1KIQB

Fv mutant y(b 101)f (vh domain) of mouse monoclonal antibody d1.3 complexed with hen egg white lysozyme
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
QVQLQESGPGLVAPSQSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLHTDDTARYYCARERDFRLDYWGQGTTLTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTIBODY D1.3
publication title Hydrogen bonding and solvent structure in an antigen-antibody interface. Crystal structures and thermodynamic characterization of three Fv mutants complexed with lysozyme.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (immunoglobulin/hydrolase)
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 1996-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kiqB00
4HWNA 4LOUC 2BXZA 1YJDH 3E3QC 5D1XD 1QSED 4OCXL 4TVPH 3U9PL 3QNYB 3HUJE 5J3HD 4U6HB 3GRWA 1P7QD 3UDWC 1LO4H 5HHNB 3N06B 3D2UA 5BOPA 3GSQA 2DDQL 2FL5B 1U8PB 4L1HA 3RWDA 4AM0B 4MVBC 3QDME 3CSYB 2CGRL 2X6MA 1OAYH 1S9WB 3GMOA 2IADB 1S7VB 2P8LB 1A6WH 1WBXB 4MNQD 1G0XA 3ZYOA 4Q0XH 1II4E 4HWEL 5E94A 1AXSB 1EO8H 2OX5A 1P7KB 5C07E 4P2RA 4K2UL 3ELAT 4ZOCA 3DO3A 2CDFA 4RNRA 5DDHB 2FGWH 1ZSDA 5CJ8A 4RIRB 3RVWC 2CUHA 1Q72H 2CMRH 4XP6L 2ZNXA 3G04B 1YYLL 2BC4A 2FECI 4Z7WE 3B9KD 1CK0L 1SYSA 3DOSA 3MLYH 3WD5L 1FL5A 1AIFB 4HKZA 4YDLB 4L4TE 5EBMA 4HPYL 4UIKL 3VRLE 4XCNA 2ESVD 4BYHA 4ZPVA 1S7WB 3GDBA 3O11A 5GGTH 4DN4H 3N85H 1S78D 3VXME 1WIPA 1MHPL 3TNMA 3PL6C 2QV2A 1RZ7H 4U1KA 5DGRA 5HYSG 4OAWB 3KPMB 3K4DA 5D1ZC 1FRGL 1S7UB 3Q6GH 2NLJB 1T5WA 1ZWIA 2VUYA 3HG1E 4ZUSA 3I9GH 4M5ZH 4XCYB 2X9XA 3QG6B 35C8L 5EC2B 1AGEA 4MD5A 4NFCA 4PJ8D 2D0GA 4XPFH 1A6TB 4O58L 4UBDC 1JNJA 4KQ3L 4FFWD 4I0PD 4N68A 4A6YH 1G6RA 1Z0NA 1UQSA 1RZJC 5JHDA 1WK0A 3FKUS 2V5YA 3HZVA 4LASH 1Y0LA 3V0AC 1QBBA 3E6FA 1I1RA 2VDRH 4IMKC 3MRNB 4JR9H 5DZOA 5C08A 3BSZL 1NSNL 2V7HB 5FCUH 1J8HA 2RFXA 2CR6A 4FQLH 4K94L 4K7PL 4XNUL 4MMXC 3T65A 1OAQH 4UT6L 4X6CE 3TVMD 4UOW0 1KTKE 2FWOA 2R2BA 4M8QB 4ELMB 5ILTH 4KJPD 4G5ZH 4N9OB 1JWMB 1UB5A 5JNYB 1UACH 3RZCB 4O2FA 5ALCH 1SJEA 1RIUL 2NXYD 3TO2A 3E8UL 5F96L 2CUMA 2NY6D 1KYOK 3BW9A 4I18A 4PJXE 1KCUL 3OKDA 4DVBA 4U0RB 4R26L 3RIFF 3SY0A 4LCWA 4NQDE 4PRNA 1J0YA 1ORSA 3UYRL 4HEME 3TA3A 1ORQB 1TPXB 1EIBA 1HHHA 1YNLL 2R15A 3VXPB 3VDAA 4P3WA 2OK0L 3L9RA 3OJ2C 4KJQC 4U3HA 5KW9H 3EO1B 1OTUC 3NZ8B 2J5LC 4FQHB 3O3DA 5JXAL 4NKIH 5TE7H 1J87A 5FO8A 3OXRB 1B4JH 2WV3A 1UM6L 1G9NC 1PDKA 3IDNB 3RGVC 1QNZH 3RWJB 2V5MA 3HE7A 2XKSA 4OZIB 1I1AC 4LNRB 4Y4HD 2WINA 4HX1B 1RIVL 3MYZA 3NAAL 3TN0D 1MWAB 2EDOA 4FG6C 3SDYH 4LK4A 5JIKA 3X13A 2PW1B 3EAKA 4U6XB 5HHVL 5ITBH 4MB4A 4I0CC 4QT5B 5HGDB 1LK3L 2XKNA 3I02B 2ITCA 4XCCH 3B43A 5FM4A 1U3HD 4PB0H 3QCUH 1SM3L 4OM0L 1EXUB 5IB1A 2AJXH 4OI9A 5L2KA 2W9LA 2QADB 1F4XL 1OVZA 1EJOH 1KGCE 1YPZA 4IIQC 2IH3B 4M62H 3RGHA 1FVCA 4KRPB 3BP4A 3CK0H 4ZODA 3TIEB 3WLBB 1TZIB 5K93A 1FC1A 4EXPX 1RIHL 2R0WH 5J4MA 2XIDA 3MODL 1TZGH 3ZDZE 1G9MH 1AGCB 3CXDL 1NCAH 4K23H 1F3RB 4XAWH 4KU1A 4JPKL 2E6JA 4BZ1H 4B7IA 1J9CT 1T20B 3PV6A 5HGGS 2WLYA 1E4WL 1T4KA 2Q7YA 5FGBA 2IGFH 4ONGH 5E00B 4CVZB 5CSBA 4GRMA 3C5SB 5L8KB 1A7NL 1A6UL 4M4RA 3VFTA 4O5LH 1OAZH 1WWWX 4WGVB 1R5WA 4FQCL 2VQTA 4N0UB 2BRRH 1ZGLP 3HR5A 3C9NB 5TQ2L 3ULSB 4RDQG 3RFZC 3SO5A 3OXSA 4H0IA 2O5YH 4R4FL 4Y16D 3QO0A 4CDHA 4Z7QF 3UTOA 4MJ6A 5IMMA 2VN4A 3S36L 1D5XA 3VD5A 4PLNC 5DI8B 2FO4B 3V5KB 3F8UB 3GMRB 1XF3B 1NUDA 2IAMB 4MNHA 2XWBB 2PO6A 2BNUB 4KK8C 4Y5XC 4YZFF 4ONOA 2QQLH 3WXWL 1C8PA 5HI5C 5C71A 4HDIA 2NY4B 5FECB 3BPNC 4C56B 2D7NA 3AROA 3P77A 1KB5H 3BKJH 5AYQA 4MA7H 3TLRA 4M03A 4NQUA 4IEFB 4LDOB 5I18H 4L4JA 2IQ9H 1M7IB 3GIZH 2P42B 4PJDA 2VLKD 4K9EC 3V79C 2OMBA 5FGCB 3IDJA 3RWIA 4YXLL 1CT8A 4OLXL 3RDTB 3P73B 4XBPA 5KN5B 4Z7VF 3DMMC 5MI0B 4GQ9L 2QSCH 1YQVL 3SPVA 3C08L 1INQB 3VGDA 4F8TA 1CFTA 4NQTA 2NR6C 4P3DB 2VDNL 2QQKL 2H41A 2CK0L 4NQSA 3DTXA 3A6CH 1U8KA 4D0BA 5T1DL 4HXBH 3WDJA 1JYNA 1LE5A 4CJ0A 4DZ8B 5F7FA 1FFPB 3HTLX 4RQQA 1ROWA 3TFKC 3FT2A 3KPSE 4GMTH 3WS6C 5KAQG 3NGBC 1T1YB 3OF6D 1VGKB 5EU5A 2APVA 3DV4B 4WEBL 3VXQB 5CP3A 3FAXA 1NKOA 1H3PH 4H88L 2DWEA 1MJ7L 4HH9B 5ITFA 2GT9B 1B2WH 1A14H 1FNGB 2F19L 1E27B 4YK4B 3FB6B 1QBAA 5SWZA 3WXVH 1DE4B 3VA2C 1MVUB 2D7PA 4LSPH 1MCJA 1PLGL 1FYHB 1LDPL 2BOCA 2X1XR 2P7TA 5GRJL 3HNTH 4FMKA 4UTBL 5DQ9B 1U91A 4XBEL 2KUTA 2QHLA 1OAKL 4Q9RH 7CGTA 1VADA 5DMIL 1KTDA 1NAKL 5EC1B 1VDGA 5K59E 3W0WD 5E08H 3S88H 5IJKA 3VFNB 3HLAB 3WJJC 4XVTL 1NAML 3H42L 3FZUD 1NCWL 3L7EB 1MFCL 1N0XL 4MJIB 2BSTA 3RL1A 4YNYB 3QQ3B 5GS1C 4NQEA 4GBXB 4IMLB 2HTLC 2O5ZL 4HD9A 3T77B 5IBUG 2EZ0C 1AR1C 5MP6L 4KRNA 1G7JB 3DYMA 2MKLC 1N59B 2Q8AH 3RY5A 4I3SH 5D96C 3OAZK 2R2EA 1BZ7B 4ZUWA 2GSGB 1CD1B 3WIIH 5MENA 1ZA3B 3P4OA 5T1KB 1KJ2A 4AT6A 1G7MB 4TUKH 1U2CA 5I30L 4G6FB 1IGMH 4ZDHB 3CPLA 1HHGA 1CFSB 3BXNB 3EDEA 5DRXB 4NZTL 4ZFGH 5JLZB 3DJ9A 4WDIA 3RZWA 1KUMA 2H2PD 2EEAA 2HYMA 3P0YL 2BMKA 4X5XB 4EDXA 4RX4A 3MV8E 2CRYA 2X70A 4M1DH 3MRIA 3PG2A 3QUXB 5IB4B 1QLFB 4MDIA 1CCZA 5D6CA 1W0YT 2LU3A 2VXVL 3CMOH 5E2VH 2YD5A 3GSRA 3OJVC 3ZHKA 4J6RH 3GBNL 1IEHA 2HRPL 3VXRD 4R90L 2J3SA 5I8KL 3AMKA 4PRBB 2M2DA 3GB7B 3L3DA 1MJUL 3T3MF 3QG7L 