3QUZD

Structure of the mouse cd1d-nu-alpha-galcer-inkt tcr complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
239
structure length
239
Chain Sequence
b'AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 65
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzD02
2APVA 3OGOE 3EJJX 1KIUA 5T1DL 4F7CA 4NSKA 2FX9H 3O6FB 3R06B 4G6JL 5A3ID 5DJ2A 4ZXBA 3QIUB 3BDBA 5IW6B 3VWJA 4I0PC 1MREL 3WXVL 4BK4A 5E6IC 3L7EB 3C6LD 3HE6C 5EA0L 3RVTD 2GYSA 4P57A 4P23C 4RMWA 2MKLC 3RJQB 5DJDB 1U3HB 3I50H 1F11B 3EOAB 5C0BA 4MCYA 5KZCD 1TCRA 5FB8A 2YSSB 5B38G 5GZND 1TZHA 3EYQC 2CLRB 2AQ3A 1NDMB 1ZXQA 5JW3L 1ZHKB 3ARDA 4YDIL 3QFJD 3BKCH 2OYPA 5FK9B 2P44B 4ONOA 2JJSA 1J0KA 5EULV 5HPMA 3MLSH 4L3EE 4HW6A 4WU5A 4ONFL 4O2EA 1KLUA 4WWKB 5AZEH 2A1WH 5KJRH 3FT2A 1ROWA 5LG1A 1A6TB 3OWEA 3D18B 4HPOL 2VUYA 3IF1B 3RDTC 1IM9B 5AWNH 5C71A 1ZANL 3DMMC 4X7SH 3HMXH 5FKAB 1IC7L 4PJDF 2VC2H 2R15A 1G9NC 4YO0A 3DX8B 5IBTH 3HE7A 3NCYS 3OGCB 4UT6H 5FO9A 3BD4A 5F3HA 1H15B 5D1QC 4TULL 3SCMA 3D85B 5C0DB 2B7DT 4NQDB 1ADQL 4JM4H 2MPAH 4RMTA 4NKOA 2VJXA 32C2A 4DK6A 2F54A 4U4BA 4MNQA 1Z6JT 5LXGL 4MJ5B 4KQ3L 4HF5L 2Y1VA 4P4KC 5B8CC 3BN9D 2W38A 3ULUC 5ESAA 1K3IA 1JYXA 2K3TA 4R26L 1AHWC 3C5ZB 4PJXE 5B21A 3C09C 3GHBH 5FF6A 1JWSA 1U2CA 3ARRA 1BQLH 4UU9A 2P45B 2Z92B 1YJDC 4WFHE 5HHOB 4CVUA 1INDL 4FMKA 5A16B 4HUWA 4FQXA 5C0IB 2GJ6D 1RZ7H 4X6BB 4IRJC 3TWCL 5E9DA 1UQSA 1CBVH 3O4LA 1LMKA 1RY7B 3DROB 3QRGH 5EU4B 4ELMF 4PJGB 1QR4A 3A6CH 2JJWA 4K3JH 4YHOH 4YEEA 1N4XH 4K7PY 1EHLL 3ZKXB 1P9MA 1A6VH 1FRGL 2BDNL 4LRNH 5TDOA 1Q9LB 1BD2A 4NUGL 3WHE0 1I4FB 4FQHA 1G7QB 1CVSC 3W9EB 2CK0H 4G42B 4A6YH 1YEHH 1DFBH 4IHOB 5TDPB 1YDPA 1D5BA 1RZ8A 3QAZB 4C4KT 3GSOB 1KBGL 1KSRA 3AREB 4Q97A 2NCMA 3MLXH 5INDA 1KCSH 1OTTD 3VWJC 5FA3B 4KU1A 5AYUH 3O3UN 4H25A 4I77L 5JO5B 5HYJE 4D9RE 5ALBL 3HFMH 5LWYL 5B4MC 1A6WL 2P5WB 4BQ6A 4ORZC 8CGTA 1CFNA 4PRPB 2ADIB 3T0XA 5CUSL 3UTSB 1DLHB 5INCB 2EIDA 3T0EB 2A6DA 3DGGA 2VZ1A 3QXUA 4S1QH 5ISZE 3HRZA 1BQSA 8FABB 4CU7A 5CLTA 5IQ7L 4M03A 4HX1A 2YPLE 3GSQA 2LTQC 3ARDC 5DMIL 4GT7A 5A40E 4N8CL 1QSVA 3DX9A 3C08L 3H6JA 3QEQD 2CO6B 1P53A 4NKMB 3S37L 1TVHB 1OSZA 3D25A 4MXVE 4R96A 1ZVYA 3VFVB 3Q5YA 4QGTA 2AABL 5C70A 3FFCA 5EOCL 3H9HB 4WEBH 3RUGB 3O6KH 2NTSP 4WENB 4RFEB 4EQ2A 1A6ZA 4R2GD 1RULL 3TBVA 4CN1A 1EBAA 4KPHL 4XGZB 4M7LL 4GKNA 1CG9B 4LCYB 1J0YA 1Q9KB 2D03L 2G60H 4XHJC 3SCMC 4XP9L 3F58H 3ECBA 1VFBB 4NN5B 4POYA 5GS0H 1N3NB 2PW2A 1U92A 3NCBB 4I4WB 2BY1A 4MQSB 4WEMB 4YBLC 5F21B 4Q2ZB 3EAKA 1MFBH 4ALAL 2AV1B 3ARFB 1WJ3A 5ERWA 1TCMA 5FDWA 3CXDL 1K8IB 4YXKH 1SJXA 5DSCB 4R3SB 4JFDB 5FKPB 5I73B 3G6DL 4NQCB 1CD1A 4POZD 4HH9A 2DTML 3RAJH 5TQ0L 1MRFH 4F9LA 5LQBH 1X5KA 5I71C 2X1XR 1OP5K 1U8OA 2XQBL 4FQXC 4X80H 5F7MC 1X5LA 5JHDE 1BOYA 5C2UB 5J12C 3JWOL 1A3LH 2VLKA 1LO3H 1U3ZA 3IFLH 5E1HB 4K8RC 4YDVB 1TJGL 2WINB 4FTVD 1FNGB 2D31B 3MRRA 4MB5A 3RTQA 3ZL4L 1P9MC 3QJHB 3R8QA 1KJMA 1ONQB 2MJWA 2IAND 3EFFA 3MACH 4MQ7A 2QTEA 4DAGH 5GISL 3V4UL 1HHGA 5IM7A 3BI9X 4GAYB 4BH7A 1JNLL 1NGPL 2QL1A 3LS4L 4JHWH 4U6YB 1KCKA 3BXNB 1B0WA 3OR6A 4OLVL 5JPNB 3OKKA 1NCTA 4H8WH 2WZPD 5C0RH 3WFHA 3OKMB 1MRCH 2HJKB 5J11B 4ONGH 4Y19D 4NKIH 5CEZL 4DN3L 3T0BA 2VUOA 2VLMD 1TDQA 4M3JA 5IB1B 3PGDB 3FCTB 1U8KA 1WCQA 2HT3C 1WZ1H 5EDXA 4FQ1H 4IM8A 4RBPH 1TTUA 2B1HH 1X5ZA 4NOBA 4MS8C 3QDMD 4Y8AA 1AQDA 3K2MC 2Z8SA 4KAQL 2FRGP 4L3EA 5HHME 2FECI 3AS3A 12E8H 1MHCB 2IG2H 3V6OE 1TITA 1AP2A 4PTTB 2VQTA 3TJHD 3DNKA 4OFPA 4HUVB 4MA1C 4PGCA 3JWDL 1MAJA 1DE4B 5AG8A 1BF8A 4WY7H 4FQCH 1U95A 3S7GA 5KSAA 2VIRA 2E8YA 1MJUL 4YWGL 1UWGH 5DFWH 3MCKA 3G6AA 3L3KA 3O45B 3WS6A 3CUPB 1NDGB 2DI8A 2ARJB 4HIHB 2AK4D 2IPTH 3ZHDA 2HTKD 4JPVH 3LY6A 2AJSL 4KJPC 3LIZH 3VD3A 2ADJA 3BUYB 3PWJB 4OT1H 3EKCA 3KYNA 2LU7A 4OV6F 2Z91A 5GHWL 2H32A 1KLFA 4L8BB 4PJXA 3GGWB 1LE5B 2XTJD 4N5UA 1IRAY 2Z35B 3VXRB 2FATL 4Y1AE 3DETD 3MXWL 1MJ7L 5F7KC 3LN5A 5J1SC 1U8QA 3H2WA 2O5YH 4UQ3B 1I9RL 4PJHB 3MV11 1WCBB 5CLWA 4R0LA 2J8UE 3RWCA 2F58H 3N0PB 5IR1A 1M7DA 3AFLA 3WUWA 1ZT4B 4CVZB 3TZVC 3HN3A 4CVXA 5KSVB 4WEUD 5DO2C 4JFED 2R0WL 2UUDK 1BBDH 3F7PC 1RJCA 3DYMA 3E6HA 1U8IA 5IW1A 2ZCLL 3DVGA 1MLCA 2C1OA 4DKFH 3O8XA 2X9WA 1VACB 3CFCL 2VDKL 1BFOA 3RTQC 3VH8A 1VESA 1BIIA 4WRLA 1G9EA 1QRNE 2DLIA 1A22B 1B4JL 4MJID 2AXFA 4NO2A 15C8L 4IIQA 4XMKL 5HYQB 1FGNL 5FUZL 5HYJA 4Y8DC 3H9ZA 5DVMA 5JHLH 2G9HB 4YUEL 2ADGB 1KFAH 3QXVA 5FYLH 1JZ6A 2QEJA 4PG9B 4UV4L 4QYOA 5DF0A 1ZWIA 1GPOL 5FGCB 3LSOA 2YPVH 5ISZA 4GUPB 5F9OH 5A2IH 5JOFB 3NA4A 4B53A 4D0BA 2EXWD 3AS2A 4KK9C 3RL1B 5AZ2H 2YPLA 5DUML 2IH3B 4HS6A 5DJYB 2DICA 3VXNB 2GY7B 5K59E 1CCZA 4M7KH 4KTEH 1FJ1A 2AEIT 3VFTA 3FB8A 3QUXD 3TYFA 4Y4KB 4H1LH 4XNYL 4RIRB 4XNXH 3QUKA 5DVKA 4X5WA 1IARB 4HCRA 3EDFA 2Z4QA 4DOHE 4NO3B 3PL6A 4MWFB 3IXAA 5HGAA 5FECA 5KSAC 2BNQB 1LO2H 2J88H 5CSZB 3WIHL 4LBEA 3T08A 2V7NA 2BC4B 3ARVA 4WI8A 3TEUA 3QA3B 5GRJL 2Q86B 2FO1A 3AGVA 4IJ3B 5IVXB 3CSGA 5DUBB 4QLRA 4C4KO 5D1ZD 4D9QE 1JGLL 2EDOA 2GK0B 2PYEB 4PJ9A 3PJSB 4L9LC 4WI9A 3MRIB 2FYYB 2DKSA 2JKXA 4QRTB 3BDXA 1WWCA 1U8MA 2QKIA 5DHYA 2QBWA 