3QUZD

Structure of the mouse cd1d-nu-alpha-galcer-inkt tcr complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 65
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzD02
4WV1C 4G3YL 3H7BA 5JMRA 2VUOA 2B0SL 5KSBE 2W65B 2DKMA 3KPSB 1L7TL 4DW2H 1VGEH 4M4RA 4Z0XB 2X7LA 3MJGX 4ODXA 1OARL 2CDGB 5CUSL 4HS8H 1ZLUK 2PETA 3U7WH 2I07A 1LO3H 4OF7A 2ZJSH 3BPLB 3QDMB 1FFPA 4FFVC 1EHLH 1PX3A 3UTPD 3Q0HA 4M1DH 2VDOH 2XPGB 3MRFA 2L0DA 4M4PA 5I1EL 5T1LD 1R3JB 1T0NB 2H3NB 5IESL 5CFHA 5I66B 4NO0A 2GITA 1HHIB 4KAQH 1RIVL 3DMMA 5LBSH 3LN4B 4LKCB 2IFGA 1RUQL 1DBBH 1JGUH 1QVOA 4PJXF 3S3PA 3X17A 3SE8H 4PJ5A 3QH3B 1ZLVH 3HE6D 4MA1C 2HT4C 1KJ2L 4F7TB 3GI8L 3DO7A 1MCKA 1IC4H 3U46A 1KB5A 4Y5VB 3BP7B 3FB8B 3G6DH 5M94B 3S9DB 2G2RB 1T0PB 1XIWA 4HUXB 1N7MH 4U6VH 2IADB 1DANT 2YWYA 3MRLA 4P9HH 1YYMH 4PGZA 4ZUWB 4XPTH 3MNZA 3OG6B 2EEDA 4DN3L 1LK2A 4Y4FA 5DXWA 4YR6B 3S35L 4OUUA 4QRRE 1I1AB 1ZTXL 4P4KA 2SEBA 4N1CA 1IFHL 5I73B 4GG8B 3MX0A 1AGEA 4M8QA 1NCWL 1VESA 1Y18B 4P46A 3S88L 5L6YH 2FECL 3VGEA 4XP1L 5FF6B 1AHWA 2AK4E 2X1WL 1IM9A 2B5IC 4IEFB 1FDLL 2CRYA 3WJJA 4YHYC 4Y89A 3VJ6B 4G43B 4LLYA 1MELA 2VC2H 5EBWA 5IHLB 1IKFH 1C7SA 3ROLB 4FQPA 3W2DL 1MFAH 4Y5XB 2HN7B 5DJ0A 1ACYH 2EDYA 2FX8H 5DJ6A 1K2DB 3MODH 4LMQI 4HMDA 4XX1E 2LFGA 3PV6B 4KMQA 1EJOH 3H42L 1H9VA 4PJFF 4JGUA 3DX9A 2GSGA 5ERWB 2VNCA 4Y88A 4S11A 2A6DB 3DGGA 1J5OH 5I17A 1P4LB 3KLHD 2NY0C 3MBXH 2CR3A 1EEUA 2X4UA 5EC1B 1SEBA 3UTOA 4U1KA 5DQJA 1FL5A 1S7UA 3F7PC 4HZAA 4UMGA 3G5YB 3TO4A 2EE3A 1OP3H 1DQDH 2A0LD 3QIBB 3MRNA 5MENB 4MCYB 1XF2A 1MFDL 4PP1D 4OZGE 3OG4B 1AI1L 3SE9L 2ZNXA 3J7HA 4GW4B 4PJGF 1A7OL 4P2YA 3VXNB 4JZOB 1OTSC 2XKNA 3BXNB 1Z9MA 1LEGB 2AXGB 5GS3A 3I02B 1AE6H 5BMFH 2X4SB 3CLFL 3ZHKA 4HH8A 5IROC 1NAMH 3PGCA 2UYLA 4LVHC 1Z3GL 5FV2A 3KLDA 4Z0BL 5FYKD 1JWSB 1RZ7H 4LCWA 5BJTB 1C16B 1K8IB 1J88A 1P7KA 3E3QE 3PG2A 2PYFA 3O11B 4ZS7H 3TA3B 3C09C 5I1LA 4ODUA 3U9PL 1S9VB 1AGDB 1J0ZA 5EU7C 2FX9H 3IDMB 3NACL 4UOW1 4TSAH 2HLFD 1TLKA 4DGVH 1Z0MA 4P5KB 1GGTA 3VMNA 1S3KL 1N8ZA 3BAEH 1OB1B 4I8DA 1V5JA 4KJPD 2V17H 5I30H 5CZKA 4Z7UE 5CEXB 1TETL 2X4OA 2RQ8A 4WI4A 4FG6D 3BMWA 4ODHH 2P44B 5H2BB 3QEHA 4KQ4H 1CF8L 2QKIA 4G9FB 1SM3L 3IU3A 1FLRL 5KSAB 5E56A 1BQLL 4GG6B 2FX7L 4IS6B 3B9EA 3VXMB 3RDTB 2HVKB 1EFXA 1WV7T 3VXQA 3HN3A 3TBYB 2P7TA 5C6WH 2XN9A 3MRHA 4EKXA 3MJ7A 4XCEA 1HIML 3MV8A 2D7NA 3GGWA 5CINL 1QSFB 2WUCH 1J9CT 3SDAC 1RJYB 2EZ0C 5EIIB 1FO0H 2O26U 1FAIL 2QQKH 1MIMH 2VIRB 3RPKA 2WANA 1CLOL 4ZFFA 4MZ3A 3FRPA 5GGRY 5DURB 3BT2H 3O2WL 4LLQA 1KJ3L 3FT2A 3RBGA 2ZUTA 2FHFA 4BQ9A 5ICYB 1S9KC 1QBAA 3AU1B 2OTWA 3VXOA 4X5XA 4XVUD 4LGPB 1CFVH 4KU1A 5C71A 3VFRB 4ZFOL 2XWTA 4XAKD 4TTGA 1T20B 5JXAH 3F8UB 2H8PB 3UTZB 3RWGB 3BQUB 1TTUA 1UM4H 3B9DA 2CIKB 4JFDD 4YXKH 4G8GB 1L7IL 4CDGC 5IFJB 1TJGH 5DJXA 4YPJA 3DXAD 2E27H 1H8OA 4RFOL 3V6OE 2QQLH 2VR9A 1S9YB 1XF4B 2GKIA 5L2JA 4LVNB 3OAZK 1IGJB 3PNWB 1CGYA 3TV3L 1M7DA 1GAFH 4JJ5A 3RRQA 1BOGA 1DN0B 4L4VE 4E42B 1XGRB 4Z7VB 5FKAB 1VSCA 4MNQA 3WUWG 5KVGL 1CD0A 5IJKA 1D3CA 3MROA 3E2HC 1I85A 4JKMA 4OCNC 1WK0A 4DKEL 2JJWA 5I1EH 4YBQD 4FXKA 4MJIB 3MLTB 1OVZA 3MRJA 4WWKC 1DL7H 2FZ3A 4NBZB 2R56L 3OXRB 3IDXL 3L7FA 3EFFA 1AKJD 1CLYH 1QTYT 3RGVD 4EI6A 4TSCL 1J0YA 2Q6WB 2JJVA 3TVMC 1AC0A 2ESVD 2DRUA 4LOUD 2Q86B 4H1LB 4FNLL 2O61B 5T1LB 4I0PC 3RZCB 5EO9A 1GOHA 3E3QC 3O6KL 2BJMH 4DKDC 3IKCB 4FXGB 5D6DA 4Y8AA 3V52H 1A3RH 3GI8H 4RA3A 3QUXD 4N5EC 1QSEA 4HUKB 1UEYA 3QCUH 5ITBL 5DQ9A 3QQ4A 2ADGB 5KVEH 1C5BH 3P0YH 1BVKA 2BFVH 2F58L 3I2CH 4NZRL 1BFOA 3QPXL 5DS8B 3FO9A 5HBBA 1S5HA 4HBCL 1A3LL 4OF5A 3GMMB 3ULUD 4PB9L 2CGRL 3WL9A 2Z4QB 4L3ED 2R0ZH 4JB9H 5FO7B 1EGJA 1N0XL 1RZGA 2C7UA 4WHYH 1Y6KR 1AY1L 5F8QC 4XVSL 4P3CL 2QSTA 1BQSA 2HJKB 4OV6F 3IETB 3F7VB 4EN3A 4APQB 1YPZE 4P46D 5L2KD 1I3RB 1JV5A 2GUOB 4UTAH 4XPHL 3RKDD 1VB9A 4LMQE 5E6IC 3PDOA 4OF0A 4XGZB 1FDLH 2CDEB 4ALAH 4Q9RL 4DOHE 3LRSB 3MXWH 5EIQA 3T0BA 2FEDC 4C56D 1EDQA 1OAXH 3HC3H 5AWNH 2B39A 4ISVA 3IDIB 4JFEB 3UX9B 3MRGB 1JK8A 1Q9OA 2R29L 5DJYA 4WW2B 3UXFA 2ITDA 3I6KB 3U30C 2F19L 3BDBA 2EO1A 3ULUH 5HDOA 5CD5C 4YDJA 4NKMB 2VDKH 3H42H 4CU7A 2H1PH 2J7LA 1FVEB 1CR9L 1NL0H 3IJSA 1HXYA 1A7QH 2DLFL 4HIEB 2Y72A 3VGFA 3CNKA 3FQRA 1JL8A 4PRIB 4CMHC 4XAKE 1T7WA 5KJRL 3FQWA 3BESR 5DJDA 4U6XA 1VGKB 4FQLL 3HCVB 3MNVA 1T66D 1BQHA 2CMRL 3QWQB 5JPMA 3CUPA 1ZLSL 4PJHE 4JHWH 4JFDE 3DHMA 3H3PH 2FGWL 4JY6B 2A6JA 3DROA 2PCPB 1F02I 4HS3A 5MEOB 1F4XH 2ZUVA 5D93B 3PWJB 4QXTB 4N90D 3TZVA 3AFLA 3OR6A 3SE9H 1ZE3C 3DXAE 3IGAA 4I4WA 4RMVA 5F96L 5F3BB 2X2YA 2AEQH 3TO2B 2GSIB 3MUGA 2NXZB 4HUWB 5TDPB 3PP4L 5C0EB 1JNNH 2XNAB 1DBKL 4HZLA 2X1OA 3K81A 4KKLD 3H6JA 4Z0BH 4FFYL 1CLCA 1BFSA 5E8PB 4K2UH 1ZGLA 3LHPL 3DVFA 4KZDL 2XFXB 5CJBA 4IJ3C 2D31B 5CBAA 3U9PH 3RVXD 3VE0A 4MQTB 1D5MA 1KBGH 4K8RC 3OAYH 4EDXB 4ZFGH 1NCBL 2GFBA 1NANI 2Z35A 1PFCA 2X40A 5DDHA 2WLZA 4I18C 5ID1A 1RVFL 3U0PA 1K5NB 2ESVE 1T7ZA 3BVNB 1TETH 1DUZA 3TBSB 4AENB 2DLIA 4QYOA 1P9MC 1YEJH 4M43L 4WVRA 5IVXF 3T04D 5E95B 2I60L 1XZ0B 3HPLA 2R0LL 1Q0YH 3FT4B 4XZUA 4OCXH 3IJHA 4KJPC 