5SX4H

Crystal structure of panitumumab in complex with epidermal growth factor receptor domain 3.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
218
structure length
210
Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGGSVSSGDYYWTWIRQSPGKGLEWIGHIYYSGNTNYNPSLKSRLTISIDTSKTQFSLKLSSVTAADTAIYYCVRDRVTGAFDIWGQGTMVTVSSASTKGPSVFPLAPCSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSTQTYTCNVDHKPSNTKVDKTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/immune system
molecule keywords Panitumumab Fab Light Chain
publication title The Panitumumab EGFR Complex Reveals a Binding Mechanism That Overcomes Cetuximab Induced Resistance.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 210
sequence length 218
chains with identical sequence J
ec nomenclature
pdb deposition date 2016-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5sx4H02
2BX5A 1HOCB 4OZGA 1QUNA 4MA3B 4ZFGH 5IMMA 3B9KA 3QXDA 3BDYL 4JRXA 3HG1E 4YGVA 2EH7H 4ZFOB 4QYOA 4Y16C 4ZFOL 2IQAB 5DQ9A 2GIYA 4WI3A 3VXRA 3ZYIA 5IVXB 4DK3A 1QBLH 2P5WE 2ZSWA 2XXMB 4KDTA 4YDVA 5E1AA 1SYVB 1F6FB 3EDJA 5KVGH 2Q7YA 1A7NH 4LRIA 4MWFB 4R2GD 3F7YA 5FO7B 4LPVA 3QDGD 4U3XA 1JK8A 3UC0H 3TIEA 1Q94B 2IH3B 3FRPG 3BRDA 4OD2A 4HWEH 5IMKA 2IADA 3MCLL 1PY9A 3IETA 3RJQB 1MVFA 5MEOA 4OKVB 2Z8WC 5HHVL 1M7IB 4LBEA 5DEFA 1PG7W 3JZ7A 4UB0H 2VXVL 4HJ0C 4RISH 3GIZL 5I8KL 1AGDA 3N1PC 5TE6H 4JFOA 5SWQA 4LSPH 4FABH 5IFJB 3TP4A 1NAML 2P8PB 4RMSA 2O5ZL 2CIKA 2HTKD 4IRZH 3QIBC 3HPJA 5I16B 3ESVF 4W4NA 4WHYH 4H26B 2FO1A 1LGVA 5FO9B 1Z3GL 1A64A 2XY1A 4LF3A 4FFWC 4MDIB 4NT6B 4U1SA 1FE8H 5BZDA 2XPGB 1UA6L 3FQXB 1JWSA 2DBLH 3QWOB 5IMOB 4GXVL 3AM8A 4NO2B 1FRGH 4E41B 4PBWD 4RFOL 3FFCB 3QIWD 4IMKC 4OD1H 4R90H 3CX2A 3TT3L 4MA8H 3GMMA 3HE6A 4XP5H 2X1XR 1H3TA 4Q6IB 2I5YL 4LLWB 1HXMB 4KPHH 2AK4B 4N0UB 4X6BA 2YS4A 4P4RA 2Y36L 1RMFH 1FQ9C 1IGCL 4HS3B 2YD5A 3I3EA 4FQLH 4ZODA 3MX0A 4O2FB 5FYKU 1F11B 2IBZY 3TCLB 2D0GA 3HZYB 4X5LA 1BX2B 5F7EL 3OKKA 4LLQA 4HDIB 1F58L 5JW4N 5CILL 4LLMA 1URLA 2D9QB 4U6XA 3S7GA 2KL6A 4EIZC 4LP4A 5CIPH 2IAMB 1T4KB 4LPUA 4NQDA 4I9WE 3MROB 2EC8A 4G9DA 5I8CB 1EH9A 1RY7B 5D8JH 2G75B 5T1LA 2NY0B 1WZ1H 1M05B 3VG0L 4UT6L 2AABL 1QRND 4JFHD 3CSPA 4NQEE 4UOJA 4G6JL 3S96A 1C5DB 4AZ8A 3CCHA 3RL1B 3MRPB 2A6JB 4JDVB 3SY0B 4WHTA 2LVEA 2Z91B 1EGJL 4ZSOE 4HIXL 4N0CD 4YHNB 2NR6D 1RZ8A 1I1AD 3BAEH 4L9LA 5HPMA 1GL4B 2L4OA 2BSRA 5E8DH 4UINH 5H2BA 1C7TA 3N06B 2NX5E 4POZD 1J05B 1OCWL 4KRPB 3G04B 2NY1C 3HC4H 4XPBH 5IM7B 1WWBX 3QNXA 4A2MA 5IEKB 5FA3B 5HHQB 4RGMC 3GSQA 1RURH 3DO7B 3QO1A 2APWA 1KNOA 2ZP0T 3BPNB 1MHPL 2NY6C 3QO0A 4YHOL 4QTHA 5DSCB 3P3YA 5GGSB 2XTJB 4NO3A 8FABA 1JPFA 1QSZA 2PR4H 4KHTH 1ZV5A 3BDXA 3DHJA 3QQNA 4L4TD 5DURB 4PGJA 2E7LA 2R1WA 3MLTA 4X80L 5E8NB 3TNNA 1WWWX 1Q9WB 2BNQD 4L5FH 4YNYB 1U8LB 4QHNA 5C0IA 5ITFA 5LKNA 2GJZA 3L3GB 3QG6A 2W9LA 3QCVH 1PLGH 2YA0A 4AK1A 5L8JB 1GC1H 3H6JA 3RDTD 3RIFF 3VJ6B 2Q86B 1CXFA 4NN5B 1GPOH 4OD3L 1UM4L 1KEGL 1YNKH 5L0QB 1CR9L 3E6HA 5DJYA 1HHIA 4PUBL 2VKWA 4DVBB 3GBNH 3P73A 1MCOH 2VLKD 1DQDH 5F9JB 1F8TH 1XGQB 4LQFH 1IAMA 1WBXB 5HXMA 2X89A 2OTPA 2JCCB 1W0WB 2VMFA 5HHNA 5K9KA 4XPAH 4RMWA 4EDWL 2MQCA 1IEAA 3DX8B 4HKBB 2CMRH 4Q6IC 3CH1B 5TDNB 1MCDA 1VFOA 3G5YA 3D48R 3KPTA 4WDIB 1A02N 3SQOL 3X11A 3V4PH 1Z9LA 3O9WA 2IMNA 1QD0A 4KKNA 1DSFH 4PJEF 4O5LH 4RRPG 5L88H 2BVTA 1R3IL 2DMBA 4R4FL 2OZ4H 1EX0A 1WZLA 5HGHA 2IAMC 3PGFL 5CHNB 1PKOA 1MIEH 4WJ5A 3VI4F 1MWAB 1C5BL 2YXMA 1OWWA 1BD2B 3VRJB 3HLAB 2R0WL 4Z7NE 5C0JB 1IBGL 1UYWL 4YH6A 5FYKL 4F9LA 4P4KC 4EBQL 2BOBB 2R15A 1FNSH 5DJXB 1U3HC 5HGBB 3T0WA 1S9VA 4RAUA 43CAB 2YHGA 3HUJF 5BRZE 1CZ8H 3U4EB 3R06B 3RIAF 4K3HA 1D9KD 2MCPL 2P8LA 4FMFA 1OWRM 2BNUA 4UT7H 2EDBA 1P7HL 4LCIH 3IJHA 3BOVA 3O6MH 1NCBL 2DLFL 4JG1L 4LLUB 5FDYA 1OGAB 4HHAB 1JGVH 2OSLA 4HS8L 4Y16A 1I7TA 4ZXBD 4PP2B 2F74B 2OZ4A 2YPKA 4FTVA 4ZUSB 5L6YH 2DQJL 1FLRH 3P4MB 1KCSL 4LASH 2O61B 2XTJC 4WU7B 5AWNH 3B5HA 2I07A 3PQYB 2F53B 4X8JA 3WSQH 5HYJE 3LQAL 4ODHL 3QUKA 3T65B 5CGMA 5DA0B 4L3EB 2HT2C 1A4JB 5IV2A 3RNQB 3NPSC 4PG2A 3SDAB 1MCKA 4OUOA 4WI4A 4YHPB 3W39B 1M1SA 1JPSL 1F5WA 4Z7UE 5INCA 3KPRA 1J11A 3MLUL 1DQQA 3QIBA 4QXWA 2OP4L 3UJJL 4YC2C 3BP5A 4Q0XH 2HA1A 2XKNB 2ITCB 2CSPA 5T3XH 1HDMA 3VH8G 4L8DB 3UYRH 3SEPA 1X4YA 2B7DT 5D9SB 3DUUA 5D71H 4KDVA 3BIBX 2HG5A 2E6QA 2UWEA 3EKCA 3MNVB 3UTSD 1YEDA 4CNIB 1KJVA 3G9VA 3RVXD 3RWJB 4MNQE 2B1HH 3EBAA 4M1CC 2ZCKL 1N59B 3KPPB 3MRRA 5ID0B 4C83B 3OPZL 3WIFA 2DWDA 4GG6B 3LN5A 4I3SH 3D3VD 2OMNA 2QHLA 2F5BL 3TLRA 3IFPA 1VHPA 5EOCH 5ISZD 2V6HA 3NCYP 1BVKB 3WDIA 4WUKH 3MJ8B 2V5SA 3VXPA 1CBVL 5IJKC 2GTZA 3BDYH 2P44B 4LVNB 3PL6D 2C3XA 4RDQF 3KGRA 1RZJL 3MRNA 3JTTB 4MB5A 3VI3F 4HUNB 1Q0YL 5CSGA 3OJDA 4L4VB 2H9GA 3QI9B 3CFDA 4PG9B 5C0EB 4YLQT 3RWEB 2AP2A 5CZVL 1VKXB 4ZQKB 5J13B 4OCLC 1JF5A 4G5ZH 3UTPE 1RK1A 4HH8A 5AYUL 4EI5C 1MLBA 1CQKA 1FZOA 2BDNL 2BVOA 3H2WA 2DI8A 4NUGL 5FYLD 5FB8B 1NGXB 2UV3A 2Z92A 4PGBB 5F1OB 5A2LH 2BOCA 2BVPA 3VXUB 5CLWA 5HHVH 3X12B 1Q72L 3KYMB 4G8GA 5I66B 3WHXA 4U6VL 4PJDA 4NFBA 1O5DT 3L5WB 4IMLA 2X70B 5ENWB 1UC6A 2B0SH 2JLLA 5E00A 1NAMH 3HZKB 4FN0A 4HW6A 1GZQA 