1KIQB

Fv mutant y(b 101)f (vh domain) of mouse monoclonal antibody d1.3 complexed with hen egg white lysozyme
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
QVQLQESGPGLVAPSQSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLHTDDTARYYCARERDFRLDYWGQGTTLTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (immunoglobulin/hydrolase)
molecule keywords MONOCLONAL ANTIBODY D1.3
publication title Hydrogen bonding and solvent structure in an antigen-antibody interface. Crystal structures and thermodynamic characterization of three Fv mutants complexed with lysozyme.
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 1996-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kiqB00
5HYSB 2B0SL 2WW8A 5T5NG 1PQZA 1NCCL 1HI6B 5C0AB 5FM5O 4HBQA 5KSAC 3G6DL 3ZT7A 4LLVB 1A4JA 4OFYD 1PJ9A 3HZVB 4F7TA 3FO0L 5F88B 5IB4B 3RX5A 5BRZE 1MJ7H 5HI4D 3TV3H 2EXYC 4GMTL 3BO8B 1GC1H 2HLFC 1VESA 3L1OH 5L6YL 3T4YB 1P5UA 1AXIB 4HK3N 1KG0B 1UM5H 4P5TA 4YHKL 5DC0A 1PZ5A 3GKWH 4RFOL 4YDKL 3MUJA 1IE5A 4EI5B 4R3SA 3UTTD 2DM4A 5D1XC 3QXVA 4PJ5E 2ZCHH 3EDFA 5IV2B 4U1HA 4JFDA 4Q9QL 4LQFH 4K3JH 5HHQA 1SJXA 4PJAF 1JPFB 2BMKB 4EUPA 3O6FB 5DHYB 4I8DA 3BJLA 2E7LA 4HDIB 3GNML 4WDIA 1VKXB 1S3KL 1YEEL 5I19H 2DQUH 1DBJH 2XWJB 4N1EA 4CMHC 5H37G 2A6JB 1KTLA 4YZFE 3TPUB 1JPTH 5LCVL 2J8OA 2CK0L 4EOWH 1BOGB 1EO8H 5DJXA 1ES0A 1FYTA 4O2EB 3WFEL 1QRNE 3K4ZA 1WF5A 2JJSA 2XWTA 4C4KT 3IFPB 3WEXB 4MAYD 1KGCD 3MLTA 3ILQD 3FJTA 3NVQA 5DUBA 4ZMAT 4OD2A 3F7YB 4P3DB 4APQA 3GKZA 1YC8A 2VDLL 5F1NB 3RVUD 3DO3A 5GGQH 1BVLB 1OHQA 3LEXA 3QULA 4R26L 2XTJC 2FYYA 4PRPB 5EULV 1A6VH 2Q76B 2WBJA 3V7MA 2YS4A 4DN4L 2X1XR 3AVEA 3E6HB 4M62L 4TPRL 4NM4L 1DQLL 1KIQA 3SDCC 4WFFD 2J2ZA 3SJVA 3ULVL 2VLRD 4B50A 3QQ4A 3MRKB 4BZ2H 5IHLB 5JW3H 4F3FA 2AXHA 4JFEB 3FO9A 1R6VA 3GI9H 3GMOB 2VLMD 4K7FA 5H94A 1RQ5A 1MELA 2BZDA 4YHZH 1MCDA 3EZJB 1K8DB 3PDOA 5AG9A 3WO4C 3C6SB 4S1QH 3QZWB 1MLCA 3MGOB 1IAOB 4OGXL 1PEZA 2NCMA 1N7MH 1KN2L 1YEGH 3GJFH 4DKEL 3QWOA 4P46D 3BMVA 3ARTA 5F3BA 1NCDL 2HG5B 2XRAL 3UPAA 4ELMF 4RDQF 4KJQD 4HUXA 1AP2A 2E7MA 3OV6A 2ESVE 4NZUL 3BH9A 4XP4H 2FX7L 3RKDC 2A6IB 3LDBB 1F4XL 2OMNA 4O2CB 1ZLVK 1EA9C 2GAZB 2PCPB 4DK3A 4G8GA 2YXFA 4X6DB 3EYVA 4YGVA 1UEYA 1F3JA 4Y16C 2OTUB 3SOBH 1NGWB 1AQKL 4PG2C 1KENL 2J6EH 5TF1L 2NY0C 3KHOA 2AXFA 4PP2A 2DLFL 4I9WE 5AD0B 1MH5B 5HYJE 2NQCA 4PLJC 5EU7C 4PJHF 1S9WA 4ZDHB 3HR6A 5JNYB 4JPIB 4OZFA 3L3DB 1CS6A 1JTPA 2MQCA 2QQKH 2YBRA 5MERB 3V79C 2XTLA 3EO1B 5D72H 1VGKA 4HLJA 5DJ6A 1LDPH 4ZUVB 1ETZB 1YPZA 2HFFB 2N7AA 3Q5TA 5D6DC 5MHSD 2IAMC 3QUYB 4M61B 3S5LB 4GW4B 2QSCL 3MCG1 3CUPB 1TQCB 4L4JA 2VZOA 5KSAA 4NUGL 4FQ1H 4YNYB 2P24B 4LSUH 2D2OA 4R4ND 2Z9TA 1FNAA 4BQ9A 4GRMB 2BRQA 2ZKHH 5FA3B 4AQOA 5D71L 1KJMA 32C2B 3C5ZC 5GJTL 3KYKL 4OFPA 8FABA 2BJML 3VD3A 3VG0L 2MMXA 1GOGA 4YE4L 1EJOH 3PWVB 5F7WC 4HG4J 1NFKA 5ITFB 5IROC 5HHXH 5D7IF 1I1RA 4LVEA 3P11L 3T0EC 3EFFB 4UQ3B 1WWCA 5IOPA 4PUBH 2XFXB 4ZPTB 3ZKNC 1AQDA 1SYVA 5D1XA 3CLFH 4UV4H 2DQEL 3UJTH 4XVSH 5DD6A 4JKPL 3SGDH 4G3YH 3W9DB 1ZT1B 1KEGH 4AT6B 4NM8H 43C9B 4PJXF 2PYFA 2B4CL 3QUMB 4FQIH 3C6LC 4Z7WF 4LASL 2H2PD 4B41A 3KPRA 1JHKH 1MRDL 1A9BB 1N59A 3MLWL 4LSQL 1WZ1L 2NXYD 2IANA 5GQBA 1YEJH 1R3IL 3I6LD 3WFHA 1A3LL 1CD8A 4OQTH 1A6PA 3VXRD 2RFXA 3BRFA 4AM0B 3PNWB 3LKQB 3C5JB 4M6OL 4Y5YB 3GMLB 1CG9A 2RIKA 5GRJL 1A7QL 5IUSA 2FBJL 3FFCB 3QHFH 5C7XL 3REWB 1M6OA 1PKOA 3MRQA 2FBOJ 3RTQB 4R96A 4F7PA 1FFRA 4PJ7A 4ISVA 4QGYA 3HC4L 1VACB 2HRPL 4N68A 3ZKSD 1DCLA 2V7HA 3MV7E 3W0WB 5IF0A 1I8MB 3LMJH 2BC4B 1T0MA 3NCJL 5IMLB 4XPFL 1J10A 1MFEL 3QCTH 4R7NA 3LKRB 5ESAA 3SDCA 1XGQA 5KSVA 5BV7C 1KYOK 4ZO7A 3H0TA 5CILL 3V5HB 3BZ4A 1NFDA 1A5FH 3EOAA 4GRWF 3MRGA 4FXKB 4WTWA 2BNRE 4IMLA 4OCWL 4JDVB 3UTSB 2YUZA 4DUXA 1N0XH 2NYYC 1REIA 2D03L 2Y06H 3BQUB 3NZ8B 3N9GL 4M7LL 5DR5L 3TT1L 3WXWH 4NC0B 2UVFA 3RVVC 1T1XA 1U3JA 2FJFA 4K8RH 3PUCA 4P4RB 2GTZB 4QXWA 3RP1A 3V4UH 1YMHB 4JPKH 5IB1B 1IGFL 4JPWH 5DVKA 1IAKA 3DV6B 5FYKE 1LP9B 3PWNA 4EUPG 3HNSL 3VXPA 5JQHC 2QADC 3HG1A 2NY2B 5E8PB 1VSCA 1JK8A 4CW1A 4XVTL 4XPGH 1HEZB 4KTDH 1JGLH 1QEWB 4AJ0A 1KXQE 5MI0B 2E6QA 1JZ7A 3VCLA 3UTTE 4I5BB 1HCVA 2NNAA 1UYWH 3BESR 1XGRB 2XN9D 1QNZH 1QLRB 3TWCH 2DBJA 4PP1D 3DTXB 4W70A 3H3BC 4DQOL 2GK0B 4AEIH 4WU5A 4Y16A 1D6VH 3MJ6A 1V3JA 1VB9A 3IDUA 4PG2A 1TCMA 4NQEB 1CGUA 4ZNCD 2GJJA 4JVUA 1MRFH 5F6IC 1NC4B 2VAAA 2VWEC 2YPKB 1ZVHA 1V5JA 4YBHA 3SQOL 4UDTB 4TOYL 3MCLL 2EYRA 1TQBC 4U7SA 5AG8A 2F74A 4MNGB 3ECBA 4GBXA 5D6DA 2LVCA 2DQCL 4MQSB 3L5IA 3JWDC 3LQZB 5IR1B 5KSUB 3GIVA 2W1NA 3EIFA 4LSPH 1FO0B 1DLFH 1QFOA 4L8BA 2DF3A 2DIBA 3PGFL 2NY4B 3FL7A 3OKOB 1S7UA 4JHAH 5HHOB 1BQLH 1EH9A 4Z78B 4DFHA 4EQ3A 1AI1L 1NC2A 4Y4HB 1S8DB 2OCFD 4PV9A 3VXUB 3B43A 2FIRT 1N6QL 1MAJA 5D9SA 3SGJC 3WIFB 2ZCLL 3C5ZA 5KAQG 2R2BB 2VZ3A 2CDGA 3U4EA 4HF5L 5AAMA 5IROA 1MNUL 1VERA 3S4SB 1X5JA 4PS4H 5GS0L 4Q7DA 2GCYA 3F58H 3EOBA 3MRDB 4Y19E 4Y2DB 2B0SH 5KVDL 5MENA 1BM3H 3T4AB 5I74B 5KVEH 4LQ1A 1C12B 3G6DH 4DVBA 2X10A 1ORSA 4YK4C 4QRRD 1WAAA 3C6LA 3KPLB 1ORQA 4FQCH 3MRBA 5ILTH 5DK0A 1N2RA 4J12A 1YMME 1UWEL 5DQDL 1BJ1J 3ARYA 1LK2B 