL 4O2EA 5JHLL 1G7QA 5DD5L 2NMSA 1SBBA 5F9WB 4ELMF 4PRIE 5DI8A 3P30L 1JI2A 4OCRH 2AXJA 4ODVL 5B3JE 1MCNA 1FL5A 4PUBH 4G80B 4PGCB 2CO6B 2VUYA 4JM2F 4KK5D 5MERB 1N0XH 3CSPA 4L1DA 3FT4A 5DZLA 1ZANH 3IDGA 3TWCL 2BX5A 4Q0XH 3VRIB 3VXMD 1TQBC 1OAYH 2EH8H 5C8JB 3L5WA 2D0GA 2QKIA 4U6VL 4OF0A 4HMEA 4G6JL 2FIRT 5L2JA 1H3GA 3DRTB 3OHXA 4G8GD 4HDIA 4PY8J 5DJ6A 3O2WL 1NMCC 3QXAA 3CNKA 3E6FB 4MJIA 5TE4H 5ID1B 2JJTC 5K9JL 2EH7H 3GBNH 1S9WB 3DUHA 4K7PL 1J18A 5KAQG 3VWKC 3RA7H 1GZPA 1IGFH 2UWEF 4RAUA 5CD3B 4YJZL 4M9OA 4JY4A 1F58L 3O4LD 4NO3A 4U1KA 1EFXD 2VXUL 4LVOC 1SMAA 4LCCB 1PZ5B 1MH5A 3AMLA 4S10A 5FKPB 5DLML 1HHKA 4R7NA 4YFLF 4D0BA 4EOWL 1MCCA 2DQUL 4Y5VB 2P5ED 5FYLH 5F96H 2GTWB 3CFCL 5IG7B 2I25N 4JRXB 5I2IA 3PDGA 1FFPB 3VFTA 4TQEL 1YNKH 1ZT4A 3T65B 2IGFH 2P24B 1XGQB 2AJZA 4XNXH 1R5WA 2UY6A 3MLSH 2I9TA 1YNTA 4TVPL 4JQIH 4RX4A 3T2OA 3MCKA 4HH8A 4JRYD 4LU5L 2QR0B 4KRLB 4UNUA 5D7KE 1I8IB 5DK2A 3EYFA 4I18B 1AI1H 5IEHB 3HE7D 1XCQB 2HTLC 1ZK9A 1B4JH 3CLFL 3OF6D 5EO0A 2EKJA 3MBXL 4KUCF 5F71A 1AO7E 4WW2C 1DQLL 4XPBH 4QRTA 1EXUB 4GKOA 5DJ2B 4LIQL 2BVYA 4AIZA 5F9WC 3QEQB 4LVNB 5CUSL 1JNNH 3F6LA 5EBGA 4P48A 2DQTL 1JWUA 3ELAT 1WFNA 4MQ7B 3E3QE 4GRWB 2C4FU 2JB5L 1QSED 1BPVA 3VWKA 4EUPH 4ZTPH 1HXMB 4Z0XB 2X1PA 2CMRL 2J8OA 2HFGL 3LKOA 4W6WB 2ZSWA 1B6UA 5J8OA 2FJGA 4PJHE 4I0PD 4XVSH 5B38B 1GGTA 3W9DA 4XWGH 1NGZA 2VXVL 4NUJA 3FOMA 3MV9D 3V7MA 1JGLL 1QYGL 3HUJF 5HHQA 3R8BB 2R0KH 3RQ3A 2VLLA 1PBYA 2WUBL 1JTTA 4HWZB 4XHJC 3P4OB 5DDHB 1CF8L 4PR5A 1D5IH 2ID5A 2X4OA 4XBPB 4N1CA 3GI8L 2EDWA 3PQYA 4LCCC 2F74A 5ECJE 3ZTJG 3U6RB 3H9HB 3LPWA 1MFEL 2VZ1A 2AAVA 4UT9H 4N1EA 5D7IA 1BQLH 4Y5VC 4ZXBA 2FL5A 3EZJB 4K3HA 4X5LA 3CU7A 1A7QH 2XKUA 1ZLUH 5ADOH 1OAUH 2ESVA 4G8EA 4WW2A 1OL0A 1XAUA 1UM6L 4ZODA 4ZOCA 5IMKA 3BWUC 5FF6A 1A9EA 4OZIA 2K3TA 1HE7A 4TSBL 5LKNA 2CDEA 1LK2A 2Y07L 3LCYA 2NY3D 3MV8B 5HDOA 1QLFB 2VDKH 1FORH 4QXUH 3TZVB 4K94C 1IAKB 2B4CH 2BNQE 3VXPB 2YPVL 4G80A 4PGCA 3Q6FB 4L9DA 1HINL 5GGQL 2NY0B 5MERA 2UZIH 2HVJB 2BOCB 2R29L 4WCYL 3WDIA 3VRIA 3BUYB 2E8YA 4LK4A 5C8JA 4XP9L 1T0NB 5D7JD 4XNZB 5C07B 3DRTA 2A0LC 4L4JA 5DMIH 4LVNC 3AM8C 4P5KB 3E6FA 2X4PB 5ID1A 1UA6H 5GS0D 2FBJL 4RMWA 4XBEL 1S9WA 5IP4A 5D72H 2BHZA 4HZLB 1VFOA 2MOVA 3CDCA 4F57H 1BEYL 1T83C 5CD3A 4RFOH 4OB5H 1WIPA 3OKDB 3CXDL 3KPOB 3V4PL 3TVMB 1JYXA 4LCCA 5SWSB 2P5WB 1PZ5A 2R69H 3BRDA 2EDQA 5FKPA 4ZNEE 1DQMH 4Y5VA 3PGCB 2P8PB 4NNYB 2BRQA 2GTWA 5ICXB 5IG7A 1YEIH 4JRXA 3DV6B 1FFPA 3QQNA 3ZTJH 3T65A 3QUMH 2LV4A 2GCYB 2I26N 2IC2A 2P24A 1XGQA 5CS7A 3CVIL 4K7FB 1O7SA 5HI3C 3RWEB 2QR0A 5EULV 1U8JB 4YAQB 1I8IA 3BPOB 3ZKXC 1LO2H 4I18A 5IEHA 3S4SG 4RWHA 3WIHH 3FJTA 1XCQA 4H26B 4WIQA 4Y2OA 5C08B 3HI6H 4UV4H 1QSFB 2VB5A 4QEGA 5J1AB 1ED3B 4DN3L 3NTCH 4JFEB 1CR9L 4LCIL 2AK1L 1EXUA 3RTQB 2BVTA 2QSCL 5DJ2A 1NAML 4EUPB 4H0IA 2BVQB 1OM3L 3QEQA 3AM8A 4OCMC 5E2WL 3VD5A 4U6HB 4RMQA 4MQ7A 3ARFD 4Z7OF 1KB5L 2QQNH 4Y4HC 4PJBB 5GISL 3TN0B 1HXMA 4Z0XA 4POZD 1G7MB 5ALBL 4FQCL 1N26A 2DKSA 5L2KE 1R5VB 4PPTA 4XNZC 1O7VA 4R0LC 5ELIA 1YEHL 5B38A 3E6HB 3OKNB 4AH2B 1X5GA 5FM5O 3D9AL 2NR6D 5JXEC 5E6ZA 4LARH 2KQNA 1VGKB 3ALXA 4ELKB 4HWZA 5DUPH 1DEEB 4QRUB 3U7WL 1QFPA 3P4OA 5DDHA 4XB8A 5FGCB 4HUUB 4XBPA 1MCQA 3ZT7A 1XF3B 2DQHL 2W0KA 3S34H 4MQXC 3U6RA 3RX7A 4G8IB 3B5HA 4ODSL 3H9HA 3VXRD 5F72S 1KGCE 3VA6A 1J1XH 1RFDH 4YC2B 1I1AC 4HC1L 2HFTA 4Z7UE 4PJ5E 5MENB 2A6DB 4HIXH 4Q97A 1BOYA 1OGAE 3GKZA 4ZAKC 4EBQL 1LP9B 1XF1A 1CIDA 5E70A 3MV8A 2HKHL 4ONFL 1QLFA 4YWGH 2R2CA 4CDHA 3DX7B 4YDLC 2AJSL 2FH6A 3TZVA 1IAKA 2H32H 2VAAB 3VXPA 5HD8D 3RI5K 1G9NC 3Q6FA 3U7YL 3BPOC 3EO0B 2OL3B 3FTGB 1PG7X 4YXHL 1MCEA 2EO1A 3EKCA 2E9JA 2HVJA 2BOCA 5FYKD 4I9WE 3BUYA 4OGYL 5M95B 5BV7H 3RTQC 4LPUA 1T0NA 4H8WL 3MRGB 5SX5K 3TNMB 5C07A 4GW4B 5C7XL 2NTFB 2DIAA 2D4DA 4PJXF 3RVUC 1WJ3A 4P5KA 5JOFB 1GXEA 2X4PA 4KQ3H 5TDPB 3K1DA 1X6NA 2OTUB 5EFIB 4JO1H 2WMPA 4KRPD 1IE5A 4I3RH 1IQDB 1CDCA 8CGTA 4HZLA 3TN0C 4KZDL 1NH6A 2VH5L 4G6FB 3QIWB 1BOGB 2WWMC 5B39B 3B9AA 1HN1A 3OKDA 1SVCP 3U36B 1FNFA 3KPOA 4LSVL 1BP3B 3SKOB 3TVMA 5I8KH 4HWBL 1IAMA 4MB5A 2P5WA 5SWSA 2VLME 3IYLW 1JTPA 4HKXB 1EJ6A 3PGCA 2P8PA 4NNYA 4Y4KC 5ISZD 5ICXA 1UKQA 3DV6A 5JW5B 1URLA 5I19H 1IFHL 5HYSB 3DMMD 3I6LE 3LEYH 3DIFB 2GCYA 1EMTH 4CKVX 4GAJL 3U9PL 2Q8BH 2GT9B 4I77H 2EXWD 4K7FA 1YEEH 3RWEA 1U8JA 5IBLD 4YAQA 1K8IB 1SVZA 5GXBB 5IM7B 4YC2C 5FV2A 5HHMB 3NFSH 