3SDCC 1BLNB 4OB5L 4H88H 3OX8A 1HOCA 4KJPC 3DXAA 4OZGF 1SEBB 4LVOC 4MA3A 4MLIA 4FQJL 3BHBA 4X4ME 4EEEA 1G7PB 1Z3GH 5EZLB 3BZDA 3QQ4A 4ZFOA 1UA6H 4FG6D 2ADGB 4U33A 3F58H 4F80A 2CUIA 4GXVH 4BQBA 1SYVA 4H8WL 2G9HB 3LRSB 4ZNEE 4JFDB 5DMYA 1PX4A 3Q6FA 3ZKMD 4MJ5B 3QFJB 4MWFA 3BPOC 5FO7A 4JPIB 2VDML 2VJXA 1QKZH 1AKJD 2D3VA 1NDGB 4M48H 4OFIA 3MC0A 2L7UA 2HJKB 1ZGLB 3LQAC 2YPVH 4G7YH 4EZMA 2I5YH 3B9EA 3VXOB 4NKIH 3MA7B 1FJ1B 4OKVA 4JJ5A 1MSPA 4F15B 2A9NL 2MKWA 2FB4H 2HT4C 4OCWL 3V52H 1A2YB 5CGTA 5C9KA 4NRZB 4X9BA 3NBNA 5IFJA 3HNVH 5EIQA 1JUFB 5C09B 4Y1AD 5DEGB 1A7PL 1FZKB 1F58H 3B2VH 5I16A 4RMRA 1KB5B 4JY5H 4H26A 1GGUA 2YD1A 1A47A 1G7IB 1MRDL 1CT8B 3GJFB 4J3UA 2XPGA 3QDME 1U9KA 1QSVA 3GJFK 4OIIL 5IMOA 2Z93B 3OB0K 5LG1A 3Q2CA 2AABH 4E41A 3TH2T 3EYUH 1IQDA 2YPLE 4G6JH 5J4MA 4NP4L 4Y4KD 4APQB 1L7TL 5DD3H 3OGCB 3QUXC 4Q6IA 1EGJH 1HXMA 3LS4H 2AK4A 3TO4C 4QF1A 4MQXD 5I0DA 1BQHA 5KG9B 4O2FA 4KMLB 1J1PL 1F11A 1RZJC 3TCLA 4KH2A 7FABL 1BX2A 1OCWH 2ZUWA 4GRLC 3G6JA 3ELAT 1X5JA 3W11C 1GVIA 4PJ5A 4IIQB 1LQSR 4GRWH 2IAMA 1MHPH 1BQUA 4FHBD 3FCTB 4Z7QE 3DRTA 2AEQL 3L7EA 2ZG2A 3L3IB 1TVBB 1SJHB 5ETUB 3S4SB 4LHJB 3WXWL 4WNQB 4Y2DC 1HI6A 2J4WL 4ZO6A 3ZE2F 4M1DL 3RWDB 3B9VA 1TVDA 1B0GA 4D9LL 4BUHA 4UNVA 2DICA 1AD9A 2HJLB 2IH1B 5DLMH 4X7SL 5GS1B 3MRPA 5AAWA 1YY8B 1H3XA 4JDVA 3SY0A 2IPTL 3EYQC 3MRJA 4BQ6A 1RIHL 2FWOA 2WSKA 2BVUA 5DHVA 2XXCB 2JJWA 1UM4H 2L7JA 1KEGH 1PZUB 1J05A 1MHCB 5BVPL 3S34H 5HBBA 5D93B 4H8WC 2YKLH 5IEKA 5FA3A 4CVXB 1FGNL 3DO7A 2YD3A 3C9NB 4JN1L 3DO3A 5TF1H 5DHYB 5DSCA 4TNVK 5GGSA 3O3BB 5C0AB 1JIBA 1EO7A 3VFNA 1DQML 4EDWH 1HWGB 1A5FH 3VGDA 3NFNB 1Y6MR 1T66C 3SQOH 4LIQE 4F15C 1KJ2H 3KYOB 3N9GH 4RFNC 3T0EE 2B1AH 5E8NA 2PW2B 1DE4A 4F8QA 4L1DA 1CL7L 4YNYA 2ZCHL 4KQ4L 2AI0L 2ICEB 4JFXB 3MLXL 3ARQA 1QBAA 3L3GA 3PGFH 1R5WB 3RPIB 3CAFA 4P3CL 3PWUB 2FX8L 2ZUUA 1KIQB 1UXWA 2Q86A 4G8IB 3VJ6A 2P5EA 4YHLL 5KS9E 1Y6KR 4JY6A 4NQUA 1CE1L 4JQIL 4XNQB 1IBGH 1UYWH 5FYKH 3V7AG 3VW3L 1WIUA 4NJAH 3EO0A 5GGVH 5F9JA 4DN3L 1XGQA 4KWUA 4OZIE 3CFKA 4Q97A 2EXWD 3DX9B 5I76A 1A6WL 2JCCA 3V79C 3CVHH 1E4XL 4MB4A 1PQZA 1YMHB 2OTWA 4IRSC 4BH8B 1ERNA 3DX8A 2W9DL 1CK0H 3UPAA 4WDIA 2V7HB 4X6FA 5BXFA 2DLFH 4JG1H 5K59E 1S7TA 1YYMH 4HGKC 5TE7L 4XI5D 1EV2E 5IJKA 4HS8H 4WWKC 5FK9B 2BMKB 1A1MB 5F1KC 3DGCR 4EOWL 1B88A 3EOBB 1JGDB 1EEYA 4NCC2 2QTEA 5DJCB 1BJ1J 5SX5H 1DBBL 4X99B 5D6DC 2NX5D 3UJIL 2DQJH 1HQRA 1OTUC 5FGRA 5MENE 1T03H 2Q20A 4JHAH 1KCSH 2PTVA 3P0VL 2C5DC 3SKOB 4ELMB 1BD2A 3VRJA 4EI5A 5D7JC 1AP2A 2NY4B 3GHBL 4Y4FD 2X9YA 3LQAH 4F7EA 2ED7A 3D2UD 2J8UB 4U1KB 5D96B 4IS6B 2HWZH 1NCUA 2X6MA 1E28B 43CAA 1ZKAA 3R06A 4QHUB 2OS7A 2ESVD 5J1AA 1JPSH 1QFUL 3UBXB 1FBIL 5F7FA 4LLUA 1OGAA 1ZS8A 5FOBA 2V9QA 2OP4H 5EU7E 1S7RB 4KK6D 1U8KA 3W0WB 4ALAL 3SDXE 5E7FA 1IGML 3QNYB 2QADD 2F74A 5LGJA 2GCYA 4JKWA 4U1GB 4F58H 3B5TA 4Z7WA 2IPKB 4HJJL 3OAZH 4P9ML 3BEVA 3LHPL 2ZCKH 4JLRB 3PQYA 4XAWH 1CDIA 1X7QB 1KIPA 1KN2L 1Q8MA 4P5TB 2F54B 2F5BH 4KRLB 2K7PA 4NKOA 1RUPL 1A7OL 3E3QE 1CBVH 2NY3C 1A4JA 2D0HA 3RNQA 4YHPA 5J89A 5JW4Q 1RUAL 2EDHA 1WCBA 2UYLA 3N1QC 4V1DD 5FM8A 2P42B 2E6JA 2R69H 5HYQA 5CJ5A 4WRLA 2CK0H 4MSWA 3QEUB 4ODVH 4MQ7A 2EZ0D 2WWMC 5HJ3B 5AYUH 2ITCA 3T04D 2F8OA 1RK0B 1FVEB 4L8DA 4OZFH 1S9YA 1FV1B 1Q38A 4KUZL 4H1LA 3LMJL 4UBDD 1QZ1A 3RTQD 4XCCH 3GUTB 5D9SA 5T1KB 3SPVA 3BYYA 4CU6A 2UWEF 5A2FA 4CNIA 3U4BL 1H8SA 4I2XE 3T0XA 5B21A 4KHXL 1QOKA 1E6JH 5TPWH 4ESKA 1N59A 1NBYB 5ID0A 4EXPX 3ZE1F 5HGAB 5DRXA 1LO0H 5BRZD 5F6IB 1FNHA 1VESA 5I1EL 1M71B 4N5UA 1FPTL 1KBGH 2XZAL 3BQUD 3TO4A 5DJ6B 3MJ8A 1S8DB 1FAIH 4NBXB 3WS6A 3SE3A 3M17B 5E2VH 1XR8B 1YC7A 2AERT 4M7KL 3IYLW 5IP4A 1UXSB 1A6AB 3KXFE 2OX5A 4HXBL 1BVZA 2B2XL 5SV3A 1L0XA 2QR0A 4PV9A 4LPXA 3RWEA 1VKXA 3NAAL 1J8HB 4W6XB 1ZHLB 5F1NB 1GOGA 3NABL 2ICWB 3PGCB 4OAWA 1CLCA 4NOFA 1NGXA 2DKSA 4PGBA 1F45A 4Y2DA 4E5XA 3IAQA 1FL6A 3OXSA 5DFWH 3KYMA 1ZT1B 1HEZB 5I66A 3RUGB 4PJDF 3T1FB 3MV8B 3GI8L 4LOUC 3KPOB 1A7PH 1BLNA 1LD9B 4LGPB 4JPVL 4W70A 5E4IA 5EG6C 1CE6A 2QHRL 3W9EB 5C3LD 1DEDA 4X6CB 1W8OA 2CDGB 4C56D 3QG7L 1G7PA 3QQ9C 3JV0A 3QJHB 5EZLA 1MRDH 1LMKA 2XNAB 5EU4A 4Y8DC 1CLYH 1LNUB 2ADGA 4KTEH 2EDJA 4NO0D 2CXGA 2E8ZA 3LRSA 4ZUTB 4U1GC 3QFJA 1JN6A 1D6EB 4FQCL 1BJ8A 3VGAC 3FO1B 2VZ3A 1XF3B 1QR4A 4NP4H 3U6RB 1T1XB 3SQBA 5BO1L 1L7TH 3V5DB 5ANMB 4LSVL 3CDGB 2VLJB 4IJ3C 5F97E 3VXOA 3T8XB 4QOKB 1FC1A 4QXTA 4XWOC 5F3HB 4N1HB 3QUMB 3WNMA 1DLHA 3QUML 5JIKA 2AJVL 5T33H 1A2YA 2BY1A 1IAIL 1NC4D 2W59A 1J1PH 4EKXA 1MCWM 1UCBL 1T89C 5C09A 3VXTB 3P40A 5CBAB 2LAAA 5E2UL 1B90A 2HJFB 5DJ0A 4E9LA 5CCKL 3MLVL 4Y19A 3MJ7A 5IB3B 1T7ZA 5E08L 1MFCL 4K07A 4TYUA 1G7IA 2XN9D 4JQXC 2AEQH 4NWTL 3SCMB 4FS0A 4O9HL 2FR4B 1QEWA 3GJFA 1YMMA 1LILA 1U91A 3WXWH 5FYJE 3UTPD 4R97C 3L5IA 4UV4H 5C08B 3PE9A 1A3LL 2J4WH 3K3QA 1EJOL 5F9OL 1J87A 4KK9D 1NCDL 4FFZH 1HHJB 1JHKL 3X13B 4G6FB 3SBWA 4IRSA 3OGCA 1DVFD 3WJJC 1N2RB 5F6IC 5ADPL 4ODWB 5T3ZD 3C8HA 3BUYA 3T3PE 4AIZB 4JG0L 1JYWA 4J23A 4QRQB 1AO7E 3C5ZC 5D7KE 1IE5A 4TOYL 4JM2B 4PRHE 5J6HA 3ZYJA 4N1CA 3G6JF 1JZ4A 3VWJB 1R3JB 4RSVA 1FGNH 5D6DA 4I3RH 4JN1H 4NKDB 2GITB 1ZLVK 2R0ZL 4KK5D 1ZWIB 