5DHVA 1Y18A 4OCXL 2EC9U 3K4AA 3O2WH 3U0TA 4HXAH 1ZKAA 1ZVSB 5L6YH 5E8DL 4MNHA 5I1HH 2HMIC 3QJFB 5K9QI 1X9QA 1P6FA 1UWGL 5F3HB 3MLYL 4K7PL 5C6TL 4RFOH 4U1GC 3U1SH 3T8XA 4PJGB 1LILA 4GW1B 3RGVC 2VABB 5CCKL 3EFDL 3H3KA 5CWSA 2WINA 3WKNA 1I7ZA 4KUZL 1CXKA 2OK0H 4NKMB 2UWEF 3O4LA 2X4NB 2ZPKH 3KPSA 4GUPB 5MEOB 4PJBF 2X1WL 1DN2A 1B3JA 1KPUA 2KQMA 4WNQA 4HULB 2R2HB 5DJ0B 1JTOA 1A02N 1BBJB 3LZFH 3GNMH 4FTVD 4Q6YA 1S3KH 1XIWC 1YEEH 3MRPB 4IS6A 2ENYA 4R0LB 4BH7A 2ICWJ 3VFOB 4IRSD 3BISA 5E56A 5JIIA 5JQ6L 1YZZA 4Z5RA 2XACC 12E8H 1I3RA 1JN6A 5FDWA 1IL1B 3U0PA 1D6EA 4U6HA 2DTSA 1NBVH 3RL1A 1FZJB 3QDHA 2A77H 2DQHH 3UP1A 4AMKL 4OM1H 4I2XB 5D7SL 3TGXA 1QPPA 2I25N 3RIAF 4HWUA 4WO4D 3CSGA 5D2LA 2XA8H 2QR0B 1ZT4A 4PRAA 2F5AH 4DN4H 4M62H 4TPRH 4HUNB 1JGEA 3VGHA 1DQLH 4AL8H 2A6DB 1FVDA 3ROLB 2VSCA 1T7YA 3ULVH 4HH8A 2OQJB 1B9ZA 4F9LA 3BZEB 2GY7B 3V5KB 3ZKXC 5EU3A 1HCFX 4QXUL 5E6IC 1TZHB 5JXEA 4TULL 1T83C 1J05B 1DBAH 1WZMA 5IB5B 4PREA 5IK3A 4P5TB 2QSQA 1OM3L 3HC0B 5FOBA 1MIEL 1PZ5B 2EDNA 2XZCL 3LEVL 2VZUA 3QRGL 4XP1H 1T7WA 2FO4B 4CRPA 5C07A 1IARB 3SKJL 3LS5L 5ISZE 3V0AC 1X5FA 4F57H 5DYOB 3O3AA 3CJJA 1F13A 4JFDB 1LMKA 2ARWA 4DKEH 2VDRL 3VXRE 4KKCD 5E03A 3QP3A 4JM4L 3U7WL 1HILA 5IFHL 1IC4H 4G6KH 4R8WH 3QFDB 3L5WA 1OD9A 1NKRA 3LB6D 4UT7L 2FX7H 1V3MA 3WE6A 3IS0X 2YWZA 2FX9H 2I60L 1FSKB 5MP6H 4IM8A 2YD5A 2O5XH 1KTLB 1U3HD 2NZ9C 1U8LA 2YSSA 3MJ9L 4WI5A 4YHNA 4FG6C 1IVLA 1TIUA 1ES0B 2P46B 1AC0A 1YEFH 1KC5L 5TF1H 5E8NB 3DRQA 2W9DL 4D0BA 2XWTB 1PLGL 2DLFH 3NCCB 3SGJA 4OD2B 5BRZA 4DGIL 4APQB 3MBED 4D9RD 3UTPE 4HC1H 4OI9A 3HMXL 3FO2A 4N90D 1NEUA 1I1AB 2WUCL 5D93B 4LSSL 3QULB 5EIVA 4NKDB 1ZHLB 4HGMA 5CLTA 5ADPL 4EZMA 5JO5B 4CKVX 3STZA 1Q1JL 4P2OC 2D31B 5J11B 2BNQD 1KIQB 1T4KB 2HN7A 4OZGE 3SJVB 4PJ9D 5CD3A 3QQ4B 4R2GB 1OQXA 4JFHD 5E70A 5E5RB 2OI9C 3P30L 1C8PA 2HT4D 2DQGH 3DUUA 2J88H 5D7JC 2Z4QB 4NGHH 4OT1L 4RGOL 2VQ1A 1MCOH 4M8VA 1XF1A 4K7FB 4DFIA 5H94B 1MFBL 1FNFA 3MV9E 1BEYL 3LV3A 5D71H 5F21B 1CU4L 3RL2A 3AAZA 2V6HA 3DHJA 3VG0H 5CINL 4YE4H 1NAMA 1PYWA 5F9AC 3P11H 4ZD3L 3OAZK 1G9NC 3KXFD 4ZTOL 1OTUD 1H5BB 4XC1H 2HT3D 1RJLB 2DQEH 1A7NL 2HFEA 3L9RA 4U1JA 3NGBC 4HUXB 3ET9F 4UIMB 3BH9B 3JV0A 4OF8A 5IVXE 5I15H 3ZE2F 2F19H 2BOBA 2PW1A 4KRLB 1I1FB 2C7UA 4MA7L 4RBPH 5GISH 1J0IA 1DZBA 5B38G 5JORA 1QA9A 4G8GB 4LASH 4PY8I 5FCUH 2FATL 4YHIA 4WEMB 5GGSB 1N0LA 5C70A 1BQHA 4RQQB 2H2SC 3EYVB 5FEBA 1KIRA 3MLWH 4LSQH 2CH8A 4XNZB 4MJID 1F3JB 4OSUH 3VD4A 5KOVC 2PTTA 1XIWA 2NY3C 5L8JB 3D48R 1BIIB 2UY7A 2XXCB 5I6XC 1A3LH 3ZDYF 2CR6A 3DGCR 4OQ1A 2IFFL 3VFVA 4FS0A 4M5ZH 1QYGH 2LABA 2DQIL 3U36A 3T0DA 5SV4A 2XQBH 5A16A 1L7IL 4OZFB 1NL0H 2DQDL 4RGNE 2FBJH 2CJUH 1VGKB 4KH2A 5DJ6B 4E41A 1YPZB 4G9FD 5C0CB 1HKLH 1PEWA 3MOQA 5T1KB 2D0FA 5FF6A 3AU1B 3HC4H 2HYMA 4ZOEA 2HRPH 4QHKJ 3TT3L 2EIDA 2MOVA 4WW2A 4J7RA 1BJ1H 4FQJL 3NCMA 5BW7C 1NGZA 2APBA 5KSAB 4MQ7A 3ZYZA 4RRPA 3LHPL 3MYJB 4XPFH 4LFHD 3FT4A 2HT2C 3NFPB 4PGBA 3S36X 4J3XA 2NLJA 1BD2E 5GXBB 3DLQR 3BIBX 2HFGH 4PJDE 4U1NA 3Q1SH 1CQYA 1T83A 2IH3A 3G5VA 4L3CA 4F7CA 8FABB 1MFAH 4O58H 2OMBA 1R3JB 3UJJL 4H1LH 3N9GH 2D03H 4LMQE 4BSWB 1BGXL 3K1DA 3NABL 4M7LH 4QRRE 5DR5H 1CD1A 1F4YH 1CBVL 4I13B 4PV8A 3OGCB 4JAMA 5IOPB 1QQDB 1J5OL 5DI8B 1RIHH 1FV1A 5D1XB 5JHDD 4NRXA 3X3GH 1UZ6F 1IGFH 4AZ8A 3VRJA 4TVSa 4B0MM 1CIUA 5DD6B 5DMKA 4NCC2 3HNSH 1FZMB 4YDLC 3K8LA 5FKPA 2PXYD 1ZLWK 4LSRH 3GBLA 3GSQA 1QSZA 2CRZA 2P4AB 3G5XA 3BJ91 4PRHB 4JANB 1YQVL 2FEEL 3KPRB 2ADJA 1N59B 2N56A 2ATKA 2FDBP 5HHVH 2IANB 5T3ZE 1MEXH 4KQ4L 2R8SH 1KXTB 1Z9LA 2ZJSH 3NOIA 2EIEA 1Y0LB 2QLVB 3MPCA 4DW2H 3PJSA 5IHUH 4OFDA 1SEBA 1Y6MR 2RFXB 3F6IA 4DQOH 5T5FH 3Q3GB 2OXGA 1ZT7A 2JLLA 4C4KO 1A6ZB 3VGFA 4MCZB 2X2YA 4S10A 4XX1G 3MRQB 2QEJA 1IRAY 4A6YH 3MXWL 4R96B 1UM6L 2DIAA 3SQOH 4F7PB 3MCLH 4LCYB 3I2CH 4ISVB 4RNRA 2V7HB 3WS3A 5IF0B 4NZRL 2XTJB 4NYLA 5JDSB 3QG7L 1HSAA 4OLYH 3TEUA 2BY2A 1JGVH 3DOSA 2DQCH 2CDEA 5C0DA 1MCFA 2EDRA 3O9WC 1LD9A 3AUVA 3QDJE 4P5MA 1XGQB 4NHUA 3SDCB 2JIXD 2HTKD 3RDTD 3I9GL 5EU5A 5IBTL 3H0TB 4ORZC 2R0WL 1O7SA 1NFDB 1IAIL 4YGAB 3N1GC 4X99B 3B9KA 5CJBA 1AI1H 2PO6D 3QDAA 1HHHB 1KLGA 4LPCA 1PX4A 5DFTA 1A7PL 3V0VA 1X5KA 5HVFB 2NY6D 3WO4B 4JCLA 2ZCLH 5C9JA 4UV7L 2ILLA 1SJHB 4YBLC 4LKCA 5FECA 3ARFD 4HF5H 3L3KB 1W72A 3PWNB 4X80L 4KJQC 4LHUA 3VXPB 1MNUH 1F45A 3DWTA 3R06A 5CJ5A 1NAML 4JFFD 5GS0H 2RBLA 4UT6L 4CW1B 2JCCB 2P8MA 1CVSC 3GJFK 1TXKA 3G6JF 3MV8D 3VFRB 5KVFL 2W91A 2W07A 5F97E 1C7SA 4UINL 3EJJX 3MRJB 5B4MD 3WHXA 4LDEB 1GZQA 3FT3B 3UO1H 2NNAB 1MAMH 5EG6C 2ZUTA 2DM7A 4Z7QF 1UWEH 2X1OA 5DQDH 3LN5A 3MV7A 2G60H 4Y16B 4HJ0C 4OCXH 1N64L 3EJZC 3ULVF 2NY0B 4XNYH 4HS6A 3U4AA 5E2VL 2X7LB 3MCKA 3QDMD 2VAAB 4ZUWA 3TM6A 2IPTL 2OJZL 1MWAL 1SBSL 3GM0A 1UWGH 4D3CL 3MLYH 1RJCA 3RQ3A 3CU1A 4K7PH 4Q0XL 2P47B 1B4JL 2EYRB 1E4WL 4IEFB 3IDJB 2BNRA 5KJRL 5ITBL 2B39A 4RZCB 4XHQA 2HTLD 1H3GA 2F74B 4YX2L 5CCKH 5F1OB 3QEQD 4Y4KC 4X5WB 5EUKA 3HPLB 4KUZH 5T1LA 4JFYA 3Q6FB 2IAMB 3GIVB 2L4OA 4P0DA 5F44A 5GZOC 4L8BB 1RK0B 1R5IA 5BW7A 4FFWC 2A9MH 4XCEA 1IEAA 5ID0A 3LN4A 2OR9L 4JY4B 2D0GA 1QO3B 5FM5M 1J1OH 1AKJA 5I1GL 1DN0A 4Y1AB 