4F80A

Crystal structure of the human btn3a1 ectodomain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
213
structure length
209
Chain Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGGVSCTIRSSLLGLEKTASISIADPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Butyrophilin subfamily 3 member A1
publication title The molecular basis for modulation of human V(gamma)9V(delta)2 T cell responses by CD277/Butyrophilin-3 (BTN3A)-specific antibodies
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 209
sequence length 213
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f80A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f80A02
1D9KD 3GK8L 3O45B 1FV1A 4FXLA 1UACH 2XA8L 3CGTA 3LKQB 4PJAA 5BW7C 5T1MA 1FYHB 4KGJA 2CR3A 3O2DL 5I1AA 5ILTL 3UJIL 3DYMA 3RIFF 5KSBB 5FYLH 5IB1B 2Q3AA 2JB5H 3IXAA 3QUYA 4OLEA 2VZ3A 2O93L 4YHML 4R2GD 4L8DA 2VDNH 4JO4L 1BJ8A 3RY4A 2I9LA 2EIZA 1T7YA 2NW2A 1BZ7A 3G5VB 4HLZG 3QFDB 4XP6H 4XTRC 3TO2A 4KK6D 43CAB 5I1DB 5IMKB 4HMEA 3CVHL 2J5LC 3C8DA 3RGVB 3UAJC 3VFNB 2NW3B 2NY3C 5D6DC 3SE8L 2XTJC 1CR9L 3KPMA 4XBGB 3ZDYE 5E2VH 5IVXE 4BZ1L 3QNXA 1F90H 1FO0H 5F96L 1MCNA 1S8DB 3WUZA 1SJHA 5FKAA 3P0VH 5DUPH 5K9KA 4PRDA 1AD0B 4ELKB 4KKAC 3QEHB 2RJMA 3KWWA 4NRYA 2WQRA 5EBLB 1T03H 3EBAA 1VACA 2VSDA 3NTCL 3MRBB 3OKKB 1PZ5B 1ZVSA 4KTDH 5LBSH 2Y1VA 5HDLA 2EH7H 4KJYB 2FSEA 3GGWA 1DP0A 1FV1B 4WUUE 5KVDL 3FONA 4KI5E 2AJSH 5BVJA 2QTEA 3I75A 1FFOA 2P8PA 5TE4L 1KTDA 4PJAB 4JFOA 5T1MB 1UG9A 3RI5K 1IC7L 4OZIA 3LEVH 4WNQA 3L5XL 5I1AB 1VEPA 4GBXA 4D9QE 1MCHA 1UH3A 5JHDA 3LDBC 1N59B 1UQSA 5CEXB 3IXAB 2BY0A 3QUYB 3S34H 2HA1A 3QO0B 4L8DB 2CIIA 4Q7DA 3TNNA 2E3VA 1WIOA 2EIZB 2YUZA 1W0VA 2NW2B 4BH8A 4PTUA 3K8KA 3TO2B 5L7XL 3F7VA 2D03L 2NZIA 3LHPH 3T0ED 4PJCE 3GO1L 1G7LA 4L3EA 4HMDA 2DQTL 5K59E 2L7UA 1XCQA 3MBEA 3D3VA 1QOKA 3HUJA 5FIEA 1BF8A 3KPMB 2Z9TA 3AMKA 3UDWC 5C0EA 3QNXB 3RVTC 1CDHA 2FX9H 2VB5A 1N6QH 4ZPTA 4UT9L 1R5WA 4BUGA 5FKAB 1FL6A 5K9KB 4PRDB 1KELH 5D5MF 5KJRH 1DBBL 4OI7A 5EU6A 3KWWB 4NRYB 4H25A 3PWVA 1VACB 3V2AR 1G84A 2WBJA 5DDHA 3V4PL 3B6SA 4HUXA 2X9YA 2FSEB 4OTXH 1CDJA 4OGXL 4Y1AA 1CQKA 4F8TA 5D93B 3FONB 1UYWH 3Q2CA 3R1GH 5BVJB 3I75B 1FFOB 2P8PB 1KTDB 5EO1A 4NO3A 2NY4B 1U0QA 3FO1A 4JZJA 4YPJA 1MRDH 1TZGH 4OZIB 4S1RL 4CVXA 5ADPL 2P8LA 2PNDA 1T7WA 4KPHH 4WNQB 2ZUTA 4YE4L 1HYSC 3MJ6A 4GBXB 1RMFH 4FG6C 2R0LH 4W4NA 5JHDB 2ERJB 3Q6FA 1IAII 1CIDA 3GJFB 2X1WL 1UQSB 4HWBA 1YYLL 2W0PA 4PG2C 4TPRL 4HJGA 3U82B 2CIIB 3ZYJA 3TNNB 3MBXH 1W0VB 4BH8B 3M1BA 2DBLH 3VGAC 5AD0A 3F7VB 4NN6C 1C8PA 3D69A 4OGAC 4JPWH 1G7LB 4L3EB 3ZHKA 3X17A 5JO5A 1XCQB 3MBEB 4HIXH 3V4UH 3HHRB 3D3VB 3HUJB 5A3IC 4LVHB 2XQBL 5C0EB 1I9RH 3RKPA 4WEMB 4ZO8A 5DGRA 1OM3H 4HG4K 4XVJH 2C3HA 4U2YA 1QKZL 4ZPTB 4XCFH 1R5WB 3QIUB 1JMZA 1FL6B 4FABH 4TTGA 4WHTA 2JE8A 1BVLB 1FDLH 1Z5LA 1HOCA 2WWKO 5EU6B 1OTUD 3V52H 4H25B 3PWVB 2J8UE 2WBJB 3FT3A 3KPRD 5DDHB 3B6SB 1NH6A 4HUXB 5I19L 5CUSL 4H26A 1DQLH 4GRLD 4OV5A 4Y1AB 4YWGL 2R2EA 1XGUA 1G9NL 5DF0A 1W2KT 2Y06L 5D2NA 5EO1B 4DGVH 4NO3B 3MV11 3FO1B 4JZJB 2YBRA 1I1CA 4CUCA 4CVXB 1L9NA 1A6AA 2P8LB 5IFAL 3FRUA 4M7LT 4LHQB 4P2OC 5E4EB 1A1OA 5E95B 3Q6FB 1FIGH 3VWJD 1KJVA 4XWGL 2K7PA 1RV6X 1OGAE 4HJGB 1ADQA 4HGKC 3MJGX 3M1BB 1V7NL 5AD0B 3QO1A 3D69B 4PJ9C 1F3JA 5JO5B 1BIIB 4GRMB 4A2LA 3RA7H 2BX5A 4EQ2A 1GGCL 5E5MA 3STZA 5J4MA 1BJMA 2IPUK 2VN4A 4DGYL 5GS2D 3ALXA 3E0GA 4P3CH 4ZAKC 1U2HA 1AGDA 4WHTB 5IB4A 2DLFL 1Z5LB 1HOCB 4IMKC 3VXUA 1MY5A 1WT5A 3L7EA 4N0CD 3FT3B 4NOBA 5CSZA 1U3HD 4NM4H 1Q38A 3CSYA 4H26B 4JQVA 4ZFOA 2YSSA 4OV5B 5LXGL 4MA1C 3OG6B 2R2EB 3GSNA 4QRPA 1XGUB 1NCAL 5D7KE 4XCCH 1MSPA 2ICES 2O5XH 5D2NB 4BSJA 2WP3O 2VZUA 2JTDA 4P2RD 5EU3A 2HYMA 5HHME 3U30C 1A6AB 5FHAH 5C92A 2V9QA 4JFDD 5J7CC 1A9BA 3FRUB 3ZDYF 5IVXF 1XCTA 2X4UA 4YHZH 1TJHH 4K8RL 4OLXH 1D9KA 1RJLA 3RKDC 1N0XL 1EHXA 1A1OB 4YHKL 1DBAH 1MRFH 1GHFL 1KJVB 3HPLB 3LQAC 5I1IL 4E41D 1OB1A 4FA8A 1FC1A 3NCCB 1J1XL 4X6BA 3OAZK 2IF7A 4G8IA 4FHBD 2GJJA 3MMEA 3QO1B 1XGTA 3GHEL 5HPMA 2WLYA 4ZFGH 1IC5H 1GOHA 2OR9L 1F3JB 2XQYG 4KI5F 1DN0A 2KZWA 3NFNA 5I6XB 2CR6A 4IOFD 2AK1L 4QRRD 2BRRL 2MQCA 5E5MB 3STZB 1NGXA 2HTKD 3SKJL 3OX8A 4UB0H 3I3BA 5MI0C 5BRZD 1MHCA 2ZUYA 1AFVH 3P77B 2A1WL 2R56H 3T08A 1AGDB 5IB4B 3JSSA 5I8OH 1IFHL 3HNTL 3RHWF 2CJUH 4K8RD 3L7EB 2NY5L 4M8QA 1T66C 4H20H 5CSZB 3CSYB 4ZFOB 1OWRM 2YSSB 1OSZA 3GBLA 1GVIA 3RNQA 3GSNB 4H1LH 4QRPB 4D94A 3ISWA 5F7YC 1NFKA 3GMQA 2HFGL 3T0DA 4PJCF 1FLTX 4NGHH 5LGHH 3WLBA 5K59F 5EU3B 2IMMA 1A9BB 5IHUL 1XCTB 3KHOA 3JWDL 3TT3L 2X4UB 4G5ZH 2VERN 2X9WA 1D9KB 1RJLB 3D18A 4JFED 3NMEA 2EIEA 4RQQA 1GOGA 3PL6D 1S7XA 4AIZA 1RJCA 3PXJA 1OB1B 2PTTB 4X6BB 4LCCC 4JREC 4G80A 4G8IB 5IR1A 3MMEB 1XGTB 4PLOB 3CAFA 5HPMB 5EOCJ 3ROOA 3B2VL 4Z6AT 4LDEB 5ITFA 4EDWH 1DN0B 4AM0A 1NSNH 3NFNB 3GSXA 3PHQA 4P4RA 3FFCD 1VCAA 4LAJH 2EDFA 4RWHA 4M9PA 1NGXB 4R2GB 4UU9A 4OCYH 3K74B 3WFEL 3ORJA 3OX8B 4KUZH 1NMAH 2CK0L 1MHCB 5E6YA 3IAPA 4RMRA 3KLHC 3T0EA 1H8NA 3NPZB 5C7XH 4W4OC 4Q0XL 3BEWA 2NY2C 3WJJA 1U8MA 4M8QB 3K3QA 4NZJA 1OTSD 1OSZB 3ILPA 3RNQB 3QCUL 2QADD 2VN7A 3RY6A 3GMQB 2OI9C 