1NIDA

The structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
333
structure length
333
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title The structure of copper-nitrite reductase from Achromobacter cycloclastes at five pH values, with NO2- bound and with type II copper depleted.
pubmed doi rcsb
molecule tags Oxidoreductase (nitric oxide(a))
total genus 88
structure length 333
sequence length 333
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nidA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nidA02
1BEXA 2XU9A 3CZUB 3NJGA 2FT7A 3ZDWA 2PPAA 3PXLA 1I53A 3FSAA 2FQDA 4G7SB 4BWTA 2J5WA 1YLBB 1BQRA 2FJSA 1AZBA 2WSDA 5B7EA 3RYMA 2P80A 2JKWA 3SQRA 2PLTA 2VMJA 1SFDA 3UACA 4YL4A 1J5DA 2FT8A 2TSBA 3H4HA 4YVUA 3EF4A 3T6ZA 1HAWA 3FYIB 1JZHA 3NSCA 4KO7A 1X9UA 4AX3A 1A8ZA 4HCFA 4F7KA 2BP0A 1NIDA 5PAZA 4E9RA 3NP3A 3DIVA 4AKPA 1KCBA 4FA7B 1A3ZA 3TA4D 2VSMB 2I85A 2Y69B 3FSVA 5B7FA 2OJ1A 3NJHA 3X1NA 3OM3B 3GYRA 1ET7A 3NJJA 2PPEA 1WS7A 2IWKA 3N2JA 4AKQA 4YSQA 2AFNA 2QDWA 3IE9A 4YSOA 1URIA 4DPAX 2XXGA 1KYAA 2J57A 2ZONA 3T6WA 2GC7C 4DP8X 3H4FA 4BWUA 4A2DA 2PPFA 2YXVA 5AZUA 4E9VA 3IN0A 1J9RA 1A4BA 1V54B 4HCIA 1EHKB 5FC9A 2XUWA 1ZDSA 2DWTA 4DP1X 5I6NA 3MBWB 2GC4C 2QDVA 2ZWNA 1JXGA 3QJUB 4YSAA 2JXMA 4E9WA 9PCYA 2UX7A 3ZIYA 2J56A 2BWIA 1RCYA 1CC3A 4ZK8A 2XVBA 1GR7A 2XX0A 3CVDA 3X1FA 1AIZA 1TEFA 2A3TA 2XLLA 4DP6X 3ERXA 3AY2A 1HAUA 3AZUA 4G7RB 1JXDA 3TBBA 1JVOA 3EH4B 5I5IA 1N70A 1SDDA 1VLXA 1MDAA 1L9QA 2B08A 2VW6A 2XV3A 3X1BA 4A68A 1WA2X 1BAWA 2VSKB 3BQVA 1FA4A 4UAHA 3WNIA 4M3HA 4A2GA 3NJIA 4W9ZA 2CJ3A 1KGYE 2CAKA 3CG8A 2UXTA 4M4RB 1B3IA 2I7SA 4QKTA 1E30A 2FNWA 3SBQA 4DPCX 1QLEB 3NP4A 4GP4B 1BXVA 4W1TA 5B7MA 1J9SA 1L9PA 2ZOOA 2FT6A 7PAZA 1PLBA 1SHXA 2FQFA 2H47C 1JOIA 4KNUA 1XB3A 3ZX1A 1NPJA 3DKHA 2BP8B 4RH4A 1BQ5A 4HALA 1V55B 5B1JA 4DP4X 1F56A 2W8CA 3G5WA 1AS7A 4P5RA 1GS6X 3FQ1A 4YSTA 1PCSA 3V9EA 1OCCB 1TU2A 3QJTB 2AZAA 5PCYA 3PAVA 1L9SA 2Q5BA 4TXVB 2BW5A 4DP0X 3SBPA 3H56A 3T6XA 1M57B 2N0MA 1HFUA 3NSDA 4FAAB 1SHWA 3T9WA 4A2EA 3CVBA 1JXFA 1MZZA 1DYZA 2IDQA 4G71B 4WKXA 2XXFA 2XWZA 1M9WA 1AZUA 2EIKB 2VM3A 2I7OA 3NSYA 1FFTB 2CCWA 1PZCA 1NZRA 1IBZA 5B3SB 4DP7X 1NTDA 1ILSA 3FQYA 3L45A 6PCYA 2XX1A 2YAMA 2PCFA 1UATA 4AI7A 2BP0B 1XB6A 5AFAA 3FU7A 3MX0B 1J5CA 3S8GB 1L9RA 4BDVA 3S3BB 5IY5B 1IBYA 2YAEA 5B1JC 1PY0A 2CALA 4CSZA 3FU9A 2HZHA 5I5JA 4Q89A 4E9TA 2VM4A 4AZUA 3ABKB 2FQGA 2YXWA 2GI0A 3NJMA 1CYWA 5F7BA 3FPYA 4L0PB 3JTBA 4E9YA 1ASQA 2YAHA 3D12B 1ADWA 1W6WA 2R7EA 3QPKA 1CUOA 5EHFA 2EIJB 3CVCA 1GSKA 2DYRB 4KOBA 4KO9A 3KW8A 3U25A 1NIAA 1AQ8A 1NWPA 4GXFA 3ASOB 2IDSA 2YAFA 2QPDB 1RZQA 4YVNA 3UADA 3PCYA 8PAZA 3NJFA 2HX8A 5I6KA 3QJQB 2JFCA 3EHBB 3OMNB 4HIPA 3S3DB 1NPNA 1JERA 3S3CB 1ZIBA 2HRHA 3NT0A 3T6VA 1GS7A 1AZNA 6PAZA 1AZRA 1SDDB 4HHWA 4GYBA 3X1GA 2X88A 4UF7C 1ZDQA 1JVLA 1WA0X 2ZXWB 2YAOA 3NJKA 3QJRB 2P80D 5D4JA 1J9TA 4GP5B 3S8FB 2CBPA 3PPSA 4KNSA 3AG1B 1JZGA 1ID2A 2UXGA 1IC0A 1AZCA 3FS9A 1R1CA 3BVDB 1GY2A 1NIEA 3KW7A 1DZ0A 4NB7A 5E9NA 2XYBA 3WG7B 3UAEA 1PZBA 1SFHA 1OOWA 1E5ZA 4BK5C 3OD3A 4X4KA 2BWDA 2GB2A 2GBAA 1ZPUA 1TEGA 2IDUA 2PP8A 3QJSB 4YSRA 2AZUA 1W6LA 4BXSV 1KBWA 4K9JA 2PPDA 3T71A 1AS8A 2DWSA 1AG0A 3WI9A 5LDUA 1PNDA 1AACA 2H3XC 3V9CA 3FSZA 3AW5A 3GXUB 4BWWA 4YSCA 5D4IA 1X9RA 2HXAA 2MRYA 2EIMB 5D4HA 1PMYA 1KBVA 3CDZA 2Y1AA 3GDCA 1NIFA 1PNCA 2QPEB 2MTAA 3X1EA 1JZEA 5B1KA 1BQKA 1MZYA 4N4YB 5TK2A 1N68A 3HB3B 3UABA 4A67A 2GHZA 1RKRA 1RZPA 3FQ2A 4G72B 1BXAA 2YAQA 4Q8BA 3QJVB 4DP2X 2IWEA 5AKRA 4BXVA 3PAUA 4QLWA 2IDFA 1OE1A 1PLAA 2RACA 2HX7A 5I6OA 4UANA 4YSPA 1GS8A 1AS6A 1W8EA 1XB8A 2IWFA 3PAZA 2H5UA 2PPCA 3FU7B 2E86A 1M56B 1MG3C 1MG2C 4BDVB 2WO2B 2B3IA 4KOCA 2HRGA 4MFHA 3AG4B 3WKPA 1E5YA 1WS8A 1TKWA 2DV6A 2UX6A 2VW4A 1KCWA 1A4CA 3HEIB 1SF5A 3WNJA 1E65A 1PAZA 1BXUA 1NIBA 3UAAA 1PLCA 3IN2A 1OV8A 3NYKA 3PLYA 4DPBX 2YAPA 1A65A 1OE3A 4NERA 2R7EB 1ZIAA 1GW0A 3ABLB 3ABMB 2FWLB 1JZIA 4AKOA 4A66A 4YSUA 3N55A 1BYPA 1SF3A 1V10A 1CYXA 1QHQA 3OMAB 5B1AB 5F7AA 2BZ7A 1J9QA 2AANA 4E9XA 2XV2A 4CSPA 1ET5A 2LLNA 2VW7A 1PZAA 2HX9A 4DP5X 3SBRA 4YSEA 3UGEA 4WTQA 4KO6A 4DP9X 5I28A 3AG2B 2EINB 4YSSA 4NAJA 1AANA 2PP9A 3FSWA 1CURA 3DTUB 2TSAA 2FQEA 2PCYA 2IH9A 4N8UA 3ZBMA 1IUZA 1KV7A 4KNTA 1GY1A 3ASNB 1T5KA 4HHGA 2YARA 4GP8B 3AG3B 4JHVA 2WO3B 2W88A 2VN3A 4G7QB 3OMIB 1OCRB 4JKNA 1ILUA 2BW4A 1EZLA 2NRDA 3TBCA 4F2EA 1PF3A 2YQBA 3ABGA 2XV0A 2QT6A 1OF0A 4HZ1A 5A7EA 1E67A 2BO0A 4E9QA 2X87A 1GYCA 3WIAA 7PCYA 4PCYA 2IAAC 3WKQA 1A4AA 1IKOP 1ET8A 1XMEB 2UXVA 1SJMA 3X2QB 4HAKA 1L9OA 3C75A 5ANHA 1NINA 2J55A 2AVFA 1WAEA 5B1BB 1NDTA 1JZFA 4GY4A 5I6PA 4KO5A 2CUAA 2DY2A 2FTAA 2Q9OA 3JT2A 4YSDA 2HLEB 2OV0A 3EH3B 1NICA 4A2HA 2BHFA 3TASA 4P5SA 5I6MA 4ENZA 2UXFA 5I5MA 3FT0A 1OE2A 2OCCB 3IBOA 1AOZA 4F2FA 1ASOA 1ZV2A 3IEAA 4EF3A 4E9SA 4HCGA 3NJNA 5I26A 1AR1B 1ETJA 3NSFA 1KDIA 2PP7A 2DYSB 2BP8A 3OQRA 1AAJA 1KDJA 3QQXA 3TU6A 1OCOB 1OCZB 2IH8A 2BZCA 1AG6A 1BYOA 1QNIA 3CDZB 4A2FA 1NWOA 3FPXA 2GIMA 1FWXA 1WA1X 2IDTA 3EH5B 4JHUA 1SNRA 3NJLA 1ASPA 1JZJA 3FU8A 3FYEB 2EILB 4PAZA 5I6LA 1L9TA 2GSMB 5TK4A 4G70B