2BNQE 5D9SB 3C9NA 5EWIH 3DV4A 2YPLB 3RVWD 5E2TL 3GBNL 3UTTA 1DBBL 3KPTA 1YEIL 5JW5A 2P8PA 4WRLA 1U36A 2YC1A 6CGTA 3T0EB 5EFIA 3X12B 4CN4A 1JRHH 1U9KA 3S8WA 1E6OH 5KG9A 1C5BH 1UADC 3D3VD 5EDXA 3S5LG 5D7SH 2Q6WB 2BVOB 3H7BB 3EOBB 4OCMC 3N1QC 1F2QA 3HZYA 3K46A 1BQHG 4G80B 3GUTA 3WLWC 3ZE1E 5HHMD 5FUCE 1FBIL 3E2HC 2R69H 2GJZB 5DQ9A 3C6LB 1ORQB 5CIPH 3MRBB 2BK8A 5DK0B 1DQDL 1N2RB 3F7VB 3SGKC 4PY7A 1J88A 4RAVA 3P0YL 4Z7UE 3CFDB 5E1AB 1TJGL 2H3NA 2BY1A 3U0TB 4TULH 1X5IA 3HN3A 4MNHB 1J1PL 2VDQH 2YPVH 3ISWA 5C6PB 3LQAC 4DEPC 2X9YA 4EJ1C 1JZ4A 2XZCH 3QRGH 1P7QA 5EPMA 3T8XB 2OLDA 3LS5H 1NUGA 1OVZA 4Q2ZB 5CWSB 2Y25A 3OHXA 5IB2A 3FHQA 3WO3B 2ADGA 2VLRA 3SDYH 4M1DH 4I0PD 4YHYC 5IFHH 1FL5A 3OR6A 3EDJA 4OGAD 1KPUB 4WNQB 4LLDB 5IFJA 1P84K 4KHXL 2BFVL 3O9WA 1WV7T 4XBGB 5BV7B 2LV4A 3QI9D 4IS6B 4Q58C 3NCYP 4BH7B 1I3VA 1CIDA 1C16A 4Y19A 3MJ9H 2ZOLA 1MF2H 4Z5RB 1I85C 4CDGC 3FQTB 1I3RB 1JN6B 4QRQB 2XZQL 5FDWB 1U91A 1J86A 2VITA 1CL7I 2DWDA 1EBPA 2W9DH 3PE9A 4LIQE 1O5DT 1I9RH 3U0PB 1S7WA 3X11B 1KJ2L 5CSZA 2CIIA 4LLUA 2VLJD 3DRTA 4XHJC 3QRFM 3IU3B 3JTTB 3GMNB 4HKZB 2PETA 5IQ9B 4M6AA 3K8KA 4DGIH 1W0WB 2NX5D 4G6FB 4MAUL 1WIPA 3DNKA 3F7PC 3HMXH 4K94L 1AO7E 3NMEA 3FQUB 1MFNA 2QADB 3QXDB 1QKZH 3KHQA 1ZT4B 5CBAB 5ADPH 2VERN 2GT9A 4XXDB 1JGEB 2VXVL 3PWPD 1Q1JH 2E8YA 3CCHA 1XF2B 4W6XB 1RJZA 5TE4L 1NQBA 1NANH 5FO7B 1YEHH 2V9TA 4H20H 3VFSA 3WHE0 3MLPA 1Z9MA 2NY7L 4OT1H 2PF6A 3C8KA 4PREB 2Z92A 1FO0L 5IK3B 4M00A 5FOBB 1MFBH 5DGQA 1BEYH 2LE9A 3GBML 4NNPL 3IFNL 3WKML 3BOVA 3GHBH 5C07B 4NKOA 5KSBA 5EU4A 5F6IB 2NW2B 2MPAL 2W0FA 1QBBA 3O3AB 4H0HB 2DYPA 4OLVH 2R4RL 4JDZA 4ZTOH 3X14A 2FJGA 4WHYH 3VGGA 1TQBB 3UYRL 5GRVL 1F11B 1HILB 4QHUA 2WLZA 4RGNC 5FGRA 5GIRA 4H8WL 4Y4KA 1AD0A 4E5XB 1U8QA 4QHMA 5D1ZC 3HAEH 4MA7H 2FNBA 4YUEL 2ZWLT 1CLOH 2FATH 2NTSP 2YSSB 4YHNB 1DDHA 4LDOB 5TE7H 3U7YL 5C6WH 2HJKA 3CFBB 2ITCB 4ELME 3DRQB 4I77L 2UYLA 5ERWA 3VH8A 4ZTPL 5LQBH 3D5OF 1VADB 1DEDA 2IFFH 1GGTA 5BRZB 4PIRF 1B0RA 4J6RL 3TFKC 5E5MA 2DQDH 4XRCA 2IEPA 1S9VA 4HPYL 3ZSSA 4L8DB 1DBML 4DJMA 1NCBL 3BDYL 4FXGA 1WBYA 2J3SA 5CD3B 4QRPE 1R3LA 3LS4L 1G9ML 4KK6D 4N1CA 1RZFL 1QR1A 5BJTA 2HAZA 1KPRB 4Z8FL 1KCRL 4XP5L 4FQJH 4PJ5B 5ISZA 4WHTA 4YK4B 1ACYL 1FNSL 3REVB 2F9BT 3K81A 4X4XB 1FFOB 3VXRA 4JHWL 3SGKA 3VFPB 1EXUA 1PG7L 2BVPA 3LV3B 3SKMA 4HGKC 3D69A 3RL2B 1C08A 3AAZB 2P48B 3BHBA 3ULUH 3UJJH 4HUWA 3TH3T 5TH2B 5SWSB 3DETD 2GKIA 3ME0A 5IGXH 1PYWB 4MXVE 1BGXH 1NCTA 4KJPC 1J0ZA 2CQVA 3G08B 3CDYA 4QXTB 5J89A 4KRPC 1U8JA 1CBVH 1L7TH 2E8ZA 2P5WD 2YD3A 4U1GB 3TH2T 15C8H 3V95A 1QRNB 3RGVB 1T04A 3L9RB 4U1JB 3V6ZB 3MUZ1 2OP4L 5TGBA 4JO3H 5FFLA 3MYZA 3STBA 4MJ5B 3C09C 1UM4L 4ZXBC 1B90A 1NH6A 2VTFA 4IRSC 4W6WB 4WW1B 1KIRB 4P2RD 1V7MH 4KV5E 5E8OA 3DXAE 1MFDL 3PABB 3KR3H 4PGZA 4KQ4H 2YN5A 2P42B 1XIWB 3EW3B 4O4YL 4J3OC 2BOCB 1A1OA 5TF0A 4YH6A 4OZGA 4V2BA 5DT1L 3VFVB 4KC3B 1CXFA 2AEQL 3IAPA 2X4OB 3MUY1 3KPOA 1KV3A 3JV4A 4WI6A 4ZSOE 1U42A 4PJIE 1RUAH 5TJWK 4NQVA 1TETL 3IETB 3P77B 3U9PH 4YO0A 4YLQT 1U8KB 3CMOL 2AI0H 3ARDC 1UM6H 4WFED 3SKUD 3O8XD 3OMZA 3DMMD 4AG4L 2AP2A 5L8KB 5DMIL 3DIFA 4NZRH 2H6PB 4MQ7B 1G6RB 1H3PH 3UMTA 1N4XL 4I18C 3FT4B 1G7PB 3I9GH 1ZEAL 1DL7L 3S35L 3D3VE 3H8NA 2R0WH 1TVBA 1D5BA 1IAIH 3EOTH 5KZCB 3ZKXB 4Q9RL 4U1NB 5E6IB 1RHHA 2ESVB 2IH3B 4L3CB 4F7CB 5IKCB 2MWCA 5DQJB 3DSNA 3H9SB 4FA8A 2C3VB 4F33A 5GHWL 3GK8L 1CD1B 1A7PH 4GKZB 4PV8B 1KLUA 3BGMA 4JAMB 3U2SA 4Z7NF 4WI4A 1F4WL 1FV1B 4NRXB 4XP6L 5B3JE 5INDB 3QQ3A 4JM2C 4JY6A 3HKFA 4LCWE 4X80H 1D5XB 4LMQI 4QOKE 5HYJB 1JTTA 4QHNA 4NBZB 4UT6H 3LCYA 1RFDL 1QFWL 3T0XA 3EJYC 1Z6JT 3G5XB 5CMAA 1AXSA 4WHCA 2B8OT 2X4UA 5GGRA 4HUUA 2A6KB 5IT2L 1RK1B 5D1ZA 4PRNA 1EPFA 5C0IB 4IIQC 2APTA 3BP4A 1QACA 4HXBH 3QXAB 2R0ZH 5HD8D 1AHWC 4G8IA 1SEBB 4RAUA 3ARBC 4Y4FC 3UZVB 4OUOA 5FXCH 1N64H 3VXQA 3NTCL 4U0QB 1TVDA 3KJ4C 2DQJL 4IMKC 1J8HD 1RSFA 4G6MH 1GXEA 3NCEB 5KS9F 2C1OA 2OJZH 1BD2A 4KPHL 2Z35B 5AEAA 2CIKA 4D3CH 1NBYB 1PX3A 2PW2A 4BUHA 1B4JH 4RNRB 4K8RD 4ODUB 3WS3B 2W0LA 4XXCA 4YX2H 4OZIF 1K4DA 4QRRA 4U2YA 5CAYB 5DEFA 4U7MA 1G7JA 2CDEB 5C0DB 3UBXA 3FT2B 4P2OB 1LD9B 4P5MB 8CGTA 5TE6L 2FHBA 4MDIB 2OI9B 4HUVA 3O3BA 3HI6H 1MCNA 4ODSH 1U8OA 5D7JB 4OLWH 5FUCC 5EUOE 1B0WA 2OJEA 1CFNB 3TPKA 3QUMH 1KLGB 3RPIA 2BSRB 1URLA 5FHBL 4UB0L 2AW2A 3EGSB 1T7VA 3NA9L 4C58B 3SPVA 5BOPA 4MDJA 5C9JB 2BHZA 5BS0D 1P5VA 1MRCL 3G04A 2EDOA 4LKCB 1N3NA 1H3WM 1DBBH 4E42A 1YEIH 2GJ6E 2GTWA 4LHUB 1PAMA 3P4MB 5E24E 3R06B 5CGYC 4OAWA 5E9DD 4HW6A 1F42A 2EH7L 5CZVL 2P8MB 4GG6A 4M7KL 3SE4C 5IHBA 1S7TA 3FB6A 2EEAA 3NGBB 3HI5H 1P9MC 1GZQB 1U8NA 5HHPA 4WI8A 1FBIH 4FTVA 1DE4A 3AFLA 3IGAA 1JBJA 1YN7A 1LK3L 3STLA 3VH8G 2XY2A 4RBPK 1DQDH 4IRSA 2GYSA 4OKVA 3G9AB 3LN5B 3MV7B 3P0YH 4KFZC 4RSVA 5IBUB 4KK5D 4XPTH 1RZ8A 4JRYE 2NY3B 3LPGA 3QDJA 3B9EA 5I6XB 2CLVB 1J1PH 1RY7B 4M4PA 4MNQD 1JVKA 4DCQA 2ZUVA 1AJ7L 3SDAD 3SDXF 4LKXA 1A3QA 2XT1B 1A6AB 4NQDD 4QWWD 4ZO9A 2V5RA 3BZFA 2BNRB 4G43A 3OKEB 5EUKB 4MSWA 5T1LB 1VDGA 4XBEH 3SKNB 3ARDA 2X4SA 4OCLC 3QYCA 1Q38A 5DS8B 3LKOA 3PL6C 4AYFA 1R5IB 3IXAA 2FL5A 4TSAH 5D96C 5JA8B 1IEAB 4I18A 5ID0B 3QAZC 