4F80A

Crystal structure of the human btn3a1 ectodomain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
213
structure length
209
Chain Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGGVSCTIRSSLLGLEKTASISIADPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Butyrophilin subfamily 3 member A1
publication title The molecular basis for modulation of human V(gamma)9V(delta)2 T cell responses by CD277/Butyrophilin-3 (BTN3A)-specific antibodies
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 209
sequence length 213
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f80A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f80A02
1SJEB 4LSRL 4OF3A 4JFEA 1GC1H 3MRIB 3RBGA 2R2CA 2FHCA 4NC1E 3WIIH 5GGRB 4NO0D 1REIA 2FHBA 3BAEL 5EUOA 3BEWB 4RDQG 3HA0A 3ISWA 3RU8L 3PQYA 5I1AB 1ZT7A 1LE5A 4GKNB 4LLYA 4Y4HC 1F4YL 3HTLX 3V5KB 1RZJC 1ZANL 2ZUVA 4WFHE 3V0AC 3IXTA 3OKEB 4PJ9B 3VWKB 3R1GH 4CDGC 1XIWD 1NFDA 3MC0A 4OSUL 5J1AA 4U1IA 1G1CA 5I6XB 3TESA 3MV9D 1OLZA 1PEWA 1ZAGA 4KK9C 4RBPH 3MJ7B 3D39D 3QQ9D 4Z7QE 3KPSD 5I66B 3H0TB 3GMOA 3CDYA 3HZKA 4YFEA 1IC1A 5EPMB 4RA3A 1U8QB 4WUKH 2WLZA 5GGVY 1KV3A 3F7YB 2PYED 4X83A 3ULUF 1GGIL 5HDOA 1DEDA 4ZDHA 5AG9A 1EVTC 4GAYB 4XBGB 4F7EB 3CU1A 3O8XC 4YPGB 1UYWL 4OLZL 5T1KB 1QBML 1C5CL 2Z31B 1OGAE 3BGMB 5DHVA 1WF5A 2L7UA 1ZKAA 3GMQB 4OM1L 5SWZE 1MIEH 3F7RA 3V2AR 4LSQH 1UWGH 1MCPH 1IQDA 3ULUH 1MI5A 4PRNB 1G6VK 1S7TB 5D7LE 4GUPA 1UH2A 1RVFL 3GRWA 4LCIL 5J11C 4WI3A 5CILH 4KZEL 1FJ1A 3GMMB 3D0VB 1NKRA 1CBVL 2X40A 4RGNB 2FLRT 3PIQA 5E56A 3BH9B 4PLOB 2DIAA 5MI0B 1GZQB 4JY6A 4F9LA 3QWRA 1BVLB 3TYFB 3SDCB 5DUBA 3OZ9H 1I7TB 2AJVH 2GJ6E 5D7IE 2EYRB 5E00A 4GRLC 2WIIB 3RDTB 5IUSA 1MHEA 3CUPB 4BKLB 1IAKA 1JNLH 5IR1B 1EZVY 4IRSD 4CVZB 5BO1H 1N0XH 4OZFB 3H8NA 3WFDH 4QHLA 5JR1H 4PG9B 4FQQB 5D2LE 1P9MA 4Y5YB 1U8JB 4G7VL 2VDMH 4XNYH 3VGFA 3CX5K 2APXA 2CDEB 4LSVH 1RURL 4NKDA 2HKHL 3FB8B 2RR3A 1ERNA 3WKML 2CDFA 4MQTB 3VXNA 4NNYA 2MKWA 3MGTA 2VXUH 1ZA3B 2JJTA 4MNHB 3NCJL 4OLWL 4KMLB 1WFOA 3HE6B 2D31B 4FQJL 4NKIH 4FQXD 3IFPB 5ETUB 4XB8A 3VW3H 4P2QD 1RHHA 4PJEB 5E2UH 5F7FA 5D71H 4OCXL 3HCVB 1IGYA 1QRNE 3RVVC 4CW1B 3P2TA 2CJUL 2Z35B 1DVFD 2BVOA 1M6OA 1D5BB 2P5ED 3CXDL 3TC9A 3SE4A 1BBJA 1KFAH 1NLDH 1RJZA 3UCRA 3TCLB 1FN4B 3MZGB 4M6NH 1JNHA 1Q9WA 2FATH 3MV7B 5L2KB 4EI6B 3BZFB 4P23D 5HDQL 5D1QD 1I8IA 4MXQD 3O3BB 3MNVA 4JVUA 3ZE2E 1A1MA 1J87A 2X7LB 4PJ7F 5KOMC 3QIBB 5FYJL 3CH1A 3RKDD 3HE7B 4ZFGH 5C2UB 3T1WA 5TF1H 1UZ6F 2DF3A 1EO8H 1T7ZA 4IOIB 4NWUH 2XZAH 2IFFH 1I9RL 2EYSB 4ZXBD 2XNAB 3I75A 3VFPA 2BK8A 2R0ZH 2L7JA 3O9WD 4P3CH 4PG2C 4JFZL 4BZ1H 1OP5H 3DXAB 2X41A 4HWBL 4K71B 4DUWA 5HYJB 1HIMH 3C6SB 4H5SA 4OZGB 2RAMA 1NGPL 4X5WA 1ZT1B 4LDOB 3UROR 1BFVL 4KPHL 1UWEL 4K7PH 3T77A 5J6HB 1NBVL 1K4DB 3J7HA 4YBQC 3VFSA 1UENA 4JR9H 4UNTA 3MRQB 1A7NL 2BNRA 5IF0B 3FOLB 2IBBA 5FYLD 3MLPA 2APVA 2J8UF 1QD0A 4KKLC 5BS0D 4KJQC 2LVCA 4UINL 1DBKH 2XY1A 3AAZA 4S10A 1R3JB 3WUZA 3QJFA 4G6AD 4EIZC 3EDJA 2DKMA 3E6FB 1CDCA 3C8HA 5FHAH 5MEOA 3JV4B 1CIDA 1M71A 3L9RB 2BOBA 1MQKH 1CE1H 1D6VL 1T83C 3WFBL 1T03H 1RI8A 1FYTD 3F6IA 2A6JA 2R0KH 1TJHL 3VXSA 3P40A 3Q5YA 5KSUB 4HCRH 5DLMH 1DE4A 2Z8WC 4JN1L 5FB8A 1TVHB 1JL8A 3IRPX 3MUGA 4I48B 1HHHA 4KMQA 3VXRD 1BD2B 1NFIA 1G6RB 2OCFD 4NUJA 4PJHF 3HC3L 4ZUTB 1JGDB 1KENL 3GM8A 3RTQC 1ORSA 3T3MF 4M43H 2XY2A 1DEEA 3VG9B 5HVFB 1TCMA 4ODVH 3CDCA 1GJIA 4GW1A 3VGAB 3X12A 2FR4B 2Q20A 3C9NB 1KTDA 3OX8B 2JK5A 1TNMA 1BOGA 3HRZB 5D5MB 3MRJB 1OAQH 3TEUA 2DQTH 1EEUA 3U0WL 3Q6GH 3LKRB 2BNQD 2OZ4H 2NY1C 3ROLB 3ORJA 2IG2H 1S7WA 3B2VL 4WEUD 2Y6SC 1EA9C 1JF1B 4E42B 1DQTA 4J8RA 3N0PB 2WANA 4NJ9H 3U4BH 5C0IA 4RFNC 4JFOB 4LOUC 4YIQB 1HXMA 3ULSB 1V7ML 3TLRA 4BSVA 5K59E 1T0MA 1FC2D 5IMKB 1G7IA 1AGEA 3VXOB 1LD9A 5JW4N 3K7UA 5E6IC 4Q7DA 2YMXL 1QQDB 1PZ5A 2DQJL 5EU4B 3QEGL 4Y4FC 5ID1A 6FABH 1Y0LA 3RY6C 1LEGB 4U1GC 4X4MA 4QTIL 1U8IA 4OFYD 4X98B 2I26N 1DLFL 2BC4A 4HJJH 4G6FD 4WY7L 4JFDB 4PGDA 3RX8A 2R69H 3ZDYE 4APQC 5C9JA 4TNVF 3G5YB 1K2DA 3D85B 4K8RL 2XTLA 4L4VA 4MQ7A 1P7KA 1C16B 5EZJB 2SEBA 2FD6H 4P9HH 1NDMB 3WFEH 2AERT 2VLKB 1ZVSB 2W9LA 3NCEB 3MV9E 1OGTB 5DJAB 1R5WA 3NFPB 5HHQB 3IVKA 1KIRA 3MQIA 3D39E 5D93C 1M7DB 3KPSE 4LSUL 4UT6L 4MSWB 1S7VA 5JIHA 1JUFA 3ULVC 2EDOA 1JNNH 4Y16C 4ONGL 2F5AH 4NN5C 4HWUA 1DQQA 2PYEE 3RWFB 2VWEE 3NCCB 3EO0A 3ARBB 3EYUH 4QOKD 1X5IA 4M5ZH 5HPOA 2MFNA 4U6XA 1F6AB 3D5OF 4EJ1C 1PG7L 1FFQA 2XZQL 3V6BR 3PDGA 4PP2A 4DN3H 3H7BA 1IILE 3EHBD 2I07B 5IB4A 4G6JL 3B5TA 4EN3B 4LLQB 5DWUH 3CMGA 1A4KA 1XGTB 4ZAKA 3RA7L 4NZUL 2FEEI 1LO2H 5D6CB 1HQ4A 1O7VA 1KJMB 3BUYA 1S9YB 4QT5A 3EBAA 3G9VA 3SGEI 4PRDA 4KVCH 2I60H 5K93A 5L8LB 3PP3K 2HMIC 4AL8L 2IQ9L 4WWKD 4JY4A 4NQVA 4RQQA 3S3PA 1IGCL 2OQJA 4OAWB 4JO2L 2NXYD 1AGDB 3IU4L 3OGOE 1JCKA 4WENB 1TNNA 5ALBH 5DD3L 1UQSB 43CAB 1URLA 1VSCA 1WBZA 5IB1B 1QEWB 4OB5H 3TBWA 2NY7L 3QWOA 4FOMA 2I9LA 1CLYL 1PLGH 2DQEH 4EOWL 1TETL 5CZVH 1QO3B 5DC9B 1DUYA 1G7HA 3OB0K 4GRWH 4L3ED 2BY2A 4AQ1B 5J8OA 3B9KC 3KPNB 5DJYA 3O45B 1IGJB 5C8JA 3LN9A 1LWRA 3LEVL 4HJGB 3MV8A 1WFNA 4KXZI 2XWTA 4MJIB 2ZCKL 4QRPA 1RIVH 3WXWH 