1NIDA

The structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
333
structure length
333
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase (nitric oxide(a))
molecule keywords NITRITE REDUCTASE
publication title The structure of copper-nitrite reductase from Achromobacter cycloclastes at five pH values, with NO2- bound and with type II copper depleted.
pubmed doi rcsb
total genus 88
structure length 333
sequence length 333
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nidA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nidA02
5AKRA 2XVBA 4G7SB 1T5KA 1L9TA 2PLTA 2PP7A 1NWPA 1X9RA 3WKQA 1GY1A 2HZHA 4DP8X 2BHFA 3EF4A 3EH5B 2DYSB 3MBWB 1V54B 2DWTA 2GSMB 3ABKB 3AG1B 2AZAA 1IKOP 1ET5A 1A4AA 3ABGA 1V55B 3N55A 1XMEB 4UF7C 4DPAX 3TBCA 2J56A 1A3ZA 3JT2A 2B3IA 1SF5A 1VLXA 2PPCA 1OV8A 2FQDA 4KO5A 4CSPA 3FU7B 1YLBB 1W6WA 2XXFA 2IDQA 1ADWA 3PCYA 4DP0X 4DP5X 4BWUA 4KOCA 3X1BA 4DP2X 1NIBA 4YSSA 1E5YA 2BP8A 3UABA 3FU7A 1PCSA 2N0MA 4NERA 1J9QA 1KCBA 1AS7A 4PAZA 3ZX1A 2LLNA 1R1CA 1PMYA 5I6NA 4RH4A 2AZUA 4E9TA 4YSAA 1UATA 1BXUA 1CC3A 3MX0B 1WAEA 1MG2C 3QJTB 1JOIA 1URIA 1JZJA 1AACA 4KO6A 4Q8BA 3NJMA 5TK2A 6PCYA 1JXGA 1XB3A 1ASQA 1J5DA 3X1GA 4X4KA 1KV7A 3WI9A 1J9SA 3UACA 1SDDB 1MDAA 2IDFA 1ZIBA 2HRHA 3HEIB 3SQRA 5I5IA 4N8UA 1A4BA 2JXMA 3DIVA 3NP4A 3RYMA 5B1JA 1ID2A 4NB7A 1PLAA 4P5RA 5I5MA 1SFDA 4JHUA 1TEFA 1KYAA 3CVDA 3PXLA 1IBYA 1BXVA 1IBZA 2VM3A 4HCFA 3AG3B 2AFNA 3FT0A 1KGYE 1A65A 1PZBA 3PAVA 3UAEA 3WIAA 4DPCX 2E86A 1ILSA 1ZDQA 2PP9A 2GC7C 4A2FA 3QJUB 4GXFA 2BO0A 2FJSA 2VMJA 3AY2A 2EIMB 5PAZA 3QJQB 1AAJA 4YL4A 6PAZA 1X9UA 2WO2B 2AANA 2JKWA 2TSBA 1J5CA 4HCIA 2H5UA 3FPYA 2J57A 1E67A 4DP4X 1NIFA 4E9SA 3AZUA 3OMIB 3C75A 4YSRA 3TASA 1CYXA 1PZAA 1ETJA 2IWEA 2XWZA 3WNJA 1BQRA 3PLYA 4BWTA 1FWXA 2DWSA 3NJNA 4A66A 1AIZA 3CG8A 1GS7A 3T6ZA 3NSFA 1AS8A 3EH4B 1RKRA 1L9RA 2GBAA 1PLBA 1TU2A 1PLCA 3FSVA 1WA1X 1QNIA 9PCYA 1W6LA 1OE1A 2EINB 1AG0A 3UGEA 4YSPA 1AG6A 3OD3A 2PCYA 4GP4B 2I85A 4YSCA 3CVCA 3ABLB 1JZHA 2IAAC 2XX0A 1BYOA 1A4CA 3ABMB 3DTUB 4HAKA 1NIAA 5EHFA 3AG2B 2XU9A 1L9PA 4G7QB 2IH9A 1HAUA 2HRGA 5D4JA 1PNCA 4YSUA 3CZUB 4FAAB 5I5JA 4F7KA 1IUZA 5AFAA 3OMAB 1OE3A 4GP5B 3ZIYA 3AG4B 4AI7A 2H47C 2BP8B 1NWOA 2YXWA 3FYEB 3FYIB 4A2EA 3OMNB 3KW7A 3S3CB 1NDTA 5I6OA 2OJ1A 1M57B 3ASOB 2XV2A 3NJFA 4Q89A 2CJ3A 4YSQA 4E9RA 3FQ2A 1AZUA 4WTQA 4A68A 4A67A 2FT8A 1QLEB 2NRDA 1PY0A 3QJSB 2RACA 2WO3B 3T6WA 2YXVA 5I26A 3AW5A 1KDIA 2B08A 1WA2X 2VW6A 3CVBA 4F2FA 2X88A 2ZXWB 1E30A 2P80A 4PCYA 4QLWA 3L45A 4ZK8A 4KOBA 2GI0A 2HX8A 1WS8A 1JZIA 1HFUA 3SBQA 4AKOA 2VN3A 2GHZA 2HX7A 4AX3A 3FQYA 1CYWA 2HXAA 4NAJA 1M56B 3OQRA 1ET8A 2QT6A 1ZV2A 4KNTA 3IE9A 3G5WA 4E9QA 3NJJA 3ASNB 1AANA 2MRYA 2Y1AA 2UXGA 1JVOA 3WNIA 4DP7X 1NIEA 2PPEA 3EHBB 4BWWA 3D12B 4EF3A 1XB8A 2J55A 2UXVA 1NZRA 4QKTA 5B1JC 5B1AB 3S3BB 2PP8A 3DKHA 4DP1X 1KDJA 1EZLA 1MZYA 1AZNA 2PPDA 5F7BA 1PNDA 1N68A 8PAZA 3PAZA 1RZQA 4GYBA 4UAHA 1TEGA 3X1FA 3TU6A 2PPFA 1WS7A 3GYRA 2BWIA 5B1KA 2YAMA 3FSAA 5E9NA 1SF3A 2Q9OA 4ENZA 1PF3A 2WSDA 5B7EA 3H56A 5I6KA 2R7EB 1E5ZA 3NSDA 2XYBA 3QQXA 3IN2A 4HCGA 3BVDB 4TXVB 1BYPA 3TA4D 1ZIAA 2DY2A 5ANHA 4FA7B 1CURA 1I53A 1OF0A 1GSKA 2R7EA 4WKXA 4HHGA 2W8CA 2HLEB 2J5WA 2DYRB 4GP8B 2CALA 4MFHA 2YAPA 1NTDA 1ASPA 1W8EA 4AKPA 1PAZA 1JZGA 1PZCA 1AQ8A 3KW8A 3TBBA 2FQGA 3QJVB 3NSCA 3T9WA 3X1NA 5B7MA 2QDWA 1IC0A 3SBPA 2H3XC 1DZ0A 2CAKA 2QDVA 1FA4A 4BXSV 2PCFA 2VW7A 4E9VA 1DYZA 5A7EA 2EILB 4A2HA 1SHWA 1M9WA 3GDCA 3NJHA 4HHWA 4E9YA 4YVNA 2FT7A 3NSYA 3OM3B 1CUOA 2IWFA 1OCCB 1JZFA 5I6PA 3SBRA 2XLLA 1OE2A 2OCCB 1KCWA 2FWLB 4JKNA 3PAUA 1JZEA 1A8ZA 3JTBA 3UADA 5TK4A 3N2JA 4M3HA 2JFCA 4E9WA 5I6MA 1SJMA 1J9TA 4DPBX 1EHKB 4KNSA 5B1BB 2XV3A 2I7OA 2YAHA 3IBOA 1GYCA 4DP9X 1ASOA 3X1EA 2BP0B 2XX1A 4F2EA 2BWDA 3FQ1A 7PCYA 4BDVA 5B7FA 1E65A 2FQFA 1NPNA 3WG7B 3T71A 2BP0A 4YVUA 4DP6X 1ILUA 2BZCA 2FTAA 2FT6A 3FU8A 2XV0A 3X2QB 4YSDA 2IH8A 1BAWA 2UX6A 2XUWA 4UANA 1AZBA 3FSWA 2YAEA 1B3IA 2YARA 4G71B 2EIKB 4AKQA 3NJGA 1AOZA 2UXTA 3NJKA 2ZWNA 4A2DA 1QHQA 1NINA 2Q5BA 1JVLA 4E9XA 1V10A 4AZUA 2CCWA 7PAZA 1BQ5A 2IWKA 2FQEA 1SFHA 2ZONA 1GS8A 4N4YB 1GY2A 4K9JA 1MZZA 1SHXA 3NT0A 3V9EA 2ZOOA 3QPKA 5IY5B 4L0PB 1XB6A 3NJIA 1OOWA 1N70A 2W88A 1FFTB 5F7AA 3FPXA 1NIDA 1ZDSA 3BQVA 2OV0A 1HAWA 3S8FB 2HX9A 2X87A 3T6VA 2IDTA 1L9OA 4YSOA 1SDDA 2TSAA 1OCZB 3ERXA 2A3TA 1JXDA 3EH3B 1GR7A 3H4FA 1F56A 4JHVA 3FS9A 3T6XA 1AS6A 1TKWA 4KNUA 1ZPUA 3CDZB 4BK5C 1MG3C 1NICA 5LDUA 2YQBA 1BXAA 1BQKA 2PPAA 3IN0A 4BXVA 4HZ1A 1ET7A 1GW0A 3S8GB 3CDZA 5D4HA 1AR1B 4KO9A 5I6LA 2CUAA 5FC9A 2I7SA 4P5SA 4CSZA 2IDUA 2XXGA 2GB2A 3WKPA 1KBWA 3HB3B 2YAOA 1RZPA 3GXUB 2QPDB 1BEXA 1L9QA 2QPEB 1SNRA 3ZBMA 1RCYA 5PCYA 3U25A 3FU9A 3PPSA 2VSMB 3NP3A 2BW5A 2IDSA 4HIPA 2UX7A 1AZRA 3NYKA 1NPJA 3IEAA 2FNWA 4KO7A 4G7RB 3V9CA 2YAFA 2VSKB 3QJRB 4A2GA 1JERA 4HALA 2P80D 2MTAA 2GIMA 2CBPA 2VW4A 1KBVA 2BZ7A 4W1TA 2AVFA 2BW4A 1AZCA 4M4RB 3FSZA 1GS6X 1OCRB 2VM4A 3ZDWA 5I28A 4W9ZA 3S3DB 5B3SB 4YSEA 2UXFA 4G72B 4G70B 1WA0X 3H4HA 4YSTA 5D4IA 1JXFA 4GY4A 1OCOB 2YAQA 2GC4C 2Y69B 1J9RA 5AZUA 1L9SA 4BDVB 2EIJB 2DV6A 3UAAA 3NJLA
