1NIDA

The structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
333
structure length
333
Chain Sequence
b'DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
molecule tags Oxidoreductase (nitric oxide(a))
publication title The structure of copper-nitrite reductase from Achromobacter cycloclastes at five pH values, with NO2- bound and with type II copper depleted.
pubmed doi rcsb
total genus 88
structure length 333
sequence length 333
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nidA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nidA02
1GY2A 4M3HA 3FSAA 1GW0A 4HAKA 2YXVA 1JXGA 2BHFA 1TU2A 1CC3A 3NJGA 2CUAA 2XVBA 3L45A 4FA7B 2BWDA 2JFCA 1V10A 3D12B 4F2FA 2GHZA 1NZRA 4DP2X 2H47C 2VN3A 5B7FA 3UADA 2YQBA 3T6VA 3PAZA 1SF5A 2A3TA 1QNIA 3X1BA 3OMIB 1KGYE 1PLAA 5F7BA 4F7KA 2GIMA 3ZX1A 1XB3A 3NP4A 2AANA 2FWLB 5I5IA 3N2JA 1SJMA 2JXMA 3U25A 3ERXA 2H5UA 4M4RB 1A4CA 1OE3A 4YSAA 3NT0A 3OD3A 2Q5BA 1JZEA 1L9OA 2WO3B 4YVUA 1NIAA 1M57B 1AS7A 5B1BB 2XUWA 3V9EA 3ASNB 1ILSA 4FAAB 4YSUA 4GP5B 1JXDA 4X4KA 4AKPA 3OM3B 3T71A 4QLWA 1A8ZA 4BDVA 2IDFA 2DWTA 2GBAA 3SBQA 3FQ2A 2PP9A 5EHFA 1ZV2A 2B08A 1ASPA 2CCWA 1SFHA 3ZDWA 2IDSA 1JZHA 3CDZA 1X9UA 3X1GA 2Y1AA 4DP5X 1NPJA 3FU7B 2BP0A 3FU8A 1DZ0A 2EILB 2DWSA 3UABA 4E9SA 4A67A 2IDQA 2XU9A 4TXVB 2IAAC 4G7SB 1M9WA 3DKHA 3ABGA 3EF4A 3H4FA 1ETJA 4BXSV 4EF3A 3TASA 3ABKB 1KCWA 1HAUA 5LDUA 1AACA 2GSMB 3NJFA 3FSZA 5IY5B 3AW5A 4E9QA 2ZONA 2VM4A 3EH5B 1HAWA 3FYIB 4UAHA 3FS9A 4KO7A 3X1NA 1FWXA 2VM3A 2ZXWB 3FPYA 3T6XA 3AG4B 1OE1A 1OCRB 2FT7A 1PMYA 1W8EA 1TEFA 3IE9A 2HX9A 1MZYA 1NIFA 2BP8B 2LLNA 3G5WA 1PY0A 2H3XC 4A66A 2WO2B 3N55A 4HALA 5F7AA 2GI0A 1PZCA 4K9JA 3X2QB 2UX7A 1SHXA 2PLTA 9PCYA 1NICA 4HZ1A 1A65A 2YXWA 2OV0A 2J57A 1AANA 1ZDSA 3IN0A 1RZPA 5B7MA 4KNSA 1T5KA 4ENZA 3EH4B 5FC9A 3FU9A 2UXVA 3ZBMA 1RZQA 2OCCB 3IBOA 4L0PB 2BWIA 3FT0A 3WNJA 1KDIA 2FTAA 3ABMB 2J55A 2P80D 1BYOA 1MG2C 3FSWA 4HHGA 3AG1B 2VW4A 2EIMB 2HX8A 5I28A 1GSKA 2PCFA 5B3SB 4A2HA 2YARA 4YSQA 1BXUA 4P5SA 5B1KA 4A2FA 2CJ3A 1NTDA 3WKQA 3IEAA 4DP0X 4UF7C 4CSZA 2QT6A 2Q9OA 2BO0A 3TU6A 2IWEA 4ZK8A 2TSBA 2VMJA 4CSPA 5B1AB 5I6KA 2X88A 4E9WA 1ET8A 4DP9X 4YSPA 1B3IA 1NIDA 2IH8A 3NSFA 4G7RB 2Y69B 4E9VA 1L9TA 4YSDA 5E9NA 4G72B 1AG6A 2EIJB 2B3IA 1OF0A 1XMEB 3DIVA 1L9RA 3OQRA 2QPEB 4KNUA 1ZIAA 1AZUA 4DP6X 1SNRA 2EIKB 2PPFA 4YL4A 3CZUB 2HX7A 2YAFA 2I7OA 1ID2A 2AZUA 3NYKA 1WA1X 8PAZA 2W88A 3TBCA 1N68A 4DP7X 4NB7A 2FQFA 2BP0B 1JVOA 1L9PA 1BQ5A 3NSCA 3X1EA 3TA4D 3WIAA 3PLYA 1N70A 4A2DA 2IH9A 2OJ1A 3KW8A 3SBRA 1NPNA 1SDDB 2TSAA 3FPXA 2PPAA 3NJIA 3C75A 2R7EA 1EHKB 3KW7A 1AG0A 4MFHA 1WAEA 3H4HA 1ILUA 1BXAA 2MTAA 3S8GB 3FSVA 4BK5C 7PCYA 3PXLA 3DTUB 3QJQB 1PZAA 2IDTA 1NINA 4E9RA 4KO5A 3SQRA 1WA0X 2QDVA 3EHBB 2PPCA 3WI9A 1JZFA 1QLEB 1UATA 1J9TA 1I53A 4GYBA 3S3DB 1NDTA 4Q8BA 2BW4A 2XXGA 2NRDA 2AVFA 2PCYA 3HB3B 4YSTA 2YAOA 3ABLB 2FT6A 4WTQA 2YAPA 2XV2A 3SBPA 4GP4B 3T6ZA 3WKPA 3QJVB 4QKTA 1BYPA 2HZHA 2ZWNA 1ZDQA 1W6LA 1ZPUA 3UAAA 5I6NA 1MDAA 1KCBA 2XYBA 1E5ZA 6PCYA 1SFDA 3S3CB 1KBWA 1PNDA 1CUOA 2PP8A 3NJNA 4JKNA 2I7SA 2PPDA 3T6WA 1X9RA 4DP4X 5I6OA 1FFTB 4KNTA 5AZUA 2XXFA 3IN2A 4KOBA 1NIBA 2IWFA 2W8CA 3ZIYA 1OCZB 1OOWA 2IWKA 3CDZB 1PF3A 4AKQA 3NJHA 1PAZA 4W9ZA 2QPDB 1PZBA 1PNCA 2PPEA 1J9SA 3NJMA 3MX0B 1W6WA 2VW6A 4A2EA 2RACA 1E30A 1GS8A 1AS8A 3S3BB 3NJLA 1BXVA 1JZIA 2BW5A 2IDUA 4PAZA 4YSRA 5PCYA 2GB2A 1NWOA 1AIZA 2JKWA 1GY1A 4PCYA 1JVLA 3UAEA 3UGEA 2DV6A 1JZJA 1ZIBA 1GS6X 1KDJA 3UACA 1OE2A 1MZZA 2XV3A 3WG7B 1IKOP 3JTBA 2YAQA 1BAWA 4JHUA 2PP7A 1KBVA 4HIPA 4AX3A 4AZUA 6PAZA 1FA4A 1QHQA 4BWUA 4GP8B 4E9YA 4A2GA 2YAEA 1SDDA 2QDWA 5D4IA 4E9TA 2R7EB 3QJUB 2I85A 1J9QA 5ANHA 5I6LA 1MG3C 3MBWB 4BWWA 1AQ8A 4BWTA 5I6MA 4A68A 5D4JA 5B7EA 1ET5A 5A7EA 1AZRA 2MRYA 1J9RA 3NSYA 3T9WA 1GS7A 4DPAX 3FQYA 3PAUA 2HXAA 4HCIA 3BQVA 1IC0A 5TK4A 4P5RA 5I6PA 4YVNA 2WSDA 3TBBA 2XWZA 4AKOA 1XB6A 3OMNB 1HFUA 2UXGA 2N0MA 3NP3A 1J5CA 1EZLA 1ADWA 1WS8A 3BVDB 1BQRA 4DP8X 5AKRA 1WS7A 4HCFA 1TKWA 1E5YA 2AFNA 4N8UA 2UX6A 5I5MA 3PAVA 4KOCA 3RYMA 2HRGA 3FYEB 1ET7A 4G71B 5TK2A 4W1TA 5B1JA 4Q89A 3HEIB 1SHWA 1CYWA 1AS6A 4GXFA 1JZGA 2DY2A 1KYAA 2ZOOA 2FJSA 3GXUB 2XV0A 3PCYA 1SF3A 1L9SA 4AI7A 3QJSB 1JERA 5PAZA 3AY2A 2XLLA 1XB8A 1RCYA 2P80A 3ASOB 2J56A 1J5DA 4G7QB 1A3ZA 4DP1X 3V9CA 3CG8A 4GY4A 2YAHA 3OMAB 1IUZA 1OCOB 3CVCA 1TEGA 1JOIA 1R1CA 3CVDA 3QPKA 1CYXA 1CURA 1AZNA 1IBYA 2VW7A 3GDCA 1E67A 4DPCX 1WA2X 4KO6A 4UANA 1ASQA 2DYSB 2FQGA 1A4AA 2XX1A 3PPSA 1AOZA 2E86A 3S8FB 4RH4A 2FT8A 5D4HA 1NWPA 1BEXA 1IBZA 4BDVB 1YLBB 3AZUA 2VSKB 4YSEA 2VSMB 2HLEB 1PLCA 1AZCA 3H56A 1GYCA 2XX0A 4HHWA 3X1FA 3FU7A 1DYZA 1E65A 4YSOA 4G70B 5I5JA 1VLXA 1V55B 2GC7C 3EH3B 1RKRA 1OCCB 3FQ1A 3AG2B 3JT2A 4NERA 4E9XA 4WKXA 2FQDA 5B1JC 4JHVA 3CVBA 2YAMA 3NSDA 2CALA 1M56B 2DYRB 2CBPA 4KO9A 1A4BA 2BZCA 1PCSA 2FQEA 2X87A 4HCGA 1BQKA 4BXVA 2UXFA 1NIEA 4NAJA 3NJJA 3NJKA 3QQXA 1AR1B 1AZBA 1ASOA 2FNWA 3QJTB 2BZ7A 4DPBX 2UXTA 2BP8A 1KV7A 1PLBA 1URIA 4YSSA 2J5WA 1OV8A 2HRHA 3WNIA 4YSCA 1GR7A 3AG3B 2AZAA 3GYRA 1L9QA 3QJRB 2GC4C 1F56A 5I26A 2CAKA 7PAZA 1V54B 4N4YB 5AFAA 4F2EA 2EINB 1AAJA 1JXFA