1INDL 1C08B 4GQ9L 5I6XB 1T1YB 2ZOLB 2A1WH 5DUPL 3EJJX 1IGIL 1U8JA 3L3IA 1SJHA 3S4SA 4G6AD 2IWGA 3QULA 3EGSA 2H32B 2F8VA 4WNQA 4GBXD 4N0RA 3TN0C 1J0ZA 4F7CB 4R4ND 1AQKL 3RWDA 1R3LB 1T0MB 4P5KA 2HVJB 5SWSB 2HJLA 3ZKNC 1E4WL 3RY5A 1H8OA 4PRAA 1YY8A 2AI0H 5FDWB 3ARUA 4OLVH 3MLXH 1HHKB 1PDKA 2OXGA 1VEOA 1AD0A 1J0KA 2FX8H 5JIPA 3FQNA 5GISL 1C8PA 4Q9QL 5F21B 4F7MA 3DI3B 1KT2A 1CE1H 4JQIH 2P46B 2HMID 1MHCA 4OKDA 4AYFA 5FXCH 5E2WL 1MVUB 3VXSA 3D18B 3HMXL 3I85A 2YBRA 2DS4A 2EEDA 4MAYD 2IANE 1FVDB 3C9NA 1T21B 2AJZB 4ELKA 4TUOB 1A6WH 4U6TA 2WAHA 5IJVB 3QZWA 1E4XH 5C0AA 3QEQA 2NY2D 3NFNA 2YPLD 2PYEE 3INUL 1NEZB 4UIKL 1FFQA 4Z7VE 5F44A 4AEIL 3MRKB 4NHUB 5GJSL 3MRHB 4IRJC 1QLFA 5TE7H 2NPLX 3D25B 4PLKC 5CJBA 2PW2A 2NW3A 5ICZA 4TSAL 3NN8B 1ZHBA 4DVRL 5BCAA 1HXYB 4ENEC 3OKLB 1JCKA 3H9SB 4JFXA 4KRMB 3GMRB 4MXVF 1O7SA 3MR9A 1U36A 3AU1A 3EFFB 3MRDA 1R5WA 3RPIA 3P0VH 1KIQA 4PJXB 1HQ4B 3OKOB 2ZCLH 3CFJB 5GS2H 5SX4I 1FG9C 1EEZA 3ZDZF 1JGEA 3TBSB 3MRLB 2OJZH 1KN4H 5C0BE 1QHOA 5DI8B 4HV8B 2W0FB 1XEDA 5EUOF 1ACYL 1YEIL 1M6OB 4YFLF 1LEGB 1YMHA 1TETL 4D0DB 4K9EL 2V5YA 5C9JB 2C1OA 1LK2A 1MAJA 2V7HA 3I50H 5HDQL 5K9QG 5ESQB 1AHWC 5H37G 1UG9A 3TIDA 4R2GB 4C4KO 1Z5LB 3KLHC 1EEQA 2FX9L 3QDGB 1KLUA 1IGMH 3LVEA 3WS3B 2VR5A 3EOBA 1WBZA 5CEXB 4IHOB 3LRGA 3PGDB 5DJCA 4Z7OE 4YXKL 4F9PA 4X99A 1YPZB 5ACMA 3NCFB 4P9MH 4PRIE 4ELMA 5JO5B 5IIEB 4X5WB 5C07E 5B39B 4F57H 3GM8A 3F62A 4MAUL 1SMOA 3GMLB 1A7OH 2VXSL 1E28A 1N8ZB 3ALXA 5EN2A 4QHUA 2V2TB 4RWYL 5JW5B 4XCEB 3RKDC 2D4DA 1RUAH 4DKDC 1H5BC 3UBXA 3H42L 5DMKA 3PJSB 2WUBH 3FQWA 3R1GH 4BZ2L 3QIWB 2QL1A 4HGWB 1JGLH 2R56L 2V7NB 5K9OB 3LMJH 5IGXL 2W9EH 1UADC 2JK5B 4YDKH 2Y5TA 1CGYA 4JO2L 1TFHA 3C6LC 4PJAE 4Z7WF 1QACA 5E6IB 5DVLA 1SQ2N 4JLRA 1QA9B 2VN4A 3GJEA 4CJ1A 1F4WL 1CG9B 2F54A 4HS6B 4NWUH 4DEPB 2NZIA 1RJCA 3M45A 2E7HA 1GGIH 3FMGL 3HE7B 4MJ6A 2XZAH 3HN3A 2OR8A 1U3ZA 1W2KT 3M07A 5E7BA 1ONQB 4X4YB 3QDAA 1KGCE 4P48A 4KQ3L 3RWCB 4JEGB 5HVHB 1FYTA 1T89A 2RCSH 4XVTL 4YHZL 4XXDB 5I74B 3MRMA 4PS4L 2D7OA 5IEHB 3VFPB 4GRWB 3NAAH 1EVUA 2F9BT 2DMKA 3FQTB 4O51B 1QRNB 3QEUA 4N90D 1FYHB 4Q2ZB 3MOBH 2UZIH 1IGJB 4NM4L 1FVEA 3L3OB 1I8KB 1SY6L 3TZVD 1FV1A 1JNNL 4LEXL 4MX7B 1IC7L 3GUTA 5T1KA 1XGUA 5F93C 4R96B 2PW1B 4LSTL 2XWJB 3I6KB 3MV7E 5CS7A 3T0DA 2EDYA 4TSCL 1I1AB 4U2YA 1MPAL 3VWKD 3GI8H 4K9EC 2K3TA 2XY2A 2EDRA 4NN6B 4B50A 3WJJA 4EVNA 4MCZB 1M71A 4MD0B 1YYLL 1X5AA 5DJ6A 2X44D 3QG7H 4FFVD 2B20A 4JRYD 3H7LA 3C5ZA 5D7LD 1TPXB 2VC2L 3OJ2C 5KSVB 1VGEH 3DVFA 5EO1A 4QHMB 1A6AA 4HPOL 4L4TB 4QWWD 1NCCH 3LPGA 2X9XA 1KC5L 1LE9B 3QEHA 3NGBC 3R8QA 1J8HA 4U1JB 4FQCH 2ARJA 4LCWB 1ZHLA 3EAKA 4Q74A 4KDWA 5F1NA 3U83A 4AQ1B 3S8WA 1XGTB 4RGND 3HNSL 3FTGB 4I3GA 4WCYL 4Z9KB 1DQLL 5J6GB 3RVTC 3C5SB 1HSAA 3TN0A 4PP1D 2VLME 3IS1X 2UZYB 1AGEB 2VQTA 4G9FE 1HEZA 1OPGH 3GBML 4BELD 1IAIH 2APFA 2EDDA 4XNYH 3RUGA 1ULVA 5CP3H 3T1FA 5FGBA 1J0IA 5FM4A 3RDTB 3OKDB 1EHXA 3KPOA 1LD9A 4Y5XB 5TF0A 1M4KA 1UZ8B 1DFBL 3W9EA 4WO4D 4X6CA 2VLKB 2FRGP 3MLVH 4IBLT 1MFCH 3QIWC 4YQXL 3UAJD 2AVGA 4PJIA 1G0YR 4PRPD 4O9HH 2XNAA 3UYPA 2E7BA 1LNUA 4YBQD 5EO9B 4KGJA 1U8NA 1A3LH 4ZUTA 1HWHB 4CADB 4YHYC 1U58B 3ARZA 1N3NA 1C16A 4QCIA 1ZT7A 4LCUB 5DK3A 3U6RA 1JHKH 4FQ1H 5ANMA 3CDGA 5DC0A 4IM8A 5ADPH 4QOKA 2CDFB 1IGTB 4JG0H 3PNWB 5F3HA 4UDUB 4IRJA 2AQ1A 5FYJU 5C0FB 1P4BL 3QUMA 4O00A 4GMSL 1ITBB 3RNKA 1X44A 2EYSA 4TOYH 2J88L 2VDQL 1R3KB 5JUEL 1A6VL 2WUCL 5EFIB 4DUVA 3OV6A 1IAOB 2I25N 2CO6B 3SDDC 5CBAA 4QRRA 5GGRY 4UQ3A 5L2JB 4KJQD 4YUEL 5SX5K 3GMOB 5B8CB 5IB3A 4GQ9H 1I4FB 4U7MA 2DDQL 1WT5C 3SCMA 2FR4A 1T5XB 1IGIH 3MYJB 3MO1B 2Z31D 1AQDB 2Q8BL 1D9KB 4JREC 4D2NA 4XWGH 1QFWI 3ME0A 4ZUWB 3RP1A 4NQCE 1NCWL 4N0CC 4PJCB 3DYPA 1AQKH 1K85A 5K9JL 2NR6C 1CFQA 1I1AC 3N0PB 1QPPA 5HHOE 4BH7A 2RFXB 1E4WH 3X13A 4JR9L 3ZKSD 4J12A 2C3VB 4NN6C 1CFNB 3OZ9L 1N2RA 2HLFD 4ZXBB 1YEHL 4XPTH 4LNRB 1NH6A 4AIZA 2XFXB 1AHWA 4KROD 4QRQA 4JPKL 5DT1H 3S98A 3QWRD 5GISH 5H94B 4JM2A 4GAJL 2YD7A 4L8SC 4ZOAA 3HMXH 4MCYB 2B8OT 4MD4B 3HMWH 2VYRE 3GSOA 2J5LB 3V4UL 4LP5A 4I0PD 2BNRE 3LEXA 1KPRB 3O4OC 2O5XL 4H25B 1UB5B 1T1YA 4K7FA 5FUOH 4YK4C 4YGAB 3BKJH 3ZKXC 3OTTA 1A4KB 7CGTA 1EO5A 1S7WB 1X3DA 2H32A 4UIKH 1ZLUH 4AEIH 4LKXA 5GJSH 1F4HA 4TULH 4F7CA 3ROLA 4XNXH 1CDHA 5DO2D 2EE9A 1T0MA 2HVJA 4TSAH 5SWSA 1R6VA 2PNDA 2YN5A 3DIFA 1HN1A 5EU7C 3FB7B 1CD1A 3BWAA 5A2JH 1H5BA 4HPYH 4Y4HC 2W0KA 5D7IB 1QRKA 4DAGL 2EH8L 3LV3B 4LHUD 3UTSB 3KLAB 4U7KA 1F02I 2DQUL 3ARDD 1ZHKA 3GMQB 4P2OB 1MVUA 3OQ3B 3QCTH 4J3OC 5F8RC 4OBSA 2XQBH 3D3VB 1GCFA 2NXZD 1FVDA 2YUVA 1T21A 5ISZB 3C6LA 2NZ9D 4KUCF 1ACYH 1YEIH 1SJVA 3NZ8B 3BE1L 5DEZA 4OJFH 4U05A 1TETH 5D72L 5IQ9A 3PL6B 4NQSA 4PB9H 1MQ8A 5I1DB 1NEZA 3MRKA 5HDQH 2HKHL 2ZJSH 3MLZL 4QHKI 1KELL 4UT9H 3NZHL 1MCNA 1X9QA 3ZTJH 3D25A 3VRLF 4L8CA 3FOMB 3FT4B 1A7RL 4HCRL 3NN8A 5GRWA 5CAYB 3BUTA 3T2QA 3VD7A 4OLXH 5D7KD 4FA8A 2CJUL 2P48B 3EFFA 1ZVSB 3HUJE 5B8CC 4PJXA 1MFEL 5FYJL 5KSBE 1HQ4A 3L5JA 3OKOA 4ZS7L 3MREB 4MAUH 3WCYA 3IRZA 3J8F7 3ES6B 3TBSA 2WQRA 2PN5A 3MRLA 1NBVL 5DI8A 2W0FA 5CBEB 5IHLB 3WD5L 1GGYA 4WUUE 3DV6B 1JRHI 4KKBD 5E2JA 4OFDA 3B8SA 4GAYB 3P4OB 5J3HC 