1QBLH 3ESUF 5T33L 3DV6A 1F58H 1OAUL 5L2JA 5B8CC 3WLBB 1WWAX 5GGVH 1H0DA 2XZAH 3Q5OA 5ADOH 2YC1A 1UCBL 4DKFH 1EFXD 1KV3A 3K2MC 4MXQD 4XC3H 1RURL 1NMBH 3D18B 1IBGL 4ZUTB 5JQ6L 3MOQA 5CD3A 1Q1JH 4FXGA 4N1CA 1QP1A 4RQQB 4M3JA 4ZODA 3VG9C 4AIZB 3KPSE 5IMMB 5FGBA 5L6YH 5C3TA 4G80B 2J8UF 4ZOBA 2J1KA 4Y88A 5IR1B 1X5KA 4B5EA 3S4SG 1F45A 3ROOB 4Y5XC 2EEBA 5EIIA 5ITFB 4S10A 4JDTH 4AM0B 1FNHA 5I1JL 3GSXB 1B4JH 5GGRA 3PHQB 4P4RB 1E4WL 3WNLA 3OKOB 4TQEH 1RUAH 3MZGB 3QPXH 1UEMA 4UU9B 5EA0H 2NCMA 2XA3A 3REVA 2BDNL 1UFUA 2CXKA 1Q0XL 4LCWD 3S88H 3ZE0E 3T0EB 2DIJA 1T5WA 2X05A 1IEHA 4HPYL 3CFKA 3HS0A 1C1EL 1P2CA 2IGFL 4K3DL 4L4VD 1T21A 1U8MB 1UM5H 3HZKA 3GJEA 3V95A 4OFIA 2CRMA 1J8HE 3T0AA 4YK4C 3ILPB 5MP6L 4PUBH 5DZLA 1YY8A 4ETQA 4FQ2H 1HDMA 35C8L 4PG9A 3TJHD 3DV6B 5L2JB 2XZCL 2VXUL 3GSWA 4AEHL 4HKJA 5J1SC 1IC1A 5LQBH 1H0DB 2XPGA 4JO2H 2YC1B 2EDKA 1ZVYA 4KKBC 3BN9D 3KPRA 4OLUH 5ALCH 1G7PA 3UX9B 5SX5K 1DQJA 1JGVL 4PY8J 1UKQA 4GRLA 4RAHA 4IJ3C 4Y5YC 3BIAX 4LLAA 3J7HA 5CD3B 4FXGB 5HYJD 1MNUL 4NC2B 2C3GA 3UBXI 3V6ZA 5A1AA 5D8JH 1L7IL 5IBUB 4B53A 2N7AA 4X9GA 1KJ2A 4RFEA 1B2WH 2H1PL 1A7BA 1S7QA 2AXHA 5EIIB 4MDIA 2AABL 4JGUA 3NCYP 1QLEH 3O9WD 2M8XA 5GGRB 1T7VA 1BFTA 1RVFL 3OKNA 2AEPH 4JFFE 3VWJA 3TT1L 2DF3A 3VXMD 1A6PA 3REVB 5TE6H 2JIXD 2YD4A 1WC7A 3U46A 4HW6A 4PB9H 1GZQA 2GSIA 1T5WB 1NL0H 4PLKC 3U4AA 3CFKB 3HS0B 1T2XA 1P2CB 1T21B 3G5YA 3UTTD 3GJEB 4OF6A 5EIQA 4YEFA 3KLDA 3JWNC 5D9SA 4HCRA 3VW3L 5AWNL 3GI9H 4UIMA 2BFVH 1YY8B 4ETQB 1HDMB 4XTRD 1RZJH 4PG9B 1DL7L 3NZHL 3IDXH 3S37L 4WFGE 3GSWB 4N0YH 4HKJB 3B5HA 1TQCC 5GRJH 3SBWA 3IF1A 2XPGB 3UAJD 1BX2A 2DD8L 2NY3D 3L9RA 3KPRB 3ARUA 1EDQA 1U3HA 4KTEL 4J3VA 1G7PB 4WHDA 5GS1C 1LMKA 2VKXA 5EULV 1DQJB 4UNUA 4GRLB 4L4TA 1GGTA 2DQJH 1XGQA 5CJXC 4UNVA 5GS3A 1KB5H 1Z0NA 5IJKC 1VEOA 3V7AG 3SE3A 3U7WH 4K71B 1H3PH 3V6BR 3V6ZB 1TFHA 5AG9A 3ZYOA 1IGCL 5D70H 3KJ4C 5D2LE 4P2RA 4PBWD 3FZUC 4RFEB 3MJ9H 2DICA 1IGFH 5KVFL 4JFDA 4NWTL 4XWOC 25C8L 3IDMA 4GXVH 4HPOL 2PO6D 1HNGA 1S7QB 4X7DC 4MDIB 2C7UA 4X4YA 5DR5H 3OKNB 3VWJB 3SPVA 2UYLB 1YEGL 1A4KA 4GAGH 4E41A 3QWOA 2KDGA 2ZOKA 4QO1A 4R9HA 4UZGA 3IDNA 2CDGA 5IVNA 3WUWG 4YDVA 1GZQB 4BZ2L 5CGMA 2GSIB 4O02L 1S9KC 3BKCH 3MYZA 2H32H 4HF5H 4ZO6A 3G5YB 5GRXG 3D85D 4QRRA 5D9SB 4UIMB 3HG1E 1CVSC 1AP2A 1IEAA 1PG7H 3BPCA 1QBML 1N3NA 5BRZA 2FECL 3GMNA 5DZNA 4M61A 1BMGA 1H5BC 5F3HA 3MZTA 5CGYC 4LQ1A 3WFZA 4Y16D 1BX2B 1QFWI 2M2DA 2ZWLT 3UC0H 3L9RB 2UVEA 2CO6B 1U3HB 1QSED 4P9HH 2ESVD 5JW3H 4OCSH 3MRFA 4UV7H 4MS8C 4AEIH 1MCOL 1UJ3C 3QDHA 4RZCA 1XGQB 1YY9D 3T65A 3JTTA 5KSBE 3QZWG 1XGRA 4P2RB 4Y4FC 1NGPH 5MEQA 1DZBA 4JFDB 7FABH 3IDMB 2OYPA 2A9MH 5I71B 1XEDA 1T20A 1S7VA 4JFEA 2C7UB 2X4SA 4X4YB 4AJ0A 4QXWA 1HQ4A 2VABA 3PL6A 3SPVB 4U3XA 4QHMA 4X9IA 2F8XC 1A4KB 3QWOB 4QT5A 2ZOKB 3BZ4A 4G6FB 1Z0MA 3IDNB 5D7SL 3VH8A 3CD4A 3W0WA 4YDVB 1PY4A 1MQ8A 4M5ZL 2LTQC 5E2UH 3T0WA 3CIQA 1OAYL 1F4WH 1JHKH 4R4NC 3P30L 3QIWC 2FEDD 2BNQD 3FFCA 4KK5C 4QRRB 4I18A 1A5FH 3X3FH 3PWJA 5DVMA 1AP2B 3DHMA 1IEAB 1G1YA 4QHLA 5CEYA 3BPCB 1N3NB 2GJZA 4XHQA 5BRZB 3HMWH 1CDBA 4MJ6A 3CH1A 3GMNB 4M61B 4I2XA 4OGAD 3LSOA 5L0QB 5F3HB 4HFWA 5HPOA 4M9OA 4AZ8A 1ZGLP 1HSBA 1JZ7A 4YHIA 4PJXA 1YNLH 1MIML 3DX6A 4ZO7A 5C0CD 4PJ7A 4BSVB 1WAAA 4RZCB 1CQYA 5E5UB 5BO1H 5DO2D 5IK3A 3T65B 5MEND 2VDPH 5GRUH 3JTTB 4Z95L 3ZE0F 1JI2A 2Z0BA 1XGRB 3I84A 3R4DA 5MEQB 4PJEE 1EFXA 1CBVL 2VXVL 1A7NH 1IAIH 5C0FA 3S5LG 3LAFA 3Q1SL 1T20B 1S7VB 4LHUG 4JFEB 3TIDA 2X4SB 4MAYC 3NH7H 4RFNB 4HS6A 2VABB 3S9DB 3N1FC 1EMTL 3PL6B 5JIHA 4QHMB 5F6IB 2K9UA 4QT5B 4U1GB 3BZ4B 2DIBA 5HHXL 4DTGH 2DQFA 3VH8B 6FABH 3SQOH 3SDXA 3GM8A 4F2MA 2YPVH 2Y6SC 4JM2C 2E27L 4NQCD 2RAMA 1FGNH 1OD7A 5EWIL 5TJWK 4JPKH 3SGEI 3FFCB 4I18B 4MA8L 4KK8C 4PYHA 4LGRB 3K1DA 1LHZA 3PWJB 4JRWA 3WHXA 4QHLB 1ZGLM 1ZEAL 5CEYB 5CILL 2GJZB 1AQKH 2PETA 4HK3J 4MJ6B 3CH1B 4HC1L 4LCWA 4NKOA 1IL1A 4I2XB 3LSOB 4HFWB 3EO9H 2DQEL 2ITCA 1X5XA 5T5FH 5I1CH 5HGDA 5T3ZH 5J57B 3SGDI 1OGTA 5L88H 1HSBB 4L4VA 3WDHA 2IH3A 3QISA 3WSQH 4YHIB 4PJXB 1FNSH 5JOFB 3DX6B 5MHSD 5CBAA 3TH4T 3UMTA 2WMPA 4H0HB 4PJ7B 4PTTA 5IK3B 2QADB 1C16A 4N0RA 4ZAKD 2XTLA 4WU5A 1UWEH 3QUML 3GJFK 1MCIA 4POZD 2UWEA 4DWHA 4FQQA 1VB9A 2RCSH 1EFXB 3RDTC 5C0FB 4K55A 4XH2A 4QKXB 4FP8H 3I6LE 3TIDB 2WUCL 1QPXA 4ZS6C 4HS6B 1QYGH 4L3EE 5HYJA 4XRCA 2Q1EA 3KG5A 3HUJE 3C08L 2UY7A 2DQFB 3ES6A 3SDXB 3ZT7A 4F2MB 1IAOA 5EUOA 5EOCH 1I8LC 3RKDD 3QQNA 4FZ8L 3KYKL 3SKUD 3O9WA 1SMOA 1X5FA 1MAJA 5EU6E 4JHAL 4M7ZB 5T1LD 5BW7A 5EZIL 5D2LF 3WHXB 5JXAL 3VXMA 2ENYA 2X4RA 4XC1H 2JIXA 5F7HA 3FB5A 4LCWB 4NKOB 2HAZA 4ZPVA 3S97C 4KKLD 5INCA 1NBZA 2ITCB 5AUMB 1PBYA 5KAQF 5HGDB 1GIGL 1MJUH 1OGTB 5J12B 4L4VB 2I26N 2IH3B 3UTTA 2HJFA 1FH5H 2A9NL 4EBQH 2W38A 5CBAB 1C5CH 5E7BA 3FL7A 1DANU 1CTOA 2P5EE 1C16B 1JZ6A 2X4TA 5IROC 3WO4B 4PV9A 2MKWA 3P11L 4OQTH 2UWEB 4LNRA 3BKJH 2BZDA 4WI8A 1YC7A 4U05A 1ONQA 5D6DA 4FQQB 3S3SA 4R26L 2QQKL 4UIKH 1WEJH 4NQDE 4XH2B 2Y7QA 4FMKA 3U0WL 4XPAL 1N6UA 1V7MH 3GIZH 4XRCB 2YA2A 4EUPG 5HYJB 3BP7A 2Q8BH 4U7SA 3QCTH 2D7NA 2CGRL 4QRTA 3CFJA 2CKBA 3ES6B 1M4KA 2Z92A 4UDUA 1IAOB 4PJFA 