4P2RB 4HPYL 5LGJB 5EPMB 1HHHA 5FYJH 1GC1C 4X4XB 1NBVL 4R7NA 4LHUD 4UT9H 3CFIC 4UTAH 4XI5D 3C8KB 3F7VB 1MNUH 4U3CA 3ZZ1A 1P84K 5F7DA 4ZFGL 2VOTA 3NMEA 3RNKB 4G8FA 1YZZA 1C5DB 4NRYA 1KXTB 2H2SC 5JHDA 5F1NA 4ZOBA 4MGXA 4O2CB 3QYCA 4U1SA 4NNPL 2VXUL 4LLVA 4R0LC 5I1JL 3L3HA 3ULVF 5GJTH 3BZDA 1YNKH 2OR9L 2DN7A 2VLRD 2DWEA 5HGHB 3NGBC 5T33H 5JPMA 5GSRB 1T2XA 1NGYB 3CCHA 5T3ZD 1JGDA 3ET9F 4OUOA 3RWIB 1PY4A 1RHFA 4M61A 4UBDD 2ZSWA 1PSKH 1GGBH 3HC3H 1A3QA 2LFGA 3KDMB 3MMEB 1HH9A 1DJSA 4G3YL 1JI2A 5IMLA 1YEGH 5MHSD 4KMQA 3DXAB 3KPTA 4X6EB 5ENWA 4QRRD 4M7LT 1T66D 2NXYD 3O8XC 4N0UB 1CE6B 3HG1E 2AJ3A 1F5WA 4OUUA 4RCAA 4TSCL 4XMPH 4U3XA 5ESVB 1FIEA 2DAVA 3WLWD 1G7MB 5E8DH 4P5TB 3D3VD 4MD0B 2BK8A 5DEGA 3L3IA 1FFPB 1Q1JH 3SDXF 3MZGB 4EI6A 1DBAL 2IAMB 1K4CB 5ESQA 2Y36L 1CU4H 3P4OA 5CHNA 2G5BA 5BXFB 1NGWA 1KN4L 2BMKB 3G6JF 2DWDB 3V6OA 3OJVC 4B7IA 4XBEL 1R3HB 3FO1A 4HJGB 3IJHB 1S7TA 1DQMH 1HKLL 1UJ3A 4Z5RA 3NACL 5MI0B 5L88H 4QY8A 4WUKH 1M7IB 3MBEA 4TQEH 5DHVH 1DSFH 1R5VA 4NQEB 4NP4L 4HK0B 2FR4B 3O3EB 4LSPH 3ARBA 4F7MB 3BGFC 2NY1D 4PJDB 4BSJA 3O9WB 1HEZA 2YRPA 3PWUA 3LZFH 4B5EA 3TFKD 4PJ8B 1F4YL 1TIUA 3PL6C 2XA8H 2Y25A 5GRZA 2FH8A 2A6JB 1HCFX 3O4OB 5DJ6A 4CU6A 5C7XL 4TNVF 5CFHA 3CFKB 5ELIA 1FO0A 4LDEB 1MQKL 3G04A 4XCYB 1ZLVK 5EZOH 3OXRA 1ZLSL 4YK4C 4Y1AA 1K6QL 3F7RA 4PJ9C 4EN3A 1ETZA 3PDOA 1S7SA 4OZHE 1CGSH 2BFVL 1Y6KR 5E8EA 2O93L 2NW2B 4XNQB 2G75A 1P6AB 4OCLC 2WW8A 2IBBA 1GL4B 3F5WB 4K2UL 4ZQKA 4BFBD 2J8UA 3HAEH 1QHOA 3O2WH 5TH2A 4DZBA 3EGSA 1N59B 4KH2A 5F6IC 2PUQT 4ELMB 5I1KL 1K3ZA 1LP9F 5D5ME 2F8XC 5DQJB 4R8WL 2FCBA 4XPFH 1G9NL 2VABB 3TCLA 5ANMB 2DBJA 2V2TA 1TNMA 1RUQH 1NCBH 1SMOA 3NABL 3FHQA 1N2RB 1JHTB 1V7NL 2NY0D 2Y07H 2EO1A 5TGBA 4U7MA 1QRNA 2XG5A 1XGRB 1AKJD 5BRZE 1RI8A 4MA8L 2WV3A 4NN6C 2R2CA 1IAOA 2VQUA 3UTZA 1UADC 2J6EH 3IXTA 3RU8L 1DP0A 2H9GA 5C9JA 4OGYL 2OZ4L 2GT9B 2VDPL 1EXUA 5JXEA 1ZHBB 1TTFA 3MJ9A 5H35B 4EXPX 5C1MB 3DO7B 1XF3A 3RWJB 1DTUA 1OPGH 1YJDL 3S3JA 2OXHA 4I3SL 1W0WB 5EH1A 4RQQB 3DECA 4L4JA 1OCWH 4MJ6B 5D7SH 3MXVL 2BCKA 1MHPH 4TUJB 3REVA 4EEEA 5H2BA 2OR7A 5KG9A 5BOZG 1HILB 4ORGB 2C4FT 1IC5H 4MHHI 2ITCB 1IKFL 1BM3L 3V2AR 3T4AA 4KJYA 4CW1B 1OP3H 1WFUA 2R23B 3H0TB 3PDDA 3WFEL 1NGQL 3P4MA 2AK1H 4FXGB 2H26B 1T80A 1NEZA 1ZLWH 3GHEH 3RWHB 35C8L 4XBGB 3RJDA 2OMNA 4HC1H 3F12A 4Z7OF 3EJZD 3BD3A 3GKWL 4C54A 2DQIL 5DHXB 5I1IL 1UB6A 5TDNB 2YK1H 2DI7A 4KUZH 4YIQA 5KS9F 4U31A 4PG2A 3FQWB 4CNIB 1XGUA 1X5AA 2B5IB 3BN3B 3NCCB 4S11A 5K9KA 1PY9A 3H42L 1EAJA 3MPCA 5JR1L 1CICC 2MKWA 4LLWB 1MRDH 5C0EB 1I1AD 1YECH 4IDJL 3QULA 1WISA 3QIWA 4EN3C 3HC0B 1EO8H 2BNUB 3R1GL 3EOTL 2R29H 1A4KB 3L1OH 1SQ2N 5D6DA 2ZUUA 4O51B 3DUSB 5T1LB 5GGVY 1N0XL 1DQDH 3H3PL 4JREC 3FB7B 1KT2A 4BJLA 4HIEB 3UJTH 3K8MA 5EBMB 4PGBA 4PJ5B 3UCRA 1J1XL 4XC1H 4XP4L 1CFVH 2Y6SC 3C8DA 1OM3L 1JYVA 3SDAD 5DD5H 4K71C 1ACZA 5FIEA 1R3LB 3L6FB 5K33A 1IGJA 2FZ3A 4OIBA 2OTUA 4PJ7F 3HG1A 2R1YB 2YKLH 4OCNC 4OQTL 1BX2A 1MIML 2PN5A 3NIFF 3ARPA 1BLNB 3QWQB 4ELKA 5F3BA 4XRCA 3TA3A 5DC0A 4JQIL 3RRQA 3T1WA 4LASH 3MUJA 3TO2A 4EDXB 5ETUB 4PRDB 2IFFH 2BVOA 3LQAC 3MRBA 1N5AB 1WC7B 5JXEC 3VE0A 1C12B 5FAAA 2HFEA 3IDMB 2QJDA 4PGJA 2Q6WB 1E28A 5B38A 1CQYA 5C0CB 3IT8D 3HCVA 4KC3B 1L6ZA 3BIBX 5TE6H 3HZKA 3MGTB 4P9HL 5HD8D 4K8RL 2DQCL 3KXFD 2QR0A 4L4VB 4E41D 4NZDA 1D5XA 3P0GB 5DURB 1T1YB 2F5AL 1U8PA 2HFFA 3H9SB 3QEGL 4GRWH 3WIIL 1MFAH 1QP1A 4HIJA 4PJFF 5D2NE 4BFIA 3NZ8A 4JQVA 5DD0L 3UZEA 1A5FL 3CSYB 1DLFL 4U6VH 3CDFA 3CDGB 3PWNA 2WSKA 1EGJH 3TIDB 2HJLA 1NFIB 3MODL 3O3DA 5A2KH 4LPWA 4S1DC 3C60B 4OZHA 1OT2A 3CZFA 4OTXL 1EFXD 1E27B 1Z5LB 4K3DH 1P2CA 1YNLH 5HY9A 3FTGB 4MXWL 1U8HA 3TM6A 3ES6B 4N1HB 1CLOH 4NN7C 5GGUA 5BO1H 7FABH 4N0RA 3O6FD 4QHUB 3SDCD 2GK2A 2IEPA 3AB0B 3CH1A 3QIUD 5EUOE 2MWCA 3UTSE 3AU1A 1VEMA 1UACL 2AJYH 1Q72H 4F3FA 3IDYC 4MCZA 4K7PH 2DLGA 2GY5A 4OFDA 1A9EA 5DUPH 3TYGH 3ZKSD 4JFFB 2ARWA 5D5MA 2BVUA 4LDLB 5D6DC 4J3SA 3V95A 3KYKH 3QPQC 3QUMH 1MAMH 2P5EB 3CX5J 5H94A 5I1HH 1WBXB 3CFBB 1YN6A 3S35H 5EIVA 1D6EB 3P77A 2C9AA 4NWUL 4UQ2A 2JIXD 1NMBH 5T5FL 1ZA3A 1N8ZB 5KOMC 3D0LB 1OAUL 3KVQA 4DGYH 5D6CA 4NC2B 4QRQA 5C0FB 5BRZA 4GAJH 1I8MA 2VB5A 5H8DA 4CADB 5HSFA 1FPTH 1QACA 1TZIB 4Q6IB 4L5FH 5BV7H 3LKSB 5SV3A 5T1DH 5I1DB 3B5GA 2I07A 3OKNB 4G6JH 2FLRT 2OL3A 3RY5A 4W81A 2YR3A 1MREH 3WXVH 5I76A 1XF4B 5GRVL 2VN7A 5EA0H 1XF5B 2IH1A 3TA3C 3BO8B 4Z77A 3QDHA 3KPNB 1QSEE 1TJIL 5CMAB 2J4WL 1EVUA 1MJ8L 3QUMB 4NQDD 3TIEA 4YX2L 1FVCA 5JDJA 4LKXB 2ZG2A 3AXLA 1A4JB 3RI5F 3M17B 4LCCA 1BFVL 3TBYA 4G6KL 4ODUB 2XZQL 1QUNA 5MP6L 5D1XB 4EI5C 3D6GA 5DXWA 5JW3H 3LKQB 3MRHB 1K4DB 3W9DA 5EO9B 1QR1A 2EIEA 3K3QA 5HHOD 1HIML 4ONFH 3BIKB 2XWTB 4K9EL 4DKAA 5ID0B 1M6OB 5KAQF 4HPOH 1LEIB 3RNQA 4FZEL 1Y18A 5DK2B 1VADA 3ZKMD 2PO6B 1ZANH 1S7XB 1IC7H 1IZJA 2V5YA 4IBLT 3TBWA 2GTZA 4JHBA 4P5MB 4WI2A 2XZAL 3MC0A 1T22A 1HDMA 5DJDA 4KDVA 2YXFA 3RVXC 2WK2A 4OFKA 3V5KA 3EOAA 4TULH 3UTPE 3WO3B 1ADQH 1Z3GL 3VFMB 3BE1L 1JV5B 2DJSA 1B3JA 2JF1A 1JZ2A 1NDMA 4M9OA 4OCXL 5LXGH 5KVDL 1U9KA 5DVOA 4HF5H 1F02I 5FM4A 3ARED 5FK9A 