chains in the Genus database with same CATH superfamily
3TVMC 1NMBH 4DZBA 4YGVA 3MNWB 4W9IC 1ZGLP 1AY1L 4P57B 4YDZA 3MBXL 4TL5A 5IFJB 2EABA 2KQMA 1F02I 1KCVH 3CN0A 3BMVA 1YDPA 3EH5B 1CFTB 3KLAA 4AIXA 3TCXA 1K4CB 2W94A 4BFOA 1MCOL 1VGKA 4PLJC 2ZUXA 4ZOCA 3V6ZA 4CA4A 2KKQA 2P43B 1D5IL 1QP1A 3ARBA 4QXUH 3B5GA 5HYSA 1BGXH 1R33A 2Q1EA 2EE9A 5KG9A 1ORQA 4IBZA 1IT9H 4Y9CA 1B2YA 4HC1L 1A4KA 1MNNA 1PCSA 4I77L 5C6TH 5C2UB 1Q9LA 1F4YH 4LLWB 5AZ2L 1D5BB 1XIWD 1J9QA 1L7TL 5FOBB 1I3GL 1ZLWH 4P5TC 3RB5A 1RJYA 2VLLB 2B39A 3SZ6A 4HGKC 1QI5A 5G55A 2LLNA 3KH3A 5HI5C 2H6OA 4EXPX 2VOTA 3D69B 4PJBA 2QR0B 3R1GL 4YSAA 1BXUA 2VAJA 4WK0B 3M6DA 4NP9A 3UEQA 2P8MB 4PP2A 4EDXA 4R4ND 1BQUA 4X8JA 3OVUB 3WN6A 4NUJB 3S37H 4C83B 3WEMA 1M42A 4NZFA 2ZOWA 1ZCRA 3GGWA 2CH8A 3VFRB 4X6CB 3B2PA 2AK1H 3OWRA 5CF3A 3MGTB 1YQ2A 4MCYA 3EOTH 3H9SD 5IQ7L 4XNYL 4ZUVA 1S9XB 1OLLA 1IC4H 3PPEA 3NIDB 2NXYB 3UZEC 1GCYA 3PHQA 2YMOA 1F11B 4AM0B 1A7NH 3FO0L 5DUML 5E6RB 2YSSA 5HGBB 2GY7B 3F8UB 3O6KL 4OIBA 4KUZH 2KLSA 3N6YA 4RMBA 3B2MA 1S7VA 4PWJA 2IH1B 4PS4H 1PQZB 4O4YH 1OAUL 2WO4A 1AVAA 1X5ZA 5HGAB 1YZZA 2AFNA 2WXFA 1A65A 2YQ3A 1VZHA 5GGUA 4LNRB 3NA4A 2OLDA 2WLZA 3FRUB 3VXNA 4B0MM 1CFQB 3VFTA 2CUMA 5CILH 2V2WA 4HJEA 2I9LB 5AAWA 3ZYZA 4UQ2B 3DTXA 1NCIA 4KAQH 4X7SH 3OBAA 4ZMLA 2OZ4L 3Q13A 1EAPB 2J25A 4A7SA 2BIPA 2NLJB 4JPWH 3C5ZD 4PJIE 2AEPL 3S96B 2OK0H 1X9UA 1YEEH 3MRFB 2DDQH 4GOSA 2AANA 3QJHA 3N1FC 3GMRA 2VLRD 5ESVB 5C08B 3ARDA 1E67A 1ODUA 3Q6GL 4GW5B 1U3HA 3WFDH 1TETL 4X83A 4S1SL 4LPUA 2YEVB 2X4TA 4MHHG 3HVNA 2Y9RT 4IKKA 3EFOA 1N0XL 4HUNB 4OFYD 5TGBB 3FQ4A 2R2EA 4K94C 4P2RD 4JRXD 5DHVB 1QSEB 4PB0L 5C0IB 4FADA 3LZQA 2X70A 5HD8D 1Z9OA 5IG7A 1RSFA 1T1WA 3QIWC 1O6TA 3L4TA 1NBCA 5TFSL 3G3LA 4PRID 2G2RB 3WCYA 3KG5A 2O26U 2GJ6B 4JFOB 1L6PA 2VDKH 2YPVA 4ONFL 2E7DA 1BYOA 1BF2A 3VXMB 3U7WH 1HCFX 1KB5L 4HS8L 5GS3A 4UAOB 3FQXA 3FH5A 5EHFA 2GFBA 3F5WB 1ONQA 4YHKH 4L3CB 2XU9A 1PX8A 4G80B 4P4RB 4PI2A 2FBJL 3VFMB 1HCZA 2WTRA 3WFBH 2ZOKA 5AVTB 3RZCB 5D4QA 3QQDA 1RUQH 4CDHA 2ARWA 4KJQC 2GK0B 2V37A 2VXTH 3VXRD 2NUTA 2ADFH 2R56L 3ARZA 3EJQA 4LSUL 4BRJA 1EDHA 4HS6B 2OJ1A 3RLSA 3MJ9L 3NN8B 5SWZD 5CSZB 5AYTA 2OMZA 1BQHA 4WWKC 5C9KA 2H2SD 5EDXA 5J7CC 2A9NL 3TTSA 1KTDB 4GQ9L 4PRBA 5GS0D 4TNFA 2Y1VA 2RACA 1KN4L 1JWSB 5KUMA 3V4VH 1MIEH 1YMMD 3UC0L 1HXYB 1BX2A 1ZHNA 1U2HA 3CVBA 4F2FA 4FQQB 4L0YA 2VWEE 2J8UB 2VLMD 1WGOA 1UZ6F 1WEJH 2ARJB 4KOBA 4AEEA 5BPPA 1VAHA 4G8GA 5LO7A 3FQYA 3TF4A 3KPNB 4NC2B 2V8MA 1ZA3A 1D5RA 2AV1B 3OQRA 4PGEA 2G4GA 5EU4B 1KGCD 5IJVA 2ZOLA 1JAEA 5F89B 4K2UL 3LKPA 2R51A 3S35L 4X2UA 4UNIA 3VQ2C 4RAUB 3BHBA 5ELIA 1MCLA 2MRYA 3UZEA 3WNLA 2YA1A 1NIEA 5CIPB 3RPIB 1E4WH 2DLFL 3V9FA 4LSPL 1J1PL 3E6HB 1EDYA 1J88A 5DC0A 2IMNA 2HRPL 2AXGB 5MEPB 2MKWA 1FL6B 2O6PA 2PETA 5C09E 4BH7B 1FAIL 4FP8L 3MLSL 2X1WL 1TNMA 5F97E 2VDPL 4ZTEA 4AJ0A 2VDOL 2PTUA 2XFXB 1ANUA 5KYWB 3ARBD 3Q2WA 1KCUL 4MVBD 4TSCH 2QPFA 4GNKB 1E5ZA 2GCYA 2K3HA 1OP3K 4B9JA 2P5PA 5ANHA 3IDYB 4A6YL 3D7PA 5IB3B 4LAQL 2R7EA 4OTXH 3NACH 1ORSB 4XMXA 2OXGB 1JWMA 1NAMB 3DPDA 2J4WH 2C34A 1NGXA 4YDKL 3GXFA 4OLUH 3UAJC 3UBXB 3O2DA 2H32A 3MV9A 1ASPA 4JFWA 4RWHA 2AJVH 2GABA 3STZA 3VTAA 5FO8A 4QO1B 1JZGA 2WZ0A 4M7ZB 3E80A 4S0HA 3LXCA 1TZHA 1G7QA 1L7IL 4ZXBA 4UM9B 7FABH 4IIZA 5FCUL 3TTYA 1CFSA 4HHAA 3CHXA 5AKSA 1YNLH 1DVYA 2K3TA 3H3BC 1HILA 2Z91B 4WHTB 3IGAA 4H20L 3V4PA 5L2KB 3FDWA 2R59A 1GGCH 2ZE0A 4GLRI 2E6JA 1BFVL 2GBTA 2JMRA 4X7EC 5GRJL 4M03A 4M6NL 1YY8A 4P06A 3Q2NA 3GK8H 2HUEA 4KPHH 4U6YA 2R29H 2FWLB 2W0KA 3TONA 1DP0A 1XTLA 2C5DC 3N2JA 4DKAA 4WUUE 3RVWC 1FNFA 1GPOH 1JZ3A 4OT1L 1XXFC 1IZJA 3FAXA 4AJYV 4XVUD 5HDBB 2LAGB 2LV4A 1NFDF 3MJGX 3HR5A 3QPXL 3ECBA 3HG0A 2XX1A 4TLTA 3RL1B 4CW1A 4LARL 4L9LC 2XZQH 5TE6H 1P69B 2OR9L 2E4FA 4JRLA 1Q9OA 1NPNA 3R7QA 5HDWA 4PREB 1V5JA 3WAJA 3DX9A 5DHDA 3ZHLA 5FFLA 4OZIB 2Z7WA 4XNXH 4JFEE 4XCCH 3KWUA 4JAMB 2XUWA 4L2YA 4KTYA 4WWKA 3FSWA 1CE6A 2EEDA 4ZX3A 1MWAH 2QHRH 1EGJH 4G71B 1T5WB 3ARDD 4GG6A 4F7EB 1E4XH 1U3HD 3SEPA 3E2HB 1ZLDA 2ZWZA 4XPHH 1DUYB 4I3SH 5DVOA 3F58L 5K1NA 4Q9BA 3U36A 3BN3B 5AUMB 1EFXA 1IIKA 4IJ3C 1BQ5A 3RIKA 1IAKB 5DF0A 1RUAH 2ZAIA 1QA9B 4FOMA 1G9MH 1L0XA 2NY3D 3OV6A 4JFHE 5GSVB 4N4YB 4OFDA 3ZTJG 4JFXB 3MBEA 1SHXA 3BQUB 4DW2H 2MCPL 3WNPA 3PE9A 1PG7X 1WD9A 2DQCH 3T0EB 1F90L 4GAFB 1GTFA 1UUSA 4HZLB 1PL3A 1I85A 5F1NB 3DV6A 1FZOA 1MEXH 1UWFA 4PH8A 3KJ6H 2WZ6A 5CCGE 3UBGA 1HAWA 5DD1H 1XF1A 3PFQA 1KJVA 1L9OA 3VD5A 2YD9A 3DVNA 3GTTA 3HMXA 5CWSB 1KIPB 3L1FA 1C08A 1TKWB 3DHJA 4KZEL 2WVVA 3KPLB 3U79A 3OAYH 3B2VL 1T80A 2H1PL 4G6AC 5EPMA 2HKAA 1MJUH 3EYOB 3TNNA 3VVVA 2EZ0C 2ERJB 3J27A 5D7HA 4TN9A 4JFTA 5E1QA 3SB3A 1UJ3B 4ZMWA 3MUGB 1OTUC 1JG9A 1JGVL 3HN8A 4X80L 3F7PC 1ZANH 4PFEA 1JRHI 3KYKH 4CBZA 4JVUA 1A6UL 1RZPA 2V5TA 1GGIH 3PGCA 1TQCC 5HHQB 5FYKD 3OKMA 5E6IB 2X4RB 2PW2B 4W81A 3UJIL 3K6NA 1E0OB 4FXKB 4NNXB 2C3HA 2I5YH 1DBAH 5GGSY 3WE1A 4QY8B 1N5YH 4AH2A 5BMFH 4QHPA 2AJSL 3QPQD 2IAMC 5DJ6A 4ELME 2XHNA 1NJ9A 2LE9A 4N9GB 5DMYA 4Q0XH 4XX5A 1QRKA 3ECVA 3Q9QA 5TQ2L 5ENWA 2GIXA 