3O6FC 1D5ZA 1Q9LB 2B39A 5ESQA 4K71B 5FUZL 2EIDA 4BZ2H 1R3HB 1NLBL 1NKRA 3PDOB 1NANI 2D2OA 1AKJB 2X40A 3B8YA 4NGHL 5ICXB 5CEZL 2JB6B 3SJVE 4IHOA 3PGDA 3KPSE 1LDSA 4JFZL 1FL5A 3RU8L 3WIHH 2J5LC 1X5YA 4JO2H 3JWOL 1YPZA 5B4MD 1XCTA 2I9TB 4WTZA 4XZUB 1BJ1H 1DANT 3I02A 1ORSA 2FX7H 4X6DB 4GW4B 1EHLH 5IIEA 1YQ2A 4ELMF 1W72L 1MCWW 5B39A 2CD0A 4LIQH 5FECB 1RU9L 2VAAB 3FMGH 1GGCH 4NJ9L 3V5KB 1N8ZA 2PXYB 4OLWH 5T5FL 3U0WL 4PLJD 3I6LD 2V2TA 1N4XH 4KQ3H 4DJMA 5JW5A 3OG6B 4XVTH 1H8NA 3EDFA 1S7VB 3MACL 4PS4H 2QLVB 3GSUB 4JZJB 2A73B 3QHFH 3LKNA 3AXLB 2PYFB 3E2HB 3NTCL 1HHGA 3OBAA 3QIWA 4P2RB 3RVXC 3BZEB 5MHSD 5ELIA 1MCCA 2WBKA 2V7NA 4Y4KB 3CXHJ 5C0GA 1L9MA 1SY6H 3IF1A 2DYPA 3OF6D 4HLJA 5D1QC 4XX1E 5AUMB 4PJ7A 1A0QH 3RVVD 5CD5D 3MV11 4LSTH 4MA1B 3S4SG 4MYWB 3GMNB 4TSCH 3RWFB 4LLDB 1P84J 1NPUA 1MPAH 1QA9A 5JR1H 5TQ2L 1I1RA 3PL6C 4PREB 1BFVH 1CG9A 3T4AB 1TJIL 1I3UA 2Y72A 3BH8B 4OF6A 1CFBA 4M6NH 5EU3A 2WW8A 3HAEA 5FO8B 1F00I 1EHNA 3AAZA 4X4YA 2VC2H 5EU6E 4TNWK 3RWCA 3WKML 5IWLC 1J5OH 4JAMB 1CICB 2QSVA 2W0LA 1BIIB 5FCUH 2Y7QB 3WDJA 2Q8AH 2OM5A 3F12B 3SDDA 1KC5H 5DYOB 4MS8D 1CTNA 3VXME 4G6KL 3MFFB 5CZXC 1QRNA 2R2HA 2DLEA 4TPRL 3QISA 2GUOB 4QRPD 3HNSH 4Q2ZA 1WT5A 1IGJA 1S9XB 4WCYH 3TNMB 1DQLH 3CC5A 4ODXB 1YECL 1BZ7A 2ADJB 5MI0C 3L3OA 1I8KA 2VDRL 4XPHL 3GIVB 4MX7A 4OZGE 3GDBA 1F3JB 4Y88A 3BSZL 3RBGA 5KVEH 3T3MF 3H3PL 2XWJA 3I6KA 5IR1B 5CSBA 1S9WB 2VZVA 3GBMH 1I1AA 5J9PB 2ERJB 1IQWL 4K3GA 3VXRE 3C2AL 4FG6C 2FGWL 2YSSA 5IB2B 4FQXD 3KR3H 3MLWL 4P0DA 1OTTD 3WO3B 4K71C 3V7AE 2AXJA 3G6AB 4GG8B 4YX2H 4MVBD 1IEBB 5GRUL 3FHQA 2DMCA 4NQVB 5BMFH 5KSVA 2IF7A 2P8MA 3S35X 4QHMA 1S5HA 1LO4H 3JWOC 2Y07L 3HCVA 2NY0D 3H9YA 2OCFD 4N9GB 3OAYK 1OAXL 1XGTA 5D2LA 4G6MH 2FEDC 2BNQA 2DI7A 4OIBA 4EDXB 3A67L 4DFIA 5J6GA 1B6DA 3U46B 4ZG1A 1IL1B 4N8CL 1FZJB 1TQCB 3P0YL 4JFFE 3O3EB 4FNLL 4LU5H 2WIIA 4HX1B 4YPJA 3O11B 3PXJA 5JORB 3RUGF 3QIUC 3BGMA 1EMTL 3PHSA 5BVJA 2VH5L 1A6VH 1RVFL 1LDPL 4HK3J 5EZJA 4DWHA 4H20L 4FQ2L 4P59L 1UZ8A 1KGCD 3MOQA 4Y4HA 4KRNA 3E2HC 3K4AA 4LRNH 3ZHDA 1BFOB 3BGAA 3VE0A 3GHEH 1PKQB 1DN0B 3TCXA 4PJIF 4NQXA 5J1SC 1R5IB 3WYRA 4ETYA 5EO9A 3BXNB 3LD8B 4CADA 4MA1C 1HNGA 1NCWH 4MQXC 1MI5A 4NFCA 5K9JH 4J3WA 5CUSL 3HI6H 5ALBL 4YPGB 3MJ9L 4I18C 4GKSB 5I1KH 3P9WB 1IT9L 3HZMA 3MV7D 3NCJH 3OZ9H 1S3KL 3EO1B 2CDFA 1RIVL 1TZIB 2CQVA 3PNWA 5C0FA 4NQDE 5GQBA 4XNUL 3IB4A 2NX5B 4JPKH 3UBXG 3G08A 3UTTD 2XI9A 5GJTH 3WNLA 1AY1L 4LARL 5J7CC 5INDB 3O6KL 4GAJH 1IAOA 4OGAC 3CMGA 3IU4L 3ZE2E 4Y4FB 1LO2L 1SVCP 1CQYA 3SO5A 2ADIB 2ZUQB 3D2UB 2EYRB 4PJGB 1U6AH 4WGVB 4HKJB 5FKAA 5B8CA 1UVQB 1I4FA 3STLB 5E56A 1WC7A 4N5ED 3S3JA 5DJZA 1T5XA 2APTA 5IBLC 4PY8I 3MYJA 1P69B 3JV4A 1G7LB 2W38A 2ESVB 4D9QD 1E6OL 4OQ1A 4TN9A 4ZUWA 6CGTA 3QHZL 3K4ZA 1LK3L 1RHHB 3EDDA 3QDJD 1VEMA 1HHHB 2RFXA 1RIUL 3UTZB 1MCBA 4G9FD 2LU7A 5KOMC 1CFNA 3EHBD 4ZXBA 2QADB 4LNRA 4J3VA 2DQHL 2EH8H 2GT9B 5BV7L 2DN7A 2XFXA 3IDMB 2HRPL 5KANI 3WFDH 1FNGB 2VE6B 1KFAL 1J1XL 2DQUH 3MCG1 5F7UA 2OJEB 2Z8RA 1DBJL 1BMGA 5HGDB 3DPBA 1JZ2A 1NBQA 4Y2OA 2E8YA 2VLLB 2HFGH 4MD4A 1YEKL 2KZ1B 2VDLL 3X3GL 3FJTA 5EPMA 4KV5F 3H3BC 3DSFH 4S1DD 2VDOH 2Q87A 3REVB 3V0VA 4UIMB 5DFVD 3OG4B 3W5MA 4GKOA 1A4KA 5D1XD 1S7WA 1X5KA 3T4YB 1CCZA 3MLZH 1I8IA 4V1DB 4G7VL 2EDKA 3NZHH 3WMSA 3PDDA 4LDLB 6FABL 1NFDA 3RA7L 4XVUD 1A7RH 4GS7B 3IS0X 3B3IB 4GW5A 4XCNA 3RX7A 3FB7A 1GAFL 4GAGL 5F96L 3RVWC 3NMEA 2CJUH 1NGYB 1WIOA 2XACC 5GS0D 4MJ2A 3THML 3LV3A 3ZT6A 1RUQL 3V4VH 3D9AH 5FYJH 3HI1B 3EO9L 3T77B 1AGBB 1C1EL 3CSBA 4DZ8B 3NCYS 4OQTH 2AXFB 5D1QA 3D3VA 5BRZB 4ISVA 4RX4A 1NBVH 1XAUA 5I2IA 3BQUB 1XZ0A 4XI5C 3MLSL 3UZEA 1GGTA 4BSVB 1HIMH 1I7ZA 3SKNA 3PL6A 5GRJH 4LLYA 5A3IC 5I1DA 5HDLA 1C5CL 1ZANL 3FT4A 5I1CL 4HCRA 4B7IA 2X09A 1PJ9A 2R1XB 4NGHH 3I6GA 2H8PB 1BWMA 2X4QA 5CEZH 2OQJA 1AR1C 4JFZH 2O93L 3RU8H 4UQ2B 2AGJH 3I75B 2ZUQC 4NRYB 1ZVSA 4D9RE 1HE7A 4EUPH 2FL5A 4PJFA 3UXFA 4MB3A 4PJXF 4F33B 4Z8FL 2ORBL 3SE4C 1GOFA 1KCUH 1RU9H 4GQPH 3ES6A 4OSUL 3WLWC 1IC1A 1SM3L 5T1DL 1PAMA 3DSNA 5CBEA 3MRCA 2E9BA 4YWGH 2IALA 1IZJA 3K0WA 3U0WH 1SEQL 3PHQB 4Z7UB 3DV6A 4QXGL 1LWRA 3LEYL 4FTVE 3MACH 4UNUA 4GAYA 3P4OA 3HA0A 3CPLB 1Q9LA 5AZEL 5BV7C 4NO0B 3O2WL 3OKMB 3IKCB 1R3HA 5TH2A 3PDOA 1KLFA 4QTIL 5ICXA 4NYLB 3JV5A 4ZTOL 2C9AA 5EB9A 1CD0A 3EJYC 3BVNA 4MNQB 2N1KA 3GKZA 1YPZF 3BW9A 1TCRB 4PJ8C 1N6VA 4EUPA 2I9TA 3C60C 3G5XB 3N1GC 1W72A 1BECA 1ZA6B 3KPRE 3LSOB 2VSDA 4Y1AA 4LFHG 4LEOB 5FECA 5HY9B 5IW3A 2VAAA 2I9LB 3QPQD 3MFGB 2FJGB 4GS7C 5DFTA 2EZ0C 3QIUA 2XN9B 1UKQA 5F9WB 3LB6C 2BSTB 3CD4A 1TIUA 5JOPD 4FXGB 1MEXH 2UWEE 1IGFL 4JZJA 3RTQC 4HFUL 3NIFF 2A73A 4XCFL 1EAJA 5EWIL 3NVQA 2PYFA 3CXDL 3GI9H 2ITDB 4G6KH 2FHBA 5E94A 3U0PB 3I9GL 3ZE1E 4PV8A 3MGAA 1YECH 3P9LB 4Y4KA 4U4BA 3S88L 4XPHH 3JWDH 2P47B 4L29B 1DVFB 4CMHC 4PJ7F 5DQJA 5EBLA 3BSZH 3H3PH 1TZHA 4Y5VC 3S35H 2VTFA 4YFDB 1FVCA 1AXTL 1KYOJ 3KJ6L 3U9UB 3RWFA 4LLDA 2NYYD 4HC1H 32C2B 1IQWH 4I18A 2MNUA 3TYGL 3MUGA 4JO4H 4LGSB 5C0CD 4WUUD 4FOMA 3MLWH 4K23L 3L5XH 1JWUB 5JHLL 4X0KB 5FO8A 3BGFB 3D39D 4HT1L 2MPAL 4M3KB 4XTRD 5JHDA 15C8L 1RUKH 1CVSC 1DANU 2ID5A 2YA1A 5C7XL 4JAMA 1HINH 1BIIA 