3SY0A 1UVQB 4R26H 1EDQA 4KKAD 1BZQK 3I84A 4H20L 1OLLA 3VGGA 2I60L 1G7JB 3LB6D 4GRMB 4WWKA 4OLYL 5K9OB 2ERJB 4BQ9A 4WI5A 1INDH 4X9BA 1MWAL 3D18A 4PRPD 4HKJB 1EVTC 1IM9A 4TTGA 2DD8L 4WGVB 4GMTL 3TWCH 3T0ED 5MEQA 1SY6A 3RIFF 3CFJB 3LKPA 3HTLX 4MZ2A 1NH6A 3V6FA 4HJ0D 3OAUL 4GBXA 2XZCL 2WBWB 4MYWB 1EHLH 2P43B 5C0DA 3D85A 3REWA 5C6WH 1RFDL 4DZ8A 1FRGH 2BDNH 4HJJL 4RFNC 4OZIF 4NUGH 2LAAA 5IROA 3MO1B 1MUJB 2ZOLA 2X44D 5EBWA 4QT5B 1GC1L 3IFPB 4TYUA 2O5ZL 3QJFB 3MV9E 3DI2B 4Z7WF 1X6LA 1KPUA 1KBGH 1EUTA 4NFDA 2NX5B 4Z7VE 3WFBL 2Z92A 4I77H 5A16A 5ALBH 5LWYH 3D69A 1A6WH 4PJHE 5C0IA 4YGAB 5KVMC 3G6JB 3OXSB 3OX8A 1FSKB 3VG9B 5EU4A 3DROA 5CUSH 2XWJB 1RJZA 1RUML 3GMMA 4XHQA 1FZOB 1JWUA 4ZAKA 3UPAA 2VZOA 4I8DA 3VRJB 4LCCC 3V5DA 1BZ7B 3VXSE 4JRWA 3VXMD 5IQ7H 5D2NA 3GMPA 1JF1B 3CMOL 2R9HD 3BKJL 4HS3B 5L2KE 5DMIH 4JFDD 1KIRA 4NQCD 1YYLL 2D9QB 4L4TD 4N8CH 3W9EA 3C08H 3B9KB 5SWSB 4JJHA 1A1OA 1DBBL 5EIIB 4YBHA 3S37H 4IHOA 1JNHA 4W68A 3UDWA 4A2LA 1P1ZB 3ULUF 2W91A 2AABH 2KH2B 3EDDA 5EOCH 3QO0A 2BOCB 4U1GC 4LSQL 5HVFB 3AROA 2VRAA 1NC4A 4ODXB 3GI8L 1AO7B 1RULH 5JORA 4DW2L 1XMWA 2ADIA 4MZ3A 4KPHH 5JOEA 4M7LH 5EUOA 2D03H 4YFLF 4HS8L 1DLHA 3N1FC 4XP9H 1HKFA 5FGCE 2X89A 4NHCL 3T09A 3QHZL 8FABA 1KPVB 5IESL 2ZUYA 4ALAH 1PZUB 1Q0YL 5E99L 4PTUA 2R8SL 3D39B 3MJ8B 3CXDH 5IT2L 4MAYC 4LQ1A 3D0VA 1T83C 4WUUB 4A6YA 4OD3L 4NWTL 2OTWB 5B3NA 3PHOB 3G6DH 1LP9B 4HKZA 3LOWA 3D1MC 4FP8L 2DTMH 3C6LA 5TQ0H 3FB6A 2GI7A 2G2RB 4YC2B 5IJKA 4N0YL 1FFQA 2XQBH 2CRIA 4JANB 3VD4A 1ED3B 2VLLB 4AIXA 4MSWB 4RFEA 1NUGA 2C1PB 1YC7A 5I74C 3QNYB 3JV0A 5FGSA 2MHAA 3IRPX 1TJGH 2J5LC 4NZUL 5FYLE 1F97A 4GBXC 4LPXA 5I8OL 4LCYA 5IVXE 2V17L 3ZL4H 1XCQA 5FDYA 3F8UB 5BV7L 3KLAA 4QRSA 4PR5A 1VFBA 4HG4J 5GISH 1FFRA 3V4UH 4PV9A 1RURL 3QWOA 1NGPH 1OD7A 3NIGE 3LS4H 1QSEA 1I8IA 4NO0A 1KYOK 4OLVH 4Y5VA 5LCVL 1MLBB 1JPTL 5CJBA 2D7MA 1FCCA 1V3JA 5CEZH 4DN3H 4HLJA 4LCUB 5EU3A 1KTLA 3WO4B 4EQ3A 5J1AB 1G9MC 3O11A 4JO1L 1FN4B 3OJMB 5F88B 1NEUA 2YD1A 3NIDE 3VXRD 3CZJA 5EU5A 3HPJA 3VFWA 4Y5XA 4KAQH 4YDVA 1P4LA 4LHQB 1M05B 1N6UA 4ZAKC 3UYRL 3L9RB 3GJEB 2DF3A 5B39B 4AH2B 2B8OT 2K9UA 2A9NL 3MRNB 5D2NC 3UROR 3JWDH 5I30L 3BFOA 1OW0A 2GAZB 3FZUC 2EZ0C 4AG4L 1S7RB 4TUOB 3IGAB 1CLCA 4GAYA 4NHUA 1MJUH 4YWGH 5KS9B 2V5RA 2XTJE 4U6YA 5FYJE 4N0UE 3L3DB 1HYSD 2XWBB 1QFWL 1QO3B 2IMMA 3UDWC 1UEMA 2WBKA 4G8GE 2VR5A 4MA3B 2AJSH 1XIWB 4HWZA 2VDOL 4D9LL 3P73B 1S9YB 3PGDA 2HH0L 3VFSA 3RPIA 5DK0A 3TH4T 3MRJB 2DM3A 4JFQB 2VLJE 1NAMB 4ZODA 5GHWH 4TNVK 3VXQB 4J6RL 2GEEA 2O26U 2DIAA 4HKXA 2FATH 2MFNA 3MXWH 1IBGL 1MJ7H 4RA0C 1EJ6A 3T2OA 4PTTA 2GSIB 3VRLE 1CTNA 1I9RH 1TENA 5HHPB 3CMGA 3MRLB 1WIPA 4LSRL 4LVHB 4EUPH 1X5HA 1DE4A 1L0QA 4LU5L 4N8PA 3DARA 3Q2CA 2X1WL 3MRFA 2Z8VC 3GJFH 1ZGLM 1XGYL 5A3IC 4OFIA 1FIGL 3O45A 1JN6A 4JVUA 4DUXA 1GZQA 4D8PB 4MJIE 1X5JA 1S9VB 4B41A 5GSVB 3C6LC 4ZO9A 2R0WH 2PXYA 3RVTC 1PKQB 3G5YB 4FXKB 1KLGB 2YC1B 2ZCLH 1A1NB 1EJOL 1X5GA 3MV9A 1P69B 2EH7L 3MNVB 1OP9A 3CFCH 2VDKH 4CL7A 4ETQA 5GZNC 4YLQT 1KEML 4L8BA 3KGRA 3WFCL 1BQHA 2BNQD 4Z7VA 1HXYB 1B4JH 4XMKH 4N90D 15C8H 3VGEA 1FGNH 2R2HB 5FUZH 4KRMB 4K3EL 5L9DL 4EUPB 4PJHA 4YUEH 2RCSL 5L2JA 3OPZL 1FC1A 4XNMA 4NQVB 1WZLA 3GJFB 4Y5VC 3CFDA 1E4XI 4UV4H 4TVPL 3ARUA 3VXSA 1AH1A 1HZHL 3S96A 4P2RD 2JLLA 2ZCHL 4G6AC 1YMMD 2A6IB 5DUMH 5D7JA 5L2KA 4HAGA 3SKNA 2DLHA 4QWWD 3AY4A 2HKHL 5F7YC 4Y5XC 4XNYH 1QSZA 1VACA 5FYKD 1A7OL 1WQVT 3IB4A 1LO5A 4PRNB 5TJWK 5GS2D 4Y16A 5DMJB 4L29B 4BKLA 3BD5A 5JXAL 1UZ8B 4IMLB 3VXUD 2X4RB 4HQQL 1D5MB 2NYYC 4K94C 1HHIA 4ZYKB 1FAIL 4GRLA 2CR6A 3VA2C 4ZUUB 3WIHH 3QIBB 3IRZA 4JDTL 1N7ML 1P7QD 3MJ9L 1PG7L 1LHZA 1JGLH 4PG9A 1F4AA 1VGKA 5TF1L 4CKVX 3DXAD 2Y7QB 2GSGA 1A2YA 4LOUD 2XFXB 2A6KB 4JE4B 2E7CA 2W59A 3BMVA 1RVFL 4HPYH 5DJYA 2MQ3A 3VXNA 4LLYA 3UYOD 5I1CL 4KRPC 1T6VN 1NBVH 1OARL 1XGQA 4WHTA 5E0QA 3MA9L 5E95B 5B39G 4G7YL 1JZ8A 4IOFD 3INUL 3FQNA 3UBXB 1KC5L 4ZFGH 4E0RB 4NUJB 2IAMD 1BGXL 1E4WH 4ZD3H 3IDIA 4LMQE 3T77B 3P9MA 4KJWD 5I8EB 4GG8A 4NNPH 5CEXA 2VXUH 4DCQB 5CSZA 5I1JH 5EU6E 3M1BA 1WZMA 2OR9H 1DQLL 3P0VL 3G5XA 1KV3A 1AD9B 5IVXA 1OTTC 2IADB 1IJ9A 4ACPA 2PXYC 1PFCA 3QXDA 4AZ8A 1MCOL 2Y72A 4J3OC 4NQED 4G3YH 4WU7A 3H7BB 1XR8B 1ZK9A 2NNAA 1MJJA 3QNZA 2GITB 3AC0A 4PFEA 3CFEB 5EPMA 4NJ9L 2ZUQC 3VDAA 3PNWA 4GW5B 4TSCH 4KMLB 4KK6C 4F9PA 1OF2A 3TBSA 4H1LA 1QFUL 4U05A 5FCSH 1AIFA 3DURB 5K9QG 2D7OA 3RNKA 5J3HC 5C08E 3B2UC 3PUCA 4M3KB 5E2UL 1DBAH 4LVEA 1YY8B 3LAFA 4XP6L 1KN4H 1U93A 1VFUA 2WIIB 3LD8C 1UWXH 4JDVB 1NGYA 1XZ0B 4XBEH 3T65A 5IOPB 3VW3L 3VXPA 4HSQA 3RWIA 4OZGB 4O58L 1HKLH 1N5YL 4D0CA 3BX7C 3GSUB 1VA9A 3NACH 5D7JC 2N1KA 2I9TB 3MMEA 1C7TA 2WANA 1MHHA 1TZGL 1BJ1H 1PEWA 4X6EA 1JP5A 3BP4B 4KRLB 4N0UA 4NP4H 3RVVD 2WBJB 4G8GA 5ESVA 3PGCA 2XA3A 3QQ4B 2W0LA 1S9XB 4Y16C 4F58L 4EUPG 3OG4B 1F4YH 1ZKAA 4PJXF 2BY0A 4I0CC 4JEGB 3VGHA 2V5MA 1FLRL 2MQ0A 4P49A 3M07A 3E6FB 4LGPB 4GRLC 5C7XH 3DRTB 2VLJA 4POZC 1K4CA 1MQKH 4C56E 4PY8J 1FL3B 5BXFA 1ZLSH 5CILL 3IAQA 2BMKA 5D71L 1K6QH 1RPQA 4Q6YA 3DRQB 4HJGA 1ZA6B 1RIUL 2BFVH 3L3OA 3MRKA 3QDGE 