3CSPA 4WO4B 4G8GD 4UT6A 1KTLA 3FSZA 3L81A 3MRKA 3KPQA 4JM2F 2VM4A 2DQFB 5DXWA 2MCG1 5I28A 3NMEA 4XMVA 2BSDA 2VLJA 5JXAH 2YD5A 2VABA 1HI6A 4GY4A 1MHPH 5I1HL 2E9IA 2FO1A 2Y69B 2B59A 2EIJB 1D5XA 2WOYA 2XVBA 4M5ZH 2R8SL 3KL0A 1DBJL 5L9DL 2FO4B 2P4AB 4OD3H 1HHGA 3GHBH 5DVKA 2F7IA 2YR3A 4L9LA 3CZJA 1G6RB 3DBXA 5IK3A 2EYSB 2YN5A 4HXAL 1HZHL 1LILA 5IHUL 2XWRA 1K3ZA 1HHIB 4J8QA 4C4KT 1QHOA 3VXPB 1RZIA 1F6FB 1CXFA 1TO4A 1QPKA 2R0LL 3BAEH 1AQMA 3EOBB 4MMXC 5KS9B 4E68A 5H35B 1TSRA 3U4BH 3RVXC 4PJ7F 4YJZL 1T6BX 2BNQB 5KSBA 4P46B 1LO3H 3ATEA 3FU7A 1BD2A 4IYKA 2J8OA 3U2IA 2XVGA 5J1TC 4U1NB 1BVKA 4IBTA 1BXXA 5DK3A 1TVBB 1XL6A 32C2A 2ZXGA 4YZWA 2FNBA 2NNXA 4UBDD 4YO0B 4PAZA 2XKSA 2EDNA 3ZGIA 2BVOA 3L4ZA 2D0GA 1KYOK 2JCCE 3MV9D 3OHXB 3OX8A 4GKSB 1H6FA 4GB9A 5J6GB 4FEMA 4G83A 3HBGA 4DEPB 2HAZA 3BAKA 1IAOA 1NCUA 4FZ8H 1BV8A 4V1DA 4LPYA 4ZXBD 3THML 4QHMB 3ETBJ 1XH2A 4HKXA 1GHFH 2EKSA 2R4SH 3K6OA 4Q8BA 5TK2A 5GS0L 4PJ9B 4IDJL 1J5DA 1JZ6A 2W9EL 3MREB 1G9NL 4LEXH 1A1MA 3MJ7A 4OH2A 4O02B 5DCCA 3SQRA 1H9VA 3EO9L 4H13C 3GSRA 4YEFA 1A4BA 2I27N 1JGLL 2EYTB 3SSGA 1I1AB 5KYUB 4F1SA 5I5MA 5T5FL 3ZTDC 4X9HA 2MQ0A 4JFSA 4JHUA 4U6HB 1X5FA 3BGAA 4N2CA 3TURA 3KPOA 3GEWB 4K9EC 3CX5J 3ML9A 5KSUB 5IVXA 3BFQG 4PQXA 1OGAA 4NZUH 4UT9L 3BEWA 4WY7H 1GL4B 3V6OC 4GW1B 3WEBA 3ZRFC 4JKPH 1MW0A 3ZDXE 4BCXA 4JHWL 1JGDA 4NZTH 3AY2A 1Y18B 2EDEA 4XXDB 1A7QH 1EEYB 4LBEB 3U0PA 1OO2A 5F0LB 3D48R 1ND0A 5E8DL 5IW3A 5HSFA 4JUSA 4WWKD 3SJVA 3TS8A 2AJXL 1KIRB 2XZAH 1DEEA 2DJSA 3B6SA 2DTMH 2Q3XA 3BE1H 1X7TA 1GAFL 1CLYL 3HMWH 3PJSA 3OMIB 4LP8A 5DK0A 2JIXA 3STLA 3T0WA 2X4UB 1F8TH 3L13A 3QR2A 1SXZA 1PX4A 4PLKD 3TV8A 4B9KC 2PMZA 1CT8A 1QEWB 4FMFA 1EFXD 2DQHH 2IAMA 5DJ8A 2W07B 5ITFB 4Z9KB 1DQDL 3OZ9H 5E24E 2OMTB 3HZMA 3A6CL 4DKDC 5CUSH 1FO0A 1IC5L 2V3FA 4AW7A 4OZHB 1XT5A 2HFFB 4NP4H 1P7QB 1KY6A 3QDMA 2IALA 3RWJB 1SEBB 3DRTA 1FZJB 3MO1B 5D7IE 5CKAA 3N06B 4PJIB 1RZ8A 3ETTA 5D9SA 3N1QC 1E27A 5KN5B 3MLRH 2MNWA 3FJTA 3DA0A 35C8L 5IOPB 1MCCA 4BFIB 2NUPB 3TZVC 4CC4A 3BPLC 1Z32X 4Y2DC 3KNBB 1PNCA 4YSUA 1EQWA 4L3EA 2RTTA 4LDOB 1J0HA 3F65A 3K2MC 3LPWA 5EFIA 3AM8C 5K39B 2BP8B 1RHFA 1SJHB 1NWOA 1INEH 1DLHA 2WLLA 3FYEB 1MJ8L 3FYIB 1EEZB 1UKTA 4RESB 2WIIA 1YMHB 4U1KB 5CEXB 2QQNH 3UMTA 3SPHA 4XBGA 4MMXA 4NJAL 4NOBA 3L3HA 1XR9B 5HDOA 3DO3A 1RUML 4LPVA 3FQ2A 2Y7SA 3DARA 4OZ4B 2MOQA 4KXCA 5BZDA 4POUB 4R3SB 2VJ8A 3OKDA 3FTGA 4FF9A 2KPNA 1Q1JH 2IQAB 4P4KB 5E9AA 4QRRB 2Y07L 5F9WC 2E8ZA 4PRPA 1WA2X 2VR9A 4G8IB 1KTJA 2QMKA 4C4BA 4URTB 1B9KA 2P3YA 2RBLA 4C58B 5I1CH 1CGYA 3VM7A 4XX1G 3C8HA 1QBML 2MJWA 1QLEH 3BDYL 5DJ0A 1J11A 3CFKA 1Q90A 2ED6A 1ETB1 3QCTL 4XP1L 1AD9B 3EGDB 2ZWYA 3IETB 1DVFB 2ADJB 1OW0C 3WGVB 5DRXB 1YPZE 3F7KA 2WXOA 2EYRB 2BVPB 2VLJD 3LNGA 1EJOH 2H6UA 4AE1A 4NJ9H 5L8LB 3O2WL 1JV5A 1KLGB 4FQ2H 4JPQA 3MA9L 5IM7A 5JW4R 2DKUA 2G0KA 3JWNE 5D7JC 1WTLA 1OVZA 5GGRB 2ZAGA 1OSPL 3OL2A 2R15A 4JKWA 3UAFA 2JELL 4XMWA 3ULUH 4MJIA 2J88H 1NKOA 3PABA 3DKHA 4E42A 2PWGA 2VL5A 4DO6A 3SE9L 3GI9L 2YPVL 4IBYA 2LQRA 4GYBA 3FT3A 4PVMA 1SY6H 1NMAL 4U2YA 1MFAL 2BNUB 4WFFE 2G5BA 4Z7UE 3HNSH 1SHMA 1LMIA 4YQXH 5F9OL 4H8WH 4BINA 2WXGA 3MGOB 4JO3H 4KRPC 3UYOD 2R69A 5CLYA 1Z3GH 2X38A 4IMLA 2IFGA 1A3RL 2ORBL 4WEBH 3U4EB 1MCNA 3IN2A 3X3GL 1HOCB 3HPLA 2KBGA 4GMTL 5CJXC 4B5ZA 4C56A 2XWDA 2R0ZL 1N6QH 3MJ6A 4I4WA 3BIKA 4Z5RA 5ABDE 4WUKL 4JPVL 1BD2D 4HGWA 4HHGA 1I8MB 4I18B 4NHUB 2BC4B 4N2IA 4OGAC 1VADB 2DYRB 3OKOA 5CNHA 4DQAA 2ATKA 3OAUH 5MI0C 4FLOA 1OAJA 3EG9B 1S7XA 4U3CA 5D7KD 3QE5A 4AYID 1J0IA 4U3HA 2YUZA 4H44C 1WZMA 4PBWD 1X7SA 3UPCA 1S7QB 5K9KB 3X3FH 4V1DD 5KOVC 2AERT 4F9LA 3QUKA 2MHAB 4PCTA 5FYKL 4NCC1 2KZWA 5DZ9A 4YVNA 4ZUWA 2ZKWA 4HUVB 3VJ6A 4Y5YA 4XWGH 3X12A 3H2WA 4LEEA 1LO4L 5AKVA 2ZCHL 4RRPM 3L3GB 1IV8A 3L9RB 3VSTA 4XRCA 1ZSHA 5EWIH 2XJKA 4UM8B 3C09C 2V5MA 1J86A 3K2IA 4M7ZC 5CN1A 5JOFB 1J8SA 1FE8H 5MENE 5GS1B 3O6LH 2JJSA 5GZNA 1CCZA 3TZVA 4P07A 5HVWA 4ACPA 1EHKB 1VERA 4N2KA 4HFUL 4YS4A 1PX3A 4YFDB 1PEWA 4DEUA 2YIHA 3TBSA 1VCBC 3IRZA 4HK0B 1HK6A 2VLKE 2CIIA 5JXEC 5EDSA 2YRLA 5TE7H 4DEWA 2VR5A 3AM8A 3DRQA 3J07A 1SDAB 1OGAD 2AJ3A 3B34A 4CVZA 3QXDB 5G4MA 3QYNA 1KACB 4H1LA 4AYMC 2EZ0D 1YJDC 4G9DB 5JIDA 1P4UA 3FB6B 1YA5A 4CU7A 5I16A 3BZEB 3EZ8A 1BZ9B 5EO0A 2ZKMX 3ARSA 2VQ4A 1J5IA 1E8XA 3BZFA 2H7WA 4MA1C 4IBUA 3PWUB 1FBIH 1UH4A 3QUGA 4HX1B 4LRNH 4NZRH 4RISH 1XGPB 3SJVD 3PFUA 1JJUA 1U8CB 2FATH 1BVLA 4XVSH 4ONHA 2JIXD 2CGYA 4WUUB 3RNKA 3BXNB 2K6WA 3W39A 4LFHG 4S0SD 1A22B 3FRPG 3K6DA 2O93L 4JKLA 2W0LA 3CCHB 2IAMD 1AHKA 4G11A 1GS8A 3OKEA 4X6BB 2YGVA 1ACCA 3NT0A 4WI7A 3W0WA 2R9HC 4LSQH 3W82A 3ATDA 3PP4H 4R5TA 3E8UH 2WTPA 2DQUH 3R0MA 1N4XL 4OQTH 3NGBB 3QDMD 5EU6E 4HIJB 1ZHBA 3LEYL 4JFEB 1XHHA 4ZMVA 1IC7L 2ZX6A 1SRDA 3S4SA 2AXFA 2D03H 5DEJA 5CCKH 4MB1A 4D3CL 4F33B 3IWUA 2VM9A 1R5WB 3L5WA 4U31A 4X9FA 4M9OA 5I8EA 4BQ8A 2TSAA 3RWIA 1R0AH 2Z6FA 5JIMA 1IBDA 3STBA 4MTMA 4X0KB 3H4FA 3L5JA 4L3ED 3S3SA 3WDHA 3FU5A 2UWEE 2AQ1A 4ADGA 3FFCA 4HPOH 3VI4B 3QI9B 3EHBC 3RGVA 3DTDA 3GXDA 3FW6A 4NZJA 3VTMA 2DQJH 4HZ1A 2FL5B 5KSVA 5CJXA 4OZGE 1EH9A 1XWVA 4QGYA 3O6MH 