4HAFA 2Y7QA 4UNTA 4GXUM 4GBXB 3F12A 4JDTL 1FIEA 5DYOA 4G8GE 2GHWB 3FZUD 4PJDE 1HKLL 1P1ZA 5EA0L 4NQTA 2FO4B 1FH5L 3TBYB 3TNMA 4D0CB 3KS0J 5EO0B 3A67H 1L6ZA 4ODXA 5A1AA 2ADJA 2QSQA 3DXAE 3GIVA 3P9MA 4HUUB 4N8CH 1F3JA 1PBYA 5IBTL 3PWNB 4FNLH 1ZLUK 1YJDL 1TJGL 1S9WA 1EMTH 5KOVC 5HPOA 4HG4J 3V0WH 1NL0L 3BKYL 5I18L 1RVFH 1T7VA 5I1JL 1JHTB 3VFUA 2YEZA 1D6VL 2DKUA 3N50A 4JZNB 4MAYB 3SGKC 2VUOA 4B0MM 5I1HH 4CMMB 3G6AA 2X4UA 3G6DL 1P4LB 3CZFA 1UB6A 3VU2A 3KJ4C 1V3JA 4L3AA 4OF0A 2NY2B 2YPLB 3QXAA 1EFXD 3LPWA 3T2NL 5I1IL 5CUSH 4N9GA 1CI5A 5EIIA 4WU5B 5D2LF 5D2NB 1S5IL 2ZNWA 2EEAA 3V5HB 2OK0L 3U46A 2GJJA 5DWUL 1S3KH 1CLOH 5BOZG 3O3EA 1F97A 4HX1A 3O11A 4XNUH 4ZFFA 4OGXL 4M7JL 1F4YL 4K7PX 4HJGA 4R3SB 5AEAA 1SMAA 3HR5A 3O6KH 2F19L 2KUTA 3IU4H 4WI2A 4E41E 3IDNB 5EU6D 4AJ0A 1Y0LB 1KOAA 1BFOA 1CDGA 1AE6L 4K3JH 1F42A 1PKQA 4OCXL 2EO9A 5GIRB 1CYGA 1UZ6F 3SKMA 4KK9C 2IC2A 5E9DA 1QYGL 1FORL 4KXZH 4QT5B 4WTZG 3VRIB 4WV1C 3MGOB 5IHUL 2AK4E 4H5SA 3IFOA 4BK4A 5T5NF 4JB9L 5B39G 4FQIL 1QQDA 5B3NA 2C4FT 1QLEH 5ERWB 4BQCA 43C9A 3MJ9A 4S11A 4FQQB 2X41A 4Z95H 3B9KD 4JFQB 1RIUH 3O8XC 3G6JE 5ACZA 4J4PD 1TNNA 1N0LA 4PJ5E 3CDYA 3EO1A 4Q9BA 4U6HB 2M1KA 3VXRD 2DQHH 5BV7H 1R0AL 4YHKH 4NFDA 2W91A 1BQLL 2JF1A 1ZVYA 1PG7X 2Q3AA 4KK5C 3F7PC 3C6SB 1FL3B 1G9MH 2LFGA 3MUY1 1F4XL 1DBJH 5INDA 4LAJH 2DF3A 2C1PB 2VISB 3SGEH 1WF5A 3S97C 5J12B 1YEKH 1KTLB 5KVFL 3ILPA 1FGVH 2ADIA 3UCRA 2EYRA 1OARH 2PTTB 4PJGA 4HKJA 4R4NC 5CFHA 3VDAA 5ITBH 1HILA 3PWPD 4HFWA 4PBXA 4PGCA 5FHAH 1G7LA 3T0EB 2ESVA 2YRZA 1KEML 4G7VH 4NO5B 1YJDC 1MJJB 8CGTA 1CD9B 5IHBA 3BP7B 1RHHA 1KXVC 1N6QL 3AS2A 4JFFD 3JUYA 2BVQB 5C6TL 5GRVL 3DI2B 1FFPB 2GY7B 1NANH 2JB5H 4GAGH 4LPWA 2ARWA 5F96H 4OF3A 1EUUA 5KS9B 3THMH 5E8PB 4DKFH 2DTMH 2GT9A 3WV0A 3IDMA 1RUQH 5I17B 4P57B 2XTJE 5HVGB 2X9WA 3IGAB 1FNGA 3AB0C 2VE6A 5GS3A 4QGYA 3VFWA 4QKXB 5C0DA 5HGDA 3HE6D 3QBTB 5I8OL 4OZIB 2VLLA 5F6HI 1YUHB 3QSKB 1AJ7H 3ARVA 3F6LA 2FNBA 4LCCC 1JPTL 4PJ8A 2CKNA 2D31B 2AXGA 4JO3H 1P9MC 1Q9OB 4FXKB 4RRPA 4MXVE 3FL7A 5IB4B 3LS5L 4JQVA 4XC1L 4F2MB 3QRFM 3T4YA 3TJHD 1JNHA 4DKEL 3O2DH 4V1DA 3MBXL 2EIZB 4POYA 2P5EE 3QRGH 2UY6A 1NFDF 3CSGA 3W0WD 4NQDD 4W81A 3U36B 3ZDZE 3UJTL 2HN7B 3CFEB 3TZVB 3MV9A 1NGYA 3R0NA 1X6NA 3F7VB 4L8BB 3RTQA 5T1LD 2JCCE 3OKNA 2Y25A 3ABZA 3WO4C 4FZEL 5KW9H 1G9NL 1AGBA 2VDPL 4Z8FH 2AK1L 3NFSL 3VWKB 1QSFD 1N64L 4JFED 1S78C 4R8WL 1YN6B 4ZS6C 4DW2H 1DN2A 2NXYC 3QQ3B 3SE8H 5EZIH 2ZUSA 4X4XA 1SEQH 2VL5B 4R0LC 3VD4A 5I0ZA 4JRYB 4QXGH 2NTSP 5D7LB 5GRXG 5SWZD 5HYFA 2DQFB 1BWWA 4O02L 5J1TC 1K9TA 1YQVL 3K1DA 5AZEH 5D1ZB 4S1SL 5I8EB 3SDXB 1VPOL 3AS1A 1BD2E 4HIEB 5FYKE 4QTIH 4M5YL 2H8PA 4ZTOH 4XXCC 4MMXC 4M7ZC 5GZND 5ILTL 4QRSA 1OF2B 5J12C 1NUGA 1WEJH 3W2DH 4UQ2A 5IQ7L 3LN4B 3I75A 4X98A 1EJ6A 1FO0L 1QVOB 5GRZA 3X3FH 4PJFF 5HYSB 4AEHH 4I77L 5LQBL 3IJYB 5T5NG 2B5IB 5CEYB 1N7ML 1NFIB 1OGAE 5JPMB 1MQKL 2VKXA 1A8JH 1VENA 2A0LD 4EN3C 4KDTC 4WO4B 1D5IL 1XCQB 3AREC 4C56A 3PHQA 5DXWA 3VXQB 1VFBB 4NNYB 4PRPB 2ZSVB 3CSYB 4OFYD 3UTQB 1IGFH 4GKNA 5DDHB 3CPLA 4Z7WE 4CRPA 4NO0A 3E6FA 3CXDH 4MDJB 1FG2B 3OKMA 3SGKA 3PQYE 1TJHL 3H7BB 3BIAX 1CXLA 3KNBB 4PTTB 1MJUL 4U1LB 1V5JA 5LCVL 1U8OB 2H1PL 4HGMA 2GW5A 5C0NC 3FO2B 3DTXB 1AXTH 2UUDH 1J1OL 1EERB 2YZ8A 3ROOB 3O9WD 1NC4A 2IJ0C 4CVWA 3MV8D 3LSOA 5SV4A 4LEOA 4L3CB 5HY9A 2NW2A 1IARB 1UQSB 2VDNL 3MGTA 3B5GA 2DLIA 3BP4B 1DQJB 2DQDL 3P4NA 4HT1H 4NBZB 3FT2A 4QY8B 3RY6C 4E42A 1T22B 1WBYB 2XN9A 1V3KA 3O6LL 2Z31B 2R4RL 3KWWB 4MHHG 4HMCA 2YOCA 1EHAA 2XZQL 5TDPA 1BIHA 2ZUXA 2IPUK 2VIRB 1G9NC 5E99L 2MKLC 4HEME 4TTDD 5GGTH 5L2KA 4YEEA 3P9LA 4D9RD 2EDTA 2VQ1B 3MXWH 2LTQB 3WNPA 5JW3L 4NKMB 4YIQB 4L29A 2XICA 3WDHA 1A7QL 1YJDH 2AJUL 1TJGH 3U9UA 2JIXD 4KROB 4XNZB 1D5BB 4M43H 5I9QB 3BKYH 3O8XA 4C57C 4O4YH 5I1JH 1NMAL 1JPGA 4RAVB 4CVZA 3FB8B 5CMAB 4X4MA 4OV6F 1U8PB 4R7DB 4Y16D 2WZPD 3EYOB 1JWUA 2PKDA 3C87A 4I0PB 3ARSA 1F6AB 3R8BB 4HK3N 1MCEA 4RGNC 1G6RB 2VXTL 3PXHA 1G6RL 2OI9C 4MQTB 5IROA 1IAKB 4OUUB 1CGWA 4GBXA 4K7PH 2ATKA 5FHBL 1ES0B 1R5VB 2W65B 1U92B 1K3ZA 5I1IH 3MCKA 4J1UB 3D87B 5I15H 2NTFB 4OCSL 2IBBA 4YXHL 4R6UA 4D0CA 4L9LC 1F3RB 4CUCA 3RZCD 1MOEA 2E7MA 3QPXL 1OAUH 5IMLB 3FOLB 4WO4C 3KPRD 2XQYK 4DKAA 4OFPA 4DUXA 4LHUB 4OGXH 1NCAL 5ESAB 4M7JH 1F4YH 1W0YT 2A9ML 3OHXB 1OL0A 1A9EB 5EBWA 5ADOH 2I60L 3ARDB 4P5MB 3AS0A 2F19H 1JBJA 1U8HB 5IB5B 4LHQB 3QFJE 2A6DB 5I71B 4LK4A 1MJ8H 3GNMH 3KLDA 4NOBA 4WFFD 4MAYA 1AE6H 2NXZB 3VWJD 4OCXH 2PO6C 3BKCL 2E7LC 1G9EA 1YEEH 5L8KB 2BRRL 1P4LA 4KY1L 1PYWB 2R39A 3I3BA 4ZO7A 4YFLI 4ORZC 2EDNA 4HQQL 1BEYL 5LBSH 2FBJL 4OBRA 1PG7H 3GSNH 2CLRA 1K3IA 1F3DJ 2A2QT 5E8EA 2OL3H 4HUMB 2AJXH 4LCCA 2GQHA 3NA9L 4X7FC 1CGSH 1ZLSL 4KJYB 5C09E 1QO3B 4RQQB 1P9MA 3CZJA 5D2NA 3WUZA 3FAWA 1ZSDA 1BBDH 3N85L 4NDMB 1OD9A 3P2TA 4ACPA 4K3DL 3SO3B 4Z76B 4DUWA 4DCQB 1IGYB 1G1YA 4Y19E 3BEWB 5F1SA 1R0AH 1DJSA 4KJQC 3PABB 3S36L 4AIXA 2DQEH 1LP9A 3WFZA 1YMME 3IDGB 4G3YH 4KK8C 3ARTA 3BT2L 1CIUA 3C8KB 5T3XD 4KVCL 4UTAL 5BS0D 1KULA 1Y0LA 4NPYB 1I8MB 4ONOA 1UWEL 3CMOH 5EZOL 1D5XB 3VFGH 1RZGA 1A1NB 1G7HA 1U95B 3U1SL 1MIMH 5DJDA 4QT5A 1NSNH 2IGFH 3S36X 1QFWM 3MGOA 