4PLKD

Hepatitis e virus e2s domain (genotype i) in complex with a neutralizing antibody 8g12
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
223
structure length
218
Chain Sequence
QLQQSGPELVKPGASVKISCKASGYTFTDFNMHWVKQSHGKSLEWIGYIYPYNGITGQNQKFKSKATLTVDNSSSSAYMELRSLTSEDSAVYYCARERFGVGNNYAWFTYWGQGTLVTVSSAKTTPPSVYPLAPGPTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Capsid protein
publication title Structural basis for the neutralization of hepatitis E virus by a cross-genotype antibody
pubmed doi rcsb
source organism Hepatitis e virus
total genus 37
structure length 218
sequence length 223
chains with identical sequence H, I, J
ec nomenclature
pdb deposition date 2014-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4plkD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4plkD02
5FGSA 5E5UB 3V95A 2YUZA 2CR6A 5I1KL 2ZOKB 5GZNC 1UXSA 5TQ2L 1PQZB 1MCSA 4FTVB 1NKRA 4HHAB 4JEGB 4NZRH 4UT9L 2HRPH 4GW5B 4PJXE 4Z7NE 4RGNB 35C8H 2MCG1 4HUNB 2EKJA 4HJ0C 1GZQB 1DR9A 3OZ9L 1CVRA 2PTVA 3DJ9A 4JFYB 3FJTA 4KZDL 2VE6B 1NAMH 4WI8A 1XEDA 5E8NA 4Q2ZA 5HGAB 3IDYC 1I7RA 5KSBA 2DQDL 4XMPL 3KYMA 3RVUC 4BA8A 3FQWA 4PJAE 4OF6A 2QHLA 5IW6B 1MUJB 2C3GA 2DQTH 1ITCA 4HV8A 4LLDA 4YWGH 4PV9B 1JMXA 3DYOA 4MJ2A 4NGHH 1NDMB 1QUNA 1P84K 1EMTH 4JN2B 5ENWB 3O4OB 2C9AA 1Z5LA 1L0XA 1YC8A 1IAOB 4Y7MA 4JVUA 3V5HA 2G60L 5F44A 5C0ND 3Q6GL 4U1MB 4FTVD 4CU7A 4EI5A 2DM2A 1AR1C 1CLCA 2E7HA 3BO8A 5FYJL 5E95B 5HJ3A 4F37F 4UINH 1QFWM 5CKAA 1ADQH 5DJAA 5SWQA 1MJUH 4RGND 1WTGT 1FV1A 1X3DA 2JJTC 4U7SA 3V2AR 4KZEL 1FZJB 2E8YA 3SE3A 5I9QC 5MEOA 5HHVH 3BDYH 3P40A 3V6FB 3O45B 1DDHA 3OJDB 1MCDA 3QZWA 1A9BA 4GLRH 4G6KH 4XMLL 3P4MB 4DVBA 4NPYB 3OSKA 5ADOL 4XCCH 2VISB 4OLYL 4TOYH 3VXPB 1TZHB 5E1AB 4P3WA 4ODTH 4MJ6B 4Z95H 4RMUA 4X80H 1IEBA 5JR1L 3O6FC 4PJGE 5ANME 1DBJH 2COQA 1BBJA 4JQVC 3TF7C 4X7CC 1JWUB 5D9SB 1MCQA 5AYUL 1G7LB 4PJBE 2EDBA 2Y7QB 1Q8MA 4KK6D 5I1HL 4MD0B 1PG7W 3BKML 5F3BB 1Y6KR 2HG5A 2IF7A 3IDMA 1QLRB 3QXAB 4QHUA 1OPGH 1PW3A 1U8MB 1EZVY 2DQIH 3TM6A 3PQYA 3RHWF 1X5GA 2R39A 1ZT1A 3QDJB 3I6GA 1FYHB 1RJLB 4NZUL 1KLUA 5TE6H 1C8PA 3ARGA 3SOBL 3O3DB 1SJVA 1H8SA 3QUKA 5E9DB 4RRPA 5E8DL 4DQOH 3HAEA 3C8KA 1FO0A 3QUMA 4LHJB 3UTTB 3ZE1E 1FGNH 3K4AA 4OLXH 4PS4H 3EYFA 4HK0B 1FNFA 4J3SA 3HC0A 3C60B 3X14A 4KJWD 3ET9F 1XGRB 4JHBA 3HZKA 2DTMH 3MMEA 1RZJL 4N9GA 2O61A 4NQEA 4RMRA 3EKCA 3SPVA 2ZZUT 4KK8D 2A83A 1YZZA 3BN9C 4PJ9D 2CKBA 5FYJU 3IKCA 3UTSB 2H32H 4LNVA 3OB0H 3CLFH 3QI9C 4GG6E 3S3JA 5K9QI 5ABDE 1LE9B 5SX4H 4BKLB 2CXKA 2XPGA 1FE8H 1NFKA 3GGWB 1BPVA 2NLJA 3UC0L 2IC2A 2ZSVA 3TT3L 1N7MH 3DVNB 4FZEH 5HY9B 1IGIL 2YRLA 2HT4C 2EDFA 2HN7B 4PREB 5D93C 3QDJD 1A1NB 1QR4A 3EDDA 1C1EH 1HQRB 5IMMA 4YDLC 2E8ZA 1ETZB 3GHBL 2EDWA 5IESH 1IC5H 3V7AE 3UTTD 1KJ2L 1X4ZA 3ULVE 3BDBA 1OP3K 1C16A 1NGXB 3DPBA 3RZCA 5DMIL 4ODSH 3WYRA 3JUYA 5JQ6H 4RSVA 3BMWA 2OJZL 2VITB 3DVFA 4BSWB 1YN6B 3NFNB 1MH5B 1TTUA 2WUBL 3IFPA 4WFGE 4P2QB 3ARRA 3DTXA 4PG9B 5B8CA 5HVHC 5ISZD 5BMFH 2I9LA 5EORL 1IE5A 3GMQB 3WXVH 1HKLL 3GSOB 2OTWB 4G8IB 2OJEA 4JG0H 2QSCH 1T4KA 5EIVA 2R1XA 3KS0J 1IFHH 1CE6B 5GRZA 2EKSB 4XXDA 4OFVA 1F3JB 1CFVH 4BUGA 1IC4L 2FJFA 4YBLB 3QNXA 5LQBL 1QSFE 3DUSA 3UDWC 3V5DA 1T22A 4QRRB 5ICZA 1IGTB 3LQAH 4ZFOA 5L6YH 1YEEH 4NP4L 5D7IB 2WBWB 3EO0B 3X3FL 4HGWA 4OZHE 4UT6H 3VFRA 3QQ9D 2DBLL 1KN4H 1S78C 3MFFA 4CDGC 1ZWIB 1AGCA 2IPKA 5ECJE 5BQ7A 3K2UH 5MP6H 3U7YH 2CLVA 1J05A 1A6TA 2R23B 3IU4L 5CGYC 5HHQB 4P2QD 1QOKA 3MRMA 3UBXI 1QQDB 3FT4A 3HC3H 4BELD 1WC7B 1O5DT 3HRZB 3DUUB 1M71B 4JRYA 4OLVL 1J0IA 3UZEA 3MR9B 2EIEA 2MTPA 2QSQA 3EYUL 2Z4QB 4BFIA 4JZJA 2VDRL 3VA6A 1CG9B 1KB9K 4L8DA 3BZEB 1JN6A 4GAJH 1RY7B 4N90D 1DQTA 3GMNB 5C0BB 4QRRD 3BXNA 5DD5H 3KGRA 4L8SB 5KVFH 2XWJB 4WHYG 4Q74A 2FHFA 1AO7A 3VXSE 4CDHA 3RTQA 4LSTH 2E9JA 5DR5L 1HZHL 5F7FA 4LLUB 1V3KA 1J1OL 3G9VA 4UTAH 5D7SL 5DI8B 5F71A 1FL5B 1IL1B 1DQLH 5IB2B 4ISVA 3QJFA 1KSRA 3DROA 1S3KL 5SV3A 2Z91B 2HH0H 4G3YH 4LHUB 2X4RA 1TQCB 1M05B 4ZXBC 2AKRA 4Y4HC 4PRHB 3KJ6L 1AHWC 2R2EB 3MTRA 3CH1A 5L9DH 5CIPA 5AZ2L 3QDHA 2RHEA 4ODUB 4KKCC 5E2UL 1EEYA 4YO0A 3L3IB 5HDBF 3NPSB 2ZUQB 2KH2B 4RMQA 1FZMB 5F1KC 1MFAH 5FB8A 1AKJB 2ZPKL 3FB6B 3TJHD 1AE6L 2WIIA 4NM4H 4Y8AA 1EFXA 4YHMH 3RA7L 3WUWA 2J6EL 3FQXB 4ZAKB 1JF1A 3GMOA 1UCBL 3KPNA 5DD0L 4O02H 4QRPB 1FCGA 4MNGE 2A6JA 3RL1B 1JI1A 1YEJL 1MCRA 1YNLH 4WEBH 1F6AB 4CADA 1F13A 2R1WB 3O3AA 2NNAB 2AJVL 5I17B 1GC1H 2NY4C 1U92A 5CAYB 1YMME 4M6NL 4LHUD 1BEYL 1Z6JT 2FD6H 2RR3A 1C08B 1WT5C 5GGTL 4OCNC 1Z0MA 3SKUD 5B39G 1DQDH 1CD1B 2EDNA 5FK9B 3QIUB 4PRHD 1MCOL 4ZQKA 1IT9L 2DKUA 1FORH 4NQSB 2XI9A 4Z18A 4JY6A 1JBJA 5T3XE 4U2ZA 3MRPA 5I75C 3Q5YA 1EXUB 1Z9MA 3HNVH 4CVXB 4QXGL 1YNTA 2X05A 4HUXB 4X8JA 5DHXB 4OI9A 4PJ7A 4NWUL 1NDGB 2R4SH 3U0PB 5A16A 1A7RL 3IDGA 5A1AA 2VN4A 4ZAKD 1IAKB 3U30C 5CEZE 1JJUA 3DX7B 3MUHL 5E00A 2Q86B 1WWWX 4L8CB 1VEOA 1XH3B 3GHEL 1Q9KB 2B2XH 5TQ0L 1BD2A 3MNWB 1NBZA 5D2NB 4OCLC 1DUZB 1DFBL 2OTUA 1CI5A 1MQ8A 2RJMA 4GOSA 1P2CB 2Y07L 3O4LB 4OIIH 3OR7B 4PJIA 1T0MA 2E9IA 4JO3H 3SGKA 4WV1B 3P30L 1KF9B 1YECL 1ZHNA 4JDTH 5TF1L 5TGBB 1SYVA 5DZLA 4GH7B 