4NQDA 3K81A 3U83A 3NH7L 4HFUL 5IKCA 2BCKA 1VPOH 1BBDL 5D8JL 1J86A 4K55A 1H8OA 3O6FB 3BRFA 2GSGA 4YDVB 1GOGA 1U58B 4IRJB 5IG7A 1YPZF 1AQKH 3D2UD 3PE9A 3F12A 3LKPB 3QDGB 2FZ3B 4YHOH 3FRUB 2C3WA 4ZTOH 3RVTD 4P2QE 3KXFB 1LNUB 4KI5C 1PBYA 4RGOH 5KSAB 1RMFH 4G9FB 3QCVL 4Z7WA 4ZS6C 2XA8H 1MCJA 2AJSH 1MHHA 3E2HC 1SVCP 2P5EE 3QQ4B 4GG6A 4OI7A 3MLYH 5F6IB 1NEZA 2F5BH 3LSOA 1MJ7L 1P4IH 3CCHB 3T8XB 1ZOXA 4MAYC 4PJAA 4JY5H 4NSKA 5CD5C 4S1RL 1KG0A 3DGGA 4BK5A 4MNGB 1ODAA 1IVLA 4LLUA 4O2FA 2NQCA 3U82B 1KCUH 1KPUA 1IFHL 3GSRA 4X6CE 4MVBD 4L29B 1MFCH 3BKMH 4RAVA 5T1KD 2YUXA 2Z31D 4M00A 2K7PA 2A6IB 4JJHA 5EC2A 1BF2A 2Q8AH 1QBLH 1UM6H 5L8JB 2WBWB 4WI2A 5KTEL 3IFLH 4L8SB 4NYLA 4OKVB 4R4FH 1XGQB 1QYGH 3GNML 3Q6FA 4HH9A 4JZJA 3E8UH 4R0LA 3TBSA 5KANG 3TT1L 5J12B 3U2SB 5I16A 5IVXF 5A2JH 3IJYA 3MBXH 4RGND 3Q2CA 4NZTH 3T2QA 3VA6A 3U46B 5EU3B 1M7IA 1CT8B 3NA9H 4K23H 3TA3B 5DZNA 2GIYA 2QHRL 4Z7OE 4X7TA 4ZOEA 5D7JB 4XPGH 2VDRL 1ETZB 3QIWB 5JZ7C 4O00A 2IBGA 3REWA 3RDTD 1MCIA 4M6AA 1KCSL 5I73C 2YD5A 2AV7B 3O3UN 5ELIA 2J88L 4ZPVB 4WO4D 5B38B 1JYNA 4QXUL 5T1MB 1JZ2A 2PO6D 4GAJL 3EGSB 2XXCB 4K3GA 4I3SL 2CXGA 5BS0E 5F1NA 3BIKB 2ZCHL 4WDIA 3D3VA 5F96L 1GAFH 5IT2L 4TSAL 1FNGA 2QQKH 2A74A 2NTFA 1RK0B 5DTFA 4KUZH 4YX2H 4GMSL 4KKBD 1OW0C 3MLTB 4LP5A 3TVMA 1TVBA 5I8EB 5C0RH 1UJ3B 3HE6D 4GBXC 1FNSL 4XNXL 3ILQC 4BFIA 3MO1A 3QXAA 1G7MA 3SBWA 1FYTE 4WI8A 5DJ0A 2X89D 3PHSA 3ZTJH 2BVPB 2UWEB 3PJSA 2APFA 4HK3J 4MZ2A 1BFOA 4HPYL 4RSVA 5AD0A 1U6AL 3MACL 4WJ5B 5IHZB 5E2TH 3VXRE 5E7FA 4P3DB 4C56B 5TE7L 1XF2A 1OB1A 4J6RH 5DD0H 1KJ2A 1H5BB 1IGMH 2R2EB 4H8WH 1CFSB 3H6JA 3MODH 3CFEA 2NY6B 4NN7B 3M1BB 1C12B 3TWCL 3F58H 1WQVT 4IRZL 5DYOA 2DN7A 4OZFH 2BFVH 3VI3E 1LP9A 3SKNB 2IAMB 2OJEA 2Z92B 4P5MA 3QIBD 3TZVB 2BNQE 3WE6A 3HE7D 4WTXA 3VCLA 1AJ7L 4EKXA 1BQUA 3FB5A 3DJ9A 2GJJA 2WUBH 2ESVA 3FN9A 2Z93A 3EFDL 3EDKA 3QO0A 4NZRL 3VFUA 3WN5B 1MFBH 4QKXB 1MIMH 4YHML 3SKMA 4ODUA 3H42L 4JPIB 1DQJA 1FVEA 3TNMA 3WNNA 2OTUA 1YDPB 5SWQA 1FORH 4LSSH 4J23A 5GGSY 4OUOA 1R3LB 3BI9X 2FL5A 3K4ZA 2YKLH 3W2DH 5HYJD 3T0EA 1GPOH 4WHTB 4PUBH 1L0XA 2HRLA 4S1QH 2VYRE 4NDMA 3T65A 5DRZA 1T2QH 2RFXA 2VZUA 5JNYB 3C60D 3WIFA 4KK8C 3TF7C 4NGHL 5ITBL 3V0VA 1VERA 2H3NB 4HWEH 3MSPA 1DQML 3N9GL 3ZL4L 2NY4C 2VDQH 1YEIL 3FRPG 1XEDA 1NC2B 1ZLSL 2CR6A 1MJUL 3SJVA 3AU1B 3HRPA 4LLVB 2X6MA 1IARB 2NY0C 4QTHB 3GK8L 4ZYKB 4JFXB 1KNOA 1PX3A 3C5ZB 5ADOL 3I6LD 1XGRA 1A1OB 3MLSL 4JQXA 1BIIA 4XH2B 5DQ9B 4GJTB 2VQTA 2H26B 4FNLL 4M7LL 1AC0A 3KAAA 2FWOA 1JPGB 4RX4A 5DT1L 5HYIA 4QOKE 1Q0XL 5KW9H 1RZKH 1PQZA 5T33H 4L9DA 2DYPA 3HMXA 3LN4A 1NKOA 1UM5H 3QA3A 3OKNB 4Q58C 4G8FB 1X5XA 1XF3A 4ZNEA 1TQCB 1J5OH 5KVEL 1QLEH 3BPOC 3U30C 1DQLL 1HH6A 5F7EH 4EI5A 4N0RA 1WLHA 3OAZH 3CLFH 1GGBL 3PL6A 4JKPH 4XP5H 1ACYH 4Y2DC 3QUZC 4LVHC 3ALXA 2XKNA 3UDWA 2ZCLH 3PP4L 3O2WH 4MHHG 4OGXL 5GJTH 4BH8B 1KBGH 5GRUL 4JO3L 3G6JF 4BQ8A 1UEMA 4R4BB 2VDOH 5I1HL 3P9LA 5J6GA 3WFZA 2NY5C 3CSYA 1J8HB 5E99L 3ZKND 3DRQB 4WU5B 1A6AB 2Q3ZA 1RZJL 1I9EA 2GK2A 4UMGA 2HT2C 2V2XA 5GIRB 2R1WA 3GUTB 1GCFA 1YJDL 1UVQA 1ZLUK 3EAKA 3STBA 4QF1B 4DGYL 4I5BA 2WAHA 1MNUH 3C5JA 3OGCB 1EX0A 1PEZA 2Z0BA 3GFUA 1NGXA 4L3EE 1EJ6A 3QZWG 1A6ZB 5FV2A 5J9PA 5DRXB 3ULUC 3GHEH 2E5EA 2ICCA 4XHJC 4A6YL 1WFTA 3UBXB 3L3OA 2QL1A 3BZEB 12E8H 4IOSD 1TJIH 5D5MF 1CF8H 3BQUC 1RZ8B 3O0RL 4ALAH 4M7ZC 1VEPA 4KJYB 4RWHA 4ENEC 1G0XA 1G6RH 3I02B 3VI4F 3QUXD 1XIWC 2OMBA 4PJFB 3KPPA 3S97C 2X44D 4KJWD 4OZIB 3WFHB 2HKFL 1F4WH 1AFVL 3GSXB 2F58H 2VLKD 3S37X 1QNZL 3WNOA 3VXUB 1CDGA 3CNKA 2ITCA 1R3HB 1NAKL 4HQQL 3TBYB 2FB4H 5A3IC 2M26A 2R9HC 3T4YB 5F9JB 1QR1A 4R7NB 2ZPKL 3QFJA 4U1NB 4Y19A 5ADPH 3MNZB 4LCCB 4FQIL 3ARBD 5KAQG 5CP3H 2ZUQC 1KB5A 4OFIA 5F1IA 5C0GB 2OP4H 4Y1AA 5DHYA 4JFFA 4J1UB 2D9QB 1JHKH 3DI2B 3VFNA 4ZNCD 5IFAH 3LHPL 2QSVA 4EQ2A 4XCCL 5HVGB 2JJWA 1J1XH 3DSNA 3UC0H 5HYSB 3S4SG 4EN3D 3V6OE 3IDXH 3I3BA 3RPIA 5E9DA 2CMRL 5A16A 4JFEB 3L3KA 4RGNE 1EFQA 3T4AA 1P4LB 2V9TA 5KVGH 2DQHH 3ME0A 5EUOB 4KVNH 1KJ3L 2F15A 3PGCA 5CINH 4ZOAA 2WW8A 2QQQA 1ED3A 3MX0A 5F1SA 3RAJH 1ZT7B 1LE5B 2OBGA 4LLYB 3NACH 1WZKA 3OJDA 1AD9B 3JWOL 4L9LC 5C2BL 3IXTB 5EG6C 3GSQA 2AJXH 5J1AB 4U1IB 4MMZC 5GISL 4X6DF 1I9IH 4X7SL 1BJMA 4XP6H 3W0WD 1HCFX 3BWUC 4JRXA 2DQDH 3W9DA 3GMOB 4RMWA 2DD8H 4TVPH 1QVOA 1AI1L 1GYAA 2Y1VA 1MRCH 4JE4B 4HBQA 1X9QA 3CFBA 2IADB 1RQ5A 1NMAL 2P7TA 2R4RH 4Y7MA 4PYGA 4FQXC 1FFPA 1U41A 3BE1H 3AUVA 3O6FD 1IMHC 1YECH 3A6BL 4ONFH 1QFUL 3RI5F 3ZDZF 1DN0B 4GMTL 4K7FA 3ZKSD 3QI9D 3KXFD 5JDJA 1P53A 3MCLL 1Q9LA 4PJEE 5J13C 3AXLA 5I8OL 1IQDB 2G5BA 5EBMA 3V7MA 1MI5B 4FTVA 4M6ML 4GUPB 5KSAD 4G9FD 3MLVH 4KMTL 1C7SA 3OG6B 1FJ1B 2PUQT 4Y5VC 4PGCA 3QXWA 3W81A 4WUUA 3OF6A 1AO7D 3DOSA 3DSFL 5ECJE 4NOBA 4JY6B 3OQ3B 1CQYA 3G04A 1JWMB 4DZ8A 2LVEA 2OS7A 3L5XH 2X1OA 3C09C 1P4BH 1BHGA 2UZIL 4XPBH 5E00B 4WI6A 3RKDC 4LHUG 1A7PL 2ZUYA 1IAKB 3BPLB 3WJLC 1E6JH 4XGZB 1G7PA 2VNCA 3CFDA 1MFEL 1D9KA 1RUPH 2GFBA 3GJFB 1MY7A 5IMOA 3S96A 4M03A 4U1KA 4QHLB 3MXWL 3UAJC 2NTSP 3FFDB 5I15H 2NW2A 1MF2L 3CPLA 4I18A 1KLFA 2BJML 4XMPH 5J1SC 1PYWA 4NKDB 2V17H 2F54B 2NZ9C 3RIAK 1DFBL 