chains in the Genus database with same CATH superfamily
3EFDH 2RTTA 4HGKC 1OAQL 3FSAA 1WTLA 4LNRA 2A6DB 2APFA 4NN5C 4XNYL 4RSVA 2BX5A 2ZJSH 1J1OL 5EU6B 4EZMA 4ZMQA 4X5XA 4P2QA 1V10A 4JN2B 3D12B 3ZDYE 1FFRA 1NZRA 3D69A 4HS6A 5CCKL 3U1QA 3E1F1 4R7XA 1DEEB 4PJBF 1QNIA 3O2VL 3O6LH 3E3QC 3P3RA 3DHJA 3LS5L 1KT2A 1DVQA 3BQUB 2QZQA 3L4ZA 2QLYA 3NGBB 2OYLA 2L4OA 3T09A 4AGOA 4HD5A 3PU7A 1JRHI 4KROC 5LNEA 1OTSD 4U6TA 1E5AA 3OAUL 5HHXH 1JWMA 4GG8B 1A6ZA 1ZA6A 4XNMA 4TNVF 1BEYH 3MA7B 1S9XB 2WO3B 2WWKT 1T1XB 5F2FA 4HWZB 5ITFB 3O4LE 4X7CC 4KZ0A 2XOTA 1LJMA 4XNYH 2H6PB 3NQIA 4QRPA 5F9DC 2GYSA 3T2NH 3OM3B 1PYWB 2D0GA 2Z31C 5C0CE 3TA3C 4OLEA 4A04A 3DK0A 1T0OA 4LSVH 4RBPK 3SD2A 1J1XL 3OKKB 3VWJD 5HGBA 5EHFA 1U41A 3P9LB 4KDTA 4IHBA 5C2UB 3L9RB 4DEWA 3A6BH 3HIZA 4AQAB 3HE6A 4WV1C 1A7QL 5A2IH 1DJXA 3L7EA 1IAMA 2H0JA 4FMKA 1D3CA 5LBSH 4OV5A 4WI0A 4Q0XH 2GJ6B 4HHAB 4MJIA 4D8OA 3RWDA 1F00I 4OZHE 5DRNA 4F7MB 4BQ8A 1OO2A 3QIBC 5G5DA 4APQA 1BVKA 3LZNA 2DICA 3HNSL 1I8AA 4RNRA 3R4DA 2Z35B 4LP8A 2YBGA 2CJUL 2YXFA 3AW5A 4PH8A 5D2NA 5IY5B 5A3ID 3MRMA 3WTWA 1VERA 5HJ3B 2G3ZA 3KLAA 4RQQA 3TO2A 3RGVD 3VI3F 3SDAB 4HLEA 1FVEB 2PABA 1N5YH 2VRAA 2XFXB 4N0UA 2WLNA 2WWNA 3R19A 4PYGA 3EH1A 1IB5A 3OVUB 4M3KB 3G5WA 4PJCE 3GRWL 2BM3A 4HFWB 4I87A 1TTRA 3LXAA 3QI9C 4WV1A 1G5AA 1MREL 3V5KB 3TCXA 1PZCA 4WI2A 1HSBA 5IUCA 5F6IC 1EVTC 4P0DA 2C9UA 4PLJC 1FO0A 1G43A 2VGLM 1DBKH 3VD1A 1ECZA 1T6VN 2XQYK 1JTOA 3T2NL 5JIQA 3IN0A 3SYCA 3B2XA 3A4FA 3DSNB 4M3JA 3QG7H 5B1CA 2DEYX 1MHPL 3RDTC 1QFHA 1K4CA 2BVOA 3HG3A 15C8H 5FO9A 2OCCB 3ZKXB 3TOPA 4Q58C 1MY7A 4PJ5A 5IFHH 4JDEA 1ZLUK 3DX0A 4LVHC 5DMIL 3LVEA 5D1XC 3UP1A 2VUYA 5J6GB 3C8DA 2P80D 3LRSB 4JFOB 1CFTB 4HAFA 2EIMB 1X5YA 4G9DB 5B3SB 1DQJB 2HPTA 4BKLB 2E9WA 2HLFD 2X4NA 2WXRA 5DS2A 1A25A 4JFFD 4JM2F 1AO7E 1R75A 5E1GA 3NABL 4OZHA 3PRZA 4IKJA 1F6AA 4F9PA 1MOEA 2DMGA 4XVTH 2C9RA 3RJDA 1NIDA 3LXUX 4HIHB 4X5WA 3SKOB 1LTXA 3NSFA 4RESB 2MOQA 5F7NC 5JLZB 2YR3A 3ISWA 4XPGH 1IU1A 4EI5A 1G9NL 2EIJB 1RZ8B 3GKZA 2X9YA 3ZRFC 1WIUA 4RGMC 1IIIA 2DQCH 2ZICA 2YHGA 3FTGB 5TF0A 4FLRA 4Y16C 4Y5YA 3VQMA 1MVFA 2UZXA 3P4NB 4K8RC 3FH7A 3ECBB 4QOKA 3ULAB 2GTWA 4JY5L 4TLKA 5DQDH 5GS2H 1KLGA 1QKZL 2KL6A 1KGIA 4M7ZB 2OYMA 4PRID 5HDRA 4ZAKB 3WEBA 5GZNC 2F19L 2YSTA 3SYQA 4N2BA 3QG7L 5K39B 5E8EA 3X1EA 2WYHA 2O5XH 3M8OH 2WXIA 2IADA 4LL1A 2Y9RT 2TSAA 2ITCB 5DJAB 4NFBA 3NJIA 3QDJE 3BWUC 4MNGA 4A7GF 4BBWA 2AJVL 1U3JA 2ZCKH 3KW7A 1UVQB 4MFHA 4QF1A 1BEYL 4HZLB 1C08B 4K3EL 4KTEL 7PCYA 3WY1A 3U46A 5I0VA 4JDZA 2W5PA 1SHSA 1H9VA 2V9QA 1SMAA 3KCWA 1FLRH 5FUZH 1GTFA 5E23A 3QDGD 1WT5C 3FB5A 1TSRA 5C0FB 4RAHA 3DXAD 4GLRH 4ZW8A 2ROXA 3A4AA 3TS8A 4QHNA 3LNIA 4X7TB 5IREA 1TUPA 4MQSB 1T6BX 5L4FA 3SOTA 1DVFB 4TLUA 3OR6A 1F90H 1UA3A 2AJSH 3DJTA 4V1DB 5FXCH 1B9ZA 1IM3A 3TL5A 2KMWA 1XEDA 3K0WA 1T5XB 1LMIA 5F0JB 2WXGA 4LSTL 1CD9B 5DJZB 4ANKA 1FFQA 1UA6H 4IRSD 1INQA 2G4GA 3WKPA 1GVIA 4LLMA 1IGJA 2QSVA 2GK0A 4MA3B 4S10A 1ZS8A 4KDVA 4ZI8A 2Q7AA 1W6LA 3N91A 4FP8L 1DQVA 4PJGA 5SWSB 2BVQA 4GIPD 1ADQH 1E5ZA 2VR8A 4QYOA 4LT7A 6PCYA 1CT8A 1PNDA 5LBSA 3T2PA 1OP9A 2AF2A 2JIXB 1QSFB 3GRWA 5DK3A 4JW3A 2AI0L 1D5ZB 3QJHB 5F7UA 3F7QA 1U8JB 4ZS7H 3ROOB 3MUGB 4HS8H 2B5IB 4QT5A 1VACA 4M7LL 5CJQH 3ZIYA 1J5OH 5I17A 3UTQA 4K23H 4X5XB 3X12B 4C56B 1G7LB 1UWXK 1PAZA 3OB8A 2NY0B 5EA0H 3MRNA 3ZE1B 2X70B 3AWGA 5EOTA 1OF2B 2FO1A 2AP2A 3NJMA 3FUDA 2X6VA 3ZE2B 3ZXAC 1R9FA 1U8MA 5DMKA 1DEEA 4N68A 1AS8A 2JMRA 3B1TA 4BH7A 2X53A 2Q3XA 1HEJC 2G5UA 2O61A 5CJQL 1L7TH 2O30A 5KSAB 2YFOA 1A7RH 1NKRA 1SHMA 1JVLA 3UAEA 5MP6L 2FH8A 3DTXB 4ZT1A 1IJNA 3UACA 4CC4C 2B59A 4U1IA 5I0DA 2DBLL 3JWNE 4LAJH 2GSGA 2M8XA 3PABA 4CADB 4NZUH 1Z9LA 3K80A 4MQXC 2NY7L 2HTKC 4DN3L 4C58B 4Y88A 1X5HA 1DVXA 3C09C 5D1ZC 1KWKA 1J8HE 4XPAL 3UTTA 3T0DA 3NIFE 3SBWA 3L3HB 4ZUSB 1HCFX 5IJDC 2K3HA 2VR7A 2SEBA 1U8IA 1E2WA 2VITA 2OMBA 4GQ9H 2EDFA 2V2XB 2GCYB 2LHAA 1YUHB 1TENA 1XBRA 1TZGH 3GMMB 4ZS7L 1I3GL 2JJTA 4UT7H 4EXKA 5ECJE 3SO5A 1FN4A 3CTTA 4EUPB 2AQTA 4KU1A 1O7DC 4TTDC 4NNYA 1GC1C 1T22B 4IRSA 3L4VA 3HJ0A 5CFHA 4BZ2A 3COOA 5IBLD 3KGTA 1XDTT 1OGAE 3KPSE 2CO7B 4MJIB 3QW9A 4R26L 2XZCL 5D7KE 3RX7A 3K4AA 1EJ8A 3U4BH 2WN3A 5DD1H 1P1VA 2DBLH 3OXRB 2Z35A 1NMAH 4HEMA 4EN3C 5ADOL 2AXGB 3LZOA 3WIIH 1A1MA 1KPUB 1U95A 1ORQB 3BAEL 3ZKQD 1IAIH 2CHWA 4L8BB 4ETYA 1UCBL 3WAJA 4HFWA 1AS6A 3RWEB 3II1A 1JZGA 4WK4B 3AM8A 4KMQA 1KYAA 3IK2A 4D0DA 4N2CA 3G6JB 5DSCA 5TDOB 2VL4A 3PV6B 2PYEE 3GSNB 2YZ1A 2ED7A 1FFNA 2N7BA 1M7DA 1IZKA 2EC9U 1J7VR 1CG9A 1EO7A 4N3UA 5ACMA 5LKNA 2ATKB 4DP1X 4UIKH 1NDMA 4UV7L 4FXTA 3OX8B 4CVUA 4Q9CA 2ADIA 3TESA 3T0EA 3L5HA 5JZ7D 1V7NH 1TEGA 1CYXA 3D51A 3LNGA 3RU8H 3SPIA 4W6YB 4X6EB 5K1NA 3D33A 2DTSA 2X38A 4RFOH 5I0XA 4WTWA 1KPVA 5D7LA 3V6ZB 3FO1A 5AW0B 2AK4D 2J25A 3VA2C 2DRUA 1IC4H 3NZUA 4XBPA 3CFCL 1MCOL 2OLDA 3GI8L 1R0AH 5HDWA 4HUXA 2VDNH 4ZODA 5LGKA 4UNTA 2HLEB 4ZMXA 4WWOA 3BP5B 4L4JA 4Y5XA 1IQDB 3RTQA 3PWVA 5EOCH 2CHZA 3QUZC 2WWOA 3FUEA 3VSVA 4J7RA 3ARBB 3MCKA 1KTLA 1QACA 2JJSA 5AVVB 1MLBB 3TBSA 3K71A 3EOYG 