4F80A

Crystal structure of the human btn3a1 ectodomain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
213
structure length
209
Chain Sequence
b'QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGGVSCTIRSSLLGLEKTASISIADPFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Butyrophilin subfamily 3 member A1
publication title The molecular basis for modulation of human V(gamma)9V(delta)2 T cell responses by CD277/Butyrophilin-3 (BTN3A)-specific antibodies
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 209
sequence length 213
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f80A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f80A02
2HMIC 3AGVA 4Y89A 5DVMA 2Y36H 3QIBA 4IOIA 5GHWH 3EYSH 1RZGA 4XP5H 4HKBA 4UTBL 4F7CA 4YXKL 3W2DL 2LE9A 1NCWH 2AGJL 4BK5A 4ONFH 4ZFOA 4YGVA 2E7HA 3L1OH 3AC0A 4F2MA 5J0BA 4FTVD 4XP6H 1BIIA 1MI5D 4KJQC 5LQBL 3MRCA 5F7HA 4NO0D 3U48A 4QRUB 3WS3B 1A6AA 1EPFA 4OFIA 3V9FA 4YIQB 1IAIM 4NWUL 5FFLA 1YY8B 4TSAH 4KTEL 3MRJB 2GSIB 1PJ9A 2DIJA 2OJZH 2YN3A 3HUJF 1N64L 1RUAL 3JVGA 3CZJA 2DYPB 3MACL 3KJ6L 4DEPB 1ETZB 1EFXA 2ADJB 4XC1L 1C12B 1GZQB 1BBDL 3IU3B 4YQXH 1CWVA 2WINA 1QFHA 4HD9A 3C09B 2IALA 4MSWB 1LK3L 2HFFA 4NP4H 3TZVD 2HT3C 4F7PB 2FX7L 1U42A 3QIBD 4YHML 1HXMA 2CRMA 4CADA 1GXEA 2ZG2A 4OF0A 1J11A 3MBEB 3RA7L 3BW9B 3GO1L 1SYVA 4TSBH 5CZVL 5CIPB 1F4YH 5HI5D 2EIEA 1FGNL 3C5ZC 3TEUA 3OKEB 1A6PA 4ALAH 3DXAD 4FFZH 4NFBA 12E8L 4L4VD 4O58H 1A1MB 4C54A 1FLTX 4LCYA 4M48H 3SY0B 4TNVF 1D9KC 1MCCA 1I3RB 1QA9B 1E4XL 4LF3B 2FWOB 3VXSD 2YD3A 4LHQB 1DBJH 4M7KL 4NQDE 2B4CH 1RZ7H 5IVXF 2EH7H 2VQ1A 2CLRA 4ZFOL 3QQNA 1EVUA 1EFXD 4QY8B 2CMRH 3N1FC 5ANMB 2FSEB 2AJXH 1U8HB 3KPSE 1LDPL 2R2HB 5FYKE 3UBXG 1OARL 5D71L 5C9JA 4G8IB 1OCWH 4JZJB 5CSZB 5C0AD 2ATPB 1VFBB 4EI6B 4P5KA 1F2QA 1WAAA 4WW2C 5FUOH 3NVQA 5CSBA 3FTGB 1XF5A 4S2SB 5CHNB 2YUVA 1EO5A 5EULV 1EA9C 3VXUA 4EUPA 4WRLA 3VFRA 1G7HA 3TA3A 2VXQH 3UDWC 4ZTPH 2WP3T 3HB3C 3REVB 1P7KB 2CRIA 2F9BT 3PP4H 4X98B 1T83A 3VMNA 2LTQB 5LAXB 3PDGA 4MQSB 3B5TA 4Z78A 4HF5H 5AG8A 3GI8H 3CZFB 4GXVL 2ZPKL 4CMHC 1QQDB 3N9GH 4RAUA 1CFTB 1OD7A 2E8YA 1CYGA 1I1FA 2AABH 4NN5B 1F8TL 3P9LA 2MQCA 3PQYA 3VGEA 4BQ6A 5FUCE 4X0KA 3OKMA 4X6EA 5JOFB 5E9DA 5JQHC 3PWPA 1P6FA 3IFNH 3OAUH 4P5TA 2Y1VA 4BSVB 1VESA 1Z9SA 4ELKB 2YRPA 3ARDD 3EO1B 3LKRA 3PL6C 5DHYA 3TN0B 1QSEA 3FHAA 4JHBA 4KHTH 5DJ6A 4NO3B 4X6DB 4TN9A 5JPNB 1MCLA 2PR4L 2D9QB 3IDNB 3MV01 1S78C 2DM3A 4LNVA 2R4RL 4HC1A 1MWAA 3WO3B 5DSCA 3QI9C 5DHVH 1JPFA 3VXUD 3D85A 2DDQL 3O3DB 3GHBL 4GW4B 1YEGL 4FQPA 5E00A 2IGFL 5D7JA 2NY1D 4M6NH 1FORL 1KCVL 1CLZL 3BVNB 5F7LB 4TPRH 4YR6A 2V2XB 3MLVL 4Q0XH 3RU8H 1LO3H 4E42B 1TIUA 2H9GB 3EJZD 4Y16C 2F53B 4R7DB 3ESUF 2PO6C 5KANI 1BWWA 3VFNA 3VXME 2CH8A 5LGKA 3O8XA 4PP2A 4P4RA 4GT7A 1GHFL 5E9DD 1F6AA 2OZ4L 4B5EA 3PWPD 4CDGC 3QDME 4PJ7A 1JZ7A 3ZE2E 3BZ4B 4P5TD 1MLBB 4EIGB 5FOBA 2WM0A 43CAA 3MLSH 1NGZB 4TUKH 3QXAB 3S5LA 1PKOA 3QUMH 5LKNA 4GW5A 5IB2B 3QFDA 1WBZA 5EUOB 3LMJL 1A9EB 1QSED 4WWKD 1M7XA 3KHOA 2BNUB 4LLMB 1CF8H 4D9QD 2XZCL 1YUHA 5F1NA 2GUOA 2XY2A 2BVOB 3D85D 3CX2A 4U6XB 5GSRA 1H3WM 1NFDE 4J1UB 1KIRB 5D7JD 2DM2A 4PGEB 1GIGH 3VWKA 1BP3B 4PBVC 4KRPB 4EN3C 5IHZA 3T04D 1ZEAL 5K9QG 3L3HA 4XP9L 4HIHB 4IMLB 3E0GA 3P9WB 2RJMA 1GGCL 4JN2B 5KS9A 1TNMA 4I3RL 5E2WH 2NXYD 1FIEA 3O4LA 4GKSB 1DBAL 1O7SA 1SYSB 4LBEA 3UTPE 3O8XD 3U36A 5HHXL 4XP4H 4QCIB 4LHUA 3QXVA 5EWIL 5GGVL 4FXGA 1UH2A 3LRSA 4XVUD 2QSCL 3MYJB 2JJWA 1GVIA 3TH2T 1GZPA 4BQCA 2B39A 1TCMA 3O3AB 1BWMA 2EC9U 1OGAA 3O0RH 3ZKMD 5E8OB 4X5XB 4HDIA 2FB4H 1JI1A 3OR7B 2EYTA 5HBBA 4XXDB 4GMTL 2B5IC 5H2BA 1UQSA 4Z7UB 1HILA 5DD1L 1T5WB 4QTHB 1UXWA 4ETQB 2W9EL 2A6KA 5F88B 4DQOL 1AE6L 1BQLH 3BKYH 4PJHF 3EO9H 3TBYB 1MFEH 4WTZA 3OKDB 4UINL 3SGKA 2K3TA 2J4WH 4J3OC 5T1LA 1KT2A 2A83B 3FO1B 4LCCB 3ROOB 2IFFL 3T0VA 1UC6A 3WLBA 1J0YA 4NRZB 3GIZH 2CRYA 4FFWD 1V7ML 3CSBA 5J89A 5KBNC 2R0LH 1QKZL 1MCRA 4YPJA 4I3SH 3O4LD 1EEYB 4QRRE 4X8XA 3IGAB 1T3FA 1T4KA 4NZUH 2P49B 1T6VN 5JA8B 3ARVA 4IMKA 1YEHL 3VFOB 4LHUD 4PJBB 1FCCA 1OAXH 4QRPB 4XCEB 1AD9A 1D6EA 5IFHH 3QEUB 2DQHL 1PAMA 3QXDA 3F8UB 5FM5M 1BVKB 2A9NL 1B9ZA 2VXTL 1CD9B 2NQCA 4MCZB 4ONOA 1OGAD 2HTLD 1MCWM 1H9VA 3QZWB 4M6ML 3WHE1 2WIMA 1I8LC 3DGCR 4Y5VA 1HEZB 2QEJA 4JY6B 5HDQH 1TITA 4NZTH 3AREB 3HPLA 4YUEH 3U7YL 4BSWA 5E6IB 2E6JA 4NBXB 4YEEA 1U8JA 1A14H 4YDJA 5D7LB 4FTVE 1MI5E 1I1YA 3H3PL 5E03A 3H9HB 5ID0A 1YJDC 3C9NA 3DRTA 1R3IH 4UMGA 2X70A 4Z7VA 2NY5L 4XHJD 4LQFH 1A3RL 5T1LD 4APQB 3EJYC 3GSOB 5KSVA 4DVBA 5JW3L 2E7BA 1D6VH 4PRNB 1R3HA 2BRQA 3IJHA 2G75B 3WS6C 3FQWB 1B4JL 4U6VL 3TJEH 1YZZA 3QWOA 1OPGL 5IB1A 2A6IB 3LSOB 4UAOB 5EOTA 1NCBL 4AY0A 1DZBA 2G9HA 5FUCC 3P77B 4H20L 2HA1A 2BOCA 5FA4B 3AS3A 5F1OB 2O61A 4TVPD 1CXKA 4RBPK 5DD3H 1QD0A 4Z7NE 4G7VL 4WY7H 5C70A 3EDFA 3VGHA 5BVPL 1CICD 3KLAA 3L5XL 2PTVA 4QXUL 2V7NB 2IFGA 2MCPH 4QXTB 4HS3B 5MI0B 3ARRA 5J9PB 3MV11 4PJAE 5I1LB 3O6KL 1T1WA 2AK4E 5JNYA 4TVPL 3BHBA 2B0SL 3DXAE 2GTZB 4L4VE 5DGRA 5BW7C 1CGVA 3JV0A 4F37F 5IMMB 1X5ZA 1HWGB 2OYPA 3A6BH 1DJSA 4TRPL 3VXSE 4A6YB 4JANB 2RHEA 3A6CL 1AR2A 4C59B 