1J87A 4H26A 5C08A 3RZCD 2AKRB 1QSFA 3WDHA 3NVQA 1N6VA 1ED3A 1XH3B 2HLAB 3QIUB 4JFEA 5J1AA 3H9SB 3RY6C 3RTQA 1VEPA 1N59B 4EUPA 2BVQA 4A6YL 5JZ7D 4NM8H 2PXYB 4HD9A 4TTDD 4Z8FL 4U6HA 4PJIF 3HRZB 4QTIH 3UCRA 2FGWL 1MY5A 3VGHA 1T7VA 4I3SL 4B53A 4PJBA 1U8MB 4YXLH 2VNCA 3SGKC 3TN0A 1G7MA 2CJUH 3H9YA 4M1CC 2FLBT 4LSUH 5IBUG 2FX8H 4HKBB 1R5VA 4KJWD 3C2AL 4LPTA 5JDSB 1GGCH 3NPZB 3E6HA 3OKNA 4AH2A 1ZVYA 1QBLL 4F7CB 1PYWB 1SEQH 2FJFB 1P5VA 4FMKA 3VXME 2H1PL 2DB8A 3GMMB 3OL2A 1VGKA 4ELKA 1DEEA 3V0WH 4QRUA 4AZ8A 5CAYB 5ALCL 1H3XA 2F54D 5L88H 4M6NL 4N0UB 1W72H 2ADFH 4JN1L 3PWVB 1WFUA 4HUUA 1KB5B 3KYKH 1R5IB 1XF3A 1NDGB 5GSVB 5JQ6L 5E8PB 1NFDE 4XVTH 3FCTB 4EKXA 1WTLA 4G8IA 3S4SB 5CJQH 5DRZB 2JLLA 3QCVL 1NCWH 3UTQB 1GVIA 1QO3B 5MENA 2A6DA 3KHOA 3O4LE 3ECBB 2FCBA 3GBML 2FEEI 4PJCE 5C0RH 1LP9A 4LSTL 3GB7B 1ZGLB 4WU7B 3RY6A 5JIIA 3P0YL 1W0WB 4JPKL 5CIPB 3B2VL 4NZTL 5F8QC 2P5EE 1VEMA 3DX7A 3B83A 3VE0B 5BV7B 4GLRH 4DEPC 4M1GH 2VAAA 3CVHH 2Q1EA 4KTDH 3EO0A 4TVSa 2OL3A 5FA4B 4P9MH 3FTGA 3RPKA 4GG6E 4J7RA 4JDVB 3QHTC 4IEFB 3SN6N 1UEYA 3SGKA 4JJ5B 2BCKB 3IAGC 4JFPB 1RIVH 2BXYA 1R24B 1KG0B 1XGRB 4JRYE 1W8OA 3U0TB 1TPXB 1WFTA 3MRGA 3D1MC 3TNMA 1PLGL 4GW4A 4QHKJ 3FAWA 2NTFA 5IR1B 1BFTA 3BKYL 5K9OB 4MS8D 5HI5C 3C09B 4NQVB 5JOFA 5TDPA 1ITBB 5F1KC 2B1HL 2OTUA 5EFIA 4W81A 4JRWA 1IQDA 2VL5B 3MOBL 4OZHE 1BBDL 1GIGL 1D5XB 5T1LB 1VSCA 3DHJA 2ZUWA 3QIWA 1BOGA 4PY7B 5B39A 8FABB 3I6KB 3JWDL 4P2QD 2W60B 3U36A 3S36X 4X7CC 3SKOA 4OZGF 2XTJC 4C57C 4PS4H 1QSEE 1CGYA 4G3YL 3TT1L 1UC6A 4HKXA 2CKNA 1KC5H 4JDTH 1RMFH 5EBLB 1IGJB 3QI9D 1I9IL 4WFFD 5JW5A 5E4EB 4L4TD 1GGBH 5HYSA 5DJXB 4U6XB 4LF3B 3DIFA 3WIHA 2B39A 5ADPL 1UWEL 5IESL 3UMTA 5D5ME 1IAIL 2F9BT 2NY7H 2ZCKH 1KCSH 3T3PE 3MV9E 1EZVX 3QWRD 1MCPL 2XQYK 4JO2H 2GT9A 4YHIB 1A22B 3ULUC 4KI5F 4GMSL 3MREB 4KXZI 4NKOB 1K8IA 4JHZA 2YMXH 5IM7A 3TESA 4AL8H 4Z5RB 1ACYH 3DX8B 2D7OA 2AKRA 3GIVB 1XH3A 2HLAA 1IC4L 3QIUA 2VSCA 3H9SA 7CGTA 2YWYA 4RZCB 1N59A 4DAGL 4HKJB 1F90H 1DQDH 3BPNB 1RZ7H 3PP3H 1TCMA 1MCOL 2PXYA 3AS0A 2P4AB 1MFDH 5K9KB 1YPZF 4JY6B 3ZDXE 4IIQB 2ILLA 3OXRB 3HRZA 1QNZH 5HHVH 2BC4B 2M8XA 2ICCA 4X9BA 2ZUYA 4PB9L 1YYMH 2C3GA 2DLFL 3O3EB 1WITA 1U8MA 4NCDA 3RWJB 3LS4L 1J1OH 1ZS8B 5ILTL 4TUKL 1KFAH 2CQVA 4Y4FB 3FMGH 4U7MA 3MZTA 4HKBA 4R90H 5EA0H 4BZYA 5BS0B 1UG9A 5JDSA 3Q48A 1GGUA 1W72B 1X4XA 2XG4A 3HMXA 4S0TD 1XIWB 4GQ9L 1PYWA 2FJFA 5ESAB 5DQDL 4F7CA 3C09C 2EDNA 3T2NL 3ZT5A 2FR4B 5J1SC 4AMKL 3GMMA 5KJRL 3RX5A 3L3JB 4I8DA 3OWEA 2B5IB 4KUCD 1IRAY 2ED7A 4N0UA 5GS3A 3PWVA 1YC8A 1EH9A 1A7OH 1KB5A 1R5IA 3ILQD 4OFVA 1NDGA 3EHBC 2VDRH 5GSVA 1IM9D 5E8PA 3FCTA 2NY5H 3S4SA 1AFVH 3UJJL 3BMWA 1NBYB 5DRZA 3TA3D 3WXVH 2VO5A 1J5OL 1KOAA 3VFUB 3UTQA 1QO3A 4H8WC 4UT6L 5ITBH 4MJ6B 3T0ED 3ECBA 4BFGA 4EN3B 1ERNA 3CVHB 3MLUH 5E4EC 1N3NB 3GB7A 1BQHG 4Q6IC 3QXUA 3H3PL 3VI4E 4WU7A 1ZGLA 2X44D 1W0WA 5H94B 5CIPA 3WLWC 2DMBA 4HEME 3OAUL 4KDVA 4N1HB 4O4YL 4YDKL 3VE0A 2HT2C 3DI3B 1CK0L 3D85D 3RDTD 4YNYB 4PJFF 5FA4A 2V17L 4DOHB 3R1GH 1MOEA 4JDVA 4KVNH 1UWXK 1YMMD 2R0ZL 4JJ5A 2BCKA 4HJ0D 4JFPA 5JOPD 4Y1AD 1R24A 1KG0A 3WFEL 1XGRA 3B43A 4R7DB 1Q38A 4HC1A 3NCYP 3U0TA 3BPNC 3O41B 4CVZB 4U1LB 5IR1A 5K9OA 1WZLA 3IF1B 3B3IB 1BFOB 2XNAB 3V52H 4NQVA 2HRLA 5F9OL 3ZE1F 4UDUB 1EAJA 4YHZH 4H1LB 4KI1A 2VL5A 2YD3A 4HGWB 5I66B 3GMQB 1SY6H 4WTZG 1D5XA 1MAKA 1QZ1A 4X6DB 5T1LA 3TF7C 1UGNA 3MYJB 5FCUH 4PY7A 3UO1L 4I2XE 1J12A 4Y4FC 8FABA 1B88A 3I6KA 4XCEB 4DGYL 2W60A 4Z78B 1W8NA 3TT3L 4I0CC 5JW3L 5C0CD 2HN7B 3QHZH 5CEZL 4LLAA 1XIWC 3HPLB 3X3GL 4NJ9L 4PP1D 1CICB 5EBLA 1IGJA 3G08B 2KUTA 3WXWL 2B5IC 5DJXA 4U6XA 4LF3A 1RZFH 3GMOB 2OXGA 3PL6B 4QNPE 3CFEB 4FA8A 4OLVH 2NY4D 3LH2L 5J7CC 4YHIA 4IDJH 3T0XA 3VD9A 4R96B 3VI3F 3F7QA 3MREA 4NKOA 3CGTA 3AXLB 4X7FC 4Z7WF 4YO0B 4Z5RA 4QXGL 1JUFB 3DX8A 3TYGH 5GRUL 5D7IF 1FVCB 4JFDB 5AZ2L 3GIVA 5TF1H 3NIGE 5B21A 4RZCA 3VXRE 4WW2F 1N8ZB 4HKJA 1S3KH 1I9JL 5IBTL 4OZIF 3ME0A 1NUDA 4PRIB 2GHWB 1SM3H 4WEBH 5K9KA 4JY6A 4IIQA 1H9VA 1N64L 3OXRA 4OIBA 2BC4A 3L7FB 5F7HA 3UYRH 2Q8AL 3O3EA 5EZIH 3MJGX 3MOAL 3RWJA 2VDLL 5AG9A 3TC9A 1ZS8A 2LAAA 4Y4FA 3C5SB 2R0WL 3UEZA 3N50A 1TVBB 4WI7A 3ETBF 5BS0A 1FFRA 3NIDF 1P84K 2DS4A 1W72A 1EVUA 1XIWA 5ESAA 1YDPB 5FM4A 2FR4A 1Q0YL 4KK6D 1WFOA 2HH0H 4JEGB 3L3JA 1MIMH 2EE3A 2FEDD 4B5EA 4JO3H 3R0MA 1R3HB 4F9PC 5EU7E 1JJUA 4D8PB 2DI8A 3SJVD 1NBYA 2PTUA 3VFUA 