3RVUD 3OR6B 3BUTA 4YE4L 3K80A 3ZTJH 4YHZL 4F7MB 2PYEE 5T5FL 3TH2T 1H3UA 3ILQD 1JYWA 3O4LE 5HHQA 1MWAH 3BD5A 2LAGB 2YN5A 4XP9L 3PWLA 1RVFH 1KTLA 4ZO7A 2Z31A 4XHQA 3MJGX 1J11A 2AV1A 1R5VA 2P43B 1E4KA 3VXSE 3BJ91 4I48A 3GKWL 3DO7A 4HF5H 2VR5A 4X6FB 1A6VH 1CS6A 5IQ9B 2UWEF 3LQZB 5EPMB 5IGXH 5EZOL 5C0IB 2GTWB 1U8HB 4K3JH 1JMXA 2XXMB 3ZKQD 43C9A 2NX5A 4M6NH 2R4RH 4KWUA 1XAUA 1RSFA 4L4VE 4N8PA 3TCXA 4DCQB 4J8RB 3SKOB 5TDNB 1I9RL 3O3BA 5EBLA 5HHOD 5TF1H 3FHAA 1T7WA 3EFDL 2IJ0C 3AAZA 4HULB 1PAMA 3MA9L 3DX9A 1DBAL 4NM4L 1G6VK 2A77L 1C5BL 4CVXA 3NABH 4H0GA 3UO1H 1NGYB 5FYKU 1ITCA 1M1SA 3U36A 3TBVA 2EDBA 3BP5A 3F7RA 4JFDD 3DROA 5I0ZA 2ZUWA 1QSFA 3BP6A 1CFNB 3MV7A 5C0AB 4TUOB 3SJVE 2XTJE 2X1OA 4N1HB 5E9DB 3V4VH 1TMCB 5FGRA 5KSVB 5HJ3B 4RGOH 5DMGD 4FFZL 4PRHA 4HJJL 3HZYA 4NP4L 3GMQA 3SCMA 3TA3C 3OX8A 4K7FA 5D2NB 3THML 1V7MH 2B1HL 2AXFA 2CRZA 4APQA 4GW5A 3DX6B 1QLRA 1JK8B 3AS1A 4LLQB 5EO0A 4RA0C 2F5BL 1VGEH 4M1GH 4TSCL 4ZOAA 5EB9A 4QOKE 4U6VL 5B38A 2R0LH 4LVOC 5CEYB 3VG9C 3D39D 2KKQA 4G9FB 3VXNA 3MJ9L 4Z76B 4B53A 4EEEA 3HE7C 3EDFA 1ZOXA 4CMMA 5FOBB 2J2ZA 3T0XA 3QPQC 3H9SB 4FQ1L 1BFOB 4TTDD 4X0KB 4EJ1C 3F7YA 4DW2L 3O2DH 4HJ0D 1NGQL 2DLFH 1XGPA 3N1PC 4LVNC 2PXYD 4ZTPH 2ARJA 2EDRA 4WI9A 3SGEI 5A2IH 4LLAA 4F33A 4PRID 4NZUH 1TIUA 4HFUL 1I7TB 4P9HH 3H0TB 5LQBH 1SYVA 5TF0A 1UADC 1S9XB 1FVEA 5T3ZH 1N5AA 3QCTL 3O8XD 3LKSA 3RUGB 3L5JA 4KTEH 4P23D 1LO3H 1CGTA 1EH9A 4TVSa 2AXGA 3ROLB 1DR9A 5DLMH 1OARL 5AZEH 1D5MB 2ZJSH 1EAJA 2F54E 2F53B 3H9HA 4JCMA 3QNZB 5GIRB 2DYPB 4RGMB 4HFWA 4XX1E 1TVHB 2VXUL 1QFWI 2QQNL 4G6JH 4XGZA 5FCSH 4LSDA 1ETZA 2I9TB 4HT1L 3LN5B 3DURA 5LWYL 4QEGA 4N0RA 3ZDYF 3G6AB 1JNNH 3EOYG 6CGTA 4OCMC 3UTSE 5DRNA 4PJFA 5I1KH 1S7XA 4KVNH 4WNQB 5E1AB 4FQ2H 1BECA 4MSWB 4E42B 1A7PH 5HHXH 5CJXA 1TCRA 3BRFA 4P2OA 4DK3A 4P49A 1S3KL 2AJUL 4X80L 5AZ2L 4Z7QE 4OLZL 4DTGL 2DF3A 5JTWA 3ARED 2XRAL 3TYGH 1PG7W 5GRVK 1NEZA 5BVJB 4HMDA 1VACB 4AIZB 2GW5A 5KANI 5D7JD 2LV4A 2GITB 3FOLB 3FTGB 4EZMA 1H0DA 4YZFE 2WP3O 3GBMH 5B38G 3ARWA 1MUJA 3L3HB 1F11B 3V6ZB 2NY2D 2PO6C 5J1AA 5ENWA 4UDTB 4YO0A 2GQHA 2MCPH 3RVTC 5GZNC 2QEJA 4HW6A 4RGND 2FIKA 5A40E 2EH7H 5BQ7B 1QFWH 2MCG1 3QWRA 4XNXH 2AEPH 5F7WC 2GEEA 3LEYL 5E2JA 2DS4A 2OTPA 1XR9B 4ZS7L 2BZDA 4JFPA 3DRQB 2XI9A 5ESQA 3U7YH 4PJ5A 5CZVL 4X6BA 1IC1A 4PREA 4OZHF 4ZUTA 3FB8B 2JK5B 1WAAF 2WQ8A 4LP4A 4MNGE 4Z7VE 1HK6A 3LY6A 2Z93A 2ZUUA 3K3QA 2B20A 5CUSH 1X4XA 1P4IL 4HKBA 3EUUA 4LLVB 4U3CA 3DHJA 4U1LB 4WHYG 2Q86B 1R0AL 4X7FC 1ZT4A 1IM9A 2QKIA 3WIHH 3MRPA 1RZJL 3BDXA 4KMTL 1PKQE 1MNUL 4KRMB 4PGDA 2J6EA 3AS3A 4P57B 1YEDA 3ULVC 2R0ZH 5KSUA 1R5IA 4X99A 3BGMA 4HIEB 4NC1C 1ZT1B 4AL8L 1QSZA 3BZFB 4R96B 4PLJC 1RJYB 2E7HA 3O41B 1Q1JL 3KNBB 5FYKD 2OZ4A 4OGXH 3MNVA 3AU1A 2AKRB 3C2AL 3HRPA 2VSDA 4A2MA 4L3EB 3CCHA 4R3SA 4NQXA 1C1EL 3BESR 4TNWK 1YYML 4P3CL 1HYSD 2ZKHH 5JZ7C 4B5EA 2OJZH 2FJFB 3D0VA 1CICB 3LKPB 3IKKA 1NEZG 3UZQA 1UM4H 4YDVB 1B6UA 5E0QA 1QSVA 1U8NA 1ZLUK 5F7HA 2AQ1A 1HH6A 4PJAB 1VPOL 4YHLH 3MLSL 4K8RC 2PCPA 3WFEH 1MI5D 4DKAA 1J10A 5F6IB 4XMKL 4PRPD 4RA3A 5FUZL 3IDMA 1WWCA 4G8GD 4HXAL 1VFBA 3FB5B 4QRUA 1KLFA 3DHMA 5IOPB 3IDIB 4MJ5A 4AEIL 1I7ZA 5C0CE 1LNUB 1H3TA 2QSQA 3HKFA 1BJ1J 2A83A 4F57H 5GZOD 1YN7A 2IH1A 1JHKL 1JGVL 3KXFA 4Q97A 1TLKA 3TT3H 4KVCH 3NOIA 1P1ZA 2Q8BH 2FO1A 4D9LH 2CD0A 4WFFE 5FKPB 3TPUB 2FRGP 1DQJB 3T2OA 2OXHA 5EO1B 4U3XA 5DT1H 3IDYC 4YPJA 1Z3GH 3HS0B 5IMLB 3TGXA 4G8IB 3BGFB 4S1SL 3TT1H 3SQOH 1ZT7A 5MEQA 3NCCB 2ZUXA 2K3TA 4JO2L 3BRGC 3DGGA 2YPLA 1RUMH 5DR5L 4WO4A 4PGBA 2FLRT 4NUGH 5DS8A 4OZ4B 1F2QA 1C08B 4M9PA 3F58H 1EBAA 2XN9A 1UH4A 5FYJE 4XP4L 3LDBC 1T3FB 4N0CC 5E8EA 1QACA 3HI6L 4AZ8A 3IGAA 1B9ZA 5I16A 1LQSR 1BBDL 2CLZA 1F3JA 5AWNL 3FN0H 4PJEE 2HVJA 3MRKA 1JE6A 2X4SA 2CDGA 2AXJA 2DQFA 1EMTH 4JY5H 4MCZB 4FTVD 4TQEH 2V7NA 4H25A 5KSAB 4IRJD 4IOFC 2APFA 4HHAA 1HDMB 3W11C 3IU3B 3T3ME 1KIQA 5JQ6H 1IARB 5F9OL 4KI5C 4ZFOB 3HUJB 2RIKA 3PXHA 4KFZC 2HLFD 1PX3A 3LS5L 1G7LB 4P9MH 4QTIL 3QIWA 2MQ0A 1WCBB 5BW7A 5F7NC 2VLME 2CXGA 3NN8A 4ENEC 5FFLA 3ZO0A 3QDMB 4QRRD 1QLEL 1WBZA 4QHKJ 4QYOB 2QJDA 3D0LB 3QEQD 3RPIB 2FX9H 2J4WH 1JGUL 2Z31C 3VI4F 5IV2A 4AQ1B 1IGJB 3O2VL 2DTSA 3T09A 1E4KC 5EZJB 4MWFA 4G43A 4NN6C 5C07B 3STBA 4DQOH 3V0VB 3N1GC 4Z7UA 5IMOB 5DD0L 4YAQB 2PR4L 3QPXL 5INDB 1LP9F 2AI0H 2H9GA 5DC9B 1XIWA 3WFZA 1DUYB 2H1PL 2EDEA 2ADIA 1E0OB 4G8FB 3P9WB 3MPCA 2F5AH 4UV4H 5FEBA 4Z7WB 5D1XA 1QSEA 5C0NC 5CKAA 5ESAB 5KS9A 4ONFH 1P7QA 4L8SA 4NCC2 3S5LA 2X4RB 1CGYA 3MLXL 3NCJL 2EE3A 1XGTB 4L4TB 5A2JH 4K9EL 5D7LD 4AQOA 5SWQA 3L3OA 1MCOL 3CDGA 5CBAA 1H8OA 5IESH 4ZS6D 5KSBA 4HK3N 4PUBL 1CLYL 1Q0XH 3VXMB 5EBWB 3VGAB 1R3LA 4Y2DD 4MNQA 2YMXH 4M7KL 2JB5L 2A74A 4ZTOL 3PNWB 1MFDH 2C3GA 3EJZC 3VMNA 3S34L 3U0PA 3QCVH 1QBML 3HG1B 1S9YB 4LPTA 4UOJA 1JHLL 1OP3H 5LBSL 1YNKH 2V2TB 2AV7B 2EXWD 4QHLA 1WEJH 5GRUH 4HWZA 5EUKA 1Z6JT 2Y5EA 5DJAB 3MXWL 3QUYB 1ZLSH 4NDMA 3B9KA 3RWCB 1BJ8A 4XMPL 3SCMC 1UVQA 1M6OB 4ZNCD 2QQQA 4QWWD 2C1OB 4W70A 5DJ2B 4APQC 2ESVA 2Q20A 1F45A 3JV4B 3BYTA 4HAGA 4P4KB 3RL2B 2V17H 1EUTA 2NY1B 3D87B 3P4MB 4R4BB 2FJHA 2HT4D 5CSZA 1KJ3L 4X6CB 4KXZI 3TC9A 