4N8PA 4OM0H 3ZHKA 2NR6C 5SWZE 1NUDA 3GSNB 1R24A 3NIDF 4OZHE 5D1QC 5CEZL 4L29A 1AKJB 2EKJA 1DN0B 3C9NB 1MVFA 3DV4B 4LCUB 1BHGA 3UTTB 1DVFD 2JB6B 1S7QA 2XZQH 4TSCL 1DUZA 5JW5B 4UQ2A 1T5WB 2VR9A 3BWAB 4UT9H 2YC1B 1MFCH 5IHZB 1CYGA 4I4WA 5EFIB 4TTDD 5DJYA 5KG9B 1KJVA 4DWHA 3O6ML 4ENED 3DJ9A 2BX5A 3JUYA 2F8VA 3HZYB 4BKLA 4JM2A 3L3HB 3VWJC 4Z6AT 1CE6B 2E9IA 4PJEA 5A2KH 1QUNA 2HKHL 3WXVH 5C2UB 4YDLB 4EVNA 3KLAB 5DQ9B 3U46A 1EHXA 3MX0A 2VXVH 3W2DH 5TE4H 3NIFE 3PIQB 3PQYB 5CJQL 4RAVB 4XVJL 4KY1L 3UZQA 1CICC 3SCMD 1G1CA 3F65A 1IKNC 3D9AH 1OAZL 3VE0A 3B2VH 4IIQA 4PRDA 1UCBL 1RUQH 5L2KB 1WFUA 1YY9D 1J7VR 1QSFD 1AHWA 1FO0H 1S5IH 4MVBC 4F58L 4P3CL 3QCVL 1TVHB 3ARBA 1WFTA 3MBEA 1CFQA 1E28B 1JZ2A 4NNPH 3IFNH 1P7QB 5EPMB 3WKMH 5EC1A 5E6YA 5LGJA 3EYOA 1IC5L 2AXGA 1G6VK 3AB0C 3UCRA 1DEEA 5EIIB 4AIZB 2JTDA 2R4RH 3ULUF 5SWQB 2BNQA 4CVZA 2ADGB 1Z3GL 3UX9B 1EHLL 2HTKC 5EU6D 4M5YL 3TO4D 3OJMB 3UYRH 3ARED 4YXHL 4JGMA 1N6VA 2V5MA 1FL5B 4EN3C 4NQTA 3VU2A 5IFJB 2HVJA 3BP6B 1MJ8L 2Z93A 3O9WB 2WUBH 3DX9A 2VXSL 1OAXH 1C16B 1BZ7B 4Y19B 1IKFL 5IW3A 1JF6A 1FZKA 3VI4F 5DA0B 3ULVD 3ARGC 1U91B 3TYGL 2DWDB 1KCUH 4I77H 4ZTPH 1KELH 4K9EL 2LQRA 3WUWA 3KXFA 1YMMB 2YA1A 1JL8A 4CBPA 3L3JA 3MR9A 1MOEA 4YBLB 3D0LB 4I3RL 4J6RH 4M7ZC 3KJ6L 4MCYA 4PGDA 5GZND 3QSKB 4JY5H 3TBWA 5DFVC 1YJDH 4QTHB 1DBMH 2GT9B 1XF4A 3DROB 3QFJB 3CCHB 3BDYH 2K9UA 1JGDB 3MNZA 1QSEB 3SE4A 4LP5A 1G9MH 2MCPL 3K3QA 4LF3A 1P9MA 2Q8AH 3TN0D 4Z8FH 1XCQB 4HWBL 3VFSB 1X5AA 4F2MA 4BA8A 3F7QA 3KPQA 4MB5A 2HJFB 3C8KB 5J9PB 4KVNH 1DR9A 2Z92B 3EZ8A 1U95A 4JHWH 1KTDA 2DDQL 4ZFFA 1PG7H 3D2UB 4UUJA 1II4E 5C0BD 4WV1C 3W9EB 2VZSA 2E27L 2HTLC 4NKOB 2JELL 3CIQA 3RWFB 5EU4B 4HK0A 4K3EL 4G9FA 3CFJA 4XNQB 2SEBA 1G7IA 2DYPB 5CBEA 4O00A 4JDZB 1HHIA 4JQVC 2QL1A 4P57B 3UBXG 3FTGA 1AH1A 4PG9A 3MRNB 4X6DF 4QHUB 1A9EA 5GIRB 4UIKH 1UXSA 1NBZA 4Y4KB 5JXAL 1AD0B 2ORBL 1J8HE 1U8QB 4QHMB 1MLBB 2FGZA 3UYOD 1BMGA 1UM4H 2WWKT 3D1MC 4NQCE 4MD4A 2G5BB 1U8HB 3R4DA 2AV1A 3WNOA 5CJXA 5CD5D 2UYLB 5ERWB 4UNTA 4O4YH 3VXSB 4LNRB 4AH2A 3GFUA 5HPMB 4LLMB 1BLNA 2AEQH 4HEPG 4ZFOB 1LO4H 5E5MB 3CDGB 4XRCB 4WJ5A 3ORJA 1TETH 2R0LL 5GJSL 1UB5A 4GAFB 1G9EA 2PXYA 4MQXC 5CP3A 1D5IH 3CMOH 3OR7A 4GAYA 4CVXA 2P5ED 2WK2A 4BFIA 2X4RA 4I0KA 4ACPA 1QR1B 2AGJH 5BJTB 3CD4A 1VFAB 4MGXA 3E2HB 3BYYA 5ISZB 4WHTB 2EZ0D 3FONB 3ZZ1A 5EC2A 3WIHH 1XR8B 4KI1A 5E9DE 2AJSL 3MLRH 1EXUB 1IEBA 1ZEAH 3B5HA 3UXFA 3PHQB 1PY4A 3GSOA 1EV2E 2BVPB 3SKMB 3WDHA 3FAXA 2VNCA 2FWOA 2GSIB 2QSVA 3EHBD 3SY0B 2QHRL 3VFGL 1BF8A 3TJHD 1D9KD 3IAGC 4NSKA 4HUWB 4O5LL 4U1LA 5JR1L 5GHWH 3U9UA 4DEPB 1PZUB 1ZGLA 3DX8B 3OX8A 5I1JL 2Y6SD 1F4WH 3O4OC 4ELMA 3JV5A 1WBXA 2F54E 1S7RB 2OSLA 4YPJA 1HQRA 4ALAL 4WWKC 5TGBB 2JIXA 1BOYA 4MNQE 5MEPB 3RDTA 4GRLC 4FXLA 2IQAA 1QFWH 2NY5L 4P2QD 4YHYB 4P4KC 1IQWH 1UFUA 4GMSH 4EN3A 3QIBD 1FG9C 1TZGL 5E8OB 1JFQL 2HH0L 3V6OE 1ZHNA 2CDFB 4OLXL 5IT2H 4YR6B 2A9NL 3CH1A 3WFBL 2XZAH 2NY1D 5JW4M 3QDGE 5L2JA 1GC1C 1A1OB 3VXMD 3EO0B 4OZGB 3HR5A 1E4XI 3NFSL 2VXUH 4QRPA 1JNLL 4P59H 4YXLL 4LLYA 1CDGA 3JWOL 5F7EL 1ERNA 1S78C 3CSYA 4NQVB 4RWYL 4LCCC 2IC2A 4X4ZA 2DWEB 3MLXL 5BQ7A 4JFFA 1OOAA 5C9KA 3G5YA 2YK1H 4UTAL 1CK0H 1OARL 4YIQB 3MV9B 1QLFA 3T04D 2APXA 3BPCB 4Z9KB 4ZUUA 2Q8BL 3MLVL 5JZ7C 2BNUA 2APVA 4HKXA 4LLWA 3MUGA 1INEL 3PP3K 4IRZL 3QWRD 4PFEA 4D8PA 5BZDA 4RA0C 5ALBL 4AK1A 3HNVL 1ADQA 2V5TA 3QB7C 4X98A 2ICEA 3DURB 3B8YA 5TE6H 4NP4H 1KN4H 1DQQA 1TJIL 4NIKB 3QDMA 5IVXB 4O51A 2BVTA 1LP9F 2VZVA 4F33B 3DARA 2Q86A 1JWSA 2YA2A 5C2BL 5FHBH 1G7QB 4A2LA 1KLUB 3BGMB 1ZLSL 2ZUXA 1VEPA 1BFVL 4WV1A 5FUOL 3DXAA 5LG1A 2CXKA 1YDPB 2X70A 2FH8A 4PJ8D 5B39B 4CUCA 1RIUL 1J18A 4PJXA 1OW0C 4QHNB 3BEVA 1IZJA 1R5VB 1VPOH 4JQVA 2EH7H 4NBYB 5CZVH 3KPNB 4OZFH 4KUCF 1RZ7L 1ZAGA 1O0VA 4M7KH 4RGNB 4PJIA 4HUUB 2AEPL 3OF6D 4ONHA 2Q1EA 3MJ8A 1VHPA 5FYJL 5B22A 5D1ZB 2OL3A 3ILPB 4PRNB 1WBZA 3C60D 1Q0YL 5IW6B 5HDBE 2Y36L 5H35A 1P4IL 4Z7VE 2MNUA 3PGCA 3TA3C 3Q5OA 3QQ9C 4RAUB 2XNAA 4HZLA 5JUEL 4L8CA 1BVKA 4KRNA 5F9WC 3VXQB 5DWUL 3P4OA 4GOSA 5DZLA 1LDSA 1SY6H 1JYVA 2C1OB 4XTRD 1BD2B 1AJ7H 3D3VA 3QUZC 5E2WL 3FB8A 4XB7A 5C92A 1FFNA 1YQ2A 4PJDB 4YBQD 1HWHB 4JREC 1KIPA 3K2UL 4KK6C 2E7HA 3DSFL 2EO1A 3ULVE 1U92B 1UZ8B 4ZYKA 4EEEA 1K4DB 2AJXL 4KKBC 4QRRB 4JRXD 4GAJL 4Q6IC 4X6BA 3S97C 3HHRB 2C9AA 3MQIA 5GS0D 4FQLH 4UBDC 1WLHA 2VLKE 1CTNA 3O3BB 3MRIA 5HPOA 4QOKA 3T77A 3FB7A 3O3EB 4TVPH 4POYA 3FRUA 2OJEB 1Z2KA 2DOCA 1JCKA 4LPTA 3RHWF 3P4NA 4QLRA 5CEZH 4ELKA 3U48A 4PPTA 2V2XA 1LHZA 4OCSH 1BREA 2VR5A 1CGSL 3G04B 4K3HA 1FZOA 3AXLA 3ZDXF 4TSCH 3A6BL 2V5SA 3UTQB 4NZTL 2GTWB 1NGYA 4YDIL 4KRPB 4LFHG 2W9EH 1JHLL 3TNMA 1OTTC 4I0PA 3TVMC 3QNXA 5EA0H 5C0BE 1S7TB 2CMRH 5AWNL 3N50A 5D70H 4AENA 2EE2A 5ICYA 4JFQA 5HHPB 2DLHA 2HKHH 5HVWA 4NFBA 4WWKA 3IGAB 2YKLL 4R4FL 4GRLA 2EC8A 3MLUH 3T3ME 3C09B 4ZXBB 4L4VD 4PJFE 3BX7C 3H7LA 4P4KA 3MREA 3ZKMD 5CJQH 1C1EL 3RWHB 2ED8A 1QVOB 4KY1H 4G6JL 1I4FA 1G6RL 2WNGA 3FRPA 4QF1A 1FE8L 4PJGF 1RZ8B 2FD6H 1UCBH 2C5DC 3QDJB 3KG5A 3GSRA 1OGAD 1U8PB 3IDNB 1IGYB 1LO0L 1UJ3C 3BPOC 2AKRB 4LKXB 2NX5A 1CXLA 3GJEA 3O8XC 3UAJC 3BZFB 4L3ED 5D2NA 