2X05A 3KXFD 1CLCA 1CICC 4KROD 2LQRA 4MJ6A 4EN3A 3P11H 3CVHA 1N3NA 4DTGH 3SDAB 5H94A 3F7VB 2KQMA 3OPZH 1Q9OB 3PL6C 5ISZE 5DUML 5DC0A 1A7PL 5BW7C 4K3EH 5FB8B 2GUOB 5IQ7H 4UI2A 4YNYA 1CZ8H 2IFFL 3LRSB 4PJAE 3C9NB 3MMEB 1O0VA 2QSVA 4X98B 5T1KB 4ONOA 2E9IA 5SV3A 4FFZL 1LNUB 5KVMC 3SE9H 4Q2ZB 3VXOB 4R7DA 4DK6A 3FFCB 1EVTC 2XZQH 1NSNL 3O41A 4CVZA 1KJ2L 4U1LA 3IF1A 5IIEB 3B3IA 1BFOA 1GAFL 3S88L 4EI5D 2XNAA 2I60L 3S96B 2CKBL 1DEDA 4LASH 1JRHL 4UDUA 1RUQL 2J3SA 2ADJB 4H1LA 4HGWA 5I66A 2XKSA 2ICEB 3GMQA 2Q76B 4X6DA 1KLFA 1NGQL 1U2HA 3MYJA 3GJFK 3NOIA 5LCVL 3BXNB 4XCEA 3DSFL 4Z78A 5DT1L 2P42B 4NHCL 1JPGB 2Y6SC 4PJHB 2HN7A 3RI5F 4J2XA 1AP2B 3V6OE 3DBXB 3HPLA 3OSKA 3CMOL 4RCAA 5HTSA 3N9GL 3PP4H 2VIRB 4KRMB 1D9KD 1T2JA 1GOHA 1CICA 1PGRB 3G08A 4WHDA 5E1AB 1ADQH 1NBVL 4RFNC 1SBSH 3S6CA 1MHHB 1S7WB 4P46B 5FK9B 5CZVL 2DI7A 2WV3A 3GMOA 3WEXB 5LGKA 5E08H 2PYED 5E94B 1RUAL 3PL6A 5DMJB 3CFEA 2Y23A 4LSPL 1T7WA 2CUIA 4R96A 5BW7A 1DP0A 3Q5OA 3AXLA 4L5FL 2F54E 4YO0A 1JUFA 4HUXB 1FVCA 4JFDA 5FHBH 4Q9RH 1NCBL 4ZS7H 4K71B 1N8ZA 5C3TA 4PGEB 4IRJB 5I30L 1CE1L 5I8OL 4PRIA 3MRKB 1I1FB 4GSDH 2VDPH 4OGXL 4P3CH 1VPOL 5DR5H 2BNQB 3L7FA 3GSNL 4HBCH 4ZUUA 4LQ1A 3LS5H 4G42B 4XMPH 1Q0XL 5EDXA 3T0DA 3M07A 1WWBX 3I02B 3LRHA 4APQB 3RVTC 4QOKB 3C5SA 4J4PC 3T0BA 1TVBA 1J10A 2VDNH 1HNGA 3KPRE 3MNWB 2Q7YB 4NCC2 1JZ4A 1YDPA 4P59L 1ZANL 2BDNL 4Q0XL 3HI5H 4N68A 3FN0L 4Y5XC 4FQ1H 1WIUA 4HW6A 4YX2H 1R3HA 3QXVA 4XCCL 2AXFB 4OLUH 4D8PA 2VMFA 4YEEA 3BKCH 4Z7NF 1F8TH 4L3ED 2AK4B 1CLZH 2Y36H 4LPVA 3GBNL 5IHZB 1DLHB 5GGVL 4LSSH 3RA7L 5F9AC 1IGFL 1CLOH 3L5JA 4YLQT 4LHUB 4IRSC 3KR3H 4P2QE 1CXEA 4ELME 3VW3H 4G7VH 5E8DL 3SDAA 4F8TA 3F7VA 2J7LA 1Q9OA 4AENB 3WSQH 4ZUSB 2AJ3B 1YQVH 3IFNH 5AUMB 5ANME 1YNKL 4HH9B 5FB8A 4WFFE 2GUOA 4L4TE 3QUZB 1JHLH 3ARTA 3LRSA 3C9NA 4XNXL 3MMEA 3BP7B 2AJYL 3VXTB 4FQHB 4X98A 2BZDA 3MACH 1JGUL 4PRNB 5T1KA 4JQIL 4MXWH 4IMKC 1LNUA 5M7QA 4Q2ZA 1MY7A 3VXOA 1BQUA 1Q9KB 4K71C 1WBZB 1BWWA 3GSRB 4MNHA 3FFCA 1I8MB 1JL8A 1SY6A 3GHBH 4IRJC 1B4JL 1C5CH 5IIEA 2YUWA 3NCJH 1BVKB 3S96A 5D7SL 4XPBL 5DQJB 5CSGA 4LBEB 5DYOB 2UWEE 2ADJA 2X9XA 2ICEA 2Q76A 4Q9QH 1A6AB 3LVEA 1JNNL 3FT3B 4PJBF 4APQC 3BXNA 4P2RE 1AQKH 5IQ9B 5DJ8B 5L2KB 1JPGA 3VFGH 1YEGH 1QACA 4PJHA 1G7IB 4GBXB 1AP2A 3DBXA 1ZHKB 4ZTPL 3BVNB 4OFYA 3IETB 2VIRA 3VA2C 3C5ZC 1LEKB 4HLZG 4F58H 2PR4L 1I3RB 5E1AA 5I74B 1MHHA 1S7WA 4P46A 5FK9A 1IGML 5TDOB 5ETUB 1F2QA 3WEXA 4XWGL 1N0LA 2BY0A 3DTXB 1VFBB 2NXYB 5E94A 2R0KL 1ZLVH 3MZGB 2MJWA 1FL3B 5D7LD 1OTUC 2QADD 1MRDH 2EDJA 5F7DB 1DTUA 1D5IL 3VGAB 4HUXA 3OR7B 4M5ZH 4Z7UB 4PJ5B 2O5XL 2Y25A 1OGAB 3EJZD 4IMKA 3LOWA 4XVJH 2WBWB 4FQPA 3QULB 1LP9F 1UACH 1BQLL 1LWRA 4PGEA 4IRJA 3MRKA 1I1FA 3T0EE 3U1SL 1U8OB 1ZXQA 2BNQA 4KK8C 1IC5H 4WTZA 4M6ML 1FBIL 3MLXH 2VC2H 4P5TD 3DROB 4G42A 1FORL 3MGOB 4QXUL 4K07A 3SGJC 3C8KB 4WEUD 3I02A 4APQA 1ES0B 4M7LT 4QOKA 4NQUA 4LKXB 5LGHL 2MFNA 2UZIL 3MNWA 1LO4H 3HUJE 1KLUB 2Q7YA 4NFCA 5T3ZL 5HVFB 4G9DB 5I8CB 4KI5D 2BXZA 2BRRH 5A3IC 1YMME 2FH8A 5JOPE 4Y1AE 1FLRL 4PRHD 3DO3A 1FC1A 2COQA 1X5HA 2AXFA 4HLZH 4XPTH 4KVCH 1BZQK 1X5LA 4FQXD 4FFYH 2AK4A 3GSNB 4WUKL 5IHZA 4BFBD 3L9RB 1DLHA 4GAGH 1OPGL 4GBXC 3AU1B 4K9EH 4F57L 3GSOB 5C6PB 1QR1B 4ZNEA 4LHUA 4JM4H 4PBXA 1PY9A 4LDLB 3U48A 43CAB 2IAMC 3RWDB 4JN2B 3P40A 4XVUD 5C0CE 3K0WA 3HNTH 2WWKO 5IWLC 2NXYC 4AENA 4HBQA 4ZUSA 2AJ3A 5AUMA 1A47A 5IB1B 4HH9A 1KTKE 3QUZA 4MJID 5DD0H 3BP7A 2OTPA 3VXTA 4FQHA 4QRPD 3TP4A 3WFHB 1MRFH 4PRNA 3UDWC 5CJ5A 3T0WA 4GAFB 1Q9KA 1EEUA 3RBSA 1NKRA 1WBZA 3GSRA 1N4XL 1I8MA 1LO2L 5LGJB 4NWTL 5IT2L 4RWYH 4WHYG 4UV4L 3C60B 1BVKA 2X1WL 1VA9A 4R26L 4HWEH 5DQJA 4LBEA 5DYOA 1FV1B 1X9QA 3SO3C 4HJJL 5FUOL 3T04D 3WNNA 2NY6D 2FO4B 4N8PA 5KW9L 1CL7I 1A6AA 5I1KH 3FT3A 4YPJA 1ADQA 2X89A 3ARGB 2IANB 5IQ9A 3LIZH 5DJ8A 5L2KA 2A1WH 1G7IA 3QWQB 4GBXA 3ROOB 2DTML 1ZHKA 3BVNA 3IETA 5EBMB 3TJEL 1LEKA 5HGHB 4LAQH 4MXQC 1I3RA 3BJ91 3EFFB 2AABL 3JVGC 4K8RC 4M8QB 5J4MA 1OCWH 5EOQL 5TDOA 5TPWH 5ETUA 2LU7A 3Q5TA 5IEKB 1EK3A 3DTXA 1VFBA 3I9GH 1HHGB 1WUNT 5JIPA 5I1HH 2L7JA 1FL3A 3PNWB 1NFDB 3ZDYF 1FHGA 3V6FB 5F7DA 3H2WA 4IS6B 3ULUF 2DQGL 3G6DH 3OR7A 4OF7A 4Z7UA 4PJ5A 5F88B 1AE6H 3EYUL 3S34L 1OGAA 3GSWB 3O4LB 3RX8A 1EFXB 1A7NH 2OR9H 4PJCB 2VISB 5IUSA 4JKWA 5KS9B 4FG6D 3VWKD 2V7NB 3SJVE 1J1XL 3QULA 1NEZB 4OV6F 4EJ1C 4Z7OE 1WTGT 3L5HA 3P3YA 4HIXL 4OCYH 1FN4B 1X4ZA 