4I8DA 2G2RA 2QADB 4G7VL 3RGVC 2LU7A 4PRIB 3QIUD 4KVCH 4BZ2H 1FNLA 3VDBA 2R2HA 2AI0H 5KS9F 3QG6A 2AJSL 2AXFB 1NC4B 1B4JL 3LPWA 2O5ZL 1KCUH 4KMLB 4YXLH 2V9RA 3QISA 1FIGH 4OD3L 1K4CB 2DQUL 3TYGH 1KJ2A 4PTUA 3QWOA 1FZKA 4HXAH 1QZ1A 3ARZA 1WICA 2O26U 5CBEA 4LSQH 5E5MA 2QQNH 3D85D 2VMFA 1RJYB 1RD6A 4YR6B 1D5MB 3KHQA 2DAVA 3IF1B 3WS6C 4Z7QF 1E4KA 3QUYA 1RZFL 1FNEB 4KUCF 1H3TA 5CMAA 4L9LC 4K94C 1A6AA 3C5SA 1OWRM 5MENB 1YPZA 4OZIF 1AI1L 1E4XH 1BVKA 3M8OL 4XNZB 1AP2A 2MMXA 4LAJH 2D7OA 2NYYD 3WJLC 1T2JA 3O4LD 2ADFH 1PKQB 3KPRB 4O9HH 5JMRA 1YY9D 2Y36H 4ZFGL 1UVQA 1KTLA 1VFBB 2O5YL 3ZDYF 2CDFA 4LLYA 1LD9A 2QADD 3EW3B 3QZWG 2V5YA 4YUEL 3ULUF 1PLGL 4JFPA 4D0CB 1U8HA 2CUIA 3DVIA 2ZNXA 3KR3L 1S7TA 3QP3A 1NC4D 1QTYT 4NZDA 1HH6B 2DI9A 3QULB 1OARL 1S9KC 3KPLB 3EIFA 1C5CL 4HLJA 1CWVA 2EDXA 2E27H 1SM3L 4ZODA 3T4YA 4ONHB 1C5BH 5FCSH 3HB3C 3HE6C 4HMEA 1WBYA 1J0ZA 1HHHB 3MRLB 2WQ8A 3LS5L 4ERSL 1MCBA 3A6BL 2JIXB 5FGBC 2W0FA 1AQKL 1OAXH 4I0PB 4DGYH 4NHCL 4JR9L 4ZD3H 4W4NA 3MRGB 4C55A 3D18B 3G6JE 4MHHI 2EIDA 4Q0XH 4X4ME 3E0GA 3KPRD 3FZUD 3WFDH 1TETH 1G9EA 3RWDB 4AMKL 2AJXH 3X3GH 1QFUL 4MNQB 2O5XH 5HI3D 4PJAB 4RRPG 1NL0H 1QO3A 4KUZL 2VDPL 1W0VB 3OBAA 2FYYB 1LMKA 5KANI 3R1GH 1A9EB 1EO8L 4MXQC 3NFSL 1WZ1H 1BGXH 3M45A 2GSIB 2NCMA 2XYCA 4QT5A 2F8OA 1MHCA 4HIIA 4BSVB 1ZT4A 4LAQH 5FKPB 1B9ZA 1E27A 4FXLA 2HKHH 4QXWA 3SKJH 1NJ9A 1IGJB 2UWEE 3A0OA 3D69A 3L7EB 1A5FL 2VLRE 5DF0A 1KJMB 3WKNA 2HTLC 3WIHL 5D8JL 4KROC 2IFFH 3KYOA 3WO4B 1U93A 3DETD 3V6OC 4OZGA 1DBMH 4NUGH 1B4RA 1K2DA 2FL5B 1G9MH 5HDLA 3TZVB 1SJHB 2EIBA 3F7PC 2DQHL 3NA4A 4I0PD 2YS4A 4I2XE 3LN9A 4Y5YC 2YC1B 5I1EL 1G7IB 4YHLL 3WFEL 2C3XA 4XZUA 1GRWA 3ARQA 4XAKE 2PF6A 3GJEB 2AJUL 2Z8VC 5DJDB 4H88L 3MYJB 5HVWA 2PO6A 2J6EA 2Z92B 3FAWA 3QDME 4ORGB 4LSRH 3F7RA 3FOMA 2ICCA 4LRNH 5GRXG 4WGWB 1BP3B 3MODL 4QYOA 2X4PB 4PJGB 5ANMB 4JFFB 5LGHL 1TZIB 1J88A 4GMSH 5EC1A 3VXUA 4PJBB 5CJ8A 1J5OH 2FO1A 5CJXA 5AUMA 1E6JL 3SCMA 1ES0A 2AXGA 3HPJA 3TA3D 5JW4Q 2WWMC 1MCPH 4GRWF 1WAAE 2Q8AH 2Y5TB 2ESVE 2IBZY 3WNKA 3TZVD 1XCQA 2VUYA 1U8LB 3OXRA 2QR0B 5GRUH 5JNYB 2EYSB 1A6PA 2EO9A 1BVLB 1VFOA 3EJYC 5DLMH 3CFEA 4XPBL 3NVQA 3QUZB 1MCCA 1A3RH 1CN4A 2V5MA 3HI6H 5IVOA 4MWFA 2XTJC 4UV4H 1KCKA 2BY0A 1KEGH 5FHBH 1B3JA 1K4DA 1KGCE 4O2EA 5KSAC 3HS0B 3LEYL 1C5DA 4YZFF 4QRTB 4NYLB 4R96A 2DKMA 3WEXB 5C9JB 5F7UA 1JNJA 3FB8A 4OT1L 2X4SA 1FIEA 4JANB 4JZNB 1IEAB 3MLZL 4HDIB 1F8TL 4PJ8B 2NY0B 4U1IA 4OCSL 4Y16B 5DMGC 4RDQG 4GG6B 1L7TL 1OLLA 3RUGE 1R6VA 4I4WA 3VI4E 4PJFA 3EYVB 1SBSL 4QHKI 1IM3A 4Q9QH 2ZCHH 4M8QB 4UIMA 1XF2B 2X4QB 5H2BB 3MROB 1U8QB 3BP7A 5B21A 4XRCA 1CLZH 5BXFA 1S7XB 1TJIH 1HHJB 3WFBH 4X0KA 1LO0H 5EUOE 1J1PH 1UGNA 3U4EA 3IT8D 4K3GA 1R0AL 4D2NA 2X4NA 3QUZD 2YR3A 3TNNB 2ZCKH 1JGUH 3VW3L 4RIRB 4EDXA 1RULH 3L3GA 4YAQA 4EOWH 1CGWA 4NKMA 4DJMA 1OW0C 3PGFH 4TVSa 3T77A 2ZSWA 5ERWA 6CGTA 3IXTB 3HG1B 5KJRH 1D5ZB 3WLWC 5J9PA 5F7YC 3RVXD 3TGXA 3KPPB 4IOIA 4PJ8D 4GRLC 5IHZB 2NY0D 4FQIH 4S1SL 4Y16D 1T66C 1FSKC 4N0YH 5AZEL 5EG6C 1TMCB 2ORBL 2DLFH 1I3UA 2NR6C 4AEIH 1DVFC 1A14L 2IBBA 2P5EA 2NXYB 3UCRA 4I48B 3LQMA 5DO2C 3BEWB 4UV7H 1N6UA 1QSFB 3IDJA 3WDJA 1CVSC 2VERN 4Q6IA 1J87A 4OJFL 1D5XA 3RPIA 3MRCA 1F45A 5LAXA 3MA7A 4WDIA 3WUWG 4LCUB 1TVHA 3MRRA 1HCVA 1RMFH 3AY4A 5LBSL 1XIWB 3BP5B 2VDKL 3CFIC 1KCRH 3PDGA 4QTHB 1NAMB 5SWZE 3ULVD 2PYEE 1T2QH 1LK3H 5EZJB 3KLDA 2CQVA 4JM4H 3O9WB 4YFLF 4FQQA 2APVA 3PV6A 4M02A 4GW1B 3P77A 1UEYA 1YEGH 4WFGD 4MA1B 2VDOH 3H8NA 4NN6B 5GJTL 2QTEA 3VG0L 4KVNL 4RZCA 5DJCB 2PR4L 4GXVL 1B0WA 4MXVE 1VGEH 3B2UD 3F12A 3QDAA 5F7EL 4GXUN 4POZD 2HMID 4KQ4H 3MACH 3U4BL 2NXYD 4HUWB 4P3CL 3RIFF 4H8WH 5FO7B 5IVZB 2GTZA 3F5WB 5IEHA 1QSFD 5GGQL 1LO4H 1A7PL 5H8DA 2H2PC 5EN2B 1WLHA 3CU1A 3BUTA 3NIFF 2UY7A 1XIWD 3L6FA 4C54A 4QHLB 3JVGC 1I3GL 1ZLSL 4PRBA 4Y0GA 2W0PA 3QQ4A 1J1XH 1M7IB 4IRJA 1CFTB 4OGAD 2EDJA 4ZTOL 2A6DA 3O9WD 3VFWA 1QA9A 2JJSA 3WIHA 5CCKL 3SDCD 1P7QB 1JPTL 4HH9A 3AC0A 3CMOH 4FABH 1NC2A 1W0WB 4LVEA 2EXWC 3WIFA 5DMKB 3S4SB 3QFJB 1F3DJ 4KHTH 1NGPH 3BH8A 2PW1B 5DWUH 3OKKA 3W81A 3M1BA 2HVKB 2ED7A 2EDLA 1HQ4A 5GRWA 4DGIL 4NM8H 3B9KC 3BRDA 4NO5B 3CXDL 3H9HB 1B88A 2NY6D 2EE2A 1KIUA 4WJ5B 2AXHA 5EU7E 2A74B 4OLZH 2JCCF 3T2OA 3MCG1 3HAEH 1FO0H 2FZ3A 3QUMH 4L1DA 1RJZA 3GJFK 4M4RA 4NKOA 3VXRA 4G80A 3FB7B 5A2KH 1MCHA 2G5RA 3S35L 4Y5VB 5DC9B 3H7BB 4P3DA 1KNOA 4A6YB 4UT7L 3C6LC 2V9TA 4I5BB 4Z7UF 4MNGB 4RAVB 3VXSD 2ZKHH 5IB4B 4NFCA 2VYRE 1YQ2A 4OD1H 4RFNB 1CL7I 5IJKA 4JAMB 5MERB 4IMKC 3VFUB 3MRKB 3OKLB 1YMMB 2FX7H 4DW2L 1QYGH 1N6QL 3WKML 1QKZL 1RK0B 3AAZA 5BRZA 1HXMA 1H3UA 1P7QD 4HJJL 3LQZA 4WO4A 2Y23A 1Q94B 1WUNT 2VR9A 2DQJH 4CBPA 3L7FB 2X4UB 1Q9OB 5J57B 5DJYA 3FQUA 3HNSL 1CK0L 1UEMA 1JGLH 1EAPA 1FC1A 2ZOLB 2AJYH 4LPTA 1I9JH 1Q1JH 1EGJL 4U6YB 1YYML 2C1PB 5C6TL 2EDEA 1JHTB 3UX9B 1BAFH 4L4JA 3O2VH 1ONQA 3CXHJ 4HFUL 4H1LH 4DKEH 3BYTA 2Q87A 5EU3B 1OP9A 4U31A 5FO8A 3OPZH 3U4AA 4XCEB 4XP1H 2BJML 4WI4A 4JVWA 4PJDF 2ARJB 3MLSL 4LARH 4FQLL 3VCLA 4OCWH 4C4KT 2YK1H 3ZYOA 3C6SB 3DWTA 3HZMA 5CJOL 2I07B 3UMTA 3PUCA 4EBQH 1YMMD 3PP4L 3G5XA 4Z8FL 5AG8A 2BVPA 1BQHG 2R56H 2N4IA 3UYRH 4AJ0A 1P4BL 