4G3YH 1T1XB 3CFKB 2CDFB 3VXNB 1IAIH 5D7JD 3MGTB 1IGFL 3VD3A 5HYJE 4JPWH 1RJYA 1GVIA 4HW6A 5FDWA 5BMFL 1RHHB 1VHPA 4Y4KC 2WV3A 1IT9L 2R4SH 4UBDD 3CMOH 1N26A 2XFXA 5C0NC 5CGTA 1E4KA 1DBJL 2J1KA 4JM2F 2VIRA 1IC4L 2CRYA 1BBJB 1RJZB 2F19L 2WIMA 5FM5O 5CIPA 3VXQB 3W82A 4WEBH 5TQ2H 1JNHB 3GMPA 2X09A 1WIOA 1Q9WB 5EFIA 2JCCF 4KUCF 1WFUA 5EWIL 1HKLH 3WXVL 1KN4L 1MSPA 2NY3D 4L8CA 1JZ3A 1I8IB 3I6LE 1NUFA 1J1OH 3WL9B 3MNVB 1YY8A 4RFEA 3FO0H 2EECA 3IXAA 3PHQB 1A1MB 5I1EL 1SM3H 4ORZC 3CX5J 4J3VA 2EKSA 4WHYH 4S0SD 4S1SL 5C0JA 3RL2A 3CH1B 3HN3A 1RHFA 2CGRL 4MJ5A 3OXSA 2DLFH 4LPYA 1VACA 4YDIL 3FQRA 3VRIA 4N0UE 4X7FC 1QKZH 1T66D 1U92A 1JBJA 4XP9H 3ZTNL 4XI5C 1U2CA 3I75B 3T2NH 4BYHA 2XXMB 3GBNH 3NFSH 3HZVA 1PDKA 2DDQH 5HI5C 4N8CL 1JMXA 4PBXA 1OGAA 2GEEA 3T04D 4JRYB 4H1LG 4OJFL 5SWZA 4NM8H 4PLJD 4AM0A 4POUB 1FZJB 3T77B 5DURB 5D7LA 1YEJH 2FBJH 3VFSB 5BOZG 1F58H 3TZVD 1JYVA 5HYQA 4MXWL 2DL9A 2RIKA 2J8HA 3RKPA 4LKXA 1IM9D 1RIHH 1VGEH 2WBJC 4JFHD 5CGYD 2C1PA 2QSQA 2BNRB 3P11H 5DGRA 4P2YA 3TO4A 1JIBA 3QO1A 4DEPB 1J0YA 1TZGL 1IBGL 5LWYL 4O9HH 1C08A 4LASL 1IC7H 4XBEL 2OR7A 3QJFB 3ULVL 5F97E 2GJ6A 5D7IA 2JELL 4M8VA 5GS0D 4AZ8A 5D2NC 2YPLA 1D5MA 5MEOB 3P9WB 4XC3H 1FSKB 4N5ED 2BOBB 1CN4A 1FPTH 3ZYJA 3UXFA 1KIPA 5D2LA 4HUXB 3L3HA 5F1KC 2A6JB 1MELA 4JQVA 3VXSB 1AR1D 4ODHH 4MCYA 4GFTB 1DE4B 4OM0L 5FB8B 1I3UA 2ARWA 5ACZA 4F7PA 4BJLA 2F74B 1RK1B 3CFJA 1HHHB 4XPTH 1Z6JT 1UG9A 1NFIB 4NUJB 1AXIB 1F42A 1FFNB 2VLKE 1ORSB 4UTBL 1NCWL 4YHYB 2VN4A 1CXKA 4W6XB 2PCPA 3C5ZD 3X12B 4W70A 1KTDB 3STZB 2JK5B 2XTJB 4AEHL 1A6UL 1G9EA 1OHQA 4G80B 1QRNA 4RNRB 4HZLB 3P9MA 2WQRA 2LAGB 1S7WB 4KKNA 4CVXB 2O61A 3MXVH 3LIZL 4Z0XA 5JOPD 5KVDH 4J8RB 1SY6L 5DVMA 1XGYH 5C0IB 3W11C 5IHBA 2P8LA 2AQ2A 1G7IB 1AGEB 4TUKL 4PJBF 1LD9B 3TPKA 2DLIA 2AJZA 3GBMH 1PZ5B 2P1YA 1CLZH 4HIEA 2XG4A 1WT5A 5ID1B 1A3LH 4YWGH 1U3HA 1Y0LB 2GI7A 2MTPA 1U8IB 3QYCA 4Q0XH 3VFGL 2BC4B 5EH1A 2OR9L 2X4PB 4PGDB 4HDIA 1CFVH 1X5YA 2GKIA 4ISVA 3AGVA 5C9JB 1HOCB 3ARDC 4X99A 1K2DB 4TQEL 2VDLL 2YUVA 4MQ7B 3HLAA 5GGTA 1ADQA 1B4JH 1UZ8A 1OAKH 2JIXB 2SEBB 1UXSA 1W72L 4EBQH 4XNZB 5C08D 5TE6H 4XC1H 2LU7A 1R5WB 4KRPD 5GJSL 2GITB 3MOAH 3W0WE 1F11A 3VDBA 1A8JH 1FAIL 5IBTH 1OOAA 3G9AB 3ARUA 1MVFA 1DQQB 4LMQE 4L8BA 3EO0B 2WQ8A 3NTCH 1MUJA 3G5VA 1IEAA 1NC4A 4OLXH 1FE8H 4HLJA 4U6XB 3A0OA 1EUUA 4PJ9C 3U36A 3VWKC 1N2RB 4XAKD 3O4OC 5CBEA 3H7BB 5IW1A 2D4DA 1FBIL 1H3VA 1S78C 5I6XC 2R8SH 3JSSA 4H88H 4M6OL 5IB4B 1T7YA 3KXFE 4CMHC 2VXVH 1A4KB 5HXMA 4E5XA 3JTTA 1N64H 4G9FE 4YHPA 1HQ4B 3VXUD 3BUYB 3AVEA 4Z77A 3K8KA 4QT5B 3BJ91 2FGZA 5F7DA 2YD2A 4K3JL 5DD1L 5DI8A 3SGJA 1AO7E 3JVGC 4NQVB 4RQQB 2OQJB 4DFHA 1V05A 1WEJL 5FM4A 1IKFL 3BT2H 4O51A 5EBWA 5F9WC 3SE8L 3VFRA 4MVBC 1F5WA 2B2XL 3B2UC 2EZ0D 2Z31C 1SYVB 4MNGE 3VU2A 4NM4L 2IH3A 1T1YA 3VDCA 1JPST 4LAJH 3TBWB 2VDPH 2W9EH 2I9LB 5EORH 4XVUC 3V6OC 5KSBE 4DVBB 1XR8A 4OF7A 1ZGLA 5BVJA 4C54A 1DUYB 1UA6L 3EJZD 4OZIF 1A1NA 4U0RB 4K3EL 2D7OA 1WCBA 3CVHA 5DQDH 4XVJL 3RGHA 5DJYB 5MEND 4FQLL 5C8JB 2R0LL 1KPVA 3GSOA 5DD6A 3MV8B 4ODTH 1QP1A 3B5GA 2DMBA 2Y06H 3WSQH 2XWTB 2ICES 4NQDB 5T3ZD 3SDCC 5IKCB 1J0HA 1AHWB 3DGCR 1CDIA 4P9ML 4M4PA 4H8WC 2DTML 3RDTC 4U1LA 4UT7L 3KHQA 5HBBA 2GSGB 5EU6D 4AEIH 3K1KC 1J88A 1TTGA 3BP7A 2EE6A 1GHFH 2MMXA 2DICA 4YZFE 3OB8A 4NT6A 3AREC 2ARJA 4S1DD 3HC4L 4KRNA 4F8TA 4P46D 4FZEL 2DRUA 4Y5YC 2ED7A 4Z7WB 1OTTD 1HHJB 4FABH 2I24N 2VE6A 1MCOL 1MHHB 3HI6L 4NO0A 1LDPL 4LLMA 2VKXA 4YK4C 5A2KH 4PJAB 4YGAB 4NSKB 4BFGA 2X4OA 3FKUS 4F8QA 1JNJA 3O3DA 4KKBC 3SDYH 1UKSA 3DGGB 2EDWA 2O5XH 4JB9L 5F9OL 3HE6C 4LLUB 4O2FB 4WW2F 1YEDB 1KPUB 3GSRB 5K9JL 1Q72L 5T1DH 3O3AA 5T5FH 5EC2B 1I7ZA 1RU9H 2OXHA 2W1NA 1EGJL 3ZHDA 3D39A 4RMTA 2A6KA 4U33A 4Q6IA 1OQXA 3N1QC 4NYLB 1NFDF 4P2RD 3Q6FB 4JZJB 4R0LB 5T3ZH 4HH9B 2PYEA 3V4VL 4GAGL 5DJDA 1U2HA 1XZ0A 4JAMA 2HWZL 2CDGA 3IJHA 2AEQL 5I16B 4P4KC 1RUAH 3ARTA 3CSGA 4YGVA 1XGPA 3GKWH 1RUQH 4X7TB 1VEOA 3MYZA 5HDBE 3D9AL 4D3CH 2ZZUT 3OB0H 4TOYH 4YBLB 3QIBC 4OLUH 4RRPG 1BM3H 1OLLA 1X5KA 3REWB 3HE7C 1JGVL 4GKSA 1CZ8L 1CS6A 3MGOA 4FG6C 4PJDB 4KTEH 4MQXC 3U48A 4HUVA 5HHXH 4HT1H 5AUMA 4KGJA 1RZKC 4JFHE 1IAIM 5JPNA 5ANMB 2RBLA 2MKLC 5FUOL 1HINL 4HLZG 4YQXH 5F1NB 4YHZL 4WDIB 5EA0H 1J1PL 3D3VB 5TDPA 5TF0A 4NNXA 4K71C 4UQ2B 2F54D 1FNGB 1H3XA 1GZPA 2NTFB 1A4JA 5F93C 1GC1L 2C7UA 3SE3A 3C5SB 4FFVD 3BPCA 3WIIL 4RAUA 4IRSA 1TVBB 5FGCE 3ARRA 5IBLD 1YNTA 3A6CH 3GRWH 1F4HA 2YUZA 4BFIB 3MO1B 3QXAB 5DFVD 5DJ0B 1T22A 3NFNA 3PJSB 4YXLL 1QOKA 4LLWA 3R1GL 2GY5A 3MNWA 2CLVB 5AD0B 4YUEH 4CL7A 1XF2B 1SJVA 3D25A 2K9UA 4UT9H 1KJ2B 1CGSH 5E2JA 4HAFA 2Q6WA 4FQXA 4WUKL 2ILLA 4P2QA 4F57H 5EIVA 3GJFH 3EUUA 1C5BH 1CTOA 4J3WA 1NBYA 1EZVX 5HSFA 4I0KA 1LK2A 2DQFB 1LP9B 4R90H 1LO5A 4J4PD 3EYOA 4WRLA 2OJEB 1DVFA 3WE6B 1YYLH 2P5EA 5EZLA 5J3HD 4UUJA 3ESUF 5FKAB 5JOPE 2FDBP 1NL0H 1MIEL 1Q8MA 1QSZA 2Z93B 5AG8A 5DMJB 3QO0B 4LSQL 2BMKA 3VFUB 1UWGL 5FA4A 1MCPL 4P23A 4XPAH 3ULUL 4L3CA 3FZUD 3TIEB 5D1QA 1DQJB 3VG9C 1FVEB 3TNMB 4MCZB 1I8LC 4X6CA 5CILL 2OTUB 2AKRA 3MRBA 3VGAC 5EZOH 1YC8A 4JRYD 4PRBA 2FL5B 5DEFA 3GMNB 2RCSH 1JTOA 4NDMB 