chains in the Genus database with same CATH superfamily
5DVOA 4EDWH 5CJOH 4NO2A 2ILLA 2HG5A 2RGSA 3GMRA 3KPNB 4GXVL 2A9MH 2ZSVA 3ZYZA 3MRMA 4NKQB 4OLXH 5AAWC 4G7VH 1AGCA 4QRSB 4HK3J 5EOCL 2FJSA 4JFZH 1N6VA 3NIGB 2C3VB 1LHZA 4UQ2A 2FWUA 2VMJA 1V7MH 1SFDA 3IS0X 4XN2A 4BM7A 1J5DA 4ZT1A 3SPVB 5E2TH 5SWZD 4JFUA 1HAWA 5LCVH 3FN3A 4JFQB 3T08A 4WWKA 3II3A 1EO8H 4V33A 1KEGL 4UT9H 3APNA 4ZPTB 4TSAL 4AQAA 1LO4H 1FUNA 3TM6A 2W38A 4AM0A 2HVJA 3MJ6A 3Q0HA 1E27A 5LAXB 1V7NL 2I85A 1QMUA 4JFXA 1QTSA 2DW5A 2FD6L 3NCJL 2LTQC 4JQXA 3GSVB 1CFVH 1RUMH 3SGEI 4YHML 4HFWB 4TSCH 2JB6B 3SYCA 2VDMB 4P49A 4D3CL 5HHPB 3VFOA 2CO1A 5JHMA 2Z92A 4OF0A 1AY1H 1YMMB 5DEZA 3UMNA 4PRIE 4TVPH 2J8UA 3LD8B 1UADC 4MMYB 2J57A 1QA9A 2FIRT 3WIHA 5DVKA 4OB5L 3WY3A 1B2WH 1IV8A 3P77B 4MGXA 3OGCA 4NQVA 5EOCJ 5CLYA 4KY1H 3MV01 3RVXD 1JHKH 4M9PA 2A6JA 3HC0B 4X7CC 4GIOA 4AIXA 3MRHB 2B39A 5B38B 1VPOH 5EUOB 3QA3A 4H0GA 3V4PA 5E8PA 5BQ7A 2YBRA 2YA1A 3WXWH 1DQTA 5JUEH 2EO9A 4MNGE 4AM0Q 5IFAH 2C7UA 1AQDB 2QMKA 2CR3A 4XBEL 4HWBA 1TEFA 4FD0A 1G6VK 2IC2A 4W9JC 1DBKH 3NTCH 4OBRA 2IBZY 3MLZH 4TLKA 3V8OA 1N0LB 1D6EA 1OP5K 4BQ8A 4KROC 5JQ6H 3VXPA 3U2SB 1O7SA 1WP6A 1MHPH 1SDDA 4ZDHA 2HLFD 2B08A 2VW6A 3FU6A 2EVIA 1QRNA 3DUUB 3LQZB 1QFWL 4M62H 1WA2X 3VVVA 4XWOD 2E3VA 1FA4A 5AYUL 4UAHA 5K1VA 3C5SB 4JE4B 1JV2B 1DN0B 3ZJAA 3K2UL 1I1FA 3NRQA 4I5BB 3WNMA 4WNSA 1O6SB 2J6EH 4NDMA 1WTLA 1HIML 2WSKA 1JZ2A 4NJ9L 1J1PH 3NZ8A 4WI0B 1UCTA 4M8VA 4GP4B 4JFHD 5T1MA 4IJ3B 3IM1A 4IOFC 4NQDD 4U3SB 3LS5H 5F21B 3NH7L 4JHAL 5IIEA 4HXAL 3CQQA 4K3EH 3GO1H 3ISWA 1RD6A 2A9BA 4OLZH 3SGDI 1TJGH 1T1WB 1OLZA 5D93C 5T5FH 2CNZA 1R9FA 3BZFA 4JFEE 4E42B 1TVHB 2MTPA 1JE6A 1EUTA 2P5WB 1ZTXE 1YJDC 3D08A 4WI7A 2WV3A 1Z9OA 1WFJA 2IG2H 5I74C 2J5LC 4FLOA 3WEXA 4DEPC 2ARJB 4HALA 4PJIA 4POUB 4PJ6A 3CFMA 3L6FA 3G5WA 3FW6A 1FLRL 1P4UA 5ISZD 5DD1L 4P5RA 4HIXL 5EEWA 2NY6D 3O4OB 1CO1A 2A6IB 4WIQA 3IGLA 3BDYL 3EZ8A 3GMNB 3GBEA 3P9LB 3VFUA 4J6IA 4Y4FD 4ZMYA 1EFXA 1U92B 2ZX9A 3SD2A 4YR6B 3PDOA 4PB9L 2HT3C 2JKIS 5IBTH 5AVTB 1U2CA 4AL8H 1DBML 1LQBC 4G2AA 3HHMA 5J6GB 4TLTA 4FGMA 5T1LA 3K8KA 3ZGHA 2ESVA 1U8LA 4OD1H 3IFPA 4JM4L 4AXWA 2CJUH 3IJYA 3NQIA 4F3FA 3KLAB 1MCLA 3J27A 4POYA 4BKSC 4MAYC 1PDKB 2F53A 1JF1B 4BCYA 4NQCB 2NR6C 3L45A 5I1GH 4G5ZH 3V6FB 2F7PA 3RTQC 3MBXL 3H53A 1Z6JT 3KPRB 2F2HA 4QF1B 3BE1L 4XAWH 5JR1L 3EXJA 2ZUWA 2VDNB 4I1RA 4X6CF 1P5UA 2X1XR 4L05A 4ZXBD 5JOPE 1I3GL 2P7TA 4YX2L 5FV2A 5IY5B 4K3JL 3JQOB 1WFNA 4JRYE 4W9IC 9CGTA 2HZHA 5FKAA 5SX5K 4GI6A 4KVCH 1HU8A 1FFPA 4FQHB 4YO0A 4ELDA 3ZDZB 4A6YL 5DT1H 1FFNB 1FORL 3JV4A 3QIBC 3EYVA 1KCRH 5F7DA 2FX8H 5AW9B 1CE1H 4KKZA 1H3PH 3O3AA 1G9MC 2BIPA 3FO0L 1QASA 4XCNB 1UM5H 1Z5HA 4PGBA 5HDOA 3FUFA 1CUOA 1R6VA 3APFA 4XPGH 2YUWA 1T1XA 4HUWB 3DI2B 2JLPA 3FB6B 5B1CA 4K3DH 3RDTB 3SDAB 4KTEL 3B7SA 4B7LA 4FFWC 4ENED 2GITB 3WN6A 1OAXH 4XB3A 3CH8A 2YA0A 2B16A 1RUQL 5ID1B 2IPUG 1BHGA 1DQJA 3CJJA 3MLPA 4YHZL 1YJDL 2QPDB 3D4YA 5CMAA 2B14A 1OM3L 1E4XH 3IPEA 4JZJC 4BZ2H 4PWEA 2X1WL 1ZVSB 1U8JA 4PRDB 1TZIA 3BH8B 3BLBA 1NCNA 2DWEA 2V6HA 3NESA 2YPLA 3PHAA 1KTBA 3X1GA 5FYLH 4I3GA 3VJ6A 5LGHL 5FIEA 1JCVA 3CN0A 3GRWH 4FFVD 4M56A 4QUOA 3VWJD 4NJAL 3BP6B 4L5FH 4MXWL 4X9FA 1PZDA 4Y9EA 2PTTA 1JK8B 4DCQB 4QTHA 3NCEB 3IRZA 4YIQA 3PDGA 4OFQA 5E94A 4XH2A 3AREA 3HA0A 2P24A 4YBLC 3U9WA 3WG7B 4KK5D 5K9QG 2D0FA 3UAEA 1MVFA 2YKKA 1VEPA 3FO2B 1B0RA 4LFHG 3BXNA 2O5ZL 4UQDA 3DUSB 3DRQA 4UV4H 1AR2A 3O41A 1WUNT 3QIWC 2EIDA 1EO7A 3MNWB 4GUCA 3MCLL 3LXBA 1MKFA 1NBVL 3FCTB 1LE5A 3K0YA 3FXIC 4LL9A 1NAKH 2XN2A 2OXHB 3KLLA 3WI9A 5A1AA 2ETWA 4YHKL 1BFTA 3N50A 1TU2B 4N90E 1FNFA 3QUXD 3WFHB 4EEEA 3QDAA 1R3KA 2ZXEB 1AC6A 3UO1H 2R9HC 2G30A 4KC3B 4PJFF 4L8BA 1KG0A 5AW7B 1INQA 2EIMB 3HAEH 3DGGB 1CU4H 4FXKB 4MMZC 1JTPA 1QOKA 2HRLA 4P4KA 3TPUB 4K7FA 2Z4QA 1NLBH 3HNTL 1LD9A 3D30A 5HGHB 1QZ1A 2CO6B 1GL4B 1KYDA 2EEFA 5DVNA 3TO4B 4PLKD 4G8EB 1ITBB 3EGXA 4JM2C 2KZWA 3UZEA 3EYFA 1F00I 5HGAB 2WCPA 5EN3A 5L2KD 1FZOB 2XWJB 2I5YH 1MPAH 2HX7A 2VIRA 1Q1JH 1B0GB 2UZXB 4PJ8D 4RZCB 1QLRA 3VFPA 1U8OA 2ARWA 3P4LA 5TE6L 4HAGA 3ROLB 1KXTA 1WITA 3NSXA 2IADA 5EFIA 1FVDA 4TNGA 3B5HA 3AG4B 3MACH 4HK0A 4N2EA 4XGZA 5DWUH 3O6FA 2Q86B 4ISVB 1ZLVK 1KCWA 1NH6A 5CP3A 4K5LA 4Z7UF 4O2CA 5HHOA 4AGLA 2X9ZA 5AVRB 4HKBA 3IN2A 4NP9A 4CMMB 2WM0A 1T66C 3CFBB 4ONGH 2VL5A 2BC4B 2A6KA 3K7UA 4U2YA 1ED3B 2WXQA 3HN8A 1T03L 4IBQA 4HC1L 5F0PB 3IKCB 5JQHC 3IGAA 2EE3A 5GGUB 