4HWEH 4WNQB 2QHRL 1I8LA 5F88A 1CGUA 2X1WL 3EOYG 1R5IA 3S37X 4TUJB 1W8NA 4V2CB 1CICD 2BMKB 3HFML 1WVZA 3Q2CA 3MUGA 1EJOH 4AEHH 3B9EA 3BAEH 4KJPD 2BFVH 1KTDB 5T3XD 2OP4L 1IKFH 5C0DB 1BBDL 1CDJA 4N8CH 2ICEB 1QFWL 1JZ3A 1XCTA 4CVZA 1FYTA 5I1KH 1AD0A 1S7VB 1FG9C 2EXYD 4I0CC 4FFZL 3MRQB 5TQ2H 5CZVL 3H9SE 4G42A 5CEZD 4D0DB 4X5WB 5EULV 5CD3A 3AS3A 4UT9H 1IQDB 5IEKB 3O8XC 1JPFA 4PJHB 4S1QL 1E4WL 4WENB 2CIKB 2H26A 3MGOB 1RIHL 4PP2A 3SE4A 3UXFA 3OZ9H 4EVNB 3VFVB 4GSDH 4KZDH 2HFEA 3BKCL 4P4KB 1QHPA 1NMAL 5EBLB 2I60L 3QQNA 1KXQE 2DQDH 4XMPH 5HYJA 4KI5C 1JP5A 1HE7A 4MCZB 3VFMA 1X5ZA 2YMXH 5BV7L 5I1AB 1JGEB 2LV4A 4B5EA 5IMKA 5JW4M 5EZIL 1A21A 1KPRB 2GSGA 2R8SL 2V2TA 3QPXL 2DJSA 5A2FA 3GSQB 5DZOA 4HS3B 4KV5F 5HGBA 3D3VA 4HBQA 4LEOB 2NW3A 2PXYD 5GGRB 3QJHA 2G60H 2NMSA 4JFDA 3Q6GH 4LEXL 3MLPA 1WIPA 3GMLA 5D1ZA 5FYJH 5JXEA 3IJHB 4X9IA 2YWYA 3RX5A 4GKSB 3KLHD 2OR7A 1B0RA 5IJVB 5CIPH 1HSAA 1I7TA 1DTUA 3G6JB 1G6VK 4KZEH 1VSCA 5HHXL 4NNXB 3DRTB 4NCDA 3AGVA 4P4KD 1N59A 1F02I 1ND0A 5KG9A 3BIKB 4XMLH 4QHNB 2YA0A 2Z8RA 1IVLA 4RFEA 4XPAL 2IH1A 5TH2A 3VXQB 1G7HB 4ZSOA 1ZXQA 5ADOH 3OJVC 3FCTA 1H3PL 1K8DA 2SEBA 2P7TB 2D3VA 1XF4A 1EHAA 1QVOB 3E1F1 5JPMA 3WHE0 4ZDHB 4M93C 5EZOL 5JR1H 3I6LE 5J3HD 1X9QA 2UWEB 5D1QB 4HQQH 5EZLA 3U46B 1AGDB 3DBXA 4OQTL 4K7FB 1AR2A 2VDQH 1CGXA 3AB0C 3IJSB 5AYUH 4GKZA 3MBEB 3PWVB 3FTGA 3T08A 1J8KA 2XKNA 4Y4FC 4Z7WE 1P4LA 5CD5D 1HWHB 3BKMH 5JQHC 2ADGA 3CIQA 2MKWA 1I1AB 4F8QA 1UT9A 4ZPTB 3TH4T 1EVUA 1QEWB 2A6KB 2N56A 4I2XB 3GJFA 1JHKL 1P1ZA 4NZUH 2XT1B 4POYA 3SOBH 1N3NA 1CFNB 5K9JL 3IS1X 5E8DH 1BZ9A 1VDGA 2AJZB 2BNUA 4OKVA 1FG2B 5DUML 4F33B 1S9WA 3H7LA 1CLYL 4ODXB 4GAGL 1D5BA 4P2OA 5F1SA 3QDMB 4Y2DC 4U1GC 1RZJH 5D7JB 4OLUL 1JTPA 2LAAA 1PQZA 4M03A 4FTVA 1OOAA 2QKIB 3ZE0F 3SDXA 3GSRB 1P5VA 4GW5A 4MJ5B 5D1QD 4TULL 2VLRD 3MNVB 4X9BA 4OGXL 4X6BA 3FONB 2XZAL 3GBML 2IALB 3UC0H 1OQOA 5IVXE 3TT3H 3PGCB 1MF2L 1E4JA 1IGIH 5HGAA 2CPCA 2ESVB 4M3JA 3TN0B 7FABL 1I1AD 4MDIA 5GHWL 3ZE2E 1OP3H 2P1YA 1YEFL 5IW6A 1MUJA 4NN5B 4P4RB 4U3XA 1IZKA 1LP9F 3GHBH 4PV9A 1Q9WB 1L7IL 3BPCB 4XH2A 1FLTX 4OIAA 4YHNB 3QCUL 1KJ2H 4JN2A 1II4E 3AS2A 5ENWA 5GZND 5DMIH 4EQ3A 2OJZH 3EBAA 4HWZB 2D0HA 1IAOA 3ABZA 3AXLB 4W81A 5L8KB 5D7JD 4H0GA 2FB4L 2WUBH 3BVNB 4AIXA 4HJ0D 5D72L 3KPSE 5JA8B 4HXBL 5EORH 4PRNA 3HLAA 1HKLH 1BQUA 3RUGB 5GSVB 4Z0XB 1MJ8L 4YBQD 2X2YA 5FUZL 1WISA 4YEEA 1NFDF 3TVMC 1FZJA 4ZNEA 4JRXD 1IC4H 4FQ2L 3MGTA 2Y9RT 3V6FA 2ESVD 5AEAA 3TN0D 3OJDA 5LQBH 4B50A 2B7DT 5EUOB 3EGSB 4KXZI 1ULVA 1NEZB 3P4MA 4K9EL 4NP4H 5T1KB 4W4OC 4YXHL 3KNBB 3B4NA 4Y2OA 3X3FH 2VISA 3TH2T 4F8TA 1KN2L 4P23C 1NLDH 2DQFB 3VXPA 4WI3A 4MJ6A 32C2B 2WQRA 1G9MC 5HHOE 4PJ9A 1MCJA 1U8PB 1KGCD 2Q76B 1LQSR 3NGBB 1AR1D 4MDJB 2EIZB 1JWUA 2E9WA 5D9SA 1G7LA 3IU4H 2JJVA 2AK4E 3OHXB 4MD0A 2R0WL 1XGYL 3RWJA 4FFWC 2HFFB 1QLRA 3QXAA 5C0FB 1U8MA 5L2KE 4OLVH 3QDJA 4IOSD 4BJLA 4CJ0A 1RJLA 5MI0B 2DJ4A 3EYUH 1RUQL 4AG4L 4TTDD 4CGTA 4S1DC 4HGMA 3IFLL 4ZG1A 2VDRH 3MRHB 3V0WL 3UTTA 1CGSL 1A3QA 4HK0A 4KKAC 4LHQB 2FEDC 4LVOB 3S8WA 5T1KD 3KJ4B 4M6ML 4AZ8A 5DR5H 1HZHH 1J1OH 5D7SH 5I1CL 4L4VE 3GSNB 3DX6B 5SWZB 4JPIB 3EHBC 3SGEH 5ISZA 2PYEB 4YPGB 1S3KH 3RNKA 2D7MA 5ID1B 3VMPA 4PLNC 4OSUL 2GAZB 1LE9A 4BKLA 2Y6SD 1KT2B 3GGWA 4ZUSA 4K7PY 3S36X 2OMNA 4WW2B 3DVNA 3KJ6H 3C5ZB 1SY6A 1T3FA 4XVUD 5HY9A 5AZ2H 5DJXB 1MFCL 5I1LB 5E2UH 2YPKB 5JOFB 4LCWE 4NRYB 4CW1B 2HN7A 4PREA 1MQKL 4JKKA 1LNUB 3UJTL 2AQ1A 5INCB 1NCNA 2VIRA 2ZPKH 3CC5A 2DQCL 3GI8L 2FX9L 1AE6H 5D1XB 4KJQD 4XTRC 3RA7H 2J6EH 3SO3C 4HBCH 1NGXA 3EYSL 5DZNA 3BN3B 4MJID 1UCBH 1IMHC 1J0JA 5DD0H 3BN9D 2APFA 4ZFFA 1YEJH 2VITA 1U95B 5I71B 4BSWA 1YC7A 4M61A 5IHUH 1YN6A 3NFNA 2AW2A 4MX7B 3QI9D 4P2QA 5SWZD 2AJVH 5E6ZA 2PYED 3CXHK 4OQTA 1HN1A 4ONFL 1TVBA 3GMQA 4M6NH 1BEYH 4ZOBA 5HHPB 4WI6A 1S7WB 4WHCA 1T89A 4FXKB 4G8IA 1DP0A 2DIJA 4N1CA 3IVKB 1VB9A 2BSSB 2FDBP 4GT7A 2QQLL 3AREB 2EKSA 4L4TE 1XGTA 2X5PA 3QXDB 1F3JA 5BS0B 1BJMA 5I0ZA 1MCOH 4PJEE 3C5ZD 3T0AA 5J11C 1IT9H 1KCLA 3VDAA 4QRRA 1IGTA 4TPRL 2EYTB 1OTTD 2PW2A 3NTCL 5D7IA 5FM5M 4JG1L 2WMPA 4QXGH 1DQML 2D9QB 3C2SA 5HD8C 1T6WA 2MQ3A 1KELL 1FN4A 4NWUH 1AGFB 5D1XD 3U7AA 3DYMA 1A7RH 1WGOA 4W6YB 1KACB 2W9DL 4XVSH 4XXCC 3GHEH 5ETUA 5TQ0H 4KRPB 3LKQB 4TVPE 2R23A 1DFBH 4Q97A 5I6XB 5HHQA 3TIEB 2XQBL 1QQDA 4QHMB 2Y07H 4LRIC 4XGZB 3HRZA 3DUUA 3HE7C 1NLBL 1FNGB 1XF5B 1PG7L 3P30H 4CJ1A 3FQNA 1YECH 5TF1H 1CXHA 3NFPB 3G5YB 4M9OA 5I8KL 4XNQB 3ARED 3MXVL 3Q5TA 4JPWL 1BFVL 5FKAA 1QNZL 5DEFA 1CG9A 4HIHB 3BZEA 2QL1A 2AJSH 3MLUL 3GMNA 1TJGL 1B4JH 1M4KA 2O5ZH 4KDVA 2KPNA 4L8SA 4EI5C 2V9QA 4OD3H 2DQUH 3EO1B 4LLUA 3MV11 5DI8A 1IL1A 5DJZB 5IB2A 3HI5L 2Z91A 3V4PL 5CGYD 4LHUA 1RZFH 3B3IB 3SE3C 5I73C 4L1HA 1M05A 1Q0YL 3BRGC 1RUPL 4XCYB 2BCKB 1AI1H 1T0NB 3M8OH 4PGBB 1IAIM 1ZAGA 4PRHA 4PP1C 2OX5A 4NBYB 4ZFGH 1EBPA 1QLEL 3L3IA 4GKNA 2O5YH 1CGTA 3OR6A 1GGUA 1HOCA 3FB6A 4YUEH 2YA2A 1PLGH 2PKDA 3KR3H 3SDDC 4X7DC 5JW4R 2X70B 4ZAKA 2W65B 5M94B 3B2VL 4MZ3A 1L9MA 1KIRA 4HSQA 3JV4B 4PJAF 3RL1A 5E8NB 1C5CH 1XT5A 1PVHA 5F6IB 1I7RB 4ZO7A 1F6AA 4XNXL 1SM3H 2R0KL 2R1WA 2NNAA 5C70A 5I66B 2JKXA 3FQWB 5JIHA 