2ERJB 2CIKA 3OSKA 1Z0MA 5GGUB 4HJEA 5D71L 2NR6C 1CTMA 3UIZA 1YAIA 3H8NA 4UT9A 3SDCA 5BRQA 1X5AA 5DQ9A 3RTLA 4MSWA 1LE9A 1KXQE 2WGNB 1NCWH 5ID1B 2R69A 2VDPL 2FECI 3PHOB 2FNWA 5DRXA 3WNNA 3SQBB 2A6KB 4TSCH 4QHLA 1URIA 4KJYA 1OV8A 4QXTB 5EUKA 2BCKB 5AALA 5FYKE 4Y8AA 3NACH 4RFEB 5LWYL 2WCSA 4LBAA 4A38A 5GS1B 3QIUC 2J5LB 4PG9B 5AAMC 3D09A 1IRAY 4O51A 4BYHA 5E2TH 1PJWA 2D03L 5BVPL 5A43C 2EINB 4UT7L 1UWGL 3CFKA 4MDJB 4Y5VB 2OZ4H 5FK9A 4PS4L 3T2LA 2DI9A 4NDMA 1H6EA 3HA0A 3U46B 4ZXBD 1CIUA 1CDBA 3JXAA 4KV5E 1OL0A 3D3VA 3IB4A 5BVJA 3NJGA 3BZ4B 3D50A 2BSSB 4NLHA 3U7YL 1RURL 2AJ3B 4L1HA 5F8QC 4ZFQA 4DZBA 4FQLL 2VN3A 1NAKH 3WE1A 5IQNA 2GJJA 1I9RL 2PW1B 5JW5B 1TYJA 4AEHL 1FVDA 5ANMB 2Q8AL 5F7BA 4WWKB 3WLWC 5E6IB 4JFHD 4QGTA 4UNIA 1C8QA 3MRGB 1LQBC 1OALA 1H5BC 1R3KA 1U92A 4ZPVA 1DQDL 3WHE1 4DGIH 1PL3A 5GRVL 4W68A 4Z77B 1ZT4B 3RNKA 4PJ7E 1FHNA 5C0ND 3CDCA 1Q9KA 1EQWA 3LKOB 1DCLA 4JZNB 1RMFL 3S2CA 4PTTB 3LQMA 4ANVA 2J88H 3AMKA 4CC1A 3CD4A 4GP5B 4KK8C 3BEWB 3GQFA 5LHDA 4YDJA 2WIIA 2OMUB 2OMVB 1H8SA 3T71A 4ZOEA 1HHKB 3WJLA 3LN9A 4U1NB 3DUSB 3BT2L 4AUUA 5JQHC 1PZUB 2GBAA 4N26A 2Z9TA 4JAMB 1GRWA 2DM7A 2Y2TA 1BX2A 3I9IA 3M45A 4D2NA 1YC7A 4XGZB 3D2UA 3NZ8B 4OCWL 2OX5B 4MAUL 5H2BA 3RGVA 3CVHA 4GLRI 1J0KA 3EJZC 1A7BA 2OXHA 3BXNA 5E4EC 4OLXL 4K5LA 2XPGB 3OLEA 5FKAB 1QSZA 3D4CA 3QFJB 2B1HH 3H9HB 4YBLB 3W39B 2DYPB 3CFBA 4UAOC 2EXSA 4NN5B 1QTSA 1MJUH 3HC4L 1MFBH 1QD0A 5E9DE 3NUKA 5J3HC 2VM3A 5J11C 2VOTA 1IAKA 5AW9B 3QT2A 3V4VL 4EE2A 5FO8B 2F6AA 3ZDZB 3KJ4B 2FT7A 3CSTA 3S6CA 3BT0A 3EDJA 3IGUA 1SBSL 5C08B 4WF7A 1NQBA 3LS4L 4RLDA 2H3XC 2R2EB 3HN8A 4QLRA 3GNML 1RK1B 1WH0A 4HGWB 2BNQB 3MBXL 4N2IA 4P04A 5C0AB 3N55A 5BMFH 1IL1B 4K9JA 3X2QB 2UY7B 4JUSA 5A2JH 1PDKB 3FO2B 4A6YB 2EO1A 1CGTA 4G6MH 1Z9OA 2VITB 1A65A 2LFGA 5DQJA 2JTDA 4MXWL 2OMYA 3T1FA 4XE0A 5TDNB 4TNWF 3B8SA 5MHSE 4IMLA 3H6AA 4HOXA 1URLA 4GAYA 1VJSA 1HHHB 4F7TB 1LNUA 4IJ3C 4AJVA 1J0ZA 2R23B 3EJPA 1KIPB 1PZDA 3RVVD 4B9IA 5L9DL 1KSRA 1I1FA 4HLZH 4GKZB 3AG1B 4NCC2 4X7EC 2E74C 4Y19D 5KSUA 1E6JH 1Z9MA 5ENWB 1T83A 4I0PC 5EO1A 4JO1H 4QTIH 4A2HA 4X6FB 1GMEA 1NTDA 1W9XA 2VJ8A 3MHZA 4YK4C 1JXJA 5C6TH 4JM4H 3RX5A 3WXWL 4BKSC 1TITA 4ILDA 4MVBD 3VXRA 2Q9OA 3BRGC 1SM3H 5TQ2H 3VJ6A 4E9WA 5IP4A 1YY9C 1LWRA 3WELA 1XSJA 2OZNA 3OZLA 3OGCA 4GBXA 5KVFE 1S7QB 3GJFK 4ZO7A 2OPCA 4M9OA 2XNAB 5I15H 1BMZA 2X5PA 3QIWD 2X9ZA 3O81A 1KIRA 3MV01 1QBAA 1CG9B 3OQRA 3OHMB 5GGSB 1K8DB 4IBYA 3O8XC 4U6HB 1XH0A 2Z65C 2VDRH 1EAQA 2WXPA 1LD9B 5I75C 3UX9B 4MD4B 1T2QH 1WA1X 2IH1A 4PCTA 2A74C 3G6DL 3PY9A 5BZZA 4NB7A 2LU5A 3OKLA 3H3PL 4HUVA 2I32A 2YPVA 1EK3A 3TA4D 3PLYA 1VGEH 2UUDK 2YMXL 3WSQH 4V1DD 1OTUC 3SE6A 2OJ1A 3RWHB 4Y1AB 1P6WA 2VZ3A 2X0VA 4TV3A 1CJYA 3ULVH 4OQTH 4BIKA 1AG0A 3IPFA 3DGGB 3ILEA 4W9FC 3T77B 2DQJH 3L08A 2ZXDA 5SX5H 4GO6B 2R0WH 2XN9B 5E8OA 4LEEA 1NINA 2ZXCA 3MLRH 5DUMH 3S96A 3FRPG 2G2NA 3E9UA 4CU7A 4L4VA 5D96B 3HHRB 3QUYD 4XMLH 3WFEH 1SXCA 2DQ6A 5GGUA 3T2OA 4AGNA 1QSFD 1WIPA 2ICWI 1L0PA 1DQMH 4OZFA 1Y1UA 5IW3A 1OXYA 5IT2H 3DRTB 3T0WA 4J6RL 4F8OA 1TKWB 3ARPA 4ATTA 1NFIA 1RIHH 4OM0L 1OHZA 2K7PA 4WW2F 1WK0A 2JKNA 1VENA 4OKDA 1ZA3A 4LDCA 5FM5O 2ZWKA 3V52H 4A7SA 1HHGB 3QJVB 2ZKYA 2EDJA 3EFDL 5ABAA 4DPRA 4MMZB 4X4ME 2YOAA 1EH9A 5JXAL 1S7TB 1PTZA 1JYWA 3GBML 2K1MA 4Z78A 3NABH 5GS0C 1GA2A 4OAWB 3NJNA 4F5CE 5JHDE 4JGNA 2W9LA 2Z91B 1WVZA 2PPDA 3PWNB 4MCZB 5IW6A 3C8HA 3FXIC 4IBTA 3ULSB 4A7VA 3EFOA 1GSMA 5DS1A 5B21A 2L7UA 4FG0A 5IHHA 4Q14A 5AZUA 3LH2L 5FECB 5IM7A 3G08B 3OWEA 5EMYA 3QUXB 2BSRB 2IWFA 1LXMA 4LSRH 1ZLEA 4L8CB 1KV3A 1ACXA 4ZYKA 3MLZL 1E6JL 2EXTA 2P5WE 4KHXH 1OB1A 4WKZB 4H20H 2JJSC 1FNAA 4K3HA 1UT9A 1G6RL 1T83C 2Q86A 4I0PA 4EN3A 5IW1B 1UB6B 2GITA 5FOJA 2RACA 2JCCB 4LRIC 3PHSA 4JPIB 4P06A 4WI3A 3NZHH 4ONFL 2WLIA 1CICA 1ZSDB 1XR8B 2GB2A 5I1IH 1BQLL 3MV7B 2C8NA 3MZGB 5C09A 4D3CL 1T6WA 2IXQA 1NGXB 1IGCH 2FEEL 5CKGA 3UJJH 1MQKL 1ZIBA 4ODWA 4WUKL 2VLME 3AT0A 1JDAA 5F97E 2WXOA 1SEQH 3RL1B 5K33A 4L0YA 4OCYH 1AXTH 4XP6L 1R3JB 3S37L 5D1QB 1X7TA 3BLBA 4MJID 1P84J 2HUEA 5CWSA 1EZUA 2APTA 5J12C 1BIHA 1KEMH 2VZSA 5CZKA 2BXYA 5I1EL 4XAWL 2QFRA 4YDJB 5I1IL 4ODXA 3W0WB 4KZEH 4XMZA 2WYZA 2YAEA 2ITCA 2WIMA 3VACA 1QFOA 1QNZL 5DZOA 2DBJA 3K2MC 3U82B 3REVB 3OAYH 4N0YH 1MG3C 1TPXB 5AVTB 1T1ZA 1E8WA 1ZTXL 2P47B 1ZTMA 1NLDL 4O5LL 3L3KB 5IBLC 3NG5A 4MXQC 4JO3L 2EH7L 3DSNA 5DK0A 4QWWD 1YNKL 2F5BH 3QEGL 2FBJL 5A3IC 3DYOA 2AV1A 4J3WA 4PJHA 1C5CH 2CDFA 3OXSB 1XGPB 3VGFA 3T1WA 2HT3C 3JVFC 5J6GA 3EYVA 3MRIB 1R5IA 5K9OB 1UD8A 3BPCB 1MWAL 3IU3B 3L9YA 4HA1A 1VKXB 1RZIA 2R2BA 4TOYL 3BVDB 2J1XA 2PCFB 3LEYL 5AYUH 1A9EA 3P30H 2FJFB 1VHPA 3S97C 1V3MA 1AGDB 4JDTH 3VGAC 5J06A 1WZ1H 1BM3L 3RYMA 3ZDXB 1A7OH 1F4WL 2ICES 3T8MA 1UADC 3AUVA 1N8OE 1H9DA 3TVMA 2DY2A 1E4JA 5GS3A 2FJSA 4A7UA 4QHKJ 4AI7A 1LVEA 4YL9A 4X99B 4J39A 5I19L 2A9ML 2XKUA 4PMEA 3VXPA 1XB8A 3ASOB 3AU1A 4LK4A 1CBJA 2VDKL 1UM6H 2APVA 12E8L 3HBGA 1YNKH 2F5BL 4KMTH 5DJ6A 2IC2A 2EDRA 3EYOB 5KYYB 1S3KH 1IKFH 3VXQA 4YDNA 1JWMB 1S7VA 3DC0A 2EKSA 4OIFA 4JRXE 1CURA 2YD6A 1NCGA 2QSQA 2XT1B 3D4GA 2FYYB 2WWMD 2HJLA 4JO3H 