1VHPA 4P2OB 4OCWL 5F9AC 3ZYJA 1A9BA 1J0JA 2FX8L 4K2UH 1M7IA 4LCWE 4CMMB 3U9UA 2VAJA 5JLZB 1WITA 5I9QC 3BP5B 4L4VE 4MJIA 1ACYL 4HK0A 5E00A 1P4BL 2DQHL 2XT1B 3HRPA 3V4VL 3O9WA 2X7LB 4I0PB 3KNBB 3KPLA 5I1KH 4RGND 5E6IB 3G9VA 3HE6B 4R8WH 3QISA 1G9NH 4LVOC 4P23B 1QG3A 3F65A 1PZ5B 2NY6B 3CFKA 4OZIB 1G1CA 1I8KB 3LDBC 4G8IB 3EBAA 1V7NH 3V6ZA 3FQRA 1CZ8L 3HHRB 5SWZD 4MA8H 4Z7WB 4JZNA 1F2QA 2EDYA 5IMOA 2NY4C 3BWAA 3QUXA 3RU8H 4NDMB 5DRXB 4OGYH 2OZ4H 3UBXG 5DHVA 3TJHC 4HK3J 2VDPH 4F9PC 4UUJB 4XPTL 1XFPA 4Y4FD 1YJDH 1HQRB 3IU3B 4I3SH 1MI5B 5E1AA 3OJ2C 4AEHL 3RDTB 4MXVF 3DMMB 4XNZB 4GRWE 1IGFL 4V1DB 3MXVH 2CDFA 1BVLA 2DM4A 3TN0D 3O0RL 4O2FA 1IKFH 1BM3H 1E4JA 2HTKC 1HI6B 5D1QB 3DSFL 3WFEH 1NGQH 5LGHL 1NGZA 3DVNB 3OTTA 3LEYL 5JW4N 3P11L 3RI5K 35C8H 3FONB 2H6PB 1HWGB 1UJTA 1XGRA 1T7XA 4D2NA 3GKWH 4G6ML 4P4KB 5B8CB 4J12A 4PJ5D 3UEZA 2DQIH 3W0WB 2XTJC 1YEJL 5I1IH 3I6LE 2I5YL 3DETC 3HAEA 1AHWB 1Y6NR 3BHBA 4ENED 3G5VB 3C09B 4RZCB 4TNWF 2GT9A 5H37H 4G8EB 3DO7A 2OQJB 3OR7B 5CGTA 4JN2A 5JMOC 2X4QB 3IKCB 4YZFE 1R24A 5CEYA 1XGPA 4IRJB 4MJ6A 3BZFA 43CAA 4I3RL 4GW4A 3H42H 5CJOL 1HILA 5DMGD 5JR1H 5LVEA 2ITCA 1T5XA 2W9LA 3QCUL 5F7HA 4KWUA 4IDJH 4EXKA 5IG7B 3ZO0A 5F70A 3R1GH 3UAJC 4HFWB 1CL7I 1PVHA 5KN5B 3AMLA 1N0XH 4NYLB 3H3PH 5EU6A 1T3FA 5KSUA 2J6EA 4F15B 3FT3B 4F7CB 5DJAA 4LAJH 2QLVB 4FZ8L 4HFUL 4N0FB 1J1XH 5DD3L 4XP4H 3TBTB 5C3LD 4IMKA 5C0CD 3VWJB 4B50A 4KGJA 1N26A 3FQWA 3JV5A 1PKOA 1OM3H 4P57B 1REIA 1Z9LA 4U2YA 2N56A 5DURD 2CGRL 2HFGL 3H9SD 5IGXL 4MCYB 4XZUA 5EORL 2Q76A 1SJHA 5C0EA 2EXWC 5FB8B 2GJZB 4OQTH 1TJHL 1MIMH 4WCYL 1Z2KA 2BNUA 5DWUL 1I3UA 2YD6A 1A4KA 5EIQA 4W4OC 3BWUC 5C08A 2LTQB 3ARDB 5D72L 3GSWA 3NPSC 4HC1A 1M4KA 1MCDA 3QUXC 2FGZA 5T1LA 1FVDA 5IB5B 5HPMB 2R4RL 2HFTA 1KLUB 1DBJL 3Q0HA 5EBMA 3DYOA 4KROD 1A8JH 4Y5YA 2FEEL 3MFFA 2EEDA 3PXJA 4XC3L 3VJ6B 2NY2D 3E3QC 4KUCF 3WUZA 5HI5D 1SY6L 5MEPA 3QXAA 3HE7B 4P9HH 3S97C 3VRIB 4K8RH 5FO9B 2DQCH 3OKYA 5F3HB 3FT4A 4HXAH 4J2XA 3WDHA 3SCMB 4PRID 4JFFD 1FZJB 2PETA 2F5AH 4YBLB 3QEGH 3SDDA 3WIIH 2F54B 4LVNC 1BZ9B 4MNQB 4X0KA 4HWBA 3QUZD 5DD0H 4M02A 4WIQA 4LGRB 1A5FH 4ZTPL 2L4OA 1DLFH 1IFHH 2VE6A 4C56A 5ETUA 3CU7A 1JVKA 3IKKA 3MLSL 5FF6B 1KENL 1Y6MR 1JWSB 2J8UF 2UV3A 4U49A 1WC7A 4YFDB 2D0FA 3MODH 4UU9B 3T2PA 5FV1L 4OTXH 5I71B 4HUWB 4FQXB 1G9ML 2FH6A 5CGYD 5AWNL 4EVNB 1H3GA 3IDMA 3QDGA 2OR8A 1BOGA 4MXWH 5E9DB 4YDJB 2Q6WA 2C3VA 1UQSB 4OCSL 2YXMA 3O4LB 2AV7A 2R0KL 4NBXB 5ILTL 2K1MA 4LCWA 1DDHB 3GSRA 3AMKA 4LPYA 1WVZA 4L4VA 1UACH 2HLFD 1AKJA 1UYWL 5C0AB 5CBEA 5TDOB 4UZGA 1BD2B 5I17B 1ES0B 4FQHB 1T66C 2HT4D 5ACLA 3T3ME 3B6SB 4UILL 3CSYA 5IB2A 1YDPB 1F00I 3CDGA 4NWUH 4OLZL 1HCVA 5T5FH 1I8LA 1T7ZA 2AEWA 2X70B 4OM0L 3QUYD 4IMKC 5TE4L 4MQXD 1OAUH 1DEDA 1BQLL 2CDEA 3ZDXF 1Q94A 2EDTA 3FRPA 5INDB 1H8SA 4H25B 1YEKL 5EZLA 1E27A 1KIQA 1CFNB 3ES6A 4EKXA 2QQNL 4F33A 4JFHE 4OV5A 2ICWJ 4OBSA 3DLQR 2E8ZA 3BDYL 2A6DB 3DGGB 2PO6D 5K59F 3MZTA 3HS0A 5FFLA 5TFSL 2CIIA 5C2BL 3RY6A 1WLHA 4DQOL 4MA1B 1FFOA 1TQCC 3HPLA 3GSQB 1TPXC 3I6GA 5FHBH 1FC2D 2JCCE 1TJIH 2J4WH 1T04B 3PV6B 1MJ8H 3DX9B 2NY1C 3V0AC 4YX2H 4PP2B 5H37G 5HHXL 1CFBA 3D25B 3ARXA 1L9MA 1EGJA 4LARL 1BFVH 2UWEE 4G6KH 4YQXL 2XZQH 5EC1A 3BH9B 3FFCB 4E5XB 5MP6H 4S1RL 2JJTA 3U46A 2X4PA 1A6ZB 2DDQL 3VD5A 3PHSA 4N5ED 1TZIA 2N4IA 4Q6IA 3TBVB 5K9QI 5JOPD 4GKNB 5LBSL 1HIMH 1OGTA 3ULVD 4JFYA 5A2JH 4K9EH 3W5NA 3ECBB 5HDOA 3JWNC 4D3CL 1U92B 3SDDC 4PLOB 3VCLA 5CP7A 5EOCJ 1HHKA 1TNNA 1LD9A 3EYVA 4PJAE 5FOBB 2XZAH 1FNLA 3BO8A 4X9HA 2L7JA 5FDWB 2VQ1A 3QUMA 1Z9OA 3TZVB 3GMLA 4LKXA 1BQUA 2WWKT 1KG0A 3WNMA 2EDWA 2BJML 4HH9B 1Z3GH 3P2TA 3BE1H 3M17A 1PD6A 1YMHA 2O5XL 1U8OB 5D1XA 3BH8B 1MCLA 5KVDH 4R9HA 3EYUL 1IVLA 4KK8D 4OAWA 1WAAE 2VLKB 4U3HA 5D9SA 3K74B 1K4DA 3G5ZA 4P3WA 4S2SA 4ZO7A 4AEIL 5C07E 2NX5D 2IJ0C 4H20H 2I60H 3MRRB 3RTQB 4FQ2L 4KJQD 3BIKA 4OLYH 1KJMB 2XWTA 2IPUK 1G6VK 1R3JA 2A74A 3BIAX 2M1KA 5ID0A 3EFFB 3B3IA 1MWAH 4K94L 4LSDA 1VPOL 1HHGB 4Y89A 5IM7B 5LJYH 1S7XA 2DD8H 4GMTH 4BH7B 3QWRA 3PQYB 4LPVA 5FGBA 5KVGL 1AGFA 3OR6B 1JGUL 2YPKB 5D7IE 3WFHB 1CQKA 3KYMA 3OAUH 4M8VA 2XZCH 3QNXA 1JBJA 4ZFZA 1I8LC 5D7KD 1RFDH 2AQ1A 4HJJH 3F7YA 5CEZE 1U8KB 4LCIL 3B9KD 5D7LD 4AIZA 3BUTA 4YHPA 2L0DA 2XKUA 2CIKA 1GC1H 1QBAA 3KHOA 1V5JA 2NTFA 2R1XA 3VI3F 1A6UL 2O5ZH 4F80A 4NM8L 2DM2A 1KB9J 4L3EB 1FQ9C 3VXME 4GQ9L 2AERT 4OKDA 2LABA 1QHPA 1V3KA 1WICA 4GRMA 1I1YA 3WFBH 1SHMA 3C9NA 3RY6C 1AO7D 5M94B 4PGCB 5D8JL 1U95B 5HVHC 5KSAB 1OAXL 1EPFA 1VFMA 1DVFA 3HR6A 4QEGA 4RWYL 4M6NL 4F2MA 5L8KB 3QQNA 2HVKA 1RUMH 4KXZI 3BW9A 3Q3GA 3TT1L 2YZ1A 2ADJB 4PRHB 1YA5A 3D39D 1JF6A 3MO1A 3CMOH 1JPST 3BKJH 3KYNB 4WUUD 1LDPL 3EYSL 1ITCA 4RMRA 2QSVA 4NBYB 2Z91B 4QT5A 5DMKB 1WBZA 4MB4A 5F7NC 1I1AC 1YYLH 3HI1A 3IFPA 3N9GL 1FNFA 3T0DA 1DBBH 2H32B 3QJFA 4P3DA 2YD9A 4PJXB 4L1DA 1MF2L 4G43A 4ETYA 4LSTL 3O81A 4JN1L 3WKML 5ID1A 3HNVL 2KL6A 3P30L 2Y06L 4G5ZL 4LSQH 1G6RL 4OCYL 3U48A 1JTTA 3GI8H 3LEVL 5JA9A 3U9PL 4R0LB 5DA0B 3RWCB 2UYLA 4DW2H 2JIXA 5IR1B 5EOTB 1RUPL 4U6HA 1M7DB 2CD0A 4I1NB 1EUUA 3NGBB 4HS8H 