4DUWA 4J6RH 4JVWA 4EIGB 4X5WB 3VFVB 2Y36H 3IDNB 3ULUE 3OJ2C 2K7PA 1P4IL 4QRPD 1HQRA 4FG6C 3R06A 3QAZC 5I2IB 3IJYB 1OAUL 3TIEA 3WNLA 1HHJA 1I9JH 4R97C 4KJYB 4FXLA 3QULA 1WEJL 5L2KE 3QDJB 1CL7L 4WJ5B 5AG8A 2OZ4L 3M17B 5C9JA 3C6SA 2F15A 1N0LA 3DVGB 4KKAD 5MEPB 1Y0LA 3CCHA 3O2WH 4HIHA 1KJ3H 1CD9B 4U1JB 3MLVH 3AB0C 4I3RL 2QQQA 1N5AB 4P2QD 5DRZA 4J12A 2H2SD 3QISA 1ZLWK 5CP7B 5AYQA 2GY7B 1OWRM 4JHBA 4MAYA 1KIRA 3HB3C 1OW0C 3DETD 3K4DA 2IPTL 3RPIB 1ZANL 4ELKA 1ZA3B 1OGAA 4PGJA 4FQQA 3R8BB 1R5IB 3JXAA 5DZOA 3L3KB 3P4MB 4NCC2 3MJ8A 1DEDA 4AEIH 1FE8L 4WO4A 4U1HB 1LDPL 2C3VB 5GGRB 4LNVA 4RFOH 4FFWC 3LB6C 3EZ8A 3QT2A 3DX6B 2AJ3B 7FABL 3WLBA 4QHNB 3MRQA 3BH9B 1BFVH 5D5MA 2HTKC 5ADOL 5F7UA 2VWEE 1OP5K 2AJXL 3CFEB 3T0DA 1MF2H 1W0WA 1G7QB 1EEYA 1JI2A 2OK0L 5KVGH 4QLRA 3ORJA 3QUKB 3VG9C 1K4DA 1BIHA 4PRPA 4JO2H 2X7LB 2NYYD 2QL1A 3FZUD 3QZWA 4ODXB 3WXVH 5TDNA 5D5MF 2I07B 3ZKND 4RRPG 2BRRH 4H25A 4XWGL 1V05A 3D6GA 2FO1A 3IDXH 1FFPB 5DMGC 3FFDA 1MCPH 2HYMA 3MRFB 3TC9A 1YN7A 3QCTL 4IDLA 4FQIL 3TN0A 4NO0B 3LY6A 2ZG2A 2GITB 3PGFL 2IC2A 2BMKA 3DMMB 4PJAF 5C6TL 4NJ9H 2VAAA 4KGLA 4ODSL 3NTCH 3BPOC 2VXQL 1QVOB 1LNUB 1NANH 1H3TA 2VSDA 3WHE1 1QKZH 4OCYL 1WZ1H 2F58H 1BOYA 3QPXH 4LSVL 4GRLD 4PJ5B 1EZVY 1RULH 1FAKT 1BHGA 4FQJL 3DO7B 1V7NH 1KEMH 5CJQL 3U46B 1KB5B 5E9DA 4OKDA 4U7SA 1NLBL 2QADD 2F53A 1CT8A 4HV8A 2ITCA 1XIWB 4XVSH 3QUXC 4P3CH 1FYTD 3GBLA 4E5XA 3QB7C 3KDMA 3MRLB 3SE4C 4MJ5B 1YN6A 2YPVL 3IFLH 1LK2B 4Y4FB 4XPHH 4H8WH 4JM2D 4BYHA 2BERA 2AQ2A 1P5UA 4OUUB 1VFBA 4L3EB 5IW3A 1UCTA 4WTWA 4P4KB 2SEBB 2FJHA 2YN3A 3DV6A 3FO0L 1AGEB 5BXFA 4QRPE 2WK2A 4M8QB 4E9LA 5J1SC 1DQML 2PN5A 3VFNA 4P46B 3O3AA 3VFGL 2DBLL 3HG1D 5D7LA 2JJTC 3NZ8A 3DLQR 1AHWB 1UENA 3ZLQC 2C3HA 1IM9B 5DK2A 1YUHA 2OL3A 4LLYB 2YD3A 5CGMA 3LS5L 4C56B 5EBWB 2DIJA 4BELD 1TMCB 4UT9H 4P2QE 2A73A 4HAGA 2G60H 4YK4B 5DJ0B 5C0FA 4LBEA 1WUNT 5DJ6B 4UBDD 1MIEH 4Z9KB 1MRCL 2W9DL 3FFCD 3SGJA 4PP2A 3UJTL 3ARGA 4HFUH 1SEQH 3CU7A 5F9OH 3C2SA 3M1BA 1ZLSH 1S7WA 3DX9B 4KUCD 2GSGB 1RUMH 4MA8L 4HK0B 4PJDA 4XTRD 3SEPA 2BHZA 3DGGB 5I18L 4R4ND 5FM5O 5I17B 3UPRA 2IMMA 3M07A 4XP6L 4F8TA 1CDGA 1UKSA 2HRPH 5E2TL 2QHRL 4ZOEA 3TLRA 1SEBB 2NY3B 4U1KB 4IRZL 2D4DA 5DQJB 1FL5B 1S7UB 4V2BA 2ZKHL 4KMTH 4PJDF 5HHMB 3TO4B 4Y2DD 4JO1L 5B4MD 1T66C 3MRNB 2OL3L 5D96C 3RHWK 4PJ7F 4ORGA 1YNTA 1F11A 3U1SL 4FFYH 3ZTJG 5I1DA 2XKNB 5ALCH 1KULA 4MYWB 5ICZA 3TNNA 2XTJB 1O7SA 2HAZA 4HGWA 3CVHL 3O3BA 2A38A 3PGCB 2UYLB 3AUVA 2Y06L 4DKFL 2HT3C 4LCWB 1A6WH 5E03A 4MVBD 1DQLL 1CBVH 4UQ3A 4F80A 1GH7A 1P7KB 1JPTH 2PYFB 2IF7A 1BGXH 5GRVK 4JRWA 3HNSH 4AIXA 1ZK9A 4ODUB 2AJYL 3QYCA 1MFCH 2PXYA 1T80A 2R9HD 4R26L 5D7IE 3HMXH 1N8ZB 3EYQC 1Z2KA 4NN7B 1GJIA 4HKBB 3S3SA 4PY8I 1CGSL 1RZ8A 3UZEA 1NLDL 1MRDL 5FB8A 1BEYH 4W6WB 3AVEA 4WHTA 2X4OB 2YZ8A 4LPVA 4Y19E 3U48A 4PJEB 4HIXL 3KPPA 5C0BD 2A1WH 3G9VA 3QEHB 4FQ1H 2F9BT 2QKIB 5SWZD 1CXLA 3SQBA 1HHHA 3IU3B 4LSTL 3OZ9H 5CZXC 5CGYD 3Q1SL 4ZFOB 2OJZH 1J0IA 3EYUL 1EFXB 1HZHH 1DCLA 2G75A 3VXQB 1LP9E 3KLSA 3BHBA 1BVLA 2P7TB 3A6BH 2XN9B 4GQ9H 3MRHB 4OZFH 5IEKA 3MJ7B 4XCEB 3ZE0F 3MV8B 3GGWB 3WXWL 3QHZL 4X9BA 1GGCH 3IS1X 3ZZ1A 3ALXA 4PJBE 3FHAA 2YN5A 1Q0XL 5HVGB 1WJ3A 3HG1E 4KTDL 5D72L 4ZFFB 5T1KA 4LLQB 4NFDA 3FT2B 2EEBA 5DC4B 5TE6H 2OTWB 3VXOB 3QUYA 4X5XB 1QACA 2EYRA 4KKAC 3EYVA 1G7HA 1H3VA 3V0AC 2H2SC 4YDKH 4MXQD 1DTUA 2R23B 4GOSA 5D70H 7FABH 4G8EB 4AM0B 5ADOH 1JZ2A 2FD6H 3TPUA 3C5ZD 4FZEL 5E2VL 5DJXB 3ARVA 4G8IA 5C0AA 1R24A 3HE7D 2WLYA 3LEVH 3IVKA 4GKZA 5GGVL 5L2JB 4M7ZC 4NUJA 1M7DB 2OS7A 4JJ5B 4XBEH 4OCWL 4Z7NE 5HGDA 3QI9A 2D9CA 3EJZD 1BOGB 4MNQB 1OAKH 1UFUA 3TFKC 4M7LH 3MROB 3QDHA 1BBDL 2BNQE 2ICWA 1P6AB 5DD3H 5K9KA 3C60A 2MKLC 4FXKB 3KPSE 4NN6C 1IILE 1UWXH 3EIFA 3MRJB 4GQPH 4ODTL 1RFDH 2FZ3B 4M61A 1WGOA 2CPCA 3LKRA 4CNIA 2JJSC 3L7FB 3EFFB 4EI6B 2YK1L 3UROR 5HHXH 3B4NA 3ZKNC 2CKNA 4XNXH 5DMKA 2EYSA 6CGTA 5EO9B 3MLXL 5DLMH 4NQCD 3V7AG 1FRGH 3LZFH 1QSEB 5IUSA 1PEZA 3DRTA 4RDQF 4AYFA 5EA0H 3EO0A 2DWDA 3PL6D 3INUL 4XB7A 5DQ9B 3QQ4B 4CJ0A 4OI8A 5GQBA 3OKLA 3NIDF 1GXEA 2UVFA 5GGSA 1BFOB 4X80L 5IHUL 1S5HB 2VYRE 2F74A 1INQA 4UOW0 1OSPL 5HGHA 3WL9B 4GRLC 4MXWH 5D1QC 5L0QC 1F13A 5C0BE 4BQ6A 1SYSB 2XA3A 3VW3L 1YEDA 1JZ5A 3N1MC 4HQQL 1RZGB 2C7UB 4X7FC 4P5MA 5GS1A 4X4ZA 2FWOA 1NCDL 2IGFL 3FO0H 4JANA 3ULSA 3QHFL 3U7YL 5CJ5A 4EN3B 3JVGA 5IVNA 5IFHH 1DQMH 3VFOA 1JV5B 5C70A 2GTZA 5E7FA 2VOTA 4RAVA 1KNOA 3MRMA 3K4AA 3SGEH 3PDOB 4JHAH 3AREA 2F5BH 2AVGA 1MWAH 4HCRL 2VN7A 4O2FA 2WBJC 3MMEA 1UXWA 3QUMH 1JK8B 1Q9OB 3FN9A 2PTVA 4CL7A 3P11L 5EOCL 4Z18A 1U93A 4NCC1 1I8LA 2ITDB 4KK5D 3HUJA 3RIFF 1NCAL 4YDJB 3WFBL 1QLEL 4EI5C 1X7QA 4DEPB 3IJSB 1OTUD 3FQRB 3TT1H 1GC1L 5IW6A 3KPQA 3FQWB 5DJDB 5HJ3A 1RZKL 1PKQA 2FGZA 4Y1AE 5I6XC 3MNVB 1BQHB 5JPMB 3VD9A 1H3XA 3CUPB 1BP3B 1LD9A 2X4RA 3FMGH 4JO1H 5C0RH 2A6JB 3DROB 2VL5A 1GPOL 5GHWL 3TZVB 1BAFH 1FYHB 1JPGA 1WAAE 4XX1G 4JFFA 4OI9A 5IQ7L 3IGAB 4I4WB 4D9QD 5IMKA 2EXYD 2P45B 1KCSL 5LGHL 5I9QC 4W4NA 4O58L 3MUGB 4M03A 3W0WD 4FP8H 5HYJD 2YXMA 1XMWA 4AJ0A 1ZOXA 3CVHH 