1NIDA

The structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
333
structure length
333
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title The structure of copper-nitrite reductase from Achromobacter cycloclastes at five pH values, with NO2- bound and with type II copper depleted.
pubmed doi rcsb
molecule tags Oxidoreductase (nitric oxide(a))
total genus 88
structure length 333
sequence length 333
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nidA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nidA02
1PLAA 3WKQA 5TK4A 3PXLA 3CZUB 3V9EA 2EILB 5I5JA 3BQVA 1JZGA 4M3HA 4HCGA 2VN3A 5B7FA 5B1JA 1CC3A 1BEXA 1KV7A 2VSKB 2W8CA 1M57B 5B7EA 3WG7B 1JVLA 4BXSV 3GXUB 4G70B 2DYRB 2IDFA 1CYXA 3OD3A 4HCIA 1MZZA 1I53A 5B1KA 3DKHA 2BZ7A 1RKRA 1XMEB 4NERA 1AZRA 1SFDA 3FU8A 1DYZA 4E9TA 3HEIB 1OCOB 2IDQA 1WA1X 1W6WA 1AS6A 1BYOA 2PPAA 3DIVA 4BWWA 3UABA 2DY2A 5I6MA 3IE9A 2J57A 3UGEA 2PCFA 2H5UA 2AFNA 3CVDA 3NT0A 1CUOA 4A2HA 1SHWA 3X1BA 2BZCA 2IAAC 4E9RA 1TEGA 2GHZA 2J5WA 1JXGA 1NDTA 1ZDQA 3U25A 3OMIB 2FT7A 1E30A 2P80D 1GYCA 1AZCA 2DV6A 3CDZA 3FPXA 3ZIYA 4A2FA 4QLWA 1JZJA 1NPJA 4KNUA 4P5SA 3NP3A 1AG6A 3QJVB 4AKQA 4AKPA 5LDUA 1A65A 3FQ2A 5D4JA 4BWTA 3WI9A 4E9QA 1AZNA 1NIEA 4NAJA 4PCYA 5IY5B 1GR7A 2AZUA 3G5WA 2VMJA 3FU7B 3NJHA 4W1TA 3H4FA 2VW7A 2HRHA 3S8FB 1GS8A 3DTUB 3ZDWA 1J9SA 1DZ0A 4YSTA 1AS8A 1BQRA 4KO5A 4AKOA 1ZIAA 1N68A 4CSPA 5I28A 2J56A 3PLYA 2MRYA 1T5KA 5I5MA 2WO2B 4TXVB 1OE1A 2UXVA 2EINB 5A7EA 4KO9A 3FQYA 1AACA 3NJKA 4BDVB 3EH5B 1ILSA 2BW4A 2PLTA 2PPCA 3NJJA 2X87A 2BP8A 3H4HA 3FYIB 1NIFA 2EIJB 1W6LA 5AFAA 5AKRA 3SBRA 2PP9A 2YQBA 1M9WA 2CALA 4YSPA 2AVFA 2FQDA 1MDAA 1OCRB 1SF3A 1J9QA 2GIMA 2UX7A 4P5RA 1SF5A 3NP4A 1IUZA 1RZQA 2VM4A 2EIKB 1KGYE 2JXMA 3T6WA 1CURA 4JHUA 1CYWA 2HX9A 3T6XA 1ZV2A 4L0PB 1IKOP 5I6OA 1WAEA 3FSAA 1VLXA 6PAZA 7PCYA 5B1AB 1HAWA 2XUWA 1NICA 1X9UA 3QJRB 2B3IA 3SBPA 5ANHA 2GB2A 2XVBA 4KOBA 1BQKA 4A68A 2YAMA 2BWDA 1E5ZA 3FSZA 2YAPA 1L9RA 2FNWA 4WKXA 2FTAA 2RACA 1NIAA 1ET8A 4E9SA 2B08A 5PAZA 4AZUA 1JOIA 1TEFA 1JVOA 3WNJA 1NZRA 2PP8A 4UANA 1SFHA 1M56B 2IDUA 1NPNA 3FSWA 1GS6X 2VW6A 2XWZA 1KDIA 1WS7A 4A2EA 3HB3B 3GYRA 6PCYA 3OM3B 2BWIA 5AZUA 1BXVA 1V54B 1J9RA 8PAZA 1GY1A 1NIBA 5B3SB 2Y69B 2XXFA 5D4IA 1JZIA 3NJNA 1V55B 1GSKA 2PCYA 3KW8A 2Y1AA 3N2JA 4N8UA 1J5DA 2IH9A 1ZIBA 2R7EB 1PLCA 4YSEA 4DPCX 2VW4A 1KYAA 1OE3A 1WS8A 3OMNB 4F2EA 2H3XC 3MX0B 4A2GA 2YAHA 3PAVA 2WSDA 2XV3A 4MFHA 3MBWB 3CG8A 1PZBA 3T9WA 3X1GA 1HAUA 1RCYA 1PZAA 1JXDA 3EH3B 1BAWA 2GSMB 3NJFA 3NSDA 2W88A 1AQ8A 1BQ5A 2XX1A 2YXVA 2BP0B 1MZYA 4JKNA 3S3BB 1BXAA 2HXAA 1NIDA 4YVUA 3ASNB 2MTAA 1GS7A 2PPFA 1NINA 4KO7A 4FA7B 2TSAA 1BXUA 1ETJA 4G71B 3UAEA 2FQEA 2I85A 2NRDA 1WA0X 1TU2A 3ABGA 3WNIA 3NJLA 4W9ZA 2CUAA 5I6LA 1R1CA 1SNRA 1AANA 5B7MA 1AZBA 2XXGA 4HHWA 1YLBB 1IBZA 1SJMA 1J9TA 3T6ZA 2VSMB 1KCBA 1L9TA 2XYBA 3GDCA 2FQGA 2QDWA 3RYMA 4DP9X 1L9OA 2YAQA 2GI0A 1A8ZA 3EF4A 1MG3C 3TASA 1KCWA 3AG2B 4G72B 2JKWA 2PPEA 3KW7A 2H47C 4DPAX 4GYBA 4F7KA 4YSOA 3AY2A 5B1BB 3ABMB 4NB7A 3H56A 4CSZA 1JZFA 2GBAA 2QPEB 1AZUA 2VM3A 4E9VA 1EZLA 2WO3B 1QHQA 4YL4A 2QPDB 3ERXA 3FT0A 3FQ1A 4YSSA 1ET7A 1PAZA 3QPKA 2X88A 2QT6A 1ADWA 4WTQA 3WKPA 1OCZB 4G7SB 1NWOA 4DP1X 4RH4A 2I7OA 3IN2A 3ZX1A 1E5YA 4QKTA 2YXWA 3IBOA 3ZBMA 5E9NA 3ASOB 4HIPA 4FAAB 3X2QB 4DP6X 2AANA 1V10A 2GC4C 4YSDA 4KOCA 4E9WA 4YVNA 3OQRA 1FA4A 2YARA 2BW5A 2QDVA 1AS7A 4YSAA 2FWLB 2HX7A 3NSFA 2CBPA 2LLNA 3CDZB 5FC9A 3FPYA 3FU7A 4GY4A 4DP0X 1IBYA 2XV2A 3AW5A 4AX3A 4HHGA 5I26A 1SDDA 1TKWA 4DP5X 4F2FA 9PCYA 4HZ1A 1OE2A 3N55A 2BHFA 3AG1B 1FWXA 4ZK8A 3NJIA 2UXGA 5D4HA 1E67A 4BK5C 3NSCA 4A67A 4BDVA 3EHBB 2PPDA 3EH4B 1AAJA 1E65A 1JZHA 4N4YB 3QJTB 4UF7C 2DYSB 2ZWNA 1OOWA 5I6KA 2IDTA 1AIZA 1N70A 3IN0A 4YSQA 1QLEB 1PZCA 1PCSA 1JERA 3SBQA 1PY0A 1ZPUA 1B3IA 2BP8B 1SHXA 2HZHA 3X1FA 1ZDSA 1HFUA 2XLLA 1ASPA 1WA2X 1J5CA 3UADA 4Q89A 2IWKA 3AG3B 4Q8BA 3TBBA 3T6VA 1OF0A 2FT8A 3ABKB 1KBWA 1KBVA 2BO0A 1GW0A 1GY2A 2EIMB 4G7QB 3JTBA 2CJ3A 3PCYA 4DP8X 2Q5BA 1MG2C 3FS9A 4KNTA 3WIAA 1AOZA 3ABLB 2UXFA 1FFTB 3JT2A 4PAZA 4GP5B 1JXFA 1A3ZA 2CAKA 1OV8A 2N0MA 1PNDA 3NJMA 1AR1B 4DP7X 2OJ1A 4K9JA 5PCYA 5I5IA 4BWUA 4DPBX 3T71A 1UATA 3S3CB 2TSBA 2IWEA 2ZONA 3PAZA 2AZAA 4KO6A 2IH8A 5EHFA 3AG4B 3IEAA 3CVCA 4GP4B 2UXTA 7PAZA 2XX0A 2YAFA 3CVBA 2DWSA 4E9YA 5F7AA 4HAKA 3X1NA 1L9SA 5I6PA 4YSCA 2IDSA 4X4KA 2J55A 2HLEB 1PLBA 1NTDA 5I6NA 1SDDB 2E86A 1A4BA 3UAAA 1ILUA 5F7BA 3QJQB 3QQXA 1X9RA 2XV0A 5B1JC 1URIA 1KDJA 1RZPA 2P80A 2R7EA 1XB6A 1IC0A 3AZUA 3SQRA 3S8GB 3FU9A 2UX6A 4JHVA 2OV0A 1XB3A 4EF3A 4GXFA 1A4AA 2OCCB 4G7RB 4ENZA 1AG0A 4E9XA 4KNSA 4AI7A 4A66A 4GP8B 2CCWA 4HCFA 2I7SA 3NYKA 3PPSA 2BP0A 4YSUA 2XU9A 2ZOOA 2HRGA 4DP2X 1BYPA 1PNCA 2YAOA 3FYEB 1PMYA 3UACA 3PAUA 2FQFA 1ID2A 3BVDB 4YSRA 2DWTA 4M4RB 4UAHA 3QJSB 2GC7C 2IWFA 4HALA 1W8EA 1PF3A 4A2DA 3V9CA 3S3DB 2A3TA 3X1EA 3FSVA 2FJSA 1NWPA 1JZEA 1ET5A 2YAEA 3C75A 3NJGA 3TU6A 1ASQA 3L45A 1L9PA 3OMAB 3TBCA 4BXVA 2JFCA 3NSYA 2HX8A 1ASOA 2Q9OA 2PP7A 1XB8A 1QNIA 3D12B 3QJUB 1F56A 1A4CA 1L9QA 1OCCB 2ZXWB 2FT6A 4DP4X 3TA4D 5TK2A 1EHKB