5EIQA 4KY1L 4J3VA 5FM5O 4M3KB 3B2UC 2GK0B 1FJ1A 4S1QL 5DK2B 1LEKA 1V3MA 4LSUH 1ZTXH 5HYJD 2ATKA 4PJ8A 5E6ZA 4JZOB 1PG7L 4PJXB 4I0PA 1K8IB 3D18A 1A7QL 4M9OA 4MCYA 3KYNA 4U1JB 4MA8L 1J8KA 1K4DB 4GAGH 4NQDB 3RZCC 4DOHE 3QHZL 2YPKA 3S5LG 4LLDB 3GO1H 4LL9A 4JZNB 4OI8A 5B21A 2Q6WA 2C1PA 4MHHI 3X12B 5ACLA 3VXOB 2DQHL 1KBGL 3QRGL 4CMHC 1BVKB 3UJTL 3PWJB 1W72A 4F15B 2PETA 2WBJB 2VDQL 3RI5F 4NQCE 3TVMA 4PP1D 3GRWL 1M7DA 2IBZX 3GSNL 4LEXL 4KXZH 1G7IA 3RU8L 4J3TA 1UB6A 4L8CA 4HWBL 4ORGA 5DO2D 1D9KD 2NY7L 1CL7I 2BVQB 4BH8A 2XFXA 1DL7H 4C55A 5FYJU 3C60B 3SHSA 2A0LC 4X4XB 4AY0A 3L5WA 5JOFA 1DN2A 1HH9A 5F6HJ 5IKCB 4RMUA 1CXKA 4ZXBD 4V2CB 3SE9H 3KPOB 1MCKA 1KPRA 1XR8A 4WWKD 3UYOD 3O6KL 4JPIB 4YEFA 4HUUA 4OGAC 5T3XL 3JSSA 5F6HI 1KULA 5E56A 1U3JA 5JW5A 5MEOB 4JJ5B 3HNVH 1OAUL 4Q6YA 1QFWM 2GY7B 1NMCC 5DSCB 2FX8H 1R3JB 4OFPA 1YMMD 3SGJC 1FL6B 4KRPC 3RA7H 4QCIA 3T0WA 4Y4HA 3AB0C 3TN0A 1CL7H 4DKDC 3MBED 1WAAE 5BRZD 2IPTL 1CXHA 3QEGL 5B4MD 5H2BA 1JYVA 3VD4A 5SV4A 5ICZA 5CGMA 3DX7A 3BQUD 1WV7T 1U3HA 2R23A 3MROB 4LAQL 3K81A 3BIAX 2I26N 3MV9D 4O2CB 4UZGA 2X4PA 4LU5H 5IQ7L 4OLVH 3H2WA 1MPAL 1AHWA 5F3BA 1T0PB 2EH8L 4HS6B 4OB5H 1G6RL 1H9VA 1JPGA 1X5JA 1CU4L 4O2EA 1U8JB 1CD0A 1EHLL 2MOVA 3ABZA 1VA9A 3IDUA 2WUCL 3S96A 4BA8A 3QNXB 4QTHB 3TBYB 5CIPB 5ICYB 2VDPL 4R4ND 2YUZA 1MLBB 4YPGB 1KFAH 2VTFA 2P8PA 3LCYA 3S37L 1J0HA 3GMMA 3OGCA 4GW1A 2IAMC 1ZLUH 4MXVF 2IALB 4KKAC 1EAPA 3MOAH 1YNTA 5FHAH 2QHRH 4YGAB 3BAEH 3FO9B 2YHGA 2NXZD 4XAKE 5CZXC 4H0HB 1RY7B 5ETUA 5L88H 3RKPA 4Y16A 3V9FA 3U1SL 2ERJC 3SE3A 4RDQF 1MHEA 2HKHH 5L8LB 2HJKA 5DHVB 5A1AA 1U8OA 4UQ3B 3CH1B 5FYLD 4JO4L 2P8MA 5JW4M 2YWZA 1HCVA 2FX7H 4W4NA 3X11B 3EYFA 4OLWL 3MNWA 5MI0C 1ZS8B 2VIRB 3MACH 3MJ7B 5KOVC 3F7VA 1I1CA 2JELH 2EXYC 5DEFB 4NM8H 3C6SA 3KPSB 5DXWA 4ZFFA 2A6JA 4YIQA 5GGUB 3V4UL 5I8CA 4QRPD 2VITA 2YRZA 1S9KC 3T04D 2VLKA 1NC2D 5ID0A 4AJ0A 3VWKD 1FBIL 5CEZH 4WI8A 4E0RB 3GK8L 1MJ8H 1T89A 2NCMA 3TNNB 2RR3A 5JOEA 3MREB 1TETH 4MX7A 3RTQD 4JVUA 3NFNA 3I6KB 5GGRB 5TH2B 4Y4FB 4BFGA 4AG4L 5CWSB 1BVLB 4JDVB 1FVDB 4P46D 5HVFB 1MHHB 4WO4C 1LHZA 5TJWK 1PZ5A 1KXVC 4HC1A 4Q58C 2BOBA 3RWHA 1HOCB 4YK4C 3ARZA 2AERT 2PTUA 4JHAH 1UKTA 4XXDA 1FGNL 4O51A 5EG6C 2LVCA 3OR7A 4KKBD 4QXUL 1NH6A 1QVOA 3HNSH 1C5CH 3FT3A 4YFEA 5I1CH 4D9QE 4RFNB 3MRMB 1TQBB 3UJJH 2NW3A 1T1ZA 3OF6A 3MRLA 1RUQH 3HCVA 4MXQC 4L9LA 1GOGA 3PP4H 4N90D 5KAQF 1FDLH 4NOFA 3V0WH 2IANE 2ZUVA 3DV6A 1RZIA 1VFOA 4FABL 3S98A 2WW8A 5MERB 5T1MB 3BKYL 2GSIA 4FQXB 1K3IA 4OKDA 2BSRB 1BQHB 3GUTB 4G9DB 2UUDH 3FQRB 4I8DA 2VDKH 2GJ6D 5B3JE 5ACMA 2BSSB 5BW7C 4GKSA 1T6WA 1K4CB 3P4LA 3WNNA 4RWYL 3Q3GB 1FFRA 3P3YA 5C6WH 3MBXH 3VI4E 1ZHNA 1FIGL 1NCCL 2CIIA 3UTQA 2P46B 3W0WA 2K7PA 1QKZL 1LP9E 4PY7A 2YD8A 2DWDA 3MV8B 4XVSL 3M1BB 3MXVL 1M71B 4U1MB 3FT4B 5EO9B 5JXEC 5C0FB 2VLLB 4GAJL 4PJDF 1XIWC 1JGLH 4ODWA 2DMBA 5DD3L 5D1XC 5J3HC 1I8MB 5MEPB 1FCCA 4PD4K 2ZSWA 3LRSB 4L8SC 4OUUB 5IM7B 4LSTH 5GGTA 3DI2B 4M00A 4HS8L 3VFPA 4D8PA 5DURD 1NDGA 2JJVA 4KHTH 1ZGLA 1L4IA 2HH0H 2PYEB 4NBYB 1HQ4B 3ULVF 3O4LB 4WJ5B 3JTSB 5DJZA 4JAMB 4IHOA 3FO1B 2GAZA 1B6DA 4TULH 1N7MH 2YBRA 3GI9H 2YD3A 4GRWE 4KJWD 1XT5A 4G8EA 15C8L 4JY4A 2P24B 1DUZB 1QEWB 5IW1A 1I9IL 3ULVL 3VXSB 7FABH 3BZEB 6FABL 4LQ1A 5L6YL 1HE7A 1HYRC 1AXIB 1IGTB 1PGRB 1T1XB 2X89D 3O45B 1FPTL 2X05A 3HMWL 2JIXB 2L0DA 1XGQA 1N6QL 3QIBB 3VFOB 1YMHA 3CIQA 1IM3A 3JWOH 3VXRA 3QFDA 4C54A 5IB5A 3U0TB 1UXWB 4G7VH 4WW1A 2ICCA 5JPNB 4L4VB 3V5HA 1GVIA 1R3HA 3PWPD 1KB9J 4P4RB 3TJEL 3KYAA 3L7FB 2PTTA 4WUKL 4PV9B 4Y1AE 1FL3B 1S78C 1S5HA 2VAAB 2Y7QA 1LO2H 4YX2H 3CC5A 4UU9B 1KEMH 1OQOA 2HTKD 4P2YA 2I27N 4ZD3H 4KQ4H 3LH2L 1IJ9A 4K8RL 3VJ6A 5IROA 2WMPA 3MUZ1 4GXVL 3IF1B 4FZEH 2FATH 3E6HA 3R0MA 5T1LB 3L1OH 4OD1H 5L2JA 2X4NA 3OPZL 1D5BA 2IPKB 3EO0B 3U46A 1ADQH 2V5RA 4LIQL 1EK3A 2B2XL 1N3NB 3SJVB 2XTJB 4PJ8C 3ARGB 4LLYB 1OY3B 4I0PC 3UC0H 3QQ4A 3TBWB 2W91A 3ZZ1A 4JFYA 5EN2A 1AI1L 4PY8I 2EO9A 5AG8A 5E8NA 4WHCA 4RISH 4UT7L 5F1SA 5FDWA 1TENA 2AK1H 1QR1B 5HHOA 2YRPA 3BO8A 5JDJA 1OB1B 4LF3A 1A9EA 4UIMA 5BVPH 3PF2A 3HB3C 4LVHB 1D6VH 3TVMC 1NGZB 4M6ML 4OCWH 3FQXA 2YWYA 3PJSA 4QOKB 3STLA 4KJPC 3ILPA 3VCLB 2DQJL 4JFDA 4LLUB 1BZ9A 3VFSA 3FL7A 4P2RE 4TOYH 2NXYC 3UJIL 1CI5A 3WNMA 5F3HA 3OKKB 1AQKH 2NY6C 5SX4I 2W07A 5T3XE 3L6FA 1UJ3B 1K5NB 5BXFB 3W2DH 2WZPD 5HYIA 1A64A 1P69B 3B3IA 1R3KB 5DHVH 4X9GA 2RGSA 4LCCB 3SKMA 4HIJB 4GG8A 3FN9A 4KI5F 4PGJA 2JB6A 3O2WL 4NGHH 1FZJA 3KPNA 3AY4A 2BY2A 3EZ8A 1JF1A 1I8LA 3UBXA 2XZZA 2F54B 2R1YA 4FN0A 5LGKA 2Z92A 1A0QL 2I60L 5J12B 1ONQA 4KKLD 4TYUA 1LEGA 1LEIA 4HIHB 3A6OA 3MLRL 2YD4A 1KIRA 3D39A 4KTDL 4BSVA 3QI9D 1WISA 2B0SL 3DUUA 5I1IH 4NHUA 4Y4HC 3LSOA 1AKJB 1R3IL 5GGSY 3TN0C 2NNAA 4RGMC 3K74B 3CVHH 3UTSB 3IDGB 3WNLA 3UTZA 2R56H 4Z5RB 3IT8D 5JHDE 4BUGA 1TZHA 5SX4H 3MRQA 2PXYA 5HPOA 1LWRA 2DN7A 1UCBH 1BQLL 5SV3A 5DD5H 3GJFK 2ICWJ 1U3HC 4PRIA 4QHMB 5B8CB 1HXYA 2H26B 5C08E 4ZUUB 4CGTA 5JHLL 3MMEB 2NQCA 3RBSA 4QXWA 3O8XA 3FQWA 1J8HE 4P23A 1YDPB 5CD5C 3BDYL 3BH8A 4LKCB 5J1SC 5CGYD 5DA4A 5EOQL 1H15B 2VJXA 2HT3C 2ZWLT 1IEBB 2MPAL 4LPVA 4QHNA 4PBVC 4OCXH 3U9PH 2HG5B 