5EOCH 1RVFH 4ERSH 4ODTL 4XNXL 4Q58C 3P0VL 3K46A 3RWFA 1RI8A 4AEFA 1I7ZB 1QYGL 3GJFH 5ITBH 1MCKA 2H32H 1K4DB 4HJGA 5CFHA 5L2KA 4L8BB 1BFOB 5C0AE 4Y4FB 5B3JE 1EGJL 4PJ9B 1N26A 3HR6A 4HPYL 1CI5A 1MIMH 3PGDB 1LNUB 3PIQA 3PABA 1CFNA 1QEWA 4EDXA 6CGTA 4RRPA 2H41A 4EXKA 1YEFL 4G8FB 3WYRA 3GNML 3C5ZA 4CRPA 3EJJX 5F3HA 2YXMA 3QUZB 2FR4B 5IGXH 1TZHB 5C8JB 3D39D 4WI7A 4P3DA 4ONHA 2ZZUT 4LASL 5LG1A 4OLVH 3IAPA 1OGTB 3SN6N 1D9KA 3F7YA 1IGTA 1I3GH 4EI5C 3REWA 1Q9KA 1PVHA 4F58L 1YC8A 3IAGC 4ZTOH 4PRPD 4U1KB 4MA7L 4YHZL 1U8PB 3IRZA 4WFEE 2HLAB 3T0ED 3V4PH 2BHYA 4WI5A 4S0TD 1ITCA 1K9TA 4MB4A 1IAOA 2ICEA 4MZ3A 4NRXB 5DWUL 4ZFZB 3SGJC 5FO9B 1LO2L 5L2KD 1DQJA 2DF3A 4IRSA 5I8KL 4M8VA 3OBAA 4JFDB 4BQ8A 3D3VB 1G9MC 4LEOB 3B43A 3UYPA 2G5BB 1MELA 1IL1A 1CFQB 5F7WC 1MRDL 5CP7B 4OT1L 4OFYA 4R26L 5FO8A 1K2DA 4HEPG 5KOMC 1Z9LA 1ZTXH 4KGLA 4J3SA 2F74B 1KIPA 5KVGH 3UDWA 5HI3D 4JY4A 1R24A 1R3KB 3I6GA 2YD9A 1WZ1H 3SDDC 3CFCH 2VXSH 1INQA 4G6FB 4BFIB 5B22A 3RY6A 3C8DA 1P2CB 1BZ7B 3GSVB 3MRFB 2WUBL 3SJVA 3M17A 4CVWA 2OL3H 3UCRA 2R0ZH 3R8QA 4KK8C 3A0OA 3VDAA 3WXVH 4Z0XB 1BQUA 2NR6C 3QCVH 4ZUVB 3FO0L 2PYEA 5HYFA 4HUMB 4ZFFB 2VDOH 5JR1L 4KUCF 4NPYB 2YPLA 1KCRL 4XNMB 3HAEH 4KAQL 4JO2H 4M4RA 4GJTB 3VFUB 3L6FB 4IRSD 4O02H 5JORB 5FECB 4NM4L 3WIFB 1NGQH 4F15C 4GH7B 4MA1C 1HHGB 4ZS6D 4PJDE 1J8KA 4NQEB 1MJUL 5FCUH 5E2TH 4G9FD 4PY7B 1R5IA 5EBWA 3RNQA 4HWEH 2XQYK 4JKPL 5ADOH 5C2BH 4D9QE 4I4WA 1UT9A 1FFOA 1QUNA 3VCLB 4PTTA 4HMDA 1QLFA 2PUQT 2KPNA 1BD2A 3I3DA 1YEDA 4N0YL 1CLYL 4X4XA 1R0AL 3DRQB 2J88L 4X9HA 4JHWH 3ZL4H 1NANI 1JJUA 4H8WC 5C09B 1A1OB 4OCRL 1FL3A 4OLWL 2BMKB 5HYJB 4HKZA 1N6UA 2PN5A 3L7EB 5MHSD 4B53A 4QF1B 3JWDC 4I48B 3C5JB 2AXHA 3SGEI 2PO6A 2PYED 4U3HA 1FZMA 4JGMA 2R0WL 3GSQB 1F3JB 2PW1B 1FO0A 2YPKA 2YPLD 4OZGF 1KGCE 3RVVD 3S96A 3ZKND 3E6HB 5SX5K 2C26A 1LD9A 4ZFGL 1TNNA 2GT9B 1H3VA 1JGDA 3G5VA 5C0ND 3PHOB 2GTWA 1DN0B 4PLOB 4PJ7E 1CBVL 3FCTB 3QUXA 3TZVC 3GB7A 5DXWA 1P4IH 3VFPA 1N0LA 3BP7B 2GAZA 1OAZH 1GH7A 1KJMA 2N56A 1FYTA 4C58B 2VYRE 3F5WB 1MAMH 3L5HA 4OQTH 3TYFB 3GMRB 4GBXA 3VRLE 1NLDL 5JXEC 2VZSA 5FOJA 4BH8A 4XC3L 1JRHI 1BD2D 5ESAB 3BKMH 3ARWA 1G1CA 3X11B 4LSTH 4NYLB 2D2OA 2DIBA 4QHNA 2DM4A 2LAAA 3P4OB 4LDLB 4U1HB 1UXSB 1X6NA 1KLUA 2DQEH 1I85C 2CO7B 4KHXH 4M93C 4D8PB 4R4BB 5HVWA 1A7NL 1NSNH 5KS9E 3BZFA 3FJTA 1RZKH 2WAHA 4PGJA 3GMPB 5CD3B 4K8RD 3TNNB 3CXDH 1JPTL 3T0AA 4PJ5B 4NQVA 3KYOA 1V3JA 5TFSH 3MJ7B 2WK2A 5DMIL 4MNQB 2O5XH 3CPLB 4NHUA 1NCCH 3RIAF 1WF5A 1WUNT 1R5WB 1DFBL 3K80A 2J8OA 3QUXD 4JFHD 3MCKA 4QRQA 1DVFB 4NQCA 5F44A 3TO2A 5E5RB 3M8OL 5E8DH 1JV5A 3LH2L 1FYTD 4ZYKB 1PZUB 2X89D 5TE7L 4DZBA 4KMTH 1RJLB 1B0GB 3CDCA 4GBXD 1JHTB 2W91A 1FFPB 1M7DB 1TMCB 4DGIH 2G2RB 4FZ8H 3ZSTA 5L6YH 4P46B 4PPTA 2Q8AL 1U3HC 4PP1C 5FM4A 2QR0B 4ZUWB 1CE6A 3W11D 2DJUA 3EGSB 3X17A 3G08B 4BH7A 2EXWD 1LVEA 3OB0K 1M6OB 1Y0LA 5CWSA 2EXYD 4F7MB 1ZT1B 4P9HH 2QSQA 5HHPA 1ZGLA 5BJTB 4OSUH 3HNVH 1R6VA 4DGYH 3DVNA 2DQJH 1SEQL 3QEHB 2CIIB 4D2NA 3ARGC 2ED7A 5EO9B 5J3HD 1W72A 1A21A 5L9DH 3O4OC 2ESVE 1JWUB 5C08A 2I5YL 4OFDA 3HI1B 5DJ2A 3SQBA 3VH8A 1CGYA 2XXCB 3AU1A 4I0PB 5TE6L 1LE9A 4EKXA 4TVPE 2XWTB 1JHKH 4WWID 4KKBD 1TJHL 1UWXK 2CKBH 4U2YA 3V0WL 3IU4H 4U1NA 4PRBA 1KYOK 3KDMA 3VWJB 1I8LA 4N8VG 2O5YL 4KTDH 3ARDC 1U8QA 2IADB 5GISH 5D9SB 3ULUE 3I84A 4GG6F 4G80B 5F70A 2NY0C 5BS0D 2CPCA 5ERWB 2QLVB 3LIZH 4P2OC 2UYLB 3ZTNL 2UZIH 4L9LB 1M7IB 2QL1A 1ZHKB 2R4SH 1OQXA 2RB8A 3NFPB 1S5HB 3LVEA 2BSSB 1MCPL 1VFOA 3IFLH 2IH1A 5DD6B 5SWZA 4PJ8A 1EBAA 4F8TA 3WS6A 2AP2A 3N1MC 4XVSL 1G7IA 1MLCA 4P57A 4NJAL 3L5WA 3MNWA 2X4TA 3GI9L 3OR6B 4RFNB 2HTKC 3CDYA 4QWWC 4LARH 1G7QB 1HKLL 3MJ6A 3UXFA 5DC4B 3DMMC 1P84K 5IHBA 2QQKL 4L9DA 1Q1JH 4MNHA 4OZ4A 4WWKC 3JZ7A 1TJIH 1YEEH 3RX5A 3HZVA 5EU6E 5CJXA 3OJDA 1W72L 4OLEA 1L7TL 4FQCH 2P43B 4P2RA 5E94B 4JFEB 5EFIA 5ENWA 3D39E 3STZA 3UYOD 1Q72H 2IQ9H 1G7PB 4TOYH 3SDAD 3H2WA 4JRYD 5GGVY 3OPZL 1DLFL 3VXNB 1D5MA 1M71A 3LEVL 5GGQL 4L3CA 4G9DA 3TWCH 3F6LA 5SWZD 3Q0HA 2ZOKB 3FONB 4ZS7L 5AWNH 4F7EB 3RGHA 5IKCB 4OBRA 1TVDA 4PRPE 4GQ9L 4Y4KB 5DD0L 5I8EA 3K74B 3PG2A 3T0EE 5GIRB 4HUWB 4CJ1A 1RUQH 1DQTA 3QJHA 4HULB 3DLQR 3BYYA 5EC2B 3S37L 5MERA 1P6AB 4WNQA 2UWEF 1MNUH 5IFAH 3O2DA 2IJ0C 2DBLL 4JN1L 5E4EC 1FGVL 3CUPB 2JCCF 5C0DA 3ZE0F 3CCHB 3KPLB 5HGDB 1U95A 5JMOC 3EYFA 2AV1B 4JAMB 4P2RD 4FQXC 4LVOC 1QFWL 1JHLL 2BRRH 1ZGLP 2FLBT 3Q1SL 3FO9A 2OJEB 1QRKA 1DEEA 4HEME 4HX1B 1P84J 4QRSB 5F1SA 4OLXH 2VH5H 4RMRA 2Q7YA 1P5UA 1F97A 4O4YL 3UP1A 5EZLA 4WO4D 3C6SA 1N4XH 4NDMA 1WT5A 3CH1B 6FABL 3EFFB 5F6IC 1YEIH 3AB0C 3V95A 1FNGA 1N8ZB 4TTDD 1L4IA 4L4TA 4CU7A 2Y72A 1DQDH 3VW3L 1TENA 4HWBA 1EAPA 3MNZA 4U4BA 3TIDA 2BERA 3KYNB 4PJCF 4XP1L 4TUOA 4XCFH 4GRLC 3VA6A 3HC3H 1IVLA 4WV1B 4NUGL 1OTTD 5FYJH 5I66A 1RULL 4LPTA 2FJFB 1IKFL 4YPGB 5J12C 1NMBH 3L3JB 1HH6B 2LVCA 3IVKB 1CGXA 1A2YB 1RU9H 3O3BA 3U9UB 1ORSB 3T4YA 2R39A 1T7VA 2VLRB 2DLIA 4G9FE 3OXRB 5J11C 5D93C 4GUPA 3J7HA 3P4LA 3NGBC 1B6UA 3OZ9L 2D4FA 3F7QA 4OLYL 3DIFA 3ARFA 5IFJA 3MBXH 2I07A 3KPQA 3SKOA 3U30B 4I2XB 4UT9L 5EBLB 5I1CL 3QHZH 4HZAA 4O2FB 1HCVA 1KPRA 1FN4A 