5GRVK 1MCSA 4CVXB 5E8OA 3JTSA 2N7BA 1QYGL 4J8RA 2Z8RA 2YZ8A 3FO2A 4NHCH 3SDAC 4JGUA 3VRJA 5B3JE 3TH2T 1BZ7A 2NR6D 3QHZH 2JB5L 2Q8BL 2J2ZA 5IESH 1U8IB 5IW1B 2HVJA 4ZO6A 3ZE2E 1JF1A 3MX0A 3DVGB 1Q0YH 1R6VA 5E99H 5GGTL 2R8SH 4M00A 2WLYA 4UAOC 3O8XB 5IT2H 3DBXA 2JK5A 3GSNA 1TQBC 2VDRH 1GGYA 1BFOB 2ICWA 4NWTH 3BAEL 4OD3H 3LKOA 3VH8B 2EKSB 1BIIB 5DT1L 4G80A 4FP8H 1JPGA 4JZJA 2X5PA 4UNUA 5IK3A 2X4TA 1P1ZA 1VFAB 4NO2B 2AXFB 4IIQB 4N0YH 4IRZL 5HYJB 3LRGA 4GQPH 5F6HJ 3HZVA 4YHYC 1J88A 3QG6A 2XN9D 4OIAA 5FGBC 3RPKA 1NMCB 5CD5C 4KHTL 4NZUH 5AD0A 1MCEA 4WFFD 5I8OH 4QYOB 5LKNA 1ZWIB 2WWMD 2V17H 3LSOB 3VWKA 5JQ6H 1D5IL 1TFHA 5ISZB 4KI5E 4X6FB 2NW3A 1CDYA 3IJSB 2VXTL 4I9WD 2H8PB 5HD8C 5CJXC 4HS6B 1RURH 3TNNA 5BZWA 5LGKA 4R4ND 1NLBL 1A7NL 2JCCA 4AEEA 5E94A 5ACZB 3UC0L 4Z6AT 3VFTB 4YAQA 1KEGL 2C3GA 5LCVH 3ZDYE 1XIWD 1JPTH 1P84J 1QFWM 5C0JB 3BGFB 3QUKB 4X5WB 2OTWA 1IC4L 4HV8A 2UWEA 4X4ME 3QHFL 3DIFB 2Z4QB 5HYSB 4JR9L 2HYMA 3BZEA 3PL6B 3VI4E 3IXAB 1WV7T 4NKDA 4JO1H 4AMKL 2VLLA 1DVFC 1JYNA 3T04D 4LBEB 2CKBA 4JVPA 2C1PA 2V7NB 3W5MA 3WIFA 4YK4B 2XPGA 3UYRH 4PJ9B 1ZGLP 3GMOA 1FV1B 3KPRE 4N9OB 2A9NH 2V7HB 2VYRE 4KKBD 4G6FD 5I30H 3RX5A 3KPSB 4AG4H 1S9WA 3SDCC 5AZ2L 4JY6A 1U8MB 2QKIB 4PJAA 5DHYB 4APQD 3BQUA 1HHHB 3K81A 4CAGA 5CKGA 2DKUA 1IGIL 2EDNA 4M7KL 4R7NB 4GAFB 4H5SA 3QQ9D 1QFWH 3P4NA 4C83A 1ZT7A 2VDOH 4D9LH 3RA7L 5F6IB 3DSNA 1A7RL 4NRYB 5JHDB 2HH0H 5F1NB 4ZFFA 4HGKC 3UJJL 5J1AA 4U1SB 1SJEB 3CIQA 4LLVB 1WAAA 2BZDA 2EDFA 3OB0H 3ARGD 5I6XC 1FYTE 5C07A 1CD9B 5ITFA 1NCDL 4K23L 5JPMB 4M6ML 1NCAL 3I6KB 3CCHB 3SGJA 1JWMA 1IBGH 1QSFE 4G9FE 3MV8B 1JZ4A 3GJEA 2ZSWB 2NY5C 3HMWL 4LSRH 1YEIL 4OZGE 4HUUA 4NN6B 1NPUA 3UZVB 4LU5H 5IIEA 1HH9B 3EZ8A 4TUOA 3IGAA 4Z7UE 4DVBA 1HE7A 1XGYH 3C87A 1FIGH 3MROA 5D7IA 5CP3H 4GXUN 4OUUB 2AJ3B 3B43A 4N90E 1UC6A 1QO3A 1P7HL 5FGRA 3SE3C 5DEGB 4LHJB 1C1EL 3GO1L 3MV7D 3L5WA 3I2CL 4EI6B 4OD1L 2NY3D 3MRJA 3S6CA 5B22A 1EJOH 5ESQB 1H3WM 2EH7H 5CHNB 5GRUL 2G5BB 5HHMB 1NGWB 2WWKO 3VXMA 3VXQA 1KEMH 3VWKC 1F4XL 1RK0B 3WFCH 2YMXL 4GFTB 1QNZL 3FO1B 1NFDE 2EDEA 1S7TB 2CQVA 3QIBD 1NQBA 2GSIA 2V9RA 1UJ3B 5L9DH 4FFWC 4K3EH 4Z5RB 1PSKL 3MRLA 2RCSH 4QY8B 3OPZH 2AXHA 3VH8G 1R5VB 4QOKE 1TLKA 3Q1SL 1X5XA 5ABDE 2F53B 2GHWB 3VXUE 4TVPH 3PWUB 1HEZB 1S9VA 1HZHH 3WXWL 1U41A 5IQ9A 2ZCHH 5T5NF 2UY6A 5DJ6B 1X4ZA 1XCTA 1YEEL 3PF2A 1BWMA 3S36X 2D7QA 2I27N 1CICB 2HKHH 3G04B 5KBNC 1FVEA 3OXRB 2BNRD 1A7OH 3OKEA 4Y1AB 5BZDB 2MOVA 4EN3B 3QBTB 3PDOB 5F9JA 1OGAD 1S7SB 5JXAH 2ED7A 1S5HA 5EUOF 2EC9U 3D2UA 4HH8A 4HQQH 3X3FL 3AS0A 2I25N 1FAIH 4KKAC 4ZQKB 3BQUC 2J8UB 4BK5A 4YHLL 2XKNA 3PP3H 4L9DA 4TQEL 1MCJA 4JDTH 5TH2B 4DZBB 3GJFA 1I3GL 5HYSG 1CXFA 1PG7H 3EGSB 3MJ9H 3B8SA 3GSXA 4TNWK 2BOBA 1EK3A 4EBQL 1LWRA 5DYOA 3LZFL 5TF1H 2X9XA 5AYQA 1RZKC 1RVFH 5E56A 4HJ0C 4TRPL 4N0CD 2DYPD 3TCLB 5I1CH 1K8DA 3C5JB 1GZPA 1OARH 2PR4L 2V2TB 4RISL 2NQCA 2RHEA 3MA9H 4G7YH 4JY5L 3SGJC 4YJZL 3ESVF 3SE4A 1D6VL 5TGBB 3B9DA 3INUH 1KC5H 4QHKJ 2OJEB 1H0DA 4L29A 5BJTA 5J89A 1J8HD 2GQHA 1BGXH 1WEJL 5EBLA 3FFDA 1DCLA 4HUXA 3KG5A 4PREA 4YDLB 3ESUF 4ZUUA 1QFPA 4ERSL 1P4IL 2H9GB 1DQLH 4LDOB 5HGBA 3P0VH 5TE7L 2EO9A 1ZGLA 1MOEA 1MCWM 1EXUB 2ED9A 4ZFOL 1XF3B 3UTQB 4BM7A 2HMID 4JCLA 5FXCH 4KDTA 2EKJA 2P47B 1MCOH 2BCKB 3EO0B 2F74A 5CJ8A 5CCKL 2APWA 3REVB 5H2BB 2A6KA 5KG9B 3MLWL 1DQQA 4JPKL 5E70A 5MEOA 3QFDA 5T3ZL 4RX4A 4I18A 4NJ9H 3T4AB 2VZVA 1T0NB 3GRWH 5FV2A 5ICZA 3HZMA 1Q38A 3P4MB 1RUQL 2APBA 3NCJH 5DEFB 1QFUH 4X4MA 4J4PD 1GGUA 3WJLC 3UBXA 5C86A 4DOHB 1LEKA 4HIIA 3JXAA 3BP7A 5E2UH 4L8CB 3VGDA 1IKNA 3QQ3A 3WIHA 4XP6H 1UB6B 1KGCD 1QBML 2FIRT 1O0VA 2AVGA 4YIQB 3ILQD 2ZP0T 3HI5L 3KPRA 4P2OD 3VW3H 3E2HC 5CZKA 4O58H 4LLQA 3HZYA 1XGUB 1N5YH 1XEDA 1RIHL 3SJVB 2NY7L 4F37F 1RZJC 3AUVA 1CIDA 5IVOA 1TZGH 1T03L 3UTTB 4QHMA 4CVWA 3CFEA 2RR3A 3NPZB 2R56L 2FECL 1IZKA 3RVWD 5E6ID 3QULB 3IDYB 4F58H 4P23D 2QADC 5F7UA 4MNGE 1YPZB 3DURA 2NY6D 5J11C 1NLDL 1FLRH 5KSBB 5T1KD 2FEDD 1IQDA 3BEVB 3ME0A 4FMFA 1OQXA 1YUHA 4Z7NE 2ITDA 4JJ5B 1KT2B 1FYTA 4U1NA 3EYQD 4PGBB 1ZS8B 5CILH 3TESA 4QRPD 1UH2A 4NM4L 4XX1G 5D71H 1QSFA 4G9FA 3T0WA 5T3XD 1KTKE 1RIUH 3OJDB 4OZGA 4OCWH 1NBYA 1BHGA 2VL4A 2FX8H 4Z7UA 3TV3L 2I9TA 1PYWA 1IGJB 2FZ3B 1LO0L 1MI5D 2OTUB 2WUCL 3HG1B 3RDTD 1ACYH 3DMMD 2FD6L 1P4BH 1L7IL 2WBJA 3SE4C 3ARTA 2DQHH 3V4VH 4XPBL 1BX2B 4HWBL 4ELKB 2CUHA 1KTRL 1H3XA 5F3BB 3TA3B 4Z7VF 5D1QD 4EZMA 3E6FA 3L5HA 3O41B 3U4BL 1EZVX 1Y0LB 2X4UA 4PJHF 2BHZA 4MX7A 3LH2L 1FL3A 4HKBA 4XP5L 1MPAL 1OTSC 1NFDA 3VE0B 1CZ8H 4P2QE 4EI5B 3PP3K 1ZA6A 3W0WD 3ULUD 1E28B 1FNSL 5ADOL 3HCVB 1PW3A 3MRCB 1N6VA 4OGXL 4I18C 2QR0B 2RB8A 3ARQA 4JO4L 4QOKA 5CS7A 3MOQA 1OB1B 4XPTH 4YHIA 4M1CD 3VXUA 1UFUA 1U8PB 2HFFB 3QO1A 4OLWL 4HIJB 4AEHH 5C0AE 1ZHLA 3V7MA 2X7LA 4BFIB 4I0PA 2ESVE 1IGFH 3NZ8B 3HE6A 3O0RH 2VZSA 1P7QA 4QGYA 3LRSA 1HYSC 5CJQL 4PLJD 5C6PB 2RFXB 1PZ5A 1IKNC 2A2QT 1QPXA 2IFFL 3CXHJ 3PWNB 4QF1A 1V8HA 3DSFH 1YY9D 5LGHH 1I8KA 2HJLB 3LEYH 5M7QA 3O3DB 4BH8B 3EHBC 4OZHB 3CZFB 1J11A 2AJUL 3RGVA 1GGCL 5HI3D 1P2CB 5HY9B 1CDCA 1GXEA 