5C9JB 1A4JB 3SO3B 1GHFL 3PHOB 1A6AB 1VEMA 4HUNB 2DDQH 2EDDA 1KNOA 4IDLA 4DVRL 1RUPL 4R7NB 5EA0L 1KB5A 4MXVE 2CGRH 4U1GB 5I74B 1A1OA 2A73B 1ZGLM 1F4WL 3VRJB 4S1DD 1GSMA 4LCWE 4UV7L 5JMRA 2F58L 1A22B 4LLMB 1WICA 3U4EB 5CEZD 1SEBA 1IZKA 4HWEH 2VERN 2ZPKL 4MNGB 4LAJH 4Z7VB 4RZCB 4WENB 3AREA 4NRZA 4K2UH 1JCKA 2CDEB 3MOQA 4JVPA 1GRWA 4YR6A 5H35A 2FHCA 4JE4B 3AUVA 1PW3A 4Y16C 5EZLB 3UBXG 1X3DA 5D7JA 3SE3C 4HK0A 4XP6H 4OM1L 1FYTD 1YYLH 1XZ0A 2BK8A 1T5XB 2W9DL 1PKQB 1H8NA 3L3IB 2Z4QA 1CK0H 3O9WD 3LKQB 5DMKB 4JZJA 3WD5H 5FO9B 4HPYH 3BWAA 5D7KE 2VLJD 4UIKH 1GJIA 2YPVL 1L7IL 3FQTB 1MFEL 1UKQA 4ZMAT 1BIIB 4HLZH 2YD7A 1JZ3A 1KLUA 1MHPH 1UXSA 2NTFA 3IRPX 4JGJA 3V4PL 3GMLB 3KGRA 1DBKL 4OGYL 3RHWK 1V7NL 4OKVB 5F9JA 5KG9B 2MHAA 3QXDB 1JHTA 2OR9L 1AIFA 3GJFB 1FRGH 1J0ZA 2NY3B 3BEWA 3O3UN 3PGCB 4PG9B 5L2KE 4X4YA 1H8SA 2IQAB 1T89C 4Y5VB 1YPZE 3OBAA 35C8H 4OF7A 2X1QA 3EDKA 5IEKA 1A9BB 3CUPA 4O58H 4YDIL 4KQ3H 4CADA 3KPMA 3IFLL 4DGVL 4W4OA 1I1YA 5D1QB 1NAMB 5GGQL 3QUZD 1JFQL 1G0YR 3ZKND 3BSZH 3PXJA 1NSNH 1XF4A 4PRAA 3FB7B 5C2BL 2ORBH 3MRFB 4K94H 4K7PH 5F6IC 1HHKB 4XP5L 4NQDD 4XNUH 5DVLA 4UT6H 4L9LC 5F1IB 4QO1A 2X7LA 4PJFF 3MA7A 3IJHB 5HHPA 2A6KB 4UNVA 4I3RL 4YHOL 3FCTA 4P5MB 5CLWA 2BRQA 1RIUH 5DJ6A 4MQXD 4I4WA 1KCKA 3M45A 1CFQB 5F1OB 3OGOE 3E8UH 5F96H 3VFMB 2WBJD 3CFJB 2Z91A 1X5YA 3CX5K 4KGJA 1YA5A 1O5DT 1AXTL 5FK9B 1KCUH 4HIIB 4OZFB 4R26H 5JORB 1IQDB 3KPPB 1MI5A 3BDBA 5HPMA 3UYRH 4RCAA 4PRPA 4HUKB 4G8GA 5HI4D 2DIAA 1YNLH 3R1GL 3BGFC 1FZOB 4KUCF 2OK0H 1FNEA 5E70A 1DANU 5IBTL 1XGUB 3C09B 1XGRB 3C6LD 4OLEA 4WHTA 4ZQKA 3R06A 1NBVL 2ARWA 2IC2A 5EULV 3EGSB 5LCVL 5JXAH 3UPRB 5ERWB 2R1XA 4PJEB 3FQNB 1MQ8A 4PJDE 3HPLA 1A3LL 4XZUA 1RI8A 3WNKA 3OJMB 1UM6H 2X1WL 2XZQL 1EGJA 1MLCB 2VO5A 3MRJA 3RAJL 2H8PA 4JG1L 4NO3A 4UINL 1RIVH 2IWGA 3EO1A 3NAAH 4NKDA 3C5JA 1DEEA 3W9DA 4ORZC 3V8OA 5HVHC 4NO5B 5HHVH 4K71C 2HJFB 2BDNL 3QWOA 1OM3L 1LK3H 4OCRL 3ULVE 3MCG1 4JQXA 1S7QA 3WS3B 5KSAC 1SM3H 4YGVB 5DEGA 1QQDB 1LO0L 4OM0H 1ZVHA 2HFFA 4MQSB 2GCYA 3SDCB 4NC1E 4HZLB 5DYOB 1F4XH 3SDDD 3H3PL 4U1SB 3R8QA 1HI6B 4ZNEA 1IGFL 1AGBA 2GJJA 4PGEB 5E8OA 4WCYL 2H2PC 1Y6KR 5J89A 1RIHH 2LABA 3DNKA 1JTPA 2J6EL 4S2SA 5FAAA 2D9QB 3MODH 4NO0B 1FE8L 3LN4B 3K1DA 5F9WB 3CXDH 3AS2A 3D5OF 1ZXQA 1IEAB 2IPUK 4FTVA 3OKNA 4JPKH 2IH3A 4IRJA 5SWZE 4M5YL 4XBGA 4KV5E 1JTOA 1E4WH 1OTTD 2HN7A 3HRZB 2HT2D 3BYYA 2FYYB 4FXKB 1A7NH 3RVUC 1RK0B 5HVGB 4LGPB 5IHUL 1A6UH 1MHCB 2W0FB 4LIQE 4R0LA 3PWUB 3CVIL 2YR3A 5TQ2H 1BD2D 1GZQB 1REIA 3OKMA 4QRRA 4RMWA 4O00A 4HV8A 4LRIA 4R4FH 3QEQA 1BZQK 2Z8VC 3LB6D 2YZ1A 2E7LC 3S36H 2WWKT 4EN3B 5IROC 3KDMA 3MCKA 3PP3K 5MHSE 4G6AD 3EYOB 2KL6A 5J13C 5J6GA 4U1HA 3QDJD 3WXWH 3VG0L 5HHME 2APXA 1I1FB 3ARXA 1KN2L 3ROOA 1HWHB 1T04B 2CXKA 1YEKL 1T83C 4OBSA 3KVQA 2DM2A 3KLHD 5IBLD 1JP5A 2GHWB 1ZLVK 1I3VA 4N5UA 3GMRA 2Y4SA 3ZTJG 4JFFD 4XPHL 5I66B 4Y4KB 3IETB 1VCAA 1NGWB 2A6IB 4XXCA 5D7LA 1IL1A 3LQMA 5TDPB 5MENE 1HCFX 4I3GA 4YXLH 1TITA 4XCFL 2C5DC 4OLXH 3OZ9L 4Y2DA 4KDTA 4MAYD 1CQYA 1ED3A 4GQ9H 3QXAA 1YQVH 2DQTL 3C08H 4WU7B 1EO5A 1V05A 2H32B 2RBLA 3VGEA 4JRXD 2VDNH 3CFDB 2QQKH 2WIIA 5C70A 2CK0H 3B5GA 2OCFD 4LPCA 1U93B 5C0DB 5T1DH 2VDOL 3TZVB 1KLGA 5FA4B 3HI1A 3BD4A 3LKRB 4FXLA 1RJZA 4WI4A 1U8QB 4M7ZB 5DMGC 4KI5E 3MUJA 2WM0A 4DOHB 5DZLA 4WEBH 1GIGL 4EI5B 2D7QA 4H88H 4EBQL 1WBYB 2XACC 1FGVL 1RUAL 1MJ7H 1NJ9B 3DUSB 4I5BA 1C7SA 1FV1B 1UC6A 3VFWA 3IJSB 1MY5A 2F19H 1I8LC 3CFKB 1F8TL 1NDMB 4ZPTB 5A16B 3VFUA 4D9RD 3EYVA 4NQCB 1NMBL 3PGDA 1MQKL 3MJ8B 1GC1L 2C7UA 1HSBB 1PLGH 1X9QA 2VQ1B 1D6EB 1IGCL 1LDPH 3CFEB 3GJFH 4OT1L 5ECJE 5GRJH 1AC6A 4UTBH 4X6DA 4XBEH 1JUFA 1WSST 2CLRA 2A9NL 5HYJA 1OAKH 4TTDC 2FBOJ 4Z7UF 5DMIH 1NAKH 4IM8A 2DBLL 2PXYC 1T21B 4E9LA 4GKZB 1XCTA 3P9LA 4U6YB 2I9LB 3C8HA 3C5ZD 5DQ9A 1BP3B 3LPFA 5KS9F 4XVTH 1NAMH 3H42H 1NCWH 1X5AA 3O6FB 5E4IA 1MFCH 2HFTA 1QG3A 1N0XH 3ES6B 4P23C 1CLCA 5F88B 2YA2A 3PL6B 3JV6A 3JWNC 3VH8B 4HH8A 2O5ZH 4LBEB 4M1CC 2C4FU 2GUOB 5D1ZB 5MP6H 3T1FB 5DFWH 4GG6A 4HGWA 3SKJL 5F89A 4Y19D 5IK3B 1QSFE 2YEZB 1D9KA 1D5ZB 3DX8B 5D9SA 1JIBA 4IOIB 4YHIA 5I30H 1KCVL 2UYLB 4HS3A 4NZTH 3BH9A 4HJGB 2XPGA 4KC3B 4PRHE 2VABA 5C0RL 1HEZB 3CDFA 2CR3A 4KTYA 3B4NA 3TBSA 3WIFB 4NRYA 2Z9TA 2R2HB 4ZXBA 4OZFH 1NGPL 1OGTB 3P0YH 3T0BA 5I1AA 4AEEA 3MGOA 1BF2A 32C2A 5CEXB 2NYYC 3QZWB 4WWKA 1G7MA 1U6AL 5KVFL 3I3EA 3W39A 1L6ZA 5ADOL 3WIHA 4AENB 2VXVH 1JGDA 4GW4A 3L95A 1E28B 4W6WB 3GBNH 4JANA 3MRGB 2HRPH 3D85D 4X7EC 4FZ8L 4R90H 5CGTA 5I8KH 2K7QA 2NY2C 4JZJC 5DD1L 5DJYB 3BMVA 5A43C 1MJUH 3LQAC 5IG7B 3DWTA 3QG7H 4RGNC 5KOMC 3TCLB 1K9TA 1QLFA 1I7UA 1YMMA 4YE4H 5I1JL 4DGYL 4D0CB 4YHZH 5T5FH 5HXMA 5CD3B 1AP2B 3MBEA 4KJYA 5BRZA 4M48L 1A02N 4KKNA 3CZFB 5BV7L 4WI2A 3NCYP 4X7TA 4XP9H 1MRCL 3BQUA 3X17A 5I1HL 2ENSA 4RAUB 1CTOA 1N5YL 3MV9A 2X4UB 4FQPA 1S7TB 3GKWH 3PIQA 4QRQB 3O4OC 4CL7A 1T66D 1DQTA 4X7CC 2J5LB 1OHQA 1S8DA 5EZOH 5F70A 3NCBB 1CGSL 3R0NA 4W4OC 3W81A 2EC9U 2EIDA 5GGSA 3RGVB 3QUKB 2ADJB 2AK4D 3ME0A 1FZMB 3MFFB 2G9HA 3VD3A 4JFQA 1W72L 1I9RH 3JV5A 5IQ9A 3EFDH 3LQZA 2WQRA 3I3DA 4PJFE 4YFLF 3GBLA 3MA9H 3IAGC 1WC7A 1DBAH 5DQJA 