3GSRB 2JELL 4K3DL 5D4QA 5CINL 5DZNA 1FVCA 4OIIL 1FSKC 2H2SD 1K5NA 4YHIA 3D9AL 3EYQD 3GIVA 4XMPH 4Y4HD 4K7FB 1SBSL 3HMWH 2JTDA 1U41A 3IJYA 5I9QB 3MV8B 4XPHL 1FV1A 3IF1A 4WUUD 1JFQH 1MF2H 3MLTB 3S35L 2HFGH 4V2BA 3HE7B 4P23B 5HDBE 5SWSB 2HVJA 2VIRB 1A7QL 2KKQA 3KXFB 4BM7A 2PXYC 1HQ4A 3TV3L 3MOBH 2R1YA 1NCNA 4HWZA 4UV4H 3U1SH 2CDFA 4X6CA 3K8LA 4L8SC 3DNKA 3LS5L 3QQ4A 4X7SL 3KPPA 4R0LA 4PGBB 2MMXA 4I77H 3MSPA 3ULUC 3UJJL 1O0VA 3MRBA 5EU4A 5C6PB 4UQ3B 2PTUA 1OP3H 3ARFD 2DKMA 5HY9A 3VXTB 2H8PA 3MV9D 3NIFF 3QUKB 4HK3J 1AGCA 4MVBD 4ZAKA 2NW3A 4PJIB 5IT2H 2VNCA 5KVDL 4PRDB 3QA3A 3HZKA 1CFSA 3NPSB 1PSKL 1MPAH 4OCYH 2NX5B 5HYQA 3RIFK 1H0DB 5INCB 5ISZE 4AJ0A 4JCMA 3QIUD 1K6QH 3KPOB 3HC4L 1J9CT 4L29A 1BJ1J 1LO5B 3BPCA 3GMNB 4HIEB 5AEAA 5F21B 5IB4B 1CN4A 1QSZA 3G04A 1MHPL 4LSPH 4WFGE 3SDXE 5K9KB 2J6EA 5KSBA 4FXKA 3MFFB 2NY6B 4R96A 1NBQA 5I8OL 3NTCH 4D0CB 4JFHE 4K71B 3UMTA 4H26B 1XGPB 1XH3A 3GSWB 1JGUH 2AJ3B 1YNLL 5FO7A 1FYTE 3BWAB 3DBXA 4OB5H 5E5MA 1T1XB 2DOCA 2X7LB 4UILH 3ZTJH 4ZXBB 2BCKB 4DKAA 1KBGL 3VFVA 4PREB 5IBTL 4CJ0A 4UB0H 1LGVA 3LEYH 3QQ9D 1GGBH 3VE0A 3BEWB 1AIFA 2I9TB 3I2CH 3RWEA 2HVKB 5DRWA 1E4WH 4XCYB 5TDOB 1P9MC 3EO0A 3GJEB 1PKQA 5I30H 4OV5B 3MMEB 1XFPA 3UBXA 2A0LD 2XG5A 4OZIB 1EERB 2ZUUA 3FFDA 3FQTB 1FDLH 1SJVA 1ZLWH 1OAQH 1FL6A 4UUJA 2KZWA 3WJJA 1OSPH 2WQ8A 3BUTA 5E2VH 1QNZH 3HC0B 1N0XH 3HG1B 4ZUUB 3LB6C 4ONGL 2MCG1 1A0QL 4QOKB 2CGRL 5FYKH 4F33B 5BOZG 2HFEA 1LE5B 4FQHB 3BD3A 4WW2F 4UNVA 5ILTL 3O6LL 3ZSSA 2R2EB 2YK1H 1YPZE 3DSNA 4HIJA 5BS0E 4KKNA 4YBLB 1U3HA 5A43C 2WV3A 2J6EL 2F5AH 3GSNH 4D0BA 3C8KA 2X1QA 4MX7A 3SCMC 1KJVA 4RISH 5J6HB 2PCPB 5C6TH 3RNKB 1JNNH 1WEJL 5E8PA 1IC4L 3BGMB 3MV7D 2RBLA 4P5MA 4L3EA 1PX4A 5ACZA 3GDBA 1EMTL 4PJEE 1GOHA 4XT1C 1Y6KR 4Z7WE 2DTML 5DJ0A 4AENB 3BXNA 3FB7A 3ESVF 3AAZB 1RD6A 1CGSH 3LS4L 1A4KB 3U0PA 4NIKB 4JG1L 4Q6IB 2J1KA 3NN8B 3BH9A 5D7IB 1S9VA 3LCYA 2OBGA 2WP3O 3PV6A 4OZHF 3RDTC 1WIOA 1TZIB 4WDIA 5DQDL 5HGHB 2A77L 1DL7L 2NY2D 2QQLL 2DKUA 4PD4K 2GKIA 4IOIB 1MCEA 4ZS6C 3PNWA 3RVXD 4MGXA 1QBLL 1AGFA 2DQTL 1EHLH 4HKBB 5L8JB 4F7CB 2AVGA 3WFEL 5T5FH 4HZLA 4P2OA 1TJGH 4KY1H 4YGVB 5I8CB 2NLJB 1XGUA 1L0XA 2AJSH 1BIIB 5DMGC 5EUKA 4Z9KB 3MRCB 2IPKA 5LCVL 2ZCKH 3P30H 3VU2A 1A6AB 1NLBL 4LSRH 3KYKH 3BT2L 3V6FA 4KK9D 4JRYE 4WI4A 3SO5A 1KJ2H 5D2LB 2Q86A 5DFTA 1OAUL 4R4NC 4L3ED 1KG0A 5SWZE 2AV7A 1CDHA 3C6LC 5BV7L 4MCYA 1FLRL 5IBLD 1FNSL 2VTFA 3MGTB 5KZCD 2VZ3A 2WINB 3PDDA 1FFRA 3HFML 3DMMA 1EAJA 2IALB 4M3JA 2XTJC 2HFFB 2IAMB 4NZRH 4WTWA 5ICYA 3P0YL 5TE4L 1HXMB 4CADB 3WN5A 3NACH 4HHAA 2EDNA 1FIGH 4ODSL 1SYVB 4GAYA 4R2GD 2EDYA 3WFCL 3BH8B 4IDJL 3DUUA 1NAMH 2DQDL 4P2RE 5MEND 1AKJA 2CUIA 3RX8A 4U3CA 3FN0H 2EICA 4BQ9A 1YY9C 3G6JE 4PD4J 1AJ7L 2WNGA 1KXTB 3I85A 4LCYB 3HNTL 1XGRA 3NFSL 4LL9A 3HI5L 2VSDA 4IRJA 4HXBL 1ACYH 4ZNEE 4P3WA 4N0FA 2VQ1B 2CLRB 1Q0XL 4XBEH 1DANU 3EYOA 5F7DA 2FGWH 1JI2A 3CVIH 5GRVK 4G7YH 5EIIA 3U6RA 3TM6A 4GRWE 5C9JB 1YQVL 3GMLA 1F3DH 4GFTB 2VDML 4LVNC 1D5BA 4X99A 5HHVH 3CC5A 4P5KB 5D2NA 4OF6A 5I1AA 5KVEH 1MRFL 5TJWK 3LN4A 3T77A 1ZVHA 5TQ0H 2A6DA 2VLKE 2APXA 4FQXA 1XF5B 2KL6A 3BN9D 3MUGA 4V1DB 4IHOA 4EUPB 3FT3A 3W0WA 3ZYIA 1G7HB 3FQNA 3TA3B 1A5FH 1YEKH 4EQ3A 1OVZA 1BEYL 3BD4A 2NY3D 4JB9L 3UYRL 3K3QA 3ZYJA 4Z7QE 3QJFB 1DBML 4OBSA 1S7UA 4Z78B 2EXYC 2F15A 4RAUB 3V0VA 1MJJA 2PF6A 2FEDD 1I1FB 3QFJD 4GRLA 3QG7L 3ARBA 2E27L 3E2HC 4OZFH 1CD0A 4O2CA 4WUUE 3P9LB 1OOAA 2A1WL 3PQYB 3S7GA 5HYSA 4UTBH 1F3RB 1MOEA 3OKMB 5EZJB 2A73A 5E9DB 4YXKH 3WNPA 2OQJA 3W2DH 4OFPA 2AGJH 2Y7QA 3MRNA 3TYGL 4KROB 2AJYH 4FQJL 4HAGA 5LQBH 1CL7I 2D03L 1WBYA 1P1ZA 1BBJB 3LKNA 4GAJH 1QSEB 4OD1L 5DJ6B 4DKEL 2C4XA 4XPAL 1P7QA 2JE8A 5D1QA 4M5YL 4KTEH 1MWAB 3DYOA 3N0PB 5HHOA 3NCJL 3MV9E 5DSCB 1A02N 1IT9L 1JPFB 2CK2A 1INEL 1I9JL 2HH0L 3WD5L 1RUAH 5D7JB 3U46A 3MACH 3KJ6H 5EOQL 2Y4SA 4XC1H 4OGZA 3VRJB 1BBDH 4YR6B 1OLZA 5A16A 1QO3A 1T1ZA 3MOAH 1LK3H 2NXYB 4LLQA 4JM2A 4N0UA 3EFDH 4G8EA 2FX7H 5DZOA 3SEPA 4MAYA 4G42A 4UZGA 4YHMH 3VFNB 3QO1A 3JWDH 3O8XB 2VZOA 4PP2B 4WHTA 5DQ9A 3RA7H 3SO3B 4XBGA 1KCKA 5J13C 5CZVH 2ED9A 3D0VA 1AHWA 1T66D 3QIWD 5FOBB 1FGNH 1IGYA 3S5LB 1KOAA 2XQBL 3GRWA 4OJFH 3NFNA 4GW5B 3QFDB 1WBZB 3VXRE 2X40A 1NMCB 12E8H 2DLFL 1PYWA 3TBWA 1BLNA 2A38A 1E4XH 5F1NB 5HHOD 2GUOB 2XRAL 2GJ6E 4M7KH 5GSRB 5C0GA 1C5DA 4ZPTA 2FHBA 3VWKB 1CXIA 5EN2A 3SDAC 5IB5B 5DDHA 5IHZB 1LDPH 2Q7NA 1OARH 2R0KL 3L3HB 1NCUA 4L8DA 2JF1A 1K85A 4FQ1L 4JM2D 2GY7B 1FBIL 3O4LB 2YSSA 1NGYB 5L2JA 4MAYD 1ZSDA 4LBEB 3U36B 4FXGB 3LRSB 4I18B 1Z6JT 4ZOCA 5F7YC 1GZPB 4BZ1L 1KIQA 5I1GL 3GMOA 3PUCA 4CN4A 3MGOA 4HDIB 1MJ8L 3W9EA 4YEFA 2EYTB 4FP8L 1YMMA 1UQSB 3O6MH 1HILB 2PW2A 1BZQK 1UXWB 1MHCA 5IWLC 1NC4A 2A6KB 5KSAC 4GXVH 2ZPKH 5D7SL 2NPLX 5C07D 1WZLA 1WLHA 4LIQL 2E8ZA 1NFDF 1P9MA 1SJHB 4M5ZH 1F8TH 3MV7E 3WLBB 3T3ME 3QEQA 4YBQD 1ZWIA 4QGTA 5I1DA 3LDBC 2PKDA 2B8OT 4XWOC 4NGHL 1JGVL 1T3FB 1T4KB 1LILA 4ODVL 1T6WA 1X4XA 2BNRE 5E99L 2VDKL 1VEMA 1KSRA 3RTQA 4JDZA 1AD9B 2R4RH 4JVWA 4GG8A 1GGIL 2EEAA 3QXDB 5EO1A 3MLUL 2FL5A 5T3ZL 2VISA 2EIZB 3WS3A 3GHBH 1VENA 1YEGH 1FORH 3AY4A 4YIQA 1KCVH 1BIHA 