4V1DE 3C9NA 1MI5E 3ARFD 5ABZA 3D33A 2XV2A 5FGRA 2NYYD 4HQQH 4HUCA 1JZ3A 3WTXA 4QRTB 1EMTH 1D9KD 1S7TA 1HWHB 4DP9X 5IQLA 3RQ3A 1YY8B 3F7KA 4PJDB 4PGJA 1G87A 5I1EL 2FATL 2CK2A 5DGRA 3ZPDA 2PCYA 5JYMA 3N1FC 1ZEAH 4PVNA 4RAHA 1GY1A 4KDWA 3FQTA 2AJ3B 5HDBF 4TQIA 3KL5A 4HLZG 5FO8B 3WJLC 1ZT1A 1JGUL 4G7QB 5ELIA 1SJXA 2ZSWB 3CVHH 3VA6A 1DL7H 3NG5A 5D6CB 4YEFA 2VDOL 3TBCA 1TJHH 2UVEA 5E8OB 5MP6H 3HE6B 3ULSA 4H8HA 5GRVK 3D87B 43CAA 3UCQA 4NPYA 4EZMA 4OZHB 3U82B 4MJ4A 4EBQH 4EDWL 5CJOL 3VYNA 2NTFA 1L9OA 4MJIB 2Q7NA 4X5LA 5F7UA 2AVFA 2ATAA 5CGMA 3OXSB 1UB6A 2A9ML 3EDFA 2ZCLL 3E8UH 3QFJA 4OLXL 2DY2A 3QNZB 4G7VL 5GGTH 4JFZL 3QORD 2IPKB 5DUMH 1EAOA 5A6MA 3SO3C 2YEVB 4H26B 1J10A 1V7ML 4KITB 3HOGA 5I6MA 2VITB 2UXFA 5E2TL 5CSBA 5INCA 5LCVL 4FFTA 4K8RD 1EO8L 4RGND 2NY2C 4JQIH 4UT9L 2Z0BA 3MHZA 1OGTB 35C8H 3T4AB 5I26A 1ETJA 4NN6B 1XL6A 1ZKAA 1T4WA 3FTZA 5EF2A 2NW3A 3ILEA 3K1DA 4WGKA 4Y19A 3QQ9C 3C60C 5DS2A 1XH1A 1OCOB 4PSPA 4ZUWA 2BOLA 3DVFA 5IB4B 1YRKA 1CFVL 1RUML 2YWZA 5D7LE 4Q58C 3MXWH 4TSCL 3TJEH 1IE4A 4BKLA 4QRPB 4PP1D 1CFMA 5D5MF 1AY1L 4PAZA 4HCRA 4TVPL 1DJGA 3HE7B 3RYMA 3QHZH 3ZHFA 4DZBB 1B2WL 1L7IH 5A2FA 5KG9B 2EVFA 1P53A 1I1AD 3S35X 3SDXA 4AJWA 4CJ1A 3GSRB 4KY1L 4NPKA 4WNJA 1JHKL 5AENA 7FABH 3WNKA 2WQRA 1KCUH 4L3CA 1CICD 2Z65C 1VPOL 4U1MA 4FNTA 5DJYA 4BUHA 4EN3B 5AVVB 1BP3B 3P4OA 3WXWL 1FPTH 2Q0ZX 3CFIC 5JUEL 2P5EB 3T4YB 5KS9A 3P0YH 1GH7A 4YUEH 1A8ZA 1OSPL 1ADQA 2ZYRA 4EE2A 1ANUA 1I4FA 1DBKL 5DC4B 3MMEA 4XP4H 3MLZL 2A6DA 3DX8B 3GJFH 1XCQA 2XA8H 5AOIA 5JQ6L 2AQRA 1MHPL 4XO3A 4GH7B 5IMMA 2Y69B 1QEXA 4PLJD 1PG7W 3OWEA 3QI9D 4M62L 2DN7A 2NTSP 4ZRGA 1OT2A 3ECVA 3U30C 1DANT 2OZ4H 4J3UA 2V7HA 4ACPA 2AQQA 1CQYA 4PG2A 2VLRA 2EEDA 3C6SB 2J6EL 4KU1A 2YD0A 4R90H 3CQPA 4PJEE 3QXAB 4WUUA 2XWBA 1J1PL 4B9PA 4WTWA 2JIXB 2EXTA 4LHJB 3LS5L 4NQED 4Y5XA 1MVYA 2F7QA 4K3EL 3DROA 2FH6A 2HN7A 3GO1L 4OLZL 4UBDC 3S35H 3SYPA 1TJGL 2PO6C 2PTVA 4Y8AA 5T5FL 5C1MB 2WZAA 1A1MB 5C0ND 4OAWB 3LRHA 4O02A 1LP9F 2IG2L 3TO2A 4UQ3B 5AWNH 2Q10A 4AIZA 1WCBA 3ARBC 3W56A 1TZAA 3MV7D 5KSAC 4E2OA 2R59A 1CL7I 4XN9A 4HULB 3RJQB 4RSYA 1CC3A 4LCWE 1GR7A 2XX0A 2QPFA 4Z8FH 3FK3A 4YHLL 1RSFA 3KLSA 1PY9A 2NX5B 1FL3B 5EZJA 4G7RB 5IQNA 1GYUA 3WJJC 4JVWA 2P8MB 3HRZC 3DHMA 4NCC1 2FGWH 3WO4C 1B4JL 5GRJH 1ZHKA 4Z3TA 5BCAA 3G6JA 2LU5A 2QFRA 1SYVB 2FL5A 3BYYA 5IBTL 4ANKA 3NN8B 2BVTA 3MKGA 2LOEA 2V17H 1IGIH 3L7EA 4AL8L 1A02N 2XVKA 4AGNA 4M4RA 3QIUA 3OKNB 4HUNB 4QEGA 2DQMA 5DEFA 3RVUC 2CJUL 1QLEB 3NP4A 3WBDA 3QDMB 1KC5H 2XY1A 3NZHH 4YHPA 3TN0C 4OUOA 1TQCC 5I1JH 2AJZA 5I1GL 4G5ZL 3QDGA 3KNBA 3S36H 1TCRA 5D96C 4JFDA 5AW5B 3Q6FA 5I71B 4XAWL 4V2BA 5D2LE 4TSBH 4C4KT 1K8IA 1EHLH 4NC2B 3DTXB 2QADB 5EU5A 2EXWD 3QR2A 1P2CB 2BWQA 3PIQA 1T04A 1XWVA 3VD2A 1RURH 1RERA 1F2QA 4B9CA 3MODH 3BYTA 4IHOA 1BBJB 4KVCL 2OMZB 3AXIA 2QVKA 4GW5A 5CEYB 2O61B 4ZSOE 5I1DB 3MJWA 5MEPA 3GM0A 1RMFH 1KCRL 2FX8L 1CE1L 1H3PL 5HGBA 3MRQB 1UM5L 3K80A 1U8HA 3PJSB 4XPGL 1NCAH 2ZUUA 4K3DL 4N86A 2ICEC 3ARDD 4BGDA 4AWJC 1DVFD 2IDQA 1OAXL 2K8QA 2X4OB 1TR7A 4JPWH 4EAEA 2I7OA 2EIEA 1OZTG 5CIPA 1R0AH 2H1XA 5FF6B 3NIFB 4GIAA 2G75B 4X5RA 4NRXB 4XMUA 3QC5X 1K4CB 1E4XL 2EE6A 1TSHA 2MNUA 3GSWA 4BZ2L 1UT9A 4P5TD 2ITEA 4V1DB 2EDHA 3T8XA 2VJ0A 4MNHA 1J87A 5MEOA 4TV3A 2FE0A 1WCQA 4BJLA 4LPTA 3NCYP 3GMOA 2GSGA 1WUZA 1EXUB 3NIDE 1MQKH 1Q9WA 3PUCA 4WFGE 1BOGB 2AABH 3LNFA 3PHOB 4M8QB 4PJHE 1UZGA 2EDLA 2E9WA 2R15A 2Y4SA 3FO9B 3GRWL 1PX8A 1HQ4B 3L3GB 1MWAA 2ZJSH 4JDTH 3HG3A 2NDGA 2WZ5A 1E43A 2FCBA 1PKQB 5CLTA 5F9JA 1ADWA 2XETA 1MCOL 3CVCA 1V27A 1UA3A 2JKLA 2RIKA 2MQGA 5F8QC 3PY9A 2WJ5A 5BZDB 1AQ8A 1U2HA 5FYKU 1NWPA 4GXFA 3BKMH 4FEMA 4L1SA 4QJ4B 4JFFD 4UV4L 4R7NA 4P2QB 3CU7A 1A3LL 2NY3C 2VR4A 1JV5A 4IKLA 4QT5A 2BSSA 4WNQB 1U8CA 3NGBB 4I0PC 1GOHA 3GD1C 4ZFZB 1NAKL 2B1AH 2B59B 1VCAA 2CLVB 5EIIA 2QVIA 3TBYA 3T8MA 3HHRB 2EDRA 3BD4A 2FHBA 1R5WA 1VESA 3COOA 3RX7A 4OI7A 1HXYA 3CSTA 4P46D 1QUNA 4QRRE 4QOKB 3MREB 1JGVL 4TNWK 2DTMH 2EDWA 4XPAH 5MHSD 3L3HA 3QJRB 3UBHA 4CA4A 5MEQA 3M7FB 3TF4A 5E00B 2GUOA 2R1XB 5FM5O 5IBUG 5E6IC 4L8SC 2LU7A 2MQCA 4WEBH 2YHGA 1MJJB 5DUBA 1VFUA 1T0PB 3I6KA 3VFRB 1H8OA 4YZFF 3ILPA 2IPUK 3JV6B 2C1OA 4KXZH 1HHKB 3IF1B 3VG9B 2DQJH 1TUPA 3RJOA 4QHPA 5A2LH 3APMA 1H3WM 2I5YL 1IKNC 4PV9A 1A4JB 3L4CA 1Q1JL 5DRWB 1ZT4B 5CJ8A 5SX4I 4UINH 4JY4B 4NO0D 3OSKA 3GM8A 2VTFA 4FQXB 4G6FB 1EAPB 2AZUA 1BQHG 1T83A 4MCZA 5DS8B 3QO1B 3AFLA 3PL6D 5C08A 5BUPA 5DWUL 1PIFA 2YQ2A 3KL3A 1H6UA 3KR3H 3RUGB 2K6ZA 3QDJA 4MXQC 1X7QB 2ZZUT 5AW0B 3GXUB 1RPQA 5ICZA 5B8CA 3K71A 2V2XB 4ZUVA 3EJZD 3GIVA 1E9QA 2GT9A 1QBMH 3PWVA 4ONGL 4G5AA 1AGFA 4EUPH 3BVVA 4QRUB 3BIKB 3VXME 2W92A 5BO1H 2DL9A 3RPIA 2MQ0A 3DX9A 4MYWB 4X8JA 3JTTA 2EIZB 2WTRA 1EZVX 2QPSA 3CH1A 5E1AA 1QRKA 2VZVA 1SQ2N 