3U7WL 1PW3A 3ULVL 3L3HB 1KEMH 5E03A 4JO1H 1FSKB 5IF0B 1H3UA 4XHJD 3DXAD 2IFFH 4BA8A 5ERWA 5DD0L 4XNZC 3VD5A 4FQQA 2QQKL 1NGPL 1OAYL 1IKFH 1N6QH 4R0LA 1NLDL 5FAAA 2ATPB 3OR7B 3TBVA 3MODL 2ZWLT 4IOFC 3CUPB 4X8XA 1DL7H 1RJYB 1RZKL 2E9JA 4JKPH 2NY1D 4NSKB 3ARRA 5EOQH 4CJ0A 2ZKHH 4JZOB 1EXUB 2R0KL 3C6SA 3QEGH 2NY6D 1IM3A 4XXCA 3GB7B 4U0RB 1KTLA 5HI3C 2R9HC 2BVEA 1MELA 2DIJA 3BPLC 4K7PY 1K8DB 2PYEB 2DRUA 1OT1A 4PTUA 1V7ML 4ZAKC 4KZEL 3LS5H 5I1GH 4U7SA 3LQMA 3F7QA 1F2QA 1JYNA 3TYFA 3L1OL 4I13B 4DKEH 4JY4B 1EPFA 4HZLB 2CIIA 1H3PL 1MJJA 4M03A 5DMIL 1CDCA 1HYSD 4EN3A 5F1IB 3BP7A 1RULL 1YDPB 3AREA 1RZFH 4P2CG 1IC4L 1X5ZA 5KTEL 2BVQA 2HT3D 3ARDC 3VXSE 1Y6NR 3UJTH 4P46D 4M4PA 5AG8A 4YHIB 3REWB 5I1AA 1E27B 3U4AA 1JL8A 2XT1B 5TE4L 2HYMA 2WNGA 4P57A 1BOGB 3WN5C 3IGAA 1WFNA 4OI9A 1G9NH 3EDEA 1NC2D 2VDPH 3QEQE 1A3QA 2AK1H 5BZWB 5A2KH 3NFSH 2C4FU 1N64H 5F71A 4PG2C 1YUHA 4M6OL 4NN7C 4U1MB 4BJLA 4HF5L 1LO3L 2GAZA 3VRLE 3R0MA 3TO2B 5L9DL 4EJ1C 4X9GA 2D03H 3VGFA 2BZDA 1OSZB 1TZGH 4HMDA 2D31A 4NHCL 4Z78B 2Z4QA 1Q9OA 4LDEB 3ARGD 1INQB 4FXKA 5D4QA 5IB4A 4KI5C 1IC5L 3UTOA 4UAOB 3DV4B 4Q9RL 2V5MA 2C3HA 4G42B 1WLHA 4MZ2A 4GJTB 4R7NB 4YR6B 3V7MA 3RY6A 2PCPB 4UTBL 4YHMH 4M5YH 4XMPL 4QRPB 3WXVL 3U36A 2ENSA 2ZUYA 1DR9A 2HN7A 3TZVA 5IQ7H 3F7VA 4OFKA 1RZ7H 4NZUL 4P4KD 2H2SC 3Q1SL 3EZ8A 3C09B 5IESL 4I77H 3C8DA 4ZD3L 1U3HD 4W68A 1GIGH 1CLZH 5A16B 5E6ID 3V2AR 3VWKA 5HHXL 4UDTA 1S7UB 4KKBC 3ULVC 2CKBB 2CKBL 3CK0H 1YN6A 3CLFL 5GGUA 2WWKO 1DLFL 4FQXB 3HE7D 1D5IH 1MCPL 2VL5A 3C5JB 4JRYA 5D7LA 2DQFA 1WZMA 1XGYH 4UZGA 3U30C 4WI9A 3GSVB 1RZKC 1LE5B 4Y5YB 5E2TL 5I30L 5I8EA 2BERA 3IFLL 2VABB 2NLJB 4HUVB 4ELME 3LIZH 4MNGA 1TJHH 2EC9T 3O45B 1TTFA 1MJUH 4PJAB 1B4RA 3OR6B 4GRMB 1OF2A 4MXWH 1U8MB 3LN4A 4BM7A 1V7NL 3A6CH 5LCVH 2H1PH 3VXNB 2AEIT 1HSBA 1FO0A 1QVOA 1MNUL 3PV6B 1J1OH 4YBLB 5HYSA 2GJ6D 3PF2A 4LQ1A 4OM1H 1BZ9B 4PLJC 5CEYA 4NM8L 3STZA 2HT2D 4RMVA 2BHYA 3E1F1 2CRYA 3LKOA 3PP3H 4P49A 4LGRB 5JXED 2JKXA 4J8RA 4FQHB 2VDNH 1EVTC 3ESUF 4WO4A 1A6ZA 1XCQA 2VXUH 4QXUL 5J11B 4X9HA 3VXQA 1IMHC 4PRPA 1N5AB 2F58L 4B41A 2P5ED 3O6LH 4CW1B 3CSYA 3DVNA 2JELL 1QSED 2GFBA 2R4RH 3O41B 5KSAD 3UTQA 4G80B 4MMZC 5DDHA 1ZA3B 2XZQH 4FP8L 1T20B 5CD5C 3AROA 1SBBA 1VFAA 2LE9A 4B5EA 1WJ3A 4YO0B 4YXLH 2PO6A 2R1YA 2FD6H 4LCWD 2SEBB 2W60B 2WBJD 4PRNA 3VFTA 1NUNB 2F54E 4HMEA 4M1CD 3KNBA 4JDZA 2FJFA 4PTTA 3MV7B 3PWJA 3DJ9A 4U1LA 4ZYKA 4M4RA 1ZLWH 5JOEA 1I7RB 1U8OA 3FKUS 3FQUA 1K6QH 2AJUH 3AMLA 3DTXA 5MERB 3EOTL 1FYTE 5D5MA 4PFEA 5JQ6L 3VFMB 3UTTB 1EUTA 1H9VA 5CINL 3TFKC 1UQSA 1AGCA 5F7DB 2HFEB 2W0PA 4DK6A 3BP4A 4BFIB 2HH0H 2IG2H 2XWTA 4QY8A 1RUML 3SE9L 1BGXL 3DGGB 1T22A 4QHLA 1WBYA 2HTLC 3HI5L 2VXTH 2H3NB 3LKQB 1S7QA 1OP3H 3V9FA 3V6FA 4YDLB 2Z31A 3KWWA 1VB9A 4EI5D 3T3ME 2HKFH 4NZRL 5FYKD 3K8KA 5FHBH 3ARYA 1UM6L 3C09C 3FQRB 3G5ZA 3BH9B 3KPQB 4HBCL 5C0RL 4X7TB 5EUKB 1IZKA 5DA4A 3QDJB 3FO0L 2KPNA 4NZTL 2VQ1A 3WNNA 2G60L 4WI7A 4NKMA 4G9FB 5CWSB 4ODSH 3FB6B 1I9RL 2AS5M 4FQXC 3SDCD 1SYSB 4KJPD 2H2PC 4AMKL 3QNZB 3QWRA 5TGBB 4MVBC 1D5BA 2HLAB 4NZDA 3MRFA 4KKAD 1NUDA 1JNLL 4DTGH 4RAVA 3QA3A 3FB8A 5TQ0L 1MWAL 3L95B 2E9IA 2MTPA 1U8PA 4R7DA 1J8HE 1MHEB 1P7KB 5DGRA 2NY0C 4OCRL 3NFPA 3BKCH 4I0PA 2BRRH 2YD2A 4KY1H 4F7TB 3SKJL 4HH9B 3TT1H 5KSUB 1G6RA 4ONGH 1BEYH 4HIHA 1IAKA 5F89B 4AT6B 1B0RB 5D1XB 5BQ7A 2R8SH 4XAKE 1ES0A 5KSBF 1U92A 1OQXA 3RUGE 4GLRI 4MA7L 1ZLSH 4YBLC 1GHFH 3QUYD 4HUWA 2DBJA 4NRXA 1CXEA 5GHWH 3TH3T 4ZAKA 1CL7I 2HT4D 4OTXH 4PGDB 3J7HA 5F88B 1KCRL 4G43B 3T1WA 5DS8B 3KS0H 1MFAL 4MNHB 2UZXB 4X6CE 3MLYH 2AJSH 4KRPC 2HFTA 5FEBA 3FOLA 5F9AC 5GS0L 4OZHA 3S36H 4G8FA 4PJIE 3D69B 3MRIB 4LHUA 4M02A 3IXTB 1YNLL 1BREA 3BPNC 1NMCB 2XRAL 1MJ7H 5GZOC 4CKVX 3ARDA 4P5MA 2VLRD 2WK2A 3AUVA 1U8HA 4KVCH 5IB5A 4Z0XB 4UTAH 2KZWA 1FZMB 3M8OL 3NH7H 1PEWA 3DX6A 2FSEB 4TVPE 4Y8AA 1S7XA 1LEIA 1T7YA 3WN5A 5ANME 4IEFB 2XV6B 1E4XI 3EYVB 2Q76B 4A6YB 1P4IL 4A6YL 1VGKB 1ZGLM 4QOKE 3LKRB 3QUXD 2Q6WA 2IQ9H 3RBSA 1XR9B 5EOTB 4JGMA 2A6IA 2QQKH 1OAYH 2Y6SC 2ICWJ 1T5WB 1DUYB 3WE6A 5A2IH 4NN5C 4QRRE 4Z76A 2X4PB 4JCMA 5IT2H 1SJEB 4DCQA 2FZ3B 3X14B 5L0QC 1RQ5A 1RZKH 4K2UL 1VFMA 4GRLD 3W11D 4AIOA 4P2QD 3RGVB 3PABA 1B3JA 1LP9F 4N5EC 3B6SB 2XWBB 4AG4H 3QFDB 2BNRB 4P2OD 2B4CL 5JXAH 2YC1B 1BM3L 1YEGL 4Y2DD 2EE6A 1A1NA 1U8IB 1U95A 5I73B 3HC0B 5D6CA 1T0NA 5H35A 2AJYL 4PD4K 1W0VA 3EHBC 4XPFL 3U7YL 35C8L 5JPNB 1H3PH 2QKIB 5IF0A 4HZAA 1DDHA 2ILLA 1RULH 5DHXB 3VA2C 1Q9KA 4KTDL 3QR2A 5DK0B 3AGVA 4CL7A 3OR7A 1A3RL 1QTYT 1RJYA 3HNTL 3MCLH 4KV5E 4NNPL 4NSKA 3WFEL 4JZOA 2FIKA 1EXUA 3MSPA 4KAQL 2VXVH 3GIZH 3BZ4B 5I8KH 3LQZB 5DD5L 5HI4C 4BSJA 3GB7A 4M6OH 4PJEB 4G8EA 2O5ZH 5L9DH 1T66D 3K46A 5SWSE 4NHCH 2X10A 3JWNC 5J0BA 4XVUC 5GSRB 1GYAA 4OF8A 4YDIL 3DBXB 4MJID 2EE2A 3FN3A 1IC5H 1H15B 4FZ8L 4HZLA 2IQAA 3RWIB 5B38B 3CDCA 5HHPB 2BCKB 4HKXB 5GS0C 4Q9RH 5IVXA 1PZ5B 4WFED 1I9JL 2GSIB 4Y19D 4RFOH 4UTBH 3WXVH 4XMPH 1IVLA 3TT3H 1MRFL 1YMMD 4P3WA 1Q94A 2IH3A 1UJ3B 4YHIA 3H3KA 1B4JL 1E27A 4NZUH 1OHQA 3BKML 3RIAK 1J12A 2DTSA 2Z8SA 1BOGA 5IESH 1M7IA 2LQRA 4NC1E 5BZWA 2BJML 2Y36H 1IGCH 4LSQL 4WTWA 3MMEB 1UH3A 3SDAC 3MBED 