1CLZH 2W9LA 3HPLB 3MODL 2VLJD 1OAYL 1EIBA 4DTGL 3Q6GH 1U8JB 4A2MA 4YDJB 2J8UA 1NC4D 5IVZB 5ID0B 3C9NB 3DRTB 3U4AA 5DS8A 2X70B 3VRIA 4LDEB 2J7LA 3ILPA 3L3DB 4JKKA 5DJCB 1LP9E 2DI8A 2E9WA 2LQRA 5KSVB 4DVBB 1NKOA 1GHFH 1HN1A 3ARUA 2OZ4H 4M9OA 1IEHA 3UJTL 2AAVA 5HI4C 1R3HB 3IJHB 2XOTA 1CTOA 4GSDL 4DCQA 3NCYS 1TXKA 1YEJL 1V7NH 3QWOB 4PGCA 3DX8A 5IB1B 5EOTB 3TH4T 5HHMB 3BPLC 4PBXA 1KB5B 4JCLA 5D70H 2G9HB 5CGYC 4PRHA 3QT2A 5SWQA 4M1CC 5E8NA 4H1LH 2O61B 2XZCH 1KLGA 4WI9A 2P46B 3FT2A 2XTLA 1BQHA 5I6XC 3OKEA 3QEGL 5JZ7D 2EDWA 1FFNB 4AYFA 4B7LA 5LGJB 3SY0A 1QA9A 5MENE 2VJXA 4U0QB 4UOW0 1ZEAH 1ZA6A 4WEBL 4CVZA 1T1WB 4XP9H 4MVBC 4HWUA 5JNYB 1GGCH 1JN6A 2JK5B 1U6AL 1F5WA 3QRFM 4QY8A 3STLB 1DE4A 1EZVX 4KZEL 5ANMA 3V6OA 1ZT7B 1VADB 2R2HA 3MJGX 5HHXH 4M61A 5EWIH 3MLWL 5GGVH 3PP3H 3C6LA 2AJZA 2QSCH 3QIUC 1JTTA 2ATPA 4GLRH 5GZND 4LCWA 1PW3A 1CE1L 5DJXB 5KSUA 3RWFB 3MBED 4PRHD 4WCYL 3RUGE 5L2KB 4HJGB 5AUMA 2F5BL 3MYZA 2AXFA 3G6AA 5GS2D 5DD1H 5CHNA 4S1QL 1RMFL 3ALPA 2W9EH 4PS4L 4DQOH 1AE6H 2V9QA 4KKLC 4Z77B 5AZ2L 4C57C 3CH8A 2R1WB 4WU5A 2WSKA 2P24A 3B83A 3TBTB 5GGSA 1A7PL 3T65A 3PIQB 5HSFA 4L5FH 3PABB 3HE6C 1CFNB 1QEWB 4EDXB 1S9KC 1UG9A 2IFFH 5JTWA 3CZFA 3C5ZB 4JHAH 1V7MH 1QQDA 4KRMB 5F3HB 2H1PL 3RVTC 4PJAF 1QKZH 3QAZC 3Q3GB 1JK8A 4P3DB 4ONHB 4EJ1C 2B7DT 1IKNC 3P0GB 1K3IA 5DK2A 3LQAC 1D9KB 3F7YB 1QBAA 1IGTB 3VXPB 1XIWC 1RK0A 1YEHH 3REWB 2DRUA 3T0WA 5I17A 3HKFA 3H9ZA 1PGRB 4D0DA 3BI9X 1ZVSA 3QFJE 4OQ1A 4ELKA 4WFHD 2APVA 4M6MH 2ZCHL 5JW4R 3T2OA 2WBWB 1DQJB 5DJ8B 2VL5B 4IRSB 4FG6C 3CLEL 4CAGA 5B3JF 5F6HI 3H3PH 2CXGA 4HS6A 2IANE 1CQYA 2NY5H 3MXVL 1JYWA 3NCBB 1A3RH 1IC7L 2YD5A 5FO8B 5GZOC 1K2DB 4XWGL 4QXGL 1KIPB 4NFCA 3CVHA 3KYAA 2H9GA 1R24B 4S0SD 5D72H 3UEZA 3I6GB 3T8XA 4ZDHB 3IFPA 4XTRC 1B4JH 4U6VH 1DBBL 2EE2A 1INQB 1EUUA 1OPGH 3BD5A 2GEEA 2VAJA 4OV6F 4ZUTB 3SJVB 3M17B 3RI5K 3RX7A 4P4KC 4H20H 3OXSA 5CJBA 5C86A 2PYEB 3FQUA 4N8VA 4G7VH 2P7TA 1B0RA 2W0KA 5BVPH 4RIRA 3EAKA 2YPLB 5D8JH 5EUOA 4HIIA 3TN0D 3L5XH 2GCYA 5IBUB 2QQQA 4LLMA 5DQJA 2AJUL 4QXUH 1RZFH 2P8PA 5I0ZA 3JUZA 4OF8A 4LFHG 4ZSOA 4P3CL 2BVOA 3O6KH 5A2IH 3PL6B 1XZ0A 5GS0C 4TVPH 4KK5D 5B39A 3TCXA 4AEHL 1B90A 1R5IB 5EBWB 3RNQB 3T2PA 3GKZA 5DVLA 2NTFA 3KLSA 4I4WB 1RJZA 1FFOB 5ESVA 2APTA 3QI9B 1X5GA 4PTTB 1QHOA 3HMXA 4MS8C 5CLWA 4HIHA 1BD2B 1XT5A 4IMLA 4TRPH 5CMAA 4P49A 4JQXA 1FPTH 3A6CH 4KJYA 5CKGA 2F53D 5JW4M 4GKSA 5D96B 2MQ0A 4P2YA 5GRVL 3TT3L 4PJFA 4ODTH 2FIKA 4XNXH 3P0VH 1FJ1B 3D48R 3BUYB 3FB5A 4KK9C 4LGRB 3QP3A 4E41E 4JDVB 1FL3B 3F7VA 1QYGH 1JNLL 4EVNA 1G6RB 4HKZB 3ZHDA 1MVUA 3QWRA 3GBNL 3MPCA 1EGJH 5IBLC 2PO6B 1E4KC 1FZMB 2W1NA 3EOTL 2RR3A 3P4MB 4HPYH 3CVHL 4X5XA 1FO0B 1AFVL 2YPKB 7FABL 3CFEB 3MRLA 1LD9B 3DURA 5DA0B 1JGDB 3G5VB 3UTTA 1HYRC 2GTWB 1FNLA 1YEFH 3QUXB 1LO0L 3IDXL 3GNMH 5F88A 3RBGA 3QPXL 1QRNA 3TBYA 5A2FA 4ZNCD 3KHQA 4U1SA 3UTSE 1KJMB 5D5MA 4HS8H 4PJDF 4LASH 4K2UL 5A2KH 3ROOA 2C7UA 3H3BC 1P4BH 3DO3A 4R2GC 5B8CC 4FMKA 4NRZA 4KUZL 1ZHBA 2YS4A 3FFCE 3RKDD 3WHXA 4M3KB 1SY6A 4W6WB 4F58H 5D6CB 5C07E 4MXWL 4QHNB 4YHZH 4LSSL 2ORBL 3T4AA 1JNJA 3UPRA 4YBHA 2E7LA 5T3ZE 5DWUH 2RFXB 4QRPA 1LO2H 4ODXB 4UNTA 1OP3K 3QWRD 5I8KH 3QEUA 3BZFB 1CGUA 4AQOA 4AK1A 3O6FA 2P5WA 4NQVB 2JLLA 3KYOB 1QFOA 3IKKA 4O2EB 4NHUB 3AREA 1H3UA 1BFVL 2ADIA 4OT1H 3EHBD 3HZYB 4B0MM 4R26H 2BVEA 4LMQI 1NCAL 2C4FU 2Y9RT 4PJ7F 2BVTA 3MCKB 3TO2B 4NQCB 1QRND 3HN3A 1JV5B 4P59L 2B5IB 2EDEA 3FZUC 4HBQA 1SJEB 4DZBB 3GSOA 3F58L 2VLJE 1TTGA 5D7KE 5DJYA 2NYYD 1TFHA 3VRLF 4N5ED 3K8KA 2G75A 3VD7A 3LN5A 1CLCA 3FQWA 1CE6B 4HUKB 4RWYL 4BH7B 5JR1H 1F02I 1CDGA 3AROA 1Y0LB 1KCRH 3BQUA 4LSVL 4KAQH 3BPOB 3LOWA 5HHPB 3NH7L 1ZGLB 4MD4B 4QRPD 4UIMA 4OUUA 5JPMA 3IDJA 1JYXA 2W9DL 2FEDC 4NM4H 4W4NA 4XGZA 5C0RL 5KS9F 1SY6L 5KW9L 1T89A 1MJ7L 3LY6A 5D1ZC 1MJUH 1N3NB 2B2XL 2P5WD 3H7LA 5C08B 1U58A 2IG2L 2V7NA 5DJ2B 4JKPH 3VH8B 2GHWB 3ARED 3OKNA 3AU1B 1LE9B 3RWJB 3OX8A 3WIHL 2YA2A 5E6ID 5J9PA 2VDPH 4Q2ZA 4XNYL 1WTLA 5D7LD 5HD8C 4U1NB 4PRBB 3RAJL 3S5LG 2K9UA 4N0YH 1CLYH 5EU5A 1R0AH 1U8QB 2J88H 1EFQA 1ZLWK 1ADQA 4HUNB 4DN3L 1CDCA 5FM5O 2EIDA 2DLTA 4OCRH 4Z5RA 4OLWH 4JANA 3V52L 5JIIA 3O2VH 4XVTL 2MWCA 3KVQA 2VQUA 1JUFA 2YXFA 1J87A 1I1AC 4XMKL 4DN4L 1S9WA 5FHBH 1Q9LA 2CK0L 2HT2D 5C71A 4L8BA 4PJ8B 1G7MA 1CBVH 3VFMA 1G7IB 1MLCB 1NBVL 4P57B 2ADGA 2DI9A 2HT4C 3MNWB 2EDQA 1JPST 2X4TB 3MRIA 1PLGL 4MMXC 1S7TB 1BF2A 4MXQC 1IC5L 1RFDH 1H3PH 4ZOAA 3L7FA 4KJPC 1NLDH 1T66C 1QSVA 2X4RB 3QUZA 4XC3H 4CGTA 1A3QA 1RZ8A 4WFFD 4F9LC 4HSQA 4FRWA 4MNHB 2YMXL 4TSCL 2J5LB 4UDUA 1S7WA 1YMHA 4OZ4B 2XV6B 3TIEA 3ARTA 4KKCD 3TO4C 3HZVB 2MTPA 2YPVH 2B4CC 2P8MA 2HG5A 4ZOEA 1K8IB 4JJ5B 5EFIB 1I8KA 2OCFD 5ENWB 3OF6D 4XNZB 5I73C 1A7NH 4JDTL 5I1KL 3GSXA 4EDWL 3KGRA 5I0DA 5E6ZA 1A8JH 4Z7VF 1JPTH 4ODWA 5ANME 5DUPH 3S88L 2WMPA 5DMIH 1DP0A 4L3CB 4G9DB 2XACC 5EPMA 3DO7A 3BDYL 1AR1D 1WZMA 2D0GA 1Q9WA 1DFBH 4WFHE 3M8OH 4A6YL 4HCRA 2G5BA 4I13B 1M4KA 4HQQL 1INDH 5K59E 3LH2H 4PJGB 3A67L 2EIBA 3QDMB 3I50L 5MERB 3QUZD 4WNQB 1VERA 3FQRA 2Q8AH 3IJSB 5J1AA 1S7SB 3HE6A 4AH2B 4ESKA 2FO4A 1U95B 1IGJA 3GSVA 1BZ7A 2ENSA 