3OHXC 5J6HA 4FI6A 3RURA 4UOQA 4PJ9A 5AG9A 2ICWJ 4N3UA 3B9EA 4PJCF 1EMTL 4UQEA 5F88A 1A8JH 1EGJH 1R3LA 2IWEA 1BVLA 4BXVA 4XHJC 4YJZL 5JIKA 1L5GA 2WLIA 1OGAD 3TFKC 2B7DT 2Z4TA 3HN3A 3P3SA 3RX5A 2BH0A 1ZEAL 2V9QA 1VFMA 3SE4A 2YMTA 1HILB 1AKJD 2PWDA 4YH6A 3DI3B 5IW1A 1MXDA 4JO8A 3CMOH 3T0ED 3WHE1 5AW4B 3CVHL 3RIFK 1DL7L 4XWGH 2JB5L 4XNMB 3VTAA 5JORB 4KKBD 1XBDA 4G9FD 1E28A 1M3IA 2DV6A 1TJHL 2UX6A 5EO9A 3V0VB 5IEKA 1A4CA 4LNRA 5F71A 1ZS2A 4I9WD 3VCLB 1Z9SA 5MP6L 1PAZA 3RNQB 3G5ZB 2C4FU 3WS6A 4I18A 1EJ6A 4LCWB 2DQFB 2G3NA 3KPLA 4G6KH 2XYCA 1D5ZB 1OE3A 3KJ4C 2XRAL 4JB9H 5BRQA 4CAGA 5D7HA 2R7EB 4O2EA 2V2WA 3W0WB 1ZANH 3CSFA 5JMRA 5I1LA 3T5WA 4Q9QL 5CEXA 3BH9A 1S9YB 2B0SH 3E8UL 2F7RA 3EG9B 3PPEA 4KDVA 4R26H 4ODWA 5GGTL 5DUML 5AD0A 5DSCB 5TGBB 3ZDXB 1TQVA 3LIZA 1ET5A 2YZ8A 1HEZA 2XKSA 3HS9A 2J3SA 3HR6A 5I28A 3MYZA 1CCZA 1U8PA 1KPUA 3DTUB 1U3JA 2DF3A 1TJXA 4JQIL 1QFUH 4ADJA 1WAAF 3FTGB 3FUHA 1XGQA 4NN7C 2P43B 3PQYE 1QX1A 5ANMA 1WIOA 2IV8A 3ZE2F 3ARGD 4R7LA 1TJIH 3MRCA 5C09D 5TH2B 2NXZC 4H8QA 4LKXB 4APQC 4F2EA 2FEDD 3ABGA 2M2DA 3KMDA 4ZX6A 1JDAA 3MXWL 4M43H 3TJEL 4HIEA 2LU4A 4A7GF 3N85H 4L4VA 1LE9B 4BRJA 5JZ7C 4H8WH 1NFDA 1ZSHA 4P5KB 3P02A 5EC2B 1SMOA 1JRHL 1ORSB 1OTSC 5JXED 1L7IL 3OPUA 1KLGB 5IP4A 3MJ7B 4MA1C 3SPJA 2G9KA 1GPOH 1NDTA 1RK0B 2DRUA 4GJTB 4PCTA 7FABL 3D39D 2CK0H 2CUAA 4FG4A 4KO5A 2NY1B 1KCUL 2HLEB 1BFSA 1BGXH 1WK0A 3A6OA 4KK9D 5ETUB 3W82A 4DWHA 4F2MA 4L29A 3HKZA 4IRZH 1OGSA 1AC0A 4QCIA 1FPTL 1OE2A 3IBOA 4K7PL 4UIKH 2IBZX 3P0YL 4YUEL 3B9KD 5IQ9B 1JNNL 3B43A 4XP4L 1M6OB 1K85A 1AR1B 3VM7A 2XA8L 4UU9B 3T8VA 2BVUA 4G80A 1YEIL 1VZIA 1BD2E 1ZA3B 3CX5K 4XXDB 3I50H 3LRSB 2X2IA 5JDSA 1H9VA 3N41B 1DQLH 4Y2DB 5JXAH 2R23B 1AG6A 4ACTA 4AENA 3LZQA 5EORH 2COVD 4EVNB 3VFVB 4DNLA 5LNGA 4GKNB 2OZ4L 5FDYA 3GRBA 2Z7UA 5D1QA 4N8VB 3VFMB 5CCJA 4OJYA 3EUUA 4R90L 4HBCH 1JZJA 2JK5B 4P9MH 2IH3A 2UZYA 1XV8A 3M1BA 1WZAA 3QZWA 3ZDWA 4NM4H 4J4PD 2CLZA 1U8KA 2HT4C 3FSAA 3LZOA 1PAMA 2NUPB 1CGSH 4AQ1B 4NI3A 2E8ZA 3L17A 3MA9H 1G7IA 1PQZB 3B2MA 3EYUH 4PGDA 2QBWA 2EEAA 1CXEA 1V3JA 3SQRA 3FT3A 5D70H 5AWNL 4MX7B 2OL3A 1IJNA 3DX6B 2F7OA 4D9QE 2CDEA 3LHPH 3VM5A 4KRMB 1VJSA 4FKHA 2EE0A 5DURB 3TBWA 1BF8A 1WFIA 4Z8FL 3FQUB 5I30H 4JLRA 3RZCA 1C1EH 2PYEB 3GXIA 2WN2A 3VD5A 4WEEA 4AZ8B 3P1VA 3MRKB 3C5JB 4ELMB 3VU1A 3UC2A 3HFMH 2XG5A 2FGWL 5F96H 2I9TA 5GRJL 3TXAA 1DJWA 5GZNC 1TIUA 3D05A 4IYKA 4AE1A 2WLLA 2EDBA 5L88H 2V17L 1IGIL 5LWYH 3RVWC 1TMCB 1PEWA 5GGVY 3B1TA 2AFNA 2WXGA 4LRNH 4M1DL 1OK0A 3H9HA 2AK4B 2XKUA 2CDGA 3VD3A 5CD5D 3KAAA 2OSLA 1H3VA 4N6RB 1GZHC 3H4FA 3KPQA 5AVXB 4AQEB 1KC5L 3NZHL 5I1JL 3A23A 2P5WD 2PCPB 2O93L 2HA1A 1VEOA 3MOAL 3CXHJ 5DK0A 3MNMA 3S36L 1DDHA 4HIJA 4P04A 4ZAKC 4C59B 4XRCA 3MBWB 2WQ8A 2ZWNA 2EKSA 1JPFA 3VXUE 4JFSA 1H8NA 1JXGA 1SJEB 2WLHA 4TSBL 4G59C 1EHLL 2UX7A 3D25A 5T3XH 3ULUE 2KBGA 4MWFB 4YHYB 1XF5A 2FYVA 5K9JH 3V5KB 5DCCA 1EH9A 1MCFA 1N26A 1RURL 2X4NB 3VD1A 3ILQC 4U1HB 3QNYB 3MODL 4R9HA 5HHNB 3BZEA 1NA8A 5HI5D 3PXHA 3FN0H 4PY8J 1JXDA 1NGYB 4CU7A 2NLJA 3TONA 5A6IA 1RMFL 1MFBH 3HS0A 1T2QH 2AXGB 1BCIA 4I13B 1QHPA 1WO2A 4S1DD 3C8HA 5FFGA 3K6IA 1ZS8A 1LNUA 3OKOB 2CLRB 3LNDA 2X7LB 3I3DA 2XKNB 3J2PA 3X1BA 4A68A 5A2CA 2ODIA 4RFEB 2E7LA 3D18A 3BQVA 5AB1A 2Z8WC 2DQTH 2IOOA 2FLRT 2WBWB 1CFNB 4QKTA 4JPWL 4POZD 3VFTA 1HEJC 4R97C 1HH9A 1YPZF 3RWJA 1FZMB 4GG6E 1JPTH 3Q6GH 3SY0A 2FT6A 5LG6A 4URTB 4NQQA 2EUZA 3UPRA 4GEIA 5C97A 1H8SA 5CJXC 3VXOB 1T4KA 4G1MB 1QSFD 2IFGA 4KNUA 3OF6D 3E0GA 4R96B 3VI3A 4OQTA 4AV0A 3QXUA 3DKHA 3GUTB 2BP8B 2DS4A 1MQKL 4UTBA 1F11A 2D2OA 2R1YA 2CSPA 5M95B 2AABL 5EU3A 1RIUH 2WJ7A 3VRIA 4U7MA 4XNDA 3MRBA 3FT1A 2CO7A 2IPTH 2WBJD 3PREA 1MHCA 4OZFH 5EH1A 1X5YA 1VACA 2ZJSL 4OCLC 5DJAA 5J1TC 2WLNA 5IB5A 3EAKA 1V3LA 2V0AA 5J1SC 4GMTH 1GJIA 5C3LD 1UA6H 1ZWIA 2N0MA 2XN9E 4L9DA 4LRIC 1I9JH 4M02A 1CDYA 5DQDH 4GOSA 3DO7A 4E41A 3CZFA 1NOFA 2AQ2A 3WTVA 3MOBH 3BKML 3O9WB 2VM3A 1YDPA 3VH8A 3I9AA 2W81C 3PXJA 4OQ1A 4PRHD 3ZR5A 2H2SD 4R7DB 2AEIT 5JQIB 3TCLA 3BEWB 1OD7A 3EH1A 3ATDA 5HPMB 2EXYC 4AQ8A 5IJCC 3X12B 4IIQB 2NY5H 1S3RA 2GTZB 2B1AL 5EEZA 1CT8A 2WXPA 3A4FA 3L54A 4GRMA 43C9A 3WU1A 1XB6A 5DFVD 4TLSA 2V3EA 4DPRA 2HFFA 4I2XB 3S3BB 1G1KA 1FAKT 1BVKB 2WXHA 2DTML 1DQQA 4OVUA 4XPAL 1FHNA 5F8RC 4AZUA 5KVFE 3RWIB 32C2A 2YXWA 3L4WA 3PQYB 3LKSA 5K39B 2WO4A 4N2OA 1FJ1B 1HXKA 4WEBL 1IAOA 1MREH 5CGYD 3GS7A 2LFEA 2K7PA 5EZOH 3I6GB 3T09A 2WYTA 4Y16B 3D12B 4HEPG 3VACA 5C0AA 2F68X 3RX8A 3DOSA 2DQJL 1ZLUK 1R3IL 1XVSA 2VKXA 1E5AA 1NIAA 4A2LA 2J4WH 4XO4A 1T20B 3TH3T 3OXRB 4NUJA 3IJ9A 4UINL 3WO3B 1FZJA 5BJTB 4IQHA 3QEQD 4FMVA 3C09C 2HX8A 3MCKA 4GFTB 4MDJA 8PAZA 5KANI 3UJIH 1E0OB 4H88L 3RWHA 1JZDC 2WZPD 2FUQA 4HIPA 5IVOA 1NPNA 2N1TE 3T3MB 4UT6A 1ZA6A 1JGEB 2JKRM 4C56A 3BAXA 