5EUOA 1IC5H 4P2CG 1JWUA 4LCCA 4UILH 3S88L 5IQ7L 1VFOA 5FKAA 4G43B 5LWYL 4MSWB 3GMRB 1YYLL 1NGQL 1BJ8A 2X4SB 3ARDB 4G5ZH 1Z3GH 5GGUB 2ZG2A 5A2LH 1CXEA 5K93A 4M5YH 4OV6F 1MY5A 2GJ6A 5ALCL 4QGTA 5IBLD 2D0HA 1I8LC 2R39A 1ROWA 1FG2A 4RMWA 1FAIL 3EKCA 5DF0A 2YEZA 4MZ3A 3P9MA 4ZFZA 5I76A 2A83B 1Q0XL 1R24B 4G8EB 2VXSH 4L29B 1DQML 1GIGL 4HZAA 2BDNL 2J8UE 4XVUC 2C26A 1IKFH 2X6MA 4N0CD 3BIKA 2I5YL 3BP5A 5IMOA 1LO5A 4UQ2B 3QUXD 1IGMH 3IJHB 2VSDA 4RDQG 1M7IA 1GGUA 1E4JA 1I75A 1LO3H 3X3FL 2GUOA 1EERB 4UNUA 5DJYB 2FR4A 2LTQC 4WU7A 2YRPA 2H45A 2R29L 4I3RH 4FFVC 3KJ6H 2P7TA 4EQ2A 4JM2B 1FPTL 2HP4A 3MRHA 5D7LD 1U58B 5FA4A 1OW0A 3V4VH 3KLSA 4EVNB 4ZS6D 1F8TL 3MLSL 4M6ML 3X13A 5C1MB 4GAGL 2MCPH 5HXMA 3LIZL 4IIQB 4P23C 1AHWB 2EDXA 1A6UL 1FYTE 3TA3A 5ENWA 5EZOL 2AV7B 3T1WA 3ARBB 3V0WL 2EDFA 5K9JL 2XPGB 3KPMA 4Y4FB 2Y9RT 1OP5K 3GMQB 5EZJA 1QBLL 4ZUSA 4M1CC 3KJ4B 3EYOB 4LOUC 1VEOA 3BKJL 1T0NB 3MNWA 5F7KC 5HY9B 4XAWL 5SWZA 1DEEB 2RHEA 3CXDH 3QPQD 4XNMA 5GRUL 1CI5A 2X4PA 4MA8L 3QUZA 3VXME 4CVZB 2HKFL 1Y6KR 5H2BA 1TITA 3GJFA 4PJBA 3QO0B 5K9KB 4LP4A 4KROD 5F71A 5F7UA 4F8TA 1JZ8A 5JXAH 1NGXA 2ORBH 1HHGA 1UVQA 2HVJB 4C54A 4ORGB 2Z93B 2BSSA 3P0GB 4Q6IA 3VXNA 5CZXC 3BGFC 4ONOA 2F5BL 3OKLA 1G1YA 1SBBA 1FZKB 4PJCE 1MHHA 3BXNB 2J6EA 3O6KL 5GSVA 4C56D 4DAGH 1E27B 3WUWB 3BD3A 4ZFGL 1FAKT 2P5WA 3V5DA 4Z7UB 2QJDA 3ABZA 3MR9B 1INQB 4MZ2A 1Q9OB 3S37L 3RA7L 2O61A 4MCYB 4F15C 1MCPL 2GQHA 3HS0A 3PWJA 1UKQA 1W0YT 2A74B 2XQYK 4ETQA 3GSXA 3QH3B 3SGDI 4HX1B 1HHJB 4P49A 4U3XA 5FYLD 4BJLA 4D9QE 4ZUTA 4M9OA 1IGCH 4WY7L 4P2RA 3E1F1 1YECL 4DN3L 5IG7A 4LF3B 1FNEA 2HWZH 3H3PH 2OR8A 3WD5L 4Y5XC 1PSKL 5F70A 4F2MB 3VDBA 3GGWA 3KPQB 2QQQA 5GS3A 5ACLA 1U95B 5C0NC 1A21A 5JOFA 2Y7QA 3CX5J 1KTDB 1MI5D 4ZFFB 5FYKL 2Y23A 3BUTA 3EYUH 2IJ0C 3KLHD 3L6FB 3V6OC 5HYQB 1M4KA 4NRYA 4LU5L 4ERSL 1MJ7L 3KYNB 4HK0B 3GSNL 2VXQH 5C0AD 1R0AL 5BV7H 1UJ3A 2SEBB 4O5LH 5JR1H 1P7KB 5F96H 1KOAA 3O8XA 3MLZH 1HKFA 3DMMA 3V4PL 3FTGB 5HI5C 1UM5L 1A0QL 3M17B 4PG9B 3D39E 1A9EB 1NBZB 4ALAH 1BWWA 5HGAA 3VW3L 3HI1A 3W11D 5C8JB 2GW5A 1RIVL 2AJZA 1Q9WB 1UKTA 2NY5H 2ZCHL 5FYJU 3OB0K 3VFNA 3PL6B 4QRSA 1K85A 1ZV5A 1AO7B 5D96B 5HDQL 1DVFC 1FNGB 3ETBF 2HH0H 4LQFL 4EI5D 4K3JL 4OLXH 3QAZB 3RJQB 1RU9H 3WFBH 1I1YA 3CMGA 5D1QB 3KPPA 1UG9A 1YPZF 1EFXB 5I8KH 4JRXE 3NFSH 4AH2B 1JNLH 2ATPA 4OQTA 2Q7NA 4ENEC 1IAMA 2DQUL 4HH9A 1JV5B 1FL6A 5F6HJ 4OFIA 3O6FD 4PLNC 1MCEA 4WJ5B 1EEZB 1EO8L 4RWYH 3RX7A 1X5XA 4LDLB 3MLXH 4UTAH 4FQXC 3ULUD 7CGTA 1OARH 3W5MA 2W59A 2H26A 4GAYB 4R4BA 2Q8BH 3OL2A 4CVXB 5I1KL 3VMNA 3DVNA 3UDWC 2B1HL 3T08A 3VWJB 4KKLC 1XH3B 1N6UA 1NMBL 4HT1L 4MQTB 4KJWD 4NPYA 4JQIH 3ALWA 3EYQD 4X6CB 5DRXB 1A2YB 5DD0H 5ALBH 5GGQL 5EC2B 3HNVH 3FRPG 1IGIH 5E2UL 1YNKL 4HKBA 4XPAH 1A6VL 1HINL 2VKWA 4RCAA 3RWEA 4BFGA 3CZFA 3GSOB 2J4WH 3S3JA 3BVNA 1CICB 4WUKL 2WWMC 4NN6B 2O5YL 2FWOB 1J8HA 5K59F 1IBGH 5CJ8A 4BZ2L 4NSKB 4P23A 4PRPD 4YDVA 4OCYH 4U1LB 3U9UB 4NQCA 3NZHH 1ZGLB 3QQNA 2F15A 1CZ8L 4OLZL 3GB7B 3OX8B 3GI9L 1BFVH 4TNWF 4OTXL 4ELMB 1U93B 5BVPH 1N5YH 1WBXB 3AB0B 4OI8A 4YHZL 1HQRB 1WIOA 3QG6B 1HH6B 4JFED 4PJ7E 1FNHA 4S1QL 4HKJA 3MRFA 4EBQL 1CDBA 2IQAB 1XF5A 5D6CA 4L9LC 5C0GA 1RZ7H 3MFFB 4EN3B 1YEGL 3IDIA 4JFZH 3OKMB 2AEPH 2GSGB 5GRVK 3SE8L 3UTOA 1ZHNB 4PLKD 1D7FA 5FYJH 4J3WA 3RHWK 3CH1B 4H5SA 1Q0YH 4Y88A 3DVGA 2DM3A 3VFWB 4X7SL 5L2JB 5JPNB 2Y36H 2B7DT 3GM8A 4XP4L 4QRPB 4PGCB 5BS0A 4DOHE 3ARGB 3H42L 4GW5A 2VUOA 5JUEH 4W4OC 5E95B 1NGPH 5EOQH 3VWKC 1T1WA 5DWUH 1X7QA 3MGAA 3V8CA 5BQ7B 5E9DA 3BD4A 4TUOA 2CLRA 1QLFB 3VA6A 4L4TB 4M7ZB 4ZUUB 4RIRA 3HG1E 1F2XK 1V8HA 1CLYH 2BNUB 1NFDF 3DSFH 4X7DC 4LLWB 3MUGB 3LAFA 4B5EA 1SMAA 5ESVB 2ADIA 5BZDB 4IOSD 2AJXH 5LBSH 4JN1L 1IM9D 1OTSC 3L5XL 1JNNH 4GAJH 4KI5E 4M43H 4X98B 4LEOA 4L5FH 4PD4K 1D3CA 2F54A 1BJMA 4M4RA 5FK9A 1RURH 1NUNB 1WIUA 1DQQB 4O51B 1MQ8A 4NUJA 1Z5LA 1M7XA 4MNQA 2IQ9H 4GSDL 3SDAA 1JWSB 3WCYA 4JN2A 4X6EA 4FQ1L 3MODL 4HEME 1KCLA 5EO0A 3O11B 4LSUL 4KK8C 2JCCF 4WV1B 3OKKA 3QUYD 1JZ6A 1IJ9A 3DXAB 4JR9H 3V6OA 2FB4L 3A6BH 3QDGA 2X70B 3D0VA 2ZKHL 4NZTH 3NACH 1OT2A 3T3PE 3O45A 1ND0A 1EJOL 4ZFOL 3HB3D 5HHXL 3H9YA 4ZSOB 4PJIB 4ONHB 2CUIA 3MJ8B 3QIUC 3BD5A 4TYUA 1Z9OA 2Y5EA 4UV4L 1EVTC 2G75A 2YKLH 4R4FH 3MROA 1B0GB 5H35B 2WWKO 2VIRA 1WQVT 2A1WL 2VB5A 4F37F 4G3YL 3GSUA 1DVFA 4NM8L 5BXFB 2XNAB 3KYOB 4HZLB 3MZTA 4N0UA 1I3GL 1RUKL 3FQRA 3WSQH 1G6RH 1OAKH 1FE8H 5DDHB 1PKQE 2DJSA 4JZOA 2IG2H 4XCNA 3A6CH 3JV6A 1LO0H 4J2XA 3D3VB 1YEJL 1JHTB 1FFNB 2EIZA 3FB5A 2MKWA 1H3TA 1KIPB 1YUHA 1P6AB 3WIIH 5D8JH 3C87A 1SMOA 4GKSA 4MJ6B 4I0CC 3HNTH 4NO0B 5I8EA 3LQAL 5LWYH 3ZE0F 4BK5A 1UQSA 5F1KC 4C56E 4U4BA 4OCRH 4X6BB 4N8VA 5MENE 3QHFL 3G5ZA 2AJUH 4PB0L 3S98A 3SDXE 1HK6A 2QQLL 2B4CC 5ALCH 2IH1B 4LCWB 3MRIB 1GSMA 4QOKB 1FAIH 1D9KC 3I6KB 3TJHC 5I18L 1K5NB 3FFCD 4HS8L 2QHLA 1Q0XH 3LMJL 1CXHA 2V2XB 2E7LC 3QCTL 3TNNA 2EXWD 1QP1A 2BXZA 1DUYB 3ZKQD 1GH7A 1FLRH 1FZOB 3MRCA 5HVGB 3AXLB 1H15B 1HOCB 3W0WD 2VDPL 1XF3A 1A5FL 5HYIA 3TBSA 5EO9B 4CVUA 5EU6A 1HWGB 2LFGA 1K8IA 3TNMB 1N0XL 2Y06L 4HV8A 3AREA 3O4OB 4YC2C 1RVFH 1D5ZA 1RZIA 3WXWL 1Z0NA 1FPTH 5AZ2L 1CD9B 