4P59H 2YGNA 3HBZA 1A4AA 3KYKL 5DD0L 3F04A 3SJVD 5J1AA 1TSHA 4NZ8A 2EO9A 1K5WA 2IADB 4UQ9A 25C8H 5IQMA 5TF1L 1QR4A 1PYWA 5D6DC 4UILL 2WQSA 4UI2A 2JB5L 3QPXL 5IQLA 1KEML 3QYNA 2O61B 2X9XA 3DTDA 5E1HB 1HHIB 3AITA 1RL1A 4NC1E 2XWJB 2QADB 3IFOA 1AZCA 1CL7L 4MZ3A 5DO2D 5BQ7A 4AV4A 4H88L 5KS9F 2HN7B 2LGNA 2NR6D 1YYMH 5AL0A 4TQHA 3QJFA 5F7YC 4P2RA 3NZHL 2YGOA 4HT1H 1EFXD 4WI0B 3T3MF 4DVBA 2GEQA 4LRIA 2YD4A 4Y4HB 2EIBA 1SJEB 4M1CD 4NERA 4P57A 4J3OG 3NSDA 3FFDA 4HUWB 1UOKA 1K8DA 4R7NB 3OR6B 1YDPA 3VDBA 4L1TA 5INDA 5I71B 4KGLA 3WKML 3QG6B 4HEPA 1EAJA 5E94B 5HHOB 5CILH 3X13B 3AU0A 5DJZA 1NGPL 1AGEA 3LEVH 3QQXA 4GRLA 4R5TA 1KGJA 5DDHA 4F3FB 5KUKA 1PLBA 3VGBA 3OKLB 4WO4C 4ZMLA 5GRVK 1FGNL 1TQTA 4E5XB 1F56A 4A1RA 1RY7B 2IANB 1YEJH 3SDXB 2Z4TA 4WWKD 5I75B 4LDLB 3OL2A 1DN0B 2AK4A 2E56A 4XCCL 4DEPB 4OZIA 1RJLA 2WKOA 4GSXA 4PJFA 3VFTB 4X42A 5BZWA 1A8JH 3RY5A 1DSWA 5IVZB 5JOFA 5C6WH 1A1MB 1KPUA 1U95B 2OMZB 3HE7D 4J3BA 1X9LA 1INEH 4UNUA 4ORGB 4QAMB 1A9VA 1E3XA 1UWGH 3CU1A 2K0RA 3ZSSA 2IMMA 3V6FA 4Q2ZA 3FTUA 3I9PA 1LO3H 2DQHH 4Z23A 4XNUH 4AYBA 4HIIA 5BUPA 4OTXL 1OAXH 3MROB 1OSEA 4JFVA 5ES4B 2J6EL 3WMPA 1KGYE 3RU8L 4KXDA 5CCJA 1QZ1A 1ZANH 5AG8A 4G8GB 3WEXA 1I9JL 5I5IA 1R3IL 2Z7UA 3EGXB 1GYUA 4FJYA 3LB6D 5DJYA 2NYKA 4AT6B 3CAFA 4BSWB 1OE3A 3U0WH 2ZKHL 3PGDB 3QZWB 3QK0A 3FU3A 4B3EA 4JRYB 1NCHA 2A9MH 1UZ6E 3GSUB 3B9EA 4I0PD 1NGPH 1IT9H 3LEVL 1BMGA 5T3XD 4B9FA 4HPYL 5HHXL 1ODAA 4OLYH 2XYCA 4LHUB 4PB9L 1SN0A 1ILSA 3QFJD 4P5TC 3QPQD 5DT1H 3MOQA 5CGMA 1TZIB 4LO9A 4XXDB 2UZYA 2ZKMX 4OGAD 1SXSA 2DWTA 1R3HA 1MAJA 2LTQC 4QRRB 4I1PA 2ZUYA 4EZJA 1IEAA 1MFDL 2O5XL 3HPJA 5HGGS 4OU3A 2FD6H 3P2TA 3B7UX 2CCWA 3MRBA 3FU6A 4JLRA 3VH8A 1MWAA 1QFUL 2WXKA 4R97B 3WLBB 1XF3B 3LKPB 4EOWH 4ETQB 3T0AA 1ZGLB 3OHXB 2DWSA 3UABA 1IBGH 3UPCA 5IB3A 1ID5I 3SGEI 1BDYA 3HZYB 4JVUA 4LVEA 4F58H 4G7SB 4MAYA 1UB6A 2GITB 3LRMA 3BVVA 4NN6C 5TJWK 1HH9A 1EEZB 3ZL4L 4QXUH 2JCWA 3MREB 4Z7NE 1X5MA 3Q2WA 1ZKAA 4H0LC 1KZQA 3KYOB 2J3SA 2VCOA 1YEEH 3DECA 4GUPB 1FWXA 4NPYB 4WJ5A 1FNFA 2J4WH 4F2MB 5MEPA 4B9GA 2V37A 3B7SA 1ZK9A 1OCRB 3E3QE 4I1NB 2CBTA 1AD9A 3BO8A 1HWWA 1MVUB 3SGJC 1I75A 2YPLA 1KCSH 4YHNB 5C07A 4HALA 1OLZA 4MHHI 5CJOH 2FD6L 4OJCA 2Z8RA 2QTEA 4K9EC 2WY3B 4TTDD 1SHXA 1UB5A 4MNHB 4ODHL 4OQ1A 2NX5B 4MAYC 9PCYA 2YEZA 1GL4B 1HQRA 1T0PB 2OQJA 4IKKA 2XA8L 4ZUWA 5F3HA 1ZDSA 3TEXA 3NTCL 3P77A 2FX9L 4HW6A 5AOZA 3A4EA 5K9QI 3CXFA 2BC4A 3G6AB 3NCWA 1ZS8B 1DJWA 2CRYA 5KUMA 4IK6A 2E8YA 2ZUVA 3BKYL 4UZUA 4YXHL 1OTSC 3L4XA 4F24A 1F42A 1QLEH 4WI7A 3LMJL 2MOVA 3V6BR 5AB2A 2XN0A 3FSWA 3KVPA 2VKXA 1LK3L 2G5RA 4HHGA 4RIRB 2DQTH 3V10A 1AFVL 2MKLC 2P24B 4PJDE 1I1CA 1CICC 2JF1A 3C5ZA 4P4KB 3IEAA 2PO6C 2EYRB 3BUYB 1VACB 1H3GA 2VNCA 2VT0A 4R6UA 2ZF8A 1XH1A 3DV6A 5T1KA 2MH4A 4XN2A 2VJ0A 4MJ4A 3DX6B 3MRNB 3QHFL 4DP9X 3NFPB 3K72B 5T5FA 1B3IA 4LAQH 5SX5K 4XVUC 5AVZB 4JZOA 1GZPA 1XGYL 2CIKB 1JTPA 1DQKA 1XZ0A 2CJUH 2PXYB 32C2A 4YSDA 4G72B 5I8EA 4BH7B 1A7NH 2B3IA 3V5HB 1GTNA 4UM8A 1FC1A 1GOFA 1HHKA 1ZIAA 1A1OA 4RRPG 3ECQA 1YYLH 4O02B 4YL4A 4QHKI 3CZUB 2JNZA 1EHAA 1EEQA 3FO0L 3MV11 3SCMC 4QGYA 4MGXA 1IEHA 1K2DB 2Y25A 3NFNA 4HK0B 3J07A 43CAA 3QUGA 2BP0B 4XHJD 1G84A 4DN4H 5HHQA 1ETZB 1EZSA 3A67H 4ONHB 1KPRA 5CD5D 3IXTB 4A2DA 4DGVH 3UTTB 4LPUA 4P99A 3UBFA 1GZQA 3FPXA 1FLTX 4ABVA 4CBZA 1KXHA 4JM2B 4I89A 4L37A 1FRGL 4KKAC 5BV7C 4S1QL 3IDMA 2DYPA 3LIUA 4L3ED 4FQCH 3VRIA 3QO0A 5AUMA 1AHWA 4KZDH 2C1OA 2PMZA 3DTUB 4XPHL 1ZLWH 3UH8A 2NQDA 3CFIC 5EUOA 2AJVH 3QIUD 1TZHA 1XH3A 3CN0A 2JQAA 1FSKC 5DUBA 2ERJC 2YRBA 2W0FA 1GGIH 1NCCH 1YEWA 4JG1L 1KC5H 3ZT5A 1ZLDA 3P4MB 3ARUA 1JZFA 2LU7A 2CLVB 2IAMC 3BKML 4HBCH 5IEHA 5ICYA 4E0RA 4I18B 4BH8B 1P0SE 1ZEAL 5EO0B 4HUNB 1BFOB 3SKMB 1A4JB 1NDTA 1QO3B 4WLCA 2VLKD 2NY4C 4A6YA 3WTYA 4IEFA 1UZ8A 2WHVA 5D1XD 2V17H 4FQJH 3QRLA 2JXMB 3MUHL 3EDFA 2RR3A 4KRPC 2C4FT 2EACA 4P2RE 4PLOB 4WSKA 5FYKD 4F3FA 4FHJA 4IKLA 4IMLB 1OQOA 4MB4A 2R0ZH 5AOKA 1OW0A 3HMXH 5I6NA 4I0CC 3TX4A 1FZMB 1H5BA 1WEJH 1V7NL 2IANA 3FHQA 3L3JB 2VZTA 3OKOB 1QW9A 2YRZA 3QZBA 3B5TA 4QRPB 2OMVA 2OR9L 2YUZA 3R06A 4ZUUB 1MLCB 4PJFB 2NUTB 1FLRL 5I6OA 5DR5H 2FB4L 2XXFA 3CHPA 1S7XA 1NCIA 1FGNH 2X7LA 2ESVB 1KC5L 2OMWB 3JTTB 3U36B 4GPVA 4KOBA 3ULVE 2R56H 1CGSH 2VDRB 4FTVB 4DUXA 1UUSA 1G7MB 2ADFL 4EPSA 2OL3A 5E1AA 4NQDA 2HFEB 3WTTA 4AITA 4W9ZA 1FI8C 1T89A 1J5OL 3V55A 1RULH 4NQDD 1W6WA 2GJ6A 2EYSA 3LZPA 3QFJA 3V4UH 5DRNB 3WIIL 3AUWB 4U0RC 3WFHB 1II4E 3L3OB 5G5DB 3VU2A 4APQB 4OQTA 3CSYA 1U8NB 1M1SA 5A16A 3JZ7A 3S5YA 2YLHA 3GS7A 3U2SB 3J7HA 4WO4B 3K91A 4PP1C 1EXUB 2YKLL 4ZOBA 1S7SB 3GSNL 3GI9L 2NTSP 2VR4A 4U7KA 5DC2A 5AW5B 4BQBA 2AQRA 5BXFB 2D4DA 2BK8A 4HUVB 3QRBA 5HHNA 3KWVA 1I1AB 2OA9A 3I2CH 3KPRB 4BINA 1FZKA 5GGRB 3TV3H 4OZFH 1G7QB 1CR9H 3D3VD 1BOGB 5KG9A 1I85C 3IRPX 3GMOB 3NAAL 5T1LA 2AEPL 4KRNA 4FZ8H 4PJHE 2FECL 4WEEA 4XX1G 3ZO0A 3IDIB 1I8KB 1QLFB 3WNPA 5I1EH 2WINA 4R4BA 3OKDA 3VFVB 3QNYB 1NEZG 5DJ0B 5L8LB 1LEIA 2MRYA 1QHPA 4QHLB 1DQML 5KSAD 1U2HA 4R0LC 4RISL 3OHXA 2WSPA 1B4JL 1W72L 3FUNA 4HCIA 5D2NC 2P8PB 4JMNA 3AS2A 4P5KA 1HSAB 1BZQK 2J2ZA 3G3LA 