4HZLB 3CZFA 3O8XA 4DKFH 6FABH 5JPNA 3ZL4H 1BWMA 3P2TA 5T3ZH 5CGTA 1AD9B 1TJHH 1TIUA 2RAMA 1RZJH 5CBAB 3VE0B 4R26H 1VFAA 4IRJC 3SKMA 1D5MB 3Q6FB 1HCFX 2NY4D 5K9QI 5HHOD 2GFBB 5KZCD 2NY6B 4I2XA 3TIDA 2Z35B 2BVQA 2PYEA 4KI5C 5BRZD 4D2NA 5DDHB 3FQNA 1U6AL 1CGSH 5ID1B 4Y4KA 1LO5B 4LARL 2VLLA 1RPQA 3ZSTA 4QOKD 4GRMA 5E5RB 3STZA 4QYOB 2WINA 1FIGH 3QJHB 4HF5L 3LDBB 4P3WA 5LG1A 3V6FA 2DAVA 2MSPA 5CEYA 4KDTA 4X6DA 3N06B 3H3BC 3HI6H 4H1LG 2C1OA 3HPLB 3EW3B 4MDIA 5J57B 1MSPA 4XZUB 2X4NA 4D8PA 43C9A 3EDDA 1XR8A 3IJHB 5EU3A 2ICES 3H3KA 4JO4L 2CSPA 1MCRA 5GGVY 1OPGH 5SWZB 3R06B 3QHZH 2R0KL 1AP2A 1JE6A 3MLWL 1HHJB 3NA9H 4GKNA 4Y5VC 5JLZA 4ZSOE 1OAYL 3TT3H 2GAZA 1FN4A 3QULB 4U05A 4XC1H 5C9JB 3C6SB 4UNVA 3QUZD 3OAYK 4N8VG 4DTGH 1INEL 1Y0LB 3CCHB 4HIHB 5GJSL 3HNVL 1KELL 3TBWB 4LU5L 2VUYA 1INDH 1WTLA 3ARTA 1I1AC 3B9KD 2ZCHH 2RB8A 3NFSL 2D0GA 4Z8FL 3U0WL 4MAYB 3K1DA 4LHUD 1KIRB 1MRFL 4ELKB 5JW3H 1OGAB 1ORQA 2WNGA 4FQQB 5TDOA 4QT5A 4MS8C 2UV3A 3WFCH 3C08H 1WF5A 3MJ8B 3MZTA 4OQ1A 4WO4B 4FZEH 1VFOA 5E2VH 2FEEL 5T3ZE 5C07D 4OZIE 2R69H 1X5LA 4YHLH 3EJYD 4K9EL 4M6OH 4Y5XC 4BK4A 4HUNB 3ZYOA 3WLBB 3BJLA 4LLWA 1XCTA 3MRQB 2P42B 5D5MB 5I8CA 2X89A 1X4XA 3UTSD 3ULVL 3OPZL 1W0WB 1EEYB 3C5ZB 2C3WA 1TFHA 2FH6A 5DT1L 4YNYB 4CMMA 5AEAA 1K4DB 3RUGE 1Z0NA 1GVIA 4PRPB 4D9QE 4KK6D 3QZWB 1KUMA 5TFSL 1IQWL 4LAQL 5TDNB 5EBMA 4WRLA 3K4ZA 4ODTH 4OGXH 4MB4A 3W0WE 4H25B 4UINL 5GRUL 5HYJE 2R2EA 1JVKA 4ZS6C 3LIZL 2DF3A 4PD4K 2YK1H 1R0AL 3EJZC 3FFDB 3QIBC 4XBPA 4PJ9C 3WS3A 2JELL 1L0XA 1YN7B 4KKBD 1S5IL 2P8MA 4Z78A 4ZUSA 3SQOL 4KFZC 3TN0B 3QEGL 4G6KH 2KKQA 2BMKB 5IK3A 3NH7L 2VAAB 3OHXA 2JJUA 4KPHH 4TRPL 3T0VA 5HHOE 4BZ2L 4Z7WE 5BRZE 1MPAL 2R4RH 4JZNA 1DFBL 1IZJA 2YUXA 5IHUH 5FGCB 1IGFL 1X4ZA 4NQCB 3WEXA 4QOKE 2ZSWA 5IWLC 1BZ7A 1B0GA 4U1MA 2ZOKA 2LVCA 3P30L 4NC1E 3MBED 2CUMA 1B4JL 4P9ML 5E9DB 35C8L 2F53B 1CT8B 2VERN 2ITCB 3I50H 1HNFA 4E5XB 3U7YH 2GTWA 3KDMB 2MQ3A 5DEGA 2DI9A 4OFVA 4V1DD 1YN6B 2J12B 2GJZA 5F7LB 5I1JH 4NNXA 1K8DA 3UPCA 4YUEH 2BSSA 3OKEA 1A47A 4JDVA 5I8EA 2G5BB 1VFBB 3BP5B 1T1XA 3MJ9A 5H8DA 3DIFA 2FJHB 3DV6B 4QRSA 5BXFB 4YE4H 4X9IA 3TESA 1OLZA 4PY8J 4YIQA 3VFNB 4KJWD 5KSAC 3G6AA 3O3AB 5J12B 5DMIL 4XB8A 5D7LB 2X4QA 4JFHE 3S37L 3RDTC 2NZ9C 3UJIH 5GGQH 2CQVA 3LVEA 1IEHA 1YUHB 2GJ6D 4CADA 2OL3B 4U6HA 2B1AL 3QNYB 2A73B 4I3GA 3RX7A 2BHUA 5C0FB 4LBEB 1IEAA 4YHPA 4GO6B 5ESQA 1GC1H 1IAIL 4URTB 4PP2B 3ARGB 1CLZL 2OTUA 3NIFF 4HXBL 4LLMA 3M1BB 1MAJA 1SBBA 1S7WB 5CIPA 1HH9A 4PJDB 2IBZX 5GJTH 5MERA 2YPLA 5E5MA 5GSRA 3UPRB 3DVIA 5L88H 3KPRD 4HEPG 3BPCA 1FZMA 5C07E 1VENA 1OTUC 3CFBA 3ETBF 5E8DL 5C08A 1KCSH 4GUPA 2N56A 4UB0L 4AMKH 3CFKA 4UZGA 3ZKMC 1EEQA 3PWPD 4MAUL 3AROA 3BQUC 3RWEB 1AGCA 1B6UA 1JHTA 2OR7A 3UTSE 4HHAA 4ORGB 1YNTB 3UBXA 5BVPL 1F11B 4NWTH 4KKCC 4KZEL 3N1GC 2BRQA 2JB5H 3HR6A 1YC8A 5I1DB 4Q6YA 2HWZL 3HHRB 1DVFA 5KSVA 5LWYL 2ZP0T 3TNNB 4LPYA 3RTQD 4HGWB 4LVNC 3CGTA 2W91A 5EU5A 3O3BB 5C6PB 4XMPL 1I1YA 2RHEA 1HOCA 1QBML 5FFLA 3WFDH 3B2VL 4UV4L 4UQ3B 1U6AH 1YECL 1GGIL 3OJDB 2FHBA 3LD8B 4PYHA 4NKOA 2PXYB 1C12A 3K8LA 3SCMA 4EJ1C 1ZEAL 4IMLA 4ZTPL 4JQVA 4HF5H 4P3DA 3EBAA 3QNZA 4HKZA 4LEOA 3PGDA 2GI7A 1Z5LA 1RZ8B 2VDNH 3UDWC 1OQOA 3Q5YA 4RX4D 5JA8B 5FB8B 3CSGA 2XYCA 3JV4A 1DDHA 4WHTB 3C6LA 4WHYG 4F33A 4K3EL 3KPPB 3TWCH 1T5XA 2ATKA 4QTHA 1HHHB 1S8DA 3WHE0 4FQXD 4WY7L 3S3JA 4P23D 1UCBH 1SJXA 4V1DE 4D3CL 3BHBB 3KYMA 1BVLB 4HPYL 1XGTA 4YZFF 4NQUA 3CMOL 1NJ9A 3MR9A 3ZMRA 1JGLH 5IEKB 3UTTD 2EH7L 1INEH 2VZ3A 1GGBH 5GJSH 5IFAL 1J8HE 3ULVD 1CDCA 1TJIH 3HMWH 1S7VA 2FJFA 5CLWA 1WT5C 1D6EA 2ZOLA 3T3PF 4YDVA 1D5IL 5JQ6H 4APQC 5CEZD 5C0JA 3W5MA 3MA9H 2BNRD 2VLJD 4KROD 2VR5A 5T1KB 1KACB 5FO8A 2A6KA 4BA8A 4NRXA 1A1MA 1QOKA 3QUYB 2HFTA 2EYRB 3EKCA 1E4KC 3EYVB 4UIMA 4XNZC 4LRIA 5CAYB 1RD6A 4I77L 1G7HB 5D1XA 3S5LG 3QRGL 4FTVD 5DHVA 2WUBL 5D2LE 4E41A 4FABL 3VMOA 4B7LA 3CIQA 5TE7H 4DUXA 2X1PA 3VXUD 3ULVH 3TPUB 3OPZH 2YBRA 5A3IC 1KLFA 2MTPA 4GH7B 1G0XA 5C0AB 1R24B 2UZIL 4XPGH 3KPRE 4JREB 1QFWI 3GJEA 3IVKB 3DYMA 4GKZB 5CEZH 4NUJB 5AD0A 1QQDA 4LCYB 4QO1A 1EVTC 1G9ML 2FBJL 1DBJH 3QI9B 4MQXD 1IC7L 1F4YL 1TDQA 4J8RA 2IH1B 4OFYA 2ZG3A 2ICWB 4K7PY 5K9KB 2DQDH 3C60B 4P0DA 5MI0B 3TJHC 1QFUL 2R1YA 2F54A 3U36A 4WI9A 1VEOA 2Q7YA 1W72H 4M61B 3UAJC 3LKRB 3KXFA 4CNIB 4GBXA 2AP2A 2NXZC 3QNXA 3GHBL 1EPFA 5ITFA 5DMKB 4PJXE 2EYSB 4ELMA 1X6NA 3GI9L 1F58L 1FGVL 1E6OH 4YHIA 25C8L 1J0HA 3DJ9A 4R96A 3O6MH 1NKRA 3DRTB 3EO0B 2DWDB 1MCQA 2MCG1 1KN2H 1FL6A 2KQNA 3TEUA 1E27A 3OKLB 1S78C 1M05A 4OLZL 5DD0L 2BC4A 5GGSB 1XGUA 1R6VA 2C3XA 3SDCA 4ELMF 2PTTA 5GS0D 2F74B 3UJJH 1INQB 5HGHB 3GMNA 3OBAA 2YZ1A 3RIAF 4F58L 5D71H 1YEDB 2Y7QA 4P5MB 4MD4A 1ES0A 5GS1B 1YEKL 3SDDD 2FWOB 3ULSB 4RFEA 4JANB 1CIUA 4KUZH 2V9TA 3VFOB 1ZWIA 4X4MA 2GTZB 4ZOBA 2ERJB 3HR5B 4RAVB 4PV8A 3LH2H 1KNOB 3KG5A 3MRMB 2ADJA 3AREB 3VWJD 1ZA6A 3E6HA 4QNPE 1LEIA 1JGVH 2P5ED 1R3IH 5CKAA 3ZE2E 2B1AH 3MMEB 3ULVE 2VXUH 3N50A 5I1AA 3KS0H 4UQ2A 3AS2A 1Q9KA 1U8OA 1NSNL 1X6LA 1U93B 5GS0H 1FNFA 5CEZE 3BH8A 1NFDA 3HUJB 2BNRE 1X5XA 