1U8HB 4G6MH 5CZVL 2UZIL 1YEDA 4Y88A 1YEJH 2I5YH 4ZXBD 3CH1B 4E42A 4U1HA 2FX7L 3VWJD 1T0PB 3AU1B 5JMRA 4ZS6D 1T7WA 4FFVC 4MCZB 2WQ8A 3EOBA 1A9EB 4XPAL 3SQOL 1C7SA 3KYOA 5D5MB 4HAFA 4RFOL 1ERNA 6CGTA 3UTOA 4I3RH 5CJOH 1OWRM 2EDQA 4G7VL 5C0BD 1AGEB 1HHJA 5H94B 2QSTA 4UQ2B 3P77B 3QCUH 1O7SA 1JCKA 3HNTL 3RZCD 3ARDD 5FCUL 4RFNB 5D6CB 5IVXF 3LKRA 2HN7A 1NUNB 1XH3B 1EERB 4P4KA 1SVCP 1OOAA 1F6FB 2F5BL 3NIGF 2I07B 2RGSA 1AHWA 1IMHC 4FZ8H 4HFUH 4TPRL 2OL3B 4RZCA 2OZ4A 4GG6E 5DD3H 4IRSD 4Y4HA 4Q9QL 4W6WB 4G8EA 4IJ3C 3HE7D 1H3TA 1U2HA 1S7VA 1D9KA 2BHYA 2IH1B 4C57C 4HWUA 2H3NA 4Z77B 4IRJA 4Z78A 2F19L 3SCMD 5I2IB 1F4WL 2CGRH 3TIEB 3U2SA 1FVCB 2FJFA 2HFGH 5IGXH 2RJMA 5EORH 2VZTA 2ICCA 3AXLB 3FL7A 3Q48A 3NIDF 4LCCB 4MNQD 3TBYB 1TJHH 2EIBA 4WCYH 5DWUH 2W9DL 4OD2A 4QWWC 3SHSA 4X4YA 5D72H 1NAKL 4MDJA 2VDNL 5E4IA 5KN5A 4OJFL 1M1SA 3W9DB 4PRIE 1QR1B 4PJEE 1MCHA 5F89A 2R4RH 2DMKA 3FT3A 1DBJH 4FQXD 25C8L 4N0FA 5E9DD 1B0RA 3TBTA 3RNQB 1Y18B 2FSEA 1VADB 3GB7A 3O4LD 3QDJE 4XC3H 5LAXA 3ARSA 2HKFL 5EO1A 1A1MB 2GTZB 3TBWB 1SY6H 4CGTA 3K1KC 1JGVL 3VFNB 3V0WL 1T22B 1HDMB 3PQYE 2B1AL 3ZYOA 1PEZA 5E2WL 1PAMA 3V5KB 2V5TA 1BD2D 1FL6B 2I26N 4LOUC 4OLUL 3H3BC 3WSQL 4MNGA 2GJZA 2R2BA 3RGVC 1KB5A 1RUAL 2A0LD 4LNRB 4P4RB 1CLZL 1JTPA 1II4E 3MTRA 4ZTPH 3VRLF 4RMSA 1A6PA 3IU4L 4PY7B 1F2XK 3SY0B 5IB5A 2AP2A 4OQ1A 1KENH 5FYKU 2HT3D 1J0HA 4XAKE 1WZKA 4KV5E 4KJWC 3D87B 4AT6A 1G9MH 4LLUB 4UDUB 5CZXC 5E6YA 5FUOL 2C7UB 3VJ6A 3L5XL 5MEQB 2QSCL 4OCSH 3U79A 3SE9L 3LKPB 2R0KH 5I74B 4R90L 4X6DE 5ILTH 1KPRA 3IDJB 1UWEL 3VRIA 9CGTA 2J5LB 3V6FB 4GBXB 4LEOB 4OZFH 1DN0A 1ZHNB 4JVWA 5SWZA 1UYWH 3REWB 1FZJA 4DZ8B 4TTDD 4KZEL 4XVUD 1HNGA 4PRHE 1FDLL 4OQTA 3V8OA 2ZOLB 2IQAA 3U0PA 4TVSa 5EBWB 1BZ9A 4UILH 3BISA 1EA9C 4Y4FA 4N8VG 4KJPD 1KPUB 2VZ3A 4OLZH 3ROOA 5DJZB 4FQJL 5MENE 4C58B 4OM0H 4PV8A 5TE4H 4Y4HC 4P2QA 4P59L 3U83A 3BPOC 2ZUTA 4UDTA 3RBGA 1YEKH 1D9KC 3D69B 4MB3A 5EZIL 4EVNA 4YDJA 3OX8B 5HDQL 1W0VA 2QQNH 1RJZB 1DDHA 2AW2A 3BDYH 5KVFL 3GMMB 1JWUB 4ZAKB 3OZ9L 2EDDA 3V5DB 5TFSH 1IAMA 5JDSB 5C2BH 2NY5L 4WFED 5D2NB 4DQOH 5C0AA 3VD7A 4X99A 3QRFM 3GMPB 1J86A 2ESVA 3MYJA 1AFVL 4F8QA 5I17A 1S9KC 3I3BA 4P48A 1ES0A 5L0QC 5E4EC 5CIPH 1KIRB 3RVVC 1GGIL 3B6SA 3ZTNL 3LHPL 3EYOA 5HHQB 4AM0A 1A1OB 3GSNL 4POUB 5HHXH 2B0SL 2OI9C 1JNHB 1X5FA 1LK3L 2J7LA 2W9EL 4LARH 4YQXH 2X70A 3MLPA 3QO0B 4S1RH 1T2QL 2VLKD 1Q9WB 4H26A 3AAZA 4YXLL 1NC4B 3LV3A 4DFHA 2DDQH 3M8OL 5I75C 5E7FA 1KCVL 5JORB 3GM0A 1EO5A 2Q87A 1MH5A 4YR6A 4CBPA 5EUOB 5LBSH 5JIPA 4JFOB 2VH5L 1WIUA 4GXVL 4D3CH 4JO2L 3QR2A 5GPRA 4AK1A 2R1WB 1CR9L 4JRXE 5DD1L 3MREA 5IMKA 4LF3B 4ZDHB 5GS3A 4PTUB 2DJUA 5CIPB 3E1F1 1T04A 2YUXA 3PV6A 1ITBB 3FAXA 3D0VB 5J56B 4A6YB 4PP2A 4HKZB 4KK9D 4KTYA 2BJMH 4RGNC 1INQB 1R5WB 2BXZA 3C6LB 3FB6B 4B0MM 2IALA 4U1JA 5KTEL 2O5XH 3BH9A 4E5XA 2PTVA 4AQ1B 1WSST 3EYUH 4L3ED 4KRNA 5EUKA 2CKBL 3HB3C 2MHAB 5JW5A 4AEIH 5HHVL 5D7KE 1A0QL 1E6OL 3X14B 4FQ2H 1BVKA 2DBLL 1XCQB 4NOFA 4GG6A 5D2LE 2R4SL 3KLAB 4QRSB 5KSAD 3CSBA 4NQTA 5I66A 2NXZC 4PR5B 1MVUB 2GFBA 3QB7C 2W65A 3ELAT 3N85L 4K94H 1VPOH 1LILA 4PV9B 3OQ3B 3KPSE 3QWOB 3JUZA 2YRZA 1A21A 5FOBA 1QSEB 1I8IB 3HKFA 5KVGH 4NO0B 1JGUH 4Y5VB 3KLSA 4Y4FC 1KELL 1X7QA 4GKZB 2ZZUT 1Z0NA 3TZVA 1NCCL 4QXWA 4WI7A 3FN0L 4HDIA 2HRPL 3PHQA 3TN0C 3ZTJH 1RZKL 5EU3B 1KTLB 3AVEA 4RDQF 4LGSB 2OK0L 4LCIH 3O11B 4ZUTA 4WWID 3BH8A 2WP3T 4JFPA 2DMCA 4UOW1 1A6UH 5HI4D 4PRIA 1W8NA 1RJLA 4PJEA 1X6NA 1L4IA 4NM8H 3HPJB 3MR9A 4P9HC 3DYPA 4Y5XB 4Z0BL 5EU5B 3VFWB 3ZT7A 5ICYA 1P4LB 1H3VA 5ITBL 1HXMB 4GQ9H 1MY5A 2H2SD 3WLBA 2XG4A 1EHAA 1SYSA 5J13C 3QUZA 5DMYA 3MV8E 1HK6A 3QDAA 3QDJA 1ZEAL 3TH3T 5D8JH 3PWVA 1OAXH 4NHUB 4M7ZC 3KJ6L 3PQYA 4ENEC 3QP3A 4RWYH 5A43C 4M6NH 2YPKA 4I2XB 3A6OA 4XT1C 2VDML 1U6AL 3TT1H 4HWZB 3MUGA 5DMGC 1LDSA 3VFSB 3RPIB 3O8XD 5DK0B 1QOKA 2B2XL 3VFGL 1LDPH 1MCCA 3EYSH 5EC2B 4ZOCA 2Q8AL 2IBZY 3N9GH 4KRPB 4OZFG 4U2ZA 3IETB 5BS0E 1MF2H 4HKXB 4LSTH 5HYJD 4JN1H 4D9RD 4HUNB 3WKMH 1FAKT 2MCG1 5HDBF 3VG0L 1SBBA 3ZHKA 3HNVH 3CX5K 3P30H 4HMEA 4UTBL 2Y06H 1U8NB 4G5ZH 1G6RH 2BVYA 4OCYH 1MWAA 4NC0B 4WFGE 3LEVH 3U9PH 5T5NG 3MRFB 3WNNA 4X6DA 5ISZD 1RUPH 4FQIL 1JN6B 1GZQB 4TSAL 2FBJL 3LEXB 1QYGH 2YPLD 2F53E 2PXYB 1J0ZA 4DK3A 2JB5H 2Q8BH 4L9LA 4PRHA 3OAZH 4XX1E 3TPUA 1D3CA 3FOMB 4WJ5A 1RZJL 5GGTH 2E7BA 5DMKA 3MV9B 2B20A 4YEFA 5FM5O 4ETQB 3BAEH 4P9ML 2FHCA 1M71B 4R7DA 3SGEI 3PL6D 5MENA 1BQHB 5DT1H 3U4AA 4RRPA 1NANI 4Z7VB 4NZJA 3ARYA 4I0KA 4OF6A 4YNYB 4IRZH 3X13A 4NNXA 1SM3L 2R0ZL 3QEQB 5L2JB 5GZOC 4XNMB 2D4FA 4GRWF 3U7YL 2WAHA 1S5IL 4PJ9D 4KHTH 4KROC 3CFDB 3B9AA 5EOTA 2QQQA 1SYVB 2J8HA 1ZSDB 1D5IH 3LD8B 5F8RC 3VXSB 5BVPL 2NY2C 3S96B 1ZLUH 4TVPE 2VXTH 2CDGB 2DQEL 1J05A 5D7JB 5L2KB 1NLBH 5CSGA 1A7NH 3ILPA 3SKNB 3UC0H 1KEGH 1LO4L 1IC4H 1LO5B 3GSVA 4Z8FL 5JHDD 2EKSA 4Y16B 3QHFH 4FQLL 4BKLB 3BRDA 3QUZC 4JR9H 4K9EC 2EDBA 1OLZA 1VFAA 1BFTA 4O9HL 5J0BA 1HHIB 3JV6B 3K2UL 4GRLB 4AMKH 2E27L 1B4RA 4JM2A 2DI9A 4YZFF 1L7TL 1S78D 3IDNA 3OKOB 4EIGB 1IGTA 3QCTL 2EE3A 3QG7L 3SGKA 1VGKB 4X6FA 4JRXA 1P5VA 