4OCNC 5EUOB 5IUSA 2PO6A 5T3XE 1EO7A 1G9MC 2W07A 3O9WB 2VXTH 3L3HA 4GAFB 5IMLA 3PGFH 4XCYA 4KUCF 4RISH 1JGLL 3FHAA 3QNZB 3GZKA 3VXMB 3WNNA 2X4RB 2E9IA 2JIXB 2XFXB 4DN4L 3FT2A 3DUUA 3MOAH 4ZPVB 3NAAL 5DMKA 5INCB 5CEZH 1NBZB 4LQFL 5DJ8A 1YQVL 4W6WB 4GSDL 5LWYH 3VGEA 1FPTH 4F15B 3UTTB 3G5XA 2HJFB 3D85A 3LRSB 4DKEL 1A3RH 1SHMA 1EK3A 5EO9A 1BVKA 2E5EA 3KLHD 2FBJH 3C5ZC 2X4TB 2H2PC 1NFDB 4PV9B 5IIEA 4MXVE 4TSBH 4LNRB 4Y16A 1ONQB 4P9MH 2EYTA 4MD5B 2NY3B 1EZVX 4EIZC 4HK3N 1I1YA 1QSEA 3UJJH 4DCQB 2ESVA 3AB0B 2Y7QB 3P9MA 1KUMA 2ZUXA 3O2WL 2RIKA 3UTOA 3OB0K 4BFIA 4ODXA 4QRTB 3BGAA 3X3GH 2EEDA 5EOQH 3CFJB 3BWAA 3VFUA 2CKBB 2Z92B 3MLXH 1AI1L 3ZDXE 1J1OH 4PJFB 1OAZL 4J7RA 1AE6L 2PO6B 3ZYIA 3TJEL 4TUJA 2AK4D 1CGVA 3L3HB 4W6YB 4Y5VC 5IMLB 4XCYB 3VXUE 3C9NA 3CMOH 3RX8A 5JMOC 5JW5A 5DFWH 1PY9A 2R1WA 3FT2B 4PJEF 3DUUB 2EDEA 5DMKB 4QRPE 5DJ8B 5AZ2H 2FH8A 4X6DE 2VDKH 4D2NA 1ODAA 4MD0A 4F33A 4XPHL 2BNQA 3G5XB 3T2QA 3D85B 4PG2A 1I7TA 2BSED 1KTLA 4FZEL 4WI5A 2AJUH 5EO9B 1BVKB 4F8QA 2XN9D 2YD2A 1F8TH 5H8DA 3U36B 5IIEB 4N0UA 4Y16B 4MJ2A 3BUTA 2EYTB 3SGKA 1I1YB 4HV8A 1NAMA 1QSEB 4DOHE 4XP4H 2ESVB 3P9MB 5C0CA 5F7NC 5DD5L 5CJOH 3U4BH 1RFDL 4JAMA 3C09C 5MENA 5F3BA 2E7BA 2FLRT 2R39A 3SDCC 4F58L 2DQHH 2ITDA 4BFIB 1GCFA 4ODXB 3KDMA 4K9EH 3LEYL 3BWAB 3VFUB 3DXAD 3ARZA 1CDGA 1UXSA 2COQA 1V3LA 3ULVD 5HJ3B 4P46C 1UM4H 1F13A 2LFGA 4TUJB 5DT1H 3SOBH 1NGYA 1Q9OA 5J9PA 4BSWA 3C9NB 5JW5B 4OFPA 1IAIM 1U6AH 3UJTH 1YEJL 1ND0A 4G9FD 2R1WB 5FECA 4BFEA 3L3OB 5F7UA 3U7YL 3FAXA 4NQCA 1CLOH 4J8RA 3MREA 1FNFA 1SJVA 3OKMA 3VG0H 4MD0B 4F33B 2BNQB 4R7NA 3OXRA 1I7TB 1KTLB 2GIYA 4LIQH 3C5SA 1N7MH 3S35X 3VGAB 4OF3A 4NN6B 1UZ6E 4O00A 5FYKD 5EFIA 3K4ZA 4KY1H 4NJ9H 4N0UB 2D9QB 2OS7A 3O2VH 4HT1H 4ZUWA 4GJTB 4HV8B 1BAFH 1NAMB 1VERA 1YPZA 3QT2A 2DQIL 4LKCA 3H9ZA 4RNRA 4JAMB 5MENB 4ZAKA 4U6TA 3FMGL 2VXSH 1UWXH 4FS0A 1DLFH 2ITDB 4IMKA 3KDMB 2Z31C 2O61A 3ELAT 1GAFL 5INDB 4IRJC 4YUEH 1T22A 5AZEL 1EX0A 2B2XH 1WCBA 4K94C 2LU3A 2WBKA 4MJ5A 2BK8A 5E08L 3O6ML 1TTFA 1NGYB 1Q9OB 1S5IL 3K80A 5J9PB 4BSWB 1J5OH 3UPAA 1MFAL 4HC1A 2HWZL 3FQTA 3FZUD 1MCPL 4RGOL 1ND0B 3ZSSA 1MWAA 5C08E 4XWOD 5FECB 4ZUVA 1EH9A 3MLUH 5FOBA 4NQCB 4XVUC 4J8RB 4ZG1A 1JZ5A 3DROA 5IFHL 3OKMB 4LVOC 5CINH 4OKVA 1VFMA 4R7NB 1NMCC 5L8LB 1AXTL 3OXRB 5T1LA 2I27N 1RIVH 2YRLA 2W65A 3QUMA 3BP5A 3C5SB 4GAJH 4IDJH 5F9OH 4B0MM 1FSKC 4MDJA 5C71A 1TJGL 4NC1C 3GK8H 4S1SL 5IWLA 5EFIB 4Z7WF 5CWSB 15C8L 1J10A 1A6VL 1U41A 4I13B 4ZUWB 1GL4B 3KGRA 1YPZB 3O2DH 1OVZA 3O4LD 5I1EL 2OJZL 4LKCB 1K2DA 4RNRB 4ZAKB 5ILTH 1E28A 3UJIH 1I7RA 4WIQA 4GQPH 3PGCA 5CSBA 1S3KL 3R0NA 5CGYD 2O61B 1JWMA 3QEGL 1T6VN 4YHMH 1T22B 4JHZA 5DK3A 4LLVA 4MS8D 4LL9A 1WCBB 4O2EB 4MJ5B 3UP1A 3EFFA 5HGBA 2CUIA 3CVHH 1AO7E 4YEEA 1GRWA 4MXVF 3FQTB 4Z0BL 3SE8H 3JUZA 5DFTA 1MWAB 1EO5A 1RZGA 4ZUVB 1Y6KR 1ZMYA 1JRHI 5DA0B 3TBWA 5F96H 5FOBB 3PWPD 4LLYB 4HS8H 1T1YA 2WIIA 1UB5A 3DROB 4NCDA 5LG1A 1FN4A 1YJDC 4NQTA 5T1LB 5F93C 1FCCA 3DSFH 2W65B 3NTCH 3BP5B 3QUMB 4FFVC 2P1YA 1LWRA 3X14A 4X8XA 4MDJB 3RTQD 3HC4H 3PJSA 2ADFL 1KPRA 1QFWH 5KVDH 2Y36L 4G6ML 1D5XA 3QIWD 5BV7H 1T1WA 4MXWL 5TE4H 1YZZA 3UYPA 2NQCA 4K3HA 1WFUA 1IC7H 1RUPL 3HI6L 2ARJA 4XNMA 3BPNC 2B4CH 3S36X 5DVLA 1K2DB 5C3LD 5M95B 3U0PA 4CAGA 4FQLH 1E28B 4LRNH 1G7JA 1CL7L 1I7RB 1KC5L 3PGCB 4JRXD 3IFOA 1F6FB 4X6DF 2W0KA 3GKZA 4L3AA 5EG6C 5I75B 2L7JA 4LLVB 4D9LL 1JTPA 5L7XH 2D03H 3LKPA 3EFFB 5HGBB 3GO1H 2DQTH 4ZD3L 3U7AA 5B8CA 5JQHC 5B21A 2JJTC 3ARBD 4M1GL 1RZGB 4F7PA 1HEZA 3TBWB 3MRNA 2EXWD 1T1YB 1GSMA 1N8ZA 2WIIB 3IDYB 1UB5B 3QIBC 4MAYD 4NZDA 2AK4A 1MREL 4I1NB 3WCYA 1FN4B 1ES0A 5FV2A 2D7TL 3HRPA 3WIHL 4FQCL 3X14B 4WUKL 1WWBX 2J2ZA 4L4TE 4OGXH 2WNGA 4JM2D 3EZ8A 5HDOA 3DUSA 4Y5XA 2BVUA 3R0MA 1D5XB 5IVZA 4XP5L 1T1WB 2HT3C 4IM8A 1TTGA 4TNWF 4KK8D 4LPYA 2ARJB 4JR9L 4P2RE 4S1RH 4Y8DC 3DTXA 4RGND 3TFKD 5ESQA 4JFDE 1DBML 2EKSA 4NOFA 3U0PB 3QI9B 1R3LA 5DC0A 1VGKA 2XN9A 2P4AB 3IFOB 4P4KD 1VA9A 4BELD 3B2UC 1Q9LA 4OI9A 1Q72H 5ISZE 1YYLH 1OOAA 4QYOA 4TPRH 4XMPH 3WLWC 4E41E 4YDJA 2OL3H 5DVOA 4JHWL 4Y19D 3RPIA 1KCRL 3GSUA 2R23A 4OB5L 3LKPB 4Y4HC 1OP3K 2QEJA 1UZ6F 2X5PA 2C9AA 5K9QG 5B8CB 3HE7C 2ADGB 4WTZA 2GHWB 4EIGB 4QRRE 3DXAA 1FNEA 2VWEC 4C56E 2XQBH 5C07D 3RDTD 3PP3H 4F7PB 1HEZB 3MRNB 1QKZH 3SGEH 4KDWA 5BRZE 2AEQL 2AKRA 4OF5A 1BEYH 5D7LD 3HNSL 2AK4B 5KS9A 1I3RB 1BM3L 2Z4QA 5CCKL 1F02I 2HP4A 4Y2DC 4PD4J 3V0WL 4DK3A 4JG0L 1T7XA 1OT1A 4R8WL 1TCRA 4G9FA 5I19H 4JFPA 1GXEA 5CJQL 1W8NA 3SGDH 3GBML 3DUSB 4Y5XB 2PF6A 4PJ5B 1G0DA 4UILH 5IVZB 3FN9A 3Q48A 4CVWA 2D0FA 5HY9B 2VE6A 1KTRL 2WINA 2ZUQC 1G1CA 3DTXB 5IFAH 5ESQB 3ZLQC 4LPXA 2EKSB 2W0LA 1E4XI 2R15A 1U95A 4CU6A 1R3LB 1VGKB 2XN9B 2KBGA 1EFQA 5I1LA 3GB7A 3GRWL 1M7XA 3MRCA 4PJDF 1Q9LB 1G6RA 1OHQA 1IGMH 1MFCH 2NY0D 4QYOB 1UACL 1CGTA 1QSZA 1XIWC 3RPIB 3GSUB 4XPTL 2BSSA 2R23B 3HLAA 4OT1L 3W0WE 1V7NH 4J12A 2F58H 1WIUA 3LIZL 1KXQE 3IT8D 1FZOB 4GMTL 2YPLD 1P5UA 2RFXA 1JZ2A 4EXKA 4WFHD 4PRHE 3DXAB 4TVPD 1FNEB 4ZOAA 1GGCH 1D5IH 1AHWC 5GS1A 4DGYH 2AKRB 2VDNL 4URTB 5KS9B 4I2XE 3SJVD 5GGTL 2Z4QB 2YA0A 4AENA 2DLFH 5BCAA 4HKZA 1LO3L 