2WLYA 4CU6A 1N59B 3T0DA 4WGWB 8FABA 5I19L 1DEEB 4Z0XA 4GRMB 3AM8C 1SEQH 1A6ZA 3CSPA 2Q7YB 2FO1A 5EZLB 3C6SB 4NDMB 1CLOL 3QG6A 25C8L 2VXVL 2I5YH 3KLHD 4LEXL 1FNGB 1C5CH 5TE6H 4XX1G 1ZLSL 4L4TB 5B38A 5FECA 4JFDD 1TJHH 3V0WH 1L7IH 3WIFA 1EAPB 3MNZB 3D3VD 3V4UL 3D0LB 2O5YH 4TUOB 1J7VR 4TUJA 3S34L 5E56A 4X6DE 3ARQA 3SDCA 5I66B 4OAWA 4M02A 1I4FB 4POZC 1WIUA 1OTUC 1DN2A 3ZTNH 2VE6A 5I1EL 1E4XI 3O3BB 1C5BL 4MLIA 3T4YB 3U4EA 3DRQA 4MXVE 2VB5A 2FD6L 4FZEL 4GUPB 3FB6A 1CFVL 4ELMB 1MCPH 4HCRL 4YWGL 4KTYA 3DIFB 2OS7A 5IFJB 2LU3A 2I07B 3KPQB 2DICA 3SKOB 2C3VA 3U9PL 3SDDB 3C5SB 4I48A 3C5JA 3RVUC 2F53E 5DURB 4XVSH 2YZ8A 5KAQF 2NW2A 4NJAH 1F3JA 3MRRA 1KPRB 1FN4B 4XMLL 3GI9H 3CU7A 3S35X 3VD5A 2ZSWA 5TPWL 3E6HA 4N9GA 3ECBB 5J06A 1FVCB 2GT9A 1DN0A 1HHHA 1HKLH 3O41A 4YHIB 3GIVB 4DK6A 2M8XA 2QQKH 5CZXC 3TBSA 1A6WH 4DAGH 2I26N 4QRRB 3KNBA 1ZAGA 3IAQA 3IJYB 2ZUQB 3RWHA 5EUOE 1FV1B 3IF1B 4R6UA 5CEZD 2X05A 4P2QA 2HVJB 1AO7A 3TYFA 3GMRA 1HQ4B 1W72H 4S10A 4HH8A 5J57B 5EU7E 1L7TH 4W4OA 2R1YB 1Z5LB 3D25A 3QDJA 4HWZB 4RGOL 3UZEA 5I1HH 5ESAA 5ICXA 1NUNB 2CDFB 2P45B 4X6CB 3QQ4B 9CGTA 4R0LB 2EECA 4DFHA 4HPOH 1TZGH 1J18A 5C09D 1HOCB 3OPZH 3MRBB 4GXUN 1DLFH 3B2UD 3DOSA 5HY9B 5CEZL 1KN2H 3LEVH 2H8PB 3WBDA 4C56A 3CFBA 5IVXA 1AGCB 1JZ8A 3DI2B 4ZAKB 2NW3B 4ZS7H 5I18L 3DVFA 3X3GL 3GMPA 1AQKL 5CD3A 1C1EL 4DEPC 3HZKB 3MNVA 1CFSB 4GQ9H 4QT5A 4X4ME 3B2VL 5DD0H 3TNNA 4CUCA 1W0VA 3DETD 4LNRB 1W2KT 5CJQL 5HYQB 2APFA 3MJ7A 4JPWL 5HGAA 3CPLA 4AM0A 4LOUD 2YA0A 3GHEL 3VGBA 4IOFC 4HJ0D 3C09C 5IEHA 1E4KA 4L29B 4ZQKA 5M95B 1F3DJ 2J3SA 4G43A 3BPCB 4K9EL 5H8DA 1L0YA 2DBLH 3G04B 4JN1H 1FGVH 1P53A 2F54A 2OM5A 1N5YL 1S7RB 3MBEC 1YYLL 3GKWL 5KSBB 4P2QD 4R96B 3PWLB 4ENED 3L3IA 3E8UL 4G6AD 1XGYL 2Z8SA 4Z7UE 5HDBF 2J12B 4N0CC 4YX2L 2DBJA 2WUCH 1JHLH 2R23B 1X9QA 5F96L 2QR0A 1XH3B 4Y2DC 5FO7B 1F4AA 3DBXB 5E5MB 4O4YH 2WWMD 2CLZA 1GPOL 4J3XA 4NM8L 4PJXB 4RBPH 4F7MA 5DJZA 3VFVB 1WC7A 2ED8A 2BX5A 1Q0YL 1FL5B 4JQIL 1T03H 3VW3H 1AIFB 1W8OA 2MHAA 3RWEB 5EO9A 4FNLL 4XP1H 4MHHG 1KC5L 4RGNC 2KUTA 4QYOA 3EO0B 1PKQB 3TLRA 3JWNC 3UBXB 4NUGH 4PJBE 1RULH 4LP4A 2PETA 1IKFH 4QRPE 5KJRH 1X5YA 3FFDB 5DRNB 1KCSL 1GAFH 1GC1L 1DVFD 3KPNA 3VWJA 1I8IA 2E9JA 5IF0A 4MAUH 4UUJB 3V0AC 3CFKA 4Y5YC 5T1KB 4X5LA 5IBUG 4G80A 1BJMA 3SDXF 3OZ9H 3MZGB 3NCFB 4OLYH 1TVHA 3N1QC 2FJGA 2BHUA 3KPTA 1MCOL 5D7LE 2I9LA 4P46D 4UT9H 1MCQA 4S1RL 2CDEA 4GRWH 3S4SG 2HFEB 1A6UL 5I1CH 4PLJD 1OL0A 3RRQA 1S5HA 3W39A 2YUZA 4MNGB 3ULVE 2JELH 2LTQC 4JFPA 4K3DH 5CINH 4HIJB 4JR9L 2EKJA 3W5NA 4OIIH 5HVHB 5MEOA 1U3HB 1HSAB 4D0BB 1NL0L 3C8KB 4MX7B 3MQIA 5GGRA 3D9AH 3K8MA 1I1CA 1T0PB 4YXHL 1SBSH 4EBQL 4NN5C 1K4CA 4PYHA 4GLRI 5E8PB 4XPHH 3RJQB 1J5OL 3S35H 3QR2A 1DQLL 4L3EB 5ESQB 4I0PD 4FQ2L 1A7QH 1G7QA 4OD2A 3IDYB 2OXHA 3TV3H 5DJ0B 2VLMD 1QR4A 3BXNB 1EX0A 3VWJD 1MAJA 5D1ZA 3LS5H 3O4OB 1PQZB 5KZCB 4X7SH 2XYCA 4OD3L 2ADFL 4UOJA 3C60C 4O5LL 3BH9B 1S9VB 5E94A 4JFEA 5HHQA 1QSFA 4WDIB 4WFFE 4RX4A 3Q48A 5KVDH 1Q9OB 1AGFB 4KK5C 2BNQA 3BWUC 1PSKH 4IM8A 2NY0B 4HZLB 3K81A 4P2OB 2ZJSH 1YPZF 1XGUB 3RP1A 3ZKSD 3HC4H 3GMMA 4KK6D 4LLVA 1I1AA 1OQOA 1HQRA 5IEKA 5DUML 1YDPA 4D9LL 2Z31A 1MHPH 5GIRA 2XXMB 4D9RD 1KG0B 1MCNA 2AV7B 4QRTA 1V3MA 2HP4A 2W65A 4YHYB 4PJEF 5I8OH 5EC2A 4MCYB 3ES6A 4Z7WF 2YD8A 4XAWL 3TJHD 5EBGA 1QPXA 3T1FA 3CUPA 2R2BA 4S1DC 1TLKA 1YNLH 5EZOL 5INDA 3BPNC 5HGDA 4BJLA 2B1AH 4X4YB 1BJ8A 3DMMB 1NEUA 1WFUA 4B50A 4YXLL 1KBGH 1Q8MA 3OAYK 4PV9A 4KI5E 4JFED 4X8JB 2R1XA 5IBTH 5ICYB 1QSFD 4HX1A 3ZTJG 4RX4D 2BP3A 3EYSL 4X4ZA 5IROC 1KN4L 3B3IA 4M7LL 1YN6A 2BNQD 4NC0B 1B0WA 3CH1A 3E1F1 4UBDC 2AEPL 2HWZL 4KRPC 3DUUB 1AKJB 3RKDC 2I27N 5JDJA 4L8CB 4JFFA 2VITA 4FQLL 4Y4KD 3KYNA 3GUTA 4K7PY 3O11A 2RQ8A 2OR9L 3WL9A 3BFOA 2G60L 4XPBL 2ICWA 1CXLA 2OJZL 1DEDA 5IK3A 4YHLH 4IRJB 3UX9B 3V6ZA 4RSVA 4ONGH 1A0QH 4JFDE 5IV2A 3D3VE 4N0FB 2CGRH 3V5DB 3MJ9L 2ZP0T 1AXSA 4JLRA 3U9UA 1ORSA 5F7DB 3OXRA 2BVUA 4C83A 5EIIB 3TVMA 5ILTH 3SBWC 3O6LH 5MEQA 4FA8A 2VZVA 3NIFE 3GMLB 4J6RL 2EDTA 1NGXA 3D87B 2P5EE 4LLWB 2NY4C 1ES0B 5E4EB 3NZ8A 1D5BB 4X99B 3CC5B 4HGWA 5D2NB 5I75B 4O2FA 1ZT4A 5SX5H 3GSRA 3T77B 5CKAA 2N7AA 1WEJH 2YD2A 1IC4H 2A6DB 2APWA 4FQXB 2D0FA 3L95B 2Z91A 3MUGB 4NC1E 1EMTH 5E1AA 3FT3B 3W0WB 1FVEA 3MA9L 3FQNB 3TPKA 1TQBC 4HMCA 2DTMH 4X9BA 1BREA 4P0DA 4M7ZC 1HHIA 3PWNA 5E8EA 3LS4H 1X5XA 2X1PA 5F6IB 2ZG3A 3AB0B 5IW1A 4OI7A 4JG1H 2VXUH 3KXFA 3SDYL 4XRCA 5T1MA 3V0VB 1BZ9A 1MJJB 2EH7L 1NGPL 3D6GA 4LAQL 4GRLB 4YH6A 5DQDH 4XVJH 2A77H 1DL7H 3ARBB 3GSUA 1FZKB 4NQEE 3RQ3A 5K9JL 2VLRD 5DHVA 5CEZE 1QBLH 2DQTH 5DLML 5HYSB 3C08L 5JO5A 3TVMD 2A73B 3WFEH 1WCQA 2QADB 2DIAA 3WFZA 4WUKH 2Y7QB 1NH6A 4GRWF 5AG9A 3MRNB 2XPGB 2W60A 3GZKA 4ZO7A 5ELIA 2GI7A 4PJIA 1WBYB 1P1ZB 3NBNA 3LKNB 5J11B 5D93B 5LCVH 1GSMA 1NLBH 2QSVA 3BT2H 4APQC 2NX5A 1P7QB 5C09E 5D1QB 1J1PL 4POUB 3ULVC 3H8NA 1OAUH 5HYJE 1EEZA 4U1MA 2AW2A 3RWIA 3WDIA 1OHQA 5BV7H 1IARB 2FLRT 3U46B 5A1AA 5IMOA 3GMNA 2EDOA 5IB4A 1HXYA 2FECL 3RWGA 3MV8D 4CKVX 5FAAA 5A16B 1QO3B 5DI8B 3HE7D 4F57L 3GI8L 4P23D 4Z7QF 5A3ID 3QUMA 3RFZC 3HFMH 3KXFD 1T1ZB 3CMGA 4Q6YA 4D0CA 1IGIL 