1KEGL 1X7QB 2I5YL 1KCVL 3MLZL 4PJFE 4P2RA 1KN4H 4FTVE 5ETUA 5IW6B 3KPQB 4U3XA 5F97E 5HJ3B 1KXVC 1NFDF 1PKQB 4FQHA 4UB0H 4JPVL 5GS2D 2P8LA 1LD9B 3P9WB 3KPMA 2X4RB 4DCQA 2FB4L 5KVFL 4N0UE 2EEAA 3WUWA 1XGYL 2VL5B 4JM4H 4TYUA 1NMBL 1JPGB 2Z0BA 4J3XA 4KZEH 4JFFB 1P7QD 3QO0A 4WU7A 3KYNA 5IMKB 3D85D 1CQKA 3NCJH 4XXCA 3GIZL 4CJ1A 2CK0H 3QXWA 1V8HA 4PJGE 1OSZA 1QFWH 1F90H 4HWBL 4XC3H 4JRYD 5LWYH 3UPAA 1DANU 4BFBD 3CZFB 3WDIA 3DPBA 4GXUM 3O8XB 5JPNB 4WWID 5HD8D 2VTFA 2WW8A 2K9UA 1FNSL 3OWEA 1YECH 5IBTL 1GGIH 3FN3A 2Y6SC 4N5UA 1EHNA 3O2VL 1BFTA 1R3LA 2PTUA 1TCRA 1VFAB 2W9EH 4GRWH 4UAOC 3SN6N 3U79A 5DYOA 5GS2H 4I2XB 4WFED 3TIDB 3TM6A 2Z8VC 4BQBA 2BVQB 2PYEB 1ZV5A 5D7SL 4H20L 3O9WD 3FQNB 1P2CA 5TPWL 4LCWE 5HGBA 4ONHA 4KK9C 1CVSC 4Y4KB 4OCLC 4YHZH 2VLLB 2GW5A 5ANMA 1MHPL 5KTEL 4ZFZA 4GRMB 4HJ0C 3STZB 4C83A 4YHOH 2WINB 3V6FB 5CEYB 1QRND 4X6DB 3DMMC 2DKUA 2D4FA 4ZO7A 1JPFA 3GSNA 1WIUA 4O4YL 4MDIB 5CP3H 5E6YA 2X4NB 4D8PB 43C9B 1CXIA 1XR8B 4LSRL 5EU3B 1H3PH 2QV2A 1W0VA 4PRHA 2DJUA 4HPYH 4JQIH 1UYWL 1A6UL 3MV9D 5J3HD 4P59L 5A2KH 1T6WA 4U2YA 4IIQA 1J86A 1AP2B 2KQMA 3QIUD 4TNVK 4W70A 4GKNB 5JLZB 2GAZB 1QP1A 2EIEA 1DLFL 1FN4B 1ZVSA 5I74B 1MHCA 1MCJA 2OR9L 4D0DA 5JOPD 1A7PL 3UTTB 3SGKA 4NP4L 4Y4FC 4MD0A 4M7LT 2MOVA 3LS4H 1MCWM 2WP3O 2WWMD 3A0OA 4F7PA 1KENL 3VI4F 4F9LA 4JDZB 4P4KC 1PBYA 1OCWH 3D48R 3GSNL 4TVSa 1UA6H 4KVCL 2FIKA 4N1EA 4F57H 3V4UH 5FGRA 1WZKA 5SWSD 1ORQB 2DQHL 1AHWC 4QT5B 5TDOB 4WEBL 5FYLH 4GMTH 3WJJC 2QR0A 2R8SL 1WTGT 1YNLL 2YPKA 4M5ZL 2APWA 3VH8A 2Z9TA 1ZVYA 1CICD 2FL5A 2UZIH 5F7EH 3L3JA 4YK4C 3JWDL 1LWRA 4HUMB 2KUTA 2GQHA 4R8WH 1BJ1H 4GRWE 1WWCA 4LLWB 3UC0H 1XCTB 1DE4B 4I3SL 1G9MH 5I8CB 3SKNA 2FBJH 3SDYH 1IC7H 2CKBH 4M6MH 3FB6B 1ORSA 4CMMB 1U58A 4M7KH 1G6RA 4R3SA 5IMMA 5DFVD 1QR1A 4LDLB 3ZO0A 3RQ3A 4RZCA 5EBMB 1YEIL 2NY3C 2Q8AH 4TUKH 2UVEA 4HGMA 3PHSA 4JRYE 3BDXA 2YMXH 2R2EB 2AJVL 3TO4C 4DGIH 5C0ND 4D9LL 3WKNA 2OXHA 3GHBH 4MQXC 4RBPK 4XBPB 2DQFA 2VDMH 3WS3B 9CGTA 4LEXH 1UM5H 3L1OH 2P8MB 3GI9H 4ZUSB 1F58H 2A9NH 1FGVH 4TTDC 3SJVA 2WBKA 4G42A 1KPVA 3VWKD 4R4BA 5IBUB 5IK3B 2CO7B 3OHXB 4IOFC 2XTJC 5D7JD 3G04A 1KFAH 2PKDA 4JZNB 4OLZH 2YD4A 3ARDA 3ARWA 4POZC 1G6RL 4ZAKD 4P5TD 4RAHA 5F70A 5HI3D 3WEXB 2ZSWB 3CU1A 5IJVA 1BZ7B 1B0GB 4U1MB 1HYSD 3IF1A 1QSEE 1J7VR 1L4IA 2E6PA 5DUML 2GCYA 1QRNE 1N64H 3NZHL 3FN0H 1ZHNA 3ARBA 1TVDA 5DEGB 2V9RA 4TNWK 4OZFG 2GJZB 3KJ4B 4NNXB 4RWHA 3ZT6A 1K8DB 3E8UH 4NQDA 5EZOL 3B2UC 4Y16D 2BSSB 1NFIA 3OKEB 4JDVB 5FIEA 5I8EB 3MA7A 1REIA 3ISWA 1T1XB 4OD3H 3DIFB 1X5KA 1OAZH 3JZ7A 5FYLE 4QRSB 5DI8A 3ALPA 5CSZA 4JFYA 4JFZH 4UT7H 4YIQB 1E0OB 3OL2A 3G6AB 3SDDC 1EUTA 3GBMH 4FQ2L 1P6FA 3ZYZA 3PXHA 1ED3A 2X4QB 3JWOC 2DM3A 1EFQA 4JPWH 3QIWA 1T1ZA 1YNKL 2X6MA 3GNML 5JOPE 4CADB 2E9IA 1NCTA 3MLZH 4U6HB 1J0JA 4H88H 1FH5H 2DTML 3CDGA 4P99A 1IEAB 4YHPB 3QDGD 4QXUH 3Q3GA 4HWEL 2OTUB 1FFRA 3HRZA 4IRSA 2C26A 2H45A 5SWSE 3BKCL 4GFTB 4EOWH 5CIPB 4HG4K 5BCAA 1HH9B 3IDJA 5JR1L 5MERB 5MEQA 4GAJL 3KS0J 2YPLB 5GSRB 2HTLC 1QFWM 4TPRH 4DWHA 3D87B 3BPCB 3V8OA 1FZMB 3QPQD 5KW9L 3CFBB 2CUHA 4U1LA 4GUPB 5DD1L 4UV7H 3CXDH 3CFKB 1YEHL 4Q74A 3U0TB 4RRPA 4JDTL 4EBQL 2D7TH 1AGCB 4XPFH 1JHTB 4HHAB 4TN9A 3UBXB 3A6CL 3V0VA 3MACL 3CXHK 4X6EA 2EIDA 5DD5L 1OHQA 5GISL 3BP4B 1LVEA 1DVFB 5KSVB 3M8OL 3PP3H 1JFQL 3MUJA 3FAWA 5EU5B 3ESUF 4FS0A 4MA7H 2V2TA 1I1YB 2B2XH 1PVHA 2VLKD 3SKUD 1C08A 5K93A 2YSSA 1UWEL 3UZVB 5JHDA 4I48A 2Y5TA 1I85C 3VXSD 3NCBB 4NKOB 3SCMB 1C12B 3IXAA 2O5YH 4XMLH 4GSDL 4NT6A 4IMLB 1DR9A 4P3DB 3FAXA 3K74B 2H9GA 1NAKH 3QNZB 4HKZB 3S36X 1SBSH 4OV5A 1FZKA 3GO1L 3PGDB 4LEOB 5IVXE 3H9SD 3KLAA 1Z5LB 5TQ0H 4YJZL 4DQOL 2C9AA 1G7JA 5C7XH 3TYFA 1UWGL 3JV4B 1DDHB 3O9WC 4JKWA 4AEFA 3C6LB 4PV9A 3BYYA 2DD8L 3NA4A 4F33B 4L8CA 5IT2L 5E08L 5I19H 1T5XB 2ATKB 5HDLA 1V3JA 2I9TB 1PG7L 4QTHB 1S8DB 1A64A 5D6DC 4MX7A 2OLDA 3GBNH 3QRFM 4YO0A 3O4LD 5AYUH 4D0BA 3V0WH 4IBLT 4JFPB 1IJ9A 3KYMB 4PJCA 1EAPA 1XGTB 1NJ9B 3MR9B 4XNYL 4NQXA 4OLXH 5EU6A 3VGAB 3MLRH 4N0YL 1IGYA 1S7VB 3IB4A 2FJFB 1KENH 4L4TA 1D6EB 1SJVA 3MRKA 1CD1A 2ZOLB 4YPGA 2QLVB 4YDVB 1PZ5A 4PJCF 5F72S 4OD2A 5EOQH 4EN3C 4RWYL 1AO7D 4KVCH 5C0JB 2VDPL 3DI2B 1MAKA 2PR4H 3Q6GH 5FO8B 2A6KB 2HKHH 4NRXB 1A1MB 1CGXA 5J1TC 2H32B 2JB6A 4G7VH 4UIMB 4OSUL 1YNLH 2WWMC 5H37H 5D1XB 4FFZL 4KY1H 1I75A 5DHVB 3TBVA 2O5ZH 2DMBA 2Z31A 4E41B 3QDGE 2MMXA 5DRNA 1KCUH 3B6SA 4G6FD 3WFEH 2B4CL 4LASL 4K3JH 2CIIA 1UEMA 5BO1L 1VFUA 4NNPL 1SY6L 1D9KA 1F6FB 2DM4A 2PUQT 4PLJD 2YBRB 4XCFH 4DGYH 2DQUL 2X9XA 1J1OL 3GJEB 4NM4L 3E0GA 1VACA 5AD0B 1QQDB 4LLVA 5LJYH 3CVIH 2WWKO 3EOAA 5KVMC 1FNAA 4Y4HA 5JIIA 3S8WA 2W1NA 3RWIA 2AJVH 4J8RB 4KKNA 3LKOA 2HMID 5GRJL 4DN4H 5ADPL 2WMPA 3TZVC 1BJ1J 2R1YB 5DJZA 5IHZA 1E4WL 2F54B 5CJOL 1ADQL 2EDDA 2Q7YB 1AXSA 5DFVC 5E2UH 4LPCA 3T0EA 3A67L 1QG3A 4ZQKA 3VFWA 3KXFB 4PJAE 4GBXB 5JNYA 4JN1L 1DN2A 3QNXB 1GIGH 2UY6A 2BOBA 1R3JA 2NY7L 3PQYD 2VLKE 4WU5A 3S34L 3PWUA 2DL9A 1BD2D 4ELMB 5C0NC 2Y07H 3MTRA 4YHIB 3DGCR 3D2UA 1FGNL 1XGQA 5A16A 3N9GL 4KRPD 4J3WA 1C5DA 4YHML 5JIPA 1JZ6A 