5DRZB 1A7RH 2NW3A 3L7FA 1P2CA 1BJ1J 3F7VB 3EO9H 3SDXF 2AJYH 5DURD 1A6VH 3OZ9L 5D1XD 5H37H 1MOEA 3RY5A 2AV1B 2AJVL 4PTTA 4PGZA 4ZXBA 3TN0A 1JGUH 3V0VB 5IM7A 4TSBH 3EYQD 2BNRD 4PV8A 1PKQE 4ACPA 4P2OC 3O9WA 4O2CA 1JNLL 2Z8RA 3ILPB 4NO2A 2FX7H 2C9AA 5BO1L 1N0XL 3SJVB 2PXYD 3WIHA 3WFDL 4LPXA 5JR1L 2HP4A 1FIGH 3L3GA 5L88H 3ECBA 2VDML 4OF0A 1Q94A 4XNYL 1KNOB 3UJJH 1XGRB 1AGBA 3QPQD 3PWUA 1MLCA 1IKNC 5HI4D 2FWOB 5IVNA 3BPNB 2J8UE 2PTVA 4MS8C 1BJ1H 1PQZB 3EDEA 2DYPB 3LN4B 3SO3B 2VXUL 5BS0A 1HYRC 3EYFA 4NKIL 4XAKE 4PJFE 3HHRB 3VW3L 3N85H 2GCYA 1HH6B 1EHNA 4EI5B 5E2UL 2LE9A 5D71L 3PL6B 2X1WL 4U0QB 4QRTA 2XKNB 4F37K 2JJSC 1MCHA 2GW5A 3ZYOA 3UTQB 3UYPA 3ZE0E 1BZQK 3BSZH 4PR5B 1R3KA 2YD3A 4Y2OA 3VXUE 1CXFA 1KFAL 1NLDL 2P5WD 2FH6A 5EIIA 3CSYB 1FYTA 1S9VA 4M6NL 5DD5H 4HGKC 2E7LC 2XTJD 2FATL 5K9QI 4Z6AT 4KRMB 3VFVB 2DBLH 4PJHE 5T3XH 4NRXA 4M7JH 2V2XB 3VXRA 3C2SA 1UVQB 3OV6A 1TTUA 4EN3C 4I5BB 4ZFGL 3CGTA 4FP8H 1EUTA 2UZXB 5TF1L 3VJ6B 1NGXB 1EO8L 5H94A 4JG0H 4NWUL 2XZAL 5J9PB 5MENE 2X9XA 2IFFL 2GK0A 1D5XA 3L3OB 3PWVA 4AMKH 2BX5A 2BNQA 2R0ZL 2DM2A 4P3CL 4YHNB 5EN2B 1NMCB 5T3ZE 4BZ1L 5JMOC 4BH7A 3T0VA 2LTQC 2EXYD 5EUOE 4CNIA 1HIML 4AY0A 2YRLA 5EU6E 1CFTA 3STLA 4L4JA 1FNAA 1MQ8A 1T7XA 4K7PL 1NLBH 5D72H 4R7DB 3VGEA 2JIXD 4JR9L 4TVSa 1OCWH 3V6ZB 5B3NA 3SDDC 4RRPA 4WNQA 5IJVA 4OFYA 2FYYB 1DBKL 4IMKA 5GGUB 4HSQA 1QR1B 1X5AA 1X44A 1TTFA 1T3FA 3ZHKA 4PRHD 1AD0B 4IRJC 1KB5B 2VZ1A 4H25A 1JP5A 5C3TA 2LAAA 4Y1AB 5FHAL 5DHYB 4JFFB 3U7WL 4IDJH 3V5DA 2KQNA 1MQKL 1CE1L 5IVOA 3S8WA 1T03L 1B88A 3CSBA 3OKLA 5DJ2A 2R0KL 4ZUWA 1MHCA 5K33A 1WAAE 1Q0YH 1WK0A 1LO0H 4HCRL 4P2RE 5DLML 3S98A 4B50A 3VH8G 1KULA 1DBMH 2D03H 4C57C 4KKCD 4QOKA 3L3KB 4XVTH 3IAPA 4PIRF 4ZS7H 1VFBB 4PJXF 3SEPA 2DQCH 1ZLUH 2WWMC 3RY4A 3MA7B 3TJEH 3PGCB 3MUJA 1AGCA 1ED3B 4ODVL 2EO9A 1QG3A 3OJDB 2N4IA 4CDHA 1MPAH 4JLRA 4QRUA 1OAQL 4PGEB 3GSQB 4L8SC 3Q6GL 2OZ4L 2IG2L 1U93B 2DJSA 4AH2A 1VEMA 5J12C 2GTWA 3MLUH 3GZKA 1F8TH 4NJ9L 4EDXA 4JRXB 3U4BL 1F2QA 2I9TA 4WWKA 3W9DB 4P4RA 1J0IA 3L1OH 2EH8H 2F53B 3T0AA 4NO3B 1QVOB 3MV8D 3WBDA 5FCUH 3TA3C 3V0WH 3LQMA 4D0BA 1HSAA 2F54E 2WWKT 3K46A 5D7JC 1RY7B 3T09A 3CFBB 4NQDD 5F7HA 3NCYP 4JPVH 5E6YA 4LCUA 1PW3A 3RWCA 1OF2A 5M7QA 3QIWC 6FABL 4LPUA 1FFPB 4XXDB 3X13A 3VFOA 1FHGA 4N0YH 2OR8A 5JDSB 2J4WH 1N6QH 4HJJL 4L3EA 4LCYB 2HG5A 3QPXH 5B4MC 1X5GA 4K7FB 3DX9B 2R69L 5B8CA 4NC2B 2MSPA 3GIVB 5I0ZA 1XFPA 1Q9LB 1BIHA 1SJEA 3AXLB 5EBMB 2G5BB 2BY0A 3BKJH 4ERSH 4XCYA 4FTVB 3DYOA 3QP3A 2VXTH 1Z3GH 3LCYA 3MRIA 4F7TA 4X9HA 4I0PC 3QUYD 4PGCB 2FD6L 4P9HL 3H3PH 2NY2B 3BD3A 5GGRA 3WFEL 5KN5A 5KZCD 1DQDH 3BEWA 3BZ4A 1E4JA 5FYKH 5HHOD 3W39B 4GS7B 5F70A 3D2UA 3G04B 3FAXA 2V2WA 4DZ8B 3PWJB 4HV8A 2XWBA 1JNNL 4PLKC 1UJ3C 2F5AL 4M4RA 3LD8B 5I9QB 5CFHA 4KV5F 4YHIA 4LF3A 1U91A 3H9ZA 3EYUL 5D1ZD 3BYTA 4M5ZL 2D7MA 4U1SB 2RJMA 3MJ7A 3CFDB 2NPLX 1D9KB 1T66C 3S96B 5IMOB 1AP2A 3DX6A 4DN3L 1U8QA 1TMCB 2NW2B 1J0JA 5E8NA 2X10A 3CPLB 2CIIA 3HR5B 1H5BC 5DWUL 1PYWB 4GG6F 2Q86A 4N1EA 3LQAC 3L3JA 4ZFFB 4PJAF 1KJVB 1LO2L 2NY6C 5T1KA 3BGMA 4JRYE 4KVCL 2I60L 2X4SA 3H9YA 1RZFH 2IAMC 2YA0A 1FC1A 1RJYB 2FX9H 2X4RA 4YDKH 1ZXQA 2QADC 2Z91A 1FL5A 4H20H 3RIFF 4PRNA 3W9EA 5ALBL 4XTRC 1FGVH 1S7TA 5C0BA 1YMHB 4OB5L 1WVZA 2XFXB 1PZUB 2R23A 1I1YB 1PLGL 1T89C 2DQEL 2R29H 3WN5C 3ZT7A 5I75B 3BH9A 3EO1A 2BNRE 2VC2H 3C6LC 1R6VA 3WNKA 5CZVL 2CIKA 1FRGH 1VFUA 3BD4A 2ZKHH 3QEQB 3TYFA 1X5LA 5CIPB 3D3VD 1L6XA 2CK0H 3GMPB 5EFIB 4UILH 5A2FA 1I7TA 3WLBB 2EYRA 4QHNA 4L8CB 4OF8A 1BVZA 3CUPA 1HYSC 1E0OB 4WO4A 4MDJA 4RFEB 5LBSH 1RIVL 3WXWL 5CEXA 3IXAB 4KDVA 3QZWB 3OAYK 2AJ3A 1H3PH 3MUZ1 2PO6A 2EKSB 3QUMH 1VPOL 5ALCH 3RL2B 3R06A 4B53A 4FQQA 1X6LA 3HPJA 3K2UH 4LNVA 4Y5YA 1CDBA 4MJ5B 3LKSA 1GOHA 3OXSB 1AQKL 2CDEA 1QSED 1WZLA 3FQRB 4YHOL 2EXWC 4ZFOA 4ZTOL 1U92B 2EDRA 3KLHC 2B1HH 4XPFH 3MFFB 3ARWA 4RGOL 2IH1A 1RMFL 2FLBT 1BOYA 2XA8L 4EXKA 2AJSL 4MNHA 4HK0A 5MHSD 3HE6A 2D31A 4PY8I 1RV6X 3MLYL 3ARGB 1E28A 5KOVC 2F5BL 3IFPA 3R0MA 4ELKB 1P4IL 2P5WE 3PF2A 3PWNA 4IM8A 1I1AD 2Q76B 4JY5L 3VWJA 2X89A 3IRZA 2XTJE 1JWUB 2E3VA 3HG1A 1CD0A 1F90H 1UCBH 5D7LB 3QIUA 4Q74A 1TQCC 2Z35A 4OD1L 5FUZH 1KCUL 4LKXB 4P59H 3BKML 5DUMH 1BECA 4OZHA 3QO1B 2Q8AL 3TCLA 1QBLL 1UM6L 3Q3GA 4FQ2H 3TJHD 3U9PH 3O4LB 3QUKA 3IFLL 1C08B 3UTSD 4R4FL 1QYGL 5FGBA 5GGSA 3E8UL 3O3BA 2GJ6B 5D7IB 5KS9B 2EIZB 4QO1A 2QBWA 1ZSDA 5EO1A 5C0CD 3CDGA 2YPLB 1N7MH 3BN9C 2X7LA 3BP5A 5FA3B 2NNAB 4NZTL 2VRAA 3QIBA 1M05A 3S4SB 5DGQA 1FFRA 3EJYD 3IFOB 3NA9L 4K23L 1KIPB 5D2LB 3L3HB 2KL6A 5JA9A 4LVOC 4XMKH 1LP9F 5CEYA 4XPGL 1INDH 2FEDD 3BFOA 4MCYB 1KJ2H 4YC2C 5HVHB 3CFJB 5E5MA 1B0GB 1CLOH 3V52H 2DI7A 4NQCB 4B7LA 3QCUH 1T20B 2PKDA 5FF6A 2G5RA 2XG5A 3OAUH 2PCPB 3P3YA 1Y6KR 1HSBA 2WLYA 3RWGA 3H3KA 1GAFL 2W0FB 25C8H 3C60A 1K4DA 2QQKL 4CGTA 4UQ3A 4HH8A 1QRNB 3P9MB 4PRHE 2E6PA 5JUEH 4C4KT 5E5UB 4KUZL 3CH8A 4YX2L 3EIFA 5JXAH 5IF0A 3O11B 2E6JA 2FO4B 1CICA 4XMLH 3MA9H 5C0RL 5JQHC 2P8LB 5LVEA 2CRMA 4GQPH 1R3JA 3NIDE 3TNNB 5A1AA 4QWWD 5BW7C 3VFTA 1NEUA 4QRSB 3ELAT 4KY1H 4NP4H 3QHZH 4LQFH 5DJZA 1HILA 2EDYA 5E2TL 1GH7A 1QBAA 