2OULB 2UYLA 1NFIA 1S7VA 2JQAA 6PAZA 3LN4A 3ZMEA 2YOAA 1I8UA 4JGMA 4PJ8A 5C0BA 5A43C 3S2CA 1MHHA 2TRYA 1P0SE 4JAMA 1SDYA 1HE7A 2X1PA 1UD3A 4PN6A 1TENA 4QRFA 4X50A 5BO1L 4BEIA 1PJWA 2CA3A 2J8UE 3DX2A 4NKDB 4APXA 3OC8A 4JO4H 1S7SB 1P5VB 4RRPM 1OTTC 1U8IB 4GQRA 4K8RH 2VQUA 4PJGB 4MA3A 3GMLA 3OAZK 4N9GA 4OKDA 1EGJL 3Q2WA 1KLUA 4EI5C 1DZBA 3IMWA 5K9OA 3N44F 4DKTA 1J1OH 3BI9X 4KWUA 4J2XA 5LO7A 2APSA 5EC1B 1ZMYA 2I24N 4TYUA 1G7HB 1HTYA 1YG9A 4QO1A 3DSNA 5IWLA 3CMOL 2IDUA 5DDHB 5IK3A 3TH2T 3BAJA 3QHFH 4UV7H 4D8PA 5A3ID 5E6SB 4XWGL 3U4AA 3BCFA 1VIWA 2BPBA 3IRCA 4LCUB 2WYZA 5KVGH 3WN5B 4XXWA 1AFVH 1P69B 1U8NB 5LDUA 2BNRA 1QRNE 1AACA 4OCSH 1JI2A 1YMHB 4G8FB 3FSZA 3L08A 3PG2A 4FNRA 1GGBH 1XIWB 3HG1A 4H1LH 4OLYH 1IAII 5GHWH 4G6KL 2AQNA 3TA3C 3DXAA 4JB9L 4H5SB 5CJ5A 2ADJA 3PWPD 2P8LA 3QO0B 4Z7NE 3CHOA 4ZUSA 4IJTA 4AT6A 2B0SL 2CIIA 4R26L 3IDYC 3Q2NA 3NQKA 2APXA 5E7FA 1F4AA 1K2DB 1X9LA 3K6SA 1DR9A 4DN4H 3QUYC 4D7PA 5IJVB 3O2WL 4TN9A 2OMTB 2DLGA 2QELA 4L4TA 5EOQH 2YAQA 3O4LA 4EN3A 2AEWA 1TPXC 1UEYA 3KDMA 1XGRA 3U0TA 5IHUH 3LSOB 1MFEH 3F7PC 1PLAA 3F8UB 1QFUL 3K81A 4PJIE 3IJSB 1NM4A 5C0DB 4OZIA 2KPWA 1D5MA 5H2BA 3VI4A 4JNXA 1AGEA 4K2UL 5ECGA 3QORA 3BQUB 4QRAA 4BBWA 2WO2B 2V8LA 2YOCA 1BLNB 1TJIL 2H1PL 4YXKH 4IBUA 3MV9A 5F93C 4A6YB 4LLVA 4M43L 3O2VH 4F8QA 4PTUB 2C3XA 4P48A 3N85L 3JTSB 1IGYA 3UAJA 2RBLA 4H8WL 3TBTA 4IBTA 4XTRC 5IM7B 4ZTPH 1HL4A 3GPSA 1M1SA 2GSIB 2YMXH 3V4LA 3RKDC 2ESVE 5C0EA 4HMCA 3VRJA 4N0YH 1G7LB 2YXFA 5H35B 3FUNA 4YSUA 1CGTA 1KIPA 2CK0L 3V6ZB 4CC4C 2XBZA 2F53E 2Y0SA 2QSCH 3MRPA 3VGBA 1BGXL 2AJUL 5KTEH 5D7JD 3DURB 3MYJA 4IRZL 4X42A 3EJUA 1RZKC 1IAKA 4DP5X 2WCGA 4Y4KD 4X0KB 2KZKA 4UIKL 4IRSA 1RZIB 3ET9F 4M00A 1WIUA 2OXGB 3M7OA 1ND0A 1ORQB 3ARVA 2XIIA 2WNXA 3T2QA 4GG6B 1TQWA 3MBED 1A64A 2YARA 2YPVA 5G55A 1AD9B 2NNRA 3I50L 1CICA 2DIEA 3KYNA 4QRPD 1DQLL 2XPZA 2GBTA 5JXAL 1QVOB 1WWBX 2OMNA 2ATKB 2CKBL 4PGCB 5EORL 5FHBH 1QYGH 3ULUC 3ZTNH 3HE7D 2QT6A 4HZ1A 2D7TH 4R4FH 2F5AH 3AU1B 4CKQA 4EQ2A 2EYRB 1P84J 4HBCL 2X87A 4P9ML 1KXVC 5I8EA 3WSQH 3MRFB 4PCYA 1MNNA 1CGVA 1LK2B 2J55A 3O8XD 3ES6B 3P30H 5E4EB 1WAEA 2DBJA 4KJWD 4NM4L 1JZ8A 5KAQG 1CGSL 4L3EE 5JIHA 1SVCP 3MA9L 1JAEA 4NHCH 3EYUL 3TIEB 3WLWC 3FT4A 5E4IA 3D1MC 2DL2A 1NOLA 1DSFH 2VN6A 1L9MA 3E80A 5D70L 3ZYOA 1MVUB 2OQJA 4TUOB 4LLQB 4H25B 3LHPL 4JRWA 4OF5A 2ADGB 3G08A 1H15B 3UG4A 5IREA 2AEQH 1LMIA 3RA7L 4B5EA 2YPLE 3STBA 5I30L 3JYBA 1J8HB 2ODHA 1C1EL 4U1NA 1BZ7A 3SDDD 3QFGA 3ZMRA 3NSFA 3PNWB 5E5MA 4OI9A 4Z7VF 4MMXC 3HFML 2RR3A 3F5WB 3QQXA 3QJXA 5F96L 1Q1PA 3VB8A 4WI8A 4HGMA 5AW3B 3MO1A 3SPGA 2Z7WA 4JGNA 5IHZB 5L88L 1NGZB 5LWYL 1MIMH 5CWSB 3DMMB 4QWWC 1W72A 5JPMA 4OFVA 2GBVA 1EIBA 1IQDB 1KPVB 4LRNL 5MENA 3EGSA 3UDWA 2ZX6A 4DVBB 2XI9A 3KVPA 1J88A 4EDXB 2DKMA 3CDGB 2BP5M 4ORZC 1TDQA 4TL4A 3ZYIA 4Z77B 5T1KD 1RZKL 5C8JB 2EYSA 5CSZB 1Q0EA 3PWUA 2QR0A 3H9ZA 3ETTA 5CEZE 1S7WA 2ZSVB 1FNEA 1S8DA 3K2KA 2HB0A 5AOLA 5IW3A 4CADB 4ZX3A 2P49B 3CBKB 4JDEB 2TSBA 1C7TA 1XTMA 3LPPA 5T3XL 1OP3K 3EF4A 3HCVB 4DZ8A 3BPLB 5K9JL 1ONQB 2WBKA 3EJQA 3JUYA 3RVVD 1QP1A 1G7JA 2ORBH 2NQCA 3EFDH 2NXYD 3FN0L 3EJCA 5DK2A 2VLJB 1KCBA 1MFBL 1ZHBB 4GW4A 1T2QL 1A14H 3UZVB 1DBBH 1U3HB 1OZUA 4RIRB 2OJ1A 3W57A 4F33A 3IXTB 1K8DB 3RILA 3LY6A 4M7LT 4Y1AA 5D1XA 5F7EL 4LPCA 3QYCA 3O3BB 2DQTL 3FB5A 3FH5A 4QXVA 4S2SA 5IHHA 4OY9A 4AYMC 1SUJA 4PRAA 3ZE1E 5MI0C 5AG8A 2RHEA 5G5DA 1T22A 1JPTL 2WLYA 3Q6GL 4A39A 3MU3A 4KKRA 5FYLE 1THAA 1X5XA 4L4JA 2JKNA 4HJTA 5T3ZL 3IYLW 4X8CA 2XTJE 4LHUA 4YDIH 2H7WA 2OA9A 3QXVA 4FQ2H 2YC1B 4R4BA 2X40A 4L5FE 4NYLA 3L5WA 1YN7B 1TTFA 4ZQKB 1U3NA 2VDOB 3FO1B 3D3VA 3GHPA 5BV7B 4WWKC 5HHOE 4CGUB 2VLKB 1KGCE 2X3CA 4ZK8A 2Q8BH 1KJVA 1RIUL 3UYOD 4ZX4A 5ES4B 2IPTL 3QAZB 4QXUL 4BFIA 1VF5C 2OTUB 3J7HA 3L9RA 1X5IA 2C9QA 2EO1A 4DFIA 4DFHA 2JCCB 4K23H 4OV6F 3BFQG 3B83A 4MVBC 4F7TA 3AMKA 3FH8A 4PTTB 4G83A 1IFRA 1IX2A 4GMTL 2DIAA 1U93B 2DWXA 4JQXC 1UA6L 1HNYA 1R3HA 5KBMA 5DC0A 5DQDL 1FVEA 2YSSA 2DQCL 5HI3D 2NCMA 5F1NA 4H40A 3F7VA 3PWNB 3KPMA 2GJZB 5GS1B 5KOMC 5I76A 3VFWA 1D7CA 3QUZD 2X44D 1SGKA 3GSOA 3MOBL 4WHDA 5G4OA 2CUIA 4PJ7A 4QLRA 3T0DA 3PJLA 1KTJA 5B7MA 1SXBA 3HBGA 3L8QA 5IROD 2PABA 2G2RB 3OBAA 4HD5A 4NGHH 1OM9A 3E38A 4PEEA 1PLBA 1K3ZA 3MFGB 4LSPH 2VSDA 2NY5L 1N6UA 4UNIA 1T80A 1Z5LB 4CN6A 2BOCA 4K5NA 2OR7A 3LZLA 5C0CA 4NP4H 1F0LA 4NWUH 1GXEA 2WXJA 4JFYA 1AXSA 2AV7A 3BFOA 2ITCA 3IJHA 4HSCX 4M3KB 5GRYA 4M5YH 5LBGA 4Z7QE 4P0DA 3QFDA 2W0LA 1G7QB 3HPLA 1XH3B 5FKPA 3UPAA 1MREL 1NDMA 3EBGA 3CN3A 5EZOL 5AAMA 3UBFA 2B5IB 3JV0A 2ZAIA 3QFJE 4OVVA 1UACH 1MFAH 2NW2A 4CVZB 2D3VA 4P46A 3SCMA 3K72B 5CFAA 5KYYA 3LQAC 2J4WL 3LN5A 4CGTA 2CGYA 2UWEA 3F65A 5DFAA 1M9WA 3DX7B 4OGZA 1FFTB 4GMSH 1AMYA 3DVIA 3NOIA 4FKKA 1XCXA 4DESA 2BDNH 3GSQA 4JREB 