1KN4H 4PJXE 2CRZA 1TCRB 4G9FB 4JFPB 3ULUL 4PJ7E 1WAAE 1P6AB 4JQIL 4EVNA 4X6CF 1F90L 1NCAH 1MJ8H 4XXCC 5DJ6A 3ZL4L 2VE6B 2WINB 4XGZB 5DUPL 3QBTB 3ARXA 5TPWL 1KGCD 2J6EA 1CGXA 1S7TA 3V6FA 3FQUA 1T03L 1U95B 3P4MA 2YD1A 1RUKH 5FYLD 3LQZA 2YD6A 5I1LB 4KTDL 3GB7B 4ZNEE 3A0OA 4YHKH 4KRPC 5GZNC 4L9DA 4V1DD 2PXYD 3MRCB 1G6RB 4M4RA 3I3DA 1RY7B 1J1XH 4PJHA 5KBNC 1RU9H 3O4LA 4OKDA 2BSSB 3HLAB 5DRNA 3N85L 1QFHA 4MLIA 5JIPA 3LEVL 4F37F 3GHEH 1GC1L 1HINL 2WQ8A 1SY6L 1H5BA 2OR9H 3KNBA 1AY1L 1TQCB 2RFXB 3WKML 2OLDA 2AK1H 2BRRH 2E9WA 2HMIC 4LVEA 5GS1B 3SKJH 1WIPA 4M8VA 3S34L 3ULUE 1U91A 1UJ3A 5SV3A 3CUPA 1TNMA 5ANMA 1LDPH 4NFCA 4AENB 2JJSC 4HKZB 2WW8A 1IFHH 2XWTA 2FL5A 5F1NA 4GS7B 1FLRL 2FB4L 2NY5H 3BT2H 4NNXA 5E8OA 3E2HB 4RMTA 4M7JH 2VTFA 4OI8A 1T2QH 4ONHA 5I73C 4WFEE 2XYCA 4ACPA 3PWPA 5ACLA 5F1IA 2DQCH 5DJ6B 3ZZ1A 3NCJH 3JTSA 1B0WA 1KELL 1W0WA 5KJRL 1RZ8A 3IYLW 1S7TB 3V6FB 3FQUB 3MRPA 5BMFH 4OUOA 5IHUH 3RTQA 1E4JA 3TT3H 3P4MB 1AD9A 1EAPA 2X40A 3LQZB 3OKYA 4OTXL 2F5BH 5HYJE 3QIWA 4MCYA 3R1GL 2VC2L 3O6FC 4FFZL 5CLTA 1PGRB 2PTUA 4PJHB 1QFWM 3O4LB 5DRNB 1OW0C 4ISVA 1HYRC 5EUOE 3CLEL 4ZTPH 4ZUUA 1MCDA 2QHLA 5FUCC 1H5BB 1X4XA 1N5AA 4JRXA 3TM6A 3UZQA 1KJ3L 1RMFL 3T0BA 3HTLX 1H3WM 4XNQA 4OAWA 5HD8C 3VXME 4JJHA 3UTPD 1U91B 1UJ3B 3PDDA 2CK0H 3CUPB 2HJKA 2MJWA 5ANMB 3S6CA 2Q7YA 4P99A 3MBXL 1OAXH 1XGYH 1U8PA 1T0MA 2IBBA 5AEAA 1QR1A 2FL5B 4Q0XH 5F1NB 1PYWA 1YN7A 5E8OB 3BPOB 3ARBA 2OM5A 3BP4A 4NO5A 3T8XA 3V4UL 4ONHB 1I9RL 3PWPB 4TTDD 4Q97A 2DQUL 3O11A 1OM3L 5I8KH 4MAYA 4NKQB 4PGCA 4U1MA 5F1IB 3O3EA 1OAUH 3JTSB 4FABL 1BOYA 1OARL 3TIEA 1VEMA 1W0WB 2KKQA 1FDLL 1RZ8B 5HHOB 4GT7A 1QRND 2VISA 2XTJE 3MRPB 3CNKA 5KTEH 1FJ1B 3RTQB 1AD9B 3D87B 1EAPB 1RURH 3DV4A 2IPTH 5DVKA 5ABDE 1CLZL 4JM2A 4M93B 1IBGH 5JQ6H 4N5EC 1DQLL 4PJGF 5EZJA 3QIWB 4U6YA 4MCYB 2DOCA 2OXGA 3I6GA 4XNXL 5FYJU 5JLZA 4ISVB 3VWKC 3DO7A 4PJFE 4ZUUB 5D7IA 4X7SH 3GNML 1N5AB 5I1JH 4JRXB 1SM3L 4P4KA 2DMCA 2HVKB 2FLBT 4LP4A 2GFBA 3W2DL 4XNQB 3V5DA 1FIGL 4OAWB 3B8SA 4Y19A 4CVUA 3UPCA 4OIAA 2Q7YB 3KPQA 1R5IA 3GUTA 4HUWA 1U8PB 3MYJA 3ARPA 1T0MB 5LKNA 1QR1B 2IGFH 1PYWB 1N26A 1YN7B 3ARBB 3BP4B 4BK4A 4NO5B 3T8XB 1NLBL 5C07A 1VFBA 3RDTA 1V3JA 3TVMC 1IKFL 5DQJA 5MP6H 1JGDA 3NA4A 2BMKA 2JK5A 1KCVH 3FB6B 4MAYB 1UH4A 4PGCB 4U1MB 35C8H 5D7LA 3A6CL 3O3EB 5C09B 3CFEA 4KROC 2VXUH 1QZ1A 1UXWA 2X41A 2Y23A 5HI4C 3TIEB 4UAOC 1JIBA 2VISB 3F7QA 2ICWB 1QSEE 3WO3B 3DV4B 1B88A 2VDRL 4JM2B 4NM4L 3P3YA 4XVUD 1I8LA 5ELIA 3CK0L 4MNGE 5EZJB 4U6YB 1MNUH 2FATL 2R0KH 3I6GB 4XCCL 4MJID 2O5XL 1HKLL 3NVQA 5JLZB 1L7IH 5EOTA 4RGNB 3DO7B 1ZAGA 5FHAL 5D7IB 4QTHA 4PJ7F 5BS0D 1WAAF 4P4KB 3JVGC 1BLNA 2VKWA 3QYCA 4OLXL 2J4WH 2GFBB 3V5DB 3EYVB 4WHYH 1GGUA 1XF5A 4Y19B 3AM8C 5FM5O 3KPQB 4A2MA 1R5IB 3GUTB 1H3UA 4HUWB 1EHLL 3MYJB 4TNVK 5IROA 2YPLA 3MXVL 4I0KA 3IS0X 4ZFGL 1IC5L 2BNQE 3RJQB 3T09A 1J88A 1R3HA 5C07B 4LHUD 3RDTB 5DQJB 1JGDB 2BMKB 2JK5B 2ZCHH 2WZPD 1DL7H 5IBUG 3SJVA 1MHEB 5JIIA 3NZHH 2BXZA 5GJSH 3S8WA 1AFVL 3CFEB 4X0KA 1UXWB 2GUOA 5I8OL 3EOAA 1S7SA 3MV7E 4LP5A 1B0GA 3QUYC 5C0CE 5DJCA 4H20L 1KT2A 3ULUF 3F7RA 3BH8A 4X7CC 4WRLA 5MENE 4TULL 1IGCH 1Z3GL 3BQUC 1LE5A 1A3LL 5EOTB 2YUXA 1F5WA 4NGHL 2NYYC 3VXSE 5DRWA 2GI7A 4NWTH 3TPUA 1ZWIA 5I76A 1MI5D 1IEBA 2A6DA 1AR1C 4QTHB 4X4ME 3PV7A 4YHYB 3QFJE 5B3JE 5DK0A 1BLNB 4G5ZL 4EDXA 4V1DA 2PXYA 4Y89A 1WUNT 2NY0B 4QXTA 3BDYH 1S78C 1YEGH 4OZHE 3WMSA 4J2XA 1XF5B 1YEEH 4U1NA 2FEEI 5FGRA 4BZ2H 4NQCE 4ZOEA 2A77H 4OBRA 5D93C 1BQUA 3DIFA 4M5YH 1IQWH 1JRHH 4EDWL 2YOCA 1R3HB 4HGWA 1FO0A 4ELMA 4JRYD 4X4ZA 2NY4C 2V6HA 1QBMH 1HKFA 4OCYL 2F54E 3RBSA 5C0BE 3SJVB 1NMAL 4S1QH 3BDXA 2BHYA 2X4OA 4X0KB 4UI2A 2CRIA 5DMGC 4GBXC 2GUOB 2DB8A 3OWEA 3EOAB 1HHHA 2PYED 3ARYA 1S7SB 1HSAA 3W9EA 1B0GB 3C2AH 5TF1H 5DJCB 1MIEH 1KT2B 2X89D 3BH8B 4U1LA 3N1GC 5GGSA 3AS1A 3Q6GL 3KXFD 4PRBA 4QTIL 1LE5B 1OWWA 1F58L 4IHOA 5DRWB 3MBEC 3TPUB 1X6NA 1ZWIB 3STBA 5I76B 1IARB 3BYYA 4MNQD 4LVHC 1IEBB 2A6DB 4XVTL 3TO4D 5J89A 1N6VA 3BYTA 1H3TA 1ERNA 5L8KB 4M6AA 2FH6A 5DK0B 3TP4A 4EDXB 1NMBL 4QY8B 4MD4A 2PXYB 4V1DB 4JN2A 3QIUC 4QXTB 2IFFH 4AIXA 4HEPG 1J86A 5JPNA 5L6YL 1DEEA 1T6WA 4U1NB 5EZLB 2XOTA 2WBJC 3SE9L 2QBWA 5HHPA 4M5ZH 1F6LL 4WHCA 4L4JA 4Z8FL 1OAYH 3KPOA 1CXHA 3DIFB 3VXTA 1B4JL 4HGWB 1AXSA 1FO0B 1GGYA 3PUCA 4JZJC 2EXYD 3FN0L 4OFVA 1ORSA 4KTYA 3QPXL 2VDQL 2QSCL 4Y4HD 3ZTJH 4PJFF 1EJOL 4DQOL 5E03A 2X4OB 1PD6A 4JE4B 5JMRA 4P5TD 1CFVL 4PGJA 1JF6A 2DM7A 1DQDL 5TGBA 2VXQL 3W9EB 1MIMH 2XRAH 4L29A 1YNKL 2DYPD 4U1LB 3WN5B 5GGSB 4KJPD 4PUBL 2YWYA 5CZVL 4FQ2L 4PRBB 3TH2T 2ZKHL 3IXTA 4Y2DD 5ICYA 4IHOB 3X11A 1QRNA 5F89A 5LQBL 1Q9KA 3CX5J 2VXVH 1NCDH 3Q1SH 4AQ1B 2BP3A 4OLUL 4PJIE 4WV1C 4MD4B 2B7DT 1EMTH 4JN2B 1ZXQA 4U1HA 5B22A 1PX4A 4Y4KD 2DMKA 1FFPA 1F2QA 5HHXH 4K07A 5JPNB 3C5JA 1DEEB 3CDYA 1NDMA 5HHPB 3VA6A 5FYJL 2E27H 1B2WL 3KPOB 2HJLA 3DX7A 3VXTB 4NRXA 4OCLC 5B38A 4P23C 1AXSB 2GCYA 2VZVA 4MA8H 5D2NC 3VGFA 1KULA 2AEWA 1XIWD 1ZEAH 1ORSB 5CILH 5HYFA 3G04B 4RDQF 2BVEA 3NA9L 3QZWA 3FOMA 5ID1A 1FNAA 3G5ZA 3VE0A 1RUQL 5FM4A 4XX1E 5TGBB 3MRLA 4BYHA 4HIIA 4L29B 1CICC 2BNRE 