5FK9A 2BIIA 4NCDA 5ERWB 5KVGE 3T0XA 4AVJA 4RSVA 2A73A 1L9QA 3HCVA 3LH8A 1FYTB 1U8KA 3I6KA 1ZSDB 2KMWA 2Z1PA 5LVEA 4KKAD 4PRPD 2EUXA 3TWCH 2QSVA 3AUVA 4LSRL 4JN1L 2R2HA 4K8RH 3LN5B 1JERA 3Q3GA 4UQCA 3QS2A 2AMUA 1MFBL 1U33A 5KSAC 1XGQA 5D70H 4PD4K 5EO9B 1HH9A 2HKFL 2UY7B 1IGCH 5ID0B 1RUKH 3JSSA 3SQOH 3FQNB 2RQ8A 1IFHL 4WEMB 2J5LC 2VDRL 5DVPA 2OTPA 4O2EA 3HFMH 4F7TB 4M4RA 1KENH 4R8WH 2BIOA 3T8VA 4I0KA 1UWGL 4JRYA 5BV7B 2QQQA 2NCMA 1B0GA 2BS71 5E8OB 4NUPA 4L3FA 3WSQH 5I24A 2YK1L 1WAAE 1QNZH 5B21A 1NFDA 3H2PA 4NQEB 4G42B 1MH5B 3T09A 4MJID 3WY2A 3X13B 3C12A 1FV1A 2PWEA 3H55A 1SHSA 5DDHA 4Y2NA 4JGNA 3PIQB 5J3HC 3SQBA 4BGLA 3LHPL 1YEKL 4HEME 4JFPA 4TPRL 3W9DA 4DPAX 3WTWA 4W9LC 4YHLL 5HYQB 1CFVL 1KEMH 2PPCA 3BPNB 3HMXL 3OQ3B 1BPVA 4Z0BL 3UERA 3F83A 3BVVA 4BH8A 4DP0X 3L17A 3X14A 3KCWA 4WRLA 4TVPE 5DJAA 4MXQD 4C56D 2DQ6A 3QIBB 4G2AA 4HULB 3U82B 3TXAA 3I74A 3MFFA 3RY5A 1CK0L 2H26B 3FAWA 3FB7A 2IPKB 4Z7VA 1MFNA 1A9EA 1JPFA 1UZ8A 5GSRB 1SXNA 4L4VE 3D06A 1S3KL 5C0GB 4X99A 3DGGB 1UATA 1X7QB 2Z35A 3AADB 1MCKA 2EC8A 3DWTA 3L3OB 3QFDA 4UDTB 1JOIA 4IU2B 3NOIA 4G1EB 5D7LB 2VQTA 1ZLEA 1I4FA 1XB3A 2FECL 3AWGA 2G9HA 2NNCA 3MROA 2AABL 4OUOA 5LB1A 1IEAA 3ZJAA 4JREB 3KVDD 2BM3A 2JXMB 4F8OA 1KV7A 3C08L 4G5AA 1SDDB 3QORC 3GLAA 1NEZB 4HLZG 2F53E 3V4UL 4FHBD 1NEPA 1NBZB 4AMXA 3MVSA 3I6GB 1AHWC 2BVEA 2IPTL 4KQ3L 4ZFGH 3E9TA 4ZI8A 2BS8A 2HT2C 5AAMC 3ULUF 4UT6L 4PCSA 4NO5A 4XPGL 2YD2A 5GZND 1KYAA 3TZVD 3OJVC 4APQB 3NQKA 4R26H 2YPLE 4AUUA 1FNHA 4YPGB 2X6UA 5IFHH 4NWUH 4LOEA 2JCCB 5TH2A 3AREB 2G3ZA 3DX8B 3QA3A 4QXGH 1T6WA 3MCYA 3L6FB 5CJOL 4WFHD 4FRWA 1QW9A 3ARFB 3UAEA 1PS3A 4Z7OE 3ECUA 5CGBA 3HC0B 2MTPA 5E2WL 2XWTA 2MNJB 1F4AA 3CDCA 1I1AC 1CB4A 4CKVX 3TNMA 1E9PB 1IVLA 5FUOL 2WUBH 4X6DB 3EGXA 3IJ8A 3LZRA 3MCLL 2JB5L 2EIMB 3NCXA 4UT7L 5HGGS 3EBHA 4G7VH 1X5XA 4WNQB 5E9DA 3WXWH 4ZFFB 2YD8A 5DEZA 1C5BH 2VO5A 4TTGA 2HLAB 5D5MF 2JNZA 4CU6A 1JZ5A 2Y06H 4G6KH 1U2CA 5A6IA 2WLJA 4IM8A 5CO1A 3P0YL 4E5XG 2NZIA 4X4YA 1UKQA 3U48A 2PXYB 1FWXA 3WN5B 4FTVE 1I9EA 4KI1A 4JFDA 5KSAA 4AJVA 1OSEA 4K0OA 4AYSA 1L9RA 4I9WE 1ZD6A 2OR7A 3KHOA 2O6FA 4JM2A 4JFZL 4K5OA 3BD5A 4GIPD 3AS0A 3MXWH 5BRZA 1KIQB 3W0WD 3T3ME 1K5NA 1BLNA 1GZQB 4XNUH 1XL4A 3OD3A 2ZP0T 5I0DA 4PWFA 4J23A 2PWFA 3QQ9D 3ZDXB 3CC1A 3KLHC 2JB6B 5DHVH 3LX9A 1HEZB 1KXQE 3B9KC 4KJYA 3H53A 4TSBH 3LRSB 4YGAB 4E9LA 4KZDL 4F7MA 2VN7A 2FX9H 1BEYH 5E2TH 5B3NA 1Z0MA 4QYAA 4FG4A 3QUYB 1KN2H 3HRZA 3VFWA 1EFQA 1EHXA 2EDMA 4PY8J 4ODBD 4Y5VA 3N1MC 3QFGA 4NNYA 4HOXA 2WB7A 4TUJB 1EZUA 4D0BB 2HKHL 5DK2B 3L4UA 2F54B 4D8PA 4YHNA 3RBSA 2H47C 3FFCD 2YFNA 2AK4E 3VW3H 1DCLA 1A21A 4LSSH 3FQWA 3VRIB 3RGVD 4H26A 4KRPD 3JV6A 1JNNL 3PL6B 1W15A 3FONA 3WJJC 5E6ZA 4PJ7A 1HIMH 3MLZL 1FORH 1JPEA 2H0FA 1J0KA 3ORJA 3A5VA 1KUMA 3C6LA 3ILPA 3QWOA 2AHIA 3FUHA 3V4VA 1TTGA 2FCBA 3CZLA 1FIGL 1ZHLA 1YEDA 4PJAE 5F0MB 1ZHKA 5T1DL 3CDGB 4AQ1C 2WO3B 4HFWB 3WY4A 3O4OC 3SKJL 5F6IC 3WXVL 1I8IB 3BIBX 3HS0B 2Q6WA 4WI6A 1ZTXE 1E30A 3II1A 3RDJA 3VXUE 2GBVA 1ROCA 4NUGH 4QLWA 3GB7B 3U9PL 4NO3B 2A1WH 3G6JF 3T65B 2HX8A 3IU4L 3MSPA 4AKOA 2OYPA 1IEBA 1O5PA 1Y6KR 3OKYA 4G5ZH 4MS6A 4P3WA 3VH8B 1FVEB 1I1YB 3UYPB 4JL2A 1SOSA 1FGVH 4LOVA 1QBBA 1NL0H 1ACYL 5BS0E 4RFEA 1LO2L 4F2MA 3P0VL 4XC1H 1MHCB 1GRWA 4P4KC 1S7TB 2B16A 3BLPX 5GRWA 4EUPB 1Q94A 5F9AC 5T1MB 4JRYD 5AAMA 3O6FA 1BVNP 2FK9A 5DJXA 5T33L 1A9BA 4KKNA 5DHEA 5KBPA 5TE4H 1FO0L 4OCWL 3ARGB 3MDJA 4I5BA 3ZRSA 3C5SB 1EZVX 1NZRA 3BLKA 3NSXA 3QG7H 3QYCA 5B1JC 1LLAA 1MAKA 3VFOB 4LNVA 1N5AA 3MHZA 3RA7H 3GMQB 2IOMA 5DGQA 1QRNA 4DGYL 3ALPA 3UTPD 2WAHA 1UM4L 1EHLH 5CIPH 1ROWA 2UV3A 4GRWF 3B3BA 5JIIA 3ROOB 1OAZL 1Z6JT 2GITA 1CWVA 4FABH 3LV3A 3QXAB 2P9RA 3ZY7A 5FA3B 3GXMA 3S6CA 2VZVA 3T3PF 1QYGL 2VXSL 4QXTB 1A6VH 4X5LA 4HH8A 1YPZB 1E9OA 1ZIAA 3G6AA 2Y36L 4PJHF 3MRCB 4YHOH 1ETA1 3BWZA 5AW4B 4NWTL 3I3EA 1SMAA 4JY5L 1MRDH 4OB5L 4P04A 4QWWD 4R90L 2XWXA 4JZJA 4JGMA 5H2BA 2B1HH 4ODXB 4MFHA 5L8JB 5CLTA 3MMEA 4DFIA 1PZCA 3QAQA 2C3WA 2DQDH 4I3RH 3UTZB 3T9WA 4ZMQA 2QDWA 1QVOA 4NRZB 3NDZE 2HG0A 3BRFA 2YBRB 1JUFA 5E94A 2AQNA 2WW8A 3UG3A 4M1GL 4MMYB 3WUWA 3HC4L 1E5BA 1NAMH 3UXFA 4E9YA 4Z3GA 2K6ZA 3CSBA 3D05A 4UZSA 2R29A 4YHPA 2PO6B 4TRPL 4LHUG 1FVDB 1LO5B 1B0RA 3LS5H 3WE6B 3B9KA 1OE2A 2OCCB 3K46A 4KK8C 4UU9B 2P8LB 5FYKU 4JKNA 4XN2A 3BFWA 3VNZA 4Z7QB 4DTGH 4PJCB 3ZYOA 2WSKA 2Z92B 1DQML 1CDGA 1VRSA 1F41A 2KUTA 4JFUA 1WITA 1I3UA 3MRJA 5MHSE 2KC0A 1GYCA 3W2DH 2FAUA 2JCWA 1GYVA 2FX7H 1E3FA 1ADQH 1AE6L 3TA3A 5GHWL 3KXFB 2K9FB 1WSST 3CPLA 3B43A 3GMOA 4Y2OA 4UQDA 3WJJA 4AGOA 3BAXA 5SX5H 4TULH 1MWAA 3GBML 4K7PL 5KZCD 1EGJA 3WYRA 4BD4A 5TQ0L 1Q9KA 1BAWA 1YUHB 3U0WL 3WS6A 4TOYL 3KMDA 12E8L 2F8VA 1U8MA 3GSVA 2JJTC 3NEXA 5E9DD 2EVGA 4PY7A 3QK0A 4NN5C 2W0FB 2ZPKL 4UQ3B 3V6FA 5DRNB 5F3BB 2Y1YA 3TV3H 5IB5A 3VWKC 4AQ1A 3QARA 4ODTH 1JNHA 2WLIB 3PUUA 2VJ0A 2R69L 4XO3A 1EO8L 5ALCH 5MENB 3UO8B 2P5EE 4NQXB 2ESVE 4M6ML 3UPRB 1RU9H 3WJMA 1NGQH 3RI5K 4UYQA 2BRQA 1OQXA 5D8JL 1RIVL 2IOOA 4KY1H 3DJSA 4WHDA 2C4XA 4JFDD 5KSAD 1GZPA 2VLKB 2Y3NA 4BFGA 4JM2D 3O3AA 4ODHH 1AHMA 4KI5C 1G6VK 3GMLB 