chains in the Genus database with same CATH superfamily
3OAWA 5KVDE 5T1JA 2O4EA 3OX8A 5A6MA 1Y1DA 1LHZA 1SN2A 3BKYL 3TTSA 2JB6B 3GHEH 5DI8A 2EZ0C 3CFBB 4OZHE 4CNIA 1HL4A 5MEOB 1NCTA 1RMFH 1NGPL 4GMSH 4GW1A 1ZS8A 1L0YA 1PS3A 3OD3A 4Y5VC 5JIPA 1DQML 3CXFA 3N0PB 2FEEI 3GSNB 3P11L 3WL9B 1M71A 3IFNL 5ABZA 1FSKB 1DJSA 3HEIB 1JNNL 2R4SH 3MV9E 2EDHA 1MFCH 3IE9A 3GMQA 1T7YA 1J0IA 3QIBA 5D1XC 4GAAA 5EO0A 3ZOAA 4U1SA 2E4TA 4A2HA 2FJHB 2WTRA 1JF1B 4N0YL 5GGUB 3UP1A 2CR0A 3NABL 3PWUB 1G7LB 4FI8A 4IHBA 4HUKB 2XN9E 4YX2L 5IW3A 4B50A 1L7IL 1DBKL 1XR9A 1VADB 2JI1A 2YD5A 1XD1A 2BP5M 4TNFA 2DV6A 3FPXA 4A2FA 4MAZA 1ANUA 1NPJA 4YHOL 1YNKH 4AC4A 1TF4A 3ZL4H 5DWUL 5C0DB 1XCTB 1MW1A 4YOKA 3QNFA 4QAMB 4AGQA 1KTJA 4KZDL 3FCTB 1QLEH 3UTTE 1TZHA 3IAPA 4HUXB 4H0HB 4IRZH 1LE9B 4LLDA 3WEAA 4Q4IA 1TZ8A 2Z7ZA 4KVNH 3GXFA 2PXYD 2WXJA 4PV1C 2P45B 2W0KA 3SKOA 1DSFH 3HA0A 1ZHNB 5JW4R 3VXSB 4XNYH 4OBRA 1AS8A 3MCYA 3VFTB 2XA8L 3EJCA 3VMOA 1QBLL 2CGZA 3KLAA 1YJDC 3T2OA 2Q7NA 1QFWI 5FYJU 3TIEB 4FRWA 1EAJA 2ZUTA 3V52L 5A16A 3LB6C 5BS0B 2D0GA 5HHPB 4HJEA 1A1MB 1A7OL 2F53B 5DUPH 1QFWM 5GRUH 3SDXF 4KI5C 2JNZA 3CWGA 2H6OA 3D2TA 4L3EB 5FUCC 1QEXA 1C5DA 1XH0A 2K3HA 3R4RA 4Z0XA 5INCA 5C0IB 3U9WA 4IJ3B 3V0HA 2DQGH 3MBWA 4OFDA 5DGRA 1U9KA 5BV7C 1A2YB 1JGLL 3BAYA 3TV8A 3KL5A 4PJ8B 3GSQB 1YNLH 4DTGH 2ED7A 2NR6D 4H40A 2WVUA 3E6FA 5E8EA 4DN4L 3VD7A 1IM9D 5IFHL 2YK1H 3NP4A 2EKJA 4P5MB 2OW7A 5C0BB 3GIZH 3BWUF 2XZQH 2BOBA 2V2WB 5CO1A 2EYTA 1TFHA 3DVNB 3VI3A 1MCWM 2BNRE 1MFAL 5DK2B 4G42A 3K6NA 2NXZD 2A74B 2BXYA 3BPCB 2CHWA 4NM8H 5A2AA 5HYIA 1Q9LA 2AJUH 4K2UH 2X2JA 4XZUB 4P59H 4AV0A 1GSMA 2DRUA 1NAMB 4JUTA 4K7PH 3BUYB 5FB8A 2FJGB 3RU8L 4EDXB 5GS0L 2F7PA 3VE0A 1E42A 4UUJB 1MCRA 1FFOB 4TQ8A 1EBPA 3MV9D 5J13B 3WNMA 1U92A 1JNJA 4KRPD 3ZK0A 3CHXA 2VDOL 5IHUL 4MAUL 4Y5YA 5TQ2H 3Q2LA 4CKQA 3EHBC 3OKMA 1G7HA 3L2LA 2VDKB 4M02A 2GEQA 2OMUA 1I1AB 3QDMA 4XBEL 4L8CB 3C08L 4Q6IA 3VGFA 2XN9D 1SVBA 1NGZA 1HKFA 5IV2B 2H9GA 1J10A 1L7TL 2D2CC 4B9PA 1D6VL 5JDSA 2WQSA 4O02L 3U7WL 5KYYA 1UQSA 2F2HA 5KYXB 1PZSA 3S35H 5C7ZA 1DQIA 1CDYA 5FS5A 3QG6A 1UKTA 3TBVB 2DWDA 4MNQE 1KYOJ 2O5ZH 2CPCA 2IADA 3HZYA 2XACC 1R47A 1U93A 1T6VN 2YD8A 5DHEA 3Q44A 2YD6A 4FQCH 5ABDE 5EBLA 3G6AA 1L6PA 3CFCL 1SJHA 2ZKHL 4DKAA 3WXWH 1O9WA 5JQ6L 4JO1L 3VXRE 3HRZC 1ZANH 2NY6D 2OM5A 2AXGA 3VX1A 1MCIA 2A83A 4AMWA 3TURA 3DX0A 2IPTH 4OFPA 4RMSA 4MQXD 4ECNA 1EH9A 3PAVA 4DIXA 5E4OA 2XQYK 3C9NA 4KTEL 4QUOA 4WTXA 5C3LD 4HP5A 1IJNA 3HS8A 3PV6A 3T9WA 4X7DC 3DK2A 1HILA 4NIYE 2EDEA 3H9YA 2JF1A 5JXED 2W88A 1DQVA 1LJMA 2BP0B 5C07B 5E6IA 3HE6A 2Y0SA 3NK4A 5LBVA 5T3XE 4I3SH 5D1XB 5JR1H 5I1AA 4QHUA 5EF3A 4APQD 3MBED 4AEHH 1LE5B 1SJEB 3QVAA 4FLRA 5KEZA 1GS7A 4CVXB 2QSTA 3EZ8A 4KO7A 5LNEA 4KDWA 4TNWF 2V2TA 2TSAA 1HL8A 5KJ4A 2O26U 3O2WH 5AKTA 1E6JH 25C8L 2VSDA 3RG1C 5CM1A 2ZCHL 2IV9A 4G1EA 3CZFA 5JOPE 2AJXH 3U1SH 4HW6A 2YUWA 4PS7A 2DQJH 4P23D 3SDAA 3TNNA 5I1KL 5IKCB 3JWOH 4RX4A 4QRQB 4GRMA 4Q2ZA 5ELIA 5JZ7D 1YEIH 1QSFB 3KJ6H 3MO1A 4MA7H 1A1NB 3ARYA 5AB2A 4HHWA 4ZS6C 2K3TA 3UGXA 3V7AG 4OCSL 3CVHH 3VB9A 3MNZA 2VZ3A 4XB7A 4HUVB 4H0LC 4CVWA 4S1RL 1L9TA 1QFUH 3C5ZA 1O9ZA 5GIRA 3NPZB 3QB7C 4NQCA 5FUZH 4DUXA 3KPQB 3G5ZA 2MJWA 1FH5L 2LU5A 4NDMB 5KUMA 2XPGA 1P4IH 4ZS7H 2PPEA 4QOKD 3F5WA 2Y5EA 4UT7H 1DDTA 1DCLA 1R24A 2R0WH 3GI9L 2FDBP 1TMCB 4X6FB 2FECI 2YC1B 3H3PL 3MRFA 3RWHA 5D8JL 4ZX5A 2CBOA 2WXPA 1T2JA 5DJCA 5IG7A 2V2XA 1EZLA 1CCZA 4CBPA 1OANA 3X17A 3P9WB 4Z95H 1REIA 2ZCLH 5SX5H 1U8JA 2XPYA 3GJEA 4OW6A 1N5AA 4HV8B 5SWSB 3UPCA 2O6FA 5CZVL 1J18A 4ODSL 5EO1B 3EW3B 5B38G 5KANI 1QSEB 4WKZB 2UUDH 5HD8D 3U6RA 4DEPC 3IYLW 4AYMC 5GZOA 3MAWA 4L18A 4QJ5B 4MJHA 4XC3L 5GZNA 3ARED 3EFFA 3GBEA 3PXHA 3VQLA 4D8PA 4DGYL 5I66B 2EDQA 1DZBA 3TN0A 3P0GB 5GSVA 5CCKL 2E3VA 5TGBA 1X6NA 5B38B 2PCPA 1OTUC 2CBPA 2ZX9A 3FAWA 3MLPA 3EH1A 3WIHA 3NIDE 4EZMA 4KKPA 3WKMH 4W9IC 4L9LB 3US9A 4DGIL 4DUWA 3VFGL 1LK2A 2Z31C 2ZXDA 4MQXC 4KXZH 4YC2B 2J1XA 4JZJA 1A6AA 2EUXA 5EU4A 2YEVB 5GGRY 1NGWB 4NQDB 1U95B 3QRGH 5HHOE 1U8KB 3IXAA 1B6DA 5AOJA 3ECWA 3K71B 2H0EA 4PJHB 3LRSB 1CDJA 5B39A 4M7LT 1U3YA 1GZQA 1T21B 3ZL2A 3EHBB 3QXWA 4CUCA 5JUEL 4OLUH 2RA1A 3CFKB 2R29H 5DGQA 4Z7VA 5DO8A 4ZI8A 2CR6A 4L8DA 4HFWA 4IBQA 3GSVA 1NEZG 1F1AA 3UAJA 1CPUA 1N8OE 3FOLA 3CHPA 4M3KB 2FGWL 2X4RA 1UYWH 5IW1B 4KDTA 4XAKE 1OT4A 3MBXL 3SBQA 5E03A 2K9UA 3EXJA 5T1MB 4LAJH 3WDJA 2P24B 4JQVC 3IM1A 4O9HH 2DI7A 4IEFA 1SYSA 3MRIA 1N12A 3MOAH 4WJKB 1BIIB 5DFTA 1OF2A 2F54D 1DVZA 1MCFA 3IBEA 1U0QA 3E2HC 1NEZB 4MA1B 3WE6A 5DTFA 4OZIA 5FHBH 5L2KD 5TE7L 2WVVB 3CTTA 5FO8B 1NCWH 1VGEL 2NNFA 4QIRA 3MUGB 4NZDA 1MG2C 5DD5H 1AGDA 1CDUA 3ABLB 4HX1B 4H13C 4U6HA 1K6QL 4WSKA 3BP4A 4PTTA 4N8PA 3L5WA 3BAWA 2H7WA 3M1BB 2HTKC 2DAVA 3KNBA 3QHZL 1U8NA 4J3XA 3D2UB 2E7MA 2DZEA 4XPTH 5DSCA 3TBWA 1BQSA 1TQUA 1A3RH 1F4HA 2R27A 2XOTA 3RVXC 4PTUB 3O11B 4HS8H 4DEUA 2MCPL 5C0EB 1WFOA 3TA3A 3VXOB 3SYCA 4HWEH 5DUBA 1EEYB 3RZCD 1X5KA 1MRFL 2EXWD 2VLJD 2R59A 3FH5A 5FCUH 3KPTA 1ZT4A 3CVBA 4LXFA 4L1LA 3VYPA 3QEHB 3VFWA 1JZ3A 3BIKA 3IE4A 3AREC 3PWLA 