2P5EB 3QRGL 3CK0L 2PN5A 1U8OA 1G9MH 1IGIH 1T22B 5J9PB 2WZPD 3HAEG 4WHYH 4GG6B 3DROA 3CXHJ 1I3GH 4PRPB 3BKMH 3MGOA 5A16B 1CXKA 3C8KA 1GOFA 1ES0A 2B7DT 2IPUG 4LKXA 4JRYB 1OY3B 4F3FB 5GHWH 3D69B 1NBQA 1C8PA 1KLUA 1BM3H 1H5BB 4G9DA 5I8CA 1NGPL 2KBGA 4UTAH 3PQYD 1UYWL 3S5LB 3P2TA 5GGTH 4WWKB 4TNWK 4PLOB 4C4KO 1Z9MA 1DVFB 3VGDA 4NQXB 4OQTL 3BZDA 5EC2B 2HTLD 4OZHB 4LLQB 4U3HA 3ARGC 3D6GA 3GSNA 3BIBX 2PW1B 2GSGB 2MCPL 3L9RA 3HCVB 4Y19B 4F33B 5H35B 3AU1A 2KDGA 1QSEB 3GSOA 3PGFH 1QR1A 4KHTH 3OV6A 1PKOA 4NP4H 5KSVB 43CAA 1VDGA 1ULVA 2WIMA 1CFSB 4MNQB 4UDTB 3RWDA 4JN2A 3FQWB 5KVEH 4I0PB 4XB7A 4OCSH 2EKSB 2QHRH 1JP5A 5D5MB 4AJ0A 4XC1L 4HUMB 4LRNH 3MV9B 3QRFM 2YEZB 4NZJA 5IB1A 5I19L 4JZJB 2OMBA 3B9KB 1PW3A 1ZLWH 1EMTL 1NCTA 4X99B 1CDUA 3WUWG 4DKEH 5GJSH 2OZ4H 4MB3A 3WFCH 3WFHA 4I77L 1B9ZA 3NACH 4XAKD 2CK0H 3UAJC 2VZVA 4PJXE 4XHJD 3UZVB 1AIFB 3HLAB 4B7IA 3QUYB 5LGJA 3HAEH 2ZOLB 4FNLL 2AERT 3C60A 2F19L 4WNQB 3RU8H 3D2UD 1T3FB 5ACMA 3VG0L 1NUNB 1IT9H 1NCCH 1FV1A 3RUGF 3SE3A 5HVWA 2YPLD 2FO4A 5DURD 4CJ1A 4NM8L 2HT3C 4JRXD 4WJ5B 4KMTL 5D1XB 5F7LB 1H3TA 3ARGA 5HYJD 2IANA 2VLKE 5I75B 3VGFA 4XP6H 1YEJH 5AEAA 1KXQE 1H5BC 4MJ5B 3NABL 3ROOA 1QP1A 4URTB 2WBJB 3BDXA 4YFLI 5EBMA 3C5JB 5HGHA 2D03L 5AZEH 2FX8L 3EFFA 1DVFC 1OB1B 4M8QA 1GGCL 5FYKU 5D7JB 3BD3A 2Q86B 1QKZH 1MJ7H 2WIIB 5IEKA 1UJ3B 2B2XH 1HHGA 2ZCLL 5FYKH 1AGDB 4UQ2B 1UZ8B 3WJLC 4UU9B 5IMLB 4ZFFB 2FHBA 4XPHL 3PNWA 1NFDA 2IBGA 3V6FA 2B0SL 3O3BB 5L88L 4IS6A 3QEQD 1CN4A 1YNLL 3BOVA 1WZKA 3UTPD 3KYKL 4P23B 4PB0L 3PHSA 5F88A 4L3EE 2JIXD 4PLKD 3GSWA 3O4LA 4M02A 5I15H 1EFXA 2ZG1A 4PJCA 2VISA 5KS9A 2V7NA 1A3RH 5TFSL 2HRPH 1NEZA 4Y8DC 4JQXA 4HMCA 4MQTB 2FLRT 1FN4A 2P5EA 1KXVC 5C0RL 3T4AB 4JZJC 1HKLH 3B9KC 2ICES 1S7SB 1XZ0B 1T22A 3VMNA 5J9PA 2O5YL 4GG6A 2JKXA 4PRPA 4GKSB 3L3GB 1JPFB 5A16A 3UJTL 5KOMC 3MBEC 1HHHB 2DIBA 4K7PY 3BAEH 4I1NB 4MLSA 1T1XB 4G7YH 1FZOB 3QUYC 4JRYA 4F3FA 4P9ML 3D69A 3SGDH 1H5BA 1MQKH 2QTEA 3OF6A 3AREC 2DQIH 1IEBB 1UM5H 3S5LA 5HI3D 4WWKA 4F37K 1DVFA 1QBBA 4NQXA 4GMTH 5EC2A 4O2FB 4OZHA 5D1XC 4LLQA 4I2XB 5K59F 2PW1A 2GSGA 3WJLA 1NCNA 1CD1B 3M8OH 1CL7H 2DQDH 2R15A 3HCVA 3QEHB 1LDSA 1WAAF 4Y19A 4F33A 3MV8D 1A6WH 5H35A 2LABA 5HPMB 4HSQA 4YHLH 2F8OA 1QSEA 2WBJC 3RIFF 1OTTC 5KSVA 2L0DA 2EDXA 1I85C 5FO9B 1CBVL 2CH8A 1CFSA 1JZ6A 3BH9B 4MNQA 4UDTA 3FQWA 4Y4HD 4PS4L 4I0PA 2EKSA 3QUXB 5D5MA 2EEAA 4LPYA 3H6JA 2F8VA 3MV9A 1TZGH 2YEZA 4OZFG 1E28B 2ZKHL 4OGAC 4JZJA 1GGBL 1E0OB 5JXAH 5KSUB 3B9KA 3HAEB 2DWDB 1NL0L 2NY7L 4M7LH 4X99A 1EBAA 1KCSL 3K2UH 3WHE0 4M7ZC 1A8JH 3BZEB 3O4OB 5JXED 3ARVA 3P73B 4HFWB 2BERA 1Z3GH 1AIFA 5D71L 3T09A 2MTPA 2CDGB 3HLAA 3QUYA 3VXRB 1ZLUK 4AL8L 2IMMA 2ZOLA 1ACYL 2Z0BA 1FO0B 4WNQA 3F7YB 4FXLA 2EDHA 3B5GA 1T3FA 5SWSD 4MQXD 2P5WD 3IDYC 2D0FA 1DQDL 1IKFL 3I6GB 3HC4H 5L9DL 1RZ7L 4OZGE 4WJ5A 1VFMA 5D1XA 2R4RH 5KVGH 4ZAKD 4MSWB 1JMXA 2D7QA 1YYML 1P4IL 1E6OL 4MJ5A 4ZFZB 4M48H 5L8LB 1CDGA 3RHWK 2WBJA 1J1OL 4YHOH 1ZHLB 3C5JA 5F93C 4RGMC 2F8XC 1ITCA 1T5WB 5EA0L 1OB1A 5GRVL 4KPHH 1HQRB 4KFZC 1RURL 4L29B 5D7JA 3QAZB 4U31A 2MQCA 2Q86A 4MD5B 2WIIA 4BA8A 1H0DB 1QSFD 4KI5E 1UJ3A 1FE8L 1AGDA 4UQ2A 1UZ8A 3RTQD 4UU9A 5IMLA 5JLZB 4ZFFA 3BI9X 4PRHE 3KLDA 1KCVH 4RGNC 2FATH 3RWIB 3O3BA 3RVUD 3CMGA 3HR5B 1B2WH 4P23A 4OZFH 3P9LB 3IXAB 3OJMB 1JF1B 1WWWX 1RZIB 2XWJB 1NLBH 4TVPD 3RIAK 1AFVL 1FNLA 3F58H 3TN0D 2VLJE 1YPZE 2IBBA 3CIQA 4ZFOL 4YZFF 2WWMD 5ENWB 1DANU 2GIYA 3MNVB 5E1HB 3D5OF 3MLUL 3QUKB 3T4AA 1F13A 2ARWA 3P9MB 4NZUL 1S7SA 4U0QB 1XZ0A 4DVRH 3BZ4B 4PJAB 2OXHA 4CUCA 4Y4KD 4L8CB 4GKSA 3L3GA 1JPFA 1OAZH 4QHLB 5GGTA 1KSRA 1HHHA 4D9QD 2DM7A 2G75B 1T1XA 1FZOA 4NC0B 3SKJH 3BP6B 4F15B 3KJ4B 4KVNL 4XCFH 4QRPE 1IEBA 1DFBH 5J89A 1JE6A 2Z35B 1K5NB 5LBSH 4FZ8H 1T2QH 2FDBP 2VWEE 2ZUQB 3LMJH 3QCTL 1F5WA 1NAKH 3LKQB 2X70B 4O2FA 5MEND 4PFEA 4XNMB 5F9DC 4EI6B 1HZHL 3UPCA 2IQ9H 4PG2A 4I2XA 2VQ1B 3EO1B 4CVXB 1CD1A 1RJYB 5HI4C 3QEHA 2X4SB 2Z8WC 4XP1L 5KOVC 1NGXB 1I7TB 5FCUL 1EO5A 3CPLB 4WV1C 4HIIB 5FO9A 3QXWA 5DJCB 3BH9A 3HMWL 3QNXB 3QAZC 1S7UB 3W9EB 1HHIB 5C0GB 3QUXA 4U05A 4M1CD 5CWSB 4JPWH 4PJFE 2PO6C 4FP8H 3VXSB 1E28A 1P2CB 1MHPL 2IJ0C 4JAMB 4L4VB 2JJUA 4OAWB 4OTXH 4KUZL 4X5XB 2KH2B 1E4XL 5KSUA 1RZFL 4UBDC 1J05B 3HAEA 2DWDA 2VZTA 1RU9H 4OLVL 3BZEA 3CSYB 1KJ3H 1WLHA 2I27N 3B2UC 5CJ8A 2O93L 3P73A 4HFWA 1J0HA 5DJZB 2CDGA 2VOTA 3VXRA 3ZE1E 3QIWD 5GS2D 