2YA2A 4RNRA 2FHBA 2GSGB 1A2YB 2MQCA 3IJSA 2H8PA 5J9PA 3LPFA 2Z93A 4Q9BA 4F37K 1C5BL 2YD4A 4LLYB 1IGIH 4XWOD 5IEHA 5ACZA 1XGQB 4WHTB 3S4SB 1WIOA 3NN8A 2AJVL 1NCNA 2OBGA 5IBLC 5C0JA 5I1EL 2YUVA 5J6HA 4F7EB 4P0DA 3FQNB 5I15L 3RA7H 4GS7C 3DIFA 5HYSA 3ALPA 4A2MA 1A7RH 1GYAA 3B83A 3GDBA 5C8JA 3IDIB 3UJJH 4LVOB 5IVNA 1P7KA 3P9MB 5HHMD 4GG8B 1NCUA 5CEXB 4BZ2L 2M2DA 1NKRA 2AJXL 3M1BB 4RMVA 1I1FA 4X9FA 5BVJA 1NCDH 1JTOA 3G5XB 3QUYC 4K23H 4M6MH 1NCAH 5AAWA 5DC9B 3ZTJG 1RMFL 5D2LA 3TT3L 4CDGC 1FV1A 4AENA 4KKCD 2V7HA 3QXDB 4KGLA 3MBED 3HMWH 4PJCB 5HDLA 1YEIH 4OF8A 3KPSA 3SJVE 4WU7B 2NY4B 2DQTL 3ARBD 2NNAB 1MJJB 3BEWB 3QNZB 1NC2A 4AEFA 2EC9T 1PDKA 3UTTE 2HRLA 3PNWB 3ALXA 1OF2B 3TBSB 4H1LB 4RBPK 1QLFA 3TO4A 1AIFB 1J87A 4WHCA 1KCUL 5I19L 4FG6C 3VGFA 1C1EH 4RAHA 3GO1H 3V6BR 1YPZE 2YD8A 3ISWA 3I2CH 4XWGL 1S8DA 2EDRA 2Z31D 4OD1H 1E4WL 1RUKL 4ZD3L 5KSBE 1S7UA 2AK4B 1SJEA 4Y1AD 5GRUH 4EN3D 5DRWB 5FM8A 3H8NA 4FFZL 1QLRA 1U93B 2I9LA 1KJVA 1F4XH 1G7PA 2YMXH 3I6KA 1QNZH 3T65B 3RBSA 3VXPB 5C92A 5DI8B 3MV8A 2FIKB 4N5EC 3KPPA 4D0CB 2HG5A 3T8XB 4PGEA 5JZ7C 4FQQA 2W92A 4UINL 2PTUA 4IS6A 2BNRE 1MHHB 1R5IA 2Q7YA 2XTJB 5FO7A 3U7WL 3ULVC 1BQHG 4JCMA 1MIEL 3Q1SH 3OAZK 1IC1A 4Y2DA 1NUFA 3P9LB 4G8GB 1JMZA 3PGCB 4X6CE 1DQJA 2VZUA 2R2EA 3WXWH 1AGDB 3CLFL 1EEZA 1AR1D 2ZOKB 4NO5A 3VMPA 1W8OA 3CPLA 3CDYA 2VERN 2W0FA 1YEEH 4JM2C 2VLJB 4FN0A 4YE4L 3U4EA 1UG9A 1QRND 1U0QA 2EICA 5BS0A 4JFEB 1HINL 5C0GA 2F8OA 4LNVA 4C59B 1B2WL 1YQVL 4YPJA 3ZDZE 1RK0A 3SGKC 4OF0A 5JIKA 2A38A 4KK8C 3L3OB 3X3FH 3MRKB 2WP3O 5FYKL 1A9BB 1K5NB 5JXED 4YHLH 2EECA 3VFUB 4OFVA 2C26A 1ZLUK 3U9UB 1B9ZA 3GBML 3T3PE 1I3GH 1BREA 3T3MF 4MJIB 2JJUA 5CP3A 5FM5M 5E00B 1FSKC 3GKZA 3VG9C 5CD3A 2F53A 4GLRI 4K7PX 4LIQL 4EBQH 4V2CB 3KPLB 5DK3A 3O2DA 2X1QA 5DRZA 1UKTA 3O6LL 4TRPH 1EO7A 4KTDL 2PR4H 1CICA 3S35X 4RISH 4HG4K 1R3KA 4JQXC 5GS1A 1N6QL 1GGTA 5D96C 4JY5H 2VISA 1CS6A 1MFDL 2EEAA 3FQRB 1D6VH 2GKIA 5C09E 4X83A 3V6ZB 5BZDA 4EJ1C 1IT9L 1JZ5A 1WEJH 4UB0L 3V5HA 4JZNB 3NPSB 4GO6B 3SBWC 5IMOB 3S4SG 3QUXB 3BWAB 4D9QD 3W11D 4ERSH 1P4IH 2VWEC 3WFDL 5TE7H 5DHVB 2JCCF 3TO4C 5E1AB 2YA0A 3MJGX 2ADFL 4M43L 1SBSL 5CCKH 2CDFB 1BVLB 2UWEF 3MSPA 3IVKA 4K7FB 3UP1A 3MLWH 4JPKH 1V7ML 2AGJL 2DQDL 4O2FB 2VR4A 3HA0A 5T3ZH 3MOBL 5I1AB 3WNOA 2B4CC 3QIWD 3C5JA 3WS3A 3P9WB 1WT5A 1NGZB 1ORSB 3NCYP 1LGVA 4P46D 2HAZA 2X6MA 2A77L 2OJEA 3BGAA 3QPQD 4LVNB 4PJBE 3RVUD 1DUYB 4L1HA 5EU7C 4YPGA 4LK4A 1LNUA 1GOGA 4H1LG 5JQHC 3HAEB 3BHBB 4NRXA 1QBMH 4PJAF 4Y2DC 2BVPA 4WHDA 5DRNB 4ZFOB 3HI5H 2HTLD 3UTQA 5CJ5A 4JN2B 1R24B 1RIHH 5CEYB 1XGPB 2NY7H 3LKNA 3NZHL 3BZFB 43CAB 3EO0A 4GW4B 2V2XB 2VLRB 3HG1D 1IGCL 2FO4A 3FN3A 1T03H 2WUBL 1T5XB 3EOYG 4U33A 1G1YA 1T0NA 2R56H 1J0IA 2XNAA 4XBPA 1WAAF 4S1SL 1MFCH 5DEFA 3TA3D 5C0ND 4K55A 2ARJQ 1WTGT 4WTXA 1ZAGA 1NLDH 1XF1A 2OSLA 4QRRB 5F7EL 3OG6B 1UKQA 5EU6B 1T3FB 3VFOB 5KSUB 4L8CA 3PWPE 2QQKL 3R0MA 1JRHL 5DJAB 3D3VB 3SE8L 2XRAL 4NM4H 3MV7A 3X12A 3S5LG 3QXTA 4WDIA 5D7IF 3GUTB 2X40A 4BFGA 4R4BA 4WHYH 3VA6A 3C5SA 2EDHA 3LN9A 3SJVA 3TV3H 2HA1A 2WWMC 2P46B 4PBWD 3UTTA 1LO0H 3NFNB 2HT2D 5GS1C 2WUCH 4XZUB 2MCPL 5IHZB 2Q76B 3GRWA 1SJHB 1R0AL 2FD6H 1L7IH 3C2AL 2C4XA 4GW1A 4AY0A 4NZTL 4XPBH 3QPXL 1KB5L 1AE6L 4PB0L 4PRBB 1YPZA 4HWBH 1TPXB 3ARZA 5C08B 1LQSR 3GSWB 4NCC2 5KSBA 1XIWC 2RAMA 1U8JA 3BEVA 3U4BH 1FVDB 4JJ5A 4BZYA 2NY1B 5SX5H 3LH2H 1QTYT 4XP5H 1MPAH 1ZS8A 4OKVA 4NRZB 3WJJA 2DQUL 5FHAL 4Y5YB 3V0VA 3MFFB 3HR5B 5FEBA 3OJDA 1FNSH 5ADOH 5MEPB 4QTHA 3QXAB 1CK0L 4QHLA 1OL0A 2BNRA 3KJ4C 4OGXH 4LVHC 4JO4H 3K8LA 3FT4B 4ZTOL 3BP6B 1WT5C 4KKBC 4JRYE 4X6CA 3SDDB 4OLWH 4APQC 4UT7H 2HWZL 4X0KB 2RQ8A 5CJQH 2VSCA 3QQ9C 3C6SA 4WO4D 1IEAA 3UJIL 3O41A 2VE6B 1H5BA 4C56B 1OSPL 1RQ5A 3G9AB 4WW2A 1K85A 1Y0LA 1B0GA 1J18A 1E4XL 1VEPA 5BRZD 4RAUA 2BP3A 3WDIA 2AJUH 3NCEB 1GGCH 3STBA 2X05A 5C3TA 4EI5A 3QDGB 5E2TL 1BOGB 3ARGC 2C3VB 5B3JF 5CZVH 2AV7B 2UZIH 3N1PC 3CLEL 1DBKL 3MRCA 4MLIA 3RZWA 1MY7A 2DKMA 4LCWB 2EYRB 3ZE2F 2V6HA 2AKRA 3GSRB 2PKDA 2FX7H 4HXAL 4GKSA 1AKJB 1JL8A 1AGCA 1BBJB 1OB1A 4LFHG 4JGJA 5CBEB 4XPAH 3SQOH 4LHUG 2QQLL 4RFOH 1FYHB 4G7VH 3HAEG 1NGXA 3B2VL 5IB2B 1OHQA 2RFXA 1IFHL 2DOCA 3J7HA 1CFTA 4HWEL 5J57B 2WM0A 5SV4A 5C09A 3HNTH 1ZV5A 1EBPA 5FCUH 4MNHA 2CDEB 4BH8A 1Q94B 2NY3C 3U30C 5EZLB 3K46A 3U1SL 2V9QA 3KPMA 4KI5F 1A7PL 1U8LA 2I24N 3QI9A 1KIQB 3DVIA 2VL5B 4OCRL 4KY1L 5FO8A 1BIHA 4F33B 4OV5B 5DEZA 2F5BH 1JJUA 2GTWA 3HNSL 5SWQA 3TGXA 4OLXL 4TPRH 3HS0B 4LSSL 4MMZC 4P2YA 3D48R 4AQOA 2CIIB 3L7FA 4N8VA 3ZDYF 4Q9QH 3O6ML 1FFOB 1I7UA 3HPLB 4GRWB 1UXSA 2WMPA 3I6GB 5HVHB 3DHMA 3DV6A 1U3HD 2C4FU 1OP3K 2F19H 3WFZA 1F4WH 3VI4F 1AGEA 1ZLWK 4PGZA 1YYML 3WJJC 1F3JA 5EC1B 2P1YA 2YBRA 1L6XA 4PJBA 1CDBA 2W9DH 1T20A 3U46B 1NAKH 2X4PB 3F62A 2VDNH 4QCIB 1AQKL 1SEBB 4OJFH 1XH3A 1I1AB 3DUUA 1UM5L 4WWKD 4JLRA 4KK5C 4LLDA 1OGTB 4JFYB 3TVMA 2ZSVA 4JG0H 1IM9D 25C8H 2WLZA 1PX3A 2BRQA 3VCLB 2PNDA 4HEME 4XTRC 3OL2A 5CP7B 1HHKB 3QFJE 4NCDA 1LD9B 2HKFH 4ZSOB 2X4OA 3WKNA 3WMSA 3EYVB 1JGVH 4GBXD 4JFXA 3V0WH 5FHBL 2B1AH 1VKXA 5I2IA 