4NM4H 2A77H 1C5BH 1NFDF 4FFYL 4NUJB 3FQUA 1HYSC 1FFQA 4YHNA 2AJZA 2IMNA 3D48R 1I3RB 3I50L 1DQDL 2X4OA 1NBZA 4FQQA 2ZCHL 4G80B 3WKML 2VOTA 2AP2A 1JGEB 2HKFL 3TP4A 5DUPL 5ISZD 2EYSA 3BIKB 3K8MA 4JVWA 2EDFA 5GQBA 4JHWL 4FFZH 1LILA 4HJJH 4NP4H 1T6VN 1LE9A 1DVFD 1MCPL 3T2QA 2OI9C 2OYPA 3JUYA 3THMH 4L3CB 3WDIA 5EU7C 1KXTB 4HUVB 2B1HH 4Y4FC 4X98A 3JTTB 4FFVD 3OHXB 4UDUB 3LD8C 4GRLD 5LGHL 2X4QB 3CLEL 4YLQT 4PJ5E 4QRPA 2F5BH 4TSCH 2G75B 3WUWB 3RVVD 4EUPA 2H3NA 1KENL 4U6VH 4X7DC 1NC2A 4XNZB 3VWKA 1KJVB 2IANB 3MJ9H 4F80A 2V5SA 1UYWL 1F6LL 1JVKA 1CGUA 5I76B 4NRXA 4XPGL 3RTQA 4FQ1H 1U3YA 4KROC 4DW2H 1BF8A 5J9PA 1NGQH 1L0YA 4LEOB 5ALBL 4P46A 4JB9L 5CEYA 5FM5M 4XVUD 3GM0A 4Y5XB 5BCAA 1QRND 2H32H 1BLNB 1UEMA 4HFUH 4X8XA 1A8JH 3QCTH 1A4KA 2OSLB 3RBGA 1BFOA 4X0KA 5C09D 2OTUA 1OARH 2R69L 5I15L 4MD4B 3T4AA 2CJUL 2EYTA 5DJCA 5C7XL 5F7DB 2YUXA 4AEFA 5HYEA 1BQUA 1LP9B 3O6LL 5DVOA 2VXUH 1Q9OA 2QQNH 1AFVL 3IFPA 2DLEA 1X7QB 3GSWB 3ZTNL 4HT1H 1S9VA 4IRJC 2VE6A 5LWYH 2YD2A 3QNZA 4CVUA 1YY8A 3CSBA 4HKJB 1UH2A 4PJHA 1XF2A 5IW6B 5JO5B 1MCNA 1Z5LB 4PTTA 2GJ6A 4XRCB 4P5TD 3LOWA 1S3KH 3F5WB 5DUBA 2FBJL 2AJUH 4X80H 3ALXA 4R0LC 5AZ2H 4OLZH 5FB8B 4DTGH 5TQ0L 1URLA 2XRAH 4NHCL 3AS0A 3NGBB 3KXFE 3X14B 2BHYA 1OT1A 3G08A 1JWUB 4J1UA 4EUPG 1AR2A 4GRWB 3AXLB 3D25A 1AY1L 1FAIL 1ZLVH 3ECBB 5AYUL 5DJ8B 1LK2B 1N64L 3KLAA 5FF6A 4EVNB 1B0RB 5JUEL 4YBLC 5EIIA 4ETQB 3OKEB 4S10A 3LEYH 4UUJA 3I2CL 3HA0A 5IVZA 5DVNA 2VLRD 5JOPD 1JZ7A 4MA3A 5ESVB 4GSDL 1P6FA 4ZS7H 4RAVB 2YPLE 3MV01 3NTCL 5GGRY 5CZVH 1JWSA 4XXCC 2YC1B 4NQED 2XN9E 3GSOA 3GNML 1EZVY 1GZPA 3G5VB 4ZS6C 1P4IH 4LSSL 3QIBC 4Y1AB 5J1TC 5I17A 4Y2DC 4KDTC 3BN9D 4UI2A 4JQVA 3T0ED 1X44A 5HYSB 1R0AH 3HZMA 4JRYD 1T22B 1C12A 1RZJH 4HC1L 4KMTH 4NJ9L 1MNUH 2J12B 3UTPE 4EI6A 3CLFL 3WHXA 4NSKB 5GRVL 1CE6B 4Q9QL 2B8OT 1EBPA 1BGXL 3LEVL 1MH5B 2EXWC 3HPJB 5GS1B 2X89A 4RMSA 4X5WA 5D6DA 4U1LA 1WIUA 3RKDD 3VFGL 3FRPA 3EDJA 5GGVY 4AL8H 3DIFA 2HLAA 1HNGA 1Q1JH 1C16A 4PJCA 1F3DH 3EJYD 3GSNB 3C2AH 3D2UB 3GSQB 1INEL 1O0VA 1KCLA 3RWDB 1BWWA 1C1EH 3PWPA 5JPMA 1YYMH 4P3CH 2XTJC 1V3KA 2XQYG 5DUML 4HLJA 5C0CD 3GMOB 4KK9D 3IAQA 2FLBT 1VPOH 2FEDC 1BAFL 5BOZG 3MLSH 5E94B 4C58B 1A7RL 2Z35B 4D94A 4K7PX 4WRLA 4P2RB 4XMKH 3HMXA 4OV5A 1OAXL 2CDFB 3GMNA 2OLDA 3LKPA 4Z7UE 2G2RA 4HXAH 5FUZH 5C0JA 2DJUA 4RNRB 3TV3L 4K3EL 1AGDA 1ZSDB 4O02L 4YHYC 4AEIH 2JCCA 4QNPF 1MIML 2BC4B 4FRWA 1AO7D 1JHKH 1QSEE 1JGVH 1I3GL 5I6XC 1SYSB 5KS9E 1FL5B 2XWTA 1QO3B 5C3LD 4HKZB 3PQYD 5EBMB 2J88L 2VDLL 3EO9L 4XCNB 3WO3B 4ZPVB 3ARDD 3O11B 4TNWF 1DQML 1ERNA 3EFFA 2CMRL 4JM4L 3TNMB 3ZE0F 1IKNA 4MNQE 2VWEE 1OW0A 4S1SH 4PP1C 2XXCB 4JKLA 4LP5A 3HUJF 4JO2H 1JZ5A 1T5WB 5DR5H 1ZWIB 4ZUSB 2DQEL 4BFIA 1CXLA 4GLRI 2ICES 2RAMA 4GUPB 3FRPG 3HE6D 5DHXB 5D93B 5IVXA 4XP4H 1G6RB 5JHDB 1UQSB 1U92A 3HI6H 3HZVB 1Y0LB 1BBDH 4ZXBC 3SDAD 4Z95L 5AWNH 4B7LA 5M94B 2BNRD 3E6FB 5C08B 4ODTL 2ESVE 4JFHD 2R9HD 3JV0A 3ULUD 5EUOA 5BZDA 5GXBB 4K3HA 1MY7A 2IEPA 1J8HB 1UCTA 1Q9LA 4P59L 3T65B 1WGOA 3KYMA 1SMOA 3GI8L 2FWOB 2R2BB 5E6ID 5TPWL 3RX8A 5F9OH 2HRLA 4QTIH 4NO0D 1CGVA 1UB5B 3LS5H 5HGBA 4O2FB 1P4BL 2FSEA 1KELL 1SJEB 3QI9A 3TO2B 5DF0A 2EICA 1INDL 1MREL 1WWAX 1X5GA 2AAVA 2ILLA 1HHJA 4GLRH 2PYFA 4R2GD 4S0TD 2BVUA 1QLEH 4I18B 3OKDB 4DVBB 3SY0B 4LCWB 4NPYA 5GSRA 4PRNB 5B4MC 1ORSB 1FFNA 1JGUH 3BQUC 4OTXL 3CSPA 1OD9A 4XH2A 3TA3B 1HHHB 3O2VH 4RAHA 3RRQA 4D0DA 3IB4A 1MOEA 4NIKB 4U1GC 4ONHA 3LKNA 1XGYL 3L9RB 5DD0H 2PR4H 1J05A 3QPXH 2VB5A 1P84K 1QRKA 2H1PH 1OL0A 3O3DB 2AEWA 2V9TA 3VE0B 5FO8B 2UVEA 2CLVA 3QJHB 4LVOB 3VG9B 2AJSL 2DD8L 3S36X 3MLXH 3NCJH 3HE7B 1AD9A 3OKOA 4K9EH 1H5BA 1MCOH 4YAQA 4JY6A 2WINB 1ZHBA 1SJHA 3WN5A 3QULA 4R4NC 4PUBH 3TIDA 1CLYH 1CE1L 3X13B 1NFDE 3U0WL 2C3HA 2V9QA 1CLZL 3OKLA 4LVNB 3TWCL 4M7KH 2XKNB 2ITCB 5B3NA 1U58A 4ZTOH 2BSED 4Y4KD 3PABA 4GH7B 1PBYA 4X9IA 2EE6A 3S34H 5L2KB 2DAVA 1S5IL 1QBMH 3MQIA 2NXZC 1JHLH 3ARFD 2DI9A 1YPZB 5LBSH 1WFNA 2VH5L 5IT2L 1FVCB 5EBWA 1NCDL 3TO4D 5T5NG 3CFBB 3MXWH 1FYTA 3K4ZA 2E9WA 3CAFA 4XMPH 3O9WA 3T2PA 4Y5VC 3IXAA 4PJIF 4NWUL 3VD9A 3RNQB 2LVEA 3TZVD 1T1WA 2VLJA 4H8WC 3MRCA 4L8BA 3DVNA 4JFED 3PV6B 2Y07L 1T4KB 2Q7YB 2X10A 4PBXA 2FCBA 3MR9A 4JM2D 4QF1A 1FIEA 4N8VA 4GRMB 4ZYKA 1KJ3H 1F5WA 4G3YL 3VFTB 1R5WB 4KY1H 1PQZA 3HR5B 3VWKC 1J86A 1UWEL 1M05A 3OXSB 1P7HL 4S1QH 1T0NB 3RL2A 3QO0B 2FEEL 4MJ6B 3RTQC 5I0DA 5IMMB 1D5XB 1PG7H 2DMKA 3AM8A 1A7QH 1OCWL 1OP9A 5E7FA 5IHLB 4MA8H 2R8SL 4DKFL 4XHJD 1NCTA 4FQJL 1MAML 3CNKA 3QHZH 2PO6B 4MNHB 4MYWB 3QUZA 3QDGE 2GK0A 2EKJA 1LVEA 4JCLA 1CIDA 5DK2A 1TJIL 2P5WD 4HDIB 3VA6A 4KKBC 2DQHH 1KBGH 3QRGH 3LPGA 2DI7A 5EOCL 1B0GB 3UJTH 3P77B 4GS7C 4KK5D 4V1DD 1QFUL 2E27L 4NQDA 2VDQH 3ISWA 3WSQL 3LKOA 3D1MC 4PJDB 3GRWH 3GSNH 1DBML 4LEXH 4OD2A 3RU8H 1CDHA 4LGRB 3ZDZF 3R4DA 3IDJB 3RWIB 4HWBH 1CT8B 3JWDC 2NY7H 4XBPB 3C09C 3KYKL 1PFCA 3SPVB 2WBJA 4J4PA 1TQCC 5IBUB 4AEHL 1CFTB 5CBEA 3KG5A 4WIQA 4NQSB 3DTXB 1QHOA 1DQQA 3FFDA 3MUGA 1U8KB 4D0BB 1BOYA 1LE5B 5HBBA 4RQQB 5IWLA 4X9FA 3BN3B 3FT2B 1NBQA 3BHBA 4N8VG 3O6KH 5EU5B 3C6LA 4FXGA 5T3XH 2GTZA 4J12A 4WW2A 3B83A 1F4AA 2VLKE 5ITFB 