4XP1H 1U3HB 1FO0B 3MRLA 1IC5H 4J6RL 4LCCC 5DD0L 1IGML 4H8WL 4HJ0C 2X4UA 1J9CT 4HDIB 1CCZA 3MODL 1MAMH 3RPKA 2WSKA 4N0UA 5JOFB 4WTWA 3HFMH 3VMOA 4MXVF 3F58L 4X99B 5DA0B 2BFVL 3EJZC 2UYLB 1G6RA 3G6JE 1UZ8B 5DMIH 1UXSB 1N6UA 3KYKH 2PETA 1V5JA 2VN7A 2VERN 1F11B 4LHUB 2WUBL 2FR4A 3UJTH 3OX8A 2CKBA 2UVEA 3EDDA 1MFBL 3MV8E 1IZJA 3HMXH 1MIML 2QKIA 1EHLH 4L8BB 3LKRA 3LVEA 4U3CA 4NQDE 2AI0H 1FORL 4LSSL 3G5VB 1IEAB 4E42A 1NC4B 5L8KB 1Q9KA 1YA5A 2YKLL 5BRZD 3W2DL 5KG9A 1EEYA 1GPOL 3DI3B 4PUBL 4S1QL 5IW1B 3VRLF 3RVWD 1T2QL 4UNVA 4MYWB 5IMMB 5C0AD 1JGLH 3U7YH 3NIGF 4KJPD 4I2XE 1OTTC 1QACA 4KC3B 5EU7E 3UEZA 4LEXH 4H0GA 4AK1A 4HWEL 2ZNXA 3WFCH 2BVEA 3TCXA 1I7RA 1DZBA 2AJUH 3HZMB 4Z77B 2VDQL 2EDDA 4Y0GA 4OCRH 5TH2A 5DI8B 1MCDA 1NGQH 5HHOE 4O51B 1WICA 3DVIA 3QUXA 3VFRB 3QG7H 3G5YA 3HC0B 2ZWLT 3QULA 3HZYA 2B0SH 5IEKA 2IH3B 1T1YB 2NYYD 3SGKA 1NDMA 4X4ZA 1G0DA 1XR8B 5KW9L 1ZGLB 2FIRT 1RZKL 1G7JA 5BVJB 4XXCA 5IEHA 3K74B 3WHE0 1UM5L 4OFPA 1L7IH 3I3DA 4N8PA 3QT2A 1WCBB 3CVHB 1JHLH 1J5OL 1QLEL 3OSKA 3QHFH 3HAEG 3ZHLA 5F7EL 4PS4H 5DVLA 1ZLWK 3CLFL 1S3KL 4JKPL 4XP5L 1ACYL 3ARBA 4F9LC 5DF0A 4FQHA 2E8YA 1A7BA 2VZOA 3B6SA 2X4QB 2QV2A 5DJ6A 3O2WL 5GJTL 5CLTA 4GOSA 1KBGL 1NCDH 4O5LH 2VDOL 4BSJA 4U1LB 3RWJB 5JHLH 3RWEB 2B8OT 2G60H 3OL2A 1AQDA 2I07A 2J6EH 3BPLC 2P43B 3BP7B 4EN3A 1IZKA 4NT6B 1XGTA 3AM8A 1VADB 2ARJB 1W0WB 3QEUB 4H1LB 5LGJA 4TPRH 3WO3B 1P9MC 4PJDE 4G9DB 5E08H 3ARXA 5ANME 2VE6B 4HIHA 1MNUL 1B0WA 4NO0B 2F53D 1KB5H 4LLMB 3BHBA 3QCTH 2IQAB 2X4NA 3D3VE 1UQSA 3CIQA 4OBSA 4FFVC 2EIBA 3O3DB 3MJGX 5IB1A 1QEWA 2HTLC 3GHEL 2JJTC 3V8CA 3RZWA 1MEXH 12E8L 3O3AB 5DFVC 2P4AB 1TJIL 1CF8L 1I7ZB 3NVQA 4ALAL 3W0WA 3P30L 3D39B 5CWSA 4HJGA 2P45B 3I9GH 5DUPL 2PW1A 1QSEE 3SE4C 3PV6A 3BW9A 4PBVC 4M62H 2DI8A 1XZ0B 3QISA 4JAMB 5DJDB 3IJHB 2A77H 2Y7QA 2D4FA 1F4WL 1E4WH 2F58L 2GSIA 4YGVB 4TUJA 3S9DB 2CRIA 3P4LA 1CWVA 1F4XH 4DKAA 4GW4A 1P1ZA 3O6FA 1XGPB 3DVFA 1UWXK 1DBAH 1AXSB 4F2MB 5MHSE 5T5NF 2FB4L 3EYSH 5C07D 2X70A 3QI9A 3KXFA 4LIQH 2I5YH 5ADPL 2V5SA 5I1GH 3MGOB 5J3HC 4UOW0 4OTXH 4OLVH 1EPFA 5KSAA 3RUGA 2OP4L 4JPKH 4PJ8D 1ORQA 1SJHA 1X5JA 2AK4A 5AUMB 3G5XA 3S6CA 1JHKL 1BJ8A 1W8OA 1EK3A 5JPNB 4PTUA 4YJZL 1AO7A 5IFAL 3UTPD 2X2YA 3CCHA 3T8XA 4UB0H 5TDPB 1J1XL 3F8UB 5DMGC 3UC0L 4ODXB 3ULVF 3WNMA 4MNGA 4Y8DC 3UTSE 1GZPB 3MRCB 2VAAA 1EH9A 1RIUH 1A4JB 1CD9B 5KSBA 2BSRB 2C7UB 3D69A 5C0CE 2A6IA 4KHTH 1HWHB 3BPCB 1BVKA 2JE8A 4RAUB 4IRSB 5KVGL 4MNQD 2DQHL 4KVNL 2A9NL 2KH2B 4L8SA 1I9JH 5CINL 5DK2A 5FM5M 3RAJL 4ZSOB 2COQA 1T22B 2YD8A 3NACL 5GS1B 5BOPA 3NFNB 4YO0A 4OZ4A 3ZMRA 1KCLA 5I18H 3SKUD 4DEPC 5E4IA 4PGJA 1ZHKB 2AJXL 5EU3A 5SX5K 4D0CA 3DMMD 4KH2A 1I9IL 3SGDH 3QEQD 4XP6L 3NBNA 2ED9A 4NRYA 1IRAY 4LGPB 2DQDL 5HI4C 1WITA 4TNWF 2DD8L 4TVPL 1NH6A 3RWDB 3DV6B 1FSKC 4YFLI 3BJLA 1NBYB 4ZPVA 5H2BA 1LK2B 1JMZA 3EYOB 4X9FA 4G43B 5JXED 2R4RL 3G6AA 5FV1L 3JWNC 1DVFB 4R4ND 4PJGB 1H3WM 1XMWA 2P5EB 3BE1L 2YC1B 1YECL 4XHQA 3N1MC 1MWAA 2F9BT 1A64A 3BIKA 2JCCE 4OT1H 4L8DA 3C8DA 1IAII 3ZKMD 4D9LH 3DRTA 1EBAA 3Q1SH 2LFGA 4KROD 1MCCA 5FA4B 4YHYC 4P23B 1A7QH 4L3CB 1OP9A 1KEGH 5FYJD 5FOJA 3WFHA 1U3JA 3K80A 4E41B 4X6CB 3MLVL 2AKRB 3MRBB 1UADC 4E9LA 5TFSH 3U1SH 1UJ3A 2QLVB 2EDBA 4LLAA 3FT3A 3ARGD 4HEME 1K85A 1FG2A 4OD3H 4WEMB 2NW3B 1P2CB 4FFWD 1NBQA 3SE9H 2BVPA 3L5XL 3S36X 1P4BL 4Z7QF 3S35X 1FV1B 3GSVA 4X6FB 4ZXBB 1K5NB 3TN0B 4P3DA 4PJIB 4PV8B 3O9WB 4NQEB 5MEPA 1E6JL 4N90D 4NO2B 1L4IA 1RUPL 4JKLA 1I7UA 1CFSA 5HVWA 3O4LD 4LEOA 4Q9BA 4PJ5B 3L3GB 3LB6C 5I15L 3LH2H 1C12A 4JREB 4KK6D 1U8LB 1Q94B 5JHDB 1AGBB 5DEGA 43C9B 4XMPL 1MLCB 2YPLD 2V17L 4M93B 3TO2A 3TZVA 3KDMB 3HB3C 5INDA 2VQUA 4G3YL 4JDZA 3RWIB 4BZYA 1IM9A 2GUOB 3HAEA 4R2GD 4WWID 1IAIL 2VH5H 4B7IA 3PNWB 2BRRH 5BS0B 5BRZE 3MLZL 4JPWL 3EYFB 1G84A 3B8YA 3JBG7 4Z7VE 3K8MA 4HKZB 4M8QB 3MUHL 1QLFA 2K3TA 5C0AE 4WI7A 2R4SL 2X5PA 5KAQF 1RSFA 3CMOL 3IDIB 4QRTB 3QXDB 1KTKE 4NQCD 4FXGA 5ICZA 1J0ZA 3IAGC 1FNEB 3RNKA 4R8WH 1R3KB 1R5IB 3TFKD 5D7IF 2ZP0T 4UDTA 3CAFA 5AYUH 3QB7C 3QDMB 5EIIB 5TQ0H 1FYTB 4WEBL 5TQ2L 4YLQT 1L6ZA 5IHLB 5JNYA 4G6MH 4JHBA 1HKLL 1G7LA 4N0CC 2BHZA 4M3KB 2ITDA 4PP1D 1J1OL 4NRXB 1JPSH 3I6KA 4AT6A 3FO0L 1FZMA 4XT1C 3PABA 1SM3L 1ULVA 4ZAKC 3DWTA 1DLHA 4LLVA 2CUMA 1TZHA 3HNVL 3KPRB 3OKMA 5IW3A 2BNUA 4OI8A 1KIUA 4ZYKA 5DSCB 2DLFL 3VMNA 2EE9A 3C5ZA 2A1WH 4KKCC 4JN2A 1QKZL 1NGWB 4XP9L 4QGYA 3E3QC 1PY9A 2HT3D 4WFEE 1JPGA 4NWTH 5MEQB 3T2NL 1D5XB 3DX7A 3PWVB 1HN1A 3GBNL 3NFSL 1IQWH 2VR4A 2DDQL 2MNUA 4FXLA 4F15B 4N8VG 4BH7B 4Z0BH 3RZCD 3MV01 4RZCB 4NM8L 4RCAA 1IEHA 1CFTB 1T21A 3P0VL 3FO1B 1YEJL 1EDQA 4U0RC 2FBJL 2XQYG 4PJ7A 1F58L 1SBSH 4BH8A 1RIHL 1NAMA 1VGEL 4DK3A 4RWYH 2F8XC 1B4RA 4WNQB 1MRFH 5IJVB 1JJUA 3P11L 4LIQE 4EUPH 4LHUD 3V95A 2EE3A 2EH7H 4K8RD 4G6FB 2MCG1 3DRQA 3LRHA 3ZE2F 2F53E 5CZXD 4O9HL 5FM8A 1IC7L 2ED8A 3TP4A 1WWBX 4X6BA 1YZZA 4W68A 5GRVL 5GXBB 2NR6D 3ETBF 4X4YA 4H25B 1PKQA 3L95A 2DWEB 1OWRM 4XC3L 3N1GC 3OGCA 3V5DB 3BDXA 5C08A 2V7HB 1CDYA 5DJ2B 1CDHA 3QDJD 1IL1A 4ZUWB 1MHCB 5I17A 1FO0H 1FLRH 4GRLB 4UTAH 4P0DA 4ODHL 3R0NA 5GRZA 3UBXA 2XICA 4X8XA 2WUCH 