1BF5A 3MGTA 1U91B 4QHMB 3H42H 4EBQL 4GQPH 2G0KA 2XX1A 5CLXA 3UJIL 3GKWH 3KYKH 1VKXB 3FFCD 5B3JE 2BP0B 2Y6TE 3MRDA 2B2XH 4QOKD 5AFAA 2OJEA 5JW4N 1W16A 3RHWF 3UYPA 5FFLA 1VFBB 4NRZB 4JVPA 3LPGA 5D6DA 2C5DC 2CALA 2P7TB 1N8OE 1F4XH 1JPGA 4K73A 3LPOA 1QQDB 5GZOA 2BSEA 5JO5B 2HJFB 1H19A 1PD1A 2VMDA 4BCZA 1M05A 2QGCA 4JO4L 5GGSB 2BFGA 2K0RA 5A7BA 4WWID 4L0PB 3SDXE 2VXUH 3BVXA 3F12B 4RBPH 2VB5A 1YEJH 3C8DA 2BERA 4Y5YB 4WV1B 5HYJD 1IT9H 2XQ0A 2PKDA 1F1AA 1AXIB 2XQBH 4IK7A 4NBZB 4KO9A 1IEAA 1EEQA 1J1OL 2NCEA 2NNAB 5F6HJ 3LZFL 4WFED 3TESA 5KS9E 4E68A 3CN2A 3NPSB 4Y7OC 4L2YA 4J3XA 2N3JA 3FOLA 3QHFL 4IKIA 4L3EB 4PJ5A 4UV7L 3VWKB 3D0AA 4S1RL 5I18H 5KSUA 3HN5A 1VZGA 2JFCA 5EIIG 2KT6A 4JG9A 2VMFA 3VQLA 4HWBL 5KJRH 1AFVL 3GGWA 1CGYA 2HPTA 4OCSL 3UOAB 1MH5B 1P5UC 1K4DA 1OGAA 2YD2A 2VZTA 2A38A 2O5YH 4ETQB 3WTUA 3EOBA 2H6PA 1GGBL 1N64H 4K3HA 2WWNA 4OLYL 5IQ7H 5GHWL 2JQZA 2VLRE 4ZW8A 4KV5E 5DD0H 1WA0X 3LDBC 5I17A 3Q1SH 4JRXB 3WYRA 3JWNG 2CG9X 2VR5A 4GT7A 1XGZA 1Q8MA 2ZKMX 1NCJA 2YJQA 3QULB 2DLTA 3GSUA 5JIIA 2P28B 2ZAGA 4LDOB 2Q7AA 5ESQA 4DN4L 2JNZA 2Z31D 1M42A 1NAMA 5JHDA 5EOQL 2MSPA 3HZMA 4JDZA 3BOVA 4ZUTA 2DWDA 1R24B 2DKSA 3FFDA 1A7QL 4WQOA 3TCXA 1I8MB 5DJ6B 3RGVD 2IAMA 1CJYA 2YD1A 3IU3A 4QAMB 5IHUL 2XFXA 2H32A 1MFEL 1UOKA 1M7DB 5DMGC 2XZAH 1NDGB 1MCPH 3HUJA 5BQDA 4AYGA 3AAZA 5ESAB 5F2FA 1G9HA 4NBYB 4YXKL 3TWCH 3GXNA 3HLAA 1A6AB 2E59A 3A0OA 5I1HH 3N3EA 3POHA 4N0CD 1S7XB 1FL5B 2P44B 1IZJA 1QSEB 4FI8A 5T1JA 3UROR 3G6JE 2HJLA 2L7JA 5LBSH 3KWUA 3P9WB 3DRTA 4ZTPL 5HY9A 1XSJA 2IALB 3DHPA 5D4IA 2YMXL 4RLDA 3OKMB 3RFZB 4N2CA 4WW2F 3CDZA 1Q9LA 4IRJA 2LU3A 1QPPA 3DK0A 4P23D 1RLBA 3LAFA 1FGNH 3VSUA 5DVMA 1ZSDB 1WBXA 2XY2A 3HPJA 3AC0A 2A5UA 5K9KB 3SGDH 2OMWA 2QSCL 1Q94B 3HB3B 2SEBA 2G5BA 1BIHA 3EHBD 3QDGE 5KTEL 1CF1A 3H9SB 4JFDE 4Z78B 4FQLH 1RPUA 1BXAA 4X6EB 3KPNA 1J8KA 1WRFA 2VR9A 1EO5A 1UZ8B 3AREC 1SLVA 1EEUA 2FJFB 4PMEA 4QRSA 5AKRA 1QFWM 1PZ5B 3PAUA 2C3VA 2PCFB 4X8GA 2QJDA 3BZ4B 4YC2C 1E3FA 1XB8A 2WCSA 1WQVT 3SPVA 3NJXA 1KENH 3VI4F 3STLB 1QLRB 3ABZA 4JFQA 1WHOA 5ACMA 2XTJB 4ZPTA 5DO8A 5FHBL 1QYGL 3ZTNL 1SF5A 4R4FL 2D7TL 2F5AL 5J11C 5LAXA 5DRNB 4HH8A 5TQ2H 4X6BB 4BFKA 1KSRA 4AYEC 3L5JA 5I0VA 3TL5A 3FOMB 1RZGB 3GSVA 2WGNB 2CBTA 2AJYL 4HFWA 5EIQA 2JB6A 3P30L 4BH7B 1F3DH 5HHPA 2WVTA 2W1NA 4P4KC 4HGWB 1R3JB 1D7DA 4LKCB 3TS8A 1A3QA 2G2NA 3MFFB 1SF3A 4H4NA 4NHCL 1YMMA 2Y6SD 4JKWA 1R5VB 4PJBF 4MMYA 4N2MA 4R2GD 2VWEE 2W80C 3P77A 1LGVA 1RH8A 1ZE3H 3UZEC 3HC0A 2W94A 3MV8B 5EBMB 3DYPA 5GIRB 3G6DH 2AEQL 3MRHA 4IMLB 4J5VA 2FQEA 4HW6A 5B38A 5EUOA 1IUZA 4Y2DD 1Z3GH 4KPHH 3CZGA 4HHGA 2JLLA 3MJ8B 4EUPG 1U8QB 3KGTA 2KLRA 2BS9A 2W88A 5FUOH 1AQDA 3EYSH 1ILUA 1BA9A 1URZA 3HAEB 4ZW5A 3CFKB 3ZE0F 3O6FC 4B9GA 3P54A 1MIML 2AJVH 2QGBA 3QZOA 1P4IL 1N0LA 4G3YH 1JUFB 3QEGH 3U2SA 3ULVC 5SWSD 2NQDA 1GYCA 5D72H 3DUUA 2ZG1A 3LQZA 4B53A 2VQ1B 1GZQB 5JW5B 2E8YA 3TZVD 2GUYA 4QTIL 3B6SB 4Z7QB 4XOEA 1KT2B 2ICWB 3ESMA 3C5SA 2XT1B 4ZW7A 4YPJA 1JV2A 1DN0A 2A9CA 3FH7A 4PJAB 4I5BA 2DD8H 1O6SA 5EBLB 4XXCA 3SKNA 4U33A 5DURD 2NY0B 4WI0A 1NICA 4MXVE 4U3SA 2FH8A 3N5AA 4MRCA 3C5ZB 3V5DB 4CN4A 2M83A 2OCCB 4HPYH 3IMBA 5FGCB 3AUWB 1T1WA 4YMPA 1ITCA 1F86A 1VRSA 2EH8H 4G7YH 1TVHA 3IEAA 5DXWA 4E42A 4EF3A 5KUKA 4A7UA 2ORBL 2P5WA 3EFDL 2JKTM 2BIMA 1FL6B 1FO0H 4ODVL 3C2AH 2YFNA 3JWNE 2ARJA 3PV6B 5IKCB 3EO9H 2F8OA 5FYJD 4X2UA 2BZCA 1BYOA 4XX1G 4U05A 2A6IA 2AK4D 5GGVH 3V0EA 2P48B 3GMNA 3P9LA 5AYQA 3ZKMD 1FWXA 3OB0K 1D7BA 1GA2A 1U92A 5BXFB 2MIZA 4YR6A 2EE2A 5HJDA 2AEPH 3QZWG 4PYGA 2ZUTA 4G6AC 4HS8H 1RQ5A 4YXHH 1E3ZA 5J6GA 5AW1B 1T21B 2J5WA 1AO7D 3K4ZA 4Z3IA 3I84A 3GZPA 5ITFB 1BQRA 4LPYA 3RWDB 2PLTA 3BVUA 4FQ2L 2D9QB 2YK1L 2AI0H 3KLAA 5C08E 2J25A 4MZRA 2W0PA 1PDKA 1JF1A 3CVHB 4NQCA 1XGYH 1SY6H 4PRNB 2H3NB 4JCLA 5DJYB 2Z8SA 5ICYB 3KYMB 3V6FA 5L9DL 3FF7A 1LWHA 3D2UD 2Q8BL 2ARJQ 2ADIB 1NM9A 1EDHA 3KPRA 1PCXA 4QF1A 3EIFA 1CBJA 1MY7A 2YRPA 3TJHD 3MA7B 3PGFH 5A2BA 2NZ9C 2DJ4A 3WKNA 4XPBH 4D9RD 4AG4H 1DSWA 3CDFA 4RDQF 3RBGA 3OAWA 4JHBA 1I8IB 5E6ZA 4FQHA 1FFNA 4FZEH 4ELKB 3EJYC 4GKSB 1TXKA 2OJZH 1URIA 2R69A 1QBLL 4J3OG 3MLRH 1P9MA 3OVUB 4ANXA 1KYAA 4HUWA 4QNPF 4YFLI 3FB6A 4X8XA 3M88A 3RDTA 3SDAA 5FAAA 4N26A 4NGHL 2GITA 4FXTA 3NJVA 4E9VA 1A4BA 5JW3H 3VTTA 5ID1A 4LSPL 4OTXH 5IBLD 3RX9A 1KUMA 4FQCH 3BPNB 1TQTA 1OEZW 1UXSB 3KVDD 2D3NA 1S2EA 5IUCA 5F0JB 4NP4L 4NWUL 1PSKH 3W81A 5L7XH 2WNKA 5H94B 5EU6B 3B9DA 2VDKH 5AL8A 5ALCH 1HSAB 3OJ2C 3CVDA 1G9NC 4KY2A 1ZVSA 3SJVB 4PRDA 3LZPA 5E23A 4M5YL 1MJUH 1JP5A 3BH8A 2R4RH 3F62A 4MQ7B 4D0CB 5SWQB 4PJXB 1KY6A 3EH4B 4NUMA 5I5IA 3QQ3B 4U7SA 4OZGE 4S1SH 1UACL 5J3HC 2CO4A 4U1JB 2YGPA 1VENA 3O9WD 3TVMB 2VE6B 2AQTA 5HTSA 1J12A 4PG2C 4UTAA 4A2GA 2OW6A 3BP6A 1HX0A 4MNQE 2R27A 1KGYE 5HHME 3KCWA 