5BRZD 1QOKA 2ZYIA 2EUVA 3VI3E 4Z7NE 1XVSA 1V3LA 1UM5H 2UYLA 3EUUA 4ETQB 1N6UA 4ZUTA 1HCVA 2R0WL 4ZYKB 1U93B 1CFNA 2VO8A 4P2CG 3VSVA 5IJKC 1LP9E 3FXIC 4FI7A 1NLDL 1JDDA 3PRZA 4YAQA 2LABA 4KY2A 4X6CF 2QADB 3OJ2C 5EBLB 5JIHA 3O41B 3DX0A 3QR1A 2ZNWA 5DWPA 5C0EB 5IMKB 1M6OB 4D7PA 1XEDA 1K6QL 2D7NA 3PGDA 1SN2A 1AO7A 3SE3C 4OF7A 3NIDF 5GGTA 2C8NA 4LOUC 1DBMH 5CINH 5T3XH 3MRQA 1HKLL 3NGBC 1V3MA 1AGBB 5C0CE 5B39G 2Y7QB 1W8NA 5J13C 1MW3A 2PYFA 5EC1B 5C0AB 3HAEB 4XP6H 3GKZA 2OW6A 4ZPVB 5D1QB 4KO9A 3WDJA 2BRRL 4BBWA 4HWEH 1NCCL 3F7RA 1NC2A 3CFDA 1CICB 1IBBA 3AU0A 3C6LD 4JCWA 4LCUB 1RZJL 3HB3B 1MAJA 1RZGB 4NQUA 1FFPB 2QPDB 1QABA 3SY0A 1WD8A 2NX5E 2PCFB 3S35X 3ZBMA 3U6XS 2FGWH 2BW5A 1USZA 3SE8H 1DFBL 1RURH 4RRPG 4WW2C 3AS3A 5LLIC 4KO7A 4DGVL 5M7QA 1DE4A 2OQJA 1WLHA 3M45A 3EFFA 3WL9A 2MTAA 4J28A 3OG6B 4KX8A 1Z9LA 3RVTC 2ZX8A 4TNWK 2WKGA 4BSVA 3K4AA 3T0BA 5L0QC 3C8KB 1XGRB 4DF9A 5A2IH 1N12A 1SMOA 4JMXA 1DANU 3OKNA 2F5AL 4XGZA 3WD5L 1AXTL 1CDCA 4YZFF 2X4PA 3CHPA 5B1CA 3V0FA 3WO4C 3ZHKA 4HIEB 1DDTA 2CPUA 3LZFL 2DEWX 2MH4A 1C7TA 4OZGB 4S0TD 4XBEL 1YAIA 5GGQL 2XTJC 2M1KA 3EYQD 3H0TA 3O6FD 4HWZB 1TLKA 4AYGA 1KJ2L 4QOKE 4IGBB 3QWQB 5CEZE 5I76B 4RDQF 2XXMB 1CDUA 4Y7MA 4KTDL 4PWGA 5A43C 3S36H 4YE4H 1UYWL 4S1DD 4L8DB 4F20A 1AD0A 2ZOUA 2AJZB 2YWZA 1ES0A 1QRND 3K8MA 3VD0A 4OD1L 1IAII 2X9YA 2A6KB 2I32A 1OAQL 2J56A 3V0WL 3HZKA 2C4FU 4AT6A 3CZFB 1BDYA 1MFVA 5D96C 4JLRA 1T66D 1V7NH 1R17A 2WOBA 1Y6MR 2DYPA 3WBDA 2VXUL 5I17B 3MRPA 1G6RH 2JJTA 2WYIA 2H0JA 2J20A 3BJLA 3DROB 5CJQH 1TIUA 4MQTB 1XQ4A 4FI8A 3IDNA 2FBOJ 2ADYA 3HI5H 2B4CL 5LGJA 2IWGA 2A99A 1GYUA 2XQBH 3L3JB 4WWPA 3TBWB 2JJWA 1FC2D 3LDBB 2H9GA 3NAAL 5CM1A 3UGUA 2WYHA 5IMMA 5IF0A 1BZ7B 2FWSA 1XX9C 2XY1A 1Z9SB 3QO1A 1WFNA 3ZL1A 4GEIA 1QHPA 5D6CB 4MA7H 1I3RA 2OSXA 3GS0A 2R0KL 3IJ7A 5B8CB 2ZG1A 5HDQL 3ZL4H 5DJDB 1UWEL 3L95A 4ZUUB 2H1XA 1A7OH 1CLVA 1GGBL 4OCNC 3QG6A 1JZ2A 3HBPA 3QULB 5JMOC 3D1MC 5JW5B 5EO1A 3B9KD 3VFUA 5L7XH 1NCWH 3B7UX 3TO4A 5EOQH 1NGWB 1IAIM 2VC2L 3AABA 3Q8BA 3AXLA 1J05B 4Q7DA 1XCTB 4KZCA 4PBXA 4JVWA 3BUQA 5FO7B 4U3SA 4L4VB 1NMBL 2EH8H 3QFJA 4N20A 1UADC 2X44D 3TA3D 4DN4H 3VWJC 1CGSH 1KCVL 5DQ9B 5FKPA 3O9WC 3TFKC 2VZ1A 5LN4A 1MY7A 1X5IA 3EBIA 2CLVA 2VMJA 3D3VA 4KXZH 5C7XH 4U7SA 3QDGA 4AQEA 1XF2B 1ITCA 5BNXD 3IDIB 4NHCH 5BQDA 4IRJC 4NGHH 5J57B 2JQAA 4QXUL 5DYFA 1BGXL 2ED9A 2F53B 2MIZA 1PW3A 1J5CA 3FPYA 3MOAH 5GGRY 1IT9L 1KOAA 3KPTA 4FJYA 4J3XA 2NY7L 4AL8C 4LMQI 1FVCB 4WW2A 1K8IA 5C6TL 4IIQC 4F3FA 4LVHB 3BUPA 1KXTB 3K1KC 2TRYA 4ODWA 1YNKL 2FGZA 2W9DH 4JM0A 2WJ7A 4A66A 2OXHB 1PJWA 2YPLB 3F7YA 3LMJH 4MNGA 4KXBA 2EECA 4H2CA 4NNPH 1N3NA 1KT2A 2J1WA 1RHHA 2XWBB 3GDBA 4JN2B 3BYTA 3D07A 4AWJC 5E4OA 4K7FB 4NO2A 3KYOB 5CD5C 1UZGA 1W0WB 4GP4B 1RK7A 4LU5H 3SKMA 5BOJA 2I85A 5I1AA 3S37L 2TRHA 4ZMYA 2EEFA 4YSCA 3D08A 3W38A 1X5JA 1KYOJ 3PU7A 4FA8A 5I8CB 5ISZA 4YUEH 3IS0X 3HZVA 2AK1L 4D0CA 3EOTL 3C9NB 4GINA 2KH2B 3NESA 1IC4L 5ES4B 3FUKA 4HWUA 3VFVA 2NW2A 1RK0B 4XOBA 4FAAB 4MJ5A 1A7NL 4N0UE 4UB0H 3TM6A 1AO7D 3NZHH 3V95A 2EICA 1OP4A 2XQYA 1DJWA 4HIIA 1I7RB 3P9MB 4KUZL 2WBWB 4ZFOA 3JTSB 3NIGB 5DJ2B 3RUGE 2GSGA 2XG5B 4PS4L 4JQIH 2N7BA 1SQ2N 2ZSVA 2KZBA 3MRLA 4X4ME 4Q9CA 2VDLB 2XI9A 4BIKA 5HDBF 4KKCC 3F7VB 1MRCL 3IF1B 2AAVA 2VITB 4PPTA 1FFNB 5CILL 1N8ZA 3T3MB 4K5MA 1T04A 2X4SA 3TN0C 4I0PB 4WCYL 1NC2D 4D0DA 4LLQA 2MSPA 2KZKA 4JPWL 5FX3A 1F6AA 5IKCB 2OK0L 2HTKD 4GMSH 3SD2A 5C0BE 1PY0A 1YEEL 3IRCA 4OZIF 2DDQL 5IR1B 2DM4A 3HG2A 1NLBH 4UOW1 1OHQA 1D9KB 2X3AA 3U46A 1QR1A 3WFDL 2LTQB 3Q5TA 1WRFA 2DIBA 2IDCA 2P80A 3BISA 3L45A 4YPJA 4ZK8A 4YK4C 2HJLA 2WC7A 1ZGLB 3B9VA 1DJHA 3RFZC 1HFUA 4FNLH 3FO9A 3X11A 1KXVC 4PLNC 3RJDA 4N6RA 4L8BB 2AK4B 4YX2H 4XH2A 4NQQA 4J3WA 4U1IA 5FW6A 3SDYL 1QWHA 3QUXB 1HN1A 2GT9A 2GW5A 5I2IA 2E46A 3ASNB 1HH6B 3BD3A 2IANE 3NCYS 2G5RA 1FNAA 1S7SA 2CJSA 3MRDA 1S3RA 1GMIA 2VDKL 2BXYA 4GKZA 2ZUTA 1U2YA 1U8QB 3LKQB 3RWCB 1JCVA 3U9UB 5DEGB 3U7WL 4PJAB 2EDFA 2NY2B 2AJYL 4ZO8A 4N5UA 5SWSE 4NYLA 2HJFB 4U6XA 3MRIB 5LAXA 3JT0A 4YHKL 3VYNA 3LSOA 5HHNA 1V3JA 3WFBL 2QLYA 2WZ5A 4M1DH 3VXUB 2OMYA 3IXTB 2AKRA 1BA9A 1T1YB 2UY6B 3SGEH 1TG8A 2H6PA 1RUQL 4BUHA 4XO4A 3WAKA 3AAZB 2ZCKH 2ITDA 5B7EA 3APDA 4LLVB 4XZUB 5IGXH 3ARGC 3DBSA 2VXTL 3VXTB 2DYPD 4U1HB 4XVTH 5BS0B 4G6JL 3QWNA 5FUZH 1PIGA 2BNRB 5D5MA 1E43A 1KCKA 3DX3A 1YECH 3UH8A 5EOTA 3VTTA 1G5AA 3BKYL 1NFIB 3K74B 3GXIA 3RNQB 3ALWA 4DVBA 5LXVA 1PD1A 4F9PA 2L7UA 4LKXB 2NY4D 1KXHA 2F1EA 1E4JA 1KFAH 5LQBH 1M71A 3LRKA 3DUUA 1UA6H 3T2PA 4ELKA 1PD6A 3BVNB 2LAAA 4F8PA 1KB9K 1N2RA 1R3LA 5DURD 1MIEL 1OGSA 3V4VL 4DT2A 5HYFA 3FO1A 5IWLC 3GD1C 2OI9C 1DYZA 1IGTA 1Y1UA 4K3EH 2DH2A 4OBSA 1Z0NA 1OP9A 2L8AA 5LXGH 3NSYA 1WEJL 3P73B 3H85A 5I1KH 2BHZA 2XQ0A 4KV5F 4IEFB 3T77B 4DCQA 5D1XC 1TEYA 4CRPA 1NSNL 2XLLA 3IPEA 4W9KC 3UYRL 2GEQA 2OMXA 4R7DB 3UP1A 3P77B 3EYFB 4KK5C 4LDEB 1UA3A 4BZ2H 4QCIB 3TO4D 4I2XA 4PJDE 1QI3A 1VDGA 3C60B 5AW1B 5FHAH 4PY8I 3FMGH 3OXRA 4JFFE 3UIZA 4E9WA 2YC1A 1G1OA 1XH0A 4FQPA 3QUZA 5EZLA 4GQQA 5B1BB 2XV3A 1E4WL 2I7OA 5AB9A 3ISWA 1FHGA 4PTTA 3EOAA 1K5WA 1UJTA 2G5UA 