2X4OA 4MCNA 4MJIE 4ONGH 4X4KA 4UB0H 1T6BX 1W9XA 3ZVVA 4ES9A 3TCLA 5FFLA 5I1HL 3S4SA 3SE9H 4KJPC 5IBUG 1P6WA 4LF3B 4PQXA 3PREA 4XHQA 3CZKA 1QMUA 3UTZA 4AYEC 3PG2A 3RIFF 4CSSA 3WELA 1CU4H 5EUOE 4MRBA 2C9XA 4HPHA 1YVLA 3TS8A 4PGZA 1A0QH 4JZNA 4I1RA 3ARFC 1AKJB 4FQPA 1B3JA 5IBUB 3Q8EA 4GXFA 1S7VB 1ND0A 4M5ZH 4XNUL 2MCMA 4ODXA 5ESVA 4B3VA 4XXWC 4DCQA 4G6KL 4LSTH 4G6ML 2WLNA 3KH4A 4GO8A 4BCXA 5CLWA 3EOTH 3O6FC 3OZ9H 2YMXL 2HRGA 2WPGA 4HIQA 4L29B 5DVMA 2DL9A 3RWFA 4PS8A 4WK2B 4QO1B 4GPVA 1EXUA 1UJ3A 4GKZB 1UENA 3K6FA 5DD0L 4PCTA 5EB9A 5HI3D 2VQ4A 3KLKA 3QJSB 5DVPA 1P69B 2WBJA 3LIUA 3RIAF 4DEPB 1NBYB 1I7RA 4BK8A 5CD5D 5HJBA 1IKNA 4U4IA 1ET5A 3C75A 4PRPA 3UTTB 1E4KA 3P2DA 4LLVB 1PL3A 1DBAH 1L9PA 4Y4HD 1MVFA 3B4NA 1WT5C 4FQ2L 2PN5A 3AMKA 3HI5L 4K7FA 4KVCL 1ZKAA 3MNWA 4NO5A 4QY8B 5KYUA 5I0WA 4LRIA 4M29A 4NM4L 4NBYB 2CNZA 3TJHD 4AENA 1FO0B 4G8EB 4OV6F 2XA3A 4HWZB 1F86A 1OCWL 4OIAA 1DSYA 1E9PB 5IM7B 1VB9A 1DBBL 5D72H 1T04B 3HPJB 2Z31B 2GYSA 2P5EB 2BSEA 1TMQA 5DMGC 1CTOA 3BQVA 3PE9A 1AQDA 5IROD 5IOKA 3PABB 3FO0L 2F7QA 1C5CH 3L3JA 4JFHE 5C3IA 4JPKL 1JVLA 3SKJH 2AV7B 4G8FB 3QQ3B 5IB4A 2JI3A 3I2CH 4NZRH 5K9JL 2XDHA 3CFDA 5CJBA 5ICYA 4F33B 4ONFH 1J1XL 2DLEA 2DDQL 5L7XH 4JCWA 3T4YA 5EEUA 4LVHC 1LO0H 4PJEE 3K6SA 1T1ZB 2NSQA 2ZYIA 3HB3D 4GUQA 1WA1X 1AS6A 4XP6L 3B37A 2DY2A 4HG4J 2TAAA 1NFDF 1T4KA 1GOGA 3N42F 1YMMD 3WU1A 3VCLA 2WIIA 2VDPH 1OAUL 2BNRB 1FHNA 3RVUD 4IDLA 1CICB 1DFXA 1J1PL 2NTSP 4OJAA 2C1OB 4OB5H 1DE4B 2WCGA 5D2LE 4HD5A 2O6DA 3H2QA 5FX3A 5F3FA 3U25A 2BNQD 4U1HB 4AYID 3E2HB 1WICA 2Y3AA 1KXTB 2Z8RA 3I9GH 3BW9B 4P4KA 3SPGA 4L1HA 4N0RA 5C08B 3S37X 5CINL 2EEDA 2FSDA 2DYPA 4JFEB 4QTHA 1AZNA 5CP7B 3ATFA 4ZUTA 3WI9A 3LZFL 3LQAL 3HUJA 3ZKXB 3G5WA 4RFEA 5DJXB 1MAKA 1JGVH 4JEGB 4QYOB 2A6IA 4XVUC 1IGML 1SRDA 4MKMA 4UT9A 2VQ1A 2PYFA 4X8JB 2LR4A 3AS3A 3UG4A 4OZ4B 4Z77B 3QWOB 4X9IA 4M48H 3QJHA 4RAUB 3AITA 1SYVB 4MA3A 3VX0A 1TJGL 1CDCA 1OP3K 3GSOB 4QRAA 5DFVD 3VNZA 2RCSH 4CU7A 5IB1B 2H45A 4MNQB 2Y7SA 5E1HB 5T3ZE 3MV8D 1J8HA 1JG9A 4BDVB 1ULVA 1ILSA 3VXUE 5CR1A 4BH8B 4WUUA 4LGSB 3CK0H 3IDJA 5GISH 3BSGA 2BVPA 1LTXA 1U2HA 1WO2A 5AFAA 3ZIMA 5AKRA 5D1ZA 3TEZA 3O0LA 1P9MC 4G11A 3M07A 4K23H 3N43F 5D7KE 4GI6A 1N0LB 3SY0B 1HHIA 2L7JA 3VXRB 3D3VD 3BZ4B 2OSLA 3T0WA 3HN3A 4JAMB 3AXLA 1CURA 3ARFB 1EZVX 4YR6A 3L95A 3EJJX 3ULVF 1FVEB 2BC4A 4UZGA 3DBSA 2Y5TB 3BFQG 4WU5B 2FO4A 2N4IA 4MNHA 3B5GA 4XODA 1NJ9A 2APVA 2C3VB 4YEFA 3OPUA 3O6FB 3KPOB 4I3RH 4N5UA 4X9GA 3CFJB 4ZFOB 2CHNA 3SBPA 3SD5A 4A7GF 4Q14A 1CFTA 5ANHA 4X4YA 1J9CT 3T1WA 3H42H 1HCFX 3IJ8A 3LXAA 1TJMA 4B41A 2AVGA 3W9EB 2YR3A 2Q86A 3QWNA 2GBTA 3KVQA 3L3IB 2OX5A 4U31A 2NY4D 3BSZA 3SBWA 3VI4E 2X9ZA 4AYFA 1DANT 5E8PB 5HY9A 3KWWA 2Y3NA 3D0LB 2ICWB 1JOIA 2F7RA 4PRIA 3ZDYE 3PUCA 1VFBB 3RVUC 3SDDD 1NPNA 4OFIA 2VAJA 4G9FD 5B3NA 4KXZI 2YPKA 1D5MA 2IBGA 4P4RB 5HHNB 2GBVA 2QHRH 3IDYB 5AYUH 3REVA 3QPXL 3QA3B 1DR9A 3UBXG 1SJVA 3ME0B 1S9KC 4LVEA 2ZOKA 4ZD3L 5C1MB 4NQQA 4PY8J 5LG1A 3UPAA 3FCSA 4QRPA 1QO3A 1L4IA 2ZSWB 3ZQXA 3ZE2E 1GGUA 1SUHA 4N8VG 2AQTA 1PPIA 3KPSA 1H8OA 1KELH 5JHLH 4HT1H 1JD7A 3UBXB 3BDBA 3EXLA 4JQXC 3QJOA 3QDGD 4NKDB 1HIMH 2HFGL 3W0WE 4CGTA 2FX7L 2ZTBA 3T4AC 3MX0B 2APSA 3WNNA 3LN4B 1AR2A 1MWAB 1Q0YH 3MRMA 1BA9A 4LVHB 4N8VB 3GHBL 3AY4A 3N50A 5T3ZD 1UA6H 3ETBF 1WWAX 3IDGA 3FO2A 1TLMA 4FNRA 2HXAA 3GQFA 4JG1H 3W2DL 3QUXD 2HJFA 3KPRD 5T33L 2ZCZA 3C6LA 2W81C 1Z9SA 4X7SL 4XBPA 1C08B 1ETJA 3NIDB 4AQOA 1TVHA 1LWHA 4JE4B 5A2LH 4ZW7A 4DT2A 3N91A 2YLKA 3WNIA 4X5LA 5LLIC 1VRSA 2ITDB 2HSIA 3FB7B 1PD6A 3EYFB 2OQJA 2QBWA 4ZPVB 1H3UA 3MXWH 2BVOB 3C8HA 2XXGA 3ARDD 4AIXA 5HHOB 5E1AA 4JDEB 3L16A 3AWEA 1J9TA 5DYOA 3NN8B 1DP0A 4LSUL 3IDMA 5JQIB 5JW5B 3FQXB 3ARBC 4AM0Q 3OLIA 2B5IC 1JV5B 1L9OA 3BXNA 3MRKA 4N6RB 4X83A 3VMPA 4G72B 4XH2A 1KG0A 5JOEA 3VWKA 1CG9A 1DQLL 2OL3B 3QUYA 2VDLB 1CDHA 2IV8A 1BW8A 1DDHA 2AP2A 5BUAA 1H8SA 1IJ9A 1MPAH 1MRCL 2J2ZB 2WLMA 3F3HA 1V05A 3R06A 2QPUA 4EZLA 2Z0UA 4X5XB 2NTFB 2EH8H 2WINB 3MRNB 3DHJA 5C6TL 3X13B 3SDDC 2C3XA 2VIRA 3ZKNC 3CH1B 3DHPA 4OLEA 4ZUSA 4GBXB 3UH8A 2AF2A 4MD5B 4R90H 12E8L 2WP3T 3F7PC 2EIZB 4ZODA 3H85A 2ZX8A 2OA9A 2WUCH 1JWSA 3IN2A 3RFZB 3OJMB 5KVFH 3ZHDA 2D3LA 4XBGA 3FFDA 3UTPD 4YBLC 2HT4D 3GM8A 3WTYA 2EDRA 3B9KA 5GJSH 1FA4A 2IAND 3ISRA 4WUKH 5CGYC 4YUEL 5MEQB 1XCXA 2DQ6A 5AW6B 4ANXA 2AQNA 4AL8H 2ITCA 4AQEA 1W8OA 5CSZA 2VCOA 4GY4A 5C0JA 3TFKD 4TRPL 3TEXA 5DMIL 5FYLH 3VMNA 5GRXG 2XV2A 4HU8A 4DETA 5AOIA 5I75C 1SDDA 4K8RD 4JRWA 3NA4A 1PX4A 3LY6A 1WGVA 2OSYA 2VYRE 3S48A 2J72A 2ESVD 1FYHB 1E67A 2CO6A 3OLGA 4MJIB 4RIRA 4A67A 4LVNC 2MCG1 2HP4A 3HNSH 3QEQE 2E5EA 1E65A 4KKBC 1JZHA 4UT6A 4X5RA 3NG5A 2X53A 3AU1A 3IGAA 1AD0A 3CXDL 5EUOB 3HZ3A 3CFEB 4HJ0C 5DD1H 5K39A 1XTMA 4TMPA 3Q6GH 2ITFA 5IVZA 3NZ8B 1INQB 4KHTL 3ZZ1A 1BZEA 5CIPB 4DQOL 1E6OL 4D0BA 4BV1A 3TEYA 2F1EA 4Y16D 3MROB 4PV8A 4AQ1C 1A5FL 1UXSB 3MQIA 3LS4L 4XMWA 1G7QA 1P4BH 2IWKA 4Q8BA 2H6PA 2BVYA 2O5YH 3TBBA 3CCHA 1MCCA 4QMEA 1OEZW 2YD2A 3HRPA 4JRYD 4FQHB 4WEBH 5T1KD 2HFFA 2C3GA 3JTBA 1M7DB 3MRDA 1T7XA 3GEWB 2BP3A 4NQVB 3WIAA 3T4AB 2OJEA 