4DFIA 1EO8H 3TYGL 1FO0A 3F7YA 1UADC 1UCTA 5TF1L 4QHUB 3F7PC 1T89C 2EC9T 3LPFA 3I6GA 1LGVA 1OARH 5E95B 3HRPA 4MSWA 4X6FB 2DN7A 5HHPB 3KYAA 3UYRL 3KPRB 2A73B 5EOTB 1ZLSH 4D0CB 4ZFZA 2P1YA 3QFJB 1ZHLA 3S8WA 3DX6B 4XZUB 3DETC 2AQ2A 2APTA 4NN5B 4X5WB 1T5WA 2ZUQC 3Q0HA 4HHAB 5CBAB 1HQRA 4L29A 2H41A 5HHMD 4WO4C 3ZTNH 5I73B 3HZVB 2ADIB 4MD5A 5BQ7B 3VI3E 1H0DA 4KU1A 4M00A 4N90D 5IF0B 4Z7WE 1JF6A 5JLZA 1MIML 1KTLB 4QF1B 5D7IE 3RWIA 3JWOH 3LSOB 5JA9A 3PF2A 4JE4B 2PXYD 3WKMH 5HI5D 4NO5B 3HR5A 5IVXB 1A6UL 4MA1B 1LQSR 3P9LA 3IXAA 1JF1A 3MRMB 1RZIA 2XWJA 4RBPH 1A6VH 3BGFB 5T5FH 4G6KH 1H3PL 5C9KA 5ENWA 4JM2B 1JMZA 1WEJL 3MNVA 5KZCB 3QUKA 5CSZB 5ANMB 1UT9A 3P9MA 2XTJD 2HG5B 3K3QA 1T89A 3OPZL 4CGTA 3MXVH 4NNPH 1MCLA 4YFDB 3BZ4A 4PJAA 1FG9C 3LN4B 4L8CA 1T2XA 3K8KA 3NIDE 4NDMB 4QHLA 4K3EL 3UJIH 2G75A 5IQ7L 3L95B 1CZ8L 2GY5A 3BP6A 3O2DH 5F7FA 3THMH 2CRIA 2YRZA 3VDAA 3ULUD 2Z35A 4XAKE 4ZFOB 3IRPX 1K5NA 3N1MC 2UWEB 2NTSP 5E6IB 1VGEH 4XC3H 3LKQA 2XT1B 2X70A 4EXPX 4XNMA 2LFGA 4EI6A 4PLJC 1NMBH 4O51B 5HJ3B 5JW4Q 4U1HB 3SE8H 2VQ1A 3EO1A 4PD4J 4JR9H 4AYFA 4CVXA 4P2RB 1RJYA 4MCZB 2X4SA 1CYGA 1NGXA 2XICA 2YPLE 3V6OA 1I7TA 4TRPL 4UOJA 4HS8L 3CPLA 4NN5C 1WV7T 4CVWA 4HIIA 4PYHA 9CGTA 1TVDA 5HYJE 5GZNC 4X83A 3SDDB 5DJCA 4CMHB 2BSED 3BPCB 3QNXA 5I73C 1S7UA 3BJLA 1DBBL 3EJYC 1D6VH 4QHNB 3W9EA 1HHIA 5C0GA 3PP4L 5I1IL 4Z95L 5CWSA 5M94B 2R39A 4NKMB 3U7AA 1KJMB 1P2CA 1SBSL 4JAMA 4L4VA 4HQQL 4OAWA 3NCFB 4X5XA 1BAFH 4TNWF 1KEGH 1J05A 4M7JH 5E08L 1IQWH 3RVXC 2MPAH 3ZHKA 3CSYA 1Q72L 3PWJB 4W4OC 4FQIH 4Z7UF 1IGCL 3GIZH 3QQ4B 2XV6B 3BGFC 2XZCL 4MB4A 5DJZA 5T1LD 1J0JA 2UYLB 3ARBB 3QEQE 3TA3B 4KZEH 4RA0C 4WUUD 5DHYB 3UTPE 2C3VB 3H42L 5K9QI 2K7QA 3EHBD 3MFGB 4XNYH 3KPSB 4AQ1B 5FHBL 4Q9RL 4QHUA 2HT4C 3IDNB 3EOYG 4HKZB 2CUMA 4TPRL 4K23L 5KSBF 3LKRB 4GOSA 4D9RE 1CTNA 2RQ8A 1MCJA 4X6FA 5HHPA 2D9CA 1J7VR 3D85B 4HBCL 3KPRA 2YPKB 1J0YA 4Z6AT 2A73A 5EOTA 4D0CA 3LS5L 3WLWD 4XMPL 5GSRB 3QFJA 5K33A 1XR9B 3KYNB 1NC4B 3SGEH 1U6AL 2HT2D 3TLRA 4F9LC 3QR2A 1YMMB 3DX6A 4XZUA 4X5WA 5CJBA 5E6IC 2VDNL 4HHAA 5CBAA 1CXLA 3HZVA 2ADIA 1MEXH 3WNMA 5BQ7A 5DVNA 5IF0A 2R1XB 3HI5L 3AB0B 3WKNA 5D1QC 1KTLA 3ZL4L 4QF1A 3QG6B 3G6AB 3LSOA 1KTDB 4PREB 1HCVA 4YX2L 4ETQB 1XF2B 3MCLL 1A3LH 4NO5A 1U3HB 3RVVC 5IVXA 3BKCL 2ORBL 4MAYB 1Y6MR 2G5RA 3MRMA 4CMHC 1XGUB 4W4OA 5HDQH 4LSSL 4XCYB 4ERSH 1FAIH 3MV8E 4KKLC 4YDIH 3KG5A 3ARSA 4Y4FD 3N0PB 4JM2A 4LCWD 1BWMA 3DO7B 5CSZA 3GO1H 5BS0D 5ANMA 1QR4A 5CJXC 2AJXL 4Y2DB 2HG5A 2VR5A 1XIWD 1FGVH 4YFEA 2VXTH 3LN4A 3HNSH 4MA8H 1YQVL 4NDMA 3X13B 2NY4B 5JORB 5DF0A 3U83A 3L95A 3W2DL 4HULB 1JHLL 3ARBC 3Q5YA 1XGYH 3B4NA 4PGZA 4ZDHB 1RIHL 4IJ3B 3REVB 1MWAH 2WK2A 2J88L 1LO3H 1FYTB 3TPKA 4WHCA 4ZFOA 1X5YA 2UWEA 5E6IA 2E27L 3FQRB 3PP3K 3GHBL 3DOSA 2XWTB 4HZAA 1C5CL 4DKFH 1KCUH 2BVUA 4O51A 2NPLX 5HJ3A 4CDGC 3G5YB 5KVDL 3S7GA 4U1HA 5SWSE 2P5WE 4P2RA 2GJ6D 4LDEB 15C8H 4MCZA 2E8ZA 1KENH 4QTHB 4DUVA 1HDMB 3O6ML 1PFCA 4Q9QL 2DBLL 3HTLX 1DLFH 2NLJB 4OF6A 3SDDA 2VXQH 2EDTA 3BPCA 3TIDB 4QHNA 1R3JB 2CXGA 4F2MB 4NKMA 3JV0A 1KJMA 3AB0C 3O6KH 4OD3H 5CJXA 1T03H 2M26A 1YYLH 1NMAH 1N7MH 2YD7A 4F37F 2EDKA 1MNUH 1RVFH 1U3HC 1FP5A 2CSPA 3N85L 2AV7B 3NCMA 2VKWA 4MAYC 4XP4H 2IALB 3PWJA 4RIRB 4ZFGH 5GRYA 3L1OH 3QQ4A 1LEGB 1U3YA 3SOBH 1LHZA 2HJKB 2UYLA 3ARBA 3SJVB 5KS9F 3TA3A 5IB3B 5DHYA 2OJZH 4M5ZL 5DD1H 1F2XK 5GQBA 5IHBA 1P4LB 4JANB 4XMKH 1T7XA 4YUEH 3KPSA 2OR7A 1V05A 4JB9H 5FIEA 4ALAH 3MRNB 4Y2DC 4TVPE 4PJBE 2ARJB 2JJSC 3IDNA 3WFZA 1KPUB 1JVKA 3GJEB 4HKZA 1PQZB 2PW2B 2GY7B 3MYZA 1CICD 3HHRB 5CGYC 3LKRA 3QSKB 2AS5M 3O9WB 1TFHA 1ZAGA 5KBNC 3D85A 2DDQL 5K9QG 2YPKA 3FB5B 1DBAL 2YZ1A 3PL6D 4EDWL 5GSRA 4LIQE 1AC0A 1XR9A 1AGCB 3KYNA 3C87A 1NC4A 3MFFB 4ZTOL 4AQOA 1QFWI 1YMMA 4D9QE 3ULVL 1LO4L 5FGCE 4OQ1A 4JLRB 1EJOH 4KJPC 1AR1C 2BRRL 4RA3A 2NW3B 4BZ1L 2R1XA 1MFAH 4JFQB 3QG6A 2UVEA 3G6AA 4PREA 1KTDA 2E7MA 2JCCE 4ETQA 4KKAD 1XF2A 4PRID 1KF9B 4XPTL 2FYYB 5FDYA 2G60H 1U3HA 2EYRB 4MAYA 3VU2A 1LP9E 3NCBB 35C8H 5HY9B 1T66C 1CGSH 3H3KA 1XGUA 4XCYA 4H0GA 1J11A 2E7HA 1R3IH 3EIFA 4JKLA 5EZOH 5C6TH 3RHWF 3OKKB 4K3GA 1D9KB 1J1PL 4R4FL 3DO7A 4BQBA 3C08H 4Y2DA 1AXIB 2LTQC 3OX8B 1X5FA 4W68A 1E4WH 2QQLL 3G5XB 4K3JH 2EIDA 2R4SH 2X1OA 3X13A 5JORA 1IKNC 5I1EH 3PXHA 1L7IH 1JWMB 2D7TL 4ZDHA 3EYSH 3GI9H 3TPUB 3REVA 4U4BA 25C8L 1FNEB 4HPYH 1LO0L 1MRFL 4AEIL 3I3BA 3UTTB 1KCRH 