3H9SB 4NQCE 3ARGC 4OGZA 5K9OB 1RK1B 2E7LC 1X5KA 3LS5H 4HV8B 4ERSH 1C08A 4XMKL 5F6HI 3A6BH 5FOJA 2LVCA 3NMEA 1AD9B 1AQKH 4RAHA 15C8L 3BWAA 4UAOB 1CD1A 4NHCH 5DMJB 2RGSA 4JR9H 3KVQA 3N1MC 4I3SL 3PWNA 5H35A 2YKLL 5EO1B 5FK9A 3QIUA 3HCVB 4WU5B 3LCYA 3ZTJH 2EO1A 4NQSA 4ZPVB 4X8XA 4AMKH 1QFUH 3K80A 1V05A 1EXUA 5A3IC 3P4OB 4KUZH 3EOAA 2VDPH 4CVXA 4RGMB 4ACPA 4K3HA 5LXGL 2XXCB 4I18A 5DJAB 1EO8H 2IMMA 3NFSH 1NDGA 2BY2A 1OLZA 5DJ6B 4IIQB 1NCTA 3U0PA 3D85A 3EOTL 1YYLH 4P46B 2Q86A 3DX7A 4X9FA 3FO2B 5CGTA 4L8CA 5A40E 1XH3A 5MEOB 4BM7A 1A5FH 3L5XL 1DDHB 3ARFB 5D2NA 4KRNA 1S7QB 4DN3L 2R9HC 3WIHH 5D8JH 4DVBB 1P2CA 4M7ZB 3H9SD 2X7LB 3O4LA 3BZ4A 3OR7A 4OM0L 5FDWB 3S97C 1UZ6F 4D9QE 5GJSL 2MCPL 1T83C 4K7PL 5TGBA 2CK0L 2PYFB 5T1DL 3CVHB 3RZCC 3PWJB 2DQHH 3RNQB 4G8EB 4FQXB 4PJBF 1BJ8A 1PDKA 1FNHA 2VRAA 3UO1L 5I1EH 4YHLH 3WFEH 4JM2B 2AXFA 2IQAB 1NC4A 3WSQL 2BVTA 4Z7VE 5B8CC 5C1MB 1MFDL 1QPXA 2ZG3A 2AJUH 1I9RL 4F15C 1A7NL 3ULVL 1MCLA 2NZ9C 4PGDA 1TITA 1RIUL 2GQHA 3CFBA 3K8MA 3HHRB 3NZHL 1RAMA 3MO1A 3T0VA 5IBLC 5ALBL 3E2HC 3MODH 4GMTL 4P46D 3IB4A 3IF1A 5FYLE 3K81A 2XA8L 5IKCB 4BK4A 1FNEA 4RX4D 4HK3J 3Q0HA 5LGHH 5B4MC 2DM3A 4N8VB 3HAEB 3ROOA 1FO0B 3ARFD 3ARUA 1WFUA 4DFHA 1CXEA 3ZHKA 1E6JH 4OGYL 3RVVC 5DRXB 1S9XB 1RSFA 1FZOB 4Z7WB 4KI5E 1IJ9A 4J4PD 1QSVA 4Q58C 1PKQA 3KPRA 3MMEB 3KS0H 2X41A 2MWCA 4LOUC 2A83B 5J8OA 5A43C 4FQXD 5IOPA 2NTSP 5IFHL 4XPBH 2A0LC 4D0CA 1M7XA 1PSKH 1H8NA 4JM2D 2XPGB 2I9TA 1HH6A 2NLJB 3QULA 2ZSVB 3OKOB 1I8KB 3KPLA 1BZ7B 1EH9A 2WBJC 5GGRY 4HCRL 4OUOA 5M7QA 1C7SA 3BPNB 5FM5O 2AQ3A 1RPQA 3GB7A 3MCLL 4LP4A 1WQVT 1UKTA 4AL8L 4OT1H 5DJ2A 1HHHA 3WN5B 3MRLA 1SJXA 3MLZH 5BOPA 1F8TH 5IMMB 3H9ZA 4JZJC 4PJXA 4GBXC 1OSPL 3CJJA 4OCSH 5DJ0B 1X6LA 1NANI 2GKIA 2UUDH 3Q3GB 2EE9A 1L7TH 5B3NA 4I0PA 3CSGA 4RMWA 5C3TA 4H1LB 1SBSH 1X5IA 5IVXB 2DS4A 1XFPA 2XXMB 3RTQC 4AIOA 1EEQA 4WY7L 2J8UE 5C08D 3RWDA 5C09E 3ORJA 2IPUK 4OLWH 4PGEB 4M00A 2VNCA 2FYYA 2XA3A 1F3RB 1TPXB 4KXZH 4R2GC 1A9EA 1R0AH 3RIAF 4PJCF 2GSIA 2R1XB 1SVCP 3VW3H 3DRQB 1YDPB 5FKPA 1U8OB 5EPMB 3LN4B 1IGJA 2DN7A 3L7EA 5IQ7H 1UCTA 1U91B 1UZ8B 4HT1L 2HLAA 4Y5XC 1QR1A 1KENL 4KJYB 3QPQD 3KPSB 3TA3A 1JTTA 4CL7A 4PTTB 4QOKE 4WTZA 4PLJD 3G6AB 3ISWA 4S1SH 5AZEH 3NPZB 2XKSA 3TZVA 2ORBH 1SJHA 3BGFB 2OXHA 5B38A 1A14H 2I25N 3QCTL 4U6VL 3E3QC 1G7IA 2CLVB 3T0EE 1A6TB 4RFOL 4JN1L 5C0IA 4R4FL 4NQXA 3GJEA 4OJFH 2R0LL 2GK0A 4QWWC 4U49A 3MYJA 4A6YL 3CDYA 2Z92A 3CFDB 5LBSH 4ORGA 5GGUB 2VDKH 4EEEA 1AH1A 5HHOB 2DMCA 4RMSA 2X4PA 1ZTXL 4LCIL 1HNGA 2H9GB 2VO5A 2FR4B 2A1WL 2EDRA 4Y89A 2OI9C 1K6QL 4I77L 2AEPL 2AK4B 2B4CC 2V2XB 3OB8A 3FAXA 4NNYB 3T09A 3KPSD 1U8KB 4KVNH 2PR4H 4GXVH 3S98A 1MFNA 5L2KB 5F7EH 2HT3C 4X4ZA 3QJFB 5JORB 3DROB 1U8LA 2QR0A 5GGSB 3U4BH 1RZJC 5T3XL 2EYSA 1NMCB 4TSBL 1AXIB 4P3CH 1BVLA 3QUZA 5D2LE 5EFIB 5K59E 5GGQH 2Q6WB 1NGYB 2IG2L 2CK2A 1A7PH 2C4FU 4G6AC 4G43B 3HS0A 3OB0K 5CIPB 5CEXB 4N0RA 2YN3A 3LOWA 3TO4B 1P53A 4QRTA 1EEYB 4YO0B 3WEXA 4TUOB 1MOEA 5C9JA 1I3GH 1ZLSH 4L4VB 4PRAB 2W92A 5HPMA 2CXGA 4LNRB 4JZNA 5HHOD 1IEAA 2V17L 4HDIA 4PJ8A 4F7CA 1N5YL 1I8IB 4ZTOH 1KBGL 5CCKH 2WWMD 4Y16A 4GG6A 1EFXB 1JPTH 1H5BC 4R8WL 3QT2A 4DZBB 1G7JB 3ECBB 3EYVA 2AK4D 4M8QA 2X4QA 2A6JB 5H2BA 1A6UL 4NUJB 3O6ML 1U8QA 1XGUB 3GJFH 4DGIH 3ZT7A 3GEWB 1S7XA 3CXDH 3MUJA 5L2KD 4AEEA 4LCWB 4DEPC 1HHJA 2W1NA 1U92B 4CMHC 1E4KC 3QUYC 5J1AA 2RFXA 3LPFA 1J12A 1LO5A 2BOBB 4ENED 5BRZE 1ZA6B 3TNNA 1JI2A 3NACL 3S35H 5DVLA 1IGCL 2UVFA 4HPYL 5E8PB 1WWCA 2Z35B 4JGUA 4UT7H 5T33L 4KHXL 2HJFB 2YPLE 4ZQKB 1ZLWH 3FN3A 3TPKA 1DCLA 4KWUA 4QNPE 1G7MB 3TO4D 1D5ZA 3AMLA 4NHUB 4L4VD 1OGAE 1N8ZB 2LQRA 4LPVA 2Y72A 4R6UA 3KPPA 5IHZA 4DW2H 1N6QH 3QXUA 3WKMH 4X8JB 5EU5B 5ADPL 1QKZH 3FT2B 4HJJH 4QTIL 2IGFL 1MWAB 3RDTC 3QR2A 2Y5EA 3VXOB 4O2CB 2DRUA 4L4TB 4I48A 3HNSH 1CK0H 4PJEB 3DMMB 2DB8A 5KSUB 2Q3AA 2W9LA 4LBEB 1QSFA 3MOQA 2OTUB 4LCWD 1LE5B 4LCYA 4WCYL 1EGJH 4NKDB 2CGRL 1YYMH 3FT3B 5C6TH 5DRWB 2APTA 4LCUA 2B1HL 2ATPB 1XIWA 4HFUH 3BP5A 1ZHNB 4OZHA 3W9EB 2G2RB 4QTHA 1NSNL 1NAMA 2ZUYA 1G0DA 1TXKA 1C7TA 1TCMA 3O9WA 2IBZX 4Q9RL 1V5JA 1T1YA 5E7FA 4XX1G 4ODWB 4GW1A 3SDCA 3A67L 3MLSH 4GRLD 1AJ7L 4HF5L 4F57L 1KIQA 4FQLH 1KPVB 1T66D 3S9DB 1NFIB 4XAWL 5CJOH 2NR6D 3T0BA 4Z8FH 3PP4H 5DJCA 4K07A 5JIIA 5D4QA 1KJ2B 1MCNA 4F2MB 1MCWW 3QWOB 1FYTE 5C07E 5EOQL 3HR6A 4OF0A 1P4BH 5CBEB 3VI3F 1R5WB 5E5MB 1L6ZA 2E5EA 2QHRH 3SBWC 4PJHF 1KB5B 3MRFA 3SN6N 3BW9B 1MRCL 4L4TD 4HUWA 4LVHC 2EEBA 5FO7A 3DMMD 1PJ9A 3HFMH 3C5SB 3F5WA 1WFOA 2A9NL 2AQ2A 4KKLC 5FV2A 2N7BA 4ELME 1BVKB 1U3HC 2OP4H 3QEHB 1WBZB 2WW8A 3MXWL 4KQ3L 3L5WB 5EN2A 1PZUB 1BBDH 3LD8C 1N0LA 3VXSA 1PYWB 1F4XL 4UU9A 1QFWH 4QHLA 5ALCL 2BDNL 4WHTB 4P9HL 1KTLB 5EIQA 5HYJE 5IBUB 4NSKA 4FFZH 1C12B 4JGMA 4YNYB 5CZVH 2BK8A 3MRBB 4TNWK 2YD7A 4P59L 1ZA3B 1P7QA 1I1RA 5D6CB 3LZFL 4TTGA 1HKFA 2VXQL 3T2QA 4TVPD 1E4WH 5DMKA 1W0WA 2XY2A 3LIZL 3SQBA 3S4SA 1RIHH 2AEQL 2IPTL 2PW1A 2XQYG 1DLFL 4JKPL 4NBXB 1ORQA 4OF7A 3ALWA 3LV3B 3BKCH 4NC2B 3WMSA 4NO5A 3H9HA 1NMAH 3I9GL 2I60H 2R4RL 3O6LL 2A74A 1ZGLM 4GG8B 5T3ZL 1TLKA 5BV7H 4FQ1L 5EDXA 3FB7A 3Q6FA 4LLWA 4Y19E 5EZIH 1HEZB 