3SDCC 2BX5A 3LQAL 5DEZA 3N1MC 4DUVA 1OAUH 4HUXA 3DECA 3T8XA 2HFEB 5SWZB 2EEBA 3U9UA 3ET9F 2P5ED 2VYRE 4N5EC 5DK3A 2IPTH 3QEGH 4JQIL 5MEOA 3OKYA 5F71A 5DRZA 2BOCB 4YEEA 2P7TB 4XI5D 4CU8A 5L8JB 1F4YL 1U91B 1BMGA 4LAQH 3E2HB 1IT9L 4XWOD 2LTQC 3L5XL 4IS6A 2CKBA 2NPLX 4CNIA 3Q1SL 3SDDA 1RU9L 1VADB 1KTDB 5IQ7H 4XPAL 4QXTA 2AABL 4IRSD 2P4AB 1MPAH 1PVHA 3QH3A 4HUMB 4Y88A 5BO1L 4Y8AA 2EH8H 1G6RH 1IBGL 4PJ9D 1OP5K 2H2SC 4KJWC 3BFOA 1CU4H 2YUWA 3NA9L 1OSZA 1EHLH 2BSTB 3V5DA 5DJXB 3RL1B 5HHMB 2WUCH 5D6DC 5I9QB 2KPNA 2VDPH 2JJTA 4F2MA 3ARSA 4HS6A 1QUNA 3CD4A 4U7MA 3I6LD 2FB4L 5FYKL 3S37H 1BBJA 3WFHA 2XWJA 1TTGA 3RGVD 1HKFA 2R2EB 1KPUA 1ND0A 4ZAKD 4ZUWB 1I1AD 1QFOA 4NZRL 3B5TA 5MENB 4ODBD 3P4OB 1CDYA 1KJ2B 4AT6B 2VR9A 1L9MA 1BD2A 4HEPG 4XNQA 1HHGB 3CPLB 3PHSA 4I0KA 3O3EA 2UZIL 3U1SH 3W0WE 4WDIB 1MCWW 1HILA 5HDOA 5DRWA 1PEZA 5JIPA 5AEAA 2H6PB 1DP0A 1JNHA 3AFLA 5EU4A 4UMGA 4EDXB 3TM6A 2Q76A 4JO4H 2X70B 3FFCD 2PNDA 2O5XL 3WNOA 3RP1A 3FO9A 4QNPE 3QDJA 4YUEL 3T4YA 4QY8A 4Z7NF 3A67L 4MDIB 4OLWH 1IFHL 5D6CB 4LARL 3JVGA 1KG0A 3QFJD 3NBNA 3GSRB 4LCUA 4RMRA 1NUNB 4Q6IA 1XF5A 4I1NB 3L3DB 3V4UH 1T0MA 4OUOA 3DYPA 4JFFA 2HJLA 5T33L 3ZE0E 2Q7NA 1PSKL 1EGJL 4IRZL 2JJWA 1FBIH 2G60L 1CD9B 3GK8H 4GFTB 1S7RA 1Z9OA 3I6GA 4M7ZC 5DEFA 4D9QD 5HHQB 5E5MA 1OW0C 3PWNA 4MAYA 3RY6A 2Y25A 4AG4H 4EI5C 1FLTX 1KTLB 2DI8A 2Z31B 4KAQL 1WFTA 1R5VB 2Y23A 4JRXA 4ODXA 3MRDA 4NN6B 4I48B 1U8LA 3QIUD 3EYSL 3DO7B 3CVHA 1FGNH 1P5VA 4JN2A 4Z78B 9CGTA 2V2WA 4QXUH 5GGRA 5TH2A 3F7QA 3D3VD 5CWSA 3H7BA 3VXRE 1F00I 43C9B 1FORL 2O26U 5SX5H 1QA9A 3SQBA 5K9KB 1A1NA 5EOTA 4F3FA 2LAAA 3LS4L 2VC2L 2OL3L 2DQUL 3O3BB 5EBLB 1KT2A 2L7UA 3AAZB 4FABH 3DX9B 1MCSA 1LO5A 2YA1A 2P1YA 1CXEA 3IXTA 3DBXB 3BKYH 4CVXB 1UT9A 1RULL 3N50A 4PR5A 1FG9C 4AH2A 5KZCD 4EKXA 3TBVB 3BP5B 4KKLC 1CBVL 3OB0K 3O6FC 3EZJB 3QI9C 1QSFB 3BP6B 3WEXA 4J2XA 4RWYH 3MO1A 1KF9B 3DMMD 4F9LA 4MB5A 1BX2A 1RFDL 2VRAA 3QAZC 5KBNC 1FNSL 1G7PA 1FIGH 1NCCH 2NR6D 4NNYA 5CCKL 4PRHB 3WHE0 3HZYB 3GMQB 3SCMB 3P30L 4MLSA 1WT5A 1QKZH 3OX8B 4K7FB 2EKSA 2Q87A 3KLDA 4APQB 1NGXA 2AXFB 1VEOA 3C5ZA 4GW5B 5GRYA 4XVSH 1QLRB 3MXVH 4WV1A 5HHOE 3TFKD 3M8OL 3REVA 4GAJH 5CP7A 3EIFA 3T0DA 5EU3A 5EO0B 5CGYC 1CDGA 3QQ9C 2ZCLL 3VXUD 5DD3H 3I85A 5B38B 2D4FA 4JFDE 1IVLA 2ICWA 5J6HA 5AAMA 3VXNB 4HS8H 4Y19A 4MZ3A 3U30C 1H5BC 1YEEL 4CMMB 2VLLA 3V2AR 4OJFL 1I7RA 3F7YB 2NW2A 1XGPB 4DAGL 3QO1A 2ARJB 5DTFA 1UJTA 1SBSL 5C8JA 4F33B 2P49B 1G0DA 3LRSA 4Q2ZA 1GGYA 4JFOA 5IIEA 1SYVB 15C8H 1FVEB 3ZKMC 1I9IH 1N5AB 3ULVH 4F58L 3LKSB 6FABH 5L6YH 1YQ2A 1I85C 4CMHB 3CU1A 5IB3A 2AXGB 2EC8A 1AGFA 1DN0A 1FPTH 3HMWH 4RBPK 4KRLB 3H9HB 1RZ8A 2YSSA 1N6QH 4PJIE 4HFWB 3ZMRA 3D85A 2NY0D 4XGZB 2APWA 3O9WC 2AJVL 5CP3H 4PJ7A 1LD9A 3D39E 3WNPA 5EIVA 1ETZB 3BZEA 1IGTA 3DURB 3MGTA 3TJEH 2DLIA 4ISVB 3O45A 3A0OA 4WUKH 1HINL 2HTLD 5DRNB 1CGWA 3U7WL 3F12A 4PJFB 4X6DF 1AR1D 1S7XB 3ZYJA 1X4YA 3J7HA 4HQQL 1FNLA 1UXWA 2EDNA 4PRIE 3VWJD 1TCRB 1T80A 3LH2H 4K8RH 4P2OB 5CFHA 4GXVH 5CAYB 5DHYA 3B8YA 5FKAA 3OPZH 4NBZB 1NEZB 3GZKA 3VDCA 5FUOL 4MDJA 4LIQH 1RMFL 2B2XH 4L9DA 3ARVA 5I1GL 5DD6A 4U05A 4PGZA 1IQWL 3M17A 3AM8C 3EYQC 1CVSC 1MUJB 4DZBA 3IF1A 5J1AB 1AI1H 5ENWB 4YO0B 2X41A 3MLUL 2FIKB 1NKRA 1NMCB 1KIPA 4XMLL 2RCSL 4YC2C 3ZKNC 1WIOA 1ZEAL 2AK4A 4IBLT 1N3NA 3BP7A 4GG6F 4UT7H 2VXTL 3AB0B 3MFGB 1OSPL 1CDIA 5ESQB 2E6QA 4PJ5B 4Z9KB 4X6BB 3IJYA 4M6MH 5K9OA 4ZUTB 1CG9A 3MRHA 4EXKA 4H5SA 2Z93B 2DQJH 4HKBB 3DXAD 2AJYL 2EEDA 1WZMA 2DL9A 4MQXC 5ACZA 3QJFA 4KI1A 4QHUB 3UJIH 1IM9B 2QKIB 5ISZA 3QWQB 3MRPB 1M7XA 4PGDB 4XNZC 2EIEA 1YEDB 2ADFL 5LAXA 1NC4B 5HDLA 5KSUB 1R5IB 1DVFA 4RGNE 4X99B 3BGMB 5HI4C 4ZO9A 4DGIL 1KPVB 2ZCKL 4ELKA 3O2WH 3NFSL 3KS0H 1ACYL 4GRLA 2OP4L 4BKLA 4YQXL 3DETD 2AJ3B 3MNVB 3AU1B 4ODHL 5E8PA 4WW2C 1JPST 4D2NA 2BP3A 3CCHB 4R3SB 4NQXB 1GGCL 3ZHLA 1A0QH 2I60H 4JGMA 3EBAA 3D0VB 3MLRH 4KTDH 3PWVA 3UEZA 4LPXA 2K1MA 2HMIC 2B0SH 3HAEA 3HN3A 4NYLA 1U8NB 1R3IH 2ICEB 2ERJB 4TSAL 1OQXA 5AD0A 3PE9A 3SBWC 4EQ2A 2VL5A 3M07A 1FP5A 3S9DB 1ACZA 1BQLH 3IDMB 2QL1A 1JNLL 1OP5H 1QRNA 1VFBB 4K3DL 3HI5L 4QRUB 1RD6A 5JHLH 3Q0HA 4MJ5B 2R4SL 3VI3F 1I7ZB 3IFNL 5E1HB 1B88A 2A83B 1YN7B 2IH1B 1TXKA 3KXFB 5C09A 4Z5RA 5FYKE 3BDYH 3S8WA 5B39A 5EOQH 1P1ZB 4Z8FL 1DBBL 4Z6AT 2MPAH 5CILL 4BQ8A 1P9MA 2X9WA 5HTSA 4E41D 1YEFL 3G5XA 1GHFH 2OBGA 3KPRD 4Z0BL 5D70L 2XZCL 5D71L 4DVRH 1RUPH 5EA0H 1MRFL 2JJTC 1ZT7B 5MEQB 1F4WH 3V7AG 2HT2C 3DGGB 2YPLB 4WO4B 4G42A 1MI5E 4PGBB 4UV7H 2F58H 5I73C 1YEHL 2R1WA 3RWFA 4LCIL 1NEUA 4XP1L 4PRPE 5DS8B 4P5TA 1QBLL 4G8GE 3RNKA 1A6AA 2ZPKH 1Y6MR 2XN9B 4TVPD 5EU7E 4Z7OE 3QPQD 3FO0L 1BM3L 2A73A 5E8EB 1MCCA 2O61A 2D0HA 5CINL 3IGAB 5INCA 3EJJX 5I16B 3LB6C 2CLZB 1F3JB 5ICXA 4OM1H 2ZSVA 4Z7NE 2FR4A 2HVJB 2NTSP 2W9DH 3MRKB 4MA1C 5FYLL 2NZ9C 2WWKO 3VGHA 2CDGB 3SEPA 2DQFB 2V7NB 5EU6D 4H25B 3HAEG 4H8WL 4POZC 1U95B 2YPVH 5HD8D 1MFEH 1X5XA 1KIQB 2VLRA 4F8QA 1I8IA 4CVWA 4Q6IC 2BNQD 5E7BA 3V4PH 1DBKH 4OGYH 1V7NH 3QIWB 5DMKA 1EHNA 2OR9H 4P2QD 5DFTA 3LHPL 4BQCA 3NN8B 1ES0A 4TN9A 3FQTA 1WBZB 4ZNEE 5ANMA 4KPHL 1Q8MA 4XCEA 3G6JF 1Q9KA 5HI3C 2X40A 5B39G 4MAYC 1F58L 