3O81A 4K7FA 4MHHI 3HFMH 5LAXB 1FL6B 1ZGLM 1CFTA 3DX7A 5EUOE 5DR5H 3K8KA 1E27B 2DLEA 1M05B 4U31A 2BC4B 1JUFA 2NY6C 2NW3A 2IQ9H 4E0RA 3H9SE 1XGUB 3SDCB 3O6FD 2PTTB 4RGNB 4L9LA 1AR2A 4HK3N 4NC2B 2MQCA 5MP6L 3GMNB 3KGRA 1H15A 1YY9D 2BVYA 3QXUA 2AQ1A 15C8L 4JZJC 2D7MA 2Y7QB 4MD4B 1ES0B 5FHAH 1WFTA 3RVVD 4RFEB 3WD5L 5HPMA 1HYSC 3LDBC 2W9LA 3QJFA 1B4RA 1CU4L 2DIBA 2UWEA 1ZWIB 4ONGL 4AH2A 1GGUA 3O4LE 5LCVH 2C3GA 2XV6B 4F7EA 3SDXE 4CRPA 5I8OH 2E8YA 4DFHA 4L8BB 5IF0A 4U0QB 2ADJB 4JG1L 4ZXBD 3NVQA 4O02H 5SWQA 1ZA6B 2DLTA 3E6HB 5DQDH 1LEIB 3BSZH 1AGFA 2AJSL 2LABA 5BQ7A 5DC9B 2P5WA 1Q1JH 4Q7DA 2UWEF 4NZJA 5I1AB 4WI2A 4UQ2B 3NPSB 4M5YH 1Q9KB 1P53A 2MFNA 3QEQA 1AO7E 3RX8A 3BH8B 1NFDB 1MCOL 5IVZA 4YDLB 1A7NL 3CX5J 3RA7L 5JIKA 1I1RA 3JSSA 4HS6A 4UT6H 2VLMD 4NRYB 3U2SA 3I6LD 4JQXA 3LN9A 2NY2B 4P2RB 4NKIH 3DVNA 5ETUB 1RU9H 5K59E 5KW9H 1AGBA 5DEFA 4MAYC 2A2QT 5DVMA 3VRJA 2IAND 4FQHB 4LGSB 4AIZA 3TCLA 2P8LB 3C2AH 1F3DH 2A6DA 3KPMB 3SBWA 4DCQB 3WUWB 1KCRL 4PJDE 4M1GH 1UQSA 2EE6A 4PJ7E 3QO0B 1KIQA 4WU7B 3OJVC 3KYNB 5JORA 4U1IA 1MI5A 4CVXA 1OSZB 3G5YA 5F93C 1JTOA 1O0VA 1JFQH 2VXVH 4XP4L 4M1CD 3EO9L 4U49A 3DSFL 5KSBA 1D6VH 1I9IH 2ZNWA 2QSCH 4J4PD 4OJFH 2DS4A 5T1DL 4JO3H 1UWEH 3M45A 4FQCH 4N0CC 5EZJA 2B1HL 2IEPA 4HLZG 4PY7A 1R3LB 1XH3A 1TCRB 1U8MA 1MCHA 3X11A 4A6YH 1MJ8L 4H5SA 5DYOB 5KSBF 5CJ8A 1JNJA 3FRUA 3GO1H 1NDMB 2UZXB 2HKFH 3O11A 1P2CB 3VCLA 5HGBB 4ONHB 2IG2L 3PQYE 4G6JH 4LSUH 5HI5D 5ANMB 5D1ZD 1BD2E 3G08A 3JTTA 3L5XL 4C83B 1N5YH 2H41A 4AT6A 1T4KA 3LSOA 1RUAH 1P84K 2EXWD 1C7TA 1VPOH 3OAUL 3SO5A 4OM1L 1JPFB 1Q72L 3GSNB 1ZMYA 4PBXA 2PO6A 4WUKL 1W0VB 2E9BA 4PRHB 1PG7W 3NFPA 2YEZA 3NGBB 2PW2A 4XNYH 1I3UA 5BV7H 1KYOJ 1I3GH 1EHAA 4GG6A 2EH8L 4IIQB 5E00A 2X42A 3ZE0E 4OGAD 5HHPA 5JA9A 3AGVA 1YJDC 5DO2D 3EYSL 1JTPA 1NC2D 5DUPL 1KTKE 1OTTC 2D7QA 1ZVSB 1MHCB 1MJUH 1NH6A 3MO1A 3G5XA 4D0DB 3SDAA 1Y6NR 3VDCA 2XG5A 4GG6F 1EX0A 3LQAL 4MD0B 1KJMA 1WSST 3OR7A 4EUPB 4F7PB 5JW4R 2HA1A 5IV2A 3D0VB 1JRHH 4S1QL 5FUZL 4FFZH 2FIKB 3MV7D 2VAJA 4K94L 2H6PA 5J12C 4AEHL 4OQTA 2B4CH 3BRGC 5D8JH 2LVEA 4W81A 4NNPH 2QR0B 2FEEI 2VDQL 2YPKB 3PF2A 3W81A 2VLME 3I6LE 2DDQL 3VH8B 4HMCA 1HNGA 4MMZC 2A9ML 2FL5B 2WIMA 3PDDA 3L3JB 5J89A 1FNEA 1MJ7L 2CIKA 1A0QL 1CGTA 2YKLH 1FPTH 1UB5A 3SGJC 4RIRA 2IANE 1AXTH 3SKNB 1NC4D 2BDNL 4YDIH 4PUBL 12E8L 4ZOCA 1K6QL 1ORSB 4F15B 1MNUL 5GRJH 1U58B 1G6RB 4S1DC 4OIIH 4PTTA 4R3SB 5IMMB 2DWEA 5FA3A 4FFVD 4WFFD 1QR1B 1E4WH 2R1XA 5CJOH 4RZCB 3OB0K 1UKQA 1XGRA 1ADQH 4OQTL 4NNYB 3ET9F 1FSKB 3QFJD 3BD3A 5C09D 4PGDA 4DW2L 1VGEL 2DQFB 3KHQA 2AEIT 1I8MA 3S34H 3REWA 5T5FL 1QHOA 4HS8L 5ALBH 3U7WL 1IMHC 3B9VA 3L5JA 1LO3L 2ZJSL 4G42B 4Z7VF 1KPVB 1FGNH 2JF1A 2R0WH 4R4BB 3LKQA 4JAMA 1RIHH 3W39A 2W07A 1EHLL 4M1DL 2F8VA 1A7RH 2VDOL 2HT4D 3CC5A 3G04B 4H1LA 4RFNC 5ECJE 5T1LA 1R5WA 4LIQH 2FLRT 1SVZA 3ARDB 4KAQL 5LBSL 3OF6D 3B8SA 3RWFA 5MP6H 5IJVB 4UIKL 2RJMA 1X5AA 1JGUL 3IF1B 2PXYC 4MLIA 2HLAA 4Z7UA 2GCYB 3SE8L 4KRPC 1ZHNB 3ARBB 3WIHA 3HE6A 4ZPTA 2X09A 4NQDB 2VMFA 5B8CA 2YD1A 1IC4L 1NFIB 3RNKA 1VEPA 4N8VA 3MA7B 5KG9A 4JG1H 3G6DL 4XAWH 4Z7UF 1T83A 3RHWF 1N7ML 5DI8B 4P9HL 5CSZB 1YYML 4J23A 4XPTL 1TNNA 4JFYB 3RVVC 2N7AA 3D1MC 3KR3H 2ZWLT 1ED3B 2NX5D 4IDJH 4R2GC 1JHLL 2DYPD 3QIWB 1WITA 1AXIB 1MEXL 3MUZ1 2VH5H 1A7NH 5L6YL 4TVPD 1Z9LA 2H2PD 1W0YT 3DV4A 4JGJA 5FAAA 4YXHL 4LLUA 3CDGB 4WCYH 1KCKA 4R9HA 3Q3GB 2GIYA 1KF9B 3MV7E 3HRZB 2CLVB 4IRSB 1IKFL 4HUVA 3IDJB 1L9NA 1MFAL 5KOVC 2BX5A 5MEQB 4NFCA 2FX8L 3QUYC 4WW2F 3MODL 4QRTA 3R4DA 1ZSDA 1OL0A 3H9YA 1LE9A 4S2SA 1KG0A 1EJOL 1HWGB 3MLUL 4U1LB 3V4PH 1NAMA 4GW1A 1IQDA 2QQNH 3RIAK 3V2AR 1J5OL 2A77H 3MBXL 3D3VD 3WO4B 1OTSD 3ZTNH 3AS0A 3MRRB 3EO9H 3V6OA 3ZDXE 5GIRA 1CDBA 4TVPH 3V0VB 4NJAH 4LIQE 4X6EB 5ABDE 2X4TA 5J11B 4JFFE 2VJXA 4U6TA 1TVBA 4JEGB 4JREC 1DQDL 5GPRA 5KANG 4WFFE 1RUKH 5TQ2H 4U6YA 5ISZD 5HI4C 2V2TB 5I16A 3QFJE 5HGAA 1T3FA 5C09E 1C08B 3ECBA 3FONA 1JGDA 2YSSB 2XFXA 5JHDB 1AE6L 4I48B 2XKSA 3VXRD 3O3EA 5BMFL 2Y5TB 1JPST 2WQRA 1ACZA 4J4PC 4B0MM 3IXAB 5I75C 2D7OA 2HRLA 3C60C 1NAML 4NT6B 3RVTC 2H9GB 1UH3A 4OV5B 4BQ8A 4NM8H 4I2XE 4ODVL 4OKVA 4NKDA 1Q8MA 3KLAB 4ZS7L 4ETQA 4OM1H 1WZMA 5T33H 1G7JB 1RK0B 3F6IA 2FX9L 4TSAL 1B2WH 2XXMB 4PV9B 4WUKH 5IBUG 4L8CB 4DGVL 3BN9C 2ENYA 3ME0A 4OZHB 5HI5C 2VZ1A 4GAYA 4X6FA 1FG2A 1FO0A 5I30L 4MX7B 4OIBA 4YBHA 3BEVA 4NQED 1GSMA 2OJEA 4FMFA 4YO0B 4D0BB 4QRRD 4ODHL 4PJCB 1RJLA 1EAPB 4KQ4L 4ZNCD 4N9GA 2ATPA 4GAGL 2EZ0D 3P9LA 1LO0L 3F7QA 4NQXB 4K71B 5EU6B 5I2IA 3IJYA 1L6XA 4PJ8D 1YPZA 5IOPA 1IGYB 4L4TB 3BISA 3VFSA 3MRKB 5GS1C 1CD1B 4YPGB 2AK4D 4S1QH 5E2WH 5FUZH 5MHSD 1PZ5B 1IT9H 2FBOJ 4OD2B 3JVGC 5DO2C 1U8PA 1A3QA 1Z9OA 2NX5E 2ERJC 1ZHBA 4AEHH 2WUCL 1KYOK 1YPZF 4S1RH 4XI5C 1FO0L 3AREC 5CSBA 2QQKL 1MIML 1N6VA 2ARJQ 2VDQH 4TVPE 1MFNA 3TBVB 3NCYP 3BT2L 5F7FA 2Z31B 2A9MH 5DRNB 3B6SB 4CVUA 3L3KA 3IFNH 2M1KA 4ZUVA 2CIIB 1I8LC 3MJ9H 4K3GA 2J4WH 4LDEB 1T7VA 1JNLH 1NQBA 4YQXH 1D9KB 2C3VA 5I76A 4PUBH 2EKJA 5JXAL 1K6QH 5T3XL 3FTGA 1MNUH 2YD8A 3IDYB 5F9WB 2NY5H 1GYAA 3D39D 