2E8ZA 2A6DA 3BZEA 4XPTL 4QOKB 4QXGH 2J8UA 5ENWA 4BELD 3V5HB 1RZ8A 3DUSB 3D18A 2EO1A 2XOTA 1QSFB 5GGTH 1ADQH 3I02A 1AGCB 1DLFH 2GAZA 4U2YA 4LQ1A 2Z9TA 5C07E 3BRGC 4BUGA 2UY7A 4QRUB 4HF5H 1O5DT 1TCRA 4OV6F 1X4ZA 2VLJB 1B9ZA 1KTRL 4JZJC 4R0LC 4QCIA 3I85A 1XGUB 3VXUA 4AH2B 4A2MA 3MXVL 1R3HA 2GTWB 5KVDL 1XGYL 4EDXB 2I9TB 5CHNA 4WWKB 3GMRA 1MFAH 4P4RB 3T4YA 1D5ZA 5F9JA 3UTPE 4R7NA 5FO9A 4U1NA 5B39G 2IMMA 3IU3A 4I77H 3MNZA 5I0DA 4PD4K 3UPCA 4PJHA 4D0BB 2X1PA 3ZKXB 1L7TH 5B3JE 3GBML 1CLZL 2YK1H 3FT4A 3SCMD 2D3VA 3RWCB 1OF2B 1LMKA 1A3LL 4YWGL 1MAJA 3L6FA 3N06B 3X13B 3VFOB 4Q0XL 1F6FB 4NZDA 1SBBA 3V7AG 4L3EB 2HG5B 4MNQE 2HAZA 1CFVL 5MENA 1ZK9A 5B8CB 1KN2L 4MDIB 5DRWB 4XCYB 2VAJA 1B4JL 4F7TB 1CLCA 2Q7YB 1CI5A 3RA7H 1S9WB 4HD9A 4Y8AA 4CU6A 1P4LA 1MCSA 4EBQL 3WLWC 5KN5B 5TE6L 4XC1L 4M9PA 1PY4A 3QEQE 3BZ4B 3HUJB 3CLEH 3MOAL 3BMVA 5LGKA 5EU6A 2CO6B 3D2UB 5I1KH 2V2WB 5IBTL 2BVQA 4TTDD 3UBXI 1AD9A 4HV8B 2XWBB 3TVMC 1S7RA 4EQ3A 4K3DH 3UTTD 5F44A 2FO1A 1VB9A 3VGDA 5CJ8A 5J57B 4YHIB 1YJDC 3CVHH 4ZOBA 5K59F 2GQHA 1U91B 4LF3B 4P46A 3NTCL 3SBWC 4QNPE 2VXSH 4OLXL 1FE8L 1TQBB 5F21B 2BZDA 1TETH 3IYLW 1AP2B 3DX6B 5EZIH 5I1CH 3B43A 3P4NB 5E95B 4ODSH 3NMEA 4XRCA 2R8SL 1J8KA 5E8NB 4H88L 3PWPD 2CIIB 1BWMA 2VXVL 2IADA 5CJOH 1BX2B 3LEVH 5IFHH 3R4DA 1MCKA 2Q86B 5FYJE 3L3JB 1N64L 3ZDYF 2YS4A 2Q8BH 2EDXA 4G6KH 4JCMA 2ZUWA 3EOAA 4H1LH 2X4SB 1DN0A 4DGVH 4CVWA 5JW3H 3S3JA 3THMH 2X4RB 3BT2L 1WAAA 2Z91B 1FL5B 4P2RA 3W9EB 5GGVH 3CU7A 5SX4H 3RVUC 1FNFA 3CVIH 5C0BB 3DROB 4U7MA 2HT4C 4QHUA 2R23B 2VJXA 1W0VA 5EORL 3U0TA 4LNRA 1QFHA 1KCRH 2M8XA 4FFZH 3EO1B 4LSDA 2CIKB 4N90E 4P99A 1MFDH 4OGAC 3S7GA 2X05A 1CQKA 1JWMA 3O4LE 5DQDL 3U0PA 3DO3A 4NBYB 5IBUG 4NC0B 4ODTL 3T0EC 4QHNB 1BF8A 5KS9E 2HJKA 2Y06L 3WSQL 4YAQA 2YPLE 1ZEAH 3MRGA 3R8BB 4WO4B 4MDJB 5EOQH 3UZVB 5CEXB 4J2XA 3LPWA 4XGZA 2W9DH 2YSSA 2AJ3B 1TPXC 32C2A 3GJFA 2PO6B 5HGDA 3U7AA 4CADA 1D3CA 3R06B 4KQ4H 2VLLA 4RISH 5E1AA 3HPJB 3FQTA 3FFDA 4AEIL 3LKSB 1F45A 3X3FL 1GHFL 4ZFOB 4N8VA 3X14A 4J3XA 2F54A 2NY1B 5CMAA 4UAOB 1T1XA 4BUHA 4U1JA 1YMMB 3CFKA 3FAWA 1HWGB 1K3ZA 2IH1B 2DLEA 4NQCE 3C8KA 3F7QA 5HGHA 4JQXC 4FABL 5E8EA 5F7MC 5GRYA 4OCWH 4HS3A 4HK0B 3BXNA 1SYSA 3OJVC 1E28B 3M17B 5BXFA 3BPNC 2RGSA 1XF5A 3PWNB 4LSPH 5GRVK 5FGSA 1JYXA 5K9OA 2XN9B 5CS7A 3JWOC 3VWJB 3VA2C 3DLQR 3SDYL 1QUNA 1MH5A 3HG1B 3OG4B 3SO3C 2H2PD 4Y4FB 2O5XL 1MCWM 3QIUB 1OSPH 2YXFA 3HS0A 1T2JA 2HLFC 5T1DL 4EI5C 3PL6C 5T5FL 1HI6A 4OZHB 5FFLA 1RU9L 3VXQA 1YN6A 1QBBA 1U8NA 3UDWC 1JI1A 2APBA 1A47A 3Q3GB 2HLAB 4N5UA 3QUKB 4OKDA 5FUCE 4PGBB 3FL7A 5TE4H 2OK0H 5GGSB 5T3ZL 4E41D 4JO1H 1OPGH 2AQ1A 4LHQB 3WL9A 1R5VB 3ARFB 5DRNA 4L3AA 1ZSDB 5EO1B 3PHQA 3CDGB 1A14H 1RUAL 4J4PA 5TPWH 3BP5B 3PGFH 1G7QB 4PB9H 2YOCA 1M05B 3NZ8A 3K4AA 3FFCB 5MERB 2R39A 1C7TA 2NXZB 2HTKC 1KEMH 3GKWL 1RUQL 4I1NB 3VH8B 2MCPL 5CEYB 1NBZA 1H8SA 4D3CL 1HHGA 1OVZA 2XPGA 2CUHA 4TOYL 3HKFA 4OLUL 4NUGH 1MLBA 1BM3L 2QEJA 3TN0D 1MCRA 4DKDC 3PXJA 5IQ7H 3AY4A 5AAMA 4NQED 4KTEL 5E5MB 5HHXL 4HT1L 2A83B 5E8PA 3NOIA 1Q1JH 4JRYA 1P5UA 3QXUA 2X9WA 5FF6B 3RVXC 3OAYH 4PJ5D 4NN6B 3SDXE 2I25N 1FZJA 4YQXL 1HSBB 3MROB 5DR5H 5JHDD 5EA0L 1NMCC 1PVHA 3RWGB 4GT7A 1ZS8A 1INQA 2FJFB 3C60B 5E4EB 5D1XA 5MP6H 4YPJA 4UQ3B 3SPVB 4GG8A 1S7XA 4MA7H 5B39A 1JHTA 1VCAA 1CICB 3TBVA 1MCEA 2W92A 3A6CL 3GRWL 2PXYA 4M9OA 2R0WH 4NHUB 2Q3AA 4P5TD 3QDJE 2VDKH 3BISA 4GXVH 3Q5OA 3RGVA 3VFTB 4OBRA 3MOQA 1L0YA 3K0WA 5DJZB 3G6DH 1CXLA 1DR9A 2J3SA 1HILB 4HIIB 4YUEL 4FFYH 3MRLB 4HUXA 4UT9L 1T5WA 3QDMD 4MLIA 4WIQA 1CGSL 2X4UB 5FO8B 4N0UB 3LKQA 4X9IA 4F57L 2F74A 2YPKA 4LL9A 1C5BL 1RK1A 4PY7A 3WIHH 3OKDB 4LPTA 4R90L 1FFNA 1VKXA 1QFWH 5DJXA 4Z5RB 1MCFA 1YYLL 3ARQA 3KPRD 4Y4HD 2E27H 5HGGS 4X8JB 5JIIA 1KXVC 2P5WA 1NL0L 1MJUH 2CKNA 2VITB 3STZA 2CKBB 4XWOC 4PRPD 3ARYA 4G80A 1N8ZA 4RNRA 4HZLA 2QKIB 3U6RA 2WK2A 5FYLH 3LKNB 1NMBH 1B6UA 5BJTA 2OL3B 4LPVA 4KDTA 5IQ9A 2O5YH 4CVXA 2YA2A 5HYEA 1LO4H 3MRRB 5IW6B 5EZOL 1Q9KB 1ZHNA 1G1YA 1CR9H 1MCWW 1UXWA 1AKJD 5KG9B 1EEYB 2P8MA 3OR6B 3E1F1 3KNBA 3D1MC 1A7RL 5DJCA 4YH6A 3QRGH 2VQ1A 3EO9L 4Q9QH 2AJYL 1A6VL 4ODBD 1BQHG 5TDNB 3DV4B 1U36A 5BCAA 2H2SD 3O8XD 1FL6A 2IANB 4EIGB 4O4YH 2FGWH 1JGUL 1CFNA 4IMLA 4TSBL 1UGNA 1I7RB 1MJ8H 4ZFZA 1S8DA 2FX7L 5TH2B 3VI3F 2X4PA 4QYOA 4JO3H 1FIGL 1EIBA 3DETC 5L88L 1HOCA 3QUXB 4LP4A 3OR7A 4Z7UE 3UJJL 5JW4Q 3QULB 3HZYB 1WZ1H 5IEKB 3UTTE 2P24B 2JIXA 4HGWB 1CGVA 4F9PA 3BDYH 1UH4A 2XV6B 1G7JB 2GITA 2VXQH 5CUSH 5IEHB 4FQ1H 2UZYB 5DMKA 5CEZD 2H32A 4HC1H 2O5ZH 2ZJSH 4GRLD 4XP4H 2NY2C 4OGZA 3MUY1 3N85L 1PKOA 4PRHA 3PWPE 1JF6A 4FQHB 3VD5A 4M1CC 3B6SB 5DJ6B 4W81A 3BSZL 1A0QH 1QSFD 3LD8C 4P3WA 1N2RA 5EIQA 4P48A 1AQDB 4J7RA 5DD5L 5CSGA 2VABA 1D9KC 5LGJB 2DBLL 3MOBH 2VLJD 3QDAA 5T3XL 1FFOA 3FQUA 4M7JL 2EEDA 4G7YH 1KCVH 4I18C 3H9SD 1KC5H 3PHOA 4HIHB 4OCYH 4GRWF 4QHMA 4FP8L 3W5NA 4PREA 4Z76A 4Q9RH 4HLZH 3BHBB 1G9NH 5LQBH 2V7NA 2X4NB 1MHPH 3RVVD 1X5FA 1SYVA 4JG0L 1SEBA 3UPAA 1IM3A 4HAGA 5GZOD 1LGVA 1MCLA 1EJOH 1YEEH 3G6JA 2LU3A 4DVBA 5CEZH 3EDFA 4AMKL 2AAVA 5D9SB 1V3JA 1IGIH 4N1CA 3FMGH 3W0WB 5CWSB 5GPRA 5JLZB 1E4KC 