1SVCP 3T0EA 5BJTA 3BEVA 4YDIH 5IV2B 4JRYA 4WUUD 3SE4A 4ODSL 3IFLH 4DGVH 4MWFB 4PIRF 4G43B 1CD8A 3ARPA 5GGQH 4Z7UB 3RVXD 4FTVE 1A6ZA 1JFQH 2H9GB 2BVPA 2V2XA 1XIWB 3UPAA 4UNTA 4WWID 2ADIB 2W0KA 4L29A 4TPRL 3NIGE 2J1KA 2FIRT 4FOMA 3QXWA 3JBG7 1CZ8L 5D1XB 1QSEB 4KKCD 4WHYH 5C2BH 1F02I 5KS9B 1J12A 4XP5H 3RHWF 1P7QB 2LU7A 4L8SB 3MRRA 3NPSB 3S5LB 3LEXA 5LGJA 3BE1L 1IMHC 4PJEF 1PG7X 5SWQB 3L3OB 3CDGB 5CBAB 4PJHF 1VFAB 1KYOJ 2UY7A 3I75A 1I4FA 3OB0H 4I3RH 5GRZA 5FYJL 4YHOH 3JWDL 4QRRE 5C0CA 1R3LB 5I8EA 1W8NA 3QEQE 4KH2A 4MNQB 1Z0MA 2A74B 5F8RC 5ID1A 1E6OL 4ODUA 3VMOA 5LXGL 4PLKD 1AXTH 4NJAL 5JIHA 3U0PB 5IESL 5ADPL 3IJHA 1FO0A 4NN5C 3CH8A 4WY7L 1CYGA 3HC4L 5I19L 3T0AA 4QHLB 5HYQA 4HWZB 5DVKA 4F9LC 3R1GH 5EUKB 2D7TL 5IBTH 1AO7A 4NDMB 3B9KB 1YUHB 4E5XB 4JGUA 1UVQB 1NBVH 2UZXB 5LCVH 1IGIL 1WF5A 2AW2A 1CR9L 3PQYA 5D7LE 1A3LH 3C5ZC 2ESVB 5F7UA 3ARDA 2DQCL 5D93C 1XCQA 5BS0E 2XZQH 4WV1C 3RIAK 5C0GA 3RAJH 1AJ7L 3ZSSA 1J18A 1WZ1L 2FJHB 4JG1H 4UINH 5CSZB 1XGUA 1L7TL 1NCBL 3L3KA 5BV7B 3EGSA 1SEQL 3P40A 1BOGA 1RJLB 2VZVA 2BDNH 3GJEA 5JZ7D 3QEUA 1OM3H 3WE6A 4WU5B 3UTTD 4MAUL 4PYGA 4OCRH 1FJ1B 3ZDXF 1LO0H 25C8L 1LEKB 1HKLL 4ZSOA 4F7PA 2ATKB 3HE6A 4PJ8B 5SWSD 5K9JL 3H3PH 4YXHL 4I0PB 3D18B 4MCYB 1IGFH 3KYNB 4N9GA 3WFCL 2YPKB 1TTFA 4RBPH 4WCYH 4DN3L 3G6DL 5F21B 2Q6WB 2C1PB 3SDAA 2BNRA 2Z8WC 4PJCF 4Q9BA 2J6EH 5FGSA 5BMFL 2NY5L 3NACL 2DL2A 1FE8H 4R6UA 4HZLA 4I18C 2EDXA 1S7SA 1W72B 1HIML 1J1XL 2CSPA 4HBCL 2DQIL 4M5YH 4CKVX 4JFZL 4YJZL 3TVMB 3ZT7A 1GAFL 1RURL 1M7DB 5E6IA 2VQUA 1G7IB 3NA4A 1UB6B 4L8CB 4NO0A 3ARBD 2UWEA 4ORGB 5IHUH 1DANT 4X6DE 4BH8B 2DLHA 2NXYB 2XFXB 2NY6B 3CVIH 5HYJE 1EA9C 1NFDB 3L5WB 1IAKA 4BFEA 3GMPA 5JOFB 2YKLL 1HH9B 4FXKA 3G9VA 2VXSL 2VZUA 3TEUA 3SGKA 1RPQA 3GIVA 1IC7L 1FZKA 3HMXL 1OGAD 3S37X 1KPRB 1XR8B 3D69A 2OM5A 4F9PA 3PWUA 5IF0A 4OV6F 3VG0H 1EX0A 1KN2H 1T66C 1YEIL 2R0KL 5BZWA 1YEKH 1YC7A 5JW5B 1A21A 4GG6E 4UNUA 4HUWA 5I2IA 3P0VL 4XPHH 1ZA6B 2B4CC 1F97A 5DZNA 4YHKL 4IOFD 4Y4HB 3SKUD 1MSPA 3TN0B 2IFFL 3O3AA 2CRMA 2M26A 4XCFH 5DK0A 4MXWL 4I2XA 3B5HA 3OZ9H 5H2BB 1E4XL 5ICZB 3DX7B 2DQTH 1U3HB 1W0VA 4DEPC 2R23B 4Y4KA 2RB8A 3OWEA 4ZOBA 1WLHA 5I1DA 3DLQR 3GSVA 2D7OA 2X4PB 5FGBC 4ETYA 4JKWA 3ARFA 2DJ4A 2VDOH 3ZSTA 5J56B 5F3BB 5EUOF 3TO4A 1JPGB 3WCYA 1UWXK 2KDGA 4HSQA 4O2EB 4QXGL 3SGEH 3MZGB 5JW4R 2KBGA 1J1OL 1O7SA 4R97B 5C0BE 4NT6A 1GIGH 3QDGB 3S96B 4EBQH 1YMME 1ZAGA 1FGVH 1RUAH 3TZVA 4JFEA 2X4TA 3LKRA 4OQTA 5IJVA 3RWEA 5BRZE 4JM2A 1T03L 3GMMB 4GW1B 1F8TH 4CDGC 1C5DA 1G7HA 4LGSB 2EE9A 4Y5YA 1NMBH 5TE4L 1EAPB 1MQKH 1GC1H 3NVQA 3K2MC 5F7EL 3VFVA 3MV9E 1IGCH 1FV1A 4OT1H 5ETUB 4C83A 2NMSA 5M7QA 1RZGB 4Y16B 3CFKA 2HA1A 4YHML 2A9NH 1MHEB 2HJKB 1U8OB 2DBLH 3MJ8A 5IMKA 3RWGA 4UT9L 5JW4Q 1ZV5A 2P8MB 3VI3E 5L7XL 3MYJA 1D6EA 3VW3L 3CFEA 3EYFB 3EW3B 3MNWB 3QYCA 4YHPA 4UQ2A 2P5WA 5CHNA 5IFJA 3F7VB 4U4BA 4BH7A 3C6SB 4JFXB 4ZFFB 5GS2H 2A6JB 4V1DA 4YIQB 5IFAL 5I8CB 1L0XA 2VITB 4OCYL 1FH5L 4AIXA 1P9MC 2VLKB 3LV3A 1K6QL 5ID0B 1Q9WA 3SKJH 4H20L 4AK1A 4X8JA 5TDOB 4MX7B 3NFNB 4U1NA 2D4DA 2UZYB 1NPUA 1JN6A 4Q7DA 5M95B 2W65A 2KH2B 1KCVH 3IDXL 3IRZA 1PZ5B 4LMQE 3CXHK 1KC5L 4HG4K 2BOBB 2CK2A 5FYLE 5C0RH 3RWHB 3B2UD 3CJJA 4P5TC 1NGPH 4XXDB 3MRBA 4O51B 3OR7B 1CDCA 1QVOB 1U8IA 1CFBA 2XZAL 3FT3B 3MZTA 1I75A 4OZHA 1U8MA 1U6AH 5KVFH 1AQDA 2NW3B 5ADOH 1T1ZB 3MRLB 2BVTA 2IG2L 3RZCD 3HCVB 4QRPE 4L9LB 1VB9A 4OIBA 3E2HC 4FZ8H 4IMKA 3L5IA 2OQJA 5DD1H 3S97C 3DV6B 1NBYA 1RZIB 4WHDA 3KHQA 2OS7A 4JHBA 4TUJA 2B5IB 2DM4A 5I1JH 4DGYH 1N4XH 1J7VR 5IJKC 1N8ZB 2GSIB 4RMVA 4U0QB 2P5EA 1ZANL 4M48H 5BV7H 4YDKL 3OAZH 5FV1L 2BXYA 1MRCH 4YFLI 1JPSL 3G6JE 4U2YA 5I9QC 5I1HH 3U6RA 5EFIA 4DFHA 1N5YH 5JW3L 2FNBA 2C4FT 1ZHNB 1JRHI 3RY4A 3G5ZA 1AP2A 2CIIB 3UTQB 2QR0A 3O6ML 3BN9C 4IRSA 4PJGA 3W0WB 1HQRA 3CZFA 5D72L 1DFBL 1CGSH 4PJ9A 4PY7B 4N90E 2DWDB 4BELD 2W9EL 4PRDA 3MCLL 1NCNA 3F65A 3QP3A 5HDQL 3IKCA 2E6PA 2IMMA 4ODWB 1W72H 3VGFA 1A5FL 4MS8C 3GSUA 4DK6A 4JO3L 5C0EA 4PJHE 5D7IA 5HVHB 5KVEL 4K71B 3Q2CA 4XT1C 2ZSWB 2QADD 1FN4A 3EJYC 1U0QA 1JV5A 2GJ6E 5HGHA 3VFPB 3BOVA 5CS7A 3RGVA 4FFYH 3SKNA 4D8PB 1NDGB 3QUKA 4ZAKA 1ZGLB 1I1AA 4KRPD 2W60B 1Y18A 4WEUD 4O9HL 3PDOA 3MFFA 3I50H 1DQDH 1IAOA 1T7YA 2ZCHH 2Y1VA 1EFXB 3WKMH 4P48A 5DJZB 4IHOB 2HKFH 2EIBA 2GAZB 5DUPH 1DZBA 2YBRB 5DJDA 4JY4B 4G8EB 2J8UA 5IW1B 4JHWH 4F7CA 3A6BL 2WUBL 5IVNA 5B3JF 1CVRA 2G5RA 3FFCA 1EHXA 4WW2F 1MCPH 2WLZA 3LN9A 4IIQA 4KDVA 5L9DL 4MMZC 3QFJA 1XGQB 1UM5L 3MV11 1YMHB 1F90L 5LGHH 1IM3B 3CLEH 3VXRB 3QFDB 3MNZA 5IB5B 5FDYA 1XH3A 4WW1B 2E7BA 3V5HB 1R3HB 1KENH 3ARDC 2X5PA 3MLZL 1NCUA 1CQKA 2PTTB 5FA3A 4LDLB 1S5HB 3HR6A 5C86A 2F74A 3HFML 1UYWH 2Y7QB 5FM8A 2B1AL 3CC5B 2APTA 2EC9T 4XPGH 4M61A 2IAMD 5DQDL 4G6KL 3WBDA 1RZFL 4KKAD 3VJ6B 3ZDXE 4QGTA 3WUWA 5ALBH 3E6HB 4JB9H 4ZUVA 1MEXL 5L2JB 2X4NB 2NY4D 5J13B 1D5BB 4C56D 3QIUA 3U46B 5E2UL 1FSKB 1TJHL 3P9MA 2CKBL 4RFEA 5I76A 3EDDA 2EDJA 4ERSL 3HC3L 2ZG3A 3D3VA 3QQ4B 2BVOA 4PJCE 4LLWA 5ELIA 4JFYB 2R69H 5I15H 3G5YA 5KJRL 3V7MA 2CJUH 3SDAC 3BUYA 5C7XH 4GRWF 4LCYA 5E8NB 5F97E 3RDTD 3PWPE 3TH3T 2BY3A 2GKIA 3O6LH 4L3AA 4CU6A 