1UM4L 3GSQA 1XT5A 2E7HA 4PJHA 2EDFA 5T1MB 4QHNA 4I9WE 4JFDA 2NCMA 2F8OA 4YXKL 1VACB 5JXEC 5HHNA 5E0QA 2LTQC 4TSBH 4LLVB 1UZ8A 1NGPH 2X70A 1TJGL 3WMSA 5EZIH 3EOAB 2E27L 3DXAA 4Y4HB 3D3VE 4WW1A 3RWIB 2B20A 2DQEH 2QQLL 3QUKA 5LXGH 4WWKD 3LKOB 3HZVA 1KJ2A 3TH4T 4PJHF 4HAFA 5BS0D 5T5FH 1GAFL 5DJZB 5IHZB 5J6HA 3TVMD 1AXSB 4LVEA 3T0EB 4X6CE 4ZQKB 3VFWB 5JNYB 4I0PD 3UBXG 4FOMA 2W60A 5ISZE 3LAFA 2NZIA 2BOBB 4WU5B 5EU7E 4N5ED 3O8XC 3PWUB 2YD7A 1L9MA 1PEWA 1DL7L 1NUNB 3VXRE 5FUOL 5E99H 3D2UB 2IFFH 1A6AA 1XGQB 5A16B 4UIKH 3P77A 1CLYL 1CGWA 3JV5A 1AKJA 4QCIA 3RGVA 1C5DB 4PB0H 1MQ8A 1LNUA 3X14A 4K7FB 4MA1B 2ESVA 4GKSA 1CFTB 3DX7B 3GM8A 2NW3B 1JUFB 4E0RB 2Y23A 5DMJB 4PYGA 2BJML 3V52L 1A3RL 4L9LB 5SX4I 4S1SH 5CILH 3QUXA 5E6ZA 3F7YA 4OLVH 5IB2A 1H15B 3QCUL 4PREA 1WLHA 3PE9A 1KIUA 5KVEL 2Q3AA 4R7DA 1C5BL 2BFVL 3I2CL 3P0YL 5HPMB 1N59A 4MJ5A 5E6ID 3QJFB 4KDTC 1UM6H 4G6ML 2UWEB 1QNZL 3BP6A 4NQEE 4AH2B 5C92A 4NBXB 1FLTX 2R0ZL 4F7EB 2FEDD 4L3EA 5IF0B 2ED8A 4JB9L 1JHLH 5F7DA 4QKXB 2EDOA 5GZNC 5SWQB 1MEXH 4YHNA 4R90H 5BQ7B 1AGFB 3MCG1 2P5WB 5L2KA 1YA5A 4UTAL 3S5LA 2B5IB 5CD5D 4R6UA 3ULUF 4YXHH 2YUZA 3B3IA 2D0FA 4JY5L 5MHSE 3QEQB 4IOSD 1BBJA 4ALAL 4K9EC 1BWWA 5I74C 4ZDHA 3MXWL 4Z7QE 1RURH 1OAXL 1T7XA 5IVZB 4C56A 3HC3L 5AWNL 1YDPA 2J8OA 3N0PB 3T1WA 4LCIH 4RMUA 3NIFE 1X3DA 4HS6B 1JCKA 3U2SB 1T2XA 4QHKI 2BNUA 3DVNB 2H2PC 4PG2A 3ULUL 2J3SA 4Q58C 1AGBB 5DEFB 4XVJH 2VDKL 3MLUH 2H1PL 3VRJB 2NY0B 4HK0A 1NL0L 4AIZB 3TCLB 1A7QL 1LHZA 4ENEC 4JLRA 4RGOH 1DQTA 1OP9A 4I0KA 3BKMH 1UQSB 1KIQB 1QYGH 5JORB 4M62H 4U1IB 5I1IL 3SE3A 1MI5B 4CVXB 2F8XC 1TZGL 3D39E 5C08E 4L4VD 4JHWL 1HYRC 2ZG1A 3UMTA 4CU6A 3H3PL 4YGAB 1M4KA 1F4XL 5F71A 2JIXD 3TF7C 3MC0A 4XRCA 3WNNA 5KSBB 1GOGA 1KT2A 4U1GC 3RZWA 2AEQL 4K8RD 5EZJB 5TE4H 3A6OA 1K9TA 4ONFL 2CRIA 4PY7B 3UEZA 1JNNL 5BS0E 2C1PA 1XH3B 3QHTC 5J13B 4JE4B 2EDNA 1U8MB 3B5HA 1S7QA 4U3CA 1EBAA 3X11B 2ZUUA 4H5SB 1F8TL 1DBMH 3FRUB 3O2DH 2Q8BL 4ODVH 2WV3A 3IU4H 4K2UL 1B90A 3VCLB 3ILQC 1KBGL 3G08B 4FN0A 3JTTB 1UGNA 3FOLA 1CG9A 4ZFGL 4AT6B 4LSPH 1T4KB 3LSOB 2FATH 1RUPH 4HKBA 4G9DA 1T04A 4HGKC 1MCFA 3HZYA 4BZYA 1MAMH 1QZ1A 4OI7A 1N3NA 1RQ5A 5I15H 1QSZA 2APVA 4PJEA 4K8RH 2PO6B 1LO2H 3LPGA 1YEJL 1TQBC 1GHFL 4O5LH 3NFPB 2YEZB 4GAGH 4F3FA 2PW2B 1LO0H 4ZFOA 4OGYL 5E00B 1M6OA 4JKPH 1I8KA 1Q0YL 5HHPB 4Q9QH 3RBSA 5T3XD 4OCXL 1NPUA 4J6RL 4PJEF 4XVTH 4XWOC 2Y36L 4U4BA 3T3PE 3MO1B 3G5XB 2W0FB 1F42A 3KJ4C 4XPBH 3SDAB 5JTWA 4QRPA 1FP5A 4QXGH 5J9PA 5EN2A 1KJMB 3OR7B 4YWGH 1NGZA 3HB3D 5IV2B 3QEUA 1I9JL 3WNPA 4PJ8C 5BZWA 3WIFA 2AK4B 3RI5F 4LSSH 4MB5A 3OKNA 2NY5C 3MLVL 2H6PB 4KHTL 1U2HA 2K7QA 1LE5A 3QWRD 3Q2CA 3LEXA 4P2QA 3TCXA 1ERNA 4FFWD 3LB6D 5GRWA 2NXYB 4AG4H 1LDSA 5T3XH 1TPXC 3NAAH 3AS3A 2R23A 4JGMA 2HTKD 4QHLA 1FNEB 4G8EA 4AM0A 3QQ9C 1JNHB 3BKYH 2VLRD 1I3VA 2P1YA 1UB5B 4RIRB 4AEIL 3STLA 5C86A 1A6VH 1TQCB 2PW1A 3MOQA 4WI3A 1U3HD 2CJUH 5IVOA 1NDGA 2VZVA 1B6DA 2G9HA 3WFHA 3NOIA 5BZDA 3GJFH 3G6JA 3PJSA 4PTTB 2IWGA 3L3DA 5HHVH 2DWEB 4QF1A 5FA3B 2R1XB 1BFVL 3T65A 4Y2OA 5DMGD 2OYPA 5LGKA 1MF2L 3T08A 3S35X 4AL8H 1HN1A 3T2NH 3IAQA 2NR6D 1EVUA 1IRAY 4PGDB 3CDYA 4JO2L 1HQ4A 3G6JF 3WXVL 1I8MB 4A2LA 3REWB 4CW1A 5E4EB 2XOTA 3CX2A 5DVNA 5FUOH 3X3GH 2BRRL 4LSQH 3LKQB 4JAMB 3W39B 3SHSA 1DVFC 5EBGA 3U83A 1MCPL 2DQJH 3BWUC 3CC5B 1BECA 3RVUC 3FT3A 4OM0L 1R5WB 1NMCB 5FA4B 4FZ8H 1EJ6A 5KS9E 4ELME 4NJ9L 2APFA 2J8UE 3RWFB 2UUDH 3OMZA 3BPNC 3NTCL 3SCMC 4U33A 2AABL 1A6TB 1QKZL 2HLAB 4Z7UB 5DTFA 1WZ1L 3LEYH 4JQVC 5HVWA 3QCVL 4GRLA 5DFTA 4G6MH 1RULL 3HE6B 3IKKA 1QNZH 4P2OD 4Y5YA 4ZPTB 1V7NL 3N1FC 5B8CB 3ZE1F 1KEML 4YGVA 1NBZA 1SYSA 3RNKB 5KG9B 4N8VB 1YMMD 4AEEA 2RGSA 4RISH 3OX8A 1FYTA 1OWWA 3DHJA 4HIJA 5EH1A 3F5WB 3IFLL 4H8WL 5T3XE 3BX7C 4X4ME 4JM2A 3CSYA 4JY5H 4ORZC 4NN5B 4OFIA 2R1WA 1PLGH 2ZCKH 4WUUD 4PJBA 1JYNA 4O2EA 3P4LA 5H37G 5F9DC 5AZEL 3WN5C 3VGAC 1LK3H 3DV4B 4WI6A 3HG1A 2I26N 2M26A 4JM2F 2DLHA 4LLUB 3LRGA 3W9DA 3S36H 5CCKH 1RSFA 4PJBF 5C1MB 4U2ZA 1ZLUH 4EUPG 2P8PA 1I1FA 5AAMA 4UT9L 2G60L 4HUVB 3IT8D 5C2BH 4ERSH 1MIEL 2YA2A 5IB1A 4QRTB 1ZSDB 4LRIC 1LE9B 2DQTH 2EDEA 3FFCA 4S2SB 4HFUL 4P2RE 3L6FA 1SEQL 1FVDA 2DJ4A 5D1XC 1KG0B 5I1IH 5F9OL 3ZHLA 3P73A 1TZGH 3GMOA 1NAMB 4GW1B 1IQDB 1RUML 3UYPA 4NDMA 2VLRE 2VRAA 2HRPL 2IAMC 5GIRB 3HRPA 3VH8G 2X4TB 3LPFA 3LV3A 2AI0H 4OLUH 1X5FA 1WWAX 4KMTL 4KUCF 1A1OA 1TVBB 2HT3D 4ONFH 3RL1A 3HMXA 4Y2DA 1JJUA 4XT1C 3P40A 3ARFD 3KYOA 1XF3A 4U6YB 2BNQA 1DLHB 3I9GH 2Q20A 1F8TH 1EMTH 5I16B 5HGAB 4IM8A 1AD9A 1T3FB 4NZUH 2Q8BH 3ECBB 3FONB 1JGDB 3U4BH 5ALCL 4Z7NF 3O3EB 2OI9C 3TYGL 3EYQD 3Q6FA 3O6LH 3EHBC 3RY6A 1MCBA 3WBDA 3E1F1 1A6WL 1VCAA 1ZGLP 5K33A 1CBVL 2DQCH 4OKVB 4MNGE 1BM3H 1JPTL 1YQ2A 4H26A 4NKDB 1BGXL 1LO5A 4GBXC 4ETQB 3HNSL 2OZ4A 3I85A 1MUJA 4OZFA 3HI1A 5A40E 1MFCL 3EYOA 5KSUA 5DK3A 5CZXD 4JFOA 5FCUL 4M7JH 3QJHA 3GKWL 4QGYA 1GHFH 1U0QA 3RY5A 3HMXL 1A9EA 2AXHA 3CD4A 4GAYB 4X6FB 1FG2B 1FO0B 1S9XA 4OGYH 1AJ7H 3GMPA 3BEVB 1BEYL 3BWAB 2OJEB 2HJFA 4IOIA 4LPWA 4PBVC 5C0BA 1RJLB 2A1WL 3QAZB 4XP5H 4Z6AT 1NEZG 