1OL0A 3H7BA 2XN9E 4A6YA 3SCMC 2R8SH 4I5BA 4GKOA 4UQ2B 2HTKC 1MNUL 1S7RB 4IOFD 3QPXH 4MNGA 1N0XL 3PHSA 3JV0A 3RVTD 2VXSL 4LMQI 4CKVX 1FQ9C 4PRPE 5KAQF 1CIUA 5MERA 1LK2A 4NQCB 3UTQB 3QUXB 3MRKA 4LEXH 1YMMA 4U3CA 4G6JL 5DFVD 1RK0A 4XPGL 1Q94A 4QT5B 3B9KD 2VH5L 4HIIB 3L7FA 2X4UA 1Q9OA 3N1QC 3LKRB 5L7XL 3SDYL 4HS8L 1CICA 3C09B 3ZO0A 4F9LA 1NJ9B 5HHXH 4URTB 1KYOK 2GHWB 2VQ1B 5CSZA 4RQQB 2DWDB 2IAMB 4L9DA 4DWHA 3VXTA 1CDUA 4U6YA 3KYOB 4F58L 1CDCA 1RURL 1LEIB 5J06A 5CP7B 1H3PH 3P2TA 5IW1B 3BYYA 5EU3A 2VKWA 3ULUC 3EUUA 2WLYA 3R0MA 1RJCA 5EZOH 1DQJA 2ARJA 3EYQC 2VDML 4X6CE 4RBPK 4E41E 2VWEE 4OQTH 3IDXL 3C6SA 3OF6D 5FYKL 2DI7A 1HDMA 2GJZB 2I07A 4NQCD 3MSPA 3QUXD 1SMOA 2R2CA 2PO6B 4Z7OF 3QAZC 3V6BR 1ACYL 3TNMB 3PL6B 1UKQA 6FABL 1U2HA 1MELA 2H8PB 3S34L 1QRNE 3BX7C 2P44B 4QYOB 4TUJA 3RZWA 1JHKH 3H42L 3RKPA 5IB3B 2HKFL 2X1XR 1HYRC 5K9JH 5EC1B 3S5LB 1H3XA 2FBJL 2IAMD 4Z7VB 1ES0B 5DUMH 5C0DA 4P5TB 1CLYH 5IFAL 2DQGL 4UBDC 2ICEA 4GAGH 3WNNA 8CGTA 4IHOB 3U82B 4UTBL 3JTTA 4WWID 2PXYA 4FG6C 3O8XB 3QIBC 4OLUH 4HWNA 3AVEA 4A2MA 4Y1AE 4D0DA 1DSFL 4X5WA 1CU4L 3CFEB 1IQDA 2P42B 5F9WC 2ZWLT 1HILB 4TULH 1INEL 2DKSA 4MWFB 4Q6IC 2EE6A 2CIKA 3MGOA 4EN3C 4OGXH 2XZAH 1TQBC 3GBMH 4MA8L 3VFVA 3AY4C 4XT1C 1MF2H 4D9QD 3PL6D 4P4KA 4PR5B 4R96B 4YXKL 5J13B 2VLME 5EBLA 4Z78A 5GHWH 2X4SB 4MCZA 1NCWL 5EOCJ 1YEFH 4LGPB 3MLRL 1JGEA 1P9MC 2P48B 1T21B 1A4KB 3U9PL 4I4WB 1L7IH 1KPRA 3QCVL 1IM3B 3QCUH 1CDBA 4P5TD 3SJVD 2CD0A 3GSQA 3DYPA 3GSNL 5EUOF 4HS3A 2D0FA 3BP7B 3GKWL 3DV6B 3IETB 4ZUTB 3O11A 3O8XD 5GGRA 5FYKU 2FB4H 5GISL 3SQOL 4NNPL 1BWWA 5FYLD 1DEDA 4HC1A 4EI6A 3U4EB 5D72H 2ICWI 4HXBH 3RJQB 3IJHA 4GKSA 3IXAB 5GRVK 3BPOC 5IJVA 3PP3K 1YJDL 4QO1A 3D25A 3NBNA 4PBWD 1MJ8H 5FUZH 2YUXA 4KI5D 3CDCA 4X4MA 5DS8B 5D5MF 3DRTA 4Y4KB 5ICYB 2J8UB 4FQ2H 5C09B 3RI5K 5J9PB 3BIKA 4KC3B 2CJUL 1G9NL 3ZKND 4K9EH 4DAGL 5E0QA 3VXQA 3Q5OA 3GK8L 4D0BB 2JJSC 1OF2A 3BH9B 2CDGB 2P7TA 1KN2H 1I9EA 3RVWD 2DL2A 1A4JB 5FCUL 1QVOA 25C8H 1QHOA 3ARXA 3BUYB 4U0RC 1FFOB 5C92A 4ZDHA 4K8RC 2UWEA 2R29L 5D1QA 1U2CA 5F72S 3BIAX 2VLRA 1GH7A 4K7FA 3IJSA 1D5XB 2YD3A 3MRCB 1I4FB 4R97C 1JYNA 3MA7B 1XGYH 1TVHB 4QOKB 4YFEA 2LU4A 1IKNA 3QEUB 1I1AA 4ZPTA 1QEWA 2P8MB 1F3DH 4I2XA 4FQPA 1AQDA 1R5VB 3W9DB 4DKFL 2M2DA 5HGHB 3QXVA 4YFLI 1I7ZA 4AG4H 3PV6B 1CFNA 3T0EB 3IFLH 4WW2F 4Y4KD 5MEQA 5C09D 5I1DB 1ZK9A 4HUVA 2AJZA 2EDKA 3LKPA 3V0WH 5IJKC 1RUAL 5FIEA 1CGSH 5LCVL 5GS0C 4NN7B 4NZTL 3V7AG 2HWZL 1JUFB 4ODVL 5D70L 4M6MH 5EBWB 4FQHB 2C7UB 1U8JB 5D7JA 4WO4C 2H2SC 4WVRA 5I1CH 3L1OL 3FFCE 1U9KA 3PIQB 1G0XA 5F9JA 2QKIA 3GRWL 3K1KC 3GSRA 4YC2C 1I1YA 2WWKO 1XF1A 4MJ5A 4OQ1A 4DK6A 3MNVA 4OSUH 5JHDE 3OJMB 1VFUA 1EA9C 5JZ7C 3MQIA 4OM1L 4JRXA 3PGCA 4QOKD 3PF2A 1WAAA 2ESVA 3TN0A 4F7PB 1MFCH 4HPOH 1KOAA 3QQ4B 4YGVB 3C9NB 4IRJB 1MQKH 2A73A 4P4RA 3UJTH 2A6DB 2FLBT 1UM5L 3T0ED 2DQCH 3GI8H 2FX9H 1Q9WA 3FMGL 1CBVL 3BPCA 4YHNA 1S9VB 3BT2L 2GTWB 4NO3B 3BH8B 3EYSH 5C6PB 3M1BB 3TYFA 4K55A 4GRMB 2QEJA 1T1ZB 5IM7B 2V5SA 4HWZA 3AXLA 4N90E 1I8LC 3GIVB 3BVNA 3K8LA 3P3YA 3SGJA 4ONFH 3OKMB 3E3QE 2WUCL 5HYSB 1P69B 4KRLB 2KUTA 3RUGA 1IILE 1FL6B 1KNOB 1VCAA 2X6MA 2XACC 5GSVA 1P7KB 4JQXC 5J1SC 2QQLH 3HUJF 1CXLA 3ARBB 3JWOC 3N06B 4X6DF 2D7QA 4XP4L 4XC3L 4P23B 4TPRH 2CIIB 1Q72L 3NTCH 5T1KA 4JG1H 3CU7A 3KPTA 4OIBA 4QHKJ 5BRZB 1D5IL 2R15A 1KELH 3BZFB 4MA7L 5F7KC 1NUNB 4E42B 4P5MB 32C2A 3HPLB 3SE4C 1U8PA 2YPLB 2W9DH 4JY4B 2Q76A 2EE3A 4ETQB 1TJHL 2WP3T 3EFFB 2CH8A 5HGGS 3W5NA 4HFWA 3PDDA 1EK3A 4X9GA 3EAKA 2XQBH 4D8PB 1T1WB 1CR9L 2XY1A 3S4SG 2HFFA 1NLBH 1PG7H 2D4DA 5C0FA 3BHBB 1FLRL 5GGSY 4YDJB 3L3HB 5FO8B 1BOGB 3HN3A 5I8KH 3MXVH 4BQCA 2LTQB 4JPWH 1BFVH 3T1FA 3AROA 1PX4A 1QNZH 2D7NA 3ARBD 3MRHA 3BKJL 4QKXB 4AY0A 3MRIA 1TJGH 1CGVA 4P23D 3QIWB 4P49A 4MJIA 4JHZA 5CEYB 5D1ZC 2BVPB 3DXAE 5JXEC 3JV5A 2BVQB 2F54E 1FPTH 4KFZC 2F9BT 3QI9A 3GSNA 3DX6A 5SWZA 4BFEA 2PYEA 3HI5H 3V4PH 3G04B 2YPLD 5ID1A 4FFWD 4UILL 5EO0B 3U2SB 1Q0YH 2GAZA 1RUPH 4MB4A 2A77L 4KY1L 1O0VA 4IJ3C 1OGAD 4MQSB 5KSBF 2FECI 4OTXL 4RISL 1S5IL 3CVHL 3C5ZA 1FYTB 5DJXA 5C07B 4S1DD 3UAJD 1AD0B 2B0SL 1QLEH 4AT6A 4YHZL 5JOFA 3BEVA 3BJ91 3QYCA 4AH2B 4CW1A 4J3XA 1LNUA 4KMTL 4QY8B 8FABB 3UTZB 3MA9L 1KIPB 2FO4B 5CD3B 2N7AA 5D1XA 1MCFA 3QEQE 3O3UN 3B2VH 3QIWD 3EHBD 1YN7B 1U95A 1HXYA 2Y06L 2J8OA 4KI1A 4TSAL 3CSYB 4L3CB 4XNXH 4MX7A 2R0KH 5HYJB 1H8OA 3DI3B 5BW7A 2IANE 4EUPA 3ZT5A 4H0IA 5HHPA 4XMKH 5E08L 1S7WA 1I85A 4BH7B 3CNKA 2GSGB 4H5SB 3IVKA 2BSSA 3G08B 15C8H 4LPYA 3GI9L 4TN9A 2V2TB 4MMXC 3AREA 4UMGA 5D7KE 4XI5D 3IKKA 5EC2B 2YKLH 4KKBD 4PIRF 1MCKA 4Z76B 3IYLW 4G8FA 1WBXA 2NW3B 3F8UB 2VLJE 5HDBE 5C07D 1BHGA 2VZVA 5C0NC 2G75B 2YUVA 1LO3H 1YQVL 2EYTA 4JFDB 4XTRD 1P7HL 4NT6B 4NJ9L 3MJ9L 2K9UA 3T0WA 1DBBL 12E8H 5LXGH 4RGNC 1AGFA 2DQEL 1F90L 2XN9B 3V4VH 1I7UB 3EOTH 2XZQL 3CUPB 1P5UA 3MRJA 4LFHG 3OAZK 2VDLL 4XBGB 2OYPA 3L5XH 3LKQA 3GRWA 4YQXL 4DN3H 3TIEA 4LVNB 4QHMA 2IWGA 5DUPL 5TH2B 4HULB 3TIDB 4XGZA 4OM0H 1XF5A 1Y6NR 1N5AB 1SHMA 5GJSH 2MCPH 1RZ7L 3NFPA 4K7PH 2CK0H 3G5YA 1YNKL 5T1DH 3S37L 2ENSA 3O4OC 3VWJB 1A6VL 3UO1H 5I15H 3PABB 4HIHA 4Z0BL 4TUKL 4M48L 4NKQB 