5FDWB 1AFVH 3ULUC 3K46A 4MJ2A 5HHOB 3BO8B 1CGXA 4YWGL 3ZTNH 4LF3B 1A9EB 4UIMB 1GGBL 1RHHA 5T3ZD 3FQXB 3PJSB 5E6IC 2LE9A 3ILPB 1PZUB 4JFDB 1BZ9B 5EORL 1A7BA 3VFSB 4EQ3A 4S1RL 2FJGA 3GSWA 2FBJH 3L3GA 2HP4A 5F3HB 4W6XB 5TQ0H 3DMMA 2JCCE 4BZ2L 4NHCH 3L6FB 1XF1A 2EIZA 3QA3A 3OJDA 3H8NA 4HZAA 3B3IB 3X3GL 2A6DA 3PDDA 4WFGD 2YRLA 5F8QC 3SGKC 3SKMB 1SMAA 1AY1H 1FAIH 1UZ8A 4IOSD 4XNYH 2JB6B 3MX0A 5AYUH 1N64H 1RK1A 4O4YL 1FZJB 5JUEH 2JLLA 3KPNB 4A2LA 1RAMA 3UBXB 1ITBB 4MQ7A 4KZDL 4EOWL 3I2CH 2R1YB 2FHFA 3VMPA 4PJIB 2UY6A 1UWGL 2ZOKA 4NNXB 1W0WA 2Z92B 1IGYA 4GSDH 3VXUA 3WJLA 3WUWG 1ONQB 4TRPL 3K2UL 1LEGB 1LEIB 3NTCH 2P45B 3ECBA 1KIRB 2V5TA 3D39B 3QUML 4BSVB 3WL9B 1GPOL 1VSCA 3DUUB 3IFOA 4NHUB 2P48B 2FZ3A 1NL0L 3LSOB 2I07A 1MJJA 3FOMA 3GNMH 2NNAB 5IVXE 4LSSH 4KHXL 5JR1L 2W0PA 3UTZB 3S35L 1RZKC 1EPFA 1TZHB 5JDSA 3MRQB 2PXYB 1DLFL 4PRIB 4MJID 1UWXH 1HXYB 4MD0A 2OJEA 5DC0A 2Y72A 3DRTA 4NJ9H 4HC1H 2X9YA 2DBJA 4GBXD 5EUOE 3O8XB 1Q94A 3CLFH 3FQWB 5K9QG 4Q9QH 1BGXH 4Z77A 3LEVH 4P23B 1BFVL 4BM7A 3BH8B 3VFGH 5CSGA 1D5IL 4OFYD 5CJXC 2R2CA 4EDWL 4P2OC 4QHNB 5IHZA 2BJML 4GQPH 4GKNA 4BSJA 5T1KD 5CMAB 3WJJA 2QSVA 1FG2A 4G6FD 2XNAB 5JXED 1JPTL 1KNOB 3U79A 1KB5B 2DM7A 5ABDE 5DUMH 5E2WL 3NCEB 5D2LA 1A1OB 4UTAL 1EEYA 1U9KA 4JM2C 2GJZA 2HVKA 4Y5YC 4QRTA 3GSNA 3KYOA 3FAWA 1SEBB 3VWJA 1BAFH 3DPBA 3QUXD 3BPLB 1A7RH 1MF2L 3FRUA 4HWBA 1HHIA 5GGVL 3TBTA 3AREB 5FO7A 4NRZB 4YR6B 5H35B 1OAXH 4PFEA 3TV3H 4K3EH 2IBZY 4JDZA 2AEIT 4HKXA 4O02H 5D7JB 4HK0B 4LSRL 3QHTC 4GAYB 1MIMH 1XZ0B 5IB2A 4M7LT 1VKXA 1I3GH 2Z4QB 2Z35A 4ODVL 4XHJC 2NY2B 4JZJB 5GS0C 4XPTL 2J88H 3BWAB 2VDLH 4RGNB 1H3XA 3EO9H 2XICA 2BCKA 5GHWL 1DQMH 2ZUQC 1P5UA 5HGAA 1KLUB 4JM4H 1TVBA 4ZFZA 3MJ6A 1UXSB 1I9JL 2NTFB 2PW2A 1SY6A 4HCRA 4KK5C 3DVGA 4CU7A 5F9JB 5KVMC 4L8DA 2MHAB 1JHTB 1QO3A 5CEZE 5F1NA 3BEWB 3QDHA 1TCMA 3DUHA 4PGCA 4X4YB 2YD1A 1QD0A 1PD6A 4JPVL 4XWGL 2VMFA 2XKUA 2DQEH 3DXAA 4GXUN 4CN6A 1YY9D 5I1LA 3O4OB 1FNAA 3IVKA 5IR1A 2CIKB 4OF3A 5IEKB 2BFVL 3BKML 3CUPB 4CADB 2Y06L 1FYTE 4W81A 1I1YB 3KWWA 4Z95H 4OZGA 4LRNL 2VLJE 4ODTH 2ITDA 4GUPA 1KJMA 4PJ7F 1XF4B 4PRAB 3FONA 4P59H 1KV3A 4OLUL 4R7DA 4HMCA 3GI8H 3REWA 2X7LB 5TPWH 3FO2A 5C0AD 3MA7B 2SEBA 5HHPB 1F6AA 3FCTB 5E9DD 1P4BH 2WK2A 1KELH 5DJ6B 1YECL 2AEQL 4I4WB 1FLRL 1INDH 2ORBL 1MREH 3L3JA 2NZIA 3Q48A 2Z91B 3HB3D 3DVIA 1OD7A 5J8OA 1ZVSA 2ADGA 4KDWA 2D0FA 1MI5B 3EOAA 3FMGL 5HPMB 3SDXA 4XI5C 4PRPB 4G8GB 4OTXH 2ZNWA 2OI9B 4X9HA 3P11L 4XWOC 4H1LB 1A3RL 3LD8B 1FNEB 1YPZF 1XGYH 4JLRA 4WHTB 4IRSC 1Z2KA 4ZQKB 4YDJA 4G9FD 3R06B 1EVTC 4WFHD 4LHUB 4OIAA 2R1XB 1L0QA 3HPLB 4PJ9C 4XZUB 1MFBL 4H26B 1K8DA 5H94A 1EJ6A 3GGWA 1YEJL 3H9SD 2AJSH 4E41A 3MRJB 2VISA 2B4CL 2DD8H 3KPRA 2H8PB 3LRGA 4NO3B 3UBXI 4NKDB 3C5JB 1DEEB 3W9DB 1CE1H 3QSKB 4KROB 5KTEL 3U0WH 5E5UB 3GSXA 1P2CA 3VE0A 1CLZH 3QWOB 3BVNA 3TWCH 3R8BB 4X9BA 1KEGL 3OAUL 3QJHA 1S7QB 3BPCA 1JPFA 3CFCL 5DEGB 2HFFB 4ZAKC 3LIZL 2GCYB 2DKSA 4G6ML 1OF2A 1S5IH 5IFHH 2F53D 3J8F7 5EOCJ 1VESA 2FEEI 3JXAA 2DYPD 4PB9L 2VH5H 5IT2H 4JO1L 1GC1C 4QGYA 3QIWC 1AGBB 1NCDH 4BSWA 5E8OB 4UAOC 1H3VA 4B0MM 5I71C 1X6NA 3NFPA 3QXUA 4S2SB 4UB0L 2G5BB 4PP2A 2OL3B 4NZDA 2N7AA 3WHE1 3K1KC 4FTVB 1Z9MA 4NWUH 5EU6A 3U2SB 3OKNB 3BKCL 1IAIL 4PJBA 4IRJB 5CD5D 2D31A 4XBGB 2FH8A 3T2NL 2Y07H 2HT3D 2HN7B 1AE6L 3CFBA 2BNQA 1HSAA 3EOBA 4G3YH 2UVFA 4P5KA 3QDGD 4LKXA 4P2QA 3RNQA 4N0FA 4R0LB 4ZO6A 3OKMB 1UWEH 1DSFL 4QRRB 1ZMYA 4LFHD 4HV8B 3QEQB 5J11C 1X5IA 3NPSC 4XC3L 5F72S 3QEHA 1X5LA 4WUUA 3KDMB 1OCWH 3MCKB 2R8SH 4KK6D 4DKFH 5J6GB 4FQJH 1MAMH 4U1HB 3TH4T 3QIUC 3B6SA 3MLTA 1OWRM 4I77L 4I9WD 4YBLB 2VWEC 1T0NA 1TJIH 3ROOB 1MCEA 3KPQA 5EOCH 1A2YA 1QFUH 3STZA 2E27H 2AS5M 4QRSA 1BWMA 3WSQH 5D7LB 1IL1B 2CO7B 3KR3L 3P4NA 1I8KA 2YA0A 1DBMH 4A6YA 1ZHKA 2HWZL 4NKOA 2GK2A 3DSNA 5BS0B 5TFSL 1BD2E 5AUMA 2IBBA 1WTGT 1B0GA 3B9KC 3ARTA 4Y2DB 1JI1A 3KYKH 1ED3B 3QXAB 1QPPA 4KV5F 4F7TA 4AEHH 1HXMA 5A3ID 2DMCA 5DMYA 2E9IA 2WIIB 3QDJE 3QDAA 4POUB 3N9GL 1KLGB 1HZHL 3HI1B 4TSBL 2VZ3A 1RJZB 5BV7C 2JE8A 2ZOLA 4AIOA 4LPWA 2GIYA 4L3ED 1KOAA 4PY8J 4X4ZA 1YZZA 3ARUA 1CICD 4JFFE 4ACPA 3WYRA 3NCFB 2JTDA 1KACB 3H3BC 4I5BB 5I8OL 3LQAH 1DLHA 4P99A 3VFWB 1NFIA 4FFWC 5DJ0A 4X4MA 2OR8A 5TGBA 3C8KA 2DIBA 3VFUB 3EYVB 1K85A 1FAKT 2FH6A 2C3VA 2XTLA 3PGDB 3WJLC 1U36A 2C7UB 1MCHA 4OCSL 4JRXE 4JQIH 3VRIA 3UTTA 4GAFB 4X6DB 1F4YH 5CIPH 1LDSA 1IT9H 1JUFB 2HFEA 2CLRB 3L5XH 5HYJB 1ZHLA 4YHYB 3Q1SH 5SWSA 3FJTA 1RU9H 4XPAH 1CDJA 2AABH 3BT2L 5I6XB 1MCQA 2WWMD 5BO1H 1XCTB 1B4RA 3P9LB 4HGKC 1IBGH 4NCDA 4IJ3C 4Y8DC 1KJ2L 3NA9H 3ZT5A 2Y5TA 1PYWA 5E2TL 5E5RB 3W9EA 1MVFA 4X6EA 3VFRA 3JV6B 1CDBA 3V6FA 4D9RE 2FB4H 5FYKH 4GG6B 2NY0C 1DQLL 4HGWB 5F89B 1EDQA 2Y6SD 3ARBA 4U49A 5DJXA 1D9KB 3B9VA 3OL2A 5F7YC 4NZRH 5HY9A 1H3GA 5D9SB 3F6IA 3HZKA 4YHIB 2A9ML 4HS3B 2D7MA 1FFOA 3BH9B 2XPGB 1KXQE 2UZIH 2VABB 3N1FC 4NCC1 2PKDA 3TBSB 4XNMB 3VWJC 4NRYB 4NO2A 4ZXBB 5KSAD 3K0WA 1FO0L 4U1IA 5I1AB 4NQVB 3MGOB 5CLTA 4F7EA 32C2B 3VXTA 1OGAA 2O93L 1PY9A 5D5MA 2O5XH 2Y36L 3Q5TA 1Q0YL 4WWKB 8FABA 4YUEH 1EEQA 1EFXD 3A67H 4FNLL 3W39B 1IFHH 4LARH 1N2RA 1LMKA 4H1LH 1JGDB