1EBPA 1ULVA 3VH8G 1RZJL 1E4XH 4G43A 3IXTB 1CVRA 1IT9L 5ICYB 4JFZL 4N0YL 3X11B 3VMPA 1QRNB 5F89B 4WW2B 1Q9KB 5I6XC 1M7IA 3QDAA 3LKRA 3EYFB 3BFOA 5GS0C 2WUCH 1TZHB 4J3OC 3QDJE 2WSKA 4J1UB 1IM3A 1NGWA 2DQJL 2Z35A 3DJ9A 3DLQR 1QPPA 4U1HB 3ETBF 1FAKT 3H0TB 4GO6B 1WZKA 4GRWE 4MJIA 1H3PL 3LRHA 1FFPB 2VITA 4PYGA 3B3IA 3C08H 2V7HA 3QEQD 4M1CC 5D70L 2VUYA 3C5JB 4FQJH 4G3YH 1IGFL 5BS0A 2HKFH 2EDOA 4LKXA 2DI9A 4LSSL 5CKGA 3TC9A 1H15A 2AK4E 4GXVL 5GZND 4G9DA 3BH9A 2HJLB 3DX7B 4NRXB 5B38B 4JHAH 5A2IH 1QNZL 3L1OH 2GCYB 3ARRA 3JV4A 3TZVC 1V3KA 2JELL 3BEVA 3NABH 4KK9D 1TVDA 1CGSL 8CGTA 2YZ1A 3QZWB 3FOMB 2CLVA 2X6MA 1MF2L 5ID1B 3VGDA 1GIGH 1D9KC 4M6ML 4C55A 3G5ZB 3BKCL 3VE0B 4Y8AA 4CADA 2A9NH 4HF5L 5E7FA 2L0DA 4OZHF 3L5JA 3MRLB 2KZ1B 3K8MA 4HIIB 1FG9C 4LHUA 2H2SC 4OFKA 4YBHA 5AYQA 2GY5A 2PW1A 1RUMH 2X70A 1T3FA 2XN9E 4D3CH 2ADJA 4X99A 3G6JA 3NIGE 4G43B 4JFHE 2VQ1A 1U58A 2BCKA 1S9VB 4NUGH 1EVTC 3KLAA 1M6OB 4OZGF 4R26H 2OP4H 2QQKH 1CLCA 5F1KC 1M7IB 3UC0L 3LKRB 3U0WH 4R2GC 4P9HL 4N8CL 5JW3L 4OCSL 4XPAH 2BXYA 1MHPH 3G6AA 1IM3B 1NGWB 2Z35B 4NUJA 1OAKL 1NMCB 1ADQH 2VITB 4RBPK 3DXAE 3B3IB 3KHQA 2V7HB 3I85A 1ETZB 2C26A 2WM0A 1NGPL 1MI5A 3MODH 4OM0H 5BS0B 4WENB 1EEQA 1PG7W 1H15B 4TSAL 4G9DB 3OSKA 3BH9B 4R4BA 1JGLH 2VLKD 3JV4B 1KLGA 1QSVA 3BEVB 4O4YL 4G9FE 2C4FT 1TJIH 3NAAH 2G9HA 2CLVB 4LSUH 1VPOH 4UT6L 4GSDH 3C8HA 3VI3F 3O8XD 5E2UL 2MCG1 4CADB 3VXRD 3EO1A 5E2TH 4DKEH 1BPVA 2PCPA 4NHCH 4H1LA 4LHUB 4L8CA 3MROA 3LMJH 4JRYA 3V5HA 4G6AD 2K3TA 1YA5A 2PW1B 2XXCB 1A5FL 3X3FL 2X70B 5GRVL 1T3FB 4NP4H 4X99B 3G6JB 3HMWL 5FYKE 5SWZE 4XAKD 1U58B 2BCKB 4K7PX 3D9AH 4LLWA 2ZP0T 4NNPH 3KLAB 1ZKAA 3B83A 2JJTA 5SWSD 2PYEA 3IETA 1MCLA 4ODHH 5KVGL 4I3SH 1YNLL 2X89A 4NKMA 4P5MA 5SWQA 3O2WH 3G6AB 4NUJB 2X10A 3OJ2C 3S37X 3KXFA 1U8KA 3T0EC 4DKAA 1A14H 2CMRL 2R1YA 3MLTB 1WSST 3WJJC 1ZLUH 1MH5A 1Q9WA 1MI5B 2D4DA 4MNQA 5CSGA 2XY1A 1ZLWK 4QOKD 4Z7OE 3LD8B 3TJEH 1FBIL 4N9OB 1A7NL 5MEOB 3RY6C 3NH7L 4R4BB 1M71A 3VFMA 1KLGB 1MCBA 3BPNB 5IB3A 4KZDL 3EDFA 3F7PC 2NMSA 3H9YA 2G9HB 6FABL 2V2TA 3PWUA 4PJIF 2YPVL 1FGNL 4XPHH 3EO1B 4I9WE 1JPGA 4H1LB 4WHYG 4L8CB 3MROB 4JRYB 3V5HB 2R29L 5FGBC 4AMKH 4JY5L 4FZEH 1IZJA 1DDHA 3M8OH 2ZUWA 3TGXA 4Y4HA 1PSKL 1F97A 5HI3C 3EIFA 4WW1A 3DYPA 1A7OL 4P5TA 4LLWB 5I1CL 1L9MA 2PYEB 3IETB 3QQ3B 5T3ZL 2DQDL 3O4LE 3TVMD 4ONGH 2AW2A 1A6ZA 4NKMB 4YDLB 4P5MB 1IKNA 5SWQB 2DYPA 1ZVHA 2JF1A 4LEXL 5DD5H 4DZBA 5KANI 3NGBB 5D7JC 4WTWA 5F8RC 4X9BA 3KXFB 3QHZH 4KROD 3UO1L 4GOSA 1U8KB 4JJ5A 5KVMC 3LEYH 2R1YB 3BGFB 4Y2DA 3UYOD 2O5YL 1MH5B 1Q9WB 1LEKA 4MNQB 4PGBA 4KMLB 1ZGLA 3TO4B 3U9PH 1PAMA 4PRIE 3RFZC 4PRPD 1II4E 4EJ1C 1M71B 3B9KB 2BHZA 3VFMB 3EHBD 1MQKH 4Y4KA 3ZKQD 1MFDL 5IB3B 3MJ8A 3MUY1 1YEJH 3MUJA 2DBJA 4O2CA 2OZ4H 5C0AD 4R96A 5T3ZD 2FNBA 3PWPE 2V2TB 1KPUA 3PWUB 5EOCL 4PS4H 1DR9A 4XMKL 1JPGB 2OJEA 1BP3B 4GRWF 1Q8MA 4K71C 3RPKA 1XIWA 3RY5A 4AEEA 3QXDA 1DDHB 1FZMA 3D5OF 4ZS7H 4Y4HB 5B3NA 2F5AH 4XC1L 3CX5K 1NDGA 4WW1B 1FNLA 2O5ZH 1HH9B 3ZYZA 4P5TB 1ZE3C 4EI5C 1C5BL 1N2RA 4JCMA 4K3EL 4KRLB 4BH7A 1R6VA 4L5FL 3EOYG 2P5WD 5EO0A 3VWJC 1CFQA 1AHWA 1FH5L 2DQIH 1A6ZB 3VMOA 1I1AC 2DYPB 5M94B 4YFEA 4DZBB 2EIBA 3FMGH 3ARQA 4KHXL 4OJFH 1QBAA 4JRXE 4M6OH 5EU5A 4JJ5B 5IB2A 4H88L 4L9LA 4Y2DB 4OQTL 3VD4A 3BKJL 1LEKB 1A4JA 1DBKH 3MRGA 4PGBB 1ZGLB 2KQNA 1G9NC 5AZEH 3TNMA 1C08B 4U1JA 3V5KA 3CMGA 1S5IH 2H45A 2R0WL 4GMSL 4XXCA 2HN7A 4XXDA 3NIGF 3BQUD 1V7ML 2HWZH 2C4FU 3GIZL 4Z7UA 4Y4KB 2Q8BL 1MCPH 1IMHC 3QCTL 3MJ8B 4HBCL 2KQMA 3QEQA 1CG9A 4N0CC 1L0XA 4I0CC 4O2CB 4R96B 4GH7B 4B41A 4OF8A 4LVNB 3QP3A 4JCLA 3MV01 2DJ4A 1S78D 1DVFD 2OJEB 4LOUD 2IBZY 2P8MA 3QUZD 1XIWB 4RISL 2X4NA 3QXDB 1FZMB 2IQAA 5DJZA 2DJSA 1A21A 4S1SH 5ERWA 3P4OA 4MGXA 3KLSA 4NQED 5I71C 15C8H 2BSRA 1A6VH 1N2RB 1RHFA 4GFTB 4BH7B 4G7YH 5FFLA 1FPTL 5DD1L 5EO0B 1CFQB 2ENSA 5BJTA 1AHWB 3QEUA 6CGTA 4XB7A 2OJZH 1KB5A 4YXHH 2AQ2A 5CIPH 1CWVA 1QSFE 3F65A 5D7IE 1I3VA 3E1F1 3P2TA 4HH9B 2GAZA 2JJSA 5EU5B 5DMGD 5IB2B 1K8IA 2FBJL 4QWWC 1RIUH 4L9LB 3MJ9A 4FQXC 3VXPA 5H94A 1KJ2H 4TSBL 4NKDA 3LRGA 4YZFF 3MRGB 1EGJH 4P9ML 4YC2B 1YDPA 3TNMB 1HILA 4U1JB 3Q3GA 3V5KB 2BVOA 3UJJL 1E4KA 2B0SH 2HN7B 4XXDB 3T0VA 4Z7UB 2PN5A 3WV0A 3N50A 4WVRA 2HFFA 1X5GA 3IAGC 5TQ0H 5KW9H 3QEQB 5EOQL 1F3RB 1WFNA 4K8RC 5CEZD 3E3QC 5L2KD 2YN5A 2H32A 1B0RA 1J1OL 2YA1A 4X98A 5D7LE 1OP5H 3CPLA 3WXVL 1IGJA 4P0DA 2VLKA 2P8MB 1QR4A 4OF0A 2X4NB 1OW0A 2IQAB 5DJZB 4A6YL 1J8KA 1LO5A 2ADFH 5GS2H 1IGIH 5ERWB 4Z7OF 4PR5A 3P4OB 2F53D 5FGCB 5IHBA 2Y36H 4G6MH 1MAMH 2BSRB 5AZ2L 3O8XA 1RD6A 4MXWH 2I07A 3H9HA 4OCMC 4JLRA 3C2SA 5FB8A 3PL6C 5BJTB 1RUPH 5F6IC 5C0ND 1Z9LA 2W9DL 2EDTA 3QEUB 3ZMRA 1KB5B 4U1GC 2DMBA 1NC4B 2E8ZA 3AVEA 2YXFA 1G9ML 2GAZB 2AJUL 1N4XH 1K8IB 5K9OA 1MVUA 4H0GA 1F8TL 4QRSA 3AC0A 4WY7L 3AREC 3VXPB 4PREA 5H94B 4NKDB 5SWSA 3NBNA 3ALPA 3HI5L 1P7QD 1YDPB 1HILB 3Q3GB 3VFVA 5I73B 1LEIA 2VAJA 4PB0L 5FAAA 2BVOB 3IDIA 4IRSC 4Q9BA 1BBDL 5LGKA 3H3BC 4R97B 5EN2A 1T2JA 2YPLE 4ZD3H 1XT5A 4GG6A 3BOVA 3DHJA 2NX5D 4TVPE 3JWDC 4M1GH 4K9EL 1KCUL 1NCUA 4QOKA 2H32B 1B0RB 4X98B 1FIEA 3CPLB 1MREH 5ESVA 4DFHA 1IGJB 