4N0UB 1SVCP 1HHKA 4JM2B 2BXZA 3O9WC 4G8EB 4WHCA 5FV2A 3VI3F 1XGPA 4G42B 5D1XA 1T7ZA 5TE4H 3QO1B 3OB0H 1Y6NR 5IVNA 4WHTB 5DQ9B 2HLFD 4ODSH 4XBGB 4H25B 2PXYB 3D0VB 3WFCH 4IDJH 2FDBP 1AHWB 2BCKA 2DQDH 4PREA 3RL1A 1WVZA 1T21B 1CU4L 2WBJC 1V5JA 1IGYB 4JKMA 1O7VA 2HVKA 1II4E 1OP5K 4XCYA 1AJ7H 2NX5D 1PYWB 3TBWB 3HNTH 5DFVD 4R90L 1BLNB 1AH1A 1UWXH 3NFSH 3HI5H 3FQXA 1DQML 4HXBH 3OMZA 5F9DC 4RFEA 5C0GB 1GOFA 1NANH 4M6AA 1C5DB 4TQEL 4ZPTB 1Q0XH 5BVJA 4PJ5E 1DANT 5EN2B 4WI8A 2YD1A 3OKKA 5CGMA 4MNQE 2YA1A 1J1OL 3S36X 2NY6D 5DA4A 1YQVH 4QOKA 4L8DB 4Y4FC 4K94L 5CJ8A 4DUVA 4PJ9C 2F58L 2VDMH 2XZZA 4F33A 2YSSB 1ZSDB 3EZ8A 5D1XD 4OCNC 4MD5A 1MRFH 4JO3L 3BGFC 4YNYA 1UM5L 3NCMA 2X42A 4G8GA 5KVFL 5DO2D 4KI5C 3GMOB 5GJSL 5J6HA 3MGOB 2O93L 3RNKA 1AGDA 1VKXB 1BEYH 1SMAA 3UAJC 3UYRH 1YMMB 1DBMH 2PW2B 2HJKA 2VLLA 4FMFA 1MHCB 1NC4B 2X4QA 4PLKC 3UJIL 1JF1A 3RWDA 1X3DA 1X5AA 1BM3L 5DUBB 1I3UA 4JVPA 2E27H 2V5YA 1GCFA 1S7XA 2N1KA 2CJUH 2YWYA 3MO1B 3E3QE 1MCBA 3QEQB 3HG1D 3BKCL 2X5PA 1OWRM 4QOKD 5DVNA 5I1DB 2VLME 3TYGH 4KZDH 3VG9B 4G3YL 1F90L 4FQJH 4P2CG 3KR3L 2D03H 4XCCL 4Y5YA 1T5XB 5C0JA 2Y6SD 2FZ3A 3BO8A 4OD1H 4PUBL 2AS5M 3DSFL 4DKEH 4XPAH 2C3GA 3RTQB 2JJTA 4O51B 4JDZB 4PRIA 4GG8B 2VWEE 3ZDXE 3NCJH 2NLJA 5I8CA 1IT9H 5EO1B 2FL5B 1INEH 2VISB 1I9JH 2HH0H 3WD5H 2DAVA 3PJSA 4JGUA 5EOQH 1KTLA 2BDNL 4RDQG 2DQFA 4XB7A 2NZIA 3L9RA 5D2LA 4M7JL 5FGCB 3SCMB 2J8UB 4FOMA 4MJ5B 5AD0A 5DS8B 3BAEL 1RHFA 3VRIB 15C8L 4OZGA 3ILPB 2XKNB 4OM0L 4EQ2A 3MGTA 1QBML 4D9RE 2HYMA 3RZCC 4JFYA 4CNIA 3T3MF 2IAMA 3W9DA 4DCQB 4BFEA 4NZUL 4PGCB 3KWWA 1KEGL 3DX8B 2R2CA 2XQBH 1C16A 4BK4A 4PRHB 3QUYC 3BH8A 5SWQB 1A22B 5E8NB 1IFHL 5IFHL 4PRID 4JFEE 1KLGB 5B4MC 2LU4A 3DX9A 1ONQA 2XRAH 4HAFA 3FT2B 1BQHB 2APBA 4IRZH 5C0CA 1IQWH 4NZTL 3HI6L 4ODUA 4LSDA 5JXAL 3AVEA 2IF7A 1ZA6B 1S7VA 4CVZB 2R0KH 1RUPL 1R3JB 4BQBA 1JN6B 3BKJL 3GJFA 1EUTA 2YHGA 4LQFL 1FBIH 1DE4B 3IDGA 4JHZA 4Q9RH 1LP9F 4M61B 3C6LB 4LOUC 4LFHD 3S36H 2AJZB 1CDUA 5C2UB 5I1IL 1BJ1H 5DYOA 4HJ0C 2IAMD 4BZ1H 3MJ8B 4NT6A 4LCWB 5DEFA 1QVOA 5KSUB 3VXQB 4FQIL 1OM3L 3MCLH 4YK4B 1MJ8H 3LQMA 4FP8H 2XZAL 4WI6A 5AUMB 2XTJB 1K3ZA 2XFXB 3BP5A 2AXFB 3G6AB 4V1DA 2VDRL 5D7SH 2O26U 4NKDA 4WU5B 2P24B 1JPSH 3LRGA 3F6IA 5GGSB 3T65B 3DHJA 4X7FC 2Y06L 2GITB 3QJFA 5C92A 2Y23A 2DI7A 1UCBH 4LCIL 5CS7A 3AMKA 1JK8B 3RHWK 2C9AA 1NFIA 1ZKAA 5I74C 4NOBA 1N5AB 3DV6A 1JGVH 4OCXH 5DK2B 4ODVH 1RK0B 5EZJA 4UDTA 4XAKD 2HFTA 5I17B 2JJSA 4RFOL 2IPTH 1ZLUK 4LMQE 2XNAB 1GGIH 1RVFL 1ZVSB 2Z9TA 5D6DA 4D0DB 4ERSL 3NIDE 1DVFC 1OAKL 5T3ZH 1BBJA 1VGEH 2VLRE 4GG6A 3H9SA 1DDHB 3FO2A 3MXWL 2M26A 4R9HA 1MHHA 4JG0L 3PWVA 3MODH 2DWDA 1T0MB 2G5RA 3RUGF 1OAYH 3WJLA 4DTGH 4V1DD 4XNQA 5TH2A 1S9YB 4I2XE 4NUJA 3EW3B 3IDIA 1UZ6E 1PX3A 3TA3D 4HH9B 1MIML 1H3TA 4DGVL 1HZHH 4HS6B 4LLDA 2EYSA 1U8LB 3B9KC 1JMXA 3SE4C 3VRJA 4Q74A 3MRHA 2B1HL 1MRCL 1KPUA 3CVHB 3HAEA 4N90D 3T8XB 3IFPB 4GSDH 1ODAA 1YEJH 3MV8E 1I9IL 5J4MA 4M7LT 1I3GL 5FGBC 3PQYD 1MEXH 1TCRA 5SWSE 3RJDA 3SHSA 1Z3GH 3E3QC 3H6JA 3KXFE 1AGEA 2LU7A 3OXSB 4UTAL 3HCVB 4MA8L 4KROD 3E2HB 3FQUB 4N8VB 2P7TB 1B0RB 1QFWI 3QEGH 1KLFA 4RIRB 3H9SD 4HIIB 2GCYB 1R3LA 3VGFA 1U92B 5DQJB 2CD0A 2P8PB 1WICA 1YQ2A 4ZSOB 5JW5B 1AGBA 2VWEC 5FKAA 2K7PA 2ENYA 4PJIE 4L9LC 3P40A 1XZ0B 4C4KO 1U6AH 1FAIL 5B39B 1IM9A 2C5DC 2NX5E 4KZEH 5IB5A 5T33L 2NTFB 1RJZB 5ESVB 2FH8A 5ID1A 3MLWH 4F8QA 5CMAB 4Y1AA 3B9AA 4KJYB 3F12A 1MWAL 4HC1L 2GJZA 3PGCA 4KK6C 5GGRY 1NGYA 4PJFB 1CE1H 2FIKB 4DFIA 1H15A 3FB5B 4OGAC 3G9AB 2C1PA 5EA0L 3MCG1 1K8DB 4KMQA 5ICZA 3F7VB 4GS7C 4IS6A 4RFNC 4WCYH 4I18A 4EVNB 4TNWK 1FNEA 1MVUB 2UWEA 3O9WA 3QCVL 2QHRL 4S1QH 1RMFH 4OQTA 3DUSB 2JCCA 2A2QT 4PS4H 5AAMA 1J8HB 3TJHC 5AZ2H 5IB3A 3B5HA 4X83A 1WFNA 2A9ML 3WCYA 4U6HB 3MRLB 3DURB 4I9WD 5GPRA 3UTTB 2QBWA 2W0FA 4AEIL 1KFAL 1VPOL 2LAGB 1QRNB 5JOPD 3H9YA 4NQTA 5CIPH 1QZ1A 4NBYB 4U1SB 5D5MB 3CIQA 3IS1X 3VWKD 1SJHA 1MIEL 2C7UB 1I1RA 1E0OB 2BVYA 1ZHBB 3LEXA 4LDOB 5F7KC 3D2UA 3WHXB 1TQCB 5BCAA 4OZIE 4PJCA 1I7UA 4KKAD 1XEDA 4Y4KC 4JHWL 3T4AB 4M00A 3UPRB 4KDTA 3NCYP 3STBA 2ZCHH 2ZCLH 3HG1E 3FN9A 1H5BC 1S9XA 4M62H 3BN3B 5KOVC 4QOKE 4M9PA 3CXHK 2YD7A 1L6ZA 3CLEH 5FUZL 2EIZA 4U6YA 4JZOA 5CBAA 3O6FB 2P5WB 3BSZL 3UTOA 4KXZH 4YHOL 5HYSG 5CILL 1IC7H 2ADIB 2DWEA 3F65A 3G5XA 2VDNL 1G9NL 2DLHA 4QXGH 4XWGH 3VFGL 1P4IL 2D7OA 5IVZA 3GFUA 5EO0A 1AXIB 3DHMA 1F13A 5CBEA 3L3DA 1DBBH 4FFVC 2Z8VC 5GJTH 1C7TA 2CR3A 2DM7A 3EKCA 5DJCA 5EBMA 4IIQA 3MRQA 4UQ2A 5DJYB 1UWEL 3ZMRA 5KSAB 2NZ9D 3ILQC 1OT2A 3HPJB 4GAFB 5SV4A 4GMSL 3LN5B 5IESL 3CJJA 3G6JB 4GQPH 4E0RA 2CKBA 3WNMA 2OSLA 3LKQA 5BZDA 1KB5A 1MQKL 3BQUB 1DQQB 4WV1C 4AT6A 1MH5A 2AJUH 1J0JA 5D7IE 4UIMB 4OUUB 1RY7B 2VUOA 4HMEA 4FABL 5JPMB 2F8OA 3IDJB 3RIFF 3CK0H 4XGZB 3I3BA 1T2XA 1EXUA 3NMEA 4XXCC 3WXWL 1FFNA 5ALCH 4LRIC 4WHDA 1U58B 1T7WA 4AEHH 1NUFA 5LGJA 3OKNB 4LSQL 5F7FA 2XKSA 3OX8B 4AL8L 2PYFB 4Q2ZB 2DJ4A 5C0BA 3U30C 1CVSC 2F8XC 3CXHJ 2JK5A 1JZ6A 3RVWD 4QHMB 5EU5B 3TT3H 2D7NA 3STLA 4KMTL 1WITA 3ZT6A 5D2LE 1ZT7A 1VADA 1KEML 3RY4A 4DGIL 4Z5RB 5L6YL 1NDMB 1J0IA 1JNLH 5TDNA 2FX8L 4LRNL 1XR9A 2IMMA 3GBNH 