4NC1C 4ZSOE 1ZGLM 5I75C 2BY1A 1X7QA 2PW1B 4LRIA 1Z9LA 3PV6B 1NLBL 5D6DA 3BW9B 5D72L 4JO4H 2Y7QB 3OKKB 1OCWL 3L3IB 5C3LD 2GSIB 4TUJB 1AHWA 3PXHA 4D2NA 5GRJH 2EEAA 1CE6B 4GW4B 1P1ZB 2FX8H 1LE9A 1N4XH 2KZWA 3MRDA 2D7TH 3KYMA 4LVNB 1VFAA 4I2XA 2X70B 3ZDXE 3QI9B 2FEEL 1S7QA 4M1GH 5AWNH 3LS5H 3RUGB 3RNQA 1ZLWH 1HHJA 1ORQB 3H7LA 1SJHB 2AK4B 3QUYA 3G5XB 4PJGE 2FH8A 4IDJL 4PTUB 1AO7B 3KLDA 5IROA 4OFDA 4XBPB 5HHOA 2YD4A 3FQXA 2BRQA 1Q0YL 4KV5E 1LO0L 4OQTA 1FLTX 5F89A 4E41E 5A2LH 2VAAB 1DBML 1YEDA 5KSBB 4KKLD 5ICYB 4LSTH 4KJQD 5D1ZA 3D69B 4XVTL 4ZS7L 5F72S 5I71B 1BVKB 2DQCL 2NY0B 4WV1B 1OTUC 5M95B 2CLRA 3V4PH 4OIIH 3IDGA 3TJEL 3GJFK 1JWSA 4PY8J 5DK2B 5ID0B 5FO7A 1I1CA 3QUMA 4LVEA 3TO4C 5C0BD 2JTDA 4YO0B 4OZ4B 1MPAL 5AEAA 3MCKA 2DI9A 3MREA 35C8H 4DVRH 1FDLH 2FECI 1EAPA 1T1ZA 4PJIE 4NQEE 4D0CB 2H1PL 4NOFA 4KK6C 3MLUL 1F8TL 4NRYB 1T1WA 4PJ5E 3KWWB 3L1OL 2EH8L 1ZHLA 3QUZB 5JHDE 5FCUL 3JWDH 2XQYK 2EEBA 4AG4H 1EFXD 5KSVA 3V0WL 3RTQD 1U8OB 3ARZA 4PJDA 5H2BB 2FNBA 5C0FA 2Y5EA 4JPVL 4CU7A 1BP3B 4LARH 5B22A 3G6AB 4JQVC 2R1XA 5ANMA 3KJ4B 1CTNA 4DKEH 5HVHC 4X6EA 4N0YL 5FYLE 1MWAB 3NIFE 2J4WL 1P7HL 4NQTA 1N6QL 4L8DB 3RWHA 3QPXL 1T04B 1UWXH 4UQ2A 3A6OA 3DRTB 5EO9B 2NY1D 2NY3B 3BKJL 3TFKC 4ERSL 1YMMD 3H9HB 1FIEA 3NGBC 2IFGA 4HXBH 4U2ZA 4X6DA 2VXTL 3AS2A 4HMCA 1Z3GL 3GHBH 1G0YR 1DJSA 5EULV 3C5SA 1ND0B 3H3PL 3BH8A 1T0NB 4ZMAT 1A5FH 4NFDA 3FT3B 3WS6A 3OHXA 4PBWD 1FG2B 3QDME 5FYKL 2XN9D 3VWJD 3HG1D 1QSEA 1KGCD 5ILTH 3LKOA 4Y4FD 3QIUD 2FECL 3GSVB 2CLVA 3WNPA 1D6EB 1IT9H 3VXPB 4RMQA 4M7ZB 5MEPB 5FOBA 1JRHH 3T0XA 4APQD 1RJLA 3GSNB 1I7UB 2GT9A 3HNSH 3KPRE 4LEOB 4ZQKA 1DL7H 1MREH 1WT5C 3IETA 5JPMB 1U3HC 1I1AA 2V2TB 1RJCA 4EEEA 3MBEB 3ARFD 5DEGB 3LEYH 4PRPE 2DQFA 3M8OH 2R56H 2AK1L 3QQNA 3TO2B 3KYNA 5INDB 1PJ9A 2BSSB 5KJRH 3FFCD 4JDZB 4DWHA 1IM9B 3NZHH 4PJEF 2NXZD 3X3GH 3HAEB 4X80H 3JV5A 5SX5H 4DN4H 2DLHA 5FKAA 5F88A 3X11B 4Y16D 2GY7B 1RZFL 3MRHA 5CP7A 1WBXA 1OAUH 2V5RA 4YE4H 1YUHA 4MD5A 4YDKL 3LN5A 4H20L 1QLFB 3UTSA 2ZUQB 4YXHH 3TIEA 1FGVL 3REVA 4MCZA 3B9VA 3IF1A 5C0CA 1S7SB 4I3RH 4FXGB 2Y25A 5ICZB 2R29L 3RNKB 4JZNA 3GMNA 2VC2L 5FGCB 4Q97A 4K07A 4UDTB 1FRGL 1ITBB 1F3JB 2ZKHL 4DAGH 2NR6C 3F7VA 2CK0L 4IOFC 4MX7A 4JDTH 4OJFH 1U3ZA 5SWSA 4UILL 4L1HA 4ZG1A 4XX1G 1BGXH 3MYJB 1JFQH 2AV1A 1G7LB 4U6VH 3SQOH 2ITDB 1K8IA 3L7EA 4HMEA 4LHJB 3AMKA 1VDGA 3FOMA 3I6KB 4UI2A 5LBSL 4AT6B 1CICD 1FZMB 3ILPA 2BHYA 3QAZB 3PABB 2MWCA 1H3PL 3FN0H 1B90A 5ALCL 1DLHB 1OQOA 1I85A 2ATKB 1TZHB 1K8DA 3OKMB 1NANH 2XQBH 5ERWA 2BNUB 3DX8B 1ZE3C 5CEZE 4TRPH 4JN2B 4U05A 2DLTA 3UMTA 4BSWA 5I19H 3SGJC 4OZGF 2B1HL 4XPFL 1ZVYA 1GC1C 3DX7B 1QFWM 3B9KD 1FL3A 3NCYS 2JCCA 1QSFE 4C55A 3IGAA 4GXUN 4GQ9H 2EE2A 3GO1H 4NBZB 4K9EH 1T21B 1TIUA 1J11A 1F90L 1UCBL 5IB3A 4PJ7B 1G9MH 4IBLT 3UTQA 2VLJE 5FUZL 3KR3H 3UZEA 5BVPH 4PR5A 1NAMB 4P59L 5DUML 4DOHB 3H9SE 1B3JA 3X17A 2QHLA 4FQ2L 3U9PL 4KI5D 4NPYB 2HFFA 1SEQH 3Q0HA 5I76A 5EO0A 3VFVA 4X6BB 2AXFA 1UB5A 3LY6A 4AEHH 1OT1A 4DZBB 4X4YB 1PKQB 1N7ML 3L95B 4AJ0A 2AXGA 1BQLH 4WU7A 4MAYD 2AP2A 4NFCA 5L7XH 5C08B 5C0DA 4K94H 3VJ6A 5CD5D 4KRPB 4XMKL 3MJ9A 4ETQA 1INDL 3C09B 1IL1B 5I17B 3RBSA 2IAND 1KJ2L 1LK3H 4YHLH 5IIEA 1A2YA 3UPRA 2GYSA 2A6DB 4HHAA 4QHKJ 3INUH 3LEXB 4YHNA 5EN2A 2HH0H 2J8UB 5ENWB 1CLOL 5TDOB 3V52L 1U8KA 4TTDC 3QCUL 1A22B 2NCMA 3D18B 1F00I 1XF4A 5BRZA 4OF6A 4JM4H 3HUJE 1IAOA 3OAUL 3KPLA 4Z7VA 1CYGA 2GAZB 5C0AA 4R7DA 25C8L 2HFEA 5DQJA 3V4UH 1F6LL 4JQIH 3QQ9C 4Q6IC 1TCRB 3V6ZA 5JUEL 2J6EA 1U3YA 5AZ2H 1KCKA 3K3QA 4POYA 2CKBH 4L5FH 4QCIB 5JXAL 2W0KA 2ADGA 1DSFH 1I1RA 4WCYH 4XMLL 1KTLB 1WISA 2FYYA 3MA9L 2VWEC 4Q9CA 6CGTA 1LILA 2EYTB 5CHNB 3GMRB 5GGUA 2OL3H 4JVWA 1J7VR 1D5ZB 4Y4KB 1JGEB 3ZE1E 5FO9B 1S9XA 3IU3B 2CK2A 3CXHJ 3FN3A 1AD0A 5I2IA 5C86A 5JA8B 2PTTA 1EO5A 3P4MB 4PJHB 4KY1L 5IJKA 4NP4L 4F58H 3QHZL 4MAUL 1FVCA 3FT4B 3RJDA 4LQFL 5A40E 5KVFH 4LPCA 1BFTA 4MMXC 5I8CB 4XP1L 3U79A 3L6FB 1IC5L 3VGHA 4PPTA 2F8VA 3AMLA 2NZIA 1MAML 4QRRD 5MENB 3HFML 2Y23A 1X5HA 3GI9H 5C0BE 4U1MB 4GBXD 5DMIL 1XCTA 4M48H 1VFBA 4AYFA 3D6GA 4ELME 3KYKL 3MA7A 3EOBA 2QJDA 3BRDA 5EU6B 3UJTL 3SE3C 2M2DA 2BVQB 2HVJB 2VL5B 3BKYH 4R96A 1S7RB 2ATPB 4IRSC 2AABH 2OTPA 1ZLVK 3HMXL 4PGEA 1RZ7H 1HH9A 5KANI 1EHLL 4P46B 1E4XH 1U93A 2AI0L 4FS0A 2QR0A 3ARSA 5GS1C 2YPVH 2K7QA 4EUPG 5IGXH 3HNTH 4PD4J 3O6KH 3FTGA 1T80A 3WD5H 4XZUB 2F53A 2OSLA 4NO3A 4DKFH 4XNQA 2XYCA 2NX5B 4XRCB 1JGLL 5DFTA 2G75A 1K3IA 1N5AB 3U7YL 1Q9OA 4UOW1 1H0DB 4LEXL 2DOCA 1YMME 3WFCL 4XXDA 2AJUL 5F1OB 5JDSA 3OTTA 1Z0NA 3EOAB 4OCRL 4LCYA 2H2PC 3P0YH 1JV5A 1NGQL 3DX9A 3IKKA 4P9MH 3EKCA 3GIVA 1DVFC 2XN9E 4P2RB 3QG7L 5D2NB 1OAZL 3HG1E 1C5DB 3QNXA 1KGCE 2B0SL 3FQWB 1R0AH 4QHUB 3RRQA 2AK4D 2HYMA 2KZ1B 5DVOA 1W0VB 3U0TB 3P4OB 3DO7B 4LNRB 3QFDB 1YN7A 4P23C 2ICWA 5GRXG 4OZHE 4J3TA 5D1QC 4W4OA 1MAKA 4MXQC 3CZFA 3DHJA 3W39A 1KOAA 1L7IL 1VGKA 4KK8D 1TVDA 3CSPA 4YFLF 1JHLL 3PWJA 3ALWA 3U0PB 3FRPA 5C07A 3QHFL 5EOCJ 3D48R 3NABH 1CGYA 4EVNA 4PS4L 4HIXH 4TSCH 4ZTPH 1CD1B 2HJKB 4WGWB 4YAQB 3PDOA 1FQ9C 2YEZB 3MRGB 4U1SA 1JPTH 4PJ8A 2YSSB 2BXZA 2NY0D 2ADFH 2D0GA 2H45A 