3UBXB 5A6MA 1AD0A 2IFFH 1HFUA 3IVKA 1JZDC 2UXGA 3FB6B 2AJZB 3EYQD 1WS8A 3WOVA 1NPUA 1DBBL 4BKLA 4IU2B 3MCLL 1IBDA 2PETA 2Q76B 4X5QA 1NJ9A 4BK5A 3WTUA 4MKMA 1B0WA 3VX0A 4I85A 4U0QB 4I5BA 1F4YH 4X9GA 4FQHA 2L7QA 5L4MA 3HKFA 1ZT1B 1WDAA 5FLVA 1YSOA 3E80A 3IAPA 4G6KH 4ZTPH 4GKSA 4GBXB 2FUQA 3FU0A 3LSOA 3WD5L 5EBMB 2WBJA 4JDTL 5JLZA 5DQDL 3ZMNA 1RPQA 3GXUB 5CINL 1U2CA 2VDQB 1DEDA 4LASL 4ALAC 4G59C 3QJSB 5E6YA 2ILLA 1I7RA 4JFYA 3R8BB 3SGKC 1EO5A 3K8LA 3N04A 3V0HA 3AXIA 1M3IA 1U3YA 5CEYB 5CBAA 3RVUD 4OLZH 1WTGT 4U1GC 4I88A 2ITDB 4YDLC 1E9PA 3T8XA 3PL6B 3CVDA 5ALBL 3HRPA 3MNVA 1WA2X 5FGBA 3NPSC 4PTTA 1S8DB 2B3RA 3O8XA 3FT4A 1A3LH 2DKSA 3DO3A 5C3IA 2R15A 3LB6C 1GH7A 4AEIL 3HAEB 2HJKB 5DRWA 5FO7A 1XGUB 4F8TA 1JNHA 2XDHA 3MLWL 1INDL 4A55A 5AD0B 3P3SA 2WTRB 1A02N 1E9OA 4GSDH 4DK6A 4HULB 1Z9NA 2VXUL 1C08A 3IDGB 4AMWA 2ZG2A 4U6YB 2VDOH 3IGLA 2ITFA 3TWCL 1CVRA 1K85A 4JPWL 1GYCA 1PZSA 4PY7A 3RGVB 1OCWL 4I77L 1KYFA 1KELH 4XB7A 5CIPA 2X28A 1NUFA 3BSHA 3EW3B 4JN1H 2WXMA 1QKZH 4HXAL 3UYPA 1TPXC 2CPCA 1XQ4A 2GC7C 4JREB 3ARVA 1XZ0B 2PXYA 3BE1L 5J89A 2YC1A 3AWFA 4NOFA 3SKJH 1HT6A 1RVFH 1QYGH 2CALA 3B2PA 5DWUL 2AQQA 4OZFB 3MLSH 5C0RL 2PYEB 1M6OB 2FQEA 4QNPF 2X87A 3A21A 4HCGA 2APSA 1CE1L 4APXB 5GRUL 1S5IH 3B3BA 4NJAH 1IAKB 4YHLH 4NRXB 1CXIA 1K5NB 4NAJA 1IBHA 1H19A 4MQ7A 5J6SA 3EOAA 1IGJB 2OCJA 5EU4A 4AIZB 3QEQA 3V0DA 1N26A 2E7BA 3CFMA 4YSCA 3QZLA 4OV6F 2AZAA 2XIIA 1SRDA 1X4YA 3GZQA 4Z78B 1YG9A 4MJJA 5DD3H 5F3BA 2O5ZH 1GYVA 1DJGA 3MFFB 4PRBB 4XBGB 3I9GL 3EFOB 1OM9A 2XN9D 3V4PL 1E5BA 1FIGH 4G6JL 4LOUD 1U58A 1GGCH 5TDNA 1MCWW 2FHFA 2I9LA 5CUSH 4XOAA 4PSRA 1AGDA 2PR4H 4GKOA 2DKMA 3MRLB 5GRYA 2UWEE 4TPRL 3L5XL 3MGTA 2A4ZA 3L45A 1F4XL 5JHLA 4L8CA 4GXVL 1QYGL 4RBPH 3FO9B 3DX4A 3GMPB 4MAYD 1KIPA 1OB1B 4P4KC 2O5ZL 2FGWH 4JRWA 3I50L 4LLUA 4P2YA 3CDGB 4QRRD 4JDVB 1JXKA 3ZZQA 1QEWB 4Z7WA 3PQYD 1OP5K 2FH6A 3H42L 4R9HA 1IVLA 1FFOA 1TTFA 2J1WA 3VI3E 5KBLA 3OWRA 3ZOAA 3L3GB 4KX7A 3GKWL 1KCUL 3DURB 3RAJH 3SCMA 4MJ2A 3VFRA 3O3EA 1NEPA 2XWXA 3VUAA 4PWHA 3MJ8B 4Z7UF 1NIAA 5F89B 3VTMA 2FYYA 2X2YA 2I60L 3FT2A 4RWHA 3OB0H 4TSAL 3ZTNH 4WI8A 2J8UE 4TUOB 2PF6A 3SGKA 4FAAB 1YY8B 2X4SA 1A22B 3O45B 1SDYA 4KNQA 4CNIA 4PWIA 1JWSB 1IAIL 4C55A 5GRJH 2NYYD 2D7TH 1ZVNA 1XXFC 4XHQA 1YECH 2B08A 4M00A 1Q90A 2QHLA 4Z7UB 2WUBH 3NN8B 4NT6A 2VSCA 5E6ID 1I7TB 2BSBA 1Q1JL 3PE9A 3OJDB 2V8LA 5CBEA 1XF2B 2X4QB 3FU8A 1C1EH 4Y4KB 3UJJL 4DERA 1FL6B 5I8OH 3W56A 4G11A 3H4FA 1BP3B 2BOLA 3STZB 4OM0H 4BXSV 3KDMB 3BPCA 3IU3A 5EORH 5G2NA 3U1SL 1ZGLM 1K8IA 3AACA 1AACA 4Q74A 3V7AE 4OM1L 4YHOL 3SOBL 1SM3L 5JO5A 4H4NA 3O4LB 5DD3L 3UBXG 3ZZLA 3FT1A 2WMPA 1OAYL 4FXGC 5E5UB 4RFOL 5FF6A 5IMKB 1SLVA 2OZ4L 5L6YH 1DBAL 1MW0A 1YEDA 4CBPA 1VESA 2DQIH 1TEFA 2CRIA 2Z34A 3FT3B 3TNMA 1KLUA 2DWEB 4KKAD 4DAGH 1KB5A 3GB7B 5T3ZL 1JV5B 3DX1A 3ME0B 1WZKA 3QUZB 3EBHA 5GGRA 4M5ZL 5D6CB 1G7QA 3W82A 1G87A 4GIOA 5EWIH 5IK3A 4K7PY 1N59B 3FN0H 2NZIA 5LAXB 1RJLB 3ISRA 4XX5A 3BSZH 2YXWA 4HXBL 1CXLA 4JVWA 4WK2B 4UZSA 3VFTA 3I3BA 4JFSA 1BZ7B 4ZUVA 3J27A 1BJ1J 2XWTB 3L4CA 4G8FA 1BD2E 3STLB 3TEUA 1HI6A 3ETTA 2JKIS 1CR9L 4A37A 2RD0A 5E00B 3ES6B 4YZFF 4ORGA 5JQIB 4NSKB 2V6HA 1NOAA 2R69L 4YHPA 5LG6A 2AJUL 4LSRL 1GGCL 1RK0B 3U7WH 3FO1B 4K3DH 1EUTA 2EVHA 2IBZX 3V0AC 1WITA 3ABZA 1NBYB 3KYMB 2I27N 3Q8AA 4HIEB 1VIWA 2YSSA 4YC2C 4RMUA 4PLNC 3LQAH 4XVUD 4IBQA 5F1OB 2B2XH 3ZHLA 4YN3A 1XCWA 1UD6A 2BO0A 3ET9F 3N0PB 2BVTA 3E8UH 3CPLB 1GMIA 5E7FA 1J11A 2FAUA 4JRYA 5I0YA 3KZ8A 4Y1AD 5T1KD 4ZQKA 3BFWA 2CDGB 3BIKB 1JGLH 1NC2A 5CGYC 1CPUA 3CFJB 2F7OA 4X8GA 4LCIL 4NWTL 3CN1A 5ACZA 3GRBA 2AVGA 3MJ9A 2KQNA 1KGWA 2KC0A 4ZMNA 1XIWB 4YNYB 4DP6X 5DQ9B 4XTRD 2XZAH 3FCSB 2M2DA 3D9AL 4CJ0A 4DW2H 5C7XL 1YEHL 1OW0C 3P4OA 4DTGL 4FRWA 3OAYK 2A9NL 1M2VB 3ECUA 4OCRL 2DLEA 4FADA 1DL7L 2P44B 4NHUB 3M17B 2PTTB 5HGHA 2JB5H 4U33A 1BZ9A 3FUIA 3VU1A 4XMTA 4HJJL 4OZ4B 1AO7B 3QFDB 1O6SB 3WKYA 3NSCA 1J0JA 4XBEL 1OANA 2D7TL 4J3TA 4K2UL 4QRQA 5F72S 4YBLC 2BY2A 1N67A 3SDXA 1R6VA 2N1KA 4EI6A 3HHSB 4EDWL 4BK5C 4NDMB 4XOBA 3BUBA 1JPEA 3PXLA 1OGAD 3ZTNL 3BN9D 4RQQB 2B1OA 3UAFA 2NW2A 4LLYB 1E4KC 2E9IA 3LQAL 3C09B 4Y4HD 1D5XB 5D1ZB 1X6LA 1S7UB 2QV4A 3U83A 2X1WL 5DS8A 1T3FA 4IIQB 2QDVA 4XP4L 4PRIB 2KERA 3RKDD 3BWZA 3POHA 5I19H 2IPKB 2JJTC 2K6WA 4L8DB 4MA1C 4BZ1A 2ZWZA 5I82A 4YUEL 2JI2A 2LAAA 2PYEA 4G43B 1VFOA 3ARGC 3G04A 5KSAC 1FGVH 2NRDA 4OFKA 2OQJB 1MJJA 3O9WC 3GXTA 4EBQL 5IB1A 3ABLB 3BE1H 5C0BD 2G9HB 3ETBJ 3UTPD 4MDRA 5MERB 3DXAE 1FNSH 2YQGA 1TNNA 5F7FA 3BRDA 1HEHC 1MCBA 3W57A 1OAQH 2HMID 2B4CH 4N2KA 4Y1SA 1RZ7L 2M1KA 2IQAB 3HE7C 2NXZD 2XYBA 1E7VA 2DI7A 3MV7D 5I8KH 5LB1A 2OTUB 1BQHG 2PP8A 5ADPH 2N7SA 3PG2A 3CMOL 3T6WA 2HRPH 3NEEA 2VO5A 1M42A 2CU9A 3I6LE 3KPMA 3MNZA 4JO8A 3C60B 5E5MB 1PLGH 3D08A 1FYHB 5D2LB 5CU9A 4UUJB 2F08A 3MLYH 4LXFA 3SE8H 3DV6B 1OOWA 5SWQA 4X4YB 5EF1A 1UXSA 3HFMH 4JN2A 4OJEH 3OTTA 5EIQA 5C2BL 3ULUC 1XV8A 3HS0B 2OP4H 3VXTA 4YE4L 3Q13A 2Y1ZA 5I1LB 3WEAA 4G9FB 4U3CA 5G4NA 1KT2B 5CN3A 3AMLA 1PG7L 3H9HA 4UTAH 4OCNC 4YAQB 3K6OA 2FO4B 2XC8A 2ZUUA 4AH2B 3QWQB 4PCYA 2Q6WA 2ADJB 3WFBH 