4H8WH 2WAHA 2DTMH 3SOBL 2D7TH 2VLKB 4I3RH 4LSQH 3A67L 3MGOA 1OQOA 3L95A 3WIHH 4FQCH 5DFVC 1U6AL 1LO5B 1P4IL 2BVPA 4PR5B 4IIQB 4MXQC 2E7HA 2ZPKH 1W72L 5E99L 3O8XB 3H9HB 4JLRB 3WBDA 3INUL 3VXRB 4P23D 5FB8B 2V5YA 3T4YA 1KGCE 1KCKA 1DTUA 1SYVA 3SDDD 4Z77A 2ZNWA 12E8H 4LIQL 4ZSOE 2G75A 5DS8A 3EYOA 5K9OB 1MVUB 3ARGD 4QRSB 4PREB 4HK0B 4KY1L 5SWSB 4JHWH 3V0VA 3GHBL 3TVMA 1KCRH 3VFVB 1LEIB 1CICD 4OB5H 4XZUA 1H8OA 2I60L 5EN2B 1CDIA 4NM8H 3NCBB 4GG6B 1J0ZA 2VXSL 1HHJA 5J12C 4ELME 1FFRA 5DURD 3P9WB 1I9IL 1XF4A 3V79C 4QOKB 4YUEL 2AEQH 5GS0D 2B2XL 3HNSH 5ESVB 2ORBH 3MV8D 5CCKH 3IKCA 1CFTA 3FRPG 4PRPA 3IFLL 1CXLA 2J7LA 3MGOB 3V0WH 4MJ4A 1J5OL 3WO4C 3L95B 1KFAL 4M1CD 2HRLA 5BXFA 2IH1A 5DI8A 4KFZC 3BGMA 3BN9C 3GBMH 2BVPB 5C0AA 1QBBA 1UGNA 4BQ8A 1VFOA 1SVCP 4RRPA 4JM4H 5I74B 4HDIA 5TFSL 3JVGA 2V9RA 3T4YB 2FHCA 2ADIA 2K1MA 3TZVD 1SYVB 1VESA 4KMTL 1X44A 5E6ID 1CU4L 1RIVL 5F9OL 2G75B 5DS8B 5FDWA 3EYOB 3U83A 3GRWH 1V5JA 3O9WC 3V9FA 3V0VB 2P5WA 3TVMB 5IW3A 2AXJA 2H2SD 1RULL 4OT1H 4XPTH 4XZUB 3LV3A 1WF5A 3AUVA 3LIZH 2FX7L 3LS5H 5EU7C 4GMTH 4KROB 3RVWC 1OPGL 4ZFFA 1ZT1A 4UAOB 1HHJB 4LARH 2APFA 2CRYA 2JCCA 4LEOA 1N59A 4F15C 5CEXA 5DMIL 1XF4B 4OV6F 3C6LC 3QO0A 2R0ZL 4LDOB 4ODTH 3V7AE 1HK6A 1GGBH 3LN5A 5D7IF 5GGTH 1JF5A 3IKCB 1CFTB 4PRPB 1C7TA 5DJXA 3MRKA 1LO3H 2UZYB 3BQUA 4POYA 1QHPA 4J3XA 1MFNA 2E7LC 5BXFB 3ULUH 2IH1B 4KKCD 5DI8B 3BGMB 5C0AB 1BIHA 4JQIH 3AB0C 4R7DA 4HDIB 3HB3D 1J11A 4HS8L 1UWGH 4PFEA 3ZL4H 1DVFA 2ADIB 3QUZA 5TPWH 2KUTA 3EYUH 1YECL 2EE9A 3DSFL 1VKXA 4WTZG 4X4XA 1IZKA 1F4XH 4BQ9A 1ZT7A 5FDWB 4O2FA 3HC4L 2PO6C 4NQEA 1QFWL 5DJ0A 3KS0J 5DUML 2NZ9D 5BV7L 5GSVA 2P5WB 2W59A 4D9QD 3SHSA 3N85H 1JWSA 3LV3B 2VDML 3B5TA 2B4CL 1GC1H 1HINH 4I48A 5CZKA 4DK6A 4N8VA 1SY6H 4Q6IA 4FQLL 4NFBA 1AY1H 4LRNL 3V6OA 3WKMH 4ZFFB 1ZT1B 1U8JA 3TBSA 2EO9A 1X6LA 3N1QC 5I1GH 4XBEH 2MQ0A 2JCCB 4LEOB 3GJFA 3RZCC 5IHZB 2EZ0D 4RMUA 1P4BL 1LP9E 4YFLF 1MCJA 3LN5B 5LCVH 3VGGA 3HZYA 5DJXB 5C9KA 1A6WL 4O9HL 5EDXA 3MRKB 3BQUB 4MSWA 1ITBB 1FLRH 2FB4H 5F6HI 4Y16C 4PGDA 2GKIA 3HMXL 5L2KA 4JO3H 4K3GA 4ORZC 4ORGA 4PRNA 4R7DB 5C0RL 1U92A 4WI2A 4MQSB 3ZO0A 1E27A 5CMAA 1YY9C 1MCQA 3QIUA 1DVFB 5CZXC 3QUZB 1BVLA 1X4YA 4GW4A 1VKXB 4MQXD 4X4XB 1ZT7B 4G8GE 3MSPA 4O2FB 2JLLA 3CSGA 2F53A 1JV5A 3MCKB 5SX4I 3VFOA 1VGEL 4NQEB 5DJ0B 2C4XA 4JVPA 2VC2H 4MJIE 4FFZH 4X9HA 5GSVB 4NPYA 2E7CA 3T1WA 1JFQL 1NPUA 2R4RL 1QFPA 1JWSB 4M00A 2EH8L 5B4MD 2DQGH 4KH2A 4L8SA 2X09A 3BAEH 3CLEH 4I48B 4NC1E 4N8VB 4MZ2A 4Q6IB 3DX9A 5HI3D 3CFCL 1YJDL 3IU4H 1KJ3H 4WFFE 1U8JB 2BY3A 2I25N 3TBSB 4PPTA 4MHHG 3TF7C 2FEDC 2D4FA 1Q72L 4TRPH 1P7QA 4ODUA 4XMPL 5D5MA 3QDGE 3NCYS 2OL3L 4DUXA 2E6JA 4MCZA 4QNPE 5D7JD 3HZYB 1G0XA 4MSWB 5JOEA 4RMSA 4RX4D 2W9LA 2NX5A 1BIIA 4PGDB 2CXGA 2P7TA 3JZ7A 4GRMA 3SGKC 5L2KB 4LHJB 5J11B 4ORGB 4PRNB 2DQUH 1U92B 4WV1A 3G6JE 4V2CB 3QSKB 1NC2D 1E27B 5CMAB 2OXHA 5DO2C 1BEYL 1OARH 1FYTD 5D72L 4GW4B 3CU1A 4ELMF 1CLZH 4Z0XA 2F53B 1JV5B 3VFOB 2PR4H 4BJLA 4UILL 2VRAA 4NN5C 4V2BA 2APTA 2A6IB 4XNXH 1RK1A 4LAQL 3GI8H 4NPYB 1F4YH 4P23A 2FIKA 2ZSVA 5CBEA 3OB8A 2P47B 1LK2A 4L8SB 3SDDA 3T3ME 4F7TA 4XPBL 3GNMH 3DX9B 1BOGA 1QD0A 1SM3H 4O58L 3MPCA 3ARGA 5IESH 4EI5D 2HT2C 4FQIH 1VHPA 1X9QA 3WD5L 4L8BA 3W2DH 2UUDK 1C5DA 3BWUC 5F71A 3NIDE 1IGML 1MFCL 3HPLA 1P7QB 4ODUB 2APVA 3HAEH 5D5MB 1CICA 1I1AD 4OCWL 5JIKA 4ZQKA 4MCZB 3CDCA 2O26U 2XZQH 4U2ZA 2F58L 4Y2OA 1RZFL 4Q9QH 2QJDA 5F6HJ 2CUHA 2NX5B 3N06B 1ZHNA 4X7TA 1SJEA 4EZMA 1NLBH 2P7TB 3UZEA 1ZK9A 1IKFH 2C3WA 1D5IL 4JDVA 4NIKB 1JK8A 3MJ7A 4JPVL 1IVLA 3A6CH 3E6FA 4WV1B 1B90A 3MV8A 4KRMB 3P77A 2V2XB 1D3CA 4OF7A 4UTBH 2PYEE 2A6KA 4POZC 1O0VA 2APXA 4JFQA 4KDVA 1KN4L 5D7KD 4C59B 5JA8B 4ONFH 3EDJA 3BRGC 4W6XB 2VDRH 3VGHA 4Z0XB 3A6OA 3CK0H 1SJXA 5F9JA 3KXFE 2FATH 5F7DA 3JV6A 1RK1B 1MJ8L 1HKLH 3MFGB 4P23B 2FIKB 2ZSVB 5CBEB 1FC2D 3UBXA 3TZVA 1LK2B 3SDDB 2EIDA 3HE6C 5E6IA 5EB9A 4F7TB 4R0LA 1BOGB 2R2BA 1WJ3A 1RUKL 3ARGB 2B5IB 5DJDA 4YHLL 4L8BB 5DEFB 4WO4C 4IEFB 1AGEA 1C5DB 4LK4A 5FCSH 2WUBL 2GT9A 1CICB 2DKMA 4FOMA 2PTTA 4G6FD 2OBGA 4ZQKB 1CD0A 1RU9L 2YPKA 1YEIL 2AEIT 5CJ8A 4ZDHA 3UYRH 1EHLH 1S5HA 5D6CA 4QWWD 3MXVH 4KKLC 5IWLC 3FOLA 3CSBA 2OCFD 2MHAA 4FQXD 5D96C 2NY7L 1R3IH 1ZHNB 1C12A 4ODSL 4X7TB 1SJEB 3QXUA 4JVWA 5DURB 3D6GA 5D4QA 5BVPL 1G0YR 3H9SE 2KH2B 4AY0A 4JDVB 4M7KL 5I1HH 1JK8B 3MJ7B 3TEUA 3E6FB 5FKPA 2UUDH 3MV8B 1LDPL 4MMXC 4Z7VA 2IANE 5C9JA 2VWEE 2A6KB 3CXDL 4JFQB 4G8EA 3W81A 5I75C 3ILQC 3PF2A 3BT2L 4ZTOL 3JWOC 4N68A 1LP9F 4M7JL 2YWZA 1T2QL 5C1MB 5I2IA 5TDNA 5F9JB 4JPIA 5F7DB 4KKNA 3JV6B 4TULH 3O2DA 1Z3GH 5IJVA 5DMJB 2DQCL 1K4DA 4CU8A 1A3LH 2IADA 3WFBH 4JKLA 2DI8A 3UBXB 3NCJL 3TZVB 4NQXA 3ZSTA 4RGMB 5E6IB 4R0LB 3E8UH 5BMFL 2R2BB 4YFLI 5DJDB 1DUZA 2EDYA 4ZUTA 3IDYC 5DD0H 1AGEB 2F5BL 4TUKH 4LPTA 1I3GL 2LQRA 2IEPA 1XR9A 2GT9B 5IMMA 5IVOA 5E8NA 3EJJX 1A0QL 4FTVE 2YPKB 3K1KC 3CVHA 5A16A 1JZ4A 2Q76A 4ZDHB 4CMMA 1MLBA 1S5HB 4ZTPL 1TPXB 5D6CB 2VH5L 3FOLB 2MHAB 3ARED 4GG8A 1C12B 4R3SA 3VFRA 7CGTA 3QAZB 4PJCA 3OKOA 1PW3A 3RWCA 4IRSD 3L3JA 3D2UD 5FKPB 5IW1A 3WHE1 2OK0H 1J0HA 3QI9C 4P48A 4PIRF 