4Z7OE 4ORGA 4HUXB 1PD6A 4R4FL 1JUFB 2JKXA 4WHYG 5BRZA 5DJXA 3EOTH 1CFBA 1PZ5B 3PHSA 5HHMD 1S9WB 1AFVH 2H2PC 7FABH 1Q9LB 3RZCA 1N6VA 3T3PE 4P23C 4U6TA 2GY5A 3K4ZA 2Y5TA 1G7MB 3G6DL 4YDVA 3VFMB 1LO0H 3IDXH 4FXLA 3QPXH 2ADGB 4Z77A 4NO2A 5L9DL 2R1WA 3BPLB 5L0QB 3MRIB 3TBTA 4HIXL 3QUYA 3U4BL 3WKML 3FL7A 2VSCA 3P73A 3L7FB 4KUZH 3S3SA 4UT7L 1KB5L 5CP3H 1RIVL 2D31A 1RZ8B 4KTDL 4Y19A 1BFTA 3Q3GA 3DVGB 1JMZA 4UDUB 3C8HA 4MXWH 1MREL 1S7WB 1YMHB 4L1DA 4LSSH 2IPUG 3TIEB 2ORBH 1BAFH 3CDGB 3VXPA 4K94C 2P8MB 2HG5B 3TFKD 3ARXA 3PWUA 1I8KB 4AIZB 5SX4H 3OGCA 1X5LA 3GSXB 4ODWB 3UBXI 4LPXA 4N1HB 5FHAL 4XAKE 1BFVH 3OAZK 2ITCA 2NY6C 5EPMB 5DJ8A 2VL5A 3SPVA 3DO7B 2HT3D 1KELL 3NZHL 1Q9WB 1NCAH 4BFBD 2GSGA 1DUZB 1FE8L 2C4FT 1MCDA 1WWCA 4WW2A 1OW0C 3GEWB 1WAAE 5DMKA 4J4PC 4P59H 1Z2KA 5IHLB 2MKLC 4ETYA 2FNBA 5DC0A 1LDSA 1U3YA 3GBML 4OLUL 5JLZA 3F58H 3RGVC 1VGKA 4ZXBC 2Z8WC 5CZKA 3VXUE 2DQIL 3C5ZD 4HUUA 5DO2C 1J88A 3FQRB 4Q9CA 2AXJA 4Y19D 1P5VA 5J1AB 3CMOL 2I60L 4ZDHA 4HUVB 2VAAA 4KRNA 4MJIA 3HE6B 1YEEL 4RWYH 2FO4B 3R8BB 1D9KD 4PY8J 4S1SL 1HSBA 3WLWC 4OCSL 1IGJB 3BZDA 4FQCL 5JHDA 4ZUTA 2X6MA 4FS0A 4LSVH 1U8MA 3NH7H 3QAZB 8FABB 3RKPA 1MCHA 4LKXA 4N90E 5KAQG 1A6ZB 2W9DH 2BHZA 5IW6A 5KW9H 4HV8B 5J56B 1MJ7H 4OTXL 1BX2A 3BRFA 3PQYE 3QG6B 2ZKHL 3CD4A 1AQDA 1U8NA 2IG2H 3G5ZB 5E9DE 4JPIA 1BOYA 3PWPE 4OZHA 4Y5XC 3TNMA 4LPWA 5B38B 3WIHH 4XNYH 3S4SA 1JZ3A 3PL6A 3RAJH 5F9JB 2P44B 5DR5L 2NY7L 1QSEE 4TUJB 5JHLL 2XN9A 3SDCB 5K59F 1VA9A 4F3FA 4OAWB 4OFYD 3QO0B 3QI9A 5I71B 2FJHB 2YEZB 4OF5A 3ZE1E 2BC4A 4ZG1A 2GQHA 5IJKC 4YBLC 1MNUL 3V52H 3OKOA 2VE6B 4NRYB 3HB3D 4XVTH 5C7XL 4JJHA 1NCDL 4HBCL 1BQHG 1G7LA 3NCCB 3U4EB 3B9KA 2IH3A 3FB6B 1FJ1A 3BUYA 4U1GB 1G7JA 1MFBL 4ZO8A 4XMKH 4K3JL 1RK1A 3H7BA 3HUJB 4JDVA 2BRRL 2CK0H 3SJVD 1G6RA 3NCEB 2C3VB 4Y16A 1F4WL 3ULVH 4OLXL 5L88L 1YC7A 1L6XA 1NBVH 3P4MA 2NW2B 5FGBA 3MRRB 4ODHL 3HR5A 1PLGH 2ZSWB 4N9GB 4P4KB 1DSFL 2NCMA 3CFEA 1XGTB 1IC5H 4F80A 3FB8B 3KPRA 1DQDL 3MUJA 1HHHB 2UZYB 3EDEA 4NHCH 3O41B 1SVZA 4N5UA 3TBSB 1FZJA 3PL6D 3KNBB 4CBPA 3RWHB 3QIBC 3V2AR 1IGFL 4OF7A 2YMXH 4TSCH 1IGML 4I9WE 2BNRB 1S78D 3B5GA 4P2QB 4GW1A 1AO7B 4X6DF 5JIKA 4PLNC 3QI9D 1CL7H 5HI5C 3QDJB 3D25B 5ICXB 5D6CA 5JOPE 1X5HA 4JDTH 5I76A 1X5KA 5I1KH 4EDWH 4EN3A 4MXVF 4OUOA 5K9QI 2YC1A 2EYRA 1VSCA 3N06B 3S88H 1HK6A 2RFXA 4YDLC 4C56B 4ODXA 3CFBB 5IVXB 4Y16D 3QHZL 5IUSA 3BDYH 4OKDA 1TTUA 3JVGC 4JRXB 3RBSA 3O4LE 2PO6D 4XPGH 3MNVB 2YR3A 4QT5B 4A6YH 1KCUL 1W0VB 3S8WA 3KPMA 5SV3A 4HQQH 1LWRA 4XZUA 5HGAB 3EDKA 4O2EA 3A67H 4AM0B 3HZYA 4DVRL 5IEHB 4O00A 4ZQKB 3I50H 1OGAE 1G6RL 4G43B 1JFQL 3HRPA 2ZUSA 3X3FL 1FP5A 2F54B 3QCTL 1SJEA 1UA6L 4K8RL 5EUOF 1TETL 3L3IB 3H3KA 5IMKA 2D7PA 1FO0L 2O5ZL 3U1SL 5F1IA 1JGEA 4RAVB 5J1SC 1Z9OA 4LLYA 5I19H 1MY7A 2JB5H 4EN3D 5FA3B 3WUWG 2CLZB 1CLOH 1V8HA 2VR4A 25C8H 2VXVH 1J1XL 2OTWA 3MROB 1RIUL 2MPAL 5DJZB 3EUUA 5FM8A 4MD4A 2ARJA 1WC7B 4RMSA 1CDJA 4I3GA 1LEGA 4NQDA 4V2CB 2VQTA 2MHAB 3V4UH 4OCYL 5EZIL 4E5XA 1WZKA 1N3NA 4QYOB 5DJDA 3KPSA 1H5BA 5AZEL 3S34H 3WFBL 3RWJA 3X14B 4MD0A 3VA2C 3HRZA 3KPNB 4NQCD 3ARPA 3IFOA 1I8IB 3OSKA 5IF0B 5I1EH 1C5BH 3CFKB 4KPHL 3T2NL 3ISWA 4M1DH 3GSNA 2FD6H 4FZEH 1BF8A 1CFVH 3LPFA 4HCRH 1XCTA 4NWTL 4YWGH 1MCWW 1TVHB 2AEQL 2FJGB 4Z7UF 2I9LB 3THML 3U9PH 2CIKA 2CDEB 1JGUL 1MSPA 3ZDYE 3WDHA 4Z7VE 2NY1C 5B39G 2EDJA 3W39B 1T83C 2HN7A 4JFPB 5TPWH 5MEPA 1ERNA 5MEOB 4UB0L 1YNTA 4XX1E 1U8OA 5GGRB 1FRGL 5DK3A 3EJZC 5IM7A 1J05A 4OM1L 1K4CB 1IBGH 1BECA 5HHME 4X9GA 4MDJB 1S7TA 1ED3B 1ULVA 5C08D 1KNOA 3MRPA 4LCUA 2AI0L 4PJBF 5BMFH 4OD2B 1FDLL 4P5TC 2X4RA 4RGOH 1QFWM 1OAQL 3OKLA 5D1ZB 1WV7T 4LRIA 4LGSB 3ME0A 1N0XL 2E6PA 5KG9A 1IEBB 2J8HA 1RSFA 1U8IA 1K8IA 4JJ5A 5CEZH 4JFZH 2DLGA 5HHQB 1QSFB 4GAGL 5I18H 1E28A 1EO7A 3BE1L 3GM0A 4U1JA 2A6JA 1KYOJ 3X3GH 5D7JC 5BW7A 3O45A 1C1EH 3EJYD 2D4DA 3B2VH 2BNQB 2P1YA 5CJQH 1PG7W 4JPWH 5T1DL 5IIEA 3ULVF 1XF3A 5DRXB 3U79A 4PJ8D 3JSSA 3GHEH 5FB8A 3V7AE 1ZLVK 2AQ1A 3GMMB 2NXYC 4LLVB 1I1AB 1HQRB 2HRLA 4MB3A 5IEKB 1YJDL 1YDPB 2Z31B 3VXMA 5KANG 1NGWB 4JRWA 4PJGA 1A7RL 3O8XC 3GKWH 1YYLH 4LHJB 5GGTA 3SO3C 1KJ3L 3DX7A 5L2KE 4QRTB 2W65B 1VEOA 3QDMA 4XVUC 3E8UH 1XGYH 1NUDA 4NCC1 3SGDH 4YX2H 4Z76A 3ES6B 1NAMA 3F62A 3IJSA 5F96H 1T7XA 3T1FB 1S7SA 3ZKMC 5HGGS 1CDBA 2R2BB 5INDB 4AH2A 3ALXA 5HHNA 5LJYH 1NMCC 2IBBA 1GPOH 3MGAA 1N59A 4PV9B 4PJHB 3L3OB 2R1XB 1RHHA 1Q94B 2Q8BL 3DVIA 4GRMA 1MFNA 1NFDA 1UEYA 1Q0YH 3QNYB 3B3IB 1YN6B 3TO4B 2Z92A 4FNLH 1KC5H 4EI5A 3V79C 4I0CC 1LEKA 1G6VK 5EC1A 2AJSL 2ITDA 4FFWC 5I73B 4OKVA 4JFFB 2VITB 1UEMA 3OJMB 3RPIA 1DBKL 1KCSH 3KYKL 1GC1H 3FN3A 4PGDA 3GUTB 3O11B 3D0LA 4PIRF 3WL9B 1KTDB 2ICWB 3FT4A 3SGJA 5JUEL 3MLXL 5IK3B 1WWBX 2RGSA 1I4FA 3QDMD 3V6ZB 1KENL 3JWOL 2NY5C 1MCOH 5IV2B 3BP4A 5IMLA 1AXSB 4JLRB 4S1RH 2HTLC 4F9PC 5FCSH 1A6UH 4HK3N 5EG6C 3S97C 4C83B 2X4SA 3TVMB 4ELMA 4MB5A 3RGVA 3FKUS 5MEQB 1QOKA 2X1OA 1T1YA 4JR9H 1E27A 2DD8L 1NGXB 2IC2A 5GGTL 5BXFA 5IG7A 3SDDA 3C5SA 4NFDA 4KI5F 1NL0H 2N7BA 3NZ8B 3UC0L 1EH9A 2AJVL 4HGWB 3SGKC 4YXHH 2VDQH 4XHJC 1ZT4B 4H5SA 4EBQH 4Q7DA 2DKSA 1FC1A 1A1NA 4G5ZL 