1MRFH 2F68X 3KJ6L 3O2DA 1D5BA 4RMWA 4ZFZB 3TNNA 5BQ7B 1JAEA 5B3JF 5IIEA 3V6OC 4RDQF 4UYPA 1UOWA 3QJFB 5H37G 4ZBJA 3MJ8A 3SD5A 4XWGL 4ELKA 4IU3B 4UOQA 3RX8A 1FC2D 1BD2D 4W9GC 2IALA 4HIPA 5EZLB 3GSRB 3D4YA 1QHQA 5BPPA 1TF4A 4DKFL 1FYTD 1DUZB 4MNHA 4C8XA 4CU6A 4PRPD 2LV4A 3QJUB 3VRIB 4KC3B 4MLIA 3VFPB 1UVQA 3MBWB 2AJXL 2OMYB 5MEOA 4HBCL 5I6MA 3O2WH 4PYHA 4M6OL 1B6UA 1TEYA 3BIBX 3W3BA 3HNSH 5EEZA 3RIFF 3ETBF 3S0PA 4ZG1A 1WD8A 2VJXA 4X8CA 5E8NA 4DPAX 3PAUA 3MUY1 2HXAA 2P8MA 4GS7C 5GRZA 1OSZB 4TSBL 4X6CB 3ZJAA 1C5DA 1MRFL 3WHXB 1HJBC 2ZX5A 4EDXA 5CD5C 2O93L 4PV9B 1H3TA 5D2NB 3SGDI 4Y7MA 1Z9SA 1I3UA 1WEJL 5D5ME 5FYLH 1P4IH 2CMRL 1XL6A 3VXRB 5E1QA 2Z8VC 5T5NF 1ET7A 4HPYH 4MDIA 1TZ8A 4JFEE 4Q2ZB 3B2DC 5CD3B 2NX5D 4FFWD 1BQUA 5CEZD 1I8MB 3NVQA 3KPTA 4AXWB 2QHRH 1IE4A 3LRLA 4R96A 3FOMB 1DBJH 5EU7C 3RUGA 4QD2E 5DYOB 3PWJB 3FL7A 5BS0E 1SOXA 2CUHA 3MLRL 5DUML 5FPIA 4RZKA 3FU5A 3HJEA 5MHSD 3CX2A 3B2MA 4GY4A 4KVPA 4M4RA 4S1RH 1RULL 3ROOA 1PKOA 3TBWA 3U36A 4F93B 3STLA 1L6PA 5L8KB 4GG8A 4UTBL 4JL1A 1R1CA 4O2FB 4L0ZA 1AZNA 4LSSH 1G7LA 2CA3A 1AGBB 1RERA 4HWZA 2CHNA 3P11H 1P5VA 4L2LA 3H3KA 1OP3H 1U8HB 4UQ2A 4V11A 3QIBA 2X1OA 2I24N 3O4OC 2WZ6A 1JGDB 1BJ1H 3S36L 2VSKB 4IRJA 5FDYA 1GZHC 1OAZL 4A7TA 4BSVA 3N06B 1HXMB 3FBQA 4IW4C 2WVUA 3AQYA 1A7PL 3WXVH 4KRLB 4PCSA 5JW3H 2LVCA 3TF7C 1H0DA 3QUML 4NRYA 4GUCA 1E65A 3ZZ1A 3FQNB 5IFJA 5DRZB 1QPXA 4YC2B 1VF5C 4G1MA 1TVHB 3FO0H 4M6OH 4L29B 1BBDL 3CFJA 4WKXA 1VZHA 5C0AD 1A6VH 4F7MA 4GUQA 2QQLH 3V0FA 5ACZB 4WSGA 5GQBA 3QNXB 4UM9B 3KPOB 2JKSA 2XKSA 2XPZA 1XGQB 2CBPA 4NXSA 3SKMA 2AQ2A 1UGNA 4OLWL 4L2YA 3EYFB 5B3JE 3O6FA 1KMGA 2HT3D 1CE6A 4JZJC 5CJOL 3P11L 5FOBA 2ZWYA 5JW4R 4PP2B 2IGFH 3DMMA 4L18A 4K5OA 3NCXA 5EEUA 4NKMA 1EEUA 4YSSA 3I74A 4L23A 3N5AA 1CVSC 1AO7A 2Q0ZX 3QFDA 4UTBH 4X80H 5D8JH 3MLVH 1UEMA 4XPHH 3TFKC 3D87B 2VUOA 2A9NH 3GF8A 5FYJU 3SBWC 5F96L 1FP5A 5FUZL 1A6TB 1AZVA 1IEBA 4JMXA 4MCZA 2OKMA 4JQIL 5F7DB 5T5FL 3AGVA 4NNPH 5JYLA 1BOYA 4KK6D 1CLOL 2XWDA 2C9VA 2AXGA 3CWGA 2PWEA 5KJ4A 1CDGA 3REWA 1P5UB 4XI5C 2X0WA 1SGKA 3JTSB 1CFNB 4FD0A 2CNYA 4LHUD 2JFCA 5IJCC 4L5FH 4JQVC 1NDGA 5DZ9A 4HWBH 2C7UB 2FUTA 3I6KB 2NZ1A 1MCDA 4LSTH 1BJ8A 2R1XA 5KS9A 3EGSB 1IO4C 2SODB 1PD0A 2NNFA 4Y0GA 2Q86B 3CLFL 2YBRA 2YGPA 3OZ9H 2NLJA 3WS3B 1FH5H 2QSTA 1UASA 3PNWB 1I3RA 4EI5C 3BVTA 4LZKA 1QRNA 2OMTA 3DYMA 2EADA 4YEFA 1XD0A 3N2JA 3BOVA 5C0BE 4Z7QB 2H5UA 2CIIB 3MLVL 3MV8E 2G2RB 5T3XH 4K71C 2A2QT 3MRPA 4LLMB 3OD3A 5E2UL 2H2PD 2X44D 2C9PA 1A14H 4NKIL 3NFPA 3WE6B 5KYNA 4KKLC 2GPZA 3W11C 2N7AA 3MNVB 1CIDA 2YO3A 4HLJA 3SKOA 1R3JA 3LZLA 1U8KB 2ICWB 2UV3A 4P2QE 1RAMA 3V9EA 1SLXA 3CZNA 3PDOA 1JGVL 4CN1A 3G5XB 5HYQB 1JXDA 4FI7A 2BRRL 2DW5A 4HT1L 5F1IA 4K7PX 4QLWA 4L8SA 1JE6A 1T1WB 1KELL 1KCKA 2DQFB 3UIYA 1W72B 1WWCA 2VXVL 3UO8B 3ZL4H 5I5RA 3REVA 1S9WA 3FOLA 3ZUNC 5DFTA 3HRZB 4M6AA 1LO3L 1SFHA 2DQHL 1TT6A 3MCYA 2IDSA 3NOIA 43CAB 4X4YA 4YLBA 3FN3A 1N9PA 1JPTL 2BP0A 1KYOK 4JFQA 3BT2H 2E4TA 5K9JH 1CDIA 1SEBA 2XY2A 1HEZA 1WGOA 2O5NA 2NY4D 3HUJE 4LIQE 2KLSA 4WENB 2BFGA 3ZTJG 4NNXB 3CZKA 4GQ9L 1R5IB 3A23A 3TASA 1WYJA 4WO4D 5K9OA 4GG6E 3CU7A 4M62H 3QQNA 1HAUA 3SDCB 4QF1B 4ETQA 4I4WB 4F7CB 5C1MB 4QHMB 5AOMA 4FL4C 2VLMD 4PJHF 4BFIB 3GFUA 5KVEL 4JS7A 4YGAB 1ZT7A 5F7WC 4LAQL 2LLNA 1NIFA 2ICEA 4FXKB 3V0VA 4UYQA 3SDYL 4F1SA 2VQ1B 2HFTA 4XN4A 4DSYA 1C12B 5EB9A 4HG4K 5AB1A 1R3IH 1HWGB 1PAMA 2F1EA 4YBQD 4JO2H 2PLTA 2P5ED 3CX5J 4JFDD 2C7FA 2SEBB 4UT6A 4Y5VA 1CFVH 1PEWA 4HV8B 4N8VG 5AKSA 3V8OA 4ANUA 3NMEA 2EXYD 3Q7JA 3QFGA 1N0LA 4KV5F 4EQ2A 4HFUL 4MD5A 5I1DA 1WWWX 4ZTEA 1NGWB 1UENA 1VFAB 2MPVA 1RZQA 1NBZB 2Z92A 3HLKA 5EOCJ 1F8TH 4E41D 4XNAA 4HQQH 1ADQA 3X11A 3GKWH 3SJVA 5B38B 1D5IL 2VW4A 1E40A 3P0YL 4DESA 5IG7A 2JELL 2HX8A 5EUOE 5EZJB 2FBJH 2WC7A 1D5ZA 3CZLA 4YSQA 3HPLB 4B41A 3P9WB 2CJ3A 2ZSWB 1VFBA 1JF6A 5H37H 4DP0X 2YQ3A 1YRKA 4C57C 4GBXD 1X7SA 3TU6A 4CSPA 2OL3B 1QWNA 4KRPB 1HE8A 3QH3A 4JZNA 1UZ6F 2WXFA 4DO6A 3B1UA 3L1GA 3TV3L 2PWDA 2QV2A 2AXWA 5CILL 3ARGA 4OI7A 5ICXA 5IB2A 1XH2A 2YC1B 4IQHA 4DKEH 1J9CT 4GOSA 2PNDA 1F6LL 2QPEB 5E2UH 3T4YB 2F53A 2IAMB 3TEYA 2QTVA 3QIUB 5FHBL 1G7JB 2CKBL 2VLRD 4ZD3L 2XXMB 2PPFA 5EOCL 1F1DA 1KN2L 1KIUA 2D3VA 1LP9E 1AKJB 3NFSH 1S7SA 2N56A 2FJUB 4FQQB 3BSGA 1E2ZA 2WWKO 8PAZA 3L9EA 1ZLSL 1TTGA 4Y9BA 3WV0A 2Y7NA 3QRGH 5HHNB 4Y4FA 1SXNA 2FJGB 1AJ7L 5ETUB 3GXPA 1UG9A 4CILA 3KW8A 3A0OA 3SY0B 4G7VH 4LPXA 4RISH 5KBDA 4G6AC 4RZCB 4XCYB 4QRSA 1XF4A 2GCYA 1A5FL 3S8GB 5D7KD 4RMSA 3D1MC 4Y8DC 3ZRCC 3OKEA 2GJZB 1VGEL 4GKNB 3WSQL 3PWPD 3HKZA 1SY6H 4L9DA 1EXHA 1TFPA 2ATPA 4QRAA 5EU5B 3SDAA 4HC1A 3BMWA 5DRZA 3SQRA 2ZXBA 4O4YL 4ELMA 5HYSB 3NCCB 3LN5B 3RX9A 1KB5B 3IFLL 3QHZH 1AIFB 1GHFL 3ME0A 3BMVA 4HJSA 5IVNA 2NSXA 1JN6B 1W8NA 5EOQH 4X6DF 1NUNB 4CVXA 4UM9A 3BKYH 2UY7A 3US0A 2IO5A 1KB9J 3ZHKA 4UMGA 1LE9B 1CFSA 1J1PL 2YKLH 1X7QB 2JK5B 4UCFA 2RQEA 3HB3B 3RWJA 3JYBA 1RHHA 3H1ZA 5DC0A 5DJYB 4G7YH 6FABH 4WFHE 1JZ6A 4F9LA 5F7KC 1ZT1A 4NUJB 1ZA6B 4XNMB 3RG1C 3EADA 1BYPA 2ZWNA 1ZRUA 3QUXC 2MPAH 5I71C 3H55A 4XMWA 1KCBA 4X6DB 4APQD 2EUWA 5LCVH 3BQUC 1R33A 