4UQIM 2UXTA 2VDLH 4M4RB 2FNWA 3KCPB 2CZNA 1JK8A 4GMSL 4DCQA 4PJ7F 3BZ5A 1AKPA 1MIEH 4Y5XC 2BDNL 4RMBA 4KKNA 2HAZA 4DUXA 2HYMA 3H42L 4J1UB 2FO8A 4JZOB 2O6DA 3MNDA 3QEUB 4WO4B 5ANME 3GKWL 3KYKL 5IJBC 3GEWB 4Z7WF 3FO2A 3GJFB 1E7VA 2JQMA 2B2XL 3DUSA 5F7KC 3I2CH 4RAUB 4NCC2 3MNWA 4O2FB 5BUAA 4X4YB 1NJ9B 4L4VE 2WWMD 3FCTA 2ED8A 5HHQB 1NFDE 1MCSA 1F4XL 2X89A 2OSYA 5DHEA 4Q6KA 4XNBA 2OXHA 4Q2ZB 5FPIA 1OCCB 1TU2A 5LB1A 4GBXD 3WFHA 1ETA1 4WAFA 3RVTD 3FTYA 2VXUL 1WFMA 4FTVD 4KRPB 1YEJL 2DH2A 1GGYA 3DGGA 2MNJB 4FXKA 1IT9L 4ZZFA 2VDRH 2CBMA 1PLGH 1SYSB 3TPUA 4F2ME 2X4UB 3CDCA 3QIUC 4J23A 5CBEB 4WKXA 5HGHA 1Z9PA 2CO6A 1FFRA 2OBGA 2QKIB 3HZVB 3IAQA 3TO4A 1Z9LA 4MDIB 2FSEB 4G8EA 4IGBB 5CJBA 4DP7X 3GXMA 2IMMA 3ZQXA 4EZLA 5HGAA 5JHLH 3B2DC 3EJSA 1FZOA 2XWJA 1NUDA 4J3SA 5I18L 3S9DB 4KJYB 5KJRL 1B0GA 1E5BA 2UZXA 4PGZA 4RZCA 5AOMA 4HVBA 1ADQL 2HKAA 2X12A 1J5CA 3S8GB 4UQAA 4HUXB 3ROLA 4Q6YA 3FRUB 4XX1E 1FNAA 1N64L 3O0LA 2BM3A 5IQ7L 5D1QE 4L1DA 4QXGH 5EU7E 5DD0L 1V5JA 2Q86A 3Q1SL 4ISVA 3ZDYF 3PWLB 1IKFH 2W65B 3EOAB 2GI0A 1WLHA 3ZU8A 1FDLH 2CIKB 2EDOA 1MCWM 3EDKA 4HP5A 4BQBA 4CMMA 3WFBL 4LSRH 3CFBA 2WZ6A 4GKOA 1N7MH 4JHZA 2BC4A 2WSPA 4TKWA 1YSOA 3FBQA 2ALWA 1ED3A 2J44A 3IMUA 3KPSD 3BT2H 3IKCA 5JNYB 5LKNA 3G5VB 2VXTH 3PP3K 4W4OA 1M1XB 1TMQA 3BUIA 3NRFA 5DJZB 5GGUA 2E75C 2XZAL 1MCPL 1L3NA 1BZ8A 4QRTA 1FZKB 1USZA 4OZFG 3NJFA 1YY8A 4PJDA 4V2CB 2JF1A 3AB0B 5L0QC 1ZD6A 3AWEA 4U49A 4WWPA 2VWEC 2JJTA 1C12B 1UOLA 2AJ3A 5FO8A 2P9RA 5AKSA 1INEH 5F6IC 2PWHA 2ZSWA 4A2MA 5ISZE 3B2UC 5D6CA 4H7VA 4G82A 1JVLA 3NJKA 5D7KD 1TEYA 5E8OA 3HE6A 5HYQB 1FGNL 2Y36L 3EDDA 5GRWA 3UTTD 4LPXA 4OZHA 2HCZX 4JCWA 4MJIA 3ZHLA 4FQLL 1MRCH 1WZ1H 2G5UA 3OXSA 3VDBA 3N43F 3VE0B 3Q8BA 3QR0A 3QNZA 4HXBH 4KROD 1SEBB 2IPKA 1CL7H 1PZBA 2IANB 4H26A 5MERB 3JWOH 5DHMC 2FDBP 1OAZH 4IKKA 1MFNA 2L7QA 2VITA 3Q3GB 1KENL 3HUJF 4ODTL 5FW8A 4F80A 5IHWA 1MCWW 2O26U 3V4VH 4GQ9H 4ECNA 2NDFA 3T71A 1AG0A 1OGTA 4XCEB 5D1ZB 4PVLA 3DBXB 5I1CL 4XZUB 4IOFD 1UVQB 4FLSA 4LLDB 5FW7A 2IV9A 5IB4A 5CR8A 1MFVA 2MRYA 3KXFD 5FYKE 3X11B 2JKSA 1T89A 3JWNC 4QRPA 5EU4B 4ABVA 2Z1PA 2OX5B 3R7QA 1NCGA 1PNCA 4C4KO 4JO5A 2E7CA 2VDQH 2WKOF 4N4YB 1MW2A 3HE7A 1N68A 5E1AB 2FWOB 2GHZA 3MNVB 5TF1H 4DZBA 1QLFB 5TDOB 3WEOA 4G72B 1LDPH 3VX1A 5KG9A 1A25A 3GSRA 3A67H 3MUGB 4PWHA 4X6DF 3VI3E 2VZ1A 3GZKA 3G6DL 5IEHB 3O8XA 1OE1A 3L3KB 3NIGF 1Z3GL 1SJHB 2ICES 4KPHL 5E8DH 5EEYA 4Y4HB 2HT3D 4S0SD 4DKAA 1M56B 4P06A 2P5EA 5FUOL 3T4YA 4KOCA 5DUPH 4FFYH 3EYSL 1T83C 4GS7B 4Y0GA 2QMJA 3ULAB 3FQWB 3N06B 1I7TB 5E6YA 2Z6FA 3DX8A 3F7QA 2AJVL 4G3YL 3AADB 1RZJH 3QEGL 4LCCB 3WKMH 4KX8A 1JF6A 4MAYD 1AQHA 4E41E 1XD0A 3NYKA 5B39B 1KGUA 5D72L 2IWGA 3IDUA 4DOHE 5B8CC 3RTQD 1F3DJ 1LTXA 5HI4C 4NFBA 3BIAX 3C6SA 2DD8L 4NO3B 3SE3A 1AQKH 3T1FB 1RZFH 4KQ3H 1EERB 5LG1A 3QXAA 1FSKB 4OZGB 4ZMWA 2BZ7A 3EF7A 2JIXA 4FJYA 5JLZB 4GRLC 4PJ9C 2Z34A 4XO8A 5CD3B 4M7ZC 2WPGA 4HPYL 1KCKA 5AUMB 4KO6A 3AG2B 3QIBD 5EEXA 4XPFH 4MNQB 4NAJA 2EH8L 4G7YL 4OAWA 1FO0L 3U79A 4UQ3A 3SE4C 4N9OB 4BQCA 4LGRB 3C2AL 3CVIL 4GP8B 2WMPB 2MPAH 2HLAB 1DJHA 3FC8A 2A0LD 5DFWH 4FFWD 1IARB 5ANMB 3DMMD 2AW2A 3EO9L 3WMSA 4EUPB 2HFTA 2YQBA 2NX5A 1FL3A 5GGVL 2ENSA 5C0RH 4NN5B 5F1KC 2W07B 5SWZB 1Y1DA 4CDGC 2P8MA 1G94A 2OMXB 3WS6C 4K5PA 1SN5A 4I18C 3WIAA 3RFRA 1CG9B 7PCYA 1IBFA 2IAAC 1A7NH 1ET8A 1E50A 5DI8B 1SYVA 3WKQA 4HWEH 4ZMTA 2AEPL 3DLQR 3NN8A 1NUGA 4HS8L 1NINA 2XIDA 4YXHL 4HU2A 3OKNA 1EAQA 1A9BB 3CLWA 4BIKA 3L4TA 4FFZH 1G0XA 5A16B 5KVDE 2B9AA 3EH3B 4I9XA 2E9BA 4NUQA 2AI0L 2F54D 2DMCA 2WNWA 3QDMA 1ID5I 4OGAC 4XMZA 1O6TA 5A2IH 4LLUB 1XGYL 5I5MA 2VT0A 4C56E 2VLJD 1ASOA 2ZG2A 1T1ZB 1ZT7B 5KN5B 5C0BE 3DTXA 3V10A 4O00A 4XPBL 3BMWA 1P2CA 3Q06A 4AG4L 3RB5A 5FA4B 1UM6H 1X6LA 5EN2B 5IHLB 1KCVH 3SE6A 1OCZB 1C5CH 5IGXH 3OX8B 3C6EA 1BBJA 2OMZA 2O61A 5CEYA 4EIZC 3NCXA 3FUJA 4WGWB 1KBGH 1T6VN 5ICUA 5BNXD 4F57H 5I1DA 4FZEL 3VXSD 4HPHA 1R34A 1LYQA 1X3DA 3MRQA 1D5BB 5FM8A 4U1SB 1XDTT 3MLRL 3PJSA 4KRLB 2YGOA 1BEXA 3CZUB 1T0OA 3MRIB 3M1BB 4W9KC 1T6WA 4UMGA 5JW3L 3GLEA 1CI3M 1FH5H 2X10A 2H0PA 2X4OA 2YS4A 5GGRY 4OTXL 2CLZB 4YK4B 4FQCL 2R9HD 4X6CB 5DK3A 4F15B 2VJXA 2ZX7A 4PLNC 3LH2H 3HFFA 1Y0LA 5FF6A 1DVUA 2WQSA 2G75A 4PY7B 3QH3B 2BNRE 3B8SA 4NRXA 4O4YH 5GGSY 3T6ZA 5L7XL 1K4CA 5TPWH 4RRPA 1L0QA 1X7TA 1BLIA 1FFOB 4PRPD 1WE5A 5ALCL 2VYRE 5IROA 2BIHA 3UO8B 1MJUL 4NQDB 2R4RL 3DXAE 2NT1A 2H1LM 4GO6B 4MD0B 1YQ2A 3TNMB 1WEJH 1EXUA 1A7OH 1DCLA 4JM2D 5SV3A 1BOGA 3PHOA 1IGFH 1TO4A 4M8QA 4JG1H 4S1SL 3NJHA 2FJHB 3BO8B 3DO3A 1LJMA 4BFBD 2VXQA 2Z7YA 1OP4A 3FO9A 2CA4A 3ZDZF 2ZAHA 3DO4A 1HQ4A 3L3GA 3NVQA 5D1QC 3WELA 5EU7C 3S5ZA 4L4TE 3GUFA 1A6ZB 4YSOA 3O4LE 1PKQA 2VDLL 3OZKA 5ISZB 1G6RH 4XI5D 2NY6B 4AYBA 2DQHH 2R2EB 4YGAB 4U3CA 3LIZL 1MIEL 3CMGA 4XE0A 