5C0CB 4IRSD 5F7EH 4WUUB 2P8PA 1DLFH 5IFAL 4JGJA 1MF2L 1ZGLP 3NIGF 1OSZA 2IBGA 4KJWD 5CILH 4Z78A 3D39B 2P7TB 1KTKE 1INQA 1KB5L 5HYEA 2PXYD 3DROB 4OGZA 5FO9A 3A6BL 2A74B 4WWKD 5FUCE 3WL9B 1UWGL 4MDIA 4NT6A 3O4LE 5I30H 3FB5B 3FQXA 3QWOA 5CLTA 1LHZA 2MMXA 4PJXE 1UACL 3SGJA 3VG0H 1UWXK 4UT6H 1PFCA 4NO2A 2R2BB 4YR6A 4M62L 4JCLA 4TSBL 1OTUD 3FFCA 4QRPA 4P2RD 4HWBL 2B4CC 3ZSTA 1AI1L 2GKIA 4LSRL 5D7JD 5LVEA 1KTRL 2XKSA 1JE6A 4LLWA 25C8L 5I73C 5KAQG 4HIXH 1U3JA 4N0UA 3UO1L 1FFNB 3MRGB 4P3DB 3O81A 4NM8H 3WS6C 3SE3C 4HS3A 5A16A 5DUML 4AL8L 5DHVH 2X1OA 1Y18B 4LVNC 2CKBA 3TPUB 3HZYA 1CVRA 3Q0HA 2DQCL 4FQXA 3ECBB 4HDIA 3RZWA 3HG1D 1ZK9A 3QI9C 1VDGA 3IDUA 3T08A 5I1LB 5J13C 1T4KA 4P99A 1OAQL 2F5AL 4YHOH 2YMXL 2P5WD 3MROA 1DBKL 2JELH 3ZTJG 1YNTB 3GSVA 1YPZE 1LE5A 5I8CA 4XPGL 1CICD 2G75A 1EFXB 2P24B 4KKCC 5EOCJ 4WEUD 4WTXA 2NLJA 3VMOA 1M05A 2H41A 1MCFA 3ARFB 1B6UA 4UV7L 4NNXB 2V9RA 4X80H 5F7WC 5CJQL 4KUCD 3L6FB 1AGFB 1X5GA 1FIGL 4GRMA 1C5DA 3QEQD 3RL1A 4Z5RB 1U8MA 2A6JA 2DD8L 2OL3B 2Z91A 4PJHB 1UJTA 3PV6A 1UCTA 1IAII 1KCVL 4TUJB 1BZ9A 4YHNA 5JQ6H 3B43A 1I75A 2NY3D 3ETBF 3NIFE 4GKZB 4OD3H 2FECL 1OP5K 1CR9H 5CGYD 3TV3L 3G04A 5EU6B 1XMWA 5IM7A 4PUBH 3V6ZB 5CZKA 1RUMH 1BBJB 3SE9H 5HHQA 4L4JA 2WM0A 1QR1B 1KPUB 3EUUA 3HI5H 4JFPB 1N5AA 4CW1A 4PJ7E 3O41A 4G80A 3FT3B 4NZRH 5C6WH 5JTWA 4UILL 3H0TB 4YO0A 1FN4B 4OZGB 4OV5B 5IMMB 3B9KB 2WANA 1Q9WA 1OVZA 1I9RH 2DQGL 5ID1B 3W82A 1I7RA 1A9BB 1U8LA 3VXRB 1R3IH 2ZSWB 4R4FH 4YDVB 5D5MF 3K81A 3DURB 4XTRC 2EIBA 3UTTA 1VERA 2YUZA 1QNZL 3WIIL 2XA3A 4RFEB 1C5BH 3DWTA 4HUKB 1JK8B 3HR6A 4CN1A 3TIEB 2EC9U 3ULUL 2R0WH 1QRNE 2IADB 1UKSA 4RBPK 4I9WD 1Q1JL 4BFIA 4DZBB 4XC3L 4EBQH 4DVBA 4BSWB 3AY4A 1K2DB 5MEOB 3V8OA 4CN6A 5DEFB 3DGGA 2R2EB 3SKJH 1FNEB 1WBXA 2FHCA 4HSQA 4U31A 4UU9B 1ZEAL 5EORL 3PWPB 4M7LL 4JFOB 1W0WA 5SWQB 3ILQD 4APQC 5GS2D 2MCPH 3SBWC 4NQED 5TDNA 4HKBA 4OCYL 3CH1A 2CR3A 1NCBH 3BH9A 3KPQA 5EUKA 3U82B 3P11L 1X5XA 4XMLL 1HK6A 4ZFGL 3QDJA 3GKWL 4JFFB 3QAZB 5FOJA 5LGKA 2VDKL 2WINB 1KCRH 5CWSA 4LF3B 5IB1B 5BZDB 4LOUD 5F7MC 1JGUL 4DQOL 4IIQC 1KIRB 2KKQA 3FAXA 3QNZA 5KVGL 5TGBA 2HLAA 1A7NL 3GM0A 5CHNA 2F8XC 1MWAA 3FO9B 4I1NB 1JZ6A 1I85A 3UC0L 3HE6B 1TTUA 3HLAA 1P7KA 5C0JA 5DGQA 4HWEL 3TM6A 5GGSY 5E6YA 3L3KB 5D2LE 2BOBA 1GXEA 4ODHH 2BNQE 5DJXA 3TJEL 4F7TA 3NCMA 4HH9A 4UB0L 5KSUA 4X6BB 4WEBL 4XP1L 5HGBA 1NQBA 4QNPF 5TE6L 2FDBP 3IDIB 3U4EA 4AT6A 1B0RA 5GS1C 3OKKB 4MLSA 3MLUH 4IRZL 4LLMB 4U6XB 4LPCA 4ODBD 2CGRL 3UJJH 2VUYA 3HRZB 4ONHB 4HHAA 4NQDB 5F88A 4G43A 1G7QB 4UUJB 3CVIL 1FFRA 2Q3ZA 3ZLQC 1NCNA 4U2ZA 3CJJA 1UZ6E 4NZJA 4PP2A 2DBLL 5D93C 4H1LH 5E6ZA 5T1LB 4OZHF 5JW4M 3IXTA 4ZUSA 4BFEA 3P4MA 2O61A 4OD1L 4R90L 4WU7A 1QSFB 2B4CH 4Z0XA 4JFEB 3OPZH 1MI5E 2F53A 4XP5L 1XT5A 2YRPA 1YEGH 4WHTB 4KPHL 4MXQC 3TVMD 2Q76A 3T65A 4A6YA 1RMFL 1VGKA 2AJYH 4L3EA 3LKRA 1OB1B 1AC0A 5SWZB 5HYSG 2BSRB 4XPFH 5H2BB 1RZJH 3SDAA 1YEJL 3W39A 4P23D 5EOTA 1Q0YH 2VZOA 5IFHL 3ZE0F 3W5NA 4XGZB 3IAGC 5CZVH 3GSQB 5CIPB 4KTDH 3QO1B 1T5WA 4KKLD 3QO0B 4QTHB 3C5ZD 2XKNA 2X4PA 1SJEA 3ULUC 4KI5F 5ALCL 3X14A 2BDNH 1JPFB 4NUGH 3BO8B 3HNTH 5IW6B 1DBML 3WFEH 5CD3B 4FRWA 1Q72H 3MLTB 3MNVA 4U6VH 3RWJA 3KPPA 4C83A 3I84A 3K80A 4GG6A 4OB5H 4CDHA 3TN0D 1E0OB 1U8IA 2GJZB 1BVKA 3HC0A 4FQJH 3RHWF 4IOSD 3ZKND 4W6WB 3ULVF 5E8DL 1ETZB 5DJYB 3E6HB 2QKIA 4WFGE 3PP3K 3JTTA 4XPBL 4C55A 3U48A 4F9PC 5DRWB 1I9JH 3QI9A 4H8WH 4L4VA 4PG9A 5C0EA 4ZQKA 1DEEB 1RURL 5DK0A 1I3VA 2VDMH 1BAFL 5HHNB 4N9OB 1B4JH 2F15A 2PR4L 4KHTL 2NY4C 5DJAB 4CU7A 5FB8A 1IM9D 3G5YB 3VXUA 3X12A 5D96C 3X11B 4L9DA 2BJMH 1IFHL 2A9NH 2IPUG 4LSQH 4OCWH 3O9WB 5HYJD 3L5WA 2X70A 5ENWA 4PJEA 3HZKA 4L5FL 5IFAH 1MF2H 1NFDE 3UEZA 1S7SB 2XOTA 5JA9A 4IRJD 1KV3A 5EIVA 1SEBA 5M95B 3QCVL 1PLGL 5GSRA 2VZ1A 4PLKD 2E7CA 4U1IB 1UWGH 3GJFH 3LOWA 4ENED 1H15A 3RWIA 1O7VA 3IDXL 3KPLB 4OIIH 3ARWA 4QRRD 5IVXF 4PBVC 1YY9D 1WFTA 2G9HA 3GBNL 4JFDA 4M62H 4MJ5A 4TSBH 3KVQA 4LQFL 4HWBH 1S9VB 3QXUA 4JPIA 3PHOB 3D3VE 5FCSH 1NDGA 4TVPL 3WHE0 4XPAL 5HSFA 1OTSC 3B9AA 2HJKA 2P8LB 5EC2B 1JVKA 2BNUB 1ZGLA 2CMRL 4P5TC 4MNQD 3RX8A 4Q6YA 3MA7A 1FJ1A 3IJHB 4M3JA 2JIXB 3V4PL 1I7UB 5DUMH 5FGCB 1FNAA 3Q48A 1M7DB 4NRZA 5HI5C 7FABH 5C0CA 1JUFA 1VADB 4O5LL 2APBA 4Y16B 5DEGA 4UI2A 1FZKA 2D7PA 3R4DA 3QUZD 3D39A 2V9TA 1CDUA 1KB5A 2XQYG 1OAQH 3DROA 4M9PA 5FYLE 5F70A 2MOVA 1J0HA 1MIEL 4LHUG 1CT8A 3FB5A 5GGQL 4PJFE 4X8JB 3CH8A 2Z93A 1XIWD 3DX7B 1FFOB 2A6KB 4UV7H 4B53A 2O5YL 4M1DH 3ZTNL 2EDOA 4HWBA 4D9LH 1JWMB 2V5RA 1CZ8L 4XB8A 3RZCB 3RVUC 4X7SH 4RIRB 4APQA 1CXHA 2DD8H 4XH2B 5ECJE 3RFZC 2IPTH 2A0LC 4D3CL 2PTUA 4GW1B 3KPRB 4LCIL 1DQQB 3QIBB 1KCVH 1FFNA 1RIHH 4P3DA 4LVEA 5KG9A 3ZZ1A 2X42A 3BP5B 4PLNC 3WBDA 1XF4B 1HDMB 3RKDD 2N7AA 5BVPH 1QG3A 3JTSB 1KSRA 5HHME 2JJUA 3ZKQD 4M8VA 5A43C 5I1LA 2BY2A 4IIQA 3DUUB 2HG5B 5L6YL 2UWEB 5CEZE 5DJ8B 1YEDB 5E5MB 3FCTA 1FLRL 1T1WB 4LASL 1YNTA 2R4SL 3MRRB 4TUKL 1DQMH 1U42A 1J18A 5ETUA 1TVBA 3WIFB 2D7MA 3V0AC 3LN5B 1EFXA 2CO7B 2P24A 3WSQL 1HCVA 2YUWA 5GSVB 3T2PA 3HC3L 4BFGA 4NNXA 2FEEL 4GLRH 5IG7B 2LAGB 4Y1AE 2AW2A 1OLLA 1AGFA 4U3CA 5FGBC 4X83A 1KENL 5BW7C 1CL7H 1AFVL 1CFTB 