4Z7VB 5C9JB 3FHQA 1OAXL 1XGYL 2HG5B 4G8EB 2XG5A 3X13A 5EORH 5JDJA 2EDWA 2LVEA 1NEUA 1WISA 5I2IB 5TDNB 1FCGA 3W5NA 4JPIB 4Q6YA 3Q6GH 5I8KL 4QTIH 5IJVB 4JQXA 1K4DB 1MFBH 4H5SA 2IADB 4NQXB 2BY1A 5DFVD 3AS0A 4XVTH 1V3MA 3KPSD 4LLDA 5KTEL 4MB4A 3FN3A 2IPTL 1DUZB 4E5XA 3G6JF 3BKMH 4HZLA 4Z7UE 4IS6A 2W92A 1XR9B 3AMLA 5E8NB 3CVHB 5A16B 3SE9H 3WFCL 2Q76B 4U1IA 2FR4A 3BSZH 4CMMB 4DN3L 1MLBB 4Z8FH 2D9CA 2M1KA 1KIRA 4P2QD 4DUVA 1YMMD 4X6FA 4X7SL 3IFPA 4GG8B 3QUXC 2IQ9L 4R3SB 3VFRB 1J18A 5E2JA 1BREA 3GMOA 1CIUA 1A9EA 4PJCB 3FN0H 2VDQH 4HXBH 2QSCH 3RWCB 3T3MF 3L3JB 1GZPA 1EJOH 4S1DD 4DQOH 5IW1B 1ZA3A 4N0FA 5E1AA 4LU5H 5D7JA 4YR6A 5FGCE 4OQ1A 1XF1A 1J8HD 1Z9OA 4ERSL 3ARSA 1CFVH 4RX4A 1P5VA 1DQDH 1WITA 2VXQH 3B4NA 4HMCA 4Z5RA 5ICXA 1DQMH 3NIDF 1JI1A 3X13B 4CJ0A 1YNKH 2QKIA 3O3AA 3KYOA 4QHNA 3NFPA 4AL8L 1H3XA 5CZVH 4NNYA 1NC2A 1KCVL 5FHBH 2ZKHH 1VFAA 4H5SB 1FYTA 3LPFA 1SBBA 2MKLC 4U3HA 1KOAA 3RWHA 4N90E 3RNKA 4OUUB 3AY4C 2R9HD 4LLDB 3ULVC 1KTKE 2E8YA 4E5XB 5JUEH 4HZLB 3DVFA 2OL3A 3KS0H 4IS6B 1A7QL 5KG9A 2ZUVA 4ALAH 2R0KL 2UZXB 4QRUA 3SQBA 2QHRL 4U1IB 3PV6A 4YHOH 5FYJH 1PX3A 2FR4B 2Y5EA 5C2BH 1KIRB 5TF0A 4X6FB 3EJZC 3IFPB 4GRWH 4EI5A 5DEZA 1FNGA 3S35L 2VLKE 4MAUH 2J4WL 2V5RA 1WZ1L 3GMOB 1A9EB 5C6WH 2UYLA 4R4FH 5DD6A 2BOBA 1I1AA 1GZPB 3PGDB 1ZA3B 4N0FB 5E1AB 5FUCE 4YR6B 1KXTB 5D7JB 3NA9H 4Q9RL 1X5IA 3RVWD 3UEZA 4KJWD 1XZ0A 2AAVA 2B1HH 4EN3C 1RUQH 5CP3A 5HHNA 3BIBX 5KSAC 5MERA 4Z5RB 5ICXB 4RCAA 1ZOXA 3C6LD 4KDTC 2QKIB 9CGTA 3NZ8A 3O3AB 1ACYL 3KYOB 4QHNB 3NFPB 3SY0A 3RIAK 4WI7A 3B43A 4J3SA 2ZCHL 4NNYB 3C8KA 1NC2B 2J8UB 4FXKA 1NEZB 1VFAB 3D0VA 4XAKE 1FYTB 5GJSL 3RX7A 1IT9H 4JFZH 4NDMA 2YD5A 1A6TA 1DN2A 4HLZH 3RX5A 5TDPA 3RWHB 3RNKB 1AJ7L 4XI5D 4WI3A 2NTFB 3AXLB 5DC4B 3UTSD 1R5VA 2OL3B 3RWFA 5KG9B 2AJZA 4U1KA 4GS7C 1E6JH 4QRUB 4Y0GA 1JGEA 2A6JA 2E6QA 3E2HC 3JV0A 3PV6B 4QOKE 3K2UL 1ROWA 3RVUC 4LSSH 3OKDA 4XAWL 4XHJD 1S7WA 4EI5B 3R8BB 5GRVK 1FNGB 1QNZH 1NANI 4KXZI 3BDYL 2IMNA 5DD6B 2BOBB 4K23H 2JELH 4YBQC 5DZOA 1L6ZA 1I1AB 3QCVL 4DEPB 1YEEL 3DETD 4K2UL 1CGSH 2OTPA 1LO2H 3Q0HA 1MF2H 1R0AH 4M6MH 3HG1D 1XZ0B 2E9JA 1HE7A 4FQXA 2A77L 1JPFB 5HHNB 5MERB 4MX7A 3RZCD 4M5YL 1IQWL 1CD1A 1JRHL 3ECBB 3QA3A 1F3DJ 2D0HA 1AC6A 3NZ8B 3FJTA 3SY0B 1MJ7H 4UV4H 2ZOLA 3C8KB 3EZJB 2MMXA 3T04D 4FXKB 3D0VB 4S1QL 2R8SL 1KCLA 4NDMB 5AAMA 1A6TB 2F9BT 3SDAD 3BJLA 3EAKA 5DVNA 5F9DC 5TDPB 3HPJA 4KUCD 2VLMD 5B38G 4N8CH 2R4SL 3C2AL 5TF1L 3WS3A 5FF6A 1MIEL 5EZOH 5FYKH 5I9QC 1P9MA 4BSVA 1ZANL 1OAKH 1R5VB 3EYSH 1JF1A 1QO3A 3RWFB 3BVNA 2ICEB 2LAAA 5CZXD 2AJZB 3TA3C 1DANT 4U1KB 4LSTH 1MELA 4N5UA 1JGEB 3VFWA 2A6JB 3BPOC 2WK2A 3ZKXB 3OKDB 1TDQA 4TSAH 4TSCH 4HXAH 1S7WB 4NSKA 4PRPE 4C83A 1X5ZA 4XT1C 5CHNA 5K9JL 1ZHLB 1WLHA 3CXHJ 3U79A 2IFFL 4O4YH 4NRZA 3DVGA 5K93A 2ZG1A 3MNWA 2IBZX 1HCFX 5F44A 5ENWA 3RTQC 4HEME 4UT6H 1P1ZA 1U9KA 4NC0B 4M93C 3S36L 3HA0A 1WTLA 1LD9A 4FQXB 3AREA 4J6RH 5GRYA 4MX7B 4Z7UF 3WL9A 3ARDC 1CD1B 3QA3B 4PV8A 3TV3L 4G6JL 2EEAA 2ZOLB 4IRSA 1G7HA 3D2UA 3UXFA 3O81A 1U8HA 2GTWA 4HIHA 2OTWA 3BPLB 2W0FA 4PJBA 1I9JH 1BQHG 3FQXA 4XCNA 4Z78A 4YDKH 3HPJB 5SX4H 4PJAE 1B3JA 1KG0A 1U2CA 3EUUA 5KVGH 4I0PD 2XRAL 5JOFA 5FF6B 3WS3B 4OD3H 3DRQB 5BZWA 3MX0A 2C3VA 4U6VL 1Y0LA 1JF1B 1QO3B 5C8JA 2AQ1A 1MCFA 3BVNB 3D25A 1WWCA 4KU1A 2CMRH 5CD5D 4AT6A 1YEHL 2JCCE 2YN3A 5JPMA 3VFWB 1NCCL 3WNKA 3ARBC 4BM7A 4D9RD 4HWUA 3RBGA 3KPSA 1FBIH 2NLJA 4CBPA 1NCDL 4NSKB 1TVBA 2EXWC 4C83B 1I8IA 1HI6A 5CHNB 4YGAB 5JXEC 1T7ZA 4KZDH 4NRZB 2DDQH 3DVGB 1P84J 3CU7A 3MNWB 4WEBL 2NXZD 2VYRE 5ENWB 4CKVX 2VAAA 1P1ZB 4P2QA 3MLVL 1YMMA 2HT2D 2FGWL 1LD9B 3MLZH 3AREB 1JYVA 1RHHA 4X5WA 3WL9B 3RIFK 4PV8B 1EHAA 2R29H 4JY5H 3H42L 3WS6A 3VCLB 3RL2A 2E9BA 4ONOA 3TFKC 4RGNC 4IRSB 1G7HB 3D2UB 1PSKH 4BQBA 1U8HB 2GTWB 4FMFA 3QPQD 4HIHB 1BVZA 2OTWB 2W0FB 4NQEE 4PJBB 1A7OH 1J8HA 3FQXB 4XCNB 5AUMA 4P4KC 4Z78B 2DQDH 1KG0B 4WDIA 4OZIE 4LEXH 5BZWB 2FD6H 2C3VB 1Y0LB 3BRFA 3UO1H 5C8JB 3PP4H 5EH1A 3D25B 3VA2C 5JHDE 3VFPA 1A6UH 2AP2A 4AT6B 5JPMB 2O5YH 1E4XL 5D1ZC 4PRAA 5I15H 2A83A 1KIUA 1HXMA 3KPSB 2NLJB 3KR3H 5C0GA 1TVBB 4H1LG 1I8IB 4KQ3L 3O6LH 3RWGA 1HI6B 1NJ9A 3ARTA 4M3KB 1CGWA 1UVQA 1TXKA 1MFDH 2IPUG 4HWBL 5I0DA 1EAJA 3D3VE 3HE6D 2GSGA 4GW1A 3EYQD 4FQJL 4G3YL 2VAAB 4P2QB 4WGVB 1CE6A 1YMMB 2HKFL 2VLLA 2N7BA 4XMKH 3F62A 1RHHB 4WO4D 4X5WB 4EOWL 3L1OL 3PG2A 3QNZA 3RL2B 1JZ3A 2H9GA 5HDQH 3FB7A 2XFXA 4HG4J 3NABL 4KRNA 5T3XL 1S9YA 4Y1AE 2Q6WA 1NCWH 3VMNA 5E8EA 1J8HB 4YHYC 3BZDA 1C5BH 4K3EH 4XP9L 4RMWA 5E4IA 4L5FH 2P5ED 2EDLA 2NY0C 1QEWA 4WDIB 3C6LA 3LRSA 4KGLA 5L9DL 3PE9A 3N9GL 4KHXH 1RUML 4NWUL 1D6EA 4UBDC 4D3CL 4H88H 2BVYA 4NQDD 1NFDA 4HWNA 3VFPB 5C86A 4NBZB 4PRAB 2A83B 3C60C 3HN3A 2E7LA 2HRPL 4NUGL 3ILQD 4MD5A 5D5ME 3WJLA 1HXMB 2OP4L 4OBSA 5I17A 3QWQB 4M43H 5E8PA 4DCQA 4B7IA 5C0GB 3RWGB 5D2LA 3TCXA 3UTSA 3SN6N 2R0WH 1UENA 5HVWA 3H2WA 4GMSH 3I6KA 1NJ9B 1MHPL 4PJ8C 1UVQB 3IU3B 1EERB 2NX5E 1QTYT 4HBCH 2IG2H 1T4KB 5F9WC 1ADQL 1DQTA 2GSGB 3BI9X 3F58L 3PDOA 4GW1B 1CI5A 5JOPD 1LK3L 1GJIA 3MODL 1CE6B 4OM0L 4LFHD 2VLLB 3Q5TA 2V5TA 3O6KH 5D1XB 2XZZA 5F1OB 2YK1L 