2ZYHA 1T1XA 2Q7YA 3GO1H 5JR1H 1S2EA 5E23A 3VGDA 3FUEA 3NIFF 5EEYA 4F93B 3RIFF 2AV7B 4YHYB 3QFJD 2R1YB 2ENYA 4XMZA 5BJTA 4Y16B 5J4MA 1WFIA 5D1ZI 3PWPA 1ILUA 3LQAH 3D09A 2FT6A 3MN8A 1EV2E 2XV0A 1C1EH 3D3VD 3ISYA 5H94B 5AW0B 5F21B 3QDGD 4YN3A 3W9EB 1HQRA 4XNMB 2YD7A 2WWNA 3ARVA 2FEEL 3O3BA 2KZ1B 3CC5B 2AS5M 4TSCL 3GMPB 5DQJB 5LBGA 1DQVA 3L9YA 4M5YL 5IESH 2EIKB 3Q8AA 1NC4A 4UIMA 5KS9F 3IJSA 3CPUA 1D7FA 4RMVA 4BKSC 4OTXL 3R18A 2FSEB 3BI9X 3NACL 3TBTA 5L4MA 4EBQH 4F7PA 2WXMA 3BESR 3G6JA 4P2OC 1R24A 4D9QE 4WWID 4OLUL 5D2NC 2AJVL 1QTYT 4KKPA 1KXVA 4OQTA 4OZFG 2I69A 3TWYA 4GW4A 4Q6IB 2BOCA 3K81A 2J1ZA 7FABL 4JQVC 5HYJA 5IY5B 5I74B 3BO8B 2CO7B 4L0PB 4MB3A 1FI8C 3TEXA 2FJFA 2X7LB 3FCSB 1MUJB 1YEFH 3F7LA 4Y5XC 4PV9A 4Z3TA 3KH4A 5ISZD 1GGCL 4J3TA 1FYHB 3S8FB 5GRUL 1IM9A 3GK8L 4AENB 1L3WA 2F61A 4X7CC 1QFUH 2R29L 1JK9A 5EB9A 5LHDA 2XRAL 3S97C 1EHAA 1LDPH 4LVNC 4NN6C 4EPSA 1RIHH 3ULVE 3SD5A 2P5EB 5DVLA 3F12B 3V55A 2JJVA 4QHNA 1GPOL 4W93A 1XH3A 2KS0A 1F4XH 4B97A 1T03H 4G43A 5TE6L 2VISA 4U1LB 3GIZH 5IVNA 4NM4L 2DMKA 1G87A 1Q4NX 3NABH 3CVHA 1A25A 1MCSA 2PWHA 2AQ2A 4YC2C 3VI3B 3PWVB 4Z7NB 1MRFH 2X6AA 3WKPA 5AD0B 4NFCA 2IMMA 2VXVL 4XNXL 3FCTB 2WVTA 4XCCL 3GUTA 4LCIH 1RERA 3DUHA 4G8EA 3T1FA 1JHTA 1NPJA 4N0RA 4MBOA 3LOWA 1MWAL 4N8VG 3M1BB 2QHRL 1EGJL 1G5GA 5DMKA 4J3OG 1U36A 5HJ3B 1E4XL 4OZFH 4ZSOA 1CLCA 1FNLA 2P80D 4HALA 4HXBL 4XPHL 4I3SL 2VLRE 5D1QC 3QNZB 5IWLA 4XNQB 1TOXA 5DJZB 4GBXB 1DUZB 4ODUB 1PKQE 4HAGA 5C0CB 1RUAL 6TAAA 1G9ML 3JV4B 4QHLA 2EXSA 3LNEA 4FE9A 2CO6A 5I19H 3ZTNH 4H88H 4Y4KC 4Y4FC 4ILDA 5D1XA 4RQQA 3HUJB 1RK1A 1GXEA 3FOLA 3MCKA 4DW2L 1M7IA 3PWLB 4A2MA 4BFRA 5C6PB 1XR8A 2VAAA 4OJFH 5HDRA 1LQBC 5DO8A 2DQCL 2QLVB 4GRLA 4OZHF 3ULUD 1VFAA 3QYMA 2F2HA 1W0VA 1LMKA 3LD8B 4G7SB 2BHUA 1MEXL 2NX5B 3KJ6L 4KGLA 2J3SA 4G7YH 2CDFA 2HRLA 2K1MA 1CIDA 4PJIF 2IQ9H 5DD1L 3SDXE 1M2VA 3V4LA 1CU4H 1GGUA 5AOKA 5LG1A 4EN3C 1T2XA 4YDJA 5HI3C 2DYSB 5BV7H 3MNWA 3O0LA 4P57A 3RY6A 1IGJB 1V55B 2DJUA 5E8EB 4PS3A 1E2VA 3QDHA 3O9WD 1CLZH 1EXHA 3TFKD 2WXQA 1P5UC 1MJUL 1ZKAA 1K4CA 3L4CA 4CSPA 3H54A 4KKBD 3M07A 1DSWA 1CDIA 1HNGA 1NBVL 4ACTA 1OD9A 2FECI 5HVHB 4KOCA 4Z18A 1V3KA 1K85A 1Z5YD 4L4TA 1QSFA 1LK3H 3RWGA 3G5YB 4EDWH 5IQOA 4M61B 3PDOA 1CQKA 1ZANL 3MCG1 3H9HA 1AP2B 3KYKL 1QFOA 5I71C 4LLWA 1GGIL 3FU6A 4JDEB 3R06A 4P2OA 5D2NA 1IGYB 5FF6B 4M9PA 4CN4A 5E1GA 2I5YL 1DBAL 3CSGA 1BCIA 3D69A 1BP3B 1ZT4A 1N5YL 2DLEA 5BMFL 1LEIA 2FSDA 3I6LD 1YMME 3WTTA 2P8MA 1M6UA 2XN9E 4Q0XL 4UOW0 5CD5D 4J3SA 5FECA 3F00A 1EK3A 1P4BH 4NUJA 1MDAA 3IS1X 3LS4H 4DGIL 4HKZA 4Y5XA 3VFNB 5M95B 3DV4B 4YDLC 2NSMA 4N8UA 2LGNA 1G7LB 4PR5B 3VFRA 4X6CA 5ID1A 1KWGA 3RYMA 4ANXA 4U1JB 2VRQA 4ONOA 1AJ7H 4U0RC 3WDIA 2ICWA 3MGTA 1ZE3C 1EVUA 3SDCB 3FH7A 4P5MB 1S9XA 1YSOA 1MHPL 2Z31B 4JANB 3CVDA 4V11A 3BDBA 4GXUM 1FIEA 5JUEH 2SODB 1QMUA 1RJZA 2VM3A 4K71B 4PCKA 4TSAH 4AM0A 3DURA 4M5ZL 5I1JH 2DQEH 2WTOA 2FDBP 2YJQA 4PLOB 2IH1A 3ZMEA 1G7MB 1PQZA 4ATWA 1J8RA 4ZDHB 4JG0L 1NDGB 1FFRA 1RI8A 5FEBA 2DN7A 1KG0B 3CE1A 4KKCD 3FRUA 3PWPD 2EO9A 3PAYA 1TNNA 2GJZB 4UQ2A 4GAYA 3OGCA 1AAJA 4B53A 5ILTH 2DL9A 5DMIH 3BGFB 1EAPA 2NLJA 4N0FA 4U7MA 4TV3A 4CNIA 3BAEL 2NXZC 1IKFH 3AQXA 4HCIA 2IV9A 3FN3A 2NY6B 3U4BL 3IFOB 4XOAA 3WHXA 5J6HB 3NCBB 4JHZA 2CGZA 3MRFA 3OLEA 1NC4D 1PPIA 1DJZA 3FFOA 1AR1C 5C08A 5ESVA 4KTGA 3NK4A 4GW5A 1TZGH 1YYCA 3CG8A 3DPBB 4AV4A 1FNGB 2WXRA 4LCVA 3Q8FA 4L5FE 1I7UA 5JQIB 2VDML 1L0YA 1SLXA 4ES9A 3WLBB 2MCMA 2C9XA 5TGBA 5KANI 4UILH 4R7VA 3II3A 2AQTA 4FZ8L 4R97B 5DHVA 5IBUG 1QFPA 3U6XA 4Y4KA 4Y4FA 3WEOA 4L4JA 4LL1A 4XPTH 5ECGA 5HYJD 1VF5C 1TCRA 2IF7A 1GHFL 1MCHA 1WG3A 3ATFA 1U8LB 3K80A 4ANKA 1D5MA 5AOZA 1JZHA 4B9YA 4LVHC 4ZUSA 1IZKA 1A4CA 4LEXL 2GJ6A 4JFOA 1H3XA 5CGTA 5F88B 1MCFA 1S9KC 3B83A 1J5OH 1IM9D 3VXMA 2EC9U 2VUKA 4XB8A 3EYVB 4I1RA 1TXKA 3LQZB 1T4KA 4MSWB 2OTUB 3F5WA 4L3CA 3WTXA 3DO7B 1UG9A 2YA0A 4FL4C 4G80A 4P4RA 4Y9FA 5BZXA 3VFMA 4TMPA 4ZG1A 1HXMA 2YZ1A 3RZCA 1R3KB 2NCEA 1NUNB 5KUKA 3P30H 4NZUL 4XMLH 5K1JA 4CMHC 4WY7L 1QI4A 3LNFA 3CFIC 2WM0A 1OB1B 5GGVY 4Q89A 4E5XA 4ORZC 3DIFA 1JMZA 2WYTA 2WLMA 2V0AA 4JKPL 3FT1A 4A68A 4HDIB 4LFHD 4WV1C 4CGUB 4NLHA 1CXIA 4FFYH 3ZKND 1A7QL 1KB5B 3HRPA 3BVXA 5E4EC 2ETWA 4KKLC 2QV4A 5C0RH 4RCAA 4K8RD 1C16B 4PW9A 3JTTB 3PWJB 3VD7A 4Z76A 4PYGA 2YGQA 3JWOH 5FYLE 1ZEAH 2DTML 2DBLL 1KTDA 3HHSB 1E8ZA 3BSZH 3HMWL 4NQDB 1WAPA 2ZWLT 4N0UB 1WICA 4N2DA 1HXYA 3LCYA 1F8TL 4JO2H 3ASWA 1AXSA 4UUJA 4FQQA 3RUGB 2DQHL 1J8HB 2CGRH 3BLBA 2CZNA 2P46B 3OZ9L 2ARJA 3MLVH 4AQAB 2L7EA 3WELA 2GJRA 2Q10A 4K5NA 1BFTA 4NN7B 3FF7A 5D1XD 3JUZA 5CR8A 1R5IB 5IFAL 1ECZA 2XVLA 5I6XB 1AANA 3Q6FA 1A7PH 4NP4L 3C5JB 4GRLD 1AGEB 1PG7H 2ALAA 1KGUA 2RIKA 4RAUA 1D5ZB 3NCEB 4Z7WA 1KLUB 1DVQA 3S88L 2PP8A 3MLRL 4M7JH 4DP1X 1NH6A 3PQYE 3U7AA 4L1LA 2XICA 8PAZA 3E6HA 4W68A 4EUPH 5EEXA 5IEHA 5C1MB 2AMGA 3V5HB 1BZEA 4ICWA 5MEPA 4AMKH 4TUUA 4LCYB 2YAMA 3FSAA 2GEEA 4Z1PA 5E9NA 2FHBA 4KHXH 4OFPA 4OLWH 4OLZH 3FHQA 2HLFC 4IKLA 4RGND 5TDPB 4XPBH 2IOIA 2QJDA 3RIAK 3NSDA 1XCQA 1NANH 1FNEA 4YH6A 2QQNL 2CDGA 4ZFOL 1U95A 3DI2B 4XMUA 4L4TD 