2HJLA 1B4RA 1NCUA 2BSTB 1RULH 5FV2A 4MA8L 2OMYA 1RHHA 5LGHL 2AXFA 3B6SB 1CF1A 3BSZL 2G9HA 4G6FD 3JWDH 3KBEA 2IFGA 2W9LA 1UWXH 3T71A 1P7QA 4AGOA 1BJ8A 2A1WH 5KYWA 5FUOH 4OQ1A 4KK6D 5FHAL 2CUMA 4TPRL 4KO6A 2IH8A 1XEUA 3GMLB 5T5FH 3SGDH 1KPVB 1ZVNA 1WG3A 3OR6B 3HMXA 3Q06A 3ZRFC 4MSWA 4RBPH 4FFWD 1XSIA 2UZIL 1E3FA 5GRWA 3MLRH 4HAFA 4LLYB 4OD2A 1BZOA 4XN1A 3K2IA 2HLEB 1G9NL 2LU4A 4QGYA 1RP9A 4R7XA 4AUUA 1N64H 4OUUB 2E86A 3KYAA 1J0YA 4J6RH 1V27A 1ILUA 3MLYH 1BFVH 4FFZA 3S3PA 5I71C 3RKDD 1ZCRA 3D4GA 1EO7A 3LEVH 5IMMB 3ARBB 1ZV9A 1QW9A 2B5IB 2JWYA 5CAYB 2XBDA 4H5SA 3DJSA 2EC8A 4FZEH 3KCPA 2UX6A 4HGWA 5EEZA 1OO2A 4CADA 4XXCA 4XCFH 3U9UB 4PJEB 3L9RB 1A4AA 3BWSA 4G7RB 1U3HC 3PXJA 3HMWL 1JZ6A 1VJSA 2WBWB 3OGCA 4MJ5B 4BE6A 1JFQL 2DH3A 5IFAL 4HKJB 1F02I 1G1OA 2PXYA 2Z6FA 4N2MA 2Y36H 2GSGB 2V9RA 3O3EA 2XU9A 3RHWK 2HRPH 1EMTH 1A6UL 4PYGA 4ENEC 4WWID 1WC7B 3PAUA 2G3MA 3IRCA 4AE1A 4DH2A 35C8L 1M2VB 3F00A 1UURA 3MGTB 4UINH 4LLQB 4QRTB 3DUHA 2IAMC 3S3DB 4CC1A 3UZQA 2KZWA 1KGUA 4AE0A 1FORL 3F7QA 4YBLB 3V0WH 5DEFB 2WD0A 1UWGL 4PRHD 4TVSa 3WMPA 3NEOA 5E8OA 3VW3L 5E5MA 4PJFE 4QYAA 1QNIA 2QV2A 4IRSC 4JLRA 5D7IA 1W16A 3U0TA 1AGFB 2CLVA 3J27A 4U2YA 5IQ9B 1QA9B 2XG5B 3BDXA 1V5JA 1DLHB 2NR6A 4AK2A 1SUJA 2NY0B 3QXAA 4JRXD 1PLGH 5KBLA 1IM9A 1AQMA 2PABA 3DVFA 3QR0A 5SWQA 3U83A 2MHAA 3LH9A 4TTDD 2WXHA 1IIIA 3J8F7 4HCGA 1EUTA 2YBGA 4CGUB 2O5XH 3CSPA 3PWPE 3P4MB 2X9XA 1ZWIB 1UZ6F 5B1JA 1D5XB 1BEXA 1RJZA 2Z4TA 4UIKL 4PN6A 2GHWB 3C8KA 2XPZA 3HR5B 4MD0A 3BN9D 1NCDL 3K5RA 1T66D 4HLZG 4KK6C 4LGPB 4LHUG 3DKHA 4LVNB 4WW1A 1HWHB 3R8BB 4U6YA 5DHVH 4KX8A 3VXMD 1TCRA 1CFQB 2VLRE 1KTDB 2X2UA 4R3SA 4IBVA 3TYFB 2XWRA 3NESA 1ETZA 1UUNA 3P1VA 4S10A 1NDMA 3WDIA 3R7QA 2JJTA 3VU1A 1JHKH 2WBXA 1YDPB 4K3EH 5L4JA 3LKOB 3SOBL 2J57A 5F7EH 1FPTL 5I17B 5E99H 1IX2A 4LHUB 4JZOA 3NT0A 3RX7A 4XZ4A 4LEOB 4PGBA 2AJ3A 2NOYA 2BZCA 2IFFL 2O61A 4HPYH 3DTDA 4LNRB 1GL4B 4N0FB 1I3UA 3ULSB 4PREA 4EJ1C 4EPSA 4EVNA 1F5WA 2JV6A 1G7MA 2KZBA 2YQ3A 1KGIA 2E9GA 2VABB 2XN1A 5TDPB 4JY5H 3EYUL 2WKLA 1GRWA 4B7IA 2PWGA 3EDEA 3GGWA 1V3KA 4UOW0 3DV6A 1GCFA 3FQ2A 3QIWD 4NC1E 3HOGA 4NQUA 1CO1A 2RGSA 1KWGA 1SZNA 4N85A 3PWNA 3JTTA 2C34A 4GUPB 2F8OA 3BKYH 4Y88A 5I19H 4J3OD 2ILLA 1J9SA 3W9DB 1AO7B 1O7DE 2BVTA 4TVUA 2PWEA 4PLOB 4UT6L 1TQCC 3L3KB 1GYAA 4ETQA 5IT2L 3MV7E 1NGPH 3DURA 2OMBA 2WO2B 3PYCA 1E4WL 1NGXA 2JJUA 2D31B 1DQMH 4QNPE 4LDCA 3QJFA 4KO9A 3P11H 3FQYA 2ZCKH 3VXSD 3IFNH 5JXEA 1A6TA 3FT4A 3NJJA 4PJDF 4RQQB 2CSPA 1UXWB 3OKEA 4IBLT 2V3FA 2BCMA 5LGYA 1JNNH 2CWRA 5ICXA 3L4ZA 3MBEA 3ZE2B 4APQA 1I1CA 4XMKH 4YFDB 2I9TA 5L8JB 2HG5B 4Q74A 3BKCH 5AQ0A 5I71B 4NZFA 4YSPA 1NCNA 1ZAGA 2NY7L 4I77H 2OAAA 1MHCB 2V3DA 4A6YB 1HZLA 3NABH 4M5YL 2EKSB 5DVNA 4ADGA 4YX2H 1ZGLA 1I1YB 2LGNA 1L7IH 5T1LD 4AV5A 5BJTA 4B96A 4OZFG 4YHOH 3EDDA 2VITB 1FHGA 5DWUH 1U3HB 4U1LA 3N1FC 4KQ3H 3KBFA 5J6GB 4KZDH 5C0BD 5HYSG 1ZOXA 4FOMA 1PW3A 1H3VA 3V0IA 4JFYA 5LCVA 2ZUYA 2GIYA 2ROXA 1NICA 4M56A 4HJGA 3ULUD 2AW2A 3QAZC 4YNYB 1RZ8A 3N85L 2WC7A 1DBML 5D70L 5I1DA 1XAKA 3WEXA 4OZFB 3V0VA 3HFML 4PRNB 2AKRB 1OAKL 5HGHA 2YZ8A 3HMXL 2W9DH 4W4NA 4E9SA 2XA8H 2Z3FA 5HYSB 1Q90A 1QBLH 2IAMB 4AZUA 1NFKA 5H2BA 1RY7B 1K3ZA 2D9CA 1DFBL 4G8GE 3RAJL 1M56B 3V52H 3MV11 4DO5A 5CEZL 4JCMA 5A2FA 1TSHA 3B8YA 2XWZA 1U2CA 4M7ZC 3Q8FA 4FFZL 1F18A 1IQDA 3R4DA 1A7OH 4JM2A 1OAXL 4IRSB 8FABB 1TTFA 1EO8L 4EI5B 4EDWL 3SGKA 3V5HB 3ZYZA 3ZKSD 3RX5A 3HLAB 3E6HA 5J1AB 1WV7T 1GSKA 4DN4H 5FDWA 4LL4A 3ISWA 2PWDA 3HTLX 3KW8A 4OKVB 5IFHH 1FYTA 5F7DB 2WVSA 3KYMA 4N8UA 4OF0A 1S5IL 4DGUA 4ACPA 4BQ9A 3LNDA 5E8DL 1QAWA 3S2CA 1MCPL 2GBUA 4U1NA 1MFAH 2LV4A 3D8MA 3OKOA 1B0GB 2BVEA 4LBEA 5L0QC 3B2UD 2DM2A 3EGDA 1I8KA 2X40A 3D05A 4HAGA 5FA4A 4R4ND 1BD2D 2E7CA 4OF3A 4H8WC 3W1ZA 1FFRA 3ZZQA 4ONHA 4FQXD 3RU8H 3RB5A 5GS0H 2XX1A 3BZFB 2BY1A 4TM9A 2C3WA 4OJEH 1ZSDB 5T5NF 1QLFB 4XNZB 5IHUH 4N2EA 4MAUH 4ZFZB 3QH3B 1NFIB 2QR0B 1BXUA 3EDFA 1X5HA 3FQUA 4PJ6A 4RDQG 5I1LA 4Y2LA 1FL6B 4P2QA 3L3DB 2RMNA 5C07D 4XBEH 1LDSA 3C08H 3K6IA 4P2OC 4WEUD 3KXFE 1S7QA 1L7TH 1CZ8L 5B7MA 4D0CA 1D6VH 4WI3A 2X1XR 1RJYB 4O02H 5BRZE 5LWYL 1IM3D 1G1YA 4EUPH 1EK3A 2IMMA 3HBPA 3R7RA 3G5VB 2W80C 2VSMB 5EU6E 2VERA 1G7PB 1GGBL 2QELA 1FIEA 4NQXB 1T22A 5DS8B 2F54A 3V6OA 4CKVX 4RMQA 1KXVA 1FBIH 1SLXA 1LO5B 2ZOLA 1F58L 4NZTL 5DD3L 2F8IA 4ODVH 3TO4B 3U48A 3R0MA 2BIOA 5TD4A 2ZNXA 3CFCH 5AB1A 3ZR6A 4A7SA 1TQCB 3SDXE 5CD3B 3OSVA 5I8OL 5JQ6H 4JO1H 3H9HA 3P4NA 3TH3T 3VTAA 5B1BB 2PO6A 4PHZA 1A6VL 4CVZA 2A0LC 4PJ7A 1F4XL 5KBDA 4E41E 1QFHA 2EO7A 1QTYT 4OAWA 4KTEH 4ODTL 1G6RH 1Z5LA 2ENSA 1E7VA 3GS0A 1YNTA 4YL4A 4J7RA 4Y19E 2BMKA 4QWWD 2ERJB 1K4DB 1MKFA 1Y07A 2FH6A 2YPVL 3F7VA 3ARGD 1J8KA 3RZCA 3QARA 5SX5K 1W72B 2HKFL 4QRUB 4M43L 2VLJA 4RGMC 3ZX1A 3P2TA 2X6BA 1A4JA 2IBZX 3O6KL 5DD6A 1GYVA 1WBZA 3VU2A 2XIDA 4NC1C 1Z9MA 3PDOB 1EFQA 1FG2B 1JN6A 3RI5F 25C8H 2ZKXA 3OQRA 4M00A 3HZVA 3V6ZA 4XNMB 5I1KH 5DMJB 5DK0A 5FR3A 2CKBA 3QORC 4PJCB 1PX8A 3BD4A 1BZ9B 3U4KA 2L7UA 3CDZB 2PYEB 3T2QA 1TQVA 1N2RB 2JIXB 3UTQB 3M17A 4A2MA 3RL2A 1SEBB 1O7DC 3OAZH 2ODIA 2WO4A 1G87A 4S1RH 