3D85D 4QRPA 4RDQG 1H5BC 2VQ1B 3MLYL 5E2WH 4WW2C 1HN1A 3GMLB 1KG0B 1RSFA 4BZ1L 1H8OA 4HGWA 4OLUH 3SDAB 2X4SA 1YMHB 4WHYG 3WSQH 3LMJL 4ZUSA 5SX5K 3MUY1 1RUAH 1CGYA 3LVEA 4NT6A 1CLZH 5BW7A 2PYFB 3BYYA 3QEUB 4ONHA 3C5ZD 4OAWB 3IJYA 3IU4H 5D9SB 3G5ZB 4S2SB 4UAOB 3PWPA 4OZGF 5BV7B 3L5IA 3KLHC 4NKQB 1S3KL 4Z7UF 3S9DB 1X44A 2VITA 3S36H 3BSZL 2ZUVA 1R3JB 2A74B 4JKPL 3X3GL 2MMXA 3B3IB 5DTFB 3MNZA 3FB5A 5FUOH 3L5XH 4YHYB 1GVIA 1F6AA 2QSCH 1A1MA 3SE9H 4XP1L 4R90H 2XIDA 3TF7C 3VFNA 1AGFB 3IAPA 4KFZC 4ZAKD 2AS5M 3T1FB 1WBYB 1UWEH 3KYMB 4X98A 2HMIC 4I2XE 3QNXB 3IS1X 2EZ0D 1J1OL 4ZFZB 2JELL 1FL6A 3Q6FA 4KZEH 3F7YB 2GJ6E 1JF5A 3GMRA 1FDLH 1UZ6E 5GIRA 4NNYA 4AIZB 4M48L 4YHPB 3KXFB 1NFDF 3QI9C 4LNRA 2CIKB 4P4RA 1E4KC 2R1XB 2NTFB 1IAKB 5DS8A 1OVZA 4PY7A 2D4DA 4MAYA 2W07A 1EHNA 1T83A 4YXHL 4M7JL 4PJIE 4FQJH 4I48A 4XXDA 3W82A 4NGHL 3O3BA 3RIAF 2EXYC 1NBZA 4U1MA 5I8CB 1I1YB 3BPCA 3C9NB 4P59H 1VSCA 1S7WA 1UGNA 2P5WD 1RZGA 3OKDA 4LLUA 4UDUA 5EZIH 2C7UA 1DVFB 3UTSD 3NAAL 5HDQH 1TVDA 2BSTA 2X89D 3UO1L 4OSUL 4F2MB 3VFRA 3HLAB 3IDJA 1EFQA 3U0TA 2HVKB 5KVFH 1EFXB 3FRPG 2BX5A 4JRYA 4LEOA 3OZ9H 3WV0A 1IM3A 3BW9B 1ZHNA 3Q3GB 4FXLA 4C55A 2AQ2A 1MCPL 1RJYB 2DJ4A 3K4AA 2NY5H 1A02N 4O4YL 4GOSA 3GIVA 3RFZC 5J7CC 1AFVH 5BQ7A 3SDCB 1TVBA 1WBZB 1GGIH 3RWFA 3ZTNH 3HI1B 2F15A 3LHPH 3RVWC 1NMAL 1OD9A 4P3DB 3GSNH 5E5MA 4G9DA 5I1LA 2B0SH 1LK3H 3DTXA 4RMQA 4G43B 2W9EH 3TVMC 2NY6C 1RIVL 2YD5A 5DJZA 4PP1D 5F8QC 5ID1B 3W81A 5CKAA 2FEDC 1JZ3A 3V8CA 1T2QH 3ZYZA 3T4YA 4YXLH 2FDBP 3M8OH 4CJ1A 3QEQE 2GCYA 1KCVH 2UYLB 3ZT5A 2JIXB 2E9WA 5I6XB 4U6HB 3RZCA 5E8OB 3JTSB 2VH5H 4J8RB 4D0DA 2DL9A 3FO2B 4GXVH 4OZFA 1OP5H 3SKMA 4JO2H 1CR9H 5DD1H 5JDSA 3ARFD 1QSED 2MNUA 4NO0D 4PD4J 3Q5OA 2HVJB 1HSBA 2OM5A 2Y5EA 5BW7C 1LK2A 3OF6D 2EDJA 3K80A 5E03A 5K93A 3ULVL 3O2VL 1UM4L 2DM7A 1JNJA 4XNZC 2KUTA 3DBXB 5HHQA 2JK5B 3GSNB 3SKOA 2ICWB 4G6AD 4IRSA 3LKOB 3T0VA 4LRIA 3ALWA 4G80B 1JPGB 4JZJB 2CUMA 4KVNL 5IK3B 2X4TB 3RWEA 2IQ9L 5KTEH 3QEHB 4M4PA 1Q9WA 3HZVB 1SJVA 3QG6B 2CKBH 2APFA 1OTUD 5HYEA 1KTDA 4MD4B 5HHVH 5AD0B 1A0QH 1E6OH 1UENA 1HOCB 2AI0L 2DBLH 4JFOA 4ODTL 3VWKB 5GS0D 2ID5A 3BESR 2NW3B 2NYYD 2R4SH 4M1DL 5KW9L 2R1WA 3N85H 1S7QA 3N1GC 4N1EA 3TNNB 1CL7L 2XKSA 5BZWB 4LF3A 2Y5TA 4ZDHA 2JCCB 3P0YL 5E94B 1EEYA 3DV4A 5DA4A 5T1MA 3UTPD 4FTVE 1U91A 5CIPA 4M1CC 4YAQB 5DQDL 2YWYA 1F58L 1KELH 2VDRL 1J7VR 3ZE0E 1NCCH 1FG9C 3CVIL 3FN0H 2IANE 3WE6A 4HV8B 2UWEB 2HRPH 1INQA 3QCVH 1R5WA 1CGWA 1I3VA 1RZKH 3BZEB 2VKXA 5F1SA 4L8SA 4PLJC 2OK0H 4KRPD 4NKDB 1CFSA 4RMUA 1UXWB 1PGRB 2CKBB 1YY9C 3ZSSA 3GBLA 3WIFB 4Y19E 4Z0BH 3DPBA 4L3CA 1T4KB 5C6TL 4XCNA 4YDKL 5ITBH 3OB8A 2VLME 3X14A 1B88A 2XPGB 5HI3C 5JQ6L 3GMOB 1EIBA 4LQFL 3FQXB 4F15C 1PQZA 2X10A 1MVUA 3MA7A 1Z0MA 1ZEAH 1S9WB 2IBGA 3QFJA 4PJCE 4X9IA 4JY6B 4PJAB 4PYGA 4ZXBC 3QDME 4MXQC 4HXBL 3BQUB 3KJ6H 2BVEA 3LPGA 4X8JA 4ZS6C 5F9DC 4H5SB 3MLTA 2PXYD 2EIZA 4MVBD 4Z7NF 4GKZA 4M8QA 3P4NB 2VDMH 3DX6A 4C83B 1ZT7B 1U6AH 4MAUL 2XTLA 3MV9D 5E8NA 4ZFFB 2B2XH 4U1IB 3VFGH 4L3AA 1MEXL 2ZG1A 2Q8AH 2O61A 4KK6D 2AK4E 2P49B 1URLA 2B4CL 5C07B 1GRWA 5ITFB 3RZCC 3ORJA 3ROLA 2UUDH 5IHUL 1JWMB 4BQBA 5J3HD 1HXMA 1UM6L 2JJSC 3VG0H 3B2UD 3L3GA 4NZRL 3BT2L 4UTBH 4P3CL 1EAPA 4HUUB 5IMMA 1RV6X 1MFEL 5DFTA 5IIEB 3NH7L 4QHNA 4WV1A 5HBBA 4DVBB 4Q0XL 4QXUL 3VXSD 3MROB 5D7IB 3GIZL 4FQIH 4TSAH 4IRSC 2ZJSL 2FBJH 2F8VA 4LRIC 4I2XA 3HE7C 1QA9A 2JB6A 2VNCA 3FJTA 3BPNC 5GGRY 5D7JD 5L2KD 2GJ6A 3FOLA 3U82B 2VDQL 3L5WB 1TMCB 3A0OA 3SDYL 1RZJH 1I7ZB 5EC2A 3WDJA 3I9GL 4Y16D 2A83B 3IETA 1CLYH 3VXMB 1FZKB 1DR9A 4JFEE 4P9MH 1MCRA 4HHAB 1PX4A 4PJIA 2OLDA 3OHXA 4GRLD 1CN4A 1SM3H 4L4TB 2R0ZH 4KQ4L 1U8NA 4QXTB 1G7HA 1L0XA 3U7YH 4DVRL 1S5IH 3BPLC 4W6XB 1CYGA 4U1KB 2D0GA 1GIGL 5EFIA 3LEXA 5BVPH 3E2HB 1HQ4A 2H1PL 2EYTA 3AS1A 5IQ9B 2YRLA 3O2DL 1FNEA 4JKMA 4L8SC 2DQEH 4R97C 2ZCKL 4MHHG 4UMGA 1XCTB 3FOMA 4K3HA 4Y4KD 5F72S 2VXVL 4LMQI 5E24E 1KACB 3S8WA 1FVEB 1BAFL 3LN4A 3OKEB 1LO4H 4Z95L 4Z8FH 1M71A 4BSWA 5HYFA 2A0LC 4FQLH 2QADB 5F9JB 5KVEL 1QFOA 1S5HB 3D2UB 4FHBD 4CU8A 4O9HH 4YNYA 5IJVA 5FYLD 3K2UH 1G6RA 2E27H 1XT5A 3QEQA 2XKNB 1L7TH 4FRWA 3SO3C 1UKSA 2KZWA 5GJSL 2PYED 1C5CL 5IFJA 1NAML 1SYVA 3QCTH 1ZSDA 5DR5L 4D94A 3QG7H 2Y23A 3GSXB 2BOBB 2P7TB 2OMBA 1CXEA 5DYOB 2NY4D 2CXGA 4YH6A 2CDGA 4QXGL 3E3QE 5HGDA 2APXA 2EDXA 1C5BH 1K8DB 2J12B 2QHRL 5GGTA 1GZPB 4HULB 4UI2A 4TTDC 4IOIA 5IB3B 2AJVH 1JHKL 2DQFA 2AXGA 3I02A 4XVUC 5EN2B 5I1EH 4DN4L 2Z0BA 5I15H 1H0DB 4HBCL 5BJTB 1T5WA 5EBLB 4GG6F 3FFDB 4OB5L 3BN9C 4HUXB 1A14L 2BSRA 3IFOA 4PREB 4WV1C 4BZ2H 3JV6A 2AJXH 1U58B 4KKNA 5HGBB 5DJ8A 3IDGA 1ZGLB 3OKOA 4N1CA 1RMFH 3TT3H 3NFPA 4GKOA 1QD0A 4PY8I 1CGVA 2VO5A 4XVTL 2BRRL 5I18L 5DZOA 2F74B 4NQUA 1GOFA 2Q20A 1KB9K 5FYJD 1DQQB 4ISVA 3UPRB 5MEOB 4AIOA 2DQTH 4HD9A 2VLRE 3QFDB 4G8GD 4FTVA 5IWLA 1OAKL 4I18B 4J3WA 4M6AA 4YHZL 5I16A 5T3ZE 5ICZB 1HYRC 1FZMA 3HZMB 4JPIA 3S4SA 4P5TD 3W39A 2IANA 4XCEB 1QEWA 2V9TA 4PJEF 5DDHA 1KCUH 4F7EA 5I19H 1LEKB 4HIIB 2VLJD 1I3RA 3BP7B 4XWGH 5MHSE 1IEHA 5F9WB 1I7RB 1RUKH 4CDHA 4QRRE