1QSFD 1VEOA 2IANB 1T0OA 4Y4HC 3VDCA 1AYOA 2BMKB 5KVEL 1LO0H 1OM3L 3P4NB 3ROLB 3I9GH 1ORSA 2H2PC 2OXGA 5HYSG 2Y24A 2D9QB 4P2OD 4S2SA 1Q1JL 3UBXA 4DQOH 3TBYA 3PHAA 4LASH 4P3CH 4FXGC 1NUDA 1TVDA 1MLBB 3TIDB 3JWNH 4KHTL 5G2NA 4UM9A 3HE7B 1P4LB 3D39E 2VDOB 5A2FA 4WWNA 5FA4B 2J72A 2R2BA 2OL3H 3Q2LA 2Z91A 1ZWIB 4WHTA 5I6PA 2WVSA 5T5NG 5L2KA 4TNWF 1YEJH 2WXPA 4I3GA 1MFEH 2FEDC 2XWJA 1KCWA 4A6YB 3TJEL 4TQIA 3CLWA 5BOZG 4NJ9L 5TK4A 2B3RA 3NDYE 1JPTH 2A0LC 4FQ2L 1ADQA 3JVGC 3NPSC 4DPBX 5HTSA 1MCQA 2NT1A 3EYSH 5GGVH 4JFYB 1Z5LB 3QNXB 1JN6B 3NPZB 3ULUL 3BEVB 7PCYA 5IW6B 5AG8A 2N7AA 2FQFA 3T71A 3GHEH 1MVUB 2Y5TB 3RL1A 4HU2A 4HG4J 4P9HC 4F57L 5ESQA 1UKSA 1KZYA 2EDXA 3HNSL 4QRBA 1NCAH 1SUHA 4H8WL 3SO3B 5SV4A 4JO3L 1MIMH 3IXAB 2CBOA 2XZZA 4XCYB 1Z3GL 5D7SH 1BWWA 3SBWC 2YARA 4PVLA 3WKMH 4JAMA 1RPUA 3U1PA 4YHMH 5E5MA 4PJDB 3VFPB 1IBGH 3WNNA 3R8QA 1N6QL 1HE8A 3RAJH 4JFFB 1XFPA 2Z3FA 4NXKA 1QPPA 4JY4A 1RZFL 1T5WA 5C08D 4IRSC 2P49B 4LHUA 3KPSA 3OAUL 2BERA 2DWEB 4FXLA 1ZMYA 5AOLA 5AUMA 4K9JA 1IAKA 3UTTE 5K33A 1XAKA 2XA8H 5DS1A 2XN0A 2ID5A 3JZYA 3FNKA 4Y4FD 4Y4KD 1HU8A 2NTFB 5DZPA 2IBZX 3FUDA 3BQUA 5T8IA 2ZCZA 2E27H 5F9JB 4D8OA 3MRHA 5FFGA 4XWGL 5DUBA 5LNGA 3T0EA 1YEWA 2YPKB 4HZLA 5FPIA 3I9AA 5CZVL 2GJ6D 5IB2B 3CSYA 5EWIL 4NBZB 3RL2A 3UZVB 2G75A 3VXMD 5CFAA 1H5BC 5EN2B 1VPOL 4NC1C 5F0JB 3ZKXC 4EI6B 2D3NA 1FE8L 1WYJA 3O6LL 2FYYA 5HI3D 1NBYB 8FABA 2G3MA 1UOVA 2CK0H 2EO7A 5CWSA 1GYAA 1CJYA 2N0KA 1TKWA 3O4LE 3KPLA 4QRSB 2WQXA 3BUYA 5IVOA 4IDLA 4PW3A 4Z3IA 4KTEH 3RZCD 5TE7L 1X44A 4Q6KA 1CXEA 5DD3H 2OJEA 4ZT1A 3VX0A 5CD3A 3EYOA 2JCCF 5I6LA 5F3HB 3NFNB 4ZO7A 4GAGL 2MQGA 3CVIH 4HJGB 2K0RA 3RJOA 3VGBA 1UJ3A 1M9SA 3MGAA 3P2TA 1KBWA 2PUQT 3MUGA 5I1LB 3N91A 1B6UA 3S7GA 4BYHA 3WS3B 3CZNA 5L6YL 3HAEH 3W56A 2XZCH 4WENB 3PHOA 5IQ9A 1U58B 1FBIL 3SE4C 2HMIC 4RISL 5GISH 3CBKB 1EMTH 2E4TA 5JHLA 3OKLB 4LE8A 5HHQA 3VB9A 3E6FA 4G7RB 1TMCB 4BZYA 2FATL 2PW2A 3K4DA 4XVSL 3IGUA 3SYQA 2ADIB 4I1PA 4FXKA 1RP9A 4FXGA 1EZSA 1RVFH 4AGMA 1BQHG 3AU1B 1P4IL 3CUPB 3OKKB 4KVCH 2XNAB 4KRLB 4IKNA 4N9GA 2IBGA 5AW5B 1E2WA 5GZOA 2XN1A 4JVPA 2MFNA 2N3JA 2BSCA 4WO4A 2NZ9D 2FWUA 4PS8A 1KTCA 4PM1A 4LSQL 2DQFA 3PP4L 1LDSA 3E8UL 2DQUL 1B4LA 3LEXA 2PYEE 5HGHA 4OQTL 3UTSE 4BQ6A 5IB1B 4DN3H 2JQMA 3ZDXF 1I8KB 4U6TA 4NRXB 1J18A 2NY1B 1XD1A 3C5ZB 4AITA 5CCKL 2QGEA 2OMNA 1YC7A 1A14H 3APMA 1EANA 1TJMA 3U0TB 4WKZB 4Z78B 1R3JB 3I02A 4OJDH 1LVEA 2VMDA 4FQXC 1W8OA 2WWOA 1OSZB 1C9SA 2FX8H 2VLRB 4XCEA 4UF7C 4U6VH 5IROA 5KVGH 1A3ZA 1G6RA 3JT2A 3O2VL 3ZPDA 1PKQB 4W9HC 4HPOL 1PAMA 1HHIA 3QEHB 2F68X 4Z23A 3FQUA 5AVYB 4BWUA 4ZAKC 2DQJL 2EE0A 3VXPA 5K9QI 1NIBA 1CG9A 1I9RH 1Q0YH 4JRXB 4P2RB 5KS9A 5H35A 1BIIB 3O6ML 2G2NA 4ZS6C 3JWDH 2APWA 3PJNA 3V52H 4DVRH 2BNQA 3DO4A 1JP5A 2ADGB 4P46A 1KJMA 4P8QA 2FLBT 4ALAH 5JPMC 1AR1D 3A21A 4LLDB 3SO5A 4ABWA 3H7BA 2F7PA 5G5DB 1IJNA 1TVBA 1RD6A 1S8DB 2A9CA 3OXSB 5EU5B 3GSXB 4N26A 3SDXB 4LZKA 4E9TA 5K59F 4WJ5A 4NKIL 4XOCA 4YO0A 1JCKA 5LNDA 5KBKA 3OHXA 5GRZA 5B38G 3FTXA 4QHUB 1JZJA 1UQSB 3T4YA 5HVHC 2C1OB 1KCLA 4GSDH 4Z77B 2TAAA 2XA3A 1DQQA 3K72A 4K8RL 4AEHH 4YLCA 4UM9D 4MMZC 4X4KA 2ICEB 5D70L 1QKZH 3FZUC 1I7ZA 4PJ9A 3OLGA 1IGCL 1RUKL 3HEIB 3SQOL 1GH7A 4JG1H 3MREA 5L2KD 4G1MB 2PW1B 4J1UB 5K93A 4KQ4H 3HFML 4EI5B 1MF2H 1XSIA 1MKFA 2MWCA 1H5BA 4GT0A 1IBYA 5I1DB 4OF6A 5KYUA 3ZHFA 2LU4A 4FNUA 2F7OA 4TUOB 5BO1L 5CEYB 4BSWB 3T2OA 2JWYA 4MAUH 3LKRB 3WSQL 2EDRA 1FRGH 5E51A 5FYJD 4F5CE 5JPNC 1QNZL 2AXWA 3D0LB 5AVVB 2PCXA 5IHLB 4EQ2A 3UCRA 3H3PH 3SZKC 3I9PA 4BELD 1FDLH 2HFGH 1WP6A 2Y25A 4OLXH 3AQYA 2BINA 2VWEC 3VE0B 1YMMB 1P84J 3FF8A 4A7UA 3GSQB 5ADPH 3N43F 2Z31C 5PAZA 1H3WM 1KEML 2WXLA 2CA3A 3RFRA 5F7NC 2F9BT 1Y18A 3MFGB 4XXDA 4AQ8C 2WP3O 4K15A 2HCZX 3ZDZE 3HIZA 3GPEA 3SE4A 1KIRA 3IKCB 1YPZF 4UINH 5DYOB 4DGWC 4AVKA 1TU2B 1I9JL 3TEZA 2RJMA 3CFUA 1GJWA 4OCYL 4RAHA 4LHUD 3KPSD 2X05A 2X4UA 3KCPA 1PLCA 3KVQA 5TF0A 1QEWA 4H8VA 5ITFA 5LBVA 3K7UA 4FC3E 1UTDA 2XIIA 1OAYL 2OMTA 4BKLB 4DZBB 3NCWA 4YGVB 2ZX7A 5ESAA 4OJCA 1LWHA 3BQUD 2FYVA 2HFFA 4CMMB 2OW7A 1YDPB 5J11B 1GJIA 4EIZC 4Z7UF 5DS8A 2HPTA 3RWJA 3T0ED 1SEBA 2D3VA 2XCMC 3RJQB 3UFIA 3VQ1C 5LBSA 1M7DB 1VGKB 1INQA 4J5VA 5T3XD 4Y1TA 2WWMC 3V6ZB 4ZFGL 5FAAA 5KN5A 3ARBB 3NG5A 2AC0A 1U21A 3AY4A 3ZE0E 2NUPA 3AITA 1IILE 1AGCA 4L37A 5KG9B 4JQXA 4R26L 1WZKA 3AG4B 4PJCF 3KNBA 5IFHL 5JLZB 3I84A 1LXMA 1Q9LB 3ECQA 1BFOB 4J3BA 3KW7A 3S3CB 5K39A 2HLFD 1RJYB 2BSSB 1SJHA 2HN7A 3ASOB 2A5UA 4H7VA 2X89A 1EEZA 4U1KA 4ZAKA 2P7TB 5DTFB 1WIPA 2QBWA 4PJBB 4NZ8A 4PG9B 4L8SA 3B3IA 2XV6B 3AVEA 5C9JB 2WUBL 4LXFA 1XR9A 4RFNB 3IB4A 4ZZFA 4LQ1A 1M05B 1CL7H 5J56B 1YN6B 3LXBA 1JTOA 2VDLH 4OZ4A 4G7VL 4AIZA 3EGSA 3M8OL 1C5BL 3QRLA 5KTEL 1QLFB 3P3SA 2H2PD 2CCLA 2Y06L 4G6KL 4X7DC 3N44B 2VQ1A 2Y7NA 4WTXA 4FQ1H 1S9WB 1OP5H 2Y23A 4RGMB 1OT1A 1SN0A 1WVZA 5I9QB 2FIRT 3LKSB 5T5NF 4CDGC 3DJTA 3FQRB 4PJHE 4MMZA 4UMGA 2YSSB 2YGPA 5DI8A 1KCSH 4EE2A 1ERNA 4LCCB 5ADOH 4HPYH 5GZOD 5CMAA 2W5PA 1OWRM 3P3TA 2YD0A 4WO4D 1AD9A 1LQSR 3EGDA 5AWNH 5BQ7A 5ICYB 5HGDA 4QRUB 2G30A 2ZUQC 5EC2B 3VQMA 1L3NA 5DRXA 