1FYTA 5KVFH 2YKLH 3UXFA 3STLB 3RWCB 4NRZB 3FQRA 3ZDXF 2XWTA 3LV3B 4M62H 4V2CB 4RWYL 1X7QB 1C5BH 4HWEL 1KB9J 2BOBB 3G5YA 1NCAL 2WP3O 4R2GB 1CFVH 5DSCB 2VLKB 5CP7B 2RR3A 1CVRA 5HHNB 3FAXA 1JFQH 4QTHA 4OJFL 2VYRE 1HDMA 1ROWA 1CD0A 5AAMA 3UP1A 2CUHA 1WK0A 3FL7A 5L8JB 5I1KL 3MR9B 3OAYH 4LOUC 3AY4C 4HUKB 5CILL 2GFBB 2I24N 2NLJA 3KJ6H 2A1WL 3TIDA 4UIKH 4MNGB 1R3JA 3OGCB 2W91A 4F2MA 2YD1A 4LAQL 3RVTD 2J5LB 3FFCD 1QHPA 4X7DC 4KKBC 1FNSL 3VFNB 5TPWL 5HHME 2JJVA 5E24E 1OAQH 3IS0X 2V5TA 4CBPA 2DLTA 4LLYB 4FN0A 3L3IB 1LD9B 2AV7A 1WT5A 5E2VL 1JNLH 2IALA 4TNVF 5AWNH 4L3EB 3LHPL 4RIRA 1G84A 1JTOA 2VZUA 1IKNA 1DE4B 1LEGA 2W9DH 2HJKA 1CFNB 5F7UA 4FQLH 3SJVA 4LCUB 5IB3A 2UZXB 4LSQL 3WUZA 1TMCB 1X3DA 3FZUC 3RL1B 1P4LA 1AE6L 4JANA 5DMGC 2Y06H 2DL9A 3MRNA 5GS0L 5DD3H 5FOBB 1FGNH 2QQKL 5D2NB 2ARJA 3TV3L 5D2LB 1KPUA 3GJEA 4OFYD 2Q3ZA 1PQZA 2PW2A 3ZT6A 3PG2A 3ARWA 5HPOA 4O00A 3O9WA 2V5SA 1IGIL 4M4PA 2XTJE 4X7SH 4NWUL 4BSWB 4J6RH 2X7LB 3FB5A 3OXSB 3BKML 1AGCA 3MFFA 1AJ7H 2H26B 1EEQA 3AY4A 4NBXB 3K8MA 2AEQL 4PIRF 3CFIC 5GHWL 1CGWA 5IGXH 2EDRA 3ZKMC 4JLRA 2BSTB 4B50A 1QBAA 1INDL 5DTFB 1XMWA 4TOYL 3ZDYE 2NY2C 2XQBH 1C1EH 3BE1H 3EYVB 4N5EC 2NW3A 2C4FT 3ULUE 4ACPA 3DYPA 4X4XB 4JFQA 1F4XH 4IRJD 2Z8VC 3MJ6A 4WY7L 1A14H 2FYYA 2XTLA 2EYSB 2P47B 2EYRA 3AAZB 2RAMA 1GJIA 5HY9A 3LRGA 2B20A 4JFXB 4NRYB 1EGJL 5D1ZB 2H6PB 4HFUH 2IH1B 2P45B 5FUCC 4APQD 4NP4L 1BLNB 2OR8A 2J5LC 4QOKD 3OKKA 1D9KA 2HWZL 1A02N 3MNZB 5I1GH 4KTYA 2Y4SA 3FO0L 3OX8A 4OCSL 3ZHDA 4BFIB 3OQ3B 1F4WH 2QHRL 3C5ZD 3G5XA 1E6JH 1FNHA 2GQHA 3ZKQD 1PZUB 1B4RA 1BIHA 3KPNB 3ZYZA 2AI0H 3O6LH 1BD2B 1CDIA 1GGIH 5AYUH 2L4OA 3R06B 3OG6B 5IFHH 1NANI 2DYPB 3HPJB 3SDCB 1JWMA 5DJ0B 4DKEL 3TPUA 2AK4D 3NH7H 2OZ4L 1FNEA 3WFCL 3M17B 3UTTA 1QLEL 1OTUD 3QPXH 3I84A 5D2NC 3RWCA 3STLA 2VDOH 4NRZA 5IV2B 5FHAL 3LV3A 3NCCB 1X7QA 4WUUE 1A5FL 4OZGB 3RU8L 3VGBA 4MA7L 2BOBA 5FUZH 1OTSC 3HA0A 2BNRE 1IT9L 1HIMH 4RGOL 5DSCA 2VLKA 5CP7A 5GPRA 4XRCB 4MAUL 5HHNA 3MRQB 3INUH 4P5TB 4AG4H 3MR9A 1G7LB 2GFBA 4UT7H 3QHFH 3QUZD 4KK8D 5E56A 4XP6L 2V9TA 1QFWH 5CGTA 3QCUL 2APFA 1SYSB 4GKNB 4MNGA 3OGCA 1CFBA 3MJ9H 5AZEL 3VFNA 4LP5A 4FFVC 4B41A 4YHYB 1QKZL 4LLYA 5F8RC 3L3IA 5A3ID 5C0EB 1LD9A 3G5ZB 3MC0A 2YWZA 3H0TB 5FYKL 4ZPTB 4XMLL 4FQXB 4L3EA 4X4ZA 1OAKH 2EDDA 3CCHB 1DE4A 5D93B 3WJJC 4KKNA 1CFNA 1TENA 2VLJB 3VFMB 1R3KB 1KULA 3FRPG 1YPZB 1C16B 3GRWL 4LCUA 3ULVC 3GHEH 2Z8RA 1RK0B 3RL1A 2BY1A 3RUGE 3S3SA 1CXHA 4YBLB 4N0CC 4MA3B 1PSKH 4GBXD 1PKQB 5FOBA 5J1TC 4LL9A 5D2NA 5D2LA 2HRPL 3OKOB 5E5MB 4R4ND 5C71A 2C1OB 3MLVH 4O9HL 2IAMD 4LCWE 4PJAF 5JUEH 4BUGA 5BS0E 3S97C 1UQSB 5TQ0L 1MAML 2V5MA 2XXMB 4G8FB 2HYMA 3RY4A 3SDCC 4BSWA 2X7LA 2NXYD 3QG7H 2KPNA 1NFIB 4GUPB 3OXSA 3STBA 1JGVH 3EJJX 1TLKA 2H26A 1U3ZA 4QRPB 5GGVY 2XA8L 3KYOB 4W6YB 3CH8A 3QYCA 2BSTA 4PJ5D 5DTFA 4EDXB 4N9GB 2DQIL 1UM5L 5GRJH 3IU3B 3NGBB 3EYVA 1Z9OA 3GMPB 4QGYA 3QDHA 1FZJB 1UM4H 3RJQB 4K2UH 4X4XA 3F6IA 2LAGB 1RUPH 2C4XA 5B38G 2XN9B 1MI5D 5DGRA 2EYSA 5H2BB 3CXHK 3AAZA 3RAJH 2UUDK 4JFXA 4M7KH 2DQDL 5IJKA 3VXUB 1DL7H 1V7NH 4NRYA 2GJ6E 5D1ZA 1A6WL 2H6PA 3NAAH 1V3MA 4YHLL 2AQ3A 2BVPB 1B0GB 1MCRA 2IH1A 3DARA 4RSVA 5ESVB 2GSIB 1BLNA 3O0RH 4PJFB 3BUTA 3MNZA 3EGSB 5GGUB 4LP4A 2N7AA 4DOHE 2HVKB 4O58H 4YHYC 4BFIA 1KPRB 4G5ZH 4LKCB 5HGBB 1T1ZB 3DXAB 4XT1C 1EUUA 4MXQD 1TQBB 3KPNA 4K8RD 1BD2A 5D93C 4K94H 1XFPA 5JXAL 1OLZA 4Q58C 3R06A 1P6FA 4KRNA 2Y9RT 3ALPA 3ZYOA 3BO8B 2DYPA 3HPJA 3SDCA 4M7LL 4HEPG 5DJ0A 2WUCH 1K9TA 3DVNB 4NCC1 4LMQE 3M17A 4L9LB 4YBLC 3MA9L 3E8UH 4DFHA 1Z3GL 5DC9B 5IV2A 5IJVB 1H15B 1CFQB 5K59E 5EZLB 5HYFA 1WAAE 1XF4B 2J8HA 4OZGA 1ND0B 5BVJB 3PV7A 1DN2A 4XRCA 3LN5B 3HC4L 3EDDA 3PWPD 3MRQA 1BFVL 1ODAA 4P5TA 5LWYL 4PG9B 5IHUH 2R4RL 1G7LA 2WBKA 5TQ2L 3V2AR 2MQ0A 5CEYB 4CW1B 4GXVH 4IHOB 2FX9H 4S1RH 1SYSA 5GS0C 1TJIH 4GKNA 4X6BB 1YECH 2F5BH 4Z7WB 1JYWA 2EXYC 2X41A 4HMDA 4POUB 4X9IA 3TCXA 2XRAH 1S9XB 5C0EA 4YGAB 4O02L 3G5ZA 3OTTA 3H0TA 2AEPL 4ZPTA 4FQXA 5IVXF 2FATL 3CCHA 3TCLB 3BKJH 1FH5L 1UH2A 2WQ8A 2VLJA 3VFMA 1R3KA 1YPZA 1C16A 1RK0A 5DFWH 3ARGD 2IAND 2UVFA 4NRXB 4MA3A 2AJVH 1PKQA 1K6QH 4OZ4B 3OKOA 1FZMB 1RHFA 5E5MA 3W0WD 4F7MB 2C1OA 5TJWK 4M6AA 3HG1B 1UQSA 1BZ9B 4G8FA 3MLWL 1G0XA 4ODXB 3W5NA 3S37H 4EUPG 1NFIA 3D39E 4GUPA 1Z9SA 1NANH 4L9LC 2X4UB 4QRPA 1AY1L 4J3OC 4BKLB 1HKFA 3U82B 3N1PC 3VWJB 3KYOA 3SKJL 2X9YA 4EDXA 4N9GA 3KLHC 