32C2B 3DVGA 3FFCE 1NCDL 5HGDB 4CADB 3GKZA 4F7CB 4O5LL 4HULB 4ZXBC 4JFYA 5DVNA 5CJXA 1KXTB 2VLLB 3NAAH 5E1AB 2G2RB 3TN0C 5JHLL 3FQTB 4FHBD 2G60L 4JHAL 2H6PA 3O9WC 2J6EL 3HR5A 2J8OA 5HHMD 2JLLA 4N8VB 3X14B 5CMAB 2E9JA 4TPRL 4U1JB 4ZFFA 1KJVA 4AENB 3V8OA 4JREC 1RUMH 3VG0H 3C8KB 4YR6A 5E08L 5HGHB 5E8EB 5ESQA 4HS3B 5EOCH 3BXNB 4ZUUA 4FMKA 4M93C 4MNQA 1SYSB 1KB5L 2A73A 3MRKA 4JZOA 4Y2DD 5KSBF 5BXFB 4MB4A 3QUZD 1XF5B 1B0RA 1YEGH 2EIEA 3LS4H 3SDAA 5K9OB 3D9AH 4GKZA 1MH5B 1YMHA 1FH5H 4Y5XA 1U8HA 3PUCA 5BQ7A 2YD7A 1I1YA 2Y07H 2I27N 3EFFA 2DMCA 1EEQA 3HS0B 1MEXL 1Z9OA 4HS8H 4UZGA 3DMMA 3S34H 2X9YA 4G6AC 4MD4A 1HI6B 3QEQA 1RZGA 3RI5K 1YN6B 4DUXA 1U8NB 3BUTA 1VFMA 1OARH 3ARDB 1T7VA 2HT2D 3WLBA 3I9GL 4XCNA 5I30H 5M94B 4M62L 4LAQH 5DRNB 2A77L 2VZSA 4LLDA 2B7DT 3QZWA 5CBAB 1E4WL 1JTPA 1YEHH 5JXEA 4YZFF 3S36H 3NZ8B 5EUKB 1F4XL 3S35H 3N50A 5FXCH 2MPAH 5I1DB 3MRMA 3ULUD 1DBAL 3SGDI 1N5YH 1NBZB 4XHJD 3SOBH 1HHGB 2XPGB 3EYSL 4UIKH 4WW2A 1MLBB 2IBZY 4LIQL 2I5YL 3MFFA 5I1GL 4D9QD 3BQUD 3MJ8A 4OTXL 4OLVL 4P9HC 3LZFH 4JPKL 4YXLH 5AAWA 5LXGH 4ENED 4WFFD 5E8PB 3BO8A 3O4OB 1HEZA 4WHCA 3ARGA 4ELKA 4YFDB 4R26H 4UB0L 3CFCH 2Q76A 1WBYB 4CMHB 2P44B 3MBED 4QGTA 2QSCH 4KI5E 4F15C 1JWUA 5IVXB 1ZS8B 1INQB 3C2AH 2NY5H 4X9GA 2ADJB 5I1LB 5D1XB 2FRGP 1MWAH 4HWBA 2V9RA 3C87A 1RIUL 1OSZA 2J7LA 3LRGA 4FRWA 4GG8B 1S7XB 5C7XH 5B39B 1JHTB 4KHTL 5D70H 5A3ID 2C3VA 2R9HD 2UWEF 3FO9B 4WGVB 3TBVB 1JI2A 4MHHI 5FAAA 1QRKA 5F9WB 3O4LA 2H2SC 2PXYB 1I9JL 5CJBA 3QJHA 3JV0A 1ZV5A 5KS9A 2EIZA 3RGVB 1ZWIA 1F3RB 5HDBF 2IANE 5I18L 5FA3A 2NNAA 3QEHA 4IMKC 3LPGA 1JPFA 4LPWA 3S4SA 3VDAA 5EBLA 3IFOA 2FBOJ 2W59A 4IHOB 1T5WB 4ONHA 1G9NC 5FIEA 5F6HJ 3LKQB 1LEKA 4PJCE 2ID5A 3BWAA 3QWQB 2QQLH 3GSNH 4G8GB 4KKAD 2YPKB 4PY7B 3I2CH 4FQPA 3QR2A 1B0GA 4ODWA 3OKOB 4NQCA 1BWWA 2YD1A 1VKXB 1JK8B 1T20A 1J18A 5DJXB 4IS6B 1L9NA 4HZAA 4OT1L 1AR2A 2P5WB 4F33B 4RFOH 3AREB 3CDFA 4D9LL 5JW4R 3HAEH 3Q1SL 2W0FA 4EUPA 1N8ZB 1A7QL 1EV2E 3U6RB 1MY5A 1KEGL 4JJ5B 5BJTB 2C3HA 1IEBA 4N0FA 2OJZH 5IQ9B 1BAFH 3EHBC 2FO4A 1EMTH 3O11A 5GHWH 3UJIH 5TFSL 5F3BA 1OT2A 5EC1A 1ZHNB 3U1SL 2PR4H 4YK4B 1UXWB 5JTWA 5GS0H 2P8MB 4OD3L 3PDDA 3KNBB 1AIFA 3CK0H 4Q2ZA 3TNNA 5DJCB 3WJJA 2D0HA 2VQ1B 4X9BA 3SE9L 4LU5H 4QRSA 4XAWH 4QRRE 2YXMA 5HY9A 4WWKC 1FL6B 2FSEB 2NXYC 1CFNB 1FO0A 4IMLB 1UM4H 3WO4C 4TULH 4ZUVB 3KPMA 4GRMA 4ZFZB 1S8DB 3ZKXC 2J2ZA 4LFHD 5GZOC 4QYOB 3RZCA 3L5WB 4QXTA 5JOFA 3GGWA 2WM0A 5IB2A 3LH2L 4W6YB 3MRPB 1E27A 2X4TA 3OR7B 1GIGH 4P4KB 1JTTA 4BQ6A 1VA9A 5FGRA 3QH3A 2VLRA 2UYLA 1U42A 4NRZA 4ZUSA 5B8CC 1JF5A 5IBUB 2VH5L 3SDXA 4LHUA 2BRRL 5DMKB 2H32B 2W60A 4HUNB 1B2WH 4PRIB 8CGTA 1TJGH 4DGIH 2YBRA 4Z7NF 1JN6B 1I8KA 5ISZA 2KUTA 4PRHB 4K7PY 1UJTA 2JKXA 2EDKA 4HKBA 1HHKA 5ESVA 1CFQB 1X3DA 3UAJD 4IIQA 1U8PA 3RVTC 4MA8H 4R8WL 1LDSA 2R1YA 4HXAH 5AYUL 5EBGA 5IMMA 5TQ0L 2YR3A 1NAMH 2NZ9D 3QDJA 3JWDC 4G6ML 4CVUA 2VABB 1TQBC 2DIJA 1NUDA 1CFBA 3QXVA 1ZTXH 3RUGE 3G5ZA 1FFOB 2IWGA 3FQUB 5IP4A 1JPSL 4KTDH 3HZMA 4NKMA 2AK4E 2XWJB 4U3XA 1NEZG 4L4TB 3PHOB 2A9MH 1H3GA 2W0LA 3DECA 4QHMB 2B4CH 5FYJU 4Y4KD 1I1FB 2G9HA 4PREB 4Z76B 2E9IA 5F71A 4Y88A 2V7NB 4PB0H 2A1WL 3HC0A 5C0ND 5E0QA 1SEBB 5E8OA 1IM3B 5K9KB 4OLEA 3SY0A 3G6JB 4NWTL 4PJFF 3AB0B 3B83A 1WCQA 4AIZB 3LV3A 1IQWL 2DQIL 2WINA 4HUUB 4Z0BL 3U7WH 1YEKH 4RGNC 5DS8A 3AFLA 2VDNH 3DUUB 3ZE0F 5IESL 5ACMA 4G42A 4JANB 3VXMB 1V3MA 5DC4B 5MI0C 1CXEA 1X7QB 4LKCA 5HHME 3WYRA 2E7MA 1L9MA 1SBSL 2X4QA 3SCMA 2VZTA 5IOPA 4RWYL 5EDXA 5L0QB 1MRFL 5C6TH 5IHUH 3RWJA 3GIZH 3RWEA 3WHXA 2R2BB 1LE9B 2EH7L 4WO4C 3MRDB 4XI5D 3KYMB 2OI9B 2OTWA 1VFAB 4I2XB 2PO6C 4HUKB 4P5KA 1VADA 1S7QB 1W0WA 3DTXA 3QEUA 4H1LA 4PV9A 5HI5D 4FXKA 4G9DA 5C6PB 2ZUTA 3RNQB 1PG7X 4F3FA 4YXKH 3QUYB 1HNGA 5KZCB 4UAOC 3OKYA 2IQAA 2NX5D 5HGAB 5HHOB 1KELH 4I0CC 3FQXB 1X4XA 4Z7UA 1MFNA 1FO0L 1FLRL 4JGUA 4UTAL 1BPVA 2WBJD 2DBJA 1GGUA 5EUOF 5F89B 3UTTA 4P2OB 2WUCL 2DQGH 2VISA 5D1ZB 4QXGL 5GSRB 3VWJC 2P49B 3VRJB 3QIUC 2CLRB 5ESAA 3CX2A 5GGTL 3IDGB 1ADQL 1JWSB 3ULUE 3GBLA 2AQ3A 5FO7B 4NHCH 1LEIA 3QUMB 4AQOA 3PWPA 4LBEA 4NQSA 4HF5L 3MCKB 4D9QE 3MREB 3O2VH 3O6LH 2ZOLB 1EAPB 1T1ZB 3PV7A 5FGBC 4R6UA 4WFFE 3ARFC 1AXSA 5IWLC 4F2MA 1PSKH 1T1WB 3KPOA 5SV3A 1MFAL 4RMRA 1CXHA 1ZHLB 4I77L 5IFJB 2NXZC 1DBBH 4MJ6B 2UUDK 2DTSA 4GAFB 3VE0A 3EZ8A 5KSVB 5HHVH 4NO5B 1L7TL 4DW2H 5C0FB 4PJXA 3ET9F 1OAXH 4NFBA 2YK1L 1J12A 1MVUA 5DK0B 3TYGH 1WAAF 2H8PB 2R1XB 5BZDB 4LGSB 4TTGA 2B20A 2AW2A 4X6EB 4AIOA 1BQSA 3I84A 1ZA6A 3RWHB 1UB6A 2BVUA 3BGFB 4C83A 2JF1A 4ODXA 3GM0A 5JW5A 4DQOH 4K9EC 2ZG2A 1CL7H 2APTA 3HPLB 3MRCA 4NN6C 3NCMA 5CJ5A 4FN0A 5DC0A 5BV7B 4X6DB 1FGNH 5SX4I 1G9MC 2BSRA 4IDLA 2P42B 3W11D 3ABZA 2E6QA 4WFGD 3C60C 5E4EC 3GDBA 3UTZA 1BQHB 3A67H 3BH8B 2C4XA 3MLWH 1EO7A 3D0LB 3OHXB 2CQVA 1J0KA 1T4KA 1P7QD 3CLEL 4ZSOA 4AEFA 2PW2B 3JTSB 4PRAA 5GS1A 2P8PA 5I1KL 3JUYA 1CICC 1QSEB 1FCCA 5E8DH 3LKOB 2ZG3A 5IB5A 4K3DL 4NCC2 1QPXA 5JMRA 5SV4A 2PF6A 3TBTA 1ZHKA 1KIQA 5BZWA 4MD0A 3CVHL 1P6AB 1E6OH 4HX1A 3MZTA 1V7NH 2LTQB 1GXEA 2VXSL 3BMWA 4HUWA 5EB9A 5FOBB 1OP3K 1RJLB 4K94C 4F7MA 1K6QH 2GT9B 3ARDD