4TNGA 1KMGA 5ISZE 1UOKA 4LLUA 3NSJA 3PJNA 2NZ9C 3U4EA 1FH5H 4XPFL 3AG1B 4PY7B 1HXKA 2OP4L 2HVJB 2K9FB 5IEHA 2NCMA 4GSDL 3CPUA 5K1NA 5C92A 4YE0A 1NLDL 2QKIA 2K8QA 4NJ9L 4NO0B 3IETA 1S5HA 4NXKA 1JBJA 3GI9H 3CSYB 4PGDB 1X4XA 2CM6A 3WCYA 1KY7A 5HHVL 1KENL 2FD6L 3H3PH 5C9JA 5D8JH 1CLYL 5SWZA 4QXGL 3EYOB 2DMBA 4XP5L 3DJTA 1PKOA 2NY2D 3F12A 3ZZSA 3ZT5A 3B2DC 1N70A 3WFEL 5DS1A 3VQ1C 4KKNA 4ANUA 1ZPUA 4MMYB 4PJBF 5CZVH 3MNMA 4ODSH 5ENWA 1SHXA 3VRLF 2E9BA 3IJEB 1WVZA 4ZPTB 2WB7A 5H4YA 4PCKA 3ZDZF 5LHDA 4MMXC 2IDCA 1XD0A 3O2DL 1ORSB 5KANG 4MVBC 2FHCA 4DGYH 3IMVA 1E27B 1T7ZA 1YA5A 3CLFL 4G7QB 4LBAA 5LCVL 2PW2A 1DSWA 4DP8X 4I4WA 5DLLA 3FOMA 4YZFF 4B9FA 4F58L 4FABH 5L0QB 1UT9A 5F0PB 2OBGA 1QI3A 4DGIH 3VFGH 1H15B 5IROA 1KBKA 2N0MA 4DWHA 4WQOA 1PNDA 1YN7A 1G7IB 2AAAA 5AW3B 3UTSB 4DGWC 1S9YB 5MEND 1ZVSA 4PS4L 4HZAA 4ZFGL 4QWWC 2TSBA 4H44C 3WS3B 4F91B 1FV1B 3TZVC 4MJJA 4FKKA 1HHKA 4DO6A 4XAWH 4KUCD 4PJFB 1AGEB 1S7RB 3ZUCA 4CVUA 3FTGB 5BZDB 3CN3A 4N5ED 3S5LG 3GMOB 1A4KA 3QULA 4AK1A 2FCBA 3BVUA 4FQ1L 2R2EA 1HWGB 3CVCA 5GGSB 2MH4A 1U3NA 3JV4B 3LN9A 5JUEH 5F7AA 2PW1B 2Z35A 1L9SA 1SOXA 4IKKA 4WIQA 4P2OB 4AQ8C 3LKSB 3HS0A 1GZHA 3EO1A 4BHUI 2YFOA 4GW4B 2XRAL 1PLBA 3QRBA 5HPOA 4Y9GA 2EXSA 4QRSA 2J71A 2FGWH 4XN8A 3S5LB 4JG5A 1K2DB 3MBXH 1O6SB 3D0VA 2I32A 1PY9A 1S9VB 4L4TA 2LTQB 5CGMA 5CFHA 3WV0A 3AZUA 2WP3O 4FE9A 3SCMC 3S8GB 2VLRB 3R19A 3IVKB 2WUBL 1KCKA 2R83A 3FT3A 3IU4L 1I3GL 5TE7H 3CPLB 1VGEH 3PQYD 2BIIA 1XEDA 3MJ8A 1AH1A 3MNVA 4NBZB 2AERT 4TF4A 1K6QH 5IJDC 2WXQA 4J8RB 4S1DD 4QXVA 2HMIC 3V7MA 3QHZH 3H55A 5BQDA 1JK8B 3PP3H 4KGLA 4OD3L 2OMTA 5EUKA 2K45A 1KY6A 3DARA 3QGVA 2QQLL 3ILPA 4B95C 4DZBA 1WCBA 4LKXB 4RGMB 3MRPB 5CSBA 1YQ2A 2G2RA 3QEGL 4NP9A 5HSFA 1KEML 3NFNA 1MRFH 4DZ8B 1XF4A 4X4ZA 1FNEA 5EZPA 1XSJA 2P7TB 1QWHA 4I2XA 1DVFB 3FO1B 2LT9A 3TBCA 3QWRD 3GMMA 1IEAB 3KEHA 4NENA 1YCSA 4F5CA 5C09B 2DIAA 4KKCC 5FW8A 3NDZE 4H20L 1QG3A 3LXCA 2CJSA 4XRCA 4BZ2L 3WFZA 1PY4A 5I1HH 5DZPA 3H0TA 1F3RB 3D3VA 2CHXA 2IQ9L 5D2NA 1XZWA 2CLZB 2R1XB 3BUTA 4I88A 5L88L 3CFIC 3GO1L 3HG0A 3MV7B 2YA2A 3FRPB 4LVOC 3Q2VA 1XBDA 2VRAA 1BSIA 1I8IA 4XP9L 1IBGL 2B1HL 1KTRL 1RPQA 4OV5B 3TWYA 5ADOL 3MRQA 3MUY1 1DEEB 3MRLB 1Z0MA 3H9SE 4CC4C 2Y6SD 3BWUC 1AD9B 4XNUH 2AC0A 1LO4L 4I9XA 2BZ7A 4N5EC 1JZ5A 4G6KH 4G6MH 3BE1L 1SFDA 3UPRB 3FU8A 4E5XG 1DYZA 2YMXH 5H37A 3D4YA 1Z5HA 4RMTA 4WU7B 3V5KA 3DOSB 3DI2B 4ZO7A 2KC0A 5DD0H 4QRRE 4GRLD 2JE8A 1ZT7B 1IZKA 3O8XB 4NHUA 3DYPA 2GHZA 4AGNA 1UCBH 4G9FA 1T0PB 1IILE 4MMXB 5F1SA 1NBQA 1IFHL 4MB3A 3RBGA 1UKQA 4E5XB 4WI9A 4NC2B 1GYCA 1QABA 3F83A 3RVWD 4KVCH 4FFVC 3HI5H 2HPTA 4QKXB 5FO9B 1RIVL 1AG6A 2EDJA 4NM4H 4XBMA 5DJ6B 5E00B 4J12A 5IFJB 4N9GB 5JPNC 5C0AD 3WLBA 1Z32X 3Q6FB 3SDCA 2ZPKL 4W68A 1IZJA 5A2JH 5ILTL 1DBBH 5G5DA 1A6ZA 3G3LA 4LSPL 4KAQL 1FZJA 1ZE3H 2VM9A 3H4FA 5FWRA 4RWYL 1WYJA 4RNRB 4YAQA 4G8GB 1T20B 3QDGA 1Z9PA 4YSTA 5DYFA 5C08D 3RGBA 4WDIA 4JFED 3FO0H 4KNQA 4JO4L 4OGXL 4MWFA 1KIPA 2CGRL 3BUBA 4YHZL 5K9JH 5GHWL 4EO5A 1J1XH 2DDQH 3EJZD 1ZHLA 3EH5B 1DJGA 1J1OL 2YHGA 3FYIB 4M8QA 5EU5B 2FAUA 3QUXA 5D71H 4UQ3B 4XP6H 4F8NA 3KPRA 5GRVK 3HR6A 3REWB 4PFEA 2B1OA 2PP9A 1K85A 1N3NB 3ABZA 1OAUH 2EJ1A 2OMZB 1BG1A 1SF3A 2P8MA 2GIMA 3IMSA 3L9BA 4I1NB 4LCWD 1JGUL 3QI9D 1J1PH 2B7DT 2YUXA 4ZQKB 1RIUL 4Z76B 2DJSA 5KVEH 1PJ9A 3VFPB 4GKLA 1OAQL 3KYOA 3SCMB 3IAGC 2Q10A 2RH0A 5FYJD 5JYLA 5AVWB 3ARDA 3DV4B 5D6DC 5L2JA 4Y2OA 2QLYA 3GSXA 1FF5A 1JWMB 3D1MC 4HIXL 4PWGA 3Q3GB 4RGOL 5FM8A 5JTWA 1MJJB 3QYNA 3OC8A 2CA3A 1VLXA 5DA0B 3W11D 2YQ2A 5CINH 7PCYA 5GS2D 3BPLC 5KS9A 5DRNA 2EDXA 4IU2A 3LQAH 3P2BA 4U1JB 1X9UA 1TVDA 2B3IA 1BAFL 4HUMB 4QRFA 1HH6B 1GHFL 4LCYB 1BCIA 1I7TA 1EEZB 4F7PB 1IGMH 1YZZA 2A9AA 2MQ0A 4WO4B 2ITEA 3NRFA 4QI3A 3MJ9A 3C6SB 2RFXA 4OU3A 1ET8A 2FO1A 3KXFB 2ALAA 4LP4A 4O5LH 4GRLC 1KJMB 3FN0L 4W9KC 5BRZB 5MP6L 2PKDA 1TJGH 3VRIA 3F6JA 3MLTA 5EU6B 1GS6X 2WNXA 5DHXB 4YDNA 1M42A 2EYSB 3EFDH 1SN5A 5LAPA 3OHXC 4A2EA 5CZXD 4WJ5B 1SBBA 4GMTL 3MRJA 4YFEA 2QZ5A 1EERB 1FG9C 1GY1A 4APXA 5FYKE 3MODL 3KCWA 3SDXB 1LD9B 4HKZA 5E56A 2IOMA 2IANA 2XTJB 4OQTL 4MD4A 4E41B 2W0PA 3CVHB 4N2HA 2ADGB 1WRFA 2HWZL 3JUYA 4Z1PA 1XMWA 1QBAA 2YGVA 4FXGC 1CLZL 4AIZB 1XGYL 4V11A 3KPLA 4P2AA 3P4OA 3UG3A 4ZYKA 3QISA 5D55A 4F2EA 1NDGA 1NFDE 4D0DB 2EH7L 2MIZA 2ZUUA 1WHOA 1ZRUA 3QHFL 1VENA 2VISB 1AP2A 4WY7L 5KOVC 1MREL 1UVQB 5IMKA 4MGXA 4RFNC 4BQCA 3VXTA 4X99A 2GSMB 4P9HC 5DQJB 3SGEH 2ESVA 2Z8SA 1MZYA 3BAIA 4JS7A 4K4KA 1L9NA 3FH8A 4MQ7A 4NSKA 4WWPA 5LB1A 5CBEA 4YVUA 5D1QE 4WI0A 4QJ4B 2A6JA 1KN4L 2WKGA 4F7MB 2W60A 4W9ZA 2UV3A 3FZUC 1JFHA 2CIKA 4PJ9D 5DF0A 1Y18A 4TVPD 1VEOA 4ZUUB 5ISZB 1KTLA 3OXSB 4LSVL 1GYWA 4Y16A 5T1DL 1I8UA 5F88A 3HUJF 3T6ZA 1PQZB 4ZD3H 4L1BA 2MOGA 4C56E 1AR1D 1MCEA 1NM9A 4JRYA 5DC0A 1JYWA 3DRTA 3N41F 2QEJA 3GUTB 2YUZA 1A6WL 4YMPA 3I6KB 3KW7A 1IV8A 3UERA 2YKLL 3KWVA 4Y5XC 2X9YA 1G9MC 1FZMB 1BZ7B 4X98A 2FX7H 2DQFA 3R1GL 1Q1JL 1F4WL 2JB5L 3L4TA 2XN0A 1ZEAL 4Q4EA 1T5XB 2H32A 1KJVA 5JHDD 1ET7A 1PAZA 3GHBH 3O3AB 1QSZA 1SXAA 1NC2B 3MRGB 4HUWB 4QHKI 3U7YL 4JVUA 1E5UI 2ZWYA 5CZXC 4OGAD 