3GUTB 1DFBL 3IU3A 4X0KB 2PYFB 3UAJD 3D2UB 3GMPA 1HH6B 1MJUL 5JHLH 1FZJA 5LBSL 4FFWC 1S5HB 1T2QL 4FZ8L 4L8DB 2A77H 2P8MB 3X14B 3JTTB 3UC0L 4C58B 1T0PB 1G7HB 2J12B 4ODVH 4EIGB 2XN9A 4UINH 2YPLB 5DURB 4WENB 3R4DA 5H2BA 1L0YA 4YZFE 4NJAL 3LQMA 3DVIA 5HYJB 3VXUA 4BK5A 2HKFH 5J06A 2R8SH 4P5MB 4PRPD 5A2KH 5J6HB 2BVPA 2HT3D 1B0GA 5ESVA 2YOCA 2GSIA 4G6JH 4PJFA 3ARDB 3EGSA 5GGUA 2DRUA 4CADB 2HVKA 5FA3B 3UTZB 1KPRA 5K9JH 5E2TH 4LKCA 2AGJH 3KLAB 4K7PH 1T1ZA 5HGBA 3DXAA 4WWKD 4GH7B 4OCNC 4S1SH 1DVFD 4OTXL 3FFCE 1K4CB 4UQ3B 1G9NH 3BO8A 4D9LL 4D0DB 5ICZB 1M7DB 3DVNA 1EGJA 4UAOB 2JJTA 4L9LA 4MJ2A 4Y19D 2JIXB 5DLMH 4EOWH 3MLRH 1FVEB 4DN4L 5IJVA 1H15A 3CFCH 1CFQA 5EZLA 4JVUA 4NZRH 1XF4A 1ND0A 5BVJA 4MNQD 5T3ZD 3HI1B 1MLCB 3WBDA 3LN9A 2CGRH 3LN5A 2D7MA 4TVPH 5E99L 4NSKB 4R4BB 3SDXF 1OARL 2X4RB 4LU5H 4PG9A 3MJ9A 4AIOA 2NZIA 4R8WH 3VWJC 3B9KD 4X80L 3CLFH 1K8DB 5CEYA 4CW1A 2EIEA 4IHOA 4RMRA 2HLFC 2IWGA 3MBXH 3EDJA 1N6QL 5IW6B 4X6BA 2FD6H 4LIQH 5B39G 4Z7WA 2WNGA 3QUYD 4UUJB 4K55A 5ABDE 3FQXB 3ZKXB 3O45B 1S9XA 2JB5H 5B8CB 3OAZK 3V6BR 2DF3A 5J12B 3TCLA 5HYSG 2CMRH 4NOBA 3V0VB 4M3JA 4ODBD 3A67L 5D1XD 2MQ3A 3AC0A 4NQSB 3ARDC 3DMMC 4HPOH 2QJDA 4JKKA 5IB5B 4C59B 4NRXA 3EYOB 1KELH 4OZ4A 1CXIA 1JGLH 2VN4A 1G6VK 4G6KL 2WBJD 1QYGH 4Y4HB 1FZMA 3QNZB 3V4UL 4F7MA 1OOAA 1OTTD 1YJDL 1FAKT 2WUBH 4QOKE 4ORGB 3TGXA 5LAXB 3HG1A 1CF8H 1BZ9A 5DFVC 2VZSA 3BWAB 2FZ3B 4R0LB 2OL3H 4ODXA 1CD8A 1CXFA 1I8LC 5IB4B 5INCB 4NNPL 1DSFL 1A21A 4YXKL 4UAOC 2X4UA 2YUVA 4OGAD 4BKLA 3UJIL 3VWJA 3ILPB 4TTDC 1HNFA 4P23D 3D25B 2VXSH 2AK4E 2IPUK 3GUTA 1JHKL 4TSBH 1RJCA 4X0KA 2PYFA 2Y07H 3D2UA 1HH6A 1SHMA 1S5HA 2VTFA 4L8DA 1DQJB 2P8MA 2OCFD 4IBLT 3X14A 2OP4H 3JTTA 4NPYB 1G7HA 3KYMB 3Q2CA 1I1AB 2YPLA 5GS2H 1YMHB 3Q6GL 5GRWA 1G1CA 5GIRB 1HINH 5GGQH 3SE8L 4JR9L 3EFDL 1IJ9A 4ZAKB 5HYJA 4O5LL 5INDB 4WCYH 3FRPA 3RKPA 4Y88A 3IDMB 4P5MA 4XPGH 5J6HA 1AD9B 1NLDH 2DAVA 4XP9H 5DD6B 4IRZH 2Q87A 1Y6KR 4YDLB 4HAGA 1D5ZB 5I6XC 3ARDA 4NN6B 4V1DB 1UWGH 1M1SA 5DEGB 4CADA 1DBKL 1GGYA 5FA3A 1D6VL 3S3PA 1MAJA 3UTZA 2FBJH 4IM8A 4KY1L 4XBEH 5B8CC 3KLAA 5EUOE 1RK1B 3IFOB 1I9RH 5J12C 3P4MB 2EDFA 1BEYH 3VRLF 4HCRL 1K4CA 4UQ3A 5IVNA 1KEGL 5BMFL 1NUFA 4YQXL 2DOCA 2VSDA 1I8LA 3ULSB 2VN7A 4XNUH 3KS0H 3V4PH 4D0DA 1M7DA 5ICZA 4BELD 5E8NB 1IZJA 4F7EB 2JIXA 4XPAH 5LJYH 2R56L 1FVEA 3QQ9C 3IFPB 4KZEL 5DVOA 4LMQI 1T83A 3V8CA 2DD8H 5CEXB 3HI1A 1MLCA 1CI5A 4HAFA 5EO1B 3QUXD 3AGVA 1F4YH 4GAYB 4NSKA 4R4BA 2X4RA 4XI5C 4Y4KB 4OI8A 2FB4L 1GL4B 1HWHB 1K8DA 3OB0H 4JCLA 4P4KB 5E2JA 5I1JL 3HMXH 1UWXH 4LCIH 5IW6A 2GKIA 2AK1H 4FABH 2QSCH 3JUYA 1NAMH 3BFOA 4EQ2A 5BCAA 4FHBD 1OM3H 5I1CL 4OCXL 4UUJA 1OT2A 3FQXA 5E2WH 1BVZA 3AS3A 3F12B 2JCCB 3O45A 4CN6A 1UCBL 4NKQB 7FABL 1KB5H 4X6EB 5B8CA 4LRIC 4L3AA 5EU6E 3QDGD 4P49A 5GISH 3EOBB 4M43L 3ARUA 3ULUH 4OSUL 5ALBH 3V0VA 4FQCH 1A3LL 2PUQT 3WLBB 1G6RL 4KJQC 3QI9C 1MI5E 4H5SB 4NQSA 1YEHH 3MV7D 5IB5A 4NN6C 5EH1A 3EYOA 1S9KC 5HI4D 5L6YL 2X1XR 4ODHL 5KSBE 3VXSA 4YDIL 5HPMA 4Y4HA 5FYJD 3QNZA 3D9AH 5CIPH 3O81A 3KAAA 1IAII 4KAQH 3IKKA 3T1WA 1HOCB 4ORGA 3U7WH 5LAXA 4AEHL 4FQ2L 3BWAA 3PUCA 2FZ3A 4R0LA 1FGVL 4WGWB 5IB4A 1F3RB 1FSKC 1A7RL 5INCA 2VXTL 2DQHH 1WZ1H 3O3DB 4BYHA 2PO6D 3EOTL 5CLTA 1TZHB 3Q1SL 5KTEH 5JXEA 4MDJB 3X3FL 4UBDD 4HC1H 1KNOB 2X2YA 4C56B 3ILPA 3D25A 4EBQH 1FLTX 1PJ9A 1JGDB 1V5JA 1HEZB 3KPPB 3B2UD 1T5XB 3PHQB 4CMMB 4ONFH 1DBJL 1DQJA 2AJSH 4NPYA 1QOKA 2W0PA 1KIUA 3QB7C 4JKPL 1KCUL 3KYMA 1I1AA 4RMTA 4LQFH 1YMHA 5GIRA 4LRIA 5ITFB 4ZAKA 1U42A 2LVCA 3JV4B 1U8LB 5INDA 4P4KC 2XKNB 1FRGL 3IDMA 3NZHH 4OGYH 1AD9A 2NY1C 3PWPE 4Q9CA 1AXTL 5DD6A 1ZGLP 1SQ2N 2VDQH 4H8WH 1D5ZA 4DEPB 2EE9A 1TJHL 5C7XH 4NKIH 1EEZB 2K1MA 2VXQL 4V1DA 3O3UN 2R1YB 4GS7B 5DEGA 2WP3T 2YSSB 4XX1G 2VE6B 3J7HA 1D6EB 4PV8B 3O6FB 3SQOL 1AKJD 3DETD 1RK1A 2HJLB 3IFOA 5T5NG 3O6KL 3K4ZA 3K1KC 3P4MA 1EBPA 4OCWL 4Z7VF 1NMAL 1N7ML 2VH5H 4PD4K 1ZA3B 4P57B 2ZPKH 1MNUL 5MEQB 4ZQKB 4E41D 3ULSA 4XP4L 1Y6NR 2P44B 4HWBH 5E8NA 1BGXH 2R2HB 4F7EA 5TF0A 1A1OB 3SOBL 5LXGH 2J6EL 3FO9B 3IFPA 1T4KB 2C5DC 4ONGH 5D2LF 1G7JB 1IFHH 1U8NB 1TJGL 2FSEB 1W0VB 2VDML 5IB2B 5C1MB 1KBGH 2IANE 4YUEL 3GGWB 4JB9L 5CEXA 2DQFB 3HC3L 5IKCB 5EO1A 5B22A 4GAJH 4OCLC 2XTJB 4GAYA 3HE6B 3RGVB 3W0WE 1NAMB 4Y4KA 4KC3B 4L4VD 5DRXB 5T33H 1AR2A 1BMGA 4H1LG 3N1QC 4P4KA 2C9AA 2R1WB 2RB8A 3FO2B 3IGAB 3PWLB 1F6AB 1KN2L 2PKDA 3MCG1 