3WSQH 4KK6C 5EOCL 3N9GL 5F7HA 1AXTL 4HUUB 3QHZL 4WRLA 1MFDH 1MREL 3LDBB 1I9RH 1MFBL 1A7NH 3ULVH 3PDOB 3EO1A 2GUOB 5F8QC 4K7PX 4Y19D 3LRGA 1RIUH 5D71L 1FNAA 2XN9D 3T2NL 3NZHH 1NBQA 2DTSA 1CD8A 5ALBH 4TNVK 3MZGB 2R1YB 4GMTH 1NGZA 2OK0L 2XA8H 3IAQA 3MFGB 3F7YA 1AHWA 4X6CB 4K71B 4DN4L 4E41B 1BZ9B 3HE7D 5E4IA 2UYLB 4PRPD 1S9WB 5CSGA 1T0NA 3QO1B 3G5ZA 1MVFA 3ZSTA 4OGYH 4R4ND 4KJWC 4N1HB 2V7NA 4P2OB 1Y18B 2JJUA 3MOAL 1QRNB 1ITBB 4KK8C 2MOVA 3SDDB 1IQWL 1T7XA 4W6WB 3SDXB 4M1GH 2A9ML 3VWJD 5KS9E 3RP1A 5JDSA 5FOBB 5IFHH 4M7LT 1I8MB 2DYPB 2NY5L 3MLVL 5C9KA 4X6BB 2X70A 3UBXA 2W65A 2EICA 5KAQG 4JO1L 3SHSA 1FRGL 3JV4A 4K3EL 2P5WE 1YEDB 4XB7A 1BREA 4HK3N 2DF3A 4HCRH 1WT5A 1F42A 4MDIB 2F8VA 4N0CC 3QHTC 4HWBL 3MCLH 5I66A 4Z7QE 3H9SA 4AL8H 3WE6A 5K9OA 4BQ8A 1RK1A 2CMRL 4NO0B 3SE8L 4P99A 4PP1D 1OSPH 4OZIE 4E41D 4UI2A 1AD9A 4JFZL 1MHEB 4XH2B 4LK4A 4I9WE 1GJIA 3MZTA 2EZ0D 3O0RL 5EO1A 3RBSA 3C60C 4XPFL 2CRZA 3HCVA 4P2OD 4WU5A 5JUEL 5BJTB 4WY7H 4LDLB 4ZPVA 5C86A 3ZDYE 3LKSA 2IADA 1GGYA 1QRND 3SDDD 3P4OA 3ULUE 4AQOA 4PRNB 2L0DA 3HLAB 1T04A 3FO9B 5C0JA 4MAYB 3MLYL 5DJ6A 4IIQA 2DYPD 1SMAA 3KHOA 4P46A 3MV8E 1DN2A 2ILLA 3FO2A 4RX4A 3WXWL 2X4TB 4RDQF 1NCUA 3MGTB 1ZVYA 2A6IB 3ARFA 1S7QA 2X1PA 5DURD 4HT1H 1NBYB 2X7LA 1KENH 4J4PA 4Y1AD 4NO0D 5FDWA 4DCQB 1J0KA 2VC2L 1WWBX 3QQ9C 5I1IL 2PYFA 3CVHA 4M43L 3PWJA 4NKIL 3SEPA 3RNQA 4PJ9B 4G8EA 4TYUA 4FQXA 3TPUB 3QCTH 4U6VH 3INUL 4X98B 4LMQE 4MVBD 4UINL 3IDNB 4YIQA 4JM2A 2IQAA 1G1CA 2VLMD 4JN1H 4JFOB 4RFOH 5LWYL 2KQMA 4X4XB 3O6KL 4XCFL 2BNQE 2R0LH 3IRPX 3RWJB 1HIML 4A6YH 1OAKL 1T89C 4MAYD 5DRNB 4WEMB 4R4BA 2BHUA 5CJQL 3RY5A 3SGDH 4OAWA 5IKCA 4XB8A 1ZTXH 4LCIH 4YBLC 2A1WH 4N8VA 5BV7B 2RBLA 3BKYL 4MQ7B 1K6QH 1UB5B 4I77H 2AEPH 1A0QL 3MLXL 1IC7L 1S9XA 5DRXA 1FZOA 4Z7WA 1MWAL 5DUBA 5DDHA 3WLBB 5CLWA 4I3RH 5C08A 2NX5D 5DK2B 5FUOL 4PD4J 5ISZB 4V1DE 5J7CC 3RNKB 1CFSB 1NCDL 5T3XH 2P8LB 4TSBH 4J3WA 5F1NA 1NEZG 3CDGB 2NZ9D 2XNAB 2IG2H 5TDNB 1UWEL 4ZUSB 2CKNA 3FRUA 3PHOB 4HH8A 3VFGL 3OKOA 2YD6A 1F58L 1I8KA 4JHAL 1T3FB 1BZ7A 5CEZH 4GBXB 3UTPE 4UUJB 5FGBA 1ZLUK 4TQEL 4YHPB 3FFCB 4KAQL 4ETYA 4TVPL 1JHLL 3WN5A 2V17H 3UTOA 3TJHC 2MQ0A 1N5YH 2VIRB 3CC5B 4KMQA 1KBGH 5DJ0A 1ZOXA 3U36B 5HGDB 5JHDB 1OM3L 3Q3GA 4HG4J 4H1LA 4L8SC 4ZOAA 1E28B 5IVXA 4EJ1C 3DSNA 4GRWE 5HVFB 1KB5L 3KXFE 1A6UH 4ZFFB 3O6MH 4M61B 4YDKL 1QFHA 3CZJA 3MLWL 1JPST 2A0LD 2OR8A 4PJ7F 5DTFA 4D9LL 4PGEA 3ARYA 5I30L 5IB1B 1MJJA 1TVBB 5H37H 1TQCC 2WBJD 5D7LE 3NACH 1IGCH 4HPYH 5IW3A 4PV8B 3BQUC 3DRQA 1XGTB 1YDPA 1U8OA 3QA3B 3KYAA 5T33H 4KHXH 1C1EL 1NUDA 5EPMA 3LN4A 3D0VB 4YZFE 4HLZH 4LLVB 4PJIF 4GBXD 1U91A 1UZ8A 2DD8L 3NPSC 2X44D 2ZUQC 2PW2B 2H1PL 3FFCD 5F7LB 3RBGA 4KJYA 2ITCB 2YZ1A 3KPSA 1N4XL 4JO4L 4PTTA 3T04D 4B0MM 3WDIA 3G6AA 4LF3B 5ADPH 1FN4B 5IIEA 4K9EC 5JHDD 4QTIH 2IGFH 4ZAKC 4UNVA 4IRSB 1VFAA 1WIUA 5L0QB 3ARSA 1F5WA 4M7JL 5BMFL 4GS7B 2W0LA 1NH6A 5ETUB 4MZ2A 4JRWA 2VQTA 1Z3GL 4JG0L 2WM0A 1NQBA 2CLRB 4GQ9L 4WCYH 4LASL 4D94A 1H0DB 2CGRH 4IDJL 5I76B 2FEEL 3STZB 4ODBD 3CFDA 4LCCB 3FQNB 3RWGB 5GGUA 4YDIL 3U0TB 3PWPE 4XVTL 1T7VA 5E70A 2VXVL 1T20B 2XIDA 4QGTA 1IAII 1NSNH 2P8PA 1YPZF 1U8IA 5HHOA 1G0YR 5D96B 5L6YL 4WEUD 1S9YB 3X17A 3TBYB 5FKAB 2F74B 2H9GA 5E2VL 5DEFB 1OY3B 5C0RL 2FR4A 4Q9RH 4IDLA 3A67H 4HC1H 4HWBA 3BGMB 3SDAB 4L3EE 3SKNA 1AJ7H 4HF5H 4F57H 3LS4L 1EHLH 5GRJL 2AK4A 2V2XA 3S36L 4XAWH 4WUKL 4NNYA 4WWKB 4O4YH 1BIIB 1U8KA 3R06B 4GXUM 1SEQL 2OXGA 2OL3L 3R0NA 4WFHE 5L2KA 5EOQH 1R3HA 4IRSD 5JORA 5SWSD 5GGSA 1MRCH 3LB6D 3MPCA 1B6UA 3VFOB 5TE4L 3GDBA 5D2NC 5EFIA 1FNSL 3MNZB 2Q6WA 1NGYA 2A9NH 3UYOD 2QBWA 5K9QG 2NYYC 4KQ3H 4OLEA 4G43A 2YD5A 4ZNCD 3DXAB 4WV1C 4L3AA 5CEXA 2F54B 1JTOA 1F4XH 1NBVL 3TO4A 5ALCH 2BDNH 1KJ3L 4GKNB 4TUOA 4P9HH 4L4VA 2F53E 4PRAA 5JIPA 1HNFA 4LNRA 1CDYA 5DD5L 1X5XA 3OR6B 1HOCB 1I8IA 4M6OL 5L2JA 4P59H 5C0AE 4JKLA 3SDAD 3JWDC 3LZFH 5M95B 2VXQH 4X6FB 1A3LL 4DZBA 1G7JA 3ECBA 2D03L 3LIZH 2ADIB 2AEQH 2L7JA 1KIRB 2P45B 1T80A 3HRPA 4NUJA 1DLFH 4WWKD 2D2OA 4JKPH 1XGUA 2NY7L 3QH3B 1S5HB 2JB5L 4A2LA 4LCWA 3I9GH 1UH3A 2R4RH 1CL7L 1FL3B 5J0BA 4LKCB 3VGAB 2BY1A 2BOBA 4FQ1H 4P2CG 4BQ9A 1ZA6A 3OKNB 2WV3A 3NAAL 3QG7L 1FDLL 3BWAB 5E8PA 2Z35A 2FH6A 3QEQB 4M1DL 4U6TA 4WTXA 2GY5A 3PWNB 5H35B 3NIFE 2HJFA 1MNUH 5A2IH 1N0XH 3DXAD 3FZUC 4GAYB 5E8OB 5FYLL 5LVEA 4GRLA 2F54D 3P9WB 1G7MA 4OZGF 5T5NG 4YE4L 5CGMA 4U33A 3N1GC 4KK9C 4NHUA 4YHIA 5HI3C 1N8ZA 3NN8B 3K1DA 3RDTB 3EOAB 1MPAL 3FN9A 2RCSL 2ERJB 4G6JH 4L29A 4I18B 5EU5A 5KOVC 3FT2A 1H3VA 1PGRB 2IH3B 1G6RB 5J12C 4XPGH 3D85B 1MWAA 3BMVA 3O41B 3VXOA 4O2CA 5IQ9B 2VH5H 5DT1L 3ULSB 4L4TA 1VFMA 1EV2E 5L7XH 2PCPA 3SDYH 4HS8H 5AWNL 4PUBL 4PJEA 2YHGA 3DMMA 4J12A 1VESA 1OD9A 5KSUA 2VLJB 4FMKA 4LBEA 1N2RB 3VE0A 2JCCE 5HYIA 3UPRB 1LE5A 3WIIH 3QQ3B 3RX8A 5I74B 4NKDA 1BQHB 3BZ4B 1DBAL 1MRDL 3DETC 3FT3A 5DC4B 5DRWA 4F58H 5MHSD 1RURH 2YD9A 2ATPA 4RBPH 3W9EA 5CUSL 1MAML 1FFPA 3QEQD 2Z31B 1BWMA 1CT8B 4ODWA 3WNPA 5FO9B 2VDMH 3AS0A 1WFNA 1QSEE 4OBRA 4OFYD 5F1IA 1VKXB 1KPVA 3IDXH 3WHXA 1FHGA 1X7QB 5IR1B 5FYKH 1H9VA 5CINL 1NFIA 3ZYIA 3RDTD 3WJJA 4ZO9A 2IAND 1ACYH 4PGDB 4F2MA 1WCQA 