4EI5D 3O2DL 4BSJA 3SJVE 3ECBA 5IQ7L 1J5OH 2Z91B 3MA7A 1DQLH 4OZFA 4OI8A 4FQ2H 5MHSE 5E1AB 4L4TD 1FVEB 5FIEA 1UWGL 4KH2A 4YO0A 2PYEE 1T80A 2Y07L 4QRRA 1HHIB 3DARA 3PWNB 3UTPD 5E8EB 2YPLE 5ALBL 1MFAH 2GK2A 4NN7C 4OD3H 5IW1B 4IMKC 1NEZG 4Y5XA 2ADFH 1U93A 4O5LH 4XRCB 5T1MB 1HI6B 4UU9A 1Z5LA 1BZ9B 3KJ4B 2Z93B 3BGAA 4XBEL 2VZTA 1FQ9C 4BKLA 3GSUB 1JTOA 4RGMB 2QV2A 1CICC 5DHVB 2Q1EA 4Y5VC 4HWBL 5JO5B 3MLYL 5T5NF 2LV4A 1HOCA 4ZODA 1SEBA 1WTGT 2NNAA 1ROWA 2XKUA 5IJKA 2W60B 4FTVA 1BD2E 1MI5A 3VFWA 1HIML 4NO0A 4K3HA 5HHVL 3SDDD 1OTSD 5MP6L 1FCGA 1UM6L 5GGUA 5DURD 2OI9B 3BDXA 3Q5YA 1G9ML 4TULL 5DUMH 4LNRA 4D9LH 4GKNA 1WISA 4LVHB 3LKOA 1EEZB 4KK8D 4U1MB 4RMWA 2EC8A 4AG4L 3RWIB 5CAYB 2GIYA 5IMOB 4QRRD 5K33A 4J3VA 4XAWH 1HXYB 3RWGB 1NDGB 1S7RA 2GK0A 3BP6B 3PWLA 3B8YA 3QUMB 5H37H 3P3YA 4KXZI 4YXLH 5TGBA 3TC9A 3TZVA 3ALWA 1D5IL 1HHKB 4PRAA 2CDGA 2R23A 4LPYA 1OSZA 3WEXA 3FOMA 2ID5A 2D7TH 3LD8B 1CXFA 5D1XB 3FAWA 4KVCH 4BUHA 3BZEB 1KN4H 3HLAA 4WI2A 4QNPE 4M7LH 1HDMB 5CJOH 4KQ3L 2P4AB 5JXEA 1NUGA 4PJXA 2AEPH 2HWZH 1UB6A 4PJAA 4EOWL 2AJYL 3RL1B 2AK4A 3S9DB 4GAJL 1M1SA 4ZAKD 4Y8DC 4FQLH 1FL5A 4JM4L 2FH6A 3DXAA 1F6LL 4L4VA 2OR9H 2G60H 4XPBH 1I85A 4JFOB 4OFKA 4DOHB 4NQUA 3VXSA 3TFKC 4RAHA 2XQYG 3FQXB 5DRNA 2BY0A 4RFEB 1Y18A 3DYMA 4UIKL 1CG9A 2DQCL 3MUZ1 3MJ9H 1CD1A 5BVJB 5IW3A 3PDOA 3OKKB 2W38A 5T1KA 3T0EC 3MLPA 5DTFA 2CRZA 2V2TB 1KTRL 1N2RA 4H8WL 3MOAL 4QEGA 2UUDH 5C0AA 1NJ9A 5B38G 4J6RH 2XZQL 3EFDL 2YKLL 2A74A 4NQCE 5K9OA 2FRGP 4L4JA 3NABL 3BYTA 4JVUA 4YHPA 3RI5F 3JWDL 1HNFA 1RJCA 1E6JL 1AC6A 4MD5B 3G5YA 1ZK9A 4JPKL 4YHKL 4MNGA 4EXPX 1KPVB 3VMOA 1XCQA 3QXTA 4YNYB 32C2A 5JXED 3R06A 2X1WL 4G8GB 3WFDH 4RWHA 1HSAA 2AK4D 4OJFL 4Y2DB 5HI3C 3MA9H 1VFAA 3MRKB 3IT8D 1AGDB 5CCKH 2WWKT 3U7WL 5ESQA 2HJKB 2AKRB 4K3EL 2DB8A 2HKFH 2VLLB 1W0WA 3VGAC 3SDYH 2X4QB 3ARGA 3AMLA 2GJJA 4RZCA 5HJ3A 1JF1B 1IAIL 1NGPH 1TPXC 3RWDB 4LAQH 4RGNB 3QRGL 4XBPA 1PQZA 3D18A 5K9JH 5FF6B 1S7XB 4NJ9H 5C08E 4NO5A 5T1KD 5DLMH 3C08H 2OMNA 4NN6C 4Z0BL 2FEEL 1X44A 3Q5TA 2EDRA 4IRSC 1URLA 2FIRT 2JB6B 5FGSA 2WIIA 2BVPA 3AS2A 5BQ7A 3ARDA 1B4RA 1A4JA 4Y5YB 1Q9OA 1U3JA 5C0JB 2Z8RA 3WHE0 2FZ3B 3BO8B 1F4XL 2X9WA 5C9KA 2BY1A 1J1PH 1F58L 4PRIB 5HYEA 2ARJQ 2X9XA 1U3HD 2AEIT 4PP1D 4QHKJ 2AK1L 1CGWA 2P8LA 3PJSB 1EK3A 5SX4I 2OZ4A 1ND0A 2FX9L 1KTLB 5C0IA 5F7MC 2DQFB 1QR1A 3L9RB 3O6ML 3RY6C 1N7MH 3IRPX 2BJML 4F57H 4RNRA 2V7HA 1A47A 5AD0B 3ARGD 1IGIH 1A9BA 4QHUA 4H1LA 4G6JL 4OZGB 4WFED 4YDIL 4IJ3B 2Q3AA 2DLEA 4M5ZL 1B88A 3L5IA 2X4PA 3D1MC 1B3JA 3RVVC 1JPGA 1L0QA 3ZKNC 1AI1L 4Z8FL 4JFYB 1A3LL 4CNIB 4X4YA 5J8OA 5C0NC 2ZUWA 3LV3A 4WEMB 4X8JA 1CU4H 3W9DB 4PJDA 3U7AA 3KWWB 1LEIB 4WWKA 1C16B 4D3CH 3C60B 1SBBA 4NKOB 2NY0D 4J23A 2H3NA 4P2OD 4R90H 5DJAA 2R9HD 2ILLA 4L8CA 3DX9B 3KS0J 1ONQB 3ZDXF 1DQMH 3ETBF 2ZSVA 4HT1L 3EBAA 4TQEH 4U7SA 5D96C 5I2IB 1SM3L 5C0CB 3KLDA 4ODUB 5HPMA 4AMKL 3NA9L 3Q6GL 3V4VL 1H3GA 3B9VA 1J1OH 4JO4L 35C8L 4JFXA 1S7VB 4MQ7A 1CXHA 1KIUA 1KUMA 3JTTA 4K94H 3GJFB 1WWAX 2H32B 3V5DA 2F58H 4K8RC 3IDGB 2C3WA 5IOPA 3FOLA 4LLAA 4K23L 3BISA 4PJGE 3HNSL 2HTKD 4JO1L 4YC2B 4QWWD 2YUXA 5DEZA 4JO3H 1LK2A 3LZFL 3DMMD 2DMBA 4U49A 1VFUA 1UM5H 5DYOB 1FVDA 4WW1A 5KVFH 3DWTA 4LLWA 3QUXC 1V7NL 1ES0A 4NT6B 5J6GB 5DEFB 5GJSH 3M1BB 1QVOB 4BZ2L 5D70L 4AZ8A 3BPNB 4WTXA 4PTUA 4LPUA 1XF2A 4QKXB 3S98A 3L95A 2FBJL 3BP5B 4GBXC 1AKJD 4IBLT 3HA0A 1BQSA 3BJLA 4ZUSB 1FH5H 4XNUL 4NKDB 3UJIH 4BELD 2V5TA 2JIXA 4BFGA 1BM3H 3W11C 1OF2A 1E4JA 2BSTA 1G9EA 2EXWC 1U91A 3BKCH 4IRJD 5HTSA 2E5EA 4L4TE 1S8DA 2WBKA 3VI3E 2NXZB 1NFIB 4G3YH 1F90H 1FZKA 3CDFA 3KR3H 5J3HC 3DV6B 2CUMA 4XCCH 4CW1A 1EDQA 1T7YA 3FHQA 1KGCD 2DL2A 4PUBH 3DSFH 4UDTB 1AD0A 3WNLA 4S11A 1A6VL 3WDJA 2XPGA 1VDGA 4KKBC 3SE9L 1PFCA 1AC0A 3T09A 4F9PA 4HKXB 3UTZB 3GMQB 4GG6B 3H9SB 3FO2B 1MHHB 3VG0L 4ELME 1UM4L 2BDNH 4NWUH 3PWVB 3VGGA 2V17L 4OLZL 2DWDB 2V9TA 4FQXD 5JW4N 4M7JH 1BOGA 2Q20A 2NY4B 2PNDA 3B9DA 4XNQB 4NUJB 5TH2B 3IDIB 1N64H 3W0WD 5JMRA 2FYYA 3BAEH 2JIXD 2OL3B 4LLDB 2EYSB 4L5FL 15C8H 2QQNL 3JTSA 4OM0H 4PBWD 4Q9BA 3WO4B 3EOAA 1ZMYA 5DI8A 1UJTA 3MRHB 1V3KA 4JHAL 1QBMH 3BPOC 1TQBB 1KPUB 4LLUA 3HAEB 3SOBL 3VJ6A 2H45A 4M7ZB 2Y25A 4GRLD 3ARBD 3VDBA 1KEGH 2GFBA 2ESVA 3GO1H 4H25A 1TCRB 2PXYA 2QADD 3E6FA 4UT6L 1AGEB 1IFHH 1T21A 4L8SA 1RPQA 4X6CE 1CICA 1OB1B 3NIDF 2XWBA 3C2AL 4WGVB 4R7NA 3LPGA 1WGOA 1R3LB 3I75A 3HI6H 1P7QD 5D1QD 5JXAH 1QG3A 4KJWD 1RIHL 5KN5A 3N85L 1AGBB 5FKAB 1RUPH 1CT8A 4FFYL 1UZ6F 3BKJH 5CD5D 1S7QA 1AY1L 4CU8A 1IM9B 4U33A 2MOVA 4JREB 1EGJA 5DF0A 4N68A 2YBRA 4X7TB 3V5HA 5ID1B 2KQMA 5D71H 2D7QA 2L7JA 4PJ8C 5D72L 5I1IH 4Y1AB 4QLRA 3VFTB 3UO1L 3F12B 1G84A 2GJZB 3PGCB 5TQ2L 5CEXA 5GS1C 4WIQA 1H15B 4FQIH 1OM3H 1UJ3C 1HWHB 2C1PB 2ESVD 4G6KL 5KSBE 5ICZB 2PXYD 4IS6B 3D69A 2XZAH 3ZO0A 1JWSB 1FNEB 2UWEB 3O9WB 5FK9B 5K93A 1WWWX 2JCCB 2VDRH 1U8KA 4DKDC 5D8JL 5IB3B 1O5DT 5I16A 2J5LC 1I9EA 2X44D 1VKXA 3ULUD 1RZFL 1YA5A 4KRLB 5EU6A 2RCSL 1UKTA 2Y06H 5CJXC 5BO1L 4PJXE 5FKPB 2WBJB 2W0FB 4J3UA 3D39A 4LCIH 4Y7MA 4XNZC 5DUBA 4PJIF 3JXAA 3QH3A 5IR1A 2VABB 4WO4C 3UPAA 1PKQE 3GRWL 3MO1A 4MA3B 3L3GA