4FQ1L 2I27N 4N9GB 1DBAH 3SDCC 2ATPB 5EFIB 4UU9A 3P9LB 5SWZA 3OZ9L 1VA9A 4RGNC 2DN7A 1YMME 3AC0A 2OJZL 3E6FA 5C2UB 1YPZB 5IOPB 2CDFA 2FH8A 3RL2A 1HZHL 1MHEA 2WP3T 3O4OC 3VFSB 1PQZA 2OBGA 3O3DB 5DVLA 1KOAA 3A6BL 4GQ9L 3F65A 2KL6A 4POYA 2XRAH 1G7LA 1U8PB 1YZZA 4DOHB 1Y6MR 3TBWA 1ZHBB 1X5HA 4KHTH 3ELAT 4XMKL 5FHBH 1GGCL 2X9YA 4WUUE 3K3QA 3WSQH 3RVWC 4LHQB 3HS0B 4BM7A 4JG0H 1IE5A 2D03H 4LRNH 1C5CL 1NUGA 5TE6L 3NPSC 2VSCA 4XCCH 3PUCA 3ZDYF 3BKJH 5DRWA 3VFUA 4ZUVB 1CE1L 3OKMA 3AMLA 2VE6A 4JRXD 1TNMA 4GLRI 5I76B 4YDLC 4YDKL 4TQEH 2NW2A 3ZKSD 3FTGB 3R1GH 3G9AB 2E7MA 2X44D 3QSKB 3ROOA 5D70L 5E70A 1TZHA 2NY2C 3GSQB 4PJHB 4JFDB 4L5FH 4HJJH 3TFKD 3HA0A 5EOTA 5HHNB 1M71A 2FD6L 3FOMA 3JUYA 1UZ8B 2X70B 3C5ZA 4MZ2A 4RQQA 3WUZA 4GS7B 3DXAB 2C5DC 4YNYA 4WW1B 3H9HA 4QHKJ 4BFEA 3HE7A 3ESVF 3LEVL 3HZVB 1KJ2B 1U3HC 1NGWB 5HPOA 1XGPA 4XBEL 3KNBA 2XZAH 5J6HB 2ARWA 1W8OA 3C9NA 1OAKL 5FEBA 2GK0A 4KJQC 4M7LL 2P48B 2W60B 4XPAH 3FCTA 5DD3L 3MOBH 3HZMA 4OM0H 2NR6C 5LGJA 4KVNH 1RFDL 3BPOB 1RJCA 4JJHA 1A6AB 2ADIA 4BUHA 3SJVE 4HW6A 3P77B 1AKJB 4QCIB 3RGVB 5HHXL 3X14B 4YXLH 2AABH 2LU7A 3L5HA 4ZTOH 2ESVB 4GKSB 4XNXL 4LCUA 5D1QD 1IAMA 3QCVH 4Y19D 5DLML 3LQMA 4DUVA 5J7CC 4NQCA 1EZVX 2ZPKL 5EIVA 1FRGL 3QUXB 3LZFL 3F7YB 1MWAA 5HDQL 5IB2B 5EA0L 5LQBL 2CXKA 4PREB 3PL6A 1OAQL 4JR9H 4K3DH 3QUMA 4R7DB 1N59B 4JVUA 1HKLH 4XCNA 4GT7A 4QXWA 3BP6B 4PRDA 2LQRA 3GSWA 4MXWL 3Q5TA 2G5BA 1UZ6E 1AR1D 3BP5A 4NQDE 2WBJD 4OIAA 4P2OC 2ZUWA 5F7DB 3WJLC 1QPXA 3HI5L 5IQ9B 4OCMC 3DECA 4K23H 4ZSOA 4O9HL 4YHNB 5IFHL 2XI9A 5AZEH 2XQBH 3U4EA 5L2KB 3BEWA 4IIQC 4DJMA 3NN8A 3S5LB 5JHLH 3HAEH 3B3IB 4EI5D 5I8KH 4JHAL 3EDKA 1A21A 3SY0A 2F5BL 3WKMH 5C0CD 1BBJB 1CN4A 3GSVA 3OAZH 4ZDHB 2MNUA 4DAGL 2FDBP 2LAGB 4A2MA 1MWAL 5I1KL 1MCLA 4B41A 3EUUA 3QNYA 5F1IA 1YDPB 1PJ9A 3QUML 1FHGA 1YEFL 3SGKC 1MVFA 5F9JA 1ZLVK 1CDUA 2OMNA 2JCCE 2BNUB 2NNAA 4HT1H 4P2CG 1AQDA 2DJSA 4F9LC 4PLKC 1YEGL 3O45A 4WFHD 2EDWA 2MHAA 1U8LA 3CVHA 1KIPA 5EORL 4JLRB 4OZIA 4JRXE 1K3ZA 4LCCA 4OFPA 3TT1L 1UG9A 2XY1A 4HXAH 1S7XA 3DTXA 4GLRH 2GJJA 4NWUH 1VDGA 1MFEH 3OTTA 1WWWX 2JK5A 3FMGL 3L9RA 3RWEA 5C0RL 4TNVF 4NGHL 3BD5A 2BNQD 4BZ1L 1BAFL 4LP5A 4XRCB 5L9DH 3P4OA 3RUGA 1KT2B 4GW5A 3KPSD 4IRJD 3GRWL 4Z7OF 2IALA 3V7MA 3DBXA 4YHKL 3W0WA 4FP8L 3TYGH 4KI5D 2C1PB 5HYJA 2EDTA 3QDMD 4OLWH 1CK0H 2V6HA 1S7QB 4MXVF 5C8JB 1X44A 5TF1H 6FABL 3ZL4L 4MNHB 3RUGF 1V7MH 5T3ZL 3ARFC 1ONQA 3I3EA 2AK1L 3RAJH 1TJHL 3OJDA 1RZJL 3GSXA 1FORH 1Q38A 1N6UA 1YYLL 5FCUH 1KGCD 3FOLB 1CG9B 2W38A 3GKWH 3JV6A 5HHOA 2Y5EA 4Z7WA 1U8KA 3DYPA 5BRZA 1ITBB 4G9DB 1T04B 3HZYB 2HH0H 1N3NB 4QOKA 3V9FA 2DOCA 1OP3K 4L3CA 5ID0A 1FIGL 4NYLA 3ARDC 1IC1A 4F3FB 4Z7WF 1GGYA 1FBIH 2EDQA 3T4AA 3HPJA 3HI6L 5FECA 4HUUA 3S97C 1M6OB 5BVJA 2OQJA 1I8KB 4NZTH 2Q76A 3QFDA 5HVFB 2OR8A 4UDUA 3ARBC 3B9AA 4Q97A 4UNTA 1I1AD 1RIUH 5IR1A 4PJCE 5F7HA 1OPGL 3GK8H 3THMH 3BDYH 4QRPB 3L3GA 2E6JA 5J9PB 4XMKH 5EN2B 3NA9L 1NGZB 5EO1A 3TT3L 5CD3A 3QEUB 2LU3A 1U8NA 3DOSA 3FO1A 2GEEA 5BZWB 3WIFB 4XC1L 3CH1A 4MS8D 4UILH 2AQ3A 3G5VA 3QUZA 4DTGL 2VISA 3OKNB 5IB3A 3D9AL 4YX2L 1C5CH 1INDL 2XIDA 1LE5B 2AJUH 5C0CE 1I7TA 1H5BC 1HWHB 3L95A 1E6JH 3LEXB 1U8IA 4P2QB 1CE1H 3QIWC 2ZCHL 3B9KA 4OZ4A 4OLYL 4TUJA 3H0TB 4NUGH 4LHUA 3L3OA 4L4JA 1IGMH 1F2QA 4Y1AD 3T77A 5JW3L 1IAKA 4QHLB 2C4FT 1BZ9A 4ZD3H 3BO8A 3WFCL 2AAVA 3C08L 4U1SB 4WFHE 1P4BH 1GCFA 5EUKA 3STLB 1UVQB 2ADFH 5DJ8A 4HSQA 4TNWF 2PW1B 4U7KA 2R69L 5C07A 3TGXA 1AFVH 4YHLL 4H0IA 1NDGB 1FV1A 4PJIE 1XF1A 2WWKT 4M6OL 1B0RA 2G9HB 3WFHB 4OB5H 5BZDB 1IGCH 3G6JB 1E4XI 3PJSB 3L3DB 4X7DC 5ACZA 4QF1B 4HEME 4LCYA 2J2ZA 4V2CB 1CDHA 4ZS6D 3QXAB 3T65B 3QIBD 5MEND 3N85H 4PJ9D 3UTSA 2VN4A 2EDHA 1XR9A 2IH1A 3X3FH 2RR3A 4M6NH 3K2MC 3T2OA 1ULVA 1HQ4B 5I0ZA 3O0RH 4CW1B 4PRBA 1X9QA 2MPAL 4OGXL 5AG9A 5J11C 4KI5E 3GHEH 1C1EH 3QDME 5M7QA 3EOYG 3FT3B 1UXSA 5DK0A 4HWUA 3TA3D 3VA6A 3DUUA 4G6KL 5EBLA 2ZPKH 1CIDA 4LAJH 3MPCA 1CZ8H 3MV01 4KPHL 4N0RA 3V4VH 1KGCE 5HDQH 4HCRA 5LQBH 4NQTA 5GGTH 3MXVH 1OAQH 5DSCA 2R4RL 5DTFB 4EEEA 1I7RA 3P0VL 4HD9A 2MKWA 2W0LA 1ZLWH 4GRLB 1FJ1A 3GJFK 2AGJH 4Y5YB 2NY1C 4B50A 3PXJA 2OM5A 5IGXH 3OGCA 4NOFA 4YGVB 4DVRH 4NFBA 1NBZB 4G9FD 2WQ8A 3MBEA 5KSAD 2N7BA 2QADB 5I1GH 2BHYA 3HI5H 3I50L 3OX8B 1FYTB 4O9HH 4HIJB 3VXMD 1JIBA 4V1DA 3RDTD 1WFNA 5I1JL 3TJEH 5GRZA 2NZ9D 2YRZA 4X0KA 3RU8H 4YUEL 4TOYH 3HR5A 1J1XL 2UWEE 2XZCH 4JM2B 3CSYB 1K4CB 2J5LB 1J8HA 1X4YA 2RCSH 3OV6A 2R1WB 1QSFD 4DAGH 2VKWA 4YE4L 5ILTH 5I1KH 4PJBB 1AR1C 1KLUA 4O2EB 3GMQA 4XH2A 1OP5H 4K71C 4CDHA 1YEFH 5JOFB 3HG1B 5JIHA 3CH8A 5JUEH 5DURD 4F9PA 4N68A 3UJIL 5GGQL 1YEGH 3W9DB 1I9RH 4XP9H 2GJ6A 2P8PB 1I1FB 4G8FA 1MFBH 3BD4A 2V7NA 5T3ZD 5EORH 5KAQG 2EC8A 1WIPA 5IB1B 5D2LA 1RHFA 2XA8H 5FDYA 3ZKMD 3FFCB 3FJTA 3HUJF 3BQUD 3ZKQD 3L6FB 1FVDB 1TXKA 3P73B 1IKNC 3GMOB 2Z31C 4G8GD 3V6BR 2BSED 4KKCD 3FQTA 5GJTL 4I5BA 5F1NA 4NDMB 2I25N 5TJWK 4NGHH 3WHXA 3D69A 4XBGA 4BZ1H 5L88L 4TULL 4MQ7A 3WLWC 3KPRA 3ARQA 5AUMA 1D9KC 1SJHA 3UYRH 3LV3B 3GRWH 4EDWH 4AMKL 1DSFH 1JBJA 4YHKH 1F45A 3IDYC 1A1OB 