4K8RL 1QHOA 3OGOE 4LARH 4XMPH 5ACZA 3O4LE 3RPKA 5LGKA 2X44D 1T3FB 4WWKB 1QG3A 2NY1C 4JPKL 3KPSE 1EK3A 4GRLB 4JPWL 4OUUA 1T5XB 3BQUD 2XKNA 4N0FA 4DZBA 1F8TH 4M6MH 4P4KB 2WBJC 4GAGH 5DFWH 1G7LB 1QRKA 2Y4SA 1SYSB 4XPGL 1JGLL 2PYEE 4IOIA 4QF1B 2H1PH 3D18B 3LIZH 1A1NB 5FYKU 3RZWA 2J7LA 1MJJA 1TTUA 3GSRB 2NY2D 2HJLA 3CC5A 3I84A 5EZOH 1UYWL 4LEXL 4QRTB 5K9JH 1KACB 1FJ1A 5EORH 4QXGL 4EDXA 4W4OA 1QNZL 3TWCL 5EUOB 3BKJH 4LHJB 1JWUB 4LCCB 1D6VL 2MHAB 5FKAB 5GRUH 4MA8H 5C09D 2I07A 4XT1C 4YAQB 3SEPA 3RWIB 2HKFH 2X09A 2O26U 1A1MA 1MRFL 4X7TB 4XX1E 1SJEA 4MS8D 1DQJA 5A43C 4KUCD 4FQQB 4N9GB 1RZGA 4G9DB 4U1KA 2GJ6B 1GPOH 3TN0A 2X42A 1JNJA 1FG2B 1LE5B 4NQED 5C0RH 1G9NH 2N7BA 3P9MB 4NDMB 4HSQA 1NC4D 3B2UD 4LL9A 4YXKL 3I3DA 2AERT 5I66A 2F5BH 5C0BA 1DP0A 3F12A 2OR7A 1DLFL 1IM3B 3BIKB 3IKCA 5HTSA 3BP5B 5IMOB 1LO5B 2V2WB 3QIWC 5DUML 5FO9A 3WBDA 1K3IA 4MD0A 3VGEA 3ZL4L 1NSNH 1S7XB 2A2QT 2OTWA 3I75A 1BQLL 3O81A 1RUML 2GUOB 1F6AA 1FN4A 2FR4B 3HRZA 1XAUA 4GQPH 4NNYA 4WU7B 3S37H 2V9RA 3RA7H 3CVHL 2P7TB 1IEHA 3LY6A 2NY4D 4JRYB 1P4LA 3THML 5HGHA 2UV3A 5HHOD 3T2QA 4Y4HD 3P40A 1MCJA 1MHEA 3VXUD 4MX7B 4K23L 4LVNC 5GS1A 1QSVA 3TCXA 3PWUA 1JYWA 4WY7H 4PS4L 5DJCA 5HI3D 3VJ6B 1T1YA 1YECH 2YD7A 4DN3H 1I7UB 5IJVA 4JFXB 4OCNC 2HA1A 3B6SA 3UYPA 3WD5H 3GSWA 1S7SB 2EYSA 1JMZA 1YC7A 1BM3L 1P1ZA 1A14L 3TA3B 5DVMA 25C8H 5KVEL 2BVYA 4GO6B 3OKDA 3SKOB 3KPMB 1J9CT 2Q7YA 4LSVL 4YBQC 5FYKH 3WLBB 4FQCL 5EZJB 5ILTL 1XR9A 3F8UB 1FRGL 5F9WB 4X5LA 4Y2DD 3RJDA 2O5ZH 3GO1L 4LU5H 4ERSH 1H3UA 4HIHA 5SWZB 3GSNH 1R0AH 4OZHB 1KF9B 4OGZA 4JJ5A 3QUZB 3O2WL 1ZOXA 4HXAL 2J8UA 1UC6A 3U0WH 5I1HL 4JREB 5EO1A 5T3ZL 3RVTC 3V4PH 4WFHE 5GS0C 1A0QH 1GGCL 2DI7A 5I16A 2RCSL 3O2VH 2CKBL 3HMWH 1BFOA 3LSOB 4J4PD 3VW3H 1HHGB 1UVQB 3U1SL 1OSZA 5I1IH 2BSSB 3HA0A 5DRWA 1F90L 1FL3B 4Q6IB 4ZO8A 4YHLL 3VXNB 1RIVH 2IPKA 4YFDB 3D25A 5EZLB 2OK0L 3OKLB 5HDQH 3FOLB 4ODHL 5E5UB 3K1KC 1D9KA 1X4YA 2APWA 2ZPKL 3D6GA 1MHHB 4QT5A 5DSCA 1EZVX 5IJKC 2WBWB 4L9DA 3UPCA 1GYAA 1A7RH 4Z18A 3UPRB 5J6HA 3B3IA 2YUXA 4TNWK 4U6XB 5F7DA 4XPHL 3LZFL 2AEWA 1UWXH 3WUZA 5M7QA 2O61B 3M8OL 2EDYA 4N5EC 3PWJB 2VH5L 2E6PA 12E8L 3T0BA 4ETQB 1MPAL 1UCTA 3GSXB 5J56B 4OKDA 2DRUA 5A3ID 3TVMB 1B2WH 4JLRA 1T03H 1NBVL 4KZEH 3ZKMC 2W9LA 1ZA3A 4ZUTB 5GRYA 5I1KH 3QIBA 2B1HH 5DTFA 2A77L 5ICXA 5IG7B 2DQHL 3ES6A 1NMBH 3DBXA 4HT1H 4OM1L 3LD8C 1LWRA 1AGFB 3TO2A 5C71A 3VXMA 4MXQD 4GS7C 5E2UH 1YNKH 1HH9B 5KVMC 1HINH 2XA8L 4YZFF 3S3SA 2F5AL 2YXMA 3QPXH 4AL8L 2ID5A 1NFIA 4WUKH 2EKSA 2O5YH 4NJ9L 4EI6A 1IT9H 4CU6A 3QHZH 3GSVA 3TJEL 1UJ3B 3BPOB 2VISA 1DBAL 1U6AH 5EOCJ 1VEMA 1CZ8H 4OLZH 3O8XB 3BKYH 1LE9A 4U2ZA 4Z0BH 4E41E 2WQ8A 2LVEA 4N8VG 4YWGH 2Z31C 4OTXH 2I9LA 4WUUD 4PJCA 5CP7A 3I3EA 5KVGH 4DK6A 3QWRA 4Q9BA 4QY8B 4XZUA 5HGAB 4S1RH 4XP1L 3T2PA 2LAAA 2OM5A 4EBQH 3W82A 4OZ4A 2AJZB 5F7MC 2FLRT 4P5TD 2R9HD 1OQOA 4F57L 3KYMA 3VFNB 1I8KB 3B5TA 4BQ6A 2H32A 4YHMH 2EDKA 4HK3J 2F58H 3SE8H 3MRRB 2GI7A 2XI9A 4LAQL 4XNXH 1GRWA 3MMEB 4X7SH 3KPPB 1HYSD 1IC4L 4G6KL 4MMXC 4R8WL 2XZZA 5ETUB 2G9HA 1AR1D 4KI5C 3SDDB 4JFDD 4CAGA 4POZD 2ATPB 4S1DD 3BPLC 4O02H 4JKKA 1OF2B 2FX9L 5J1AB 5MP6L 3H42H 4FP8H 1LEGA 3B9AA 2O5XL 3BI9X 1FL6B 3QIWA 4PJ8A 4YFLI 1ZLUH 2ZUQC 1KPVA 3QBTB 5C0FB 1YEFL 1LNUA 1UEMA 4QHLA 4CL7A 4RISH 2W60A 3TCLA 1KUMA 3QJHA 2IALA 3CFIC 2H26B 4HWZB 2IMNA 3DVNB 2KDGA 3OF6A 1CL7H 3DUSA 5J6GA 3C60A 4HC1L 3D85A 4H0GA 2FJHA 4JN1H 3NIGE 3L5XH 3FCTA 4F37K 1FGNL 3PV6A 5HDLA 1D5MB 3IDMB 1WSST 4GBXC 3D39A 4OLEA 4APQD 4U6YB 4X6FB 3BVNB 4KXZI 3BP7A 3L3GA 1I1AD 2Y07L 4G42A 4P23B 5ESQB 5C08E 4KK9D 1ED3A 4AY0A 3TZVC 1KJ3H 4GSDH 1MVUA 2DQGL 2J88L 5LJYH 3VGAC 4NQCB 3MODH 3CFKA 4NGHL 1MCOL 3SJVD 1SM3H 1V3LA 3MNVA 4R2GD 2AK4B 2FB4H 1EX0A 4QRUA 3WFDL 3EDEA 5HGGS 1KB5B 4JRXA 3T09A 4HKJB 3MRFB 2FECL 3V52L 3UJIL 4WWID 5D6CB 4URTB 2KZ1B 1JZ3A 4NQSA 2PN5A 4ONFL 4NOBA 2LAGB 5GS2H 4XC1L 5E1HB 4H5SB 4ZO6A 4KU1A 4DVRL 2R1XB 4U0RC 5LVEA 5C09E 4PRIE 3BGFB 2A1WH 5DJ8A 5DO2C 5I15L 2F19L 5ICZA 3AM8A 4LPWA 3QEHA 35C8L 5GISL 2X1QA 2V17L 3UROR 1I3GH 1RUKH 1O7VA 4JKMA 5FCUL 1T1WB 1X7QB 5IJKA 4YHPA 4W68A 3O41A 4OSUL 3TH4T 1H0DA 4X5XB 1U8MB 3U4BH 5I1DA 2E7BA 2CLRB 5HJ3A 3W39A 2NMSA 4EXPX 1A4KA 5E00B 5C3LD 4G8GD 4F15B 3FQWB 4DKAA 3ULSA 3R8QA 4M5ZL 1QYGL 3VDAA 4FFZL 3O2DL 3FZUC 2XQBL 5I1EL 2ADIB 3LQAH 2EYTB 2I24N 4OF7A 1NL0L 4L4VA 4Y5VC 4XCYA 2CJUL 2Z91A 4PB0H 2QQLH 1HKLL 2F54B 5TPWH 5SX5K 4K07A 4Y5XB 4NUJB 5I18H 1Z5LB 4HS8H 4GKNA 5I0ZA 1OGAA 3WDIA 1KT2B 4QTIL 4X6EB 5C0CD 3VXUE 3MXVH 1G0XA 5T1KD 3OKKB 4L3EA 2IGFL 5ANME 4GXVH 2DLGA 2VDPH 3QDGB 5EBWA 2AS5M 1KYOJ 2HFGL 5KSAD 3Q1SL 3HCVA 4JHBA 1P2CA 1MFAL 4QHKI 4O58L 2DIJA 4NWUH 3PV7A 4IRJC 3O45B 1ND0B 2AJVH 3R0NA 2XY1A 1X5GA 4I3SL 4TUJA 2Z31A 3U7AA 3L7FA 4NRZA 2EXYD 4Y8AA 1F4YL 5AZ2H 4DGVL 2HLFD 1LEKB 4EI5C 4RWHA 2IADA 1RIHL 4R90H 3X3GL 3PHOA 1I7RB 3ESVF 1Q94B 2VIRB 3UTZA 4Z0XB 4GXUM 1L6XA 3MGTA 1DVFB 1KBGH 2CD0A 1QR4A 1OP3H 4LSRL 5D1XD 3QUXA 1U3ZA 2OZ4H 3DECA 4L8SA 2IPUG 2FGWH 4XC3L 5KS9A 4PTTA 4X0KA 4TVPD 5HHVL 3KNBA 2J8HA 4F9LC 2WM0A 2VLLA 1MEXL 1EJ6A 1NEZG 2R8SL 5JXEC 4LEXH 2ZJSL 1TZIB 