3W2DH 4FMVA 5T33H 3UZEC 1ZLEA 1TT6A 3QFJE 5A2KH 1C8PA 3RPIB 4NLAA 1NQBA 4V33A 2G4GA 3MRBA 3K7UA 2V7HA 2OW6A 5DZOA 2A9NL 5HDWA 1UT1A 1WBXB 1X7TA 3MA7A 4WWKC 3FPYA 4DOHE 4JKMA 4PW4A 4ZSOE 5EC1B 5IVXA 1JK9A 3B3IB 4LPYA 5I26A 4AT6B 2H4EA 4AV4A 1I7UA 4WHDA 4NUJB 5ALCL 3JZ7A 1NGYA 5KVFE 3CZJA 5DMYA 3JWNH 3GZQA 4DKFL 3N55A 5K9QI 5F7KC 4LLWA 1PD1A 3DMMA 4EI0A 3TESA 1DQLH 2UXGA 1QACA 4X5WB 4ATWA 4KU1A 5KG9A 1MRCH 1LL1A 3DPBB 1FIGL 3EH4B 3BGFB 1AAJA 4KVPA 2X4SA 5ID1B 2ZKMX 1RK0A 3HHMA 2EXTA 4TNVF 5C6TH 4PIBA 5FYLE 1V7NL 1OOWA 4XN4A 2VDRB 2C9QA 3OHXB 3MJWA 2AMUA 3AFLA 5A3ID 1XBRA 1A9VA 4J3VA 1OT1A 4GKSB 4PJ9C 5EOTB 3ZN6A 1TO5A 12E8H 4HEPA 4MB4A 4XN9A 1JZ4A 4LIQL 5DZLA 1ICTA 4PRHA 2WLLB 3P54A 5C0CA 1OF0A 1VF5C 2FT8A 2UZYB 5GS1C 2H8PB 4N86A 5F89B 1F3DH 3H6AA 5F9JA 4YUEH 4FXGB 4PJIA 5F1KC 5F9AC 2EDBA 5LBSA 1GJIA 2A6DA 4OZGA 1Q94B 2PR4L 3IJSB 5CBAB 4DK3A 2Y06L 3IFOB 3BWZA 5AUMB 2J6EL 4BKLB 2UZXB 2IQAA 4PJAA 3ZXAC 1I1FB 2G30A 4U3CA 1OTSC 4TRPH 4UT9H 5EDXA 5GGTA 5DMIH 1Q0EA 1CTNA 5EC2A 4YDMA 1B0IA 4RFNB 4W4OA 2C4XA 2DJ4A 5F72S 2ZUWA 3P3UA 1OALA 1SMOA 1UATA 3S3CB 4WAFA 2IWEA 1UWXK 3SKNA 2JB6A 3BAXA 2BS71 3AM8C 1BREA 3ASWA 3SE8L 3TXAA 5IW6B 1LLAA 3VXMA 1MF2H 3CFBA 2K6WA 4J3UA 4G82A 2AQPA 3RRQA 4HOXA 4N1EA 4B97A 4PVLA 2IDSA 3CXDH 4RBPK 5C0RL 1NCCL 5AW7B 3I6LD 4RGND 1TKWB 3GSNA 5JIMA 4K5PA 4KHTH 1DQKA 1MQKL 4DQOH 4AQAB 1JRHL 3H9SB 1UB6B 3WEOA 1ES0A 4FXKC 3ZTNL 3SPVB 5HI4D 2OR9H 1A5FH 1EO5A 4MYWB 4JVWA 1FI8C 4WJG3 5E6RB 2YSTA 5IWLA 1MJ8L 3NEEA 1MHEB 4R5TA 2FX9L 3LIZL 3PWUA 1G7LA 3GLDA 4Y5XB 1XH3A 4ELME 1SGKA 4X9FA 3B2VL 4LDOB 1WAAF 4HCFA 4QRRB 5D1QC 3DX4A 3PPSA 4MA8H 4O58H 4YDVB 5C0DA 4L1SA 3ZR5A 4FQJL 1IFGA 5ID0B 3BSZH 1HL9A 5K9KA 3FCTA 4AYDC 1U8CB 1JTTA 4HUXA 4YDLC 5DRWA 3WS6C 1MW0A 4YL9A 4M4RB 1GW6A 1JGDA 3KS0J 4XR8C 5A3IC 4BA0A 3VYOA 2IWFA 5FHAH 4TPRH 1CGSL 4OGZA 1ZHNA 3VXSA 5HYFA 3P69A 4PGEB 1RZJL 3L45A 4XO8A 5K9OA 1XF3A 4AIOA 3VFTA 1KN2H 4FNTA 2W07B 2UZIH 2VLMD 2VDPB 3TIEA 1GOHA 3PP4L 1G9NH 3QZMA 4WWKB 3LNHA 3WNOA 5HHPA 4KK9D 2F53A 1PLAA 2G3ZA 5TK4A 5KWYC 3GSRB 5M94B 1F2XK 3QUZC 4L3EA 5I5JA 3OB0H 4UIMB 5C0IA 4N8CH 2AQ1A 3VFRB 4Z3GA 1A2YA 5DHMC 4OI8A 3V4PL 1GTNA 2IH3B 2WQUA 2W8CA 2NY0D 4FMFA 5B7EA 4OFQA 1YEHL 4P5MA 2IDFA 5C0BA 4JVPA 4HC1A 1I53A 4H4NA 5F70A 2V2WA 1DVYA 3HMWH 3DVNA 3UG5A 3IB4A 3BEWB 5IFAH 1HJCA 1JFQH 1QRNE 1WIPA 5DK2A 2DL2A 4H8QA 3VFSB 1SXNA 1BLNB 5C70A 2A74A 3BPCA 3MR9B 1A6UH 1BZQK 3FTSA 4GO9A 1HYSD 1ZXQA 3O41B 4ZAKC 4MAYB 3KM2A 5FGBA 1EXGA 1FZKA 3UYPB 35C8H 1NAMA 1A25A 4R8WL 5KJ7E 1SHWA 4EDXA 1KB5B 3BCFA 4UNUA 2BWQA 4W9CC 4NYLB 4UUJA 5IBTH 4XVTL 5KSAB 3BRFA 1NDTA 4HLEA 3EO9L 2XWJB 1FORH 1A3QA 5GS1B 3B43A 2DBJA 2EC9T 3VW3H 4P46C 2PTTA 2Z4QB 4X0KB 3QJVB 4AKQA 1N9PA 1I1AA 2J8HA 3EADA 4NWTL 3SGEI 4C54A 5IQNA 4E9QA 4L8CA 3F01A 5JPMC 1I9JH 2OXHA 4ZMQA 4UILL 1GYUA 2X0VA 4FL4B 2Y9RT 5F1OB 3DC0A 3EYSL 4PBVC 2A4EA 5F97E 2E0PA 4W9GC 2AZUA 2VMJA 2O5NA 1GOFA 3VRJB 2QVMA 1IAII 2R1YA 3AROA 3T0ED 1ACYL 2UVFA 3MN8A 4GI9A 3GUFA 4UIKH 4X7TB 3A6CL 3VWJB 3PY9A 4POYA 3ZMNA 2K8MA 4DAGH 2EVHA 5EIIA 2BSRA 1NCDH 2HKHL 2WWKT 3S97C 4IQHA 3I02B 4NNXB 5JXAL 2CU9A 1AO7D 1AACA 4FQXA 4K55A 2QMKA 3JV0A 3BISA 5CUSL 2WYIA 1MY5A 1MRDL 1N6UA 1SM3H 1XF1A 4BYHA 2HTLD 3J2PA 5DZVA 4O2FB 5ITFA 1WITA 1WTGT 3SOBH 1DEDA 5AZEL 3CZNA 3NIFF 1FFNB 1FPTH 3FF7A 1R33A 1IGFH 2CALA 3RWJA 1A02N 1JXKA 2Y7MA 4FXKB 4ELKB 1P4LB 2XWXA 4R2GC 3AUWB 2IFFH 2JJWA 5C07A 1NFDB 5IQLA 3N42B 3VXNB 1A14L 2W59A 2ODHA 5DRXA 1LE5A 4Y8AA 2XKSA 2Q3ZA 2X10A 4CVXA 2VLKE 3ATAA 1QEWA 3T6XA 4Z3IA 4JHWL 4L0PB 5IUCA 5GGTL 1S3KL 3BIBX 4TSBL 3TPUB 4MCZB 1FNGA 2W0FB 4JY6B 4NZUL 5IKCA 4NUPA 2HVKA 2VR6A 2L4OA 3G6DL 4M93C 4QRQA 4WFGD 3SGJC 3SQBA 4DVBB 1QSFA 3W39B 1IT9L 2C4FT 4IOSD 4KFMA 2XNAB 1IFRA 5JQHC 2E8ZA 3HHSA 4P2RE 2PWHA 2YAMA 3QDJD 4YDLB 4HUVA 5DJAB 5AOMA 4L8SC 2PMZA 4PBXA 4UT6H 3KPQA 4IK6A 3P9LA 4NDMA 3RUGA 4I0CC 1T03H 3WUZA 3LN5B 3JWDC 1E4WH 3GSNL 1FC1A 1EHLL 5GRZA 5KAQG 1VFAA 4KRLB 5D7IF 4C56B 4DF9A 3ARGA 3NZUA 1MXGA 3B7YA 5CU5A 3PGFL 1HOCB 1QYGL 5DJDB 4BSWA 1TZIB 4K94L 5EIVA 4U49A 1HSBB 1UD5A 3AS2A 3NCEB 1HINL 3ESOA 8PAZA 1KSRA 3D51A 2YZ1A 4QHLB 1OK8A 1QUPA 1BEYL 2XTSA 3VH8A 3QUZB 2DJMA 2NY7H 3AWFA 4GSXA 2ZX5A 3TEUA 4TQEL 5SWSA 3KLHC 1HXYA 4TSCH 4QT5A 4UQDA 4OZHF 1TZAA 1U33A 4EI5D 2IH9A 2CE6A 1IGJB 3KPMA 4YSEA 4C83A 6TAAA 4NT6B 5EBWA 4AW7A 1ZT1B 1S7XA 5I66A 2VN4A 4KQ4L 2DMHA 3C2SA 1H3WM 3FU5A 3DUUA 1HHGB 1KLGA 3FU0A 2XV3A 5EF2A 5DEJA 3QUGA 1HNYA 5DZNA 3KLDA 3WXVL 5B38A 1X5IA 1KPUB 4J39A 4TULL 2AQ2A 3N85H 2F19L 1E4XL 3QFJB 4L9LA 3FBKA 4JPIB 5D70H 3V10A 3CMOL 1ZSHA 2ADJA 3QUKB 2X0WA 2WW8A 3G5YB 1CK0L 3HFMH 4LNVA 1NIDA 3L3GA 1OAKH 3NQIA 1WZLA 3HMXH 3Q9QA 4EN3D 5CHNA 4BJLA 1NGWA 1PEWA 3N40P 4IGBC 4AJYV 4FHKA 1FCGA 3C12A 3GD1C 3K71A 2KZ1B 1YPZE 4N2LA 2NX5E 4Y4KC 1DFBH 3EGSB 3LRSA 3RAJH 1WA0X 3VGAB 5CEZH 1NKRA 1A9BB 1MLCB 2LAAA 1NUDA 2AEOA 4PB0H 4ZSOB 4F24A 5EEWA 2IPKB 3CD4A 2GJPA 4P46B 5MHSD 1AC0A 1R1CA 1T21A 1ZA6B 3MDJA 3MNDA 4FFZH 4P2YA 1OAXH 5G4OA 2QGCA 5JPMB 3CFKA 2NXYD 3A5VA 4EDWH 5D7LB 1QWUA 5DC9B 