4HIHB 5E7FA 1BZ7B 2ICWI 1YJDC 4JFZL 4Z8FH 3TBWB 3F12A 1JPTL 2JCCA 5I0ZA 1TNMA 5GZOC 5DWUH 2FGWH 4X6EA 4YDJB 4I3SH 3IXTB 5KS9E 6FABH 1MJ8H 3KS0J 1NDMB 3EOBA 1X5IA 4OKDA 3LQAL 1JNHB 1SJXA 3UYOD 3V4VL 4OM0H 3GJFH 3WLBA 4PLJD 2G60L 4H5SA 4M1DH 5CGMA 3ULVF 1QBLH 3KPRD 3LAFA 4GS7C 4HT1L 3IFLL 3QFJD 3X11B 2H1PH 4PRPE 3T77B 5SX4I 2YK1H 3O6FC 1I3VA 5J56B 1C7SA 1HOCA 5ALCH 2GTZB 5GZND 1DBMH 4B7LA 4OLXL 4HUWB 4JN1H 2Z91B 4LVHC 4F80A 3A6CL 4ODUB 3O3DA 1MUJB 2VR4A 5E2UL 5HHOD 1TZHA 5I1EL 5DC4B 3QCVH 4MDJA 4K3DH 1KNOA 4C56A 4YE4L 1FDLH 1OAXL 3GBMH 1JGDA 4HPYL 4LSTH 4WUUB 1HEZA 3KPPA 1RZJL 3A0OA 3B5TA 3P0YH 3V6ZB 4H0HB 1KEMH 1T5XA 2YKLL 3PHQA 4Y19E 4CMMA 2BNRB 4H1LH 3B2VH 4NZTH 5EN2B 5E5UB 2EEDA 2JE8A 3HE6C 3RGVC 4JM2D 5KZCD 2V9QA 2C3HA 4A2LA 3VFOB 4DKDC 4MNQE 5T3ZE 4CRPA 3LKSB 5ITFA 3BMVA 3MLZH 3EDEA 3U0WL 2HT4D 3JV4A 4OF5A 1U8LA 5JW4M 4Q6IB 4YHKH 2XKNA 2F5AL 1JPST 1U41A 4DVBB 4KQ4L 5TGBB 4P0DA 5LVEA 4NC2B 5ERWB 2FJHB 3QJHB 3SEPA 4DGIL 2HMIC 1YN7B 4ZO7A 5F6IB 1EEZA 3BKYH 3KJ6L 1P7QD 2R1YA 2Z92B 4S2SB 5JR1H 3L3DB 2YSSA 2VE6A 2Q7NA 1RULL 1YN6B 3MO1B 1D6EA 3EO9L 4PV8A 3O6FA 4UOW0 2WSKA 2HJLA 1LILA 1RJLB 5E6ID 5I18L 1BBDH 5SV4A 5AAWA 2W07A 4UV7H 1ZA3A 1OAQL 4N8CL 4P57A 5MEQA 3GKWH 3PWNB 4ZQKA 4KDTC 3UBXI 1GHFH 4TUJB 4P2RD 2R2HA 3RUGB 4G3YH 4IOFC 4LPCA 5D1QD 4U2ZA 1QPPA 2EE2A 1MRCL 2W9DL 1A1OA 1MCIA 2MKWA 3F5WB 3BQUC 3MRDB 4KHXL 3FO9A 1T4KA 1L0XA 2UZYB 3RVVD 4JO4L 1G7JA 4ZPVB 1U8NA 2FSEA 1W0VA 4U6YB 5IB2A 3SDDD 4LCWB 3GGWA 1TZIB 2YA1A 3FB7B 5IESH 5ADPH 2DQFA 5IKCA 5A43C 5C92A 1FGNL 2XG5A 3S98A 4KKLD 1JGEB 1MIEL 3MODL 4LEXL 1ZGLM 1DQQB 3HE6A 3RGVA 1NAMA 4GMSH 4HCRA 4NNXB 5DRXA 4AEFA 3SKUD 4A6YB 5CCKL 3K46A 3NZ8B 4OLYL 2R1WA 2NXZC 3FO2A 4QO1A 4UNVA 5CBEB 3IGAA 1JYNA 1IC4H 1P84J 5L8KB 1IILE 3PWLA 3HNVH 4QRRD 3E2HB 1F6AA 1JRHI 2XYCA 4HIHA 3WN5B 2F15A 1BZ7A 3ARBD 3X12B 4H88L 3W81A 1IM3B 4JQVC 5CHNB 3GJFB 3TBWA 1NJ9B 5JHDB 2H2SC 1MPAH 3KPSD 1RY7B 4PB9H 4YDJA 4DGVL 4RMSA 2DLFH 4LSDA 3IXTA 3CZFB 1NDMA 5DGQA 4ZSOB 4YH6A 1FPTH 4YHPB 2GJ6B 3NMEA 3QDJD 5MI0C 5ILTH 4U3CA 1JNHA 1N5YH 1EEYB 4JG1L 1EHLH 4KDTA 2CRYA 1A2YB 2ZUUA 2RBLA 2N1KA 5F6IC 3U0PB 5JIHA 2E6PA 3DRQB 4GQ9H 5DQDH 3FOLB 4AMKH 3X11A 3T77A 5CZXC 1NC4D 3AROA 3JBG7 3S9DB 5KJRH 3NA9L 2X4QB 3GDBA 4PRBB 2GTZA 5I1GL 5T1DL 1HSAB 12E8H 4HUWA 3GSUB 2BJML 2Z91A 1F4WL 4N0YL 3FHQA 3BT2L 4JJHA 4ODUA 1MUJA 1JNJA 2DJUA 1J5OH 1JIBA 3TBSB 4OIIL 3TBVB 1MFCH 1NFKA 3RWGB 1U3HD 5HYQB 2YXMA 2PF6A 4MAYD 3NH7L 4WUUA 1MCWW 4LEOB 5DHVB 3H3PH 3V6ZA 4RGNE 4XPFH 1RZKL 2BNRA 3K4AA 4PYGA 5EN2A 5F21B 3OAUH 4O4YH 4YDKH 4G6AD 1CK0H 4OFDA 2N56A 4Z0BL 3VFOA 4R9HA 4Y2DD 3LKSA 2V17H 3EW3B 4Q6IA 3BHBB 4DVBA 5TGBA 2QQQA 4AG4L 4N9OB 3WFEH 4WGVB 5CGYD 5ERWA 2FJHA 1Y18B 3QJHA 1AC6A 3E2HC 4C83B 4J3SA 3UTOA 4UT7L 1LE5B 1CU4H 1YN7A 3WN5C 5TE7H 2Z92A 1IC1A 4S2SA 3JSSA 3L3DA 5F1OB 1WZMA 1LK3L 1YN6A 3MO1A 1QFHA 1FYTD 4HWBA 2AJUL 2V2XB 4LHUG 4P99A 4WI8A 2L7UA 1RJLA 3TYFB 4NBZB 4WI2A 3UO1H 3ZO0A 5D96B 3PWNA 4KJPD 4DGYH 1AR1D 4QXTB 2NNAB 3TT3H 2XACC 3O8XC 4TUJA 2YD9A 4CNIB 3RUGA 3QDGE 1OAKL 1TTGA 3X3GH 3BD4A 3WDJA 2ADGB 3F5WA 4NJ9H 3MRDA 1W2KT 2D31B 5A2JH 3GHEL 3WXWH 3QJFB 5DFTA 4ZPVA 1AH1A 4U6YA 3ARQA 3WO3B 2X42A 1T66D 3DSNA 1TZIA 3FB7A 3MV7E 4LCWA 5SX4H 4X4YB 3AVEA 1JGEA 3LH2H 2JELL 5FYJE 1DQQA 3D39B 2RJMA 3LQAC 1MREL 4NNXA 2JK5B 4A6YA 3U4BL 4RFNB 3NZ8A 4OI9A 3RNKB 4PJ8B 5GRUH 5DXWA 3QG7L 2ZCHL 5CBEA 1AHWC 1JGVL 3CDGB 3SCMB 1I9JH 2P8LB 3WN5A 3X12A 4X6CB 1IM3A 1JF5A 4JG0L 1LDPL 5CHNA 4LLMB 3GJFA 5EIQA 1MF2H 1NJ9A 5JHDA 1N64H 3ZSTA 1BJ1H 1QEWB 2K7PA 2NYYC 5GRJL 2OTWB 1R0AH 2Q8AH 2IG2H 3CZFA 3MOAH 2YD5A 4ZSOA 4CJ0A 3JV5A 4YHPA 1ZHNB 2GJ6A 2ZJSL 2FRGP 3MROB 5F1IB 2ERJC 1EEYA 4Z7QF 2R0WH 1CWVA 3QDMB 3OKLB 3O9WD 1A2YA 4BZ2H 3U0PA 1S8DB 3DRQA 3QA3B 3JWDC 1RZJC 3BH8B 4RDQF 3FOLA 1Q0YH 4KXZH 4LOUD 2X4QA 2CR6A 4JY5H 1KCLA 1HXYB 5HVHB 1F97A 5J11C 4PRBA 4X9GA 3LZFH 1EZVY 1HSAA 3GSUA 2Z4QB 5D96C 1FYHB 4H20H 3EJZC 3ARPA 4M6OL 4NM4L 4K94L 4KKBD 5BO1H 2FECL 1YEFL 3TBSA 4Y5XB 4AY0A 3TBVA 5F44A 3RWGA 4E41E 2WUCL 3DGCR 3I3EA 5HYQA 4F9PA 2R23B 2D2OA 4D3CL 1WAAA 4LEOA 4XXCC 5DHVA 3EYQC 1OWWA 4OF3A 5DO2C 1JHTB 4ZUVB 1MVFA 4G6ML 2ED8A 3LY6A 3WFDL 2YRPA 4H25B 1YZZA 4ODTH 4FZEL 3FZUD 3SE4C 5DMGD 4IRSB 5KSAC 5C2BL 1GSMA 2DI9A 3RY5A 3CFDB 4PJ8C 3BHBA 1EV2E 3HS0B 5C0AE 2ICWB 1QRKA 4FFZH 2X09A 5BZWB 3SCMC 1Y18A