3HG0A 4RETB 1KBWA 1TCRA 2I7SA 3MJ9H 4Z18A 2FNBA 2VXQL 3TYFA 4YFEA 1DJYA 2OJZH 5DJXA 1KBGH 1R3HB 3MXWH 4KNTA 3EO1B 4K94C 3ESUF 5CXPA 5KW9L 1P9MA 2X6AA 1U93B 3A6CL 1OCZB 1NBVL 3CZEA 1ZS2A 3CSFA 2COVD 3MLWH 3UGXA 2DQDL 3T3PB 1U8CA 3KPRD 5D1XB 5I1KL 1AHMA 1KCVH 3GBNL 4PRPE 1MNNA 3B9VA 1EAPB 5MEND 5ERWB 1T1YA 3HZYA 2PW1A 2W95A 3QCVH 5DJ8B 2C9QA 3FB8A 4XO8A 5EU6E 1RK7A 3ALPA 4W9CC 4H8WL 3V5DB 4A2EA 5T1DL 1HH9B 2R4SL 1W8OA 3VD7A 1BXVA 3AQDA 5FIEA 4UU9A 1JPST 4IBLT 2JLPA 4ANWA 1E8XA 3T0BA 4IHOA 3DV4A 3SGEH 3UTSD 4NZTL 5F6HJ 4ODVH 3INUL 6TAAA 4Q0XL 1E8ZA 2EVGA 3RURA 4QUOA 5INCB 1M7IB 1EHXA 3WUWB 3VXUD 3ARBA 4AV0A 4PBVC 2KH2B 1YNLH 4NGHH 3AREB 4LASH 4OFDA 5IF0A 4FTVD 1KBVA 3MPCA 5E2WH 5KZCB 3L5WB 4H2CA 2XI9A 3L1OL 3QUYA 4KQ4L 4KRMB 4L8SB 2EH8L 5D2LF 1UB5B 2X89A 3B9KC 3RE0A 2YEZB 4D0CA 4E9TA 2R7EB 5KVMC 4I9WE 3GTVA 5FW6A 1IM3D 3VGEA 3D39D 2OYKA 4ZMZA 4R7LA 5A7EA 5IB5B 5B7EA 3MRDA 4OIIL 3RZCC 5TGBB 5I1HL 4ZFGL 2W0LA 3S88H 4PGBB 1GS7A 1M4KA 3B37A 5BMFL 1PZ2A 1PX4A 1SLUA 4KKZA 5FB8B 1E5UI 3QCUL 4P5RA 1XHHA 2WSDA 1QHOA 4AW4A 1DDHA 2J6WA 3X3FH 1ADWA 1GJUA 3F7PC 3GBDA 3GTNA 1D6EA 1QW8A 2AXHA 1DQJA 3DRTA 4XAKE 3T0EE 2JI3A 1R24A 3ARTA 3RVTC 2A6DA 4C4KT 3MMEB 4HVBA 1QBML 3D3VB 4OZHB 2X4TA 4JKLA 2HRGA 4CA4A 1ZOXA 3DRQB 4G6ML 4W70A 3VWKA 1MHEB 2H8PA 1TVBA 3V7AG 4JREC 2VQ1A 4JRYD 5TFSH 4OY9A 4FCHA 1SDAB 1A3QA 4NX0A 4JKWA 1LEGB 5FGCB 1QWUA 1JMZA 5JPMC 3VD2A 4OFIA 3ZY7A 3FRUA 2YN3A 3MYZA 3QUXA 4Z77A 3O3EB 2WN2A 2VDLH 3KPPB 5C9JA 3LKOA 3TN0D 1WFUA 4WI5A 4NP4L 4BRVA 4DKAA 1V8HA 3FFCE 1SYSB 1OAUL 4NQUA 2TRHA 3LKRB 3Q8FA 3VXTB 3BJLA 3AXLA 1SLWA 4RH4A 3ZDXE 3QNZA 4DIXA 2HMIC 4FQJL 4FYRA 1DQQB 1BEXA 2BOCB 1A14L 2KHAA 5AOLA 5EZJA 4BDVB 2BSEA 4WUUA 3PJNA 4ZFFB 2CUMA 5DTFB 1VFBB 4ZMAT 1G7HA 4P9ML 3A4DA 5D70H 4L1BA 3MFGB 1WICA 2HWZH 4OZGF 1BX2B 5AW3B 2A5UA 4IKNA 3RWCA 3UTZA 1I7UA 5ID0B 4TVPH 5H4ZA 4N8PA 2UWEA 3LX9A 4TVSa 4XMUA 5F44A 3JV0A 3QZOA 4ZNCD 4XCEA 3PL6D 2IALB 3AG2B 2IPKA 3RWDB 5F21B 1HE7A 3KR3H 4JHVA 5ICYB 4E0RB 5GGSA 2B20A 5EO0A 2R0ZL 3C9NB 5C0EB 1ZHKB 2JJWA 3IFNL 4Y4HC 2K4AA 3RPIA 4WNQB 5CGBA 4MBOA 1F3JA 4JPKH 4W6XB 5B3NA 3DK2A 4JR9H 1AZBA 2IG2L 2ZXEB 4Z7QF 2QADD 4DVRL 5CZRA 4O58H 1Z5HA 3KL5A 5L2KE 2EUZA 1S46A 3QUZA 3NA9L 4MS6A 1EFXB 4WGWB 1E90A 1QI4A 2D31A 3K4DA 1NCCL 4X9YA 2BY3A 3EYVB 4P49A 5AFAA 3KYAA 1FO0B 5FS5A 2JIXA 3GMRA 2QEJA 2WXQA 4W9KC 1CDJA 1NCUA 3T1FB 4WJG3 3SDCC 1XD1A 1XGYH 1ORQA 1HI6B 5HYJE 4MCNA 1QRKA 1CC3A 4V33A 1FGVL 4MDIB 3HS9A 4J8QA 4TS6A 3JSSA 5C8JB 2HKFL 4NBYB 5AW1B 4Z0XA 7TAAA 3VFUB 3WS6C 1RSFA 3HE6D 4YGVA 3T6VA 4PRHA 4CVXB 2IPTL 3A47A 1JHKH 5H35B 2Y7LA 1HL8A 3WMQA 4LVOC 4GMSH 4JFPB 4ZO9A 1U8NA 4TNEA 1SJMA 3ZT6A 1B0GA 3VTTA 3ARFD 1QFWM 1NAMH 2VSDA 2WANA 4M4RB 3QEQE 4Y4KD 4N1HB 3EFFA 4Y9CA 1E6OH 3AM8C 2B59B 2Q5BA 3ILPA 4NLAA 4N2MA 4U1IB 5JHLH 2EIEA 3IJHB 1QZNA 1AS7A 4X5WB 4N0FA 2F8XC 2J44A 1RSYA 4B9YA 2O5YL 3LNDA 4KXZI 2HT2C 4Y5VC 1I1AA 2WB1A 3G5ZB 4OCSH 3IT8D 2P45B 3GSOA 3BZEA 2IDFA 2BSED 3NPSB 1J05B 4AENB 5GZOA 3IJEB 1LD9A 2MCAA 3S35L 3OLIA 4G8GD 1M2VA 2W80C 3FN9A 3IKCA 4I48B 3BKMH 2H0FA 2IH1B 3IFOB 5D5MA 1X9UA 3N40F 1U8CB 5D1XA 2EE3A 4W93A 4PWGA 4M8UA 1OM3L 3NRFA 3GSNH 3UBXA 3C6LD 3KJ6H 3JZYA 4I0PB 4W9JC 2IAAC 4XR8C 2XTJC 4W6WB 1F4YL 5D72H 5HYJA 2P5EB 3EHBD 4GRWB 5FHAL 3QXAB 4EF3A 4YHZH 4MNGB 5JMOC 4OD3L 1YDPB 4EDXB 5D1ZI 4KHXL 2GSMB 3CVHL 3IWUA 5AVYB 2ED8A 2NNAA 2VLKB 3DSFL 3FS9A 4ZSOE 4O00A 5IUSA 4OF8A 5CP7B 1FFPB 4N6QA 4U05A 4KKNA 3ELAT 3WUWA 4BK4A 2FJHB 4F5CA 1MZYA 2EDQA 4E41B 1W80A 3J8F7 3H42H 2WAHA 5J4MA 1JG9A 5HSFA 1TO4A 4FEIA 4GRMA 4M7ZC 4NKDB 1MCHA 2DLTA 4WUUD 5EBMA 2AC0A 3G6JA 5TDOA 5GGRY 4M6NL 3FOMA 3FFCD 1JPGB 1FFNB 5JIMA 3NRQA 4J3OH 3IDJB 4BZYA 4IIQC 2D7PA 3PP4L 4FNUA 3IDXH 4RGMB 4AQZA 3B6SB 5B7MA 1HDMB 5CBAB 2QMKA 3MV9B 3RVVC 3ORJA 1WJ3A 2ESVD 2E46A 2HLAB 4Y4FC 1E9PB 5FGRA 5DGQA 2EH8H 4CDGC 5SWZA 3FU9A 4QJ4B 3FQXB 1PVHA 1N2RB 3IBOA 1T0NB 2NDGA 5HY9A 3C12A 4Z7OE 4WQOA 3TZVA 5FYKU 1BFVH 4Z7VA 4PIBA 4X4XA 2RQ8A 4QJ5B 3FQTB 1NUGA 4AJ0A 2X4PA 2X89D 5E2TL 1QRNB 1YMMA 1BVZA 3TFBA 2CA4A 3BYTA 4G42B 3B5HA 3GM8A 4X50A 4UUJA 5BV7H 3LMJH 1U92B 4ZPVB 5I17B 1IQWH 1VGKB 4XP4H 4WSJA 3C5ZD 4ZYKB 2X0UA 5AKTA 3PPEA 4DUVA 1ET8A 3FMGL 5L8JB 3MCKB 2R0KL 1OK0A 2X70A 4KPHH 5BRZB 4GEJA 4KZEL 5EOTB 1S5IL 3D06A 2WGXA 3IETA 4N8VB 1L9TA 4D9QD 1AG6A 1DE4A 4WU5A 1I1AD 1TCMA 1AP2B 5E4IA 1OF0A 1BQHB 1RHFA 1OGAB 4XMKL 3CZSA 1VZIA 4KDTC 5DEFB 2UVFA 4BE5A 5I1AA 3BVWA 3LN4A 2X2HA 4PGJA 3G6DH 4AH2A 2R8SL 3CBRA 2MWCA 4AJYV 3ARDA 1EVUA 2QGBA 4NM4H 5BS0A 1UXMA 1U8QB 5I1GH 3B7TA 2MQ0A 3HC3H 2AZUA 3BUQA 1QR1A 5C9JB 5IBUB 1OT4A 3DMMB 2AMGA 3S36H 1M2OA 3TWCH 4ELKB 1AC6A 4Q6IB 2ADGB 4Z3GA 1SEBB 4MTMA 3LKRA 3RJQB 3O6FC 1KN2H 4FFYA 5GS1A 1P84K 3B56A 2NQ3A 1BECA 4YPGB 2K7QA 1O9VA 3TBVB 1OTTD 4OJDH 5F7DA 3P54A 2WXLA 4JFWA 2GBVA 1B3JA 2TAAA 3QQ4A 4HJGB 5LN4A 4TQIA 1U58B 4L3CB 2ZCHH 3RJOA 4F7EB 1OQXA 1I7UB 4FFWC 4QRFA 4AMKH 2IDTA 1A6AA 3J2PA 4ERSL 3CXHK 4Z7VF 2NY3B 4KO5A 1YEGL 3EBAA 5IJVB 4PVLA 5C71A 1M05B 1SPDA 3CIQA 4GS7B 3DBSA 2PPCA 4HWBA 3APMA 2DQMA 4GYBA 1QPPA 