3CCHA 4LPWA 3CFBB 1UACL 6FABH 1R5WA 3MO1B 3S34H 4X7EC 3LPGA 2X40A 1KB5A 3BW9A 1D7FA 3JTSB 3OTTA 4JREB 3H42H 5D7KD 3TP4A 1W8OA 3PJSA 4QRSB 2BRRL 2HKFH 3WHE1 3ROOB 5ACZB 2VLJD 1RZKC 5SX5K 5HVGB 2FBJH 2C5DC 3QEHA 1WBZA 3OAYK 1QRKA 3L5WA 4NOBA 4EXPX 5KTEH 3WO4C 2HT2D 5IFAH 4YK4B 2DQGH 1KCSL 1OD7A 1PYWA 1UJ3B 2RIKA 2AI0L 1QACA 4WHTA 1S7SB 4UTBH 3TZVC 3WS3B 3T2PA 1V8HA 3RWIB 5TDOA 1KCUL 1JRHI 4LP5A 5E8EB 1C12A 4YNYA 1KCVL 2Z31D 5IOPB 4PJFF 3BPLC 3MRBA 2DLEA 4PJDE 3RFZC 1DSFH 3VGFA 2HFGL 1CU4H 1ZA3A 3B8SA 5GXBB 5DJ8A 5D6CA 5CZXC 4YHKL 1INEH 5DHVA 3B9KA 2I9TB 5E4EB 3CSBA 4S11A 2FIKB 4AYFA 5KVDL 3MJ7B 4MA8H 1J10A 1Z9SA 3DVGB 4F9PA 3LV3A 3FO1A 1DUYB 2CSPA 5TPWL 2ARWA 3GB7B 3MLTA 5DJ2B 4J2XA 5H94B 2MSPA 4GG8A 4KKLD 4KK5D 1Z0NA 1U3HD 1NCWH 5TJWK 4PJXB 5KS9B 3MLRH 3PHQB 4JZOB 3H3BC 4J6RL 5ITFB 1MHHA 3U9PH 5ITBL 1HEZA 3KWWB 1BFOB 1D9KB 3D1MC 3QCVH 2D7PA 4UQ2A 2EEAA 1S7RA 4W68A 3GSNH 2P5WB 4BZ1L 2K3TA 2J3SA 4PGCB 3GKWH 1EFQA 3OF6A 5E99L 3PP3H 5GISH 2YBRB 3HAEG 4N8VG 4NNPH 2PN5A 3J7HA 3QUXA 4NQCA 3SQOH 3UTQA 3VXNA 3VDCA 2HJKB 5DD1L 1EUTA 2EEDA 3QUZC 2AABL 4OZIB 2GT9B 1KUMA 1YJDH 4M9PA 1C5BL 3LKRA 4MNHB 2VUOA 2DIAA 4XNMB 4JFHE 1A7OL 4HD9A 2NW2B 4RNRB 2VQ1A 4RQQA 2DWDA 2HLAB 2IAMA 3WD5L 5F6HJ 3SY0A 1QR1B 3LKOB 3G6DL 4PJ8C 2CJUH 3TA3B 1G9NH 1ZKAA 4DAGH 2Z8SA 3GK8H 1LEIA 2EDYA 5CP7A 2XKUA 4Y16C 4PD4K 3DI2B 1H3GA 5KVGL 5IW1A 2JJWA 5B38B 1D9KD 5FCUH 3MV8B 1O7VA 4MCYB 5GS1B 4K3DL 3FHAA 2DM4A 4KV5E 1SEBB 2P5WD 2R29H 4X4YB 4NDMA 3I50L 5C0IB 1OTUC 3NCMA 4NQXB 4J1UB 5T3ZE 4EUPH 2GK0B 3ARVA 5IMOB 2GJZA 3VRLF 1PKOA 4FRWA 4KUCD 4DGVL 3TNMA 4H1LG 1CF8H 3PL6A 3P9MB 1MJ7L 3MYZA 4G6ML 4JVPA 3DX9B 2H8PA 2JELL 1JF6A 3FFDA 4HIJB 4FFYL 3I3BA 3VGEA 1CZ8L 1AY1L 4I9WD 4DKFH 4MXWL 5IB3A 5E2TL 2D7TL 3S5LA 3TFKC 1RUAH 1B90A 2FCBA 2BNQB 3QIBB 4Z7VA 3ILPB 1GOGA 4P5TA 5LCVH 3SJVA 4NZTH 5GGTA 2HWZH 3ULUD 3ILQC 4JRXE 5D70H 4IHOA 4IMLA 3U6RB 4TRPL 4PRDA 3EYQD 4GLRI 3O8XA 1ZGLP 2HMIC 3L1OH 4XPTL 2CUHA 3OKDB 5IG7B 3MV8D 4EN3B 3GRWH 1MLBA 5T5FL 1UC6A 1HILA 1XGQB 3EO9L 5IFJB 1X4YA 2YXFA 1OAYL 1Z9OA 4XWOD 4OM1H 1ROWA 1XIWC 4UDUA 2FJHB 4PR5A 5F70A 4NBZB 4DUVA 5HPMB 1U8NB 3E6FB 4V1DB 5JW5A 3VWKB 3MV7E 4F7CB 5BVPL 3O9WC 2JB6B 2VL4A 4AQ1B 3IDIB 4OUUB 3VFTA 5DEGB 1RUML 5FYKE 1T21A 1UM5H 2MKLC 4M1CD 4OF3A 1A4KA 3AFLA 2W38A 2QJDA 3FMGH 3W39A 1CBVH 4XHJC 1CS6A 2BNQD 3QIBD 4MA1C 3BT2H 4NN6C 2XWBB 2EDTA 1SJEA 2BOCB 2UUDK 3DV6A 5IT2L 3IETA 4ZUTA 4BFGA 4N5ED 2BSRB 1MI5A 4UV4L 3QWRD 1JNHA 2UV3A 3K0WA 4ZUVB 3LSOB 3ARTA 1IGYB 3ZTNL 4EN3D 5J1AB 2RFXB 4KTEL 3GSWB 5DVOA 3O2DL 1LO5B 1B2WL 2VAJA 4XCNA 1DBKL 2WUCH 3IU3B 5C2BL 3IXAA 1P4IL 3D5OF 1CFQB 2X4OB 1DLHB 2AVGA 1JPGB 2WK2A 1OT2A 3K74B 4GRWB 4MD4B 3KXFB 1G1YA 4PLKD 1M6OB 5DS8A 4F7EB 4Y4KA 2OCFD 5ICYA 2J8UA 5SX4I 5C09A 1MY5A 3W2DL 1GOFA 4XP4H 2J5LB 4V1DD 1Q72H 3VWKD 1X5HA 1A1OA 1LP9E 4D0BA 5KVEL 1JV5A 3L5IA 5IHLB 1D5IH 3BH9A 1EEZB 2CDGA 4WUUE 1CE1L 5D7LB 2W60B 3D2UD 4ONGL 3DUHA 4MA7H 4PG2A 1A4JA 3BUYA 1FFOA 3TJEL 1TTFA 1I3RB 1J0HA 2VL5B 3REWB 2FGWL 4R0LB 4KTYA 1TJHH 3UTPD 5HYQB 2P24B 4LCYB 1I4FA 4NIKB 1JNLL 4BK5A 4MJIE 5I1JL 5DD3L 2AS5M 1Y0LB 3NIGF 1RU9L 1T5WB 4QOKA 1CR9H 3D0LB 1JGDB 1CQKA 4WW1B 4OZHB 5FHAL 3QEUA 1WEJL 3ZKXB 1FLRH 4Y5VC 5KJRL 2P8MA 1BFSA 3GMRB 1R5VA 3W9DA 5HGHA 1HHGB 4O5LL 1XR9B 1NFDE 1X6NA 1LDSA 5IF0A 1T1YB 3KXFD 5GGVY 3SDCB 3T0EA 3ROLB 2X1OA 4RFNC 5I1DA 1KIQB 3BKJH 2MFNA 3DO7A 2LU3A 2FEEI 1IC1A 1JUFA 2ICWB 4LIQE 2QSTA 1UJTA 5EBWA 1Q9LA 1R3IL 4K8RD 4FQHA 2C7UA 3PWPB 1U8JA 4PB0L 3L9RB 2NY6B 4JHWL 5D7LD 4D3CH 1UG9A 2AERT 3MRFB 3PIQA 5IWLA 5HI4D 1XGPB 2V5TA 4G8GE 5TDPB 4UILH 4KJPC 4L3EB 1CQYA 2A77H 1GGCL 4RAUB 4KY1H 3NCBB 1KPUB 1TENA 1VHPA 3VXSB 4OTXH 4RISH 3UJIH 1S5IH 3CVHH 3QB7C 4UU9B 2NY1B 4F7PA 2UZXB 2B0SH 4YHZH 4YGVA 2DWEB 3C9NA 4MSWB 4NSKB 3RWHA 4KMTH 1JZ8A 2ZUWA 5GS0D 3MA9H 4UNUA 5EBGA 1SVZA 5D2LA 1OWWA 2EC9T 5ESAB 5MEPB 3FQRB 3VG9B 3SE9L 1T7YA 1S9VA 4S2SB 2GTWA 4NO3A 4OI8A 1ORQB 4GRMA 1T1ZA 5IM7A 3PWUA 2Y06H 3PWPD 4TSAH 2F53B 3GIVA 1R3LB 4O58L 4XBPA 5F7DB 3LN5B 4NQDA 3OKMA 3Q6FB 3W11C 5HYSA 5C0AB 5E08H 4LLWB 4LSDA 4L3ED 5T1MB 1FL6A 1LDPL 1OSZB 5AAMA 1P7KA 5LJYH 1I1FB 3JSSA 3T3MF 4MGXA 4DK3A 2CLZB 2VDNL 3REVB 4W4OA 1ORSA 3ARBA 4AK1A 2J88L 3IDUA 2NY1D 4WFHD 2F5AL 1R3JB 1YQVH 4P23A 1LK2B 2CIIA 4HX1B 5E6IB 3VJ6B 1ZLWK 4NJ9H 5DWUL 3LQAC 1J9CT 1KULA 4NQTA 1F4HA 3KLHC 3OAZH 3BZFA 2LAGB 1D3CA 4M7LL 2DQEH 1F90H 2X10A 2GJJA 1WJ3A 4E42A 4P5MA 5DK3A 3HPLA 2YXMA 5DSCA 2XZQH 1REIA 1CICB 2YPLA 1HYSD 4PBXA 4JY4A 1EO5A 3CSPA 4P4KC 4ETQA 3VH8B 1HSBA 3EFFA 3U7WL 2VDLH 5CSZB 1CXKA 2GCYB 3DARA 3F62A 1OGAA 2F53D 4YQXH 3VXTB 2JK5A 1UENA 4X99B 1QP1A 4D8PA 1A6ZA 1T1WA 5DUPH 1W72L 4RMTA 4ZFZB 3BIBX 1VGKB 5C0AD 3BHBA 2B1AL 2CKBL 2E6QA 1RZ7H 4YDJA 3L3HA 1INQB 1BOGA 1FVEB 1YNKH 3S37H 4IEFB 3LKNA 5J3HC 1DQJB 3MOBH 5IK3B 1A6VH 3JV6B 4TUKH 4M48H 4KGJA 2WNGA 2JCCB 1HDMB 5EOCH 3N9GH 1AXTH 3QIWA 3QHZH 5DFWH 4ONOA 5E6ID 5CEYA 1MREH 1ODAA 2VZ3A 5CD5C 1M7DB 4MD5B 1MFBH 2DLGA 3RKDD 4OFIA 2BSTA 2BVQA 3SDXF 3LRSB 4I0KA 1T5XA 5CSBA 2KKQA 1R3KA 2MHAA 3D9AH 2WZPD 3T2NH 3G04A 3D6GA 2OK0H 2F58L 