1JGUL 4QXGH 5CEZD 4PRHD 4DW2L 3KPRD 5IHUL 3F5WA 2COQA 4OZIA 4V1DB 5AUMB 1UGNA 5T5FL 2IAND 4WI7A 3JTSA 1S7VA 2BSTA 4FQXB 1UQSB 3MA7B 3IRZA 4K3GA 1XGUA 1MCRA 3G5ZB 5DJZA 1AGBB 5F89A 4R7DB 4G8FA 1KTKE 2NTFA 1MY7A 4A6YL 4U6VL 4NN5C 1NANI 2VE6A 3I2CL 1OGTA 3CH8A 3FQNA 1F00I 4PGJA 4DGYH 4OLYL 4YXKH 5CKGA 1JGVL 5CLWA 3TNNB 3FOMB 4M8QA 3OWEA 1KGCE 4I48A 5IVNA 4H1LG 2X9XA 5EOCH 3MJ9A 2VN4A 1U8IB 3MRCB 4KGJA 1MCLA 5A1AA 1CFSA 2XTJD 5DUMH 2CSPA 3TZVA 3BUYB 3RUGB 3TBSB 3ZL4H 2DLTA 4Z7VB 3SGEH 2D7OA 4Z76B 1AGEB 1RUMH 5B38A 3TC9A 4HV8B 4Q9CA 3OG6B 4JDTL 5L8LB 3CVHH 1UH2A 1D5ZB 3VI3F 4M6NL 1PKQA 3HMXA 2R2EA 3HUJE 4QCIA 5ACZB 5FM4A 4PLKC 4WFFE 2BVQA 3THMH 2VLRE 2YMXL 5TDOA 3AGVA 4OUUB 1LEIA 1HNGA 4N0FB 4K23H 4L9LB 3ZDZE 1W0VB 1DFBH 5I71C 1K4CB 2QTEA 1IAIM 2VLME 4TNVF 2ENSA 2VDKL 4IOIB 4WUUE 4W81A 1S9KC 1RD6A 4C56A 1OWRM 1MJJB 1A14H 1BZ9B 1N8ZA 3SDXA 3V6FB 3UO1L 4LCIL 3IAQA 2VL5A 1MAML 4LSVH 4FHBD 4NWTL 2VLKB 4EDXB 1AXTL 5GGRY 3VWKB 1FRGH 3GO1H 3PGDB 4QYOB 2G60L 3HZKA 5FO8A 3RKDD 4PB9H 4XAKD 2I07B 4HCRL 4XNYL 3VXOA 3WNLA 4X8JA 5TDNA 2D9QB 1MCQA 3P4LA 1A1MB 1SJEB 1DQJB 1RZKL 5T3ZH 1GGCH 2RQ8A 5DEZA 5J1TC 2RCSH 4Y16D 3HE7C 2CKBH 2NY0D 1R5WB 3HLAB 3N06B 3RWGA 2L7JA 4Y5VA 1F90H 5DUPL 4YHLH 4KHTL 4DTGH 1AIFA 5DEGB 1MI5A 1YNLH 5I66B 1INDH 3CDFA 4WFGD 4ZQKB 1FC1A 3TBTA 3F12B 5M95B 3BN9C 5HYSA 4ODHH 3IKCB 3RVXC 1MSPA 5C0AA 5FO9B 2ZOKB 4X7FC 5KN5B 1H3VA 2A9ML 2OTWB 4PJFB 3I75B 1T66C 2X1PA 1T89A 5KSBE 1F6AB 4HJGA 1FN4B 2IAMD 4XPHH 2RAMA 5F88A 4NNYB 1J0YA 5C3TA 2PYEA 1J1OL 5D7KD 3M8OH 1OAQH 1MCIA 3BO8A 5EWIL 2VH5H 5MHSE 1P4LB 5HGHB 1AGCA 1NDMB 1MPAH 3T4YA 3DVIA 4N9OB 5JOPD 1KG0A 5J12C 4IRJA 4LLAA 5C86A 3RNQB 4Y1AD 1JRHL 2GITB 1E6OL 2YPLD 5I1LB 4EI5A 3QIUB 5IJVB 1C5BL 2FEEI 3B6SB 1BX2B 1J87A 3GSWB 3MSPA 1WCBA 2I9TA 1PQZB 1HSBA 3T0ED 4WW2C 1WK0A 2R69L 3ZKND 1A4JB 4NOFA 1JPFA 2BMKA 4F7TB 3O3DA 3O6FA 2ZSWA 5DHYA 4NJ9H 5F7LB 4HIHB 1FLTX 3TJEH 1JPSH 1L0YA 3OB8A 4HIEA 1KB9K 1FYHB 2XWJA 2J8UB 1CFVH 5DZNA 2A6JA 2VDQL 2RR3A 2YPVL 3C5SA 4KTEL 4O2FA 1BOGA 5I16B 3FO1A 4JGUA 4WEBH 3DX7A 1HN1A 4KGLA 1FORH 3IFPA 3WEXA 1OSZB 4R3SB 3B4NA 3K4DA 4LSTH 2IPKB 5D4QA 4OIIH 2E9BA 3I6LE 4JO4H 4M48H 4U1HB 5F1NA 4GH7B 1V05A 4UOW1 4FNLH 3OAUH 1IAII 1D9KB 4UAOC 3SDYL 4M1DL 5HHQB 3CX5K 3O0RH 1RI8A 2D7NA 4LAQH 2X4QA 2Y5TA 4PRPA 4QT5B 4EUPB 5AYQA 5DSCB 3LVEA 3E6HA 1JF1A 1ZANH 1A3RH 4WDIB 2P8LA 5J3HC 4BQ8A 4BZ1H 2K7PA 1OD7A 3SN6N 2YD4A 3OXRA 3EYSL 1MF2L 3ZLQC 1S9YA 4HJJH 5DJXB 1FYTB 3P0VL 3SHSA 5L88L 4IOFC 1I9RL 3HTLX 3MLTB 4JLRB 4YC2B 5DK3A 5I30H 1X4XA 5DUBB 5DTFB 5ABDE 3C6SA 4XCFH 3S34L 3DBXB 5T3XL 1T6VN 3MGOA 2NY1B 2DI9A 4EDWH 3TO2B 2NYYD 1EMTH 5ID1A 3LEXB 1FGNH 2A38A 2PR4H 2FYYB 1QKZL 1ZE3C 4GQ9H 2WBJB 3RVVD 2JF1A 5F7HA 2EC9T 2MQ0A 3EAKA 4G6FD 1NFIB 4HHAA 3L3OA 4EI6B 1M71A 2Y07H 2BERA 1T80A 2QADD 1YEHL 3GSVB 1ACZA 4HIXH 4F3FB 4RFNC 2A6IA 4H20L 4XBPA 4O2CA 3FO9B 3B9KC 4OD1L 5JW4N 5DMJB 1LE9B 1ZHKA 4X6DA 2OTUA 4PJCB 5CP7B 2DJUA 3WFDH 3PDOB 1IM9A 4K7PX 4K94C 1S9XA 3GHBL 4OBSA 1MH5A 1MLCB 3T0AA 3V52H 1KCSL 4OZ4B 3UJIH 4OZGF 3KYMB 4OLVL 5FYLL 1NBQA 4KMTL 1BQUA 3HE7A 5CEZE 4PRHE 3L3DA 5I1CL 2H32B 2XN9E 1NJ9A 4ONFH 3X17A 3IJYA 3QWOB 5C07D 5IWLA 5F3BB 4ZUVA 4DVRH 2G9HB 1AP2B 4TN9A 3QUYA 4M61A 3S5LA 35C8H 2V17H 4P99A 3CUPA 1CLOL 2VUYA 3QIWB 1UACL 4S0SD 1CGTA 2MKLC 2A0LC 2PUQT 4YGVB 1ZHBA 5TE7L 2UZIH 2E6JA 1LNUB 4QHLB 5L7XH 3OSKA 5LQBL 1MWAA 2AXFB 1EVUA 4PP2B 3QJHB 5IVZA 2H8PA 4GJTB 2W0PA 1SEQL 1EGJH 5J6GB 1S9WB 4FFZH 3BMWA 3O2DH 5FUZL 4OBRA 2AJ3A 5I1EH 3D85B 5LKNA 5IVXF 3PWVA 1RPQA 2YBRB 3FCTB 4H8WC 5B21A 4D0CA 3A67L 3IDXH 4LVNB 3EFFA 4JQXC 1WC7A 1G0YR 1NMAL 3WHE1 4ZPTA 5BRZD 3D39B 4NKIL 4LIQH 3SBWA 3BP7B 4Y2DC 5GGTL 2M1KA 2CPCA 4G42B 5HI4C 1ED3B 2XIDA 1ZT1A 5FYJD 4AT6A 43C9A 4QTIH 3CSPA 4P9ML 2C4XA 2LU3A 1A9BA 4JKLA 2IGFH 5C0JA 4JPVH 1DANU 4WHYG 3NAAL 4PJ5D 1KJMB 4JRXB 1BPVA 4FQHA 1CXIA 3ULUL 5IGXL 4I3SH 4M1GH 3HAEG 3LKQA 3C5JA 1L7TL 2VRAA 4Y5YA 3ALXA 4DGVH 3FFCA 15C8L 1I7TA 5HYSG 1AQDB 1SYVB 4LGSB 2HMID 5CP3H 5SWSD 1EO5A 1WCQA 5LGHL 3FN0L 4H26A 2ZUSA 4LGPB 5ICZB 4JO3L 4PJDF 2PYFB 1VACA 4WGWB 5TQ2H 1I8MA 2GHWB 1QRND 3RGVD 4C83A 4YHPB 5SV3A 4XC3H 5FGCE 3O41B 1V7ML 1H0DB 4KKNA 3BRGC 4LPUA 3KR3L 5HJ3B 4MAYC 1JGUH 3V5HA 5JIKA 4CMHB 3ULSB 3ILQC 1XZ0A 3WFHB 5JMRA 1UWXK 4FXKA 5C08A 4ZG1A 1BECA 5IP4A 4JDVA 2R23A 3RVUC 4GG6E 3BQUA 3NZ8A 1XIWD 1CG9B 3ARWA 4XCYB 1RUAL 3VMOA 1NLBH 2D7MA 2CO7B 1M6OB 4FTVE 3U9PL 2WSKA 1IC7L 4GG8A 4P4RA 4TNVK 4W6YB 4U6VH 2AI0L 3LD8B 1XGYH 3QR2A 2GK2A 2IFGA 1LP9A 4PJ7B 2B1AH 2PTUA 5D5MF 1X5ZA 4GS7B 4NN7C 4GKNB 3ZE0E 2EECA 5CJOL 5JOPE 2DL2A 3RX8A 1CDJA 1H3PL 1T0MB 1HEZA 1PVHA 4R7NB 1QEWA 4M7LT 1L9MA 5ESAB 4Y1AE 3QUKA 5KSVB 4HBCH 4J3TA 1CGWA 2YPLE 1I3UA 2NW3A 1UT9A 3MO1A 3BZ4B 5EBWB 1H8OA 4I5BA 3EOTL 3I50H 5C09A 2R1YA 4PRIA 3EOAB 3HCVB 4PBVC 1XGRA 3MRGB 1P2CB 3WN5C 4IMLB 1KJ2A 1QLRA 3OZ9L 2R9HC 3DTXA 1I9IL 4TUJB 2Z31B 3EO9H 4JDTH 3L7FB 1WT5C 1DTUA 4M6NH 1T1XB 5E6ID 2FJFB 4NQEA 3DYOA 2ESVD 4P46C 5TQ0H 4PBXA 2YMXH 3PHOB 3H9SD 1IAKB 3OAYH 3UTZB 2YPKA 1BVZA 3HG1B 5JW4R 1FQ9C 2DD8H 3QNZA 4KZDL 4KDTA 