3S37H 3AJ7A 3SPJA 2H9GA 5ISZA 3GUTB 3Q9QA 4Q8BA 3EYSH 1Z9SB 2PCYA 4M1GL 3HVNA 1BZEA 1J86A 2VR3A 1JSYA 1MELA 1KCRL 1Q94B 2J1YA 3DETC 3QQDB 4HSCX 4L4TE 4RFNB 4Z0BH 4FABH 3I75A 2R1YA 2ROYA 5DHVA 5JR1H 5DWUH 1AXSB 5AAPA 3WTXA 3HG1B 1QABA 2JE8A 2CGRH 2WZAA 4FQIH 2CRZA 1DLFH 3FCBA 4LP5A 4YK4B 2X4OB 2N01B 2Y4SA 3RVTD 2V17L 4MX7B 2Q8BH 5ALCH 4K7PH 4ODTH 4AL8L 3IJYA 1MCFA 2C4XA 3MYJB 4D0BA 1RUAL 1MCPH 4JKNA 2BIHA 2X9WA 3KAAA 4KJQC 3EO0A 3QUMA 1MFEH 4JEGB 1JCVA 3UTSB 4GI6A 5DJ6B 1JWSA 1Y6NR 2DQIL 2H2PC 3EYOA 3FKUS 2H3NA 1BFSA 2QPFA 2OMZA 4WHTA 1GPOH 2J7LA 5EU6A 2IJ0C 4X6EA 4P5TB 3UJTH 3PDGA 3UZEA 2WLKA 43C9A 1FYTB 2V5MA 2A99A 1HNGA 5C0NC 3LKSB 4PRHB 5IR1B 2EVJA 3JWNC 5DU7A 3NJLA 4GXVH 5GZND 1M53A 3W39A 5EU3A 2IAMA 3EGXA 1BYNA 1AIZA 3BPNC 3T4AB 1KB5L 4HS3A 4KK8D 3D39B 1KG0A 5MI0C 4AT6A 1JGIA 2YXMA 3TIDA 1MKFA 2I5YL 1HXYA 4D9LL 1MREH 3WDJA 3N85H 3PWVB 1KDJA 1H0DB 4NFDA 4PRDA 2DJ4A 1OE2A 2PO6B 2VXVH 5HGAB 1ORSA 1ROCA 1WPCA 4G1MB 2EICA 4GBXC 4MRBA 2ESVE 5J9PB 3INUH 4AX3A 3N1MC 1UJTA 2VM9A 5CEXA 4K4KA 1TZIA 3QDGE 4X6CF 3DXAA 4F8QA 3V7MA 5IK3B 1MF2L 3DX3A 3HFML 3L4YA 1SZNA 4KJPD 2Z6FA 5IQ7H 3MNWB 1DDTA 3VXSA 2K70A 2Y7MA 1OSPH 3HC4H 1ET5A 5I66A 3ZL2A 3FZUC 4FNSA 2EDEA 3GEWB 2J6EA 4GAGH 4LLQB 1UXWB 3DI3B 5JIDA 4ZX6A 3CMOH 1X5FA 3NSXA 2VN7A 1GZHA 4MAYB 1IGML 5F7LB 4YVNA 3TBBA 2XWZA 1AIFA 4NC2B 1I1FB 2DZEA 1BVKB 3CFKB 1ZHNB 1I4FA 2Z0BA 1OSPL 7FABL 1TKWA 3S34L 4GT0A 3MRMB 3RWJB 4XNDA 1PY9A 1I82A 5HVWA 4RAVA 2JKLA 5FO2A 2EDDA 3H9SE 5BVJB 4PMFA 3TN0B 4MXWH 1MXDA 1QUPA 2J1KA 4P46B 4KVCL 1MCCA 3GSQB 1SHWA 5HHPB 3VFWB 1KNOA 4OF7A 1AQHA 5C07B 4JY5H 2XV0A 1JHTB 2C3XA 3I6GA 4ZDHA 3WFBL 5B39B 1JPGA 2A77L 3KLHD 2V5TA 3EUDA 3MGOA 5EULV 2X1PA 1IGYB 3H53A 4I3SH 5HI3D 1Q1JH 2P5EE 4GRWE 4LCYB 4NYLA 1ES0A 2A83A 4FLSA 4OJFL 4Q6YA 1P6AB 4YNYA 3R7RA 5C0AE 3CG8A 3EXLA 2J43A 2NY1D 1KIUB 1TNMA 2FGZA 4X2UA 1BVLA 5LGHH 2EDOA 1IBYA 2CLZB 4PBDA 4XNZC 4AEFA 1NMBH 4CRPA 4G2AA 4B6ZA 4F80A 2F1AA 3VXRD 3VNYA 1BMWA 1JUFB 2DS4A 4E41E 4PWKA 4BGDA 3GZPA 4JFFB 4L4TA 2V4LA 2ZOLA 3IJSA 5F9WB 2MNUA 4PWEA 5GJTL 1HH6B 2DQEL 5GZNA 3LKQB 3AZUA 3S5LG 4OTXH 5L88L 3M7OA 3PL6C 3RP1A 5F88A 2GI7A 4YDLB 4M1CC 4OGYL 2ZPKH 3T2QA 2OR9H 4HJ0D 4FQXD 4LCCB 4NQXA 4TL5A 1HC1A 1DYZA 4JFQB 4LFHD 4WFEE 4JG9A 5D1ZA 5E7BA 4YSOA 1X5ZA 4YBQC 5IB3B 5I5JA 4ZS6C 4LU5H 4B9CA 5JTWA 1KXVA 1OCCB 3HAEH 4IJTA 5TDPA 5DUPL 3KBHE 4OKVA 1HN1A 3CVBA 4NC1C 3U9PH 3QQ9C 2TRYA 5DEFA 2H1XA 3CFBB 5A1AA 1GGBH 2W9DL 4MMXA 4N22A 1GOGA 3MRKB 4BXVA 3WTVA 5BS0B 1BF8A 4G1EA 5C0DB 4HDIB 1JZ7A 5T5FH 2NCEA 2FX7H 3RIKA 4BQ9A 3L2LA 3NCJH 2XWCA 4ZFOB 3UG4A 4WDIB 4LPVA 2CKBA 3H2QA 3QS3A 1YAZA 2R29A 1D5IH 3K74B 1I1YB 5EC1B 1SQMA 1SMOA 5EIIG 5GGVY 3S48A 1G0DA 4RRPA 1UWEL 1XGPA 1IL1A 3QE5A 1A47A 3EJRA 1ZLVH 2F8OA 4IBVA 5JDSB 1I8IA 1WG3A 2FJFA 5E5MA 2C1OB 4FKEA 3VWKC 2YEVB 4H1LG 2ZUSA 2YXVA 1CDCA 3M8OL 1T4WA 3CC1A 3HUJA 1IAII 1D5MB 4FA7B 1HHHA 5J11B 4PJ8A 5HHVL 1QQDA 3KXFB 5J12B 1DBML 1QSEB 2VDLB 2BLFA 3OV6A 4FYQA 4MNQD 4BZ1H 4J5VA 1B4TA 2ZAGA 2ZPKL 5I1JH 3GBEA 2XQBL 3IDXL 4A2LA 3RWIB 4QHNB 3QB7C 3Q8EA 4X7TA 3IFPA 5I16A 1YPZB 5IEHB 2OW6A 4OCMC 4CSSA 4DTGH 5B38A 3HB3D 2NYZA 2XN9E 4C4BA 2A9AA 4P4RB 2H9GB 4LSPH 3OMIB 2VMCA 5GJSL 1B4JH 3UC2A 4X6FA 4IOFC 3GK8L 1KUMA 3NP4A 1CGSL 2FWLB 4RVBA 4HYTB 2EYRA 3BUYA 2JXMA 4DJMA 3JWDL 3IU4H 3O41A 2IXQB 3D25B 3IF1A 4G80B 4Z8FH 4FYTA 1S7VB 4EAEA 4YH6A 4CMMB 3M6DA 1RIVL 4GQPH 1OAKL 1QA9B 2C3GA 1FJ1B 1XR9A 3JWDC 2HJLB 1UURA 2XUWA 2D8KA 1RIUL 4PJGB 5D1QA 4U0RB 5SWSA 4BFRA 4ZW5A 1ND0B 2EVIA 2VLJA 3IS0X 3P02A 3BPLB 4YOKA 4HKBA 5DHYB 1UWFA 4ODXB 3QUMB 3BH9A 1CF8H 2NUTA 1XMWA 3QJHA 1UM5H 5LAPA 5DK2A 3EOTL 1TFHA 2H3NB 1E9OB 3IGKA 2XKNA 4LBEA 1H3PH 1ASPA 2DJUA 3C6LC 3QZWG 4NRZA 4FQQA 3CLEL 3DBXA 5LBSL 2N3JA 3VMPA 5ID0A 5KS9E 5HHQB 5F96H 3MUJA 5I9QC 1MNUL 5CZXD 1UOVA 4DVBB 4Y4HA 2KLRA 2NSQA 3EBIA 3D52A 1YMMD 4X6BA 5GGTH 1KXTA 1F11A 4TVUA 3ARRA 5L0QB 1YN7B 1K6QL 3PIQB 1A9EB 5HXMA 2Z7ZA 4P23C 1TG8A 4KI5E 3G7TA 4RDBA 2MCMA 2ZKWA 3CK0H 3BWAB 5EC2B 3S96B 3VGAB 4EIZC 2R9HD 4NS0A 3UP6A 1IFHL 1K9TA 2NSMA 3EJQA 5J0BA 1FPTL 3DGCR 4PJCF 4Z8FL 1HIMH 2BSDA 3EJYC 3D0LB 1S3KL 4KY1H 1OAYH 1HQ4B 2GI0A 4QR7A 3V0GA 4ZD3H 2AQNA 1U91B 2BP3A 3X3GL 2MQGA 4LF3B 4CDHA 4OJYA 1NAMA 1S78C 2YGVA 3AVEA 4XN7A 5F9WC 3W0WE 1VFMA 3L17A 3VXMA 4PGCB 3EH4B 5FC9A 4XPFH 1P1ZB 2E9GA 3ZBMA 3GLEA 1T89C 3NEOA 3OF6A 2AV7A 3U6XA 1B4RA 5JPMA 4M1GH 1OGTB 1P5VB 3HFFA 2J55A 3O3DA 3AXLB 1U3ZA 2E9JA 2VLRB 1BYOA 1DBKL 4J28A 5E56A 5EN2A 1U8PA 1DQQA 1UD5A 5I28A 4QXGL 3Q06A 2NT1A 4EIGB 1S6NA 1RLWA 1T7WA 1BXUA 1YEJL 1IFHH 1OZUA 3WKQA 3H2WA 1UEYA 3LXBA 4UF7C 1KENH 4X83A 5FUOH 1JK9A 3SCMB 4L9LA 3VCLA 4CAGA 1A6ZB 4XT1C 3L16A 3MA7A 2NUPB 4M02A 4JUTA 2ARJQ 3P3YA 4E9VA 1G9EA 4YHIB 3B2UD 1BD2B 5B39A 3TN0C 1ESOA 2R29H 3QRGL 3SSGA 4EVNB 4OLUL 1I7RB 1MNUH 4JFYB 4WW2B 2GG1A 1UCBH 2EIZA 1D7FA 3MLUH 4HIXH 1LDPH 2WXNA 2BHUA 4KGJA 1EHLH 4H8UA 1MJ7H 3C87A 1LE5B 1NMAL 4Z1PA 1G0YR 2ZNXA 1KJMB 5D7EA 1TJGH 4JCLA 4NKMB 5AYTA 1CL7H 1CF8L 2D3LA 4PGZA 3FT4B 4BUQA 3HCVB 3HS8A 4HEPG 4Y4KA 3VDAA 1N6QL 3UYRH