5CZKA 5EO0A 3U2SA 4ZUUB 3THMH 3RY6A 2J7LA 4DN4H 1K3ZA 4DKEL 3FB5A 3ARDB 1P6AB 2Q7YA 3O2DA 4F3FB 3OPZL 4AENB 1TNNA 4XP1L 4PPTA 3VRIA 1UA6L 5JDJA 4APQB 5C07A 3JTTB 2PXYB 3ZKQD 2R69L 3KDMB 3T3PE 3E8UL 5MENE 2DMKA 4AH2A 5HI5D 3VMNA 1IAMA 8FABA 3F7VB 4QY8A 3UTZA 2IMNA 1KIPA 2FO4A 2A9MH 2Q20A 4ZTPL 1GIGL 1R24B 5B39A 3VRJB 2HVJB 2BVOB 3H6JA 2NY5H 3MLVH 4ELMA 3MBEC 4JO1H 4EDWL 1YN7A 1U41A 1IKNC 2GK2A 3L95B 2OZ4L 1I1AC 3CSYA 4Z78B 4L3CA 4HS6B 1JCKA 3B9DA 4HWBH 3TBTB 3ES6A 4YHYB 1ZSDB 4PJDB 2CMRH 3SE8H 4BSJA 4HGKC 1GC1C 1HH9B 4BH7A 1K5NB 1QSED 5GSRB 4H5SA 4JFZH 3G08A 2EECA 3ARDD 1VADA 4U1SB 5EC2A 3O0RH 4XPFH 4Z76A 4F37K 2CDEA 4LPXA 4APQD 5JUEH 5D7JC 3O11B 3RGHA 2G75A 1E4XI 4EIGB 1WSST 1D6VL 4H20L 5GGVL 3S5LG 4EI6B 4NT6A 4JKWA 2J4WL 1KJVB 4UNTA 4B7IA 1UM4L 4GSDL 4Y8DC 1FFQA 4XXCA 4Y19A 4CMMB 3MLYH 3KPMB 3BD4A 4E9LA 2XN9A 3D25B 1I7UA 4YBQC 4MNQE 3CUPA 2YMXL 3T0XA 3WXWH 4YX2L 4LRIA 3HE7A 3TN0C 4XBGA 2OBGA 3OL2A 3EDJA 1JFQL 4PRPA 3PGDA 2E7CA 3UZQA 3VGBA 5L88L 3IFOA 4NN5C 2DBJA 4S1RL 3TIDA 1OF2B 1N5AA 4OLYH 2YA1A 1MSPA 3VFSB 2VC2H 1U3YA 1EAJA 5I1IH 5DK0A 4M43H 4NKIH 4HZLA 4FFVD 1DL7L 1F4YL 3INUH 2NXZB 3VWJA 3SKOA 5D6DC 1WIOA 2VLRB 3S3SA 3PABA 1BJ1J 4M4PA 5LWYH 1JPSL 1X5FA 1RUKL 2N1KA 3O6KH 4HUUA 4XCFH 2H3NB 3RHWK 3W0WE 4E0RB 4LKXB 3OX8B 5I1HH 1J8HE 3SGJC 4M3KB 3V79C 5KVMC 1HIMH 2KZ1B 2DLTA 3PDOA 1KC5L 5C08E 2GUOA 3PV7A 1OAKH 5DQ9B 4KKNA 3S7GA 3TT1L 1AQDB 5CJQH 3U1SL 3JWNC 1FJ1B 1I7ZB 2R1YA 4TTDC 1Q38A 1QBML 4CUCA 4X6CA 3ESUF 5MEQB 4E41A 4HUVB 1TFHA 3LKPB 3TBWA 4RWHA 3WNMA 2UYLA 3VFNA 2YUWA 3BKYH 3QO1A 1A0QH 3TBSB 3MLXH 1IC7H 1MWAH 4J8RB 1UZ6E 4WFFE 4EIZC 1GZPB 1Y18A 4JFFE 3VD9A 4HQQL 5E24E 1QRNA 2C3VB 2VDQL 4OF5A 5FUOH 5F9JB 3SDDA 1NCDH 1GHFL 1I1YB 2NXZD 1GPOL 5DEZA 3NGBC 4MS8C 4JFHD 5FOBA 2ZUTA 2HLFD 4AEFA 4Q6YA 3IDYB 2Y6SC 1I8MA 2DYPA 5IROA 1ZLUH 1UWEH 4L8BB 3VFGH 3B5HA 1RFDL 1F58H 4JRXB 4XVUC 3VGDA 2E7LA 4JHAH 1YEDA 5EBMB 2B4CL 4F7MB 4X6EB 3GSXB 5EB9A 4TQEH 4JFEE 2A73B 4KAQH 4TVPH 5MI0C 1JHLH 4Y1AA 4NO0A 4JCLA 1DE4B 4FS0A 4Q7DA 3EJZD 1EGJA 4DTGL 4KJQC 5IBTL 1OM3H 1MHEA 5T3ZD 4KU1A 1W72A 1X5AA 4LVOC 3KJ4C 3TYFB 4HKXB 5D7IF 1EUUA 1KB5H 4C4KO 4IBLT 3V6OE 4YDKH 3DV4B 5BJTA 1X44A 1T1XB 3MLWH 1ZT7A 4D9LH 3MV7B 4UIKL 3WNOA 5I30H 3FO9A 2HRLA 4MAYA 5I9QB 3MV01 4H26B 3FQTB 1EVTC 2E7MA 4GFTB 4N0CD 2XG4A 2GJ6E 4WW2C 1RZIB 2ADJB 3RVUD 3C5ZC 1CDGA 2VTFA 2X4TA 1GXEA 1YJDC 5ESQA 3ZTJG 2A6IA 5E9DD 2DD8H 1OTTC 1T83A 3T65B 2H1PH 1NBYA 4JJHA 3UZVB 5DHVH 1A6WL 1NAKL 1N4XH 4JO4H 1AGBB 4DCQA 5BVJB 3C60D 2NX5A 3O6FB 5F96L 4DKAA 5HYFA 5D1XC 1G9NC 4AIZB 1T0PB 2DBLH 3HG1E 1KLGA 1QLFB 3DGGB 1YEHL 3QXTA 5DRZB 3TPUA 3FRPA 4X98A 4M7JH 4UOW1 5I71C 3IDNA 4GJTB 3UTSD 2I24N 4HFWB 4JFOA 2ICWJ 4X4XA 1Z3GH 1W0YT 4GQ9H 4P2YA 4LASH 3MV7D 5BW7C 1YMHB 3EOBA 1LP9B 4IDJH 3WL9B 5FYKD 4PJCE 1I85C 5DRNA 4YDIH 4U1HB 4WUUB 4XVTH 2VXVH 2WINB 2XTJE 3AREC 1HHKB 2FGZA 2OZ4A 4P2RE 3T1FB 5HHNB 3V0VB 2AJ3B 5E2VH 4N0FB 4NCC1 2V5RA 5C0RH 4EQ2A 1SYSB 2VLLB 4HUKB 7CGTA 1BOYA 5F7NC 1NMBL 3MRIB 1NLDL 4MQ7A 3LS4H 5EU7C 5K33A 4JPKL 5HYSG 1UB5A 5GRJH 2HFTA 4XVJL 4JFQB 4MJIB 5CBAA 5JLZA 1JZ4A 5DQDL 1G6RL 3S36H 4F7TA 4HJGA 4WUKH 3EYOB 1A02N 3QWQB 3VXME 3WLBA 1BF2A 2ZG2A 5B3JF 3O6FD 5DK2A 1FP5A 3STLB 2FATL 1SEQH 2OL3H 3QI9B 4M5ZL 3D39E 1NUGA 4YBHA 1CFSA 1NFDB 2F8XC 2KQNA 4HKZB 2P8LA 5IHBA 1T6VN 1UYWL 5TE4H 4KRPC 4UB0L 2WBJA 3CDGA 1ZVSB 5F1OB 1FNSH 3FN0L 2XNAA 5TDNA 5I6XC 1F2QA 3PHOA 5D93B 4GAFB 3DURB 3H0TA 4ELKB 3NOIA 2DLIA 3WFHB 2XWTB 4YDLB 5LGJB 3B8YA 4JE4B 4GBXA 3GBNL 4HIEA 1NBVH 5EOTB 5KW9L 4AT6B 4UUJA 1KJ3H 4WUUD 3BEVB 4YHPA 3FFCA 2E6PA 1ZVHA 4G8GB 1GYAA 4M6OH 3NCJL 3L3OB 3U36A 5HGDA 5JHDA 1MRFL 3NIDF 1A3LH 4XP9L 3I3DA 2D03H 4U1LB 1E28A 5HVHB 1G7PA 1HXYB 1XZ0B 2NY7H 5TF0A 2JB5H 3E6HB 3HZYB 3C5JB 1A1MA 4P5KB 2DL9A 2J2ZA 2WIMA 1CL7H 1PFCA 5C71A 3GZKA 3QFJE 1PY9A 1KFAL 3BQUB 5IB1A 4EUPB 2X42A 5C6WH 5BO1L 1JZ2A 5GGTH 3NAAH 3QG7H 2HT4D 1FDLH 4HEPG 4AM0B 1L0QA 3F7QA 5HDQL 4M1DH 4PV8A 4Y5XA 3QA3A 4G8FB 1WBXB 1EDQA 3D0VA 3QRGL 4LLVA 5FYLH 1CTNA 2YWZA 4YE4H 4NQUA 2E6JA 43CAA 2PTTB 4E5XA 4WI7A 2EH7L 4HBCL 4ZO6A 5C0BD 5CLTA 2ITCA 1G84A 1MPAH 1JWMB 4O51B 2RCSH 3ZDZF 4G8GD 4LF3A 5KN5A 4M8VA 3S96B 5IHUL 3GMPA 5J89A 1UB6A 4MQTB 4IRSA 5SWSA 5CP3A 3KPQB 5DT1H 3I6KB 3ZMRA 5AWNH 4PUBH 3MRJB 5F6IC 4OBSA 4NJAL 1HI6B 4FHBD 2CLRA 4H0HB 5GZOC 3I84A 4NZJA 1H0DA 4KTDL 1DBAH 1MRDH 1V7NL 5I76A 3BQUD 3STZA 3IAGC 4LCCA 1MY7A 3RWGA 3U0TA 4LQFL 3TCLA 5E7BA 5DMYA 4UAOC 1T20A 4N5UA 5CUSH 1MAMH 1FAKT 2FWOB 2VABB 3LRHA 4G7VH 5HDOA 1S9YA 3TBYA 2F74A 4LSPL 1AKJD 3BGMA 3SDAA 2ZCLL 4U1NB 3QEGL 5F7WC 1A64A 2Q7NA 5K9KB 5CINH 1S78D 1NKOA 3ZDXF 5DHYA 4RGMC 4WWKA 4XVSL 1BIIA 3R06A 4QRPD 4MYWB 1B6DA 1IRAY 1MFEL 1ZS8B 4ODHL 4ZXBB 4IIQC 1UACH 4P57B 5SX5H 5E6YA 2YOCA 4P46C 3OAYH 1NGZB 4Y4HB 4JLRA 3VFOA 3F7YB 1AHWB 2NY2C 2GITA 2BRRH 3ULUL 1ZHLB 3ARFC 4DVRL 2YRZA 3MNZA 2IEPA 4H8WC 3G5ZB 5EA0L 5IMLB 4M7ZC 5F3HA 4J4PC 3BESR 4DUWA 2V7NB 3DXAA 1HHIB 1KCSH 2F54A 4PJXF 4Z7NF 4O00A 1H5BA 1G7QB 1GAFL 4U1KB 4FQXC 1KCVH 1BZQK 5JDSB 4LGRB 2HFGH 5JHLL 1DN0A 4JM2C 4O2FB 4X6FA 4YHKH 3UBXB 1W2KT