5DQDH 2FEDD 4WGVB 3CLFH 4XXWC 5GGUB 3S5LG 1TDQA 2BVPA 2WXIA 5F7DA 3VXNB 4B50A 3NRFA 4BWWA 2V2WB 5I1IL 1KLGA 1G7PB 2C9AA 4TSBL 2A0LD 3FB8A 3DTXB 2MCAA 4M93B 4FCHA 4NOFA 4ISVB 3S3BB 1BEYL 1SJEA 5E2TL 5FWRA 5GGRA 4UCFA 5JPNA 4W9CC 1KN2L 1RZQA 4XAWH 2N1KA 3CSTA 1I8AA 4HUMB 1NAKH 1XSKA 4HIHB 1GIGL 1TZAA 2X10A 2F15A 4W9JC 3GMRB 1E28B 4E0RA 3ARDB 5IROD 1U3HB 2ROYA 2P26A 2APVA 4OJYA 2ZUWA 2BNUA 1JIBA 2VCOA 3VW3L 2IPUG 4EOWH 3LQMA 3QNFA 3EFOB 3MGOA 2A38A 5CGYC 1UD3A 4FEIA 5JNYA 2NY3B 3GRWH 3U4EA 3VGAC 1BVZA 1HIML 4AQ8A 3BT0A 1FORL 4YDNA 3ZT6A 1ESOA 3H7LA 2X70B 4XTRC 5IJCC 5IG7B 2XYCA 1T1WB 2BNQD 1PZ2A 4P46D 4O2FB 3AS1A 5BRQA 4NHUA 4DKFH 3BSGA 2YEQA 5B7MA 1IC0A 3PQYB 2OMWB 2CJUH 4J12A 3M7FB 4XO5A 4E9VA 2VW7A 1W16A 1SZNA 1RH8A 3K5RA 4NUGL 1E6OH 1T7XA 3TVMB 1KTKE 3IMUA 2A1WL 4PRPE 4BZ2A 1ONQB 1P1VA 2R2CA 2WANA 5C09A 4G5ZL 4JRFA 1UWYA 1BAGA 2V5YA 4PJ9D 4HUVA 3CX5K 2XT1B 2ZOKB 2UWEF 3EDKA 3L7EB 1PBYA 1NL0L 1ZVHA 2VZOA 2CIKB 3W3BA 2ZYRA 4JZNB 5FO9A 3L3GA 4GJTB 3L9RA 2BX5A 4XC1L 4LVOC 4RAVA 4RZCA 2MOVA 4PMFA 2CDEB 1LEKB 4UM8A 2FEEI 4TVSa 5JOFA 3KGSA 4L18A 3EAKA 2RFXB 4ERSH 4OZGF 2IEPA 2A6JB 1Q9WB 1BVNT 3NFPA 2E7CA 3QG7L 5KANG 4IS6B 3SHSA 1KSRA 1IGIH 2NMSA 3CK0L 5G4OA 2J73A 2NNFA 2OMZB 4HZAA 2BPBA 2WBXA 3HFFA 3S0PA 1FNSH 2DTSA 2FJUB 1WT5C 3I2CH 4PRBB 1MW1A 4MJIE 4YVUA 1EHLL 1CDJA 4Q52A 4HMEA 3QXDA 2XOTA 2Y22A 4HUUA 1ZHNB 3D39B 4Z95H 1TFPA 2WNXA 1WCBA 4XP4H 4FABL 3BZEA 3V6OE 4J3OC 1DL7H 1TJXA 1A6VL 1JI2A 3NIDE 4Z8FH 1A6ZB 1FQ9C 1MCPH 1XGZA 3NJGA 1RZKH 4G8GB 4YHOL 1YQVL 1G7HA 6FABL 3PWUA 4HX1A 1A02N 3P4OB 2X3BA 2HMID 1XGPA 1MRDL 1IJ9A 3O3EB 5IJVB 3L2NA 1JVLA 2B2XH 2ZSWB 3KLKA 1KGXA 4Y1AE 2B1HL 1DANT 2ZONA 3BHBB 4WUUA 5I75C 5T3ZD 4W6WB 1YEIH 2DQDL 2WLKA 4I3RL 1QFWH 4JJHA 2HB0A 4JKMA 2BVUA 1WAAF 4D9LH 5EEWA 15C8H 3WLWC 1A7RH 3L1EA 2PTTB 3ZKMD 3ME0B 2AQQA 1KB9J 4QUOA 2WQRA 5BVPH 3H1ZA 3LS5L 2C1PB 3MACL 3IGKA 1KPVB 3P9LB 4DETA 3D2UA 5C70A 3EH2A 1DEDA 3OB8A 1TJIH 4DTGL 1R5WA 4MRBA 2GCYB 1GR7A 2A77H 5EU3A 3K8KA 4UTAH 1CE1H 1BBDH 2ZICA 3FFDB 4ATTA 1MCWM 1E4KC 1QSEE 4BK5C 2NPLX 1EJFA 3MJ9A 3QH3B 4ONGH 5LDUA 2PPAA 4R4BA 4XAKE 1E4XI 2FX7L 2E7LA 1ADQL 1CTMA 1GW0A 1JWMB 1OPGH 3UTTB 1OEZW 4J4PA 4A7TA 1P7HL 4POZD 1T3FB 2H32B 3MV9B 2O5NA 2V2TA 5FYJL 5FO8B 2X89D 2LVEA 2YOAA 4ZAKD 4P5SA 3DC0A 4B95C 1TZHB 4JX0A 1G7QB 4G3YH 4R84A 3KS0J 3OR6B 4TULL 3A6BH 1EZVY 5C0JA 3QUMB 2QPEB 4P59H 4ZS6D 5GXBB 1S46A 2GJPA 2VSMB 4HHAB 1CF8H 4MLIA 3QIWB 4OZFA 2WHVA 3VFSA 5ERWA 3OC8A 4HCRA 3IGAB 3O3UN 3V4PB 2Z7UA 1XIWC 1IGMH 1PZSA 1ZT7A 4PV8A 3TV3L 1NQBA 4XWOD 2P5WE 3QZWG 2Q8BH 3QJRB 1I75A 4MXVE 2VW4A 3NJVA 1RU9L 3T5WA 1NGQL 1I9IH 2H3NA 1KF9B 4LCWE 3RWFA 1YCSA 3O4LB 2MPAH 3LN5A 4KY1L 4M7LT 3U1QA 3VG9C 1UD8A 1NDMA 4JDZB 4R4NC 1JHKH 5EO9A 2UY7A 1E8WA 1DVTA 5ID0A 3CZKA 3FB5A 4U1SB 3PG2A 5EZOH 4NFBA 2ICWJ 3HR5B 4CW1B 4Z7OF 1JMXA 1SYSB 5ABZA 1JPGA 5HJDA 1UM5L 1JPST 3D4CA 1UB6B 1Q9OB 5AVZB 3AMLA 5L2JB 3MYJA 3QUHA 1HKFA 2CUHA 1F3DJ 4N2AA 1NWPA 2QKIC 4P3DA 3BPOC 3KM2A 1MREH 3VD1A 3GIVB 4O5LL 5BCAA 2J8UE 4WWKB 1ET5A 1A4AA 1TVHA 4UQEA 5HY9B 2HH0H 2XIBA 4HEPG 5T3XL 1DBML 4MCZB 4KITB 4QPEA 3MTRA 4GIOA 2RA1A 1VLXA 5F1SA 1IMHC 2CHWA 1YLBB 3HS8A 4NEHB 4ELMA 2NY5H 3U36B 4PEEA 4N8VA 3WUZA 4R0LA 4XP6L 1EFXB 5JORB 3EJZC 2I07B 3C5ZC 5T1LB 3VU1A 4HWEL 4PN6A 4JUTA 2PYEB 3UTSB 4CN1A 2O5ZH 3T3MF 2JVUA 5BUPA 3D87B 1KJ3H 5DD0H 1SBSL 4PMEA 4EKJA 4X4ZA 4F58H 2AZUA 2FGWL 3SE8L 2ZYSA 2IPKA 2ZXDA 1RURL 3QJTB 5LCVA 5GSRA 1BG9A 2JK5A 3WEAA 1UACH 1P9MA 5C0GA 1NCNA 3DDGA 4PG2A 1X7QA 4UDTA 2DWDB 3L3OA 4BE6A 1KGWA 1G7JB 4IU2A 1JZ4A 5FW7A 4G1EA 2G60H 5HD8C 5JHLL 3RDTC 3DVNB 1AY1H 5C09D 4KKQA 2WVVB 3PWNA 1GC1H 2JXMA 4S1RH 2VSDA 5EPMB 4A04A 1S9VB 1YVLA 4CC1A 2QVIA 4P5RA 4C4UA 5A6LA 5LN8A 4QRQA 4OAWA 1MCOH 2YMXL 2WWMD 1QEXA 3I6GA 3WOVA 3GT6A 4UTBH 1NOFA 4LEOB 4FQHB 1HL8A 4U1MB 4MNHA 3RHWK 1H3TA 2WMPB 4IQHA 1MNUH 4BK5A 3GSNB 3S36L 1QBLH 3KWXA 4PJAF 5FGCB 1VKXA 2JCCA 1L7TH 3V5DB 1I3GH 3AREA 4WSJA 3L4WA 3E1F1 3L6FA 3OKMB 4GXFA 1FL5B 4FG0A 5H4ZA 1ZXKA 2BVTA 3NZSA 3UTPE 4YL4A 1FP5A 3R1GH 2IG2L 2YSTA 1V7NL 5F6HJ 3SDDC 1NJ9B 4YR6B 4YEEA 5AEAA 1JFHA 2PCPB 1G6RL 4WNQA 4ZFFA 4K5PA 4A55A 1DJIA 3MRKB 3KPQB 4JR9H 2IWEA 1ETJA 2O30A 2V9UA 1TF4A 2F74A 1H3VA 3HI5L 4HBQA 2VLJB 5DWUH 2XQBL 5HDBE 4N0YH 1RKRA 3IT8D 4XNYH 2ZT9C 2F08A 3A24A 3QEUB 2PXYA 4WUUD 4AOFA 3WN5A 3MUHL 5DSCA 1BF8A 2B59B 3Q0HA 1S7UA 2EINB 1BECA 3UGEA 2LFEA 2M26A 1OT4A 3ULSB 1O9WA 4CUCA 3Q8EA 3ZZSA 1AXIB 1OCWL 3O6KH 1YG9A 2FZ3B 4ODVH 2I60H 2P42B 3UGXA 1DJGA 3CVCA 1HHGB 1BZDA 4OZIE 1GZQA 1O9VA 5FDWB 2Q86B 2YD4A 1FH2A 4LOFA 2NY0C 4L9LB 3ZL4L 1PKOA 4O58H 3DBXB 5IK3B 4FJ6A 3DTUB 3FK3A 2JB6A 3R19A 3V6BR 1HEZA 2UZXB 3LRSA 1NCWL 5L7XL 5EOQL 3ZDZB 3H42L 1BQSA 4ZPTB 1W9XA 3D2UD 3A4AA 1AGDA 4X42A 2JE8A 2AEPH 4BV1A 4P9ML 3IFPB 2FWOB 5LGYA 2NQCA 3AWEA 4OV5B 4A7QA 4TUJA 1BHGA 1R46A 1NUGA 3Q6GH 1BVKB 32C2B 2EH8L 4S1SH 1WFMA 4FFYA 4DN4L 4J4PD 1CGSL 4JFHD 3GBEA 3BKCH 1UT1A 3CHSA 2GUYA 3OX8B 4IJ3B 4JB9L 5A6MA 2I9TB 4MVBC 2P1YA 1JHLH 3PHSA 5C7XL 4V1DB 2FRGP 1P53A 2ZKYA 3I85A 2K8QA 4NHCL 2EKSB <