5C0GA 3GXNA 1Q9OA 4XHJD 5JORA 4N2OA 2QDWA 2CZNA 5IW1A 4ZMZA 3OL2A 1KCWA 4HC1L 2AJZA 4G8IA 5T1MA 3TGXA 4OY9A 2X89D 3WUWA 1FNSL 5A2CA 1B9KA 2P24A 3ULUL 1S5IH 3CUPB 4PJDE 5D1ZI 5I6XC 4MJ2A 5C3TA 3TBSB 4OFKA 4CJ1A 3FHAA 1W0VA 1BIIA 3GT6A 3JVGC 4YHNB 1MCPH 3UMTA 3M7FB 1MAML 4R4FL 1NEZA 2EEFA 4NN7C 5EDSA 2BS9A 3ARXA 4Z6AT 1RIHL 2F1AA 2R4RL 4FCAA 4JFFE 3MGOA 1NCJA 2R0KH 5MENA 3MUGA 1E9OB 3O45B 1NAML 4GQ9L 4PJ5B 2EDMA 3HG1D 1ZLVH 2V9TA 2EADA 4XB3A 3CU7A 3M1BA 2ICWJ 1MHPH 1JYNA 3L4UA 1Q72L 4KK8C 4PTUA 5EN3A 4RVBA 4R2GB 3ZSTA 2QADD 3BVWA 4KJQD 4AMXA 2VDKL 2X4PB 3FT1A 4UMSA 2CDEA 2M8XA 4B5EA 4ZFFA 1EEYA 3TH2T 2YARA 2BW5A 1TCMA 1H5BC 2AJYH 3VGDA 4M6ML 3FB8B 1CZ8H 3HG3A 2F8XC 4HEME 1F6AA 5LWYH 4AZ8B 2CDGB 3QEHA 4M93B 4TUJB 1E5BA 1OD9A 3GSUA 2V5SA 1ED3B 3OAZK 2P5WD 2ICEC 4FTVD 1V3MA 4N6QA 1MELA 2WNGA 4F2FA 2QQQA 1O5PA 5DD3H 1F58H 4NZTH 1QBML 3T8XA 3PQYA 1CGWA 2CJUL 1PYWA 2XQ0A 2ZT9C 2UWEE 3FRUA 3ZRCC 5I8OH 1KBGH 1DQQB 2BPBA 4GKNA 5BZZA 4IMKA 1A6VH 1I85C 2AEPH 1F4XH 4PWHA 4GXUN 2K78A 4HIJB 3II1A 4UF7C 4AQAA 3MLXL 5I8CB 4ODTH 1S7VA 4G1MB 3FFCD 5LGJB 4BFEA 2AK1L 1YEDB 4HGMA 1D3CA 1ZA3A 3BQUD 4M6NL 4HIEB 2YPVH 4NQEB 2VMFA 4ODHL 1B3IA 3U0PB 2B2XL 2Z64C 2HKFH 1ZDSA 2NY3C 3BH8A 4MLIA 4DK5A 1WA2X 2WOYA 3KG5A 5GS0D 4JG9A 3QWRA 3HC0B 2DWEB 3O6KH 2GSIA 2SEBA 1MH5A 2BO0A 4JDVB 4KKAD 4AJVA 1FL3B 2Z1KA 1CD1B 2GVYA 3F05A 1QLRB 3E80A 4UM9B 3UTTA 3EJYD 3FS9A 5GJTH 3TVMC 4UQ9A 5HI5D 1NANI 2X9WA 1A3ZA 2CAKA 2UY7A 3HVDA 3MMEB 4YO0B 2VQUA 4HWZA 3QRFM 3SE4C 2AEQL 5EOQL 5IM7A 4BWUA 4K0OA 2HN7B 1T04A 2ARJA 2GT9A 2Z31A 4NKQB 2P5EA 2ZONA 4XPFH 5ECJE 3LZPA 4RSVA 2OP4H 4KTDL 3L7EB 4GSDH 4IRJC 4M61B 4EMZA 2JCCA 5EF1A 1NLDH 4IGBB 3IEAA 4F8TA 5BO0D 2OXGA 2XWTB 2UXTA 3PGCB 4V2BA 3GRWL 4Y4KB 4Z7OE 5HYJD 4GRWF 5HHVH 1KENH 2FD6H 3LPOA 1UT2A 4WHYH 1CLYH 3K4ZA 4G8FA 1CQKA 3VSUA 1G0YR 3MYJB 3PWVB 3QQ3A 3T3PF 1NTDA 1AMXA 4ZW5A 3S2AA 4YLCA 5IOPA 4ABQA 1HK6A 2BOCA 5IJVB 1A7RH 1T1ZA 4H26B 3MRRA 3BMVA 3NCFB 4JFDB 2WIMA 1DJZA 4K3DH 2J6WA 1XF2A 4QJ3B 2R2BA 3DX6A 2DQUH 3HE7D 4JL1A 4I0PB 3WNKA 5GRJL 1XB3A 1QRNB 4UAOC 4JQVA 1CICA 4OIFA 4ERSH 2C1OA 3CLFH 1OPGL 5C0AA 4ENZA 5LCVH 5C0FB 4JFZL 5GGSY 4PJ7F 5DA4A 5HHME 1JL8A 4NN7B 1LGVA 4KX9A 4F58H 4PYHA 1HEJC 2NUPB 1YNTF 3BW9A 1MHHA 2MNUA 3WJLC 1DUZB 5C08A 2JK5B 3CC5A 3ZHFA 4JFEA 5CP7A 4FG6D 4X7CC 1FZOA 3VI3E 4JO8A 4PS4H 4BRVA 1FGVL 1KNOB 3AS1A 4ZFGH 1DUYB 5DJXA 1I4FB 5D7JC 4XT1C 1H3TA 4QYOA 1IU1A 5BMFL 1X7QB 1VHPA 4G7YL 4FQ1H 5E08H 4NRXB 4OZ4A 3EGXB 3QCVL 3QWOA 4BXVA 5GS0C 4UM8B 3WHXA 3S96B 2PP7A 3O6LL 4RAUA 3RTQD 3D12B 1HQRA 5M7QA 5AW8B 1WBYB 1BVZA 1RXLA 1T2XA 4ICXA 2XRAH 5IB1A 4L3FA 3MU3A 4KJWC 2E59A 3QIBD 3EJSA 3QI9A 3ETTA 1DVFD 4LCWA 3SJVE 4BH8A 1M2OA 3A6BL 5J12C 4FCHA 4XI5D 5C09D 3CFUA 5TF1L 2ICEB 1ETB1 3KZ8A 3QDME 2D3JA 1QQDA 4HMEA 2WJ5A 1N0LA 1XR8A 5DJZB 1TQSA 1KLUA 2WUBH 3BZ4A 3HLKA 3OKKB 3ZHNA 1NOLA 2VL5B 2DYRB 1I3GH 2AEWA 1AZVA 4HBCL 5LNDA 4OJDH 5IGXL 4PJBE 4JAMA 1Z9LA 3ARFA 1OXYA 1RKRA 3UYRH 4NERA 1FVEA 1LWRA 3RDJA 4JUSA 4BSVA 4CN1A 2NNAA 4RSYA 4WU5A 1BYOA 3NA9L 3K2MC 1J5HA 4PGCA 4OD3H 1VZGA 2PCFA 3MLUH 3E38A 3CFJA 2VLKB 1LILA 2NY3B 4N2KA 3QEGH 4AGLA 1H0DB 3W9EA 1KEMH 1JXGA 3L3IA 2B0SL 1B2WL 1KLFB 1YECL 3TNMB 3EIFA 4L9DA 3RWIB 3CXHK 1JZJA 5KVDL 1RUPL 3KM1A 4ESKA 4L0ZA 3D0LA 2ICWA 3O8XD 3P73B 4H20H 2G2NA 4R7DB 3V5DB 3KPNA 4P2RB 3IS0X 3O3DB 4TLUA 5HHNA 2IQ9H 5KSBF 3CU1A 3COOA 3RTLA 3LKQB 3RGVC 4N0UA 5L88H 2VW7A 3GO1H 1Y0LB 3SKUD 1GS8A 4XP9H 2HLAB 1IBGH 3RBSA 1IAOB 4KROD 3US1A 3EF7A 4GAYB 1O6VA 1AGCA 1BG9A 5ADOH 3HBZA 2WZ6A 4MJ6B 4FLQA 4JGUA 4MS8D 4IRJB 2P52A 3PNWB 4JKPL 2ZSWA 4OF6A 3FKUS 3R18A 5I5MA 3DX7B 3RVVD 2R39A 1OGAB 3D06A 4N68A 5E2TL 2ZD0A 1NFAA 2C7UB 2H2PC 1B0WA 5BZXA 1LO4H 3APFA 3GTNA 4Y1TA 4C4KT 3DX2A 4NKDA 4NQCE 3BE1H 3NJKA 4A55A 2BIMA 2AK4D 3MX0A 4P5KB 3QRLA 1EVTC 3D5OF 3LVEA 4L23A 4ZX4A 3BP7B 3FUNA 1MWAA 4QAWA 1IGTB 1WFNA 1D9KD 4N8VA 2YRLA 1X5YA 2QGEA 4ZMVA 1OCRB 4PRDB 4I87A 2UX7A 2Z65C 3QIBC 3W37A 2CKBH 4PSRA 5I30L 5KBPA 2F5AL 5F6HI 2EIKB 2ED6A 2FGZA 2RAMA 1IFHH 4XI5C 4PR5B 2H1XA 2B16A 1DJHA 2A9DA 1DVSA 1ACXA 1I9RL 3PNRB 4UAOB 4NFCA 3S0PA 5GGRB 1HX0A 1C08A 1NMBL 4K7PY 2C9UA 3UYOD 3NEXA 1FO0L 5A6LA 1HXMB 1I7ZB 1E90A 2ITDA 3VD1A 3FUFA 4IBUA 2ZPKH 3FB7A 5ILTH 3EYFA 4FQIL 4ZPVA 2W65B 3PFUA 4LSPH 4KAQH 4JPVH 5CEYB 1BQKA 4JDEA 1ZHKB 3L8QA 1Z7JA 2VDQB 2NX5B 3NN8A 5KVEE 4H2AA 3FT2B 2FWOA 1L9RA 2FNWA 4W6YB 3ESUF 4CSTA 3FQXA 4LEXL 5J4MA 5JW5A 1AGBA 3FNKA 5D7JB 1NAKL 4JO4H 1JV5A 5GQBA 3W3BA 4N6RA 4PLKC 2J1WA 4OGXH 3VXPB 3HG2A 2CGRH 2WQVA 4LU5H 1CL7L 1C16B 3MFFB 4RZKA 4L8BA 2ZSVA 5JHDA 1VGKB 5GHWH 2J2ZA 2Q2EB 1RV6X 2BNUB 2FLBT 1J1OH 2FE0A 3QBTB 6PCYA 3CDCA 1HHJB 3WGVB 4FFYA 1N0XL 5CNHA 4PJDB 2Y69B 3VVWA 3CH1A 5JDJA 2QFPA 5J12B 4GBXA 4MD5A 4R7LA 1CS6A 1GKOA 1JGUH 3A4FA 4Z7VE 1MJUL 1RIUH 2J1YA 2Y1AA 1DQJA 2NYYD 1OAQH 4JFFB 2IGLA 1NSNH 3SDAD 3KL3A 3RFZA 2GITA 3SN6N 4C8XA 3U7AA 4KPHL 4U4BA 4HIXH 4RGOH 1PVHA 3RVTD 2E46A 4KMQA 4MS8C 1JHTB 2YAHA 2IGFL 2O30A 3FJTA 2AMGA 3S9DB 4ZMLA 4EKXA 3HC4L 5MEQA 1M3IA 1TPXC 4DEWA 5A7BA 2VLLB 3RVVC 3HAEB 