2AS5M 1MCWW 3NPSC 5KSBF 5HVFB 2ZG2A 5C0DA 2NR6C 2H9GB 3MCG1 4WWKD 3GFUA 3FB7B 1S9YB 1S9WA 1YNTA 1TJIL 1YUHA 2Q6WB 1G9EA 5E8EB 3HCVA 4X83A 4RAVA 4LSUL 1VPOL 3VD7A 2PXYC 4KV5E 5D2NE 5DD1H 1DLHB 2BSTA 3B9AA 4KHTH 3RZCA 1ITCA 1QEWB 2NXYC 3C6LB 1ACZA 5E2TL 2FHBA 4NHCL 3LMJL 3ABZA 1F11A 1RJYA 1D6EB 3GSNL 3QI9D 5IHLB 1F4AA 2UZIH 1PJ9A 4NP4L 1KEGH 4U3CA 4PP1D 1N64H 3U36A 2VZSA 4JZOA 3SDAA 3D9AL 4NNPL 2ICCA 2AJXL 1HIMH 1OLLA 5I17B 5E8PB 4ODHL 2GK0A 3RWDA 4JFXA 2AV7A 2RB8A 2BC4A 3UTSB 5D2LB 2E7MA 4I3SL 1G7QA 5TE7H 3TESA 3I6KB 2R2HA 4S0SD 3TPKA 2EC9T 1DBJH 2HFTA 3FQRA 1A14L 5DWUL 3BUYA 3PDOB 4PJAF 1CZ8L 2I5YL 5FA4A 5HJ3A 3MV8E 4KJQD 2D2OA 3WN5C 3WXVH 1CYGA 2OTUA 3MLRH 1VADA 4LLMA 3LS4L 3IGAA 4JKKA 1GC1C 2JCCF 5C0DB 4A6YH 3U4EA 3DYOA 1S9WB 1YNTB 1YUHB 2DL9A 3L3OA 4P49A 1HQRA 2MCPL 3HCVB 3HG1B 4PJ5D 4RAVB 5C6TH 3QUXD 3MRDA 2BSTB 3RZCB 4BK5A 3QULA 2W9DH 5T5NG 2QQNH 1UWXK 5JR1L 1FP5A 2GJ6D 4AMKL 5HYQA 1G9MH 1F11B 1RJYB 4RWYH 3M8OL 4G7VL 4F3FA 3K7UA 3BP6A 3IFNL 3IAQA 4WY7H 4F9LC 1I8KA 3UZVB 4JZOB 3SDAB 4X80H 3DMMC 3HI5H 4NZUL 3FCTA 3TWCL 3F7YA 1ZS8A 1EZVY 4HUKB 4PB0H 4I0PA 2GK0B 4ODBD 3BXNA 3RWDB 4ONGL 3CXHK 4JFXB 2AV7B 5DJ2A 2BC4B 1U8OA 4OZ4A 1G7QB 1BBDH 1PG7X 4M48H 4CN1A 2R2HB 1OSPL 4PJEA 3QHZL 2Q3ZA 1JYWA 2CSPA 3MRIA 1BGXL 3FQRB 3BUYB 1PZUB 1KCUH 4FQPA 5INDA 1JN6A 5FA4B 4OZIF 1QLFA 3U9PL 2OTUB 1UB6B 4TTDC 5IT2L 4Z7VE 4PP2A 4G42A 4ETYA 1PLGL 1VADB 4CW1A 3A67H 4LLMB 2QQQA 3IGAB 1BD2D 4UQ2B 1MQKL 3U4EB 2AJVL 5SV4A 1P4IH 4OZFH 4WGWB 3LKOA 3EDKA 4WW2C 4ZMAT 1NUDA 4AK1A 2NY6C 4WCYH 5F7KC 2OZ4L 1HQRB 3K4DA 3EJZD 1W72H 1X5AA 5E99H 5I0ZA 1K85A 1XGPA 5T1KD 4DAGH 3INUH 3MRDB 3A6BL 4PS4L 2HT4C 1ZHKA 1V8HA 3QULB 3L5HA 2VLJD 4LSDA 4OD1H 2D7PA 1F3DH 1YEKH 1KCSH 3HUJF 5HYQB 1YEFL 1RZKL 4EXPX 5J06A 4F3FB 4ZS7L 1KN2H 1WZMA 3BP6B 2F5AL 3V8CA 3RWIA 1EHNA 4ZO9A 1I8KB 2O5ZL 5CWSA 4EN3D 1X5HA 4HFUL 3FQWA 5KSAD 3FCTB 3GHBH 3RRQA 3F7YB 1ZS8B 4I0PB 3RHWK 3BXNB 5J3HC 5DJ2B 1U8OB 2DLTA 4OZ4B 5GRWA 4NCC1 1FFNA 2I60H 1P84K 3I02A 1LVEA 5EIVA 4PJEB 4OJFL 2I9LB 4M6OL 4HULB 3MRIB 1BZ7B 2EDDA 3P9LA 5FV1L 5A43C 3VFGH 1CFBA 1I9IH 1JN6B 1FORL 2JKXA 3TYGH 1DBKL 1QLFB 4QXGH 4M1DH 1D5BA 1U42A 4O2EA 3IFLH 4PP2B 4G42B 4NN5B 3T0EE 4CW1B 5C08D 4BFGA 3LH2L 4NCC2 2HTLC 5FO7A 1KFAH 1B4RA 3KPPA 1SJHB 2CO7B 3HE6A 3LKOB 2NXZB 3NACL 5HYIA 3RVUD 4LRIA 2BRQA 5TFSH 4LLYA 1KIPA 1BFVH 1CCZA 1XGPB 1ZVSB 4WO4A 1ZHKB 3GGWB 1WVZA 3KJ6L 4YBQD 4KMTH 3NOIA 1CU4H 2DRUA 4DGIH 4OLWL 1B6DA 5FEBA 4JFOB 2W9EL 4I77H 3AS3A 3RWIB 2PW2A 2Q7NA 2VDLL 3FQWB 4POUB 1HN1A 2DWDA 2P5EA 1NKOA 4G7YL 1RULH 3IKKA 2QR0A 1U8NA 2XNAA 3CX2A 2P46B 2FX7H 1FFNB 4YXHL 1JNJA 3QUKA 2EC9U 3I02B 3HC3L 1NGQH 1XAUA 5F7EH 1OPGH 2OR7A 4NQDA 1GYAA 4PTUB 2YMXL 3P9LB 2XKNA 5DHVH 3RVVD 1RIUL 3THMH 4KV5F 4Z7NE 4TN9A 5DMIH 4D8PA 3C87A 1KJ2L 1AO7D 2R0ZH 2P49B 1EGJL 1ZT4A 5D1QD 1NANH 4KXZH 1D5BB 1JNNL 3T4AA 3UPRA 2NY1D 2B0SL 1FHGA 3TA3D 3DBXA 5FO7B 2N1KA 3KPPB 4Z7WA 2FEEL 5H2BA 3HE6B 4XNUH 1QACA 3BMWA 3HR6A 5TQ0L 4FRWA 3EDEA 4OLYH 5KW9L 5FDYA 1JYNA 1KEML 1KIPB 4WO4B 1FYTE 4U49A 3DUHA 5B39G 4OCXL 3T77A 2ZG3A 4U4BA 1YECH 4HCRL 3H7LA 1NFIA 5HHOD 4K94H 4WWKA 3KPRE 1PEZA 2FIRT 5F7FA 1LE9A 3ZDXF 3BD5A 1IGIL 2RQ8A 3LD8C 2PW2B 5D96B 4QXUL 5DUMH 3CC5A 1MAML 3OZ9L 2DWDB 2P5EB 3ARDD 1TETL 2QR0B 3VFSA 1U8NB 2VDMH 2XNAB 3FRPA 1J1PL 3VGBA 4C54A 3QUKB 3O4OB 5ESAA 4ZUSA 3QI9A 4YXLH 1HH6A 2H8PA 4NQDB 1N4XL 3PP3K 3I50H 2XKNB 5HGAA 4RRPG 3OKEA 3SKOA 4D8PB 2DTSA 1P4BH 1UM6H 2A74A 4OM1L 2YRPA 2G60H 1ZT4B 1M1SA 4NQVA 2ZCKL 5I30L 3CH8A 2X9XA 3MA9L 2ED7A 3T4AB 3JBG7 3UPRB 1A6WH 4O9HH 1LO4L 3DBXB 2I24N 4Z7WB 2ADGA 3HMXH 2V2WA 5H2BB 5FCUL 5HI5D 4CL7A 5J0BA 2VLRD 5C0RH 1MCSA 4YDLC 2D7QA 3NGBC 5JXED 1I3RA 5C09D 2Q87A 3CZFA 3O3DA 4JKWA 4L4TD 3ZE2E 4H8WL 5C70A 3T77B 2DTML 4LPWA 4I3RL 4LSQL 1NFIB 3BGFC 4X6DA 2YUVA 4WWKB 4KAQH 1LE9B 3OHXA 2YBRB 3TO4C 1VGEH 4PJ5A 2IAMD 5K9QI 2ZPKL 4Z7VF 2ZUUA 3CC5B 3QUXA 2F74A 4RMVA 1RK0A 3OJDA 4YHNA 1JFQH 3B9KC 5HY9A 2R4RH 1IC4H 2EH8H 3VFSB 2H6PA 3SCMC 4UQ3A 3T2NH 2GJ6A 2MQ3A 1TITA 5ISZD 5ESAB 4ZUSB 1LQSR 1XFPA 2D7MA 5BOPA 2YEZA 3CFCH 12E8L 1HH6B 1YJDH 2H8PB 3CLFH 4RA0C 1G6VK 4IRZH 4YBLB 4EKXA 5HGAB 4Q2ZA 3K81A 3OKEB 3SKOB 2A74B 1X5LA 1DFBL 5HVGB 1H8SA 1JHLL 1LO0H 4NQVB 4MA7L 2EXYC 3OPZL 1P69B 4HZAA 4C56D 1X5YA 3W11C 4ZXBD 3W9DA 1H3GA 5J1TC 2H26A 4RFOH 1FZOA 4NBXB 4NM8L 4UINH 5D1ZD 4P5TC 2V2WB 1ZTXL 3DPBA 3AY4A 4NZRL 2HH0H 5F7MC 3VXUB 5IG7A 1VSCA 3RQ3A 1FG2A 3QB7C 2JJWA 5I16A 4BKLA 1IKNC 1INDH 4KJPC 2ORBL 3CZFB 3O3DB 5D72H 4N8VG 1YYMH 1BD2A 4X6DB 3E3QE 2RR3A 3OHXB 1RJZA 4YDIL 4WJ5A 1BWMA 3N0PB 5HHQA 2Z8WC 4JM4L 4OIBA 3QUXB 3ZE1E 4BQCA 4LAQH 5T1KA 5CLWA 2F74B 3ARVA 1RK0B 3OJDB 4YHNB 2VLJA 1U36A 4XGZA 4Y4KC 2H6PB 3HR5A 4UQ3B 2WV3A 2GJ6B 1JPSL 2DI7A 4PY8I 2J8HA 4XPBH 3OAUH 4EEEA 2C3XA 2YEZB 5IMOA 3KVQA 4U7KA 4O58H 4JFEE 4DOHB 1CE1L 3WD5H 4LVNC 3W0WD 4Q2ZB 4EN3A 4J4PD 2YD8A 4KC3B 5KSAA 3MXWL 3WNMA 2Z8RA 3RUGA 4KDTA 4OCWH 1TQBC 3HZMA 3STLA 1QFUH 4PRHD 3IB4A 1RQ5A 1RZFH 3LS5L 4UBDD 2VUOA 3W9DB 1FL5A 2H26B 2CLZA 3CVIL 3G6DL 1QG3A 3MLSL 3C60D 2OZ4A 3FFCE 3QQ9C <