1JK8B 3DVFA 2VDKH 3CFCL 1A47A 4PTTB 2AXJA 1TLKA 1ADQH 4I9WD 3VCLB 3MZGB 5KSUA 1OL0A 1P4BH 5HYJD 5JW4Q 4DZ8A 4LCIH 1FO0A 3BPLB 4NWTH 3PHSA 1AXTH 2XKSA 4HXBL 2R0ZL 5IFAL 3F5WB 4KMLB 2ZUQB 4WU5B 1S7VB 1CE1L 3QZWG 1EHAA 4Y4HA 1S8DA 4HCRH 3VXUA 2VAJA 1B6UA 4D9LH 2C3GA 1XGUB 4JJHA 5DJZB 5F89B 4PJEE 4G6ML 1RZKH 1QFWM 5DRNA 4G8FB 1GOHA 4GLRI 5ANMA 2NTFB 4FG6D 1N26A 1W8NA 4LRIA 4YQXH 4RGMC 3MV11 3RIAK 1KB5L 2VE6B 1OGTB 4KVCH 3VD7A 1TFHA 3FQNB 2KUTA 2YRLA 4JQXA 5DUPH 2EEDA 4KHTH 1DANT 3ZT6A 3ECBB 4GBXB 4OFYA 4M8QB 4MHHG 2AABH 3MRDA 4R4NC 4Y2DA 4J3SA 4JM2F 3ZYOA 4D9RE 1C12A 3DI2B 3TZVB 1S7UB 4N90E 1KFAL 3HI6L 4ODSL 4U1SA 3VGAB 3KPLA 4OLWL 4LPXA 4P2OD 3PP4H 5B38B 1NC2B 3KYAA 2E3VA 4PV9B 3QUML 2X89D 4NJAL 1QTYT 4O9HL 4XP9L 1LK2A 4FABH 1PKQB 3VRLE 2R2EB 4J4PA 5F93C 2BVQB 3C5ZB 4P9HL 1Z9SA 4U33A 1ZVSA 5D7JD 5CHNA 4JFHE 2CDGB 1RUPL 3IS1X 3QJFA 3U4EB 5F3HA 4WCYH 4NT6A 2ERJC 1NCNA 5FIEA 2GCYB 5A40E 4PJGA 2H2PC 4M02A 4GW1A 1RZJL 1WITA 4TTGA 4U0RB 4C56B 5E6ZA 4RMRA 4LHUD 3JVGC 3CK0H 5MENB 4A2MA 1A8JH 2NXYC 3HI5L 1N8ZB 3ARUA 2X4NA 4DVBB 1ORSB 1Q72H 5GGVH 2YA0A 4GUPA 5MEOA 3KXFE 1C5CL 2R2HA 4WGVB 5DJ0A 3HZKB 5DHVB 5FO8B 1BBJA 1Y18B 3W5NA 3VRIA 1CDUA 4XPTL 3VXOB 3MRPA 5I2IA 4MAYA 4R0LA 4YEEA 1QFHA 5C0EA 4KTEH 3WNPA 3MV7D 4D94A 3QEUA 2B5IC 3RWGB 4OJFL 4Y5VB 3TIDA 2NY3D 1V7NL 4MJIE 2VN7A 3IFLL 2CGRL 6FABH 2WINB 1I7ZB 3TBTB 4Z7UF 4XBEL 1MHCA 5F8QC 3TIEA 3HUJA 3O4LB 4JKWA 4J8RA 2BNRD 2D7TL 3KPSB 3HFMH 2QR0A 4TSAL 5T1LD 1CGYA 2W92A 2VQTA 2XQYG 3ROOA 2A6DA 4HJGB 3ROLA 4Z7OF 4OM0L 4KMQA 3LQMA 2OTPA 4JHZA 4G9FE 1P84J 2PYEB 5GGVY 2OQJA 4YHOH 4WUUA 3BZEA 3V5KA 1Q9LA 5FYKD 1TZHA 3EYSH 5BMFL 4PJAE 1J05A 1AGCB 3O6LL 1QPXA 4AEHL 3WN5A 5IB5A 2HT2D 5ECJE 3DGGA 3P0VH 5FYJE 4OV5A 4IRJB 4V2CB 5L88H 3MUHL 1D6EB 4UT9L 1MFCL 3HC0A 3IU4L 4U6HB 1AKJD 1WT5A 3RL1B 1QFWI 3NCBB 2R2CA 2FO4A 3S34H 1TMCB 4P46A 3S6CA 5T3XH 4D2NA 4HAFA 3RIFF 1WCBB 5DYOA 2I9TB 1HSBB 1FCCA 1ZLWH 5D2LB 3WXVL 3WIHA 1ULVA 4PRAB 1J1XH 1ZWIA 1FVCA 4OF0A 2DICA 3O3DB 3S7GA 2ZSWB 1FVDB 1OP3K 2MQ3A 3W2DL 2UZYB 2VQUA 3QFDA 4PP1C 1OAUL 5DURB 4WI9A 5JHDE 4HIEB 5CSBA 5EU3B 4MXWL 1HQ4A 5SWSE 3D9AL 3B2VL 4OD1H 1RUQL 3RZCD 3C5SB 1S5IL 4O2FB 3FO1B 3PQYD 1KIUA 3DX7B 2D3VA 1TDQA 5E8NA 1MCSA 3U30C 2X5PA 5L2KD 1KCSH 2PNDA 4LPVA 2OX5A 1J12A 5FYLH 2UZXB 4KMTH 4NN5B 5E99H 5I1CH 5F9DC 3VDCA 1K6QH 1I1AA 1P7QD 3OJDA 2X4QB 2Y5TB 1ZHLA 4NKDA 4OGYL 1XT5A 3L5WB 5JO5A 1JF1B 1ZTXH 2D31A 2GFBA 3RAJH 1T4KA 3BT2L 2WUBL 3WE6B 2P8LB 1OAXL 4H88L 1UACH 1U8LB 3OXRB 4UMGA 1S9YB 2Z4QA 4X6CF 2QKIA 1CLZH 2VOTA 2KPNA 3O9WD 1AE6H 5BOZG 4D0BB 5ADOL 1KCUL 2XXMB 1KELL 4Y19D 1SEQH 1WISA 1WWAX 5FUZH 3FO2B 5ID1B 1KNOA 4RX4D 1GGIL 3A67H 4JY5L 4XXCC 4XCCH 1YMMD 5I71B 1NMAH 5AZEL 5EBMA 1YJDL 4ESKA 1H5BA 5DLMH 4NKIH 3STZB 5DD5H 1RJLA 4HHAB 3L3OB 3Q6GL 2HN7B 4PJHE 4LPYA 5EBLA 3FN3A 5GGTH 4JEGB 1M71B 2R4SL 3JVGA 3JWNC 4UIMA 4QEGA 2Q8AL 1I1FA 4XBPB 4HWEH 3H9SE 4NC1E 3DUUB 2EDLA 5HSFA 4K9EC 3QFJD 1OP9A 5GGSA 2VQ1B 1ZHKB 3BN3B 4RQQA 4KVNL 4P9MH 1QSED 4JFFE 4OLUH 3IDGA 1NCUA 3MV8E 3NAAH 1IM9B 4KRMB 4XI5D 3GIZH 1S9XB 2BSED 1BIIA 4IDJH 4KQ3H 3GRWH 1NAMB 1F02I 3S4SG 3MA9H 3HE7B 4HJ0D 3D2UD 3EJZD 1NJ9B 3IJYB 1W8OA 2DMBA 1NAKH 3MOBL 5TFSL 2HFEB 4UIKL 5C0CA 5LGHH 2DYPD 3FN0H 3R1GL 3QDME 5T1KA 1E4KC 2BOBB 2PW1B 5F1IA 5D7IE 2C7UB 3CPLA 1EDQA 3AU1A 5I9QC 3CXHJ 1AR2A 2DQFA 5JORB 1QA9B 4YHIB 1BQHB 2EIBA 5IEHA 5E08H 3P73A 4Y4KD 1ZHBB 5LAXA 1OSPH 3MYJA 4MXVF 4PR5A 1X5HA 3NFPA 1SY6A 4EKXA 1XMWA 3N1PC 2PTTB 3QEQE 1MWAB 2AQ1A 5GZOD 3LKNA 5IVZB 2H8PB 4PJXE 2FIKA 2VDOL 1MAKA 4FFWD 4Z7WE 3VGBA 4MLSA 3U36B 1SHMA 4HG4K 2AJ3B 5A16B 1LO4L 1R3JA 5J12B 4BSWA 3VXSD 4D0CB 4WO4C 5KTEH 4E41B 3OGCA 1WC7B 1QQDA 5EIQA 1B88A 5DI8A 1IC7H 4ODTH 3VGDA 1JZ5A 1D5IL 4KV5F 2ZUWA 5J7CC 1SJVA 1KLFA 5FF6B 4TSBH 2I27N 2AGJL 4WW2B 1FZMA 3JXAA 5CJOH 1X6NA 5GS2D 1NGZB 2CRYA 3AROA 4GT7A 4PRHA 4JANA 2XN9A 3VD5A 3WIHL 2Q20A 4PGBB 1RAMA 3V7AG 3MLRL 2DJ4A 2NLJB 5C0JB 5DJAA 4MA3A 1IC1A 4Y7MA 4G7YH 1CR9H 4PJIF 3WLWD 5L9DH 5ISZD 1Y0LA 3G5VB 4FQHB 5F9JA 5LXGH 2ARJA 1F4HA 5HHME 2AVGA 3OZ9H 1I9IH 3Q3GA 4CMMA 5CZKA 1A6ZA 3B9DA 4KKCC 1I7TB 4MCZA 3BGAA 4OF5A 2AJYH 2D7PA 2W65A 3F62A 3VRJB 5I8CA 3ZMRA 4GRWE 4OFKA 2EO9A 5DMKB 4WVRA 3LB6C 1SQ2N 4H26B 5FB8A 1EUTA 3C8HA 5KANG 4BUGA 4KZDH 4LCYA 3OG4B 5FKPB 3UBXI 1QLEH 4UAOB 3GSQB 5I73C 1U3HC 5JDSA 4C83B 3CFCH 1IQWL 2ADJB 4GMSL 4JO2H 3GHEH 1HIML 2ATKB 4KDWA 4HFWA 5SX4I 2XZAL 3BYTA 3MV01 3UTPD 1MHPH 3BE1L 3PDDA 1XZ0B 3PJSB 4X99A 2VXUL 4PYGA 5IFAH 5B3JF 4P59L 2EDWA 3MBEC 5C08B 2R23B 2YN3A 1ZT7B 1CE1H 1HHHA 3QWQB 4RMTA 1UH4A 1MUJA 1XFPA 4NZDA 2YK1L 4GG8B 1CK0L 4HLZG 3S96A 1SJHA 2NY5C 3EBAA 3BKCL 3ESUF 1KB5H 4PJ9C 3L3KA 3EUUA 4NYLB 4XHJD 4NO2A 2HT4C 1HSAB 5KW9H 3Q5YA 2JCCA 3H2WA 3JBG7 3MV9D 3VFRA 4NHUB 2VLJE 3QUKB 4XWGH 5EU5B 5F8RC 4RMUA 3MRJA 1G7HA 2NW3B 3JWOC 3MO1B 5JLZA 3FT3A 4NP4L 2NX5E 1PG7X 4RFNB 5C09B 2R1YB 4PRIB 1KN4L 5DJDA 1GHFH 1KFAH 3VFTA 3B9KB 1JMXA 1KJ2B 5D2NE 4NJAH 4O9HH 4XP9H 2JB5L 1EZVY 3PWPE 2YOCA 3V0VB 3WDJA 1OTUC 4P9HH 3BW9A 2X7LA 4F80A 2HT3C 5FECB 1RUPH 3QXUA 1W72B 4WI2A 1ZSDA 3QNZB