2IH1A 5GS1A 3IT8D 2ZCHH 4KQ4H 2YA2A 1CDBA 4PJHA 2H9GB 4TUJA 3NCBB 5HVFB 4P3CH 3K8LA 4Q0XL 4YHLH 1KTDB 1RK1B 4Y7MA 5T3XL 2JTDA 1QBML 1FZOB 2BVOB 4K8RL 3L3DB 3VW3H 2D9CA 5B22A 2Z92B 1Q1JH 2BFVL 3TEUA 5BS0B 5IHZB 2BOCB 4XC3H 1C12B 3DVGB 3V6ZA 4DN3H 3O4LD 5D71L 3QDMD 4CVXA 5JMOC 4JFPA 5DHYA 2KQNA 3WHXB 4PJDB 2RGSA 1L7IL 2B1HL 3O3BA 4ZOBA 3FT3A 1WCQA 5E00B 1T80A 2BSSB 4OCYH 2W9DH 5ICYB 4I3SL 3H0TA 1LO5B 4OZ4B 1FN4A 3OX8B 4BKLB 3DXAB 3O0RL 5EOCL 3A6OA 3P11H 3KYOA 4XMLH 4OV5A 3GKWH 4WUKL 2VDKH 3BHBB 1RJLB 5LJYH 4J4PA 3O3AB 3QQ4B 5ID1A 1A9BA 4EOWH 4ZUVB 1JGUH 2DM7A 2ICEA 1KUMA 4DQOH 1NDMB 2NY1B 1KPVB 5JHDE 1DBBH 4MHHI 3UJIH 3Q6FB 4OF5A 5DMGD 4RGMB 3DURA 4S10A 3PWUA 3UP1A 2NY6B 4WHCA 1WTGT 3B9DA 4G5ZL 3SCMC 4G8IA 4RFEA 4Q9CA 1Z6JT 2QQQA 2X1PA 4XNQA 3GHBH 4MGXA 4DZBA 1WFOA 4BSWA 1K2DA 4JJ5B 1ORQB 3TJEH 2R2EA 1FNEA 4WEBH 4XP1H 4UU9A 2XG5A 3DX9A 3PWPA 1RHFA 2JCCF 3RZCC 2J6EL 2B0SL 1NAMB 2QBWA 4BH8A 3RVTD 1QFUH 3LKSB 2AEPL 1FBIH 4H88L 2CGRH 4GFTB 4J3TA 4JFFA 2WINA 2DAVA 4JM2C 4ALAH 3CVIH 4AENB 3ZDYF 3E0GA 1MAKA 5FK9A 2BMKA 5IB1A 4P46B 1A1MA 3CX5K 3F58L 1JGDA 3C08L 3VWJC 1KIRA 1JZ8A 4HK0B 1K5NB 4HJJH 1JYXA 1NC2B 1MHHB 1IQDB 5I6XC 3LHPH 3SKOA 5DK2B 5LXGL 1QKZL 3FO9A 4M48L 3Q3GB 1MH5B 2DYPD 4JM4L 4ORGB 5DD6B 1KN2H 4G7YL 2YPVL 4HWNA 3L3KA 4NKIL 1RUPH 2J8UA 4QF1B 4U1KA 4IS6A 1BQHB 3ARGB 1ZHNB 2FB4L 3V52L 3IDIA 4Q7DA 1L9NA 5HVWA 1AIFB 5DZNA 3HNVL 1YEJH 1G84A 3T0ED 4AM0B 3G6JB 5IFHH 5EBGA 3MPCA 4JRWA 3B2VL 4PJ5B 3OKYA 4X5XB 5AZ2L 5JZ7C 1S7RA 4JY5L 3HRZA 2AEWA 4ONHA 4JPWL 5DQDL 3U0TB 3W0WA 3ZT7A 1G7QA 3DRTB 4PRBB 4UUJA 5ALCH 3L7EB 1I1CA 4K8RC 4QRUB 4HEPG 1DBMH 1PKQE 3QNYA 4KUZH 5EC1B 3SDDD 4JANB 5E9DE 1HI6B 2QV2A 2MFNA 4P4KB 5FGSA 1JV5B 2IPKA 3U4BH 1U3HB 3EYUL 4KHXH 1B0GB 2G2RB 1QSFA 3TBTB 2JJSA 4NC1C 1AD9B 4JFEA 1X7QA 5DD3L 5I1EH 4P5TA 4NCC1 4XHJC 1FPTH 3MRJB 5FV1L 3LS4L 2FWOB 5DHVB 1OB1A 5SWZA 5B3JF 4JN2B 4LL9A 4M7KH 3H9HB 1J0JA 2YWYA 4FFYL 2BK8A 4B7LA 4HXBH 2B2XH 4XGZA 2O26U 5FUCC 5CIPA 2CPCA 1X5HA 3NABH 4WENB 1BAFH 5HJ3A 1RK0A 4HLZH 3VFNB 5IW6A 3BO8A 5MEND 4PJGE 5IVNA 1TNMA 5CD3A 2VL4A 1D3CA 3QXVA 1QBBA 1H3VA 5A40E 1CFVL 1IFHH 2GJ6B 3VA6A 2ESVE 1NBYA 1DE4B 4S2SB 5MP6L 3D5OF 5DLML 1QPXA 3NPSB 3ALWA 4GG6F 1E4JA 5HGAA 4JPVH 2X2YA 1JI1A 4HWZB 3RWGB 1HYSC 2QHRH 5J57B 3HHRB 2EDWA 4R2GC 3DNKA 1S8DA 4BQ9A 4LAQL 2HT3C 3M17A 3TPKA 1XR8A 4YC2B 1UXWB 1JFQL 2P5EB 4IOIB 4OFYA 4NUJB 4P46C 1QSEB 1ETZA 2FGZA 4JY6B 3O2VL 5KSAB 2Z9TA 3IDXH 4PGEB 3CGTA 1UXSA 1V8HA 5CKGA 2YWZA 5D1ZD 3S34L 4Y4HD 2YKLL 3EO0B 5DRWA 1SBSL 1DEEA 1BVLB 3CFKB 2P1YA 4JVUA 2WBJB 5TF1L 5I76B 1FC2D 2ICWA 5EUOB 3WHE1 3PGCA 4TVPH 5BO1H 2ED9A 1PQZB 2OTWB 5DJAA 1A5FL 4LSVH 2FYYB 4HXAL 4X6FB 5BXFB 2HTKC 1MI5D 1S7TB 1KJ2B 1KJ2L 3QUMH 2AJVH 3ARGC 3N9GL 1ZT1A 2B1AL 3NA4A 1TLKA 4V1DE 3MV8A 5BW7A 1UCBH 4ODTL 1EA9C 1S7SA 1EEYB 2MJWA 5E2UH 1P7QD 2EO1A 3Q5TA 2CDGA 5CCKH 5KVMC 1HQRB 5E08H 3MV9E 3QJHA 3UROR 4NWTH 4U1IA 1ZXQA 4V2BA 3UPRB 2D7TL 5GGQH 4C58B 2JE8A 4EI5B 2V2WB 3NIDE 1AP2B 3KPLA 4NJAL 1PEZA 4LLVB 5GGVL 1EJOH 4F7EB 5IBUG 2O5YH 4LCYB 2ZNXA 3ZTNH 1D6EA 5F9OH 3PHOA 5E6IC 3FO1A 3OKEB 1NCDH 1XF3A 3CVHB 3CVHL 2BY3A 1T1XA 3V5DA 5EC2A 2VLJA 5J1AB 1QFHA 1CK0L 3SDCB 4D3CH 4DEPC 3MLRL 3T8XA 3HE7C 3V6BR 2HVKB 2QQNL 2JIXA 1YYML 1ZS8B 4LVOB 5FOBB 1I7UA 5K93A 2IFGA 1U8KB 1M7DA 4LNVA 5HVHC 5HGGS 1VADA 3VXTA 1TVHB 5I74C 5LGJB 5J3HD 3O6FD 3L3JB 2GCYB 1ZLVH 2HJFA 4WFGD 4Z7WB 3KXFD 1T03L 2PETA 2R0ZH 3BPOB 1PD6A 3BEVB 1INDH 4GO6B 4JHAL 1T6WA 2R4SH 4YZFF 5DUPH 3VDCA 2H6PB 4TUKH 4BZYA 1AC6A 2YD4A 1KIPB 2H32H 5K33A 3DX7A 5C08A 1FFOA 3HC3H 2A6KA 4NKOB 2W1NA 3QUYB 2HWZL 2CRIA 3BD3A 1JWMA 1KENH 3PV7A 3RZCA 1AFVH 1HHJA 4RIRA 4U1NB 4XH2A 4POZC 5JXEC 4LPYA 1S9KC 2J12B 4C56E 4ODWA 1WCBB 2UYLB 4GW1A 1UENA 3B2UD 3VFRB 3E8UL 3L9RB 5HYQB 1E4KC 1DP0A 1IKNC 4MSWB 2PF6A 4MQ7B 3HPLB 4Q9QH 1TPXC 2VLRB 1XF4A 5KSAC 1QBMH 4K8RH 4BZ1L 1S9YB 5E2WH 1I1YB 2BFVH 3NCEB 2DQTL 3JTSA 4H1LB 3KYAA 3HFML 3SPVB 3VWJA 1R3JA 4U3HA 4F58L 5DJ8A 4NKDA 2WBJC 2YZ1A 5E5MA 2GITA 1ZWIA 1C08A 1T1WA 4IMKA 3LRHA 1L7IH 3OAZK 2XA8L 2ZOLA 1ZT4B 4XAWL 1AXSB 4BUGA 3EJZD 5D1QD 3INUH 3QUXB 5DRXB 3DOSA 4RX4D 1A7BA 1BOYA 2FH6A 5GSVA 1IILE 3O0RH 3NCCB 3TO4B 5IG7A 4DOHE 3RQ3A 1R3LA 3RDTC 1CFTA 4DVRH 4JKKA 5JW4R 5FDWA 2EDQA 4Y5XC 1HHKA 4GRLB 4PJHF 2VZSA 3D1MC 4P2QB 2XN9E 2QR0B 4PV9B 1WSST 2EXYD 2R69L 3N1MC 2CK0L 3MNWB 4ODVL 4N0FB 1KTDA 2FLBT 4OAWB 1DZBA 4OZFB 3L3DA 1IEHA 4TVSa 5BS0A 5IHZA 3D18A 5L2KE 1C12A 3KLSA 3DVGA 1BPVA 4Y2DB 4E5XB 4XCCL 5C2BL 1FL6B 5CZXD 4TNVF 2AJZA 3OXSB 5FYJD 4KXZI 4TUOA 5GXBB 5IJVA 1GGBL 1E6JL 5T3ZE 5TPWL 1P5UA 2J6EH 4M93B 4K9EH 2DKMA 2BSSA 2Q1EA 5ICYA 1LO5A 2AEPH 4OZ4A 1LO0L 4OLZL 1CE6B 4NHUA 4HKZB 4BKLA 3MRHA 5F7HA 1KBGL 1F90L 2KQMA 2WLYA 3SGDH 1FAIL 1RJLA 4KKAC 5E2VL 4RNRB 3O3AA 2FX9H 1NFKA 5EU4B 1HXYA 3OKLA 4ZUVA 1AO7D 3H9SA 3ALPA 1NDMA 5FYLL 3GMRA 3C08H 1WICA 2EKJA 1KPVA 4YXKH 1I3GL 2VWEE 4PRHD 5B38G 4M9OA 1JN6B 1KB9K 2X4OB 3ZDXF 5HHMD 5LXGH 2Y9RT 3SGEI 3ULUF 3CFJA 3WFCL 5CEZD 4JM4H 1D9KC 4GAFB 1P2CB 1UEYA 2Q7NA 4PJBB 2BRQA 1XGPB 4EXKA 1ORQA 4QXTB 1JZ3A 3ET9F 3QUYC 4HV8A 1DLHB 1EFQA