4NPJA 3C5ZD 1PZAA 5DZ9A 1RZ7L 3U1QA 3WLWC 1BAFH 2HCZX 2Z9TA 43C9B 5AENA 4OSUL 4ABWA 1X5ZA 2XXCB 1G6RB 5D2LF 1IEHA 2IALB 2VXTL 3TJEH 1PTZA 1PZ5B 3EBHA 2YIHA 3FN0H 3K8LA 4G71B 3GSWB 5MP6H 3PHOB 3UAEA 4Y5YC 3NCJL 1HHHB 5DT1L 5I23A 4YBQD 3CDYA 3L4WA 1KT2B 5KW9L 2J25A 5HHXH 4Q6IC 2WWKO 2V7NB 1AQHA 1E9QB 3O2VL 5EUOA 4FYQA 1KEGL 1LQSR 1FVDB 1FNFA 1KCBA 4D9RE 3RGVB 2WGXA 1INQA 1AHMA 4P05A 4P2CG 5CIPA 3OX8B 3ELAT 5DFAA 2P9RA 1A3LL 5E2VL 3SD2A 1GJUA 4NRZB 3D4ZA 5LXVA 1MIEL 1MFVA 5IB5B 2FBRA 1UXSA 4NZJA 1RZIB 4QPEA 4WRLA 2HWZH 5DI8B 1SOKA 1MCNA 3B5TA 1XGYH 2QSVA 2COVD 2FEDC 2DWXA 4U2ZA 4CNIB 3VAEA 5CJQL 4FFTA 4FQHA 5T3XL 2EH7H 2EXYD 5IHWA 4OLXL 1UWFA 1XFPA 3QHFH 3FCUB 4OIIL 4ZFOL 2OSWA 1MREH 4YSSA 3T4AA 3PPEA 5FKPA 5T5NG 1M71B 1USZA 3VGHA 3NCXA 2MQGA 3B6SA 3FONB 2IEPA 3MLZL 2R9HC 2ZG2A 1FN4B 2H3KA 4QXTB 1JV2B 5E6IC 3GMQB 3HE6C 4HZLB 3BFWA 5EO0B 1KN4H 5EZIL 3X2QB 5ALBL 1RPUA 3SQOL 2WTRB 4U1GC 1Z3RA 1JTPA 3M86A 1XR9B 3BHBB 3OR6A 4P48A 5F7YC 4F3FA 3ZDXE 3KLQA 4AJ0A 5KS9F 1IBYA 4LPXA 4LSVH 3K72A 3RVTC 5G2NA 5T1DH 1VDGA 1CGYA 3FCBA 3S36L 2C26A 4ADJA 3L17A 1PDKB 1WFMA 4JANB 4MZ3A 2XIIA 4KHXL 3V79C 1WCQA 1U8IB 1T80A 4NPYA 9PCYA 4OVVA 4WCYL 3BRDA 4Z7OB 2WHVA 3C5ZC 3II2A 3VI4F 2BY0A 3IMWA 1A6WH 4LAQL 2Y25A 3NUKA 3ARBA 2GKIA 3OWRA 4HLJA 5MEPB 5D4HA 5EOCH 2YKLH 4MNGA 5JYMA 2BXZA 3ROLB 4GJTB 1TTAA 3ZDYF 1HH9B 2FJFB 3R1GH 3KLAB 1Q1JH 1MWAL 4PJEA 2JB5H 3L9RA 4YGVB 1TO4A 3VD4A 2X41A 4YS4A 1ZEAH 2ZZUT 4AY0A 3O4OB 3W81A 1ITBB 4MJ5A 4HBQA 4I18B 1YY8B 3AABA 2DEXX 3GBDA 3JWNE 3LZOA 4UOQA 3TA3D 3U7YH 3MC0A 3DECA 4Z0XB 3S5YA 3D52A 1C5DB 3WDHA 1F6FB 1J5CA 3MCLL 5BCAA 5HHMB 4ALAC 1M2VA 3ABKB 4OBSA 1ZLDA 4X50A 3ENEA 3MGTA 5GZOC 1MCSA 1F1GA 1PZ2A 3L4YA 4QRTA 5E8EB 2CO7B 5GZNC 5IIEB 4Q7DA 3IF1B 5FPIA 2QVKA 2A9NH 4XVJL 2EYTB 3E9UA 3CE1A 3DK0A 5DEFA 3TN0C 4XO4A 1PAMA 2ZXEB 3VI3B 3OLDA 1TEYA 2FRGP 2G3XA 1WE5A 4PLJC 5AG9A 1SHMA 1TPXB 1ORQB 1BVKB 1AGFA 3BH9A 1QA9A 2L7EA 5ALCH 1DLHA 5DR5L 2VXQA 4JZJC 4DKFH 5FB8B 2OL3L 1KV3A 2VDLL 3LNFA 1XGPA 3VE0B 1FE8H 1LYQA 2F1BA 5D7SL 3LQAC 2N3JA 3L7FA 4H1LG 4Y7OC 5ABAA 3VTMA 2V3EA 1U92B 3HUJE 1FIGH 2R2HA 3CBKB 5J1TC 2PNDA 4LCCA 2QPFA 4Y5YB 3SJVB 1U6AL 4R26L 4FFYL 3VD5A 3OKMB 3K81A 4YSCA 3SKMB 5KSVB 5HJDA 2VSCA 3A4DA 3TPKA 5HHQA 5I6NA 4GINA 4M7KL 2N56A 1CFQA 1NGZB 1QI5A 3G6JA 1I31A 2H9GB 5LBGA 3TYFA 1A4BA 3UAJC 4H1LB 5JDSB 4ZNCD 1UQSB 3LZQA 1YDPA 4LIQH 1BZDA 2WBJD 4KDTC 5JHMA 1RZPA 3QG6B 4MCMA 3QDAA 2DWDB 5LAXA 2JKRM 2IADB 4PJBB 5T5FA 4PRPD 7CGTA 5I0DA 1Z9NA 3HZYB 3UAFA 4LHUA 5E4IA 4JHVA 2CA4A 4LEOA 5E9AA 4WUUE 4TN9A 3V0AC 3DA0A 3KWTA 3HKZA 4LNRA 3ZDZB 1WTLA 1Y6KR 2VXSL 3AADB 5EG6C 1FRGL 4E9XA 4KNSA 5CLTA 4MS6A 2PR4H 1LNUB 4NP4L 4K3JL 2OI9C 2H26B 2VABA 1HL5A 2J6EH 3IRPX 3BD5A 3LAFA 1WHPA 3BJLA 1QVOB 2E8YA 3T0EA 4R4BB 3PU7A 1TENA 4F80A 4NRYB 2M83A 2YJLA 4GG6A 1VSCA 2X70A 3ZKQD 2GJ6D 5IHHA 3FC8A 4GLRH 2ZG3A 4XN7A 4YDZA 4GUPA 3D9AH 4LFHG 3GB7B 4FYTA 3NACH 5E6IB 3HE6B 3SE8H 2F18A 3FSVA 4F9LA 4Z0BH 4QHUB 1AO7A 3VTTA 2AHIA 1YQVL 3RNQB 1CJYA 2CO2A 3TLRA 3ZTCC 3L3KA 2BDNL 5EMYA 3T6QC 3KAAA 3T09A 1P6FA 3FO9A 3ZKMC 3MREA 1ODUA 3CZFB 3HC3H 5C0RH 1NCCH 2D31A 4DP4X 2J12B 1MFBL 4GRMB 4Q2ZB 2FHBA 5C2UB 3DUSB 5IVXF 3LH8A 4RQQA 1MQKH 4PRIE 1JRHH 4Y4FB 2ICES 1SQMA 4HETA 2ZG1A 2HG5A 4LEBA 1G9HA 1YEGL 3GBML 3OB0K 4XP4L 4FG0A 3UJIH 3JXAA 4RDQF 4F9PA 4NQCB 4YE4L 1U58A 5IB2A 1MHCA 1MJ8H 3TP4A 1BFTA 3LNIA 5C97A 4LE8A 1MI5D 3EFOA 1I1YA 3F5WB 1OZTG 4IOSA 1EHXA 1HCYA 4YK4C 3B2VH 2I07A 4QRPE 2E47A 2MTPA 4HJJH 3QDJA 1U3HA 3GI8L 3QWQB 4FQJH 3KPSE 5J6GA 3GMNB 4ODBD 2NY1B 5DJCB 3EJQA 1X5MA 1X4YA 2XVGA 4YNYA 1OGSA 3ZPDA 3CDGB 5AVUB 1U8JB 5LUMA 1UJ3C 1N5AB 3CV5A 4OZFA 2A73B 3BYYA 3FFOA 5IB3A 2Y2TA 4NHCH 3OF6D 1ZDQA 4PRNA 2WQ8A 3OMIB 2WBJC 2C9SA 5AAMA 1RZJH 3D7PA 2VAAB 2HT2C 3O9WC 5DHVA 4YHIA 3AGVA 1IKNC 2W9EL 1J8HD 1R5WB 1JVKA 1E4KC 1UB5A 5TTRA 4HF5L 4ZJ9A 4AKPA 4D8PB 5FA3A 3S36X 4GFTB 1U8PA 3PP4H 3TBYB 3MJGX 4UV4L 2H0JA 4LRIC 4PJAF 3RNKA 4HVBA 3NJVA 4F37K 2PCPB 4IRSA 2BLFA 2DMKA 8FABA 5B39G 3CJJA 1NH6A 4L5FE 4EI5A 3V5HA 3DTUB 3ZDWA 4M5TA 1NC4B 5CEXA 1BQRA 1A6AB 5E23A 1OKEA 4XN5A 5EU4B 3VG9C 4HJUA 1ZIAA 3V4PH 3HJEA 2TRYA 4HDIA 2JH2A 4C4BA 4OKVA 1YEHH 3KHQA 3CZEA 3T0AA 1M7IA 4E2OA 1OE1A 1MVYA 5B39B 2DWYA 3JWNC 4F1ZA 4RRPG 4EQ2A 5IMLB 3RY6A 2PLTA 1T3FB 2JVUA 1B0GA 4B0MM 1NIFA 4NBXB 3B2XA 1I8LA 3AMLA 2ZQKA 2RD0A 4HFWB 4PD4K 3SBRA 2YQBA 3SZKC 2X4RB 4R8WH 1JWUB 2G3NA 4CL7A 2WXOA 3VM7A 4XVTH 5IJBC 1XGTB 4JPSA 2VN6A 3EO9H 1HI6B 5SX4I 3T6WA 5E6ZA 1SYSB 3MRIB 1CGUA 2HX9A 1QLFA 1ZV2A 1OF2B 4ZFZA 3QH3A 1NFIA 2QR0A 3WNLA 4KKLD 1TNMA 1XGRA 3RWDB 1P1ZA 1OSPL 1FL6A 1QNZL 4NWTH 6PAZA 3L3DA 5BXFA 4F57L 1PKQA 2OI9B 4P4KC 4UILH 4J3OF 3EYQC 1CBJA 2VXQL 4LT7A 4Y2DC 4OKDA 2XWCA 1AGDB 3EYSH 5AYQA 4U6HB 2VDNB 3FQNA 4XXDA 4M6OL 5I1GL 3QIUD 2ZJSH 4KOBA 2XVBA 3TYGL 3L5WB 1F11A 3LRMA 4FI7A 3ECBB 1G7PA 1ACYH 4L4VD 1YY9C 3V9FA 3V4VB 3JV5A 5B4MD 2VJ0A 3FQTA 1NIAA 3FB6A 1LO5A 4MDIB 3A6CH 4GS7C 3R8QA 3TO4A 3VUAA 2HT3C 2WZPD 2Z91B 3OKNB 2WCSA 5CGBA 5DUBB 2HKHH 1IBDA 5CD3A 3RPBA 4RMUA 3RHWF 5JXAH