1E4XH 2VABA 3RL1B 4Y2DB 3PWPA 4AQOA 1NUFA 3KYOB 3ZDZE 5MENE 1XF3B 2BNQB 4QGTA 3MGAA 4NWTL 2JB5L 3VXPA 3V79C 2AK1H 1H0DA 4IRJB 1WC7A 4Y4HC 1UKTA 4MJID 4LQ1A 1IARB 3ARYA 5DRXA 1G9NH 1YYLH 3MOAL 3I3DA 3RTQA 1T0MA 3V7AE 3PWLA 1MREH 4WHDA 5HVHB 2OSLA 3WFDL 4M00A 1IGIH 3BPLC 2MCPH 4PJXA 3T0EC 3PV7A 4H26B 3VI3E 3RZCD 1MUJB 4OZFB 3HI1B 5IBLD 3EYOB 4EQ3A 5KSUB 5ESAA 5IMLA 4JFOB 1NEUA 2BY0A 3MUHL 1UB6A 1MLCA 2R2HA 1A9EB 3W11C 4R4FH 1S9XB 3KJ6H 2VDNL 3GMPB 5JDSB 3V8CA 4J3TA 4RX4A 2XZQH 3W5NA 2E9JA 4EZMA 2HJFB 4IOIB 2AEPL 1ZT7A 4PGBA 3TWCL 4U1NA 5FUCE 5C0BB 4PIRF 1C8PA 4RMRA 2APBA 4MMXC 3EJJX 4UU9B 4X6DF 3ES6A 4L9LC 5J8OA 3BRDA 4G9FE 3E6FB 4FQXA 3CDCA 5EWIH 4GG6E 4APQD 4P23A 1UCBL 2CDFB 3RL2B 3WS6C 1MHEB 4JFHD 3VXME 1PQZB 4H1LH 1BQUA 5HGGS 3T4YA 3SOBH 3KPOA 1JGLL 1D5ZB 1G7LB 4LFHD 3UTTA 1GGBL 1O5DT 1BIIA 4KHXL 3D9AH 4YX2H 1TJIL 3HMWL 3C5JA 4J1UA 1QSFE 2W0PA 4JDZA 3BGAA 4JKKA 5ICXB 1F4AA 2YUWA 4JFED 5I73C 3N1QC 4OLYH 4JKLA 1L0QA 3IDGA 4IMKC 4DZBA 3GEWB 5JQ6L 2XY2A 3QWOA 4I0CC 3WIHH 5KVDL 4G80A 1IM3A 2E3VA 3MA9L 4QNPF 2BNRA 2VLJA 4XCYA 1E28A 3C8DA 3KWWA 4M93B 2GT9A 3ZE2F 4X4XA 3ULVF 5A3ID 1KB5L 4P48A 4PJFA 5DRWB 3VFUB 2V5MA 1SYVA 3OKMB 2VE6B 2YD5A 1PYWA 5I71B 4PRID 4FTVA 3QG7H 1FC2D 2NW2B 2R2BA 3F62A 4Y1AB 3ROOB 1A2YA 4JQXC 1TZHB 1HINH 1W72A 2CLRB 5F1SA 3ZT5A 4N0UA 5TE7L 1DE4A 5EOTB 4NQVA 1M71B 3FOMB 1T7YA 2FO4B 4G8GE 3VXUA 3FB6A 1CFQA 4RQQB 4NOBA 3TJHD 2J6EH 3B43A 4X8JA 3SBWC 3H9HB 4XPGL 5JO5A 2BVOA 3HE7B 4PJGA 3UAJD 1FZOA 5CEZL 1CCZA 2IH3A 1JF5A 2NXZD 3QG6A 1XGPB 2MPAH 4RSVA 3KNBB 4IHOA 1DBJL 4YEFA 4PJ9B 5B3JF 3C9NB 4Q0XL 2K1MA 4OBRA 1KXQE 1V3LA 4Z7VE 2GK0B 1J10A 5AZ2H 4HC1H 2ZZUT 4P4RA 3FCTB 1SHMA 3HZMB 2ZUQB 2DQDL 1CGVA 2VO5A 1SJEA 3B5TA 3VG0H 4WHCA 3K2UH 5LGJB 3RI5K 1II4E 3MLSH 4MJIE 3LCYA 5CZVL 1W72L 1CGUA 1A5FH 2ADIB 3ZYIA 1S78D 1YY8A 2V5RA 5DHYA 5J13C 3UTPE 3P0VH 1VADA 3VGBA 4LCUB 1U8HA 3REVA 1UADC 1E6OL 5EPMB 3TA3C 3O6ML 4WGWB 1W2KT 1MWAB 3AS1A 1KN2L 3PL6B 1EO8H 3QUMB 4NQSA 3LQAC 3MCLH 3EDEA 5HYQA 2BSRA 4ZYKA 2OMBA 4PS4H 1NGQH 4R7NB 4XCNB 5F6HI 4QRQA 3UJJL 4PRDB 5HXMA 1J1XH 1FNGA 3GSWB 2B8OT 3GUTA 3RGHA 3MZGB 1J8HD 2DBJA 5D71L 5FUCC 5M95B 3VMPA 3OKYA 3SGDI 2YC1B 2PO6C 4ZNEE 3HNTH 4K94C 3SDDA 2D9QB 4ZSOB 4KUZL 1DQJA 3PHOA 2FECI 5FYKH 3MRBB 3U4EB 3BEWB 1CDYA 1RMFH 3NN8B 3LH2L 3NABH 3QDJD 4XHJC 1W8NA 3KYKL 2O5XH 3SY0B 1CD8A 3GSVB 3VWJA 1JGVL 1R3IL 3QDAA 1I7ZA 2P5EA 4JPKL 4N8CH 1AH1A 1VFMA 5F1IB 2VXUL 5F9JB 4M3JA 2BOCA 4JFEE 2NNAB 4UOJA 4KTEH 1AQDB 1LGVA 5GS0L 1YQVL 3O45B 5DWUH 3BN3B 2MHAB 1U8LB 3CVHB 4D9RD 2EDXA 1KIPB 1KC5H 2JKXA 1JHKH 5JZ7C 4QHMB 4LVOB 4OZIB 2YHGA 3JWOL 4LCCB 1CXKA 4TULH 1KN4L 4ONOA 1S7XB 4PRIE 5F44A 3STBA 1T6VN 3DTXB 3BZ4A 4KXZI 4W4OA 1U92A 4AZ8A 2NXYC 2V7HA 5DJ2A 1BREA 4UTBH 2VDLH 1G9NC 3X13A 3IYLW 2JK5B 3U0TA 4XNUH 8FABA 3L9RB 1EH9A 3EFDH 1T2QH 4JM4L 4G3YH 1V3KA 2Y6SD 3P4OB 1JYVA 3RUGB 2B0SH 1P7QA 4GW5B 3GSOA 1TQCC 3MRDA 3NCJL 4WNQA 4GRWF 1L7TH 3D85A 2CK0L 2NMSA 1QFWL 1TVHA 1OARH 1I4FA 2IALB 3BP4A 5E1HB 3DBXB 1F90L 4XC3L 3W0WB 1HHKA 4JRYA 5CUSH 3NCEB 3MOAH 5HYJB 4KK9D 5SX5H 5F8RC 5CP3A 2E8ZA 4HJ0D 1ONQB 4CUCA 4L1HA 2IMNA 3I75A 3GSXB 5IESH 4NO0D 2W9EL 3DMMD 1RIVH 5E4EC 3JV6B 2NY4B 5HHOB 5KZCB 1RUQH 4Z7WB 1U8KB 5BRZB 4N0FA 3O9WA 5FYKE 4PJ5D 4YHZL 4P9HC 3O41A 1MVUA 4QOKB 1ZT4A 4LLAA 2AXFA 2AEPH 1KJ2H 1JMXA 1RV6X 4PPTA 1H8NA 4YHOL 3RZCC 4L3CB 5ID0B 1NMCC 4NYLB 3KAAA 2I9TA 5IBLC 1QRNA 3T1FA 3T4AB 1EEZA 1XIWD 4NC0B 3HPJB 1HSBA 5FECB 4HUUB 5BVJB 1J05A 4F37K 2OQJB 3QQ3A 3ILPA 2Q76B 4JFPA 3QFDB 1MCIA 1H3PL 4ZO8A 4Y4FD 4DN3H 2V5SA 2YA0A 4JQIL 4UDUB 5EC2A 3EOTL 3MV9A 3S35H 3HE6C 3P4NA 5IR1B 4P4KD 1ZTXH 4KHXH 4ZMAT 3L3GB 1BJMA 5B8CC 1IFHH 2X1QA 3QIUA 3SGDH 2NPLX 3BMVA 1NCWH 3NFNA 3T0AA 5EO1B 5CD3B 3S88H 1T83C 1XAUA 1U8NB 3FO1B 2QSVA 1UACL 4RAUA 4XP1H 4PR5A 1CXHA 5F1OB 3CH1B 5KVDH 3QDJE 3G5VB 3QUZB 1IM9D 2VISB 1JF1A 5IB3B 2XG4A 4XNZB 1JPSL 3LS4L 1I7TB 2H32A 3L95B 4NN5C 1KB5H 2CKBA 1U8IB 3B9KB 4OZ4B 1OCWL 2BXYA 3W2DH 4TUJB 2AV1A 5D6CA 5F89A 4LHUB 1UA6L 3L3OB 3BOVA 3T77B 2CH8A 5IP4A 4F57L 3V4UL 1IAKB 3T8XA 1WCQA 4WW2C 5SWSA 1BZ9B 1KPRA 3BO8B 3BW9A 1XF5A 5FYLL 1EGJL 5L8LB 4GMTL 1MCWW 4D9RE 5EUKB 4Z76B 4L8SA 5DJ8B 5C07B 2M8XA 4Q6IA 3U6RA 4X4YA 3AY4C 5F7EL 1FV1B 1CICA 1B0RB 2NY3D 4R8WL 4KXZH 3IRPX 2KZ1B 2XZZA 5ACZB 3UC0L 5HHMD 3TO4D 5C3TA 3SDYL 2W59A 3UTSB 2CKBL 4M6ML 4Q0XH 1NGYA 1QO3A 1XR9B 1MFDH 5DVOA 1AI1H 4TTDD 3BGFB 4M7KL 1A7OH 5D93C 1GZPA 3KLHC 3V6OC 4K7PX 2EECA 4PRBB 4IOFD 2EICA 2XTJD 1B3JA 5CZVH 2Q8AL 3CLFH 4TUKL 2RIKA 1NBVL 2YMXL 3S37X 3BJ91 1EBPA 2DICA 1Z3GH 4DGIL 5F21B 4POZD 4LCWD 1A6ZA 2VDML 2A0LC 4LEXL 1UM5L 5E1AA 4ZO6A 1FG9C 1UXSB 3L1OL 5DK0B 4PP1C 2WIIA 2A9NL 3DUUB 5GRYA 4L29A 3P9MA 4YFLF 2D7PA 4U0RB 5EBLB 3VWKA 3NACH 3CSPA 5FK9A 1U8QA 2AV7A 2YD2A 5IVXA 1S3KH 2VR4A 5LAXA 5D7JA 1KFAL 5DSCB 4KH2A 1I7RB 5BW7C 1WQVT 3B2UD 1J87A 4NHCL 1J12A 1FJ1B 5HDBF 4PJ5E 4ZAKA 3NCMA 4P5TA 5F9AC 4JZJA 2GYSA 3OGCB 3MRCA 2DM7A 1T1YA 1CF8H 2H26A 3MBEB 1SM3H 1FLRH 1N64L 1G84A 1BQLH 3FN0L 2HLFC