2CXGA 4OZIE 4Y4FB 1BWMA 4DGVH 5BZDA 5D7SL 5I2IB 2XUWA 5FO9B 1ZDSA 2R0ZH 4C54A 4LHUG 1HH6B 2WUCL 1T66D 4P99A 5LJYH 4U1IB 3BEVB 1QFHA 4P2QA 4ILDA 1IGMH 3MV9E 4YSAA 4E9WA 1M4KA 4WNQA 5D8JL 5IR1B 4EQ3A 4RGNE 1YAIA 2CLVA 4HH9B 2B59A 4ZFZA 5IB2B 3AY2A 4LLMA 4JFPB 3RZCC 4ETYA 2B15A 3SE9H 5KSBF 3BZEB 4XO9A 4QOKA 3MREA 5L2JB 2EC9U 2YEQA 1YECL 3WUZA 4F8PA 3DV6B 1EQWA 1EBAA 1FVCB 4EIUA 4ZXBB 2HP4A 2VDRL 4JUSA 1PLGL 2DPKA 5E00A 2R1XA 3WNIA 2FBJH 5JPNB 2YO3A 1MHEB 1MJJA 2IH1B 4WVRA 3MGOB 5INDB 3VFRA 3KZ8A 4J3OC 4B0MM 4WFHD 3IFNH 1FF5A 2AXHA 4KH9A 3BD3A 1YUHB 3D69B 3JV6A 1BXVA 1HHKA 2DI9A 3IF1A 4HJ0C 4BKTC 3S4SB 5J89A 3F3HA 7PAZA 4UNTA 4KKQA 3FTSA 1A4JA 5DRWA 2F9BT 1ZT4A 3KGSA 4JY4A 1JPEA 1XB3A 3GEFA 2WP3T 3O3UN 4FQXA 5HHXL 1JPST 4J8RB 1EAPA 1A47A 4TQEH 3QRFM 1KZQA 3LKNB 3QISA 4PJFB 1TQBB 1HI6A 4ZMZA 5IHBA 4CVXB 5L4JA 1BQ5A 3G9VA 1YY9C 4QXGL 5DS8A 3D0VB 1N3NB 3QO1A 4DP4X 1HJBC 5HVFB 5TE4H 2K8MA 4PS3A 1X7SA 5I6XB 5AVSB 3RUGA 1IKFL 1C9SA 1X7QA 4WJKB 4F5CA 4NZFA 3HS0C 4TXVB 2V2XA 3LVEA 1ZPLA 4LSRL 2VMEA 4GSRA 1N7ML 2QTEA 5DEGB 5C0FB 3T6XA 1D2PA 4TVSa 4QRUA 3BIKA 3SO5A 2E7LC 2XPYA 3BT2L 3HMXH 2EIZA 3CVBA 4FX5A 2D4FA 5EF3A 4JFED 4DOHB 3C60D 4TQPA 5E08H 1J5IA 2EH7H 3VWJB 2AERT 4KDTA 4NQTA 1B2YA 3TEYA 2XG4B 2Z31A 3LNHA 1EHNA 5AB2A 2H26B 4Z7UB 4U0RC 4Y5VB 3NZUA 1HILA 3ARYA 1IIKA 4N6QA 1BW8A 2A77H 4LOEA 3P3RA 1INEL 3V8CA 4ABUA 4CSSA 6CGTA 5JORA 4JL1A 4XNMA 2GK2A 5MENE 2IGTA 1IM9B 3V0VA 1KLFB 1F18A 3VCLA 1WYJA 4FDWA 3S5LB 4XP5H 1HKLL 2E9JA 4XT1C 1Q0YH 3IDIB 3MPCA 3RNQA 3G5ZA 4WU7B 2XVLA 3NFPB 4LCWA 2DQFA 4TQ8A 3GSXB 1D5ZA 4IOSA 1MJ7L 2R7EA 2Q3ZA 4UYPA 1XF4B 3MNZB 3W0WA 4CMHC 1MRCL 1WZ1L 3QUXB 2ZCZA 3DJTA 3L48A 1S9YA 3EG9A 3G3LA 4KKLC 3LKOB 3KW8A 4HXBL 1JWUB 1M3JA 4N68A 3H55A 4RNRB 3U25A 1CL7L 3OZ9H 3ZSTA 3LPWA 5DSCA 5EO1B 3JWOL 4LARH 5HDBB 5TGBA 4ABWA 1OAZL 4BK5A 4HOXA 4PW4A 1X9QA 3V52H 5JOPD 1Z2KA 5I5RA 1RZQA 1LO5A 1QSED 2J8HA 3CSPA 3WHXB 12E8H 3V4VL 4PSRA 2VLME 4GQ9L 4AQ8C 5LGKA 4HWZB 3WMQA 4NRYB 4BH8B 3D6GA 4OZFB 3S3CB 1UD2A 3FTGA 5DJCB 4AYFB 2D7QA 4Y1AE 5D1XE 3M86A 3V0WH 1ZA6B 5L2KB 5TH2A 2LVCA 4LKXA 4UBDD 4IK6A 1FH2A 2J1ZA 2PO6D 4LVHB 1UD6A 1BQLH 1LE9A 3HB3D 1DVSA 4F58H 3FB8B 1QBAA 1CR9L 1FYHB 3ARBD 4P5KA 5J0BA 1HK6A 5EC2A 1NCUA 1ESOA 1PGRB 1ID2A 1ORSA 1SPDA 5TF1L 2LE9A 4YDLB 1KLGA 1DE4B 3MJ7A 2YWYA 1RK0A 3PWJB 1WIPA 1QO3B 4TULH 2BVPB 5FR3A 25C8H 3CZNA 1ZAGA 1NSNH 5ETUA 3D3VE 5CKGA 1XR8B 5E8DL 3NCCB 5EIVA 4OF6A 5EB9A 1WFUA 1KYOJ 5GSVB 4EMZA 3QJSB 5DUPL 3NDZE 4J28A 5IQ9A 3ARFB 4KUZH 1AS8A 3SHSA 4KZCA 1M6OA 3BUPA 3RVUD 1QI4A 4UU9A 1RZJL 1D9KB 5D5MB 3WKML 3QXTA 4K5OA 1ZA3A 4HS3B 4XXDA 3TN0D 3LRSA 4A7VA 4ZFGH 4PJ8C 4Y2DA 3ZOAA 3SKOB 1MSPA 1J1XH 2R23A 2HXAA 4MB5A 4LCVA 4EVNA 5IB1B 3VFVA 3ZRSA 4GKNA 3NRPA 4MB3A 4UNUA 4N8VA 3VFMA 2YRBA 1NIFA 4UMSA 2E76C 2Q6WB 1AQKL 1LWRA 3UG5A 1RZFL 2JK5A 4KQ3L 4Z1PA 1MZYA 4BSWB 3UABA 1YYMH 3MV8D 1JTTA 3U36B 1J7VR 3RL2B 4AQ1A 4BD4A 2NUPA 2JMRA 4XPFL 1EBPA 1PQZA 3FU3A 4XNZB 2APFA 2JKJA 4HUMB 3SQBB 3UBXG 1HL9A 2XC8A 3UEQA 4MX7A 2E7DA 2DM3A 2H5UA 3DX6A 4JS7A 1HHJB 1N59B 4IM8A 2MPAL 4G6JH 5IWLC 1MG3C 1KIUB 3QYMA 3K0WA 4HLJA 4M6MH 4P3DB 4FEIA 1GZPB 2NYYC 1RK1B 2YGNA 3FQUA 4XXWC 3WHE0 3LJ3A 2Y5TB 2PYEA 5C0RL 4AZ8A 1UWXH 1KFGA 3DIDA 3MRKA 1EA9C 1S9XB 3C5JA 4ELMA 2FVNA 4KHXH 3N0PB 4FKEA 4UZGA 2XQYA 5C71A 4HWEL 1A7NL 1BZDA 2YAPA 1A65A 2ZX5A 2UWEE 4ZFOL 1A21A 1CLOH 1QWNA 3BVNB 5DTFB 1V10A 2AK4A 1LP9B 4FFZL 1OO2A 4HZLB 4HLEA 4N6RA 4DTGH 4AQEA 3LXCA 5G4NA 3FUEA 3GSNH 4P3CH 2PCPA 4AK2A 3C6LB 4EN3C 4YSEA 5J8OA 3QB7C 1MY5A 4N87A 4YSSA 3EDJA 1I9IH 3ECBB 3HG0A 2D3LA 3MBWA 5AOKA 5B38G 2CHDA 5KVEH 1SJEA 3RBSA 3D5OF 3K46A 4UT6L 3SPHA 1I1AB 3QORC 4H1LB 4MWFA 3OMIB 4FJ6A 3V5KA 2XPGB 3WY2A 5LN8A 2X4NA 1KCVL 2HWZH 4U1HA 1C5CL 3QNYA 3V55A 5HHNA 5IGXL 3P2TA 1L4IA 1OCWH 1KBGL 1UFGA 4K7PY 1NGYA 4F57L 3UAJC 3A6CH 4RGNC 4Z23A 4IHBA 2AXGA 3HMWH 4HKZB 4R4NC 2NY3D 4UZSA 1LO0H 2CLRA 3L5XH 1MI5D 2X7LA 2XKNA 2FRGP 3OKOA 4FQIH 1A4AA 1CYGA 1BBDH 2VERN 3FUMA 4I0PD 4KXAA 4RFEA 1LO2H 4XBPB 1FAIH 4XE5B 3DHJA 4LAQH 4NZUH 2X4TB 2CD0A 4JO3H 1M7IB 5B1BB 1FH5L 2FWSA 4HUUB 3JT2A 3W9EB 5HVHB 1CFNA 3QI9B 4N2IA 4PJ5E 3B7TA 4IEFB 3LH2L 4DK3A 1FZMA 4FL4C 5EO0B 2DLHA 3DGCR 1H3TA 5JA8B 5KYXB 2Z91B 4Q4EA 5TPWL 4OB5H 3MJ9A 1OGAE 2AKRB 4L48A 4IRSC 5E6ID 3VXOA 2EXSA 4G1MA 4IDLA 4KXDA 4DK5A 1F8TH 2BLFA 2FK9A 4R96A 4NQEB 3GUTA 5ID0B 1WEJL 2PW2B 2BP8A 3BDXA 1A7OL 1BZ7B 1CICC 5L4IA 3CBJB 1DP0A 1K6QH 1QAWA 2ADFH 2IH8A 1IGFL 2X2HA 5AVZB 4JG1L 4ERSH 5HYIA 2X4QB 2WNGA 1OY3B 3B7RL 4PV8B 2GIMA 4KBPA 3UZQB 4ODXB 3MV7B 5JHDE 1M7UA 1CLZH 1PZ2A 1J5OL 3UG3A 3VGAB 1UD8A 1WDAA 1ASPA 1PW3A 1SUHA 1G6RL 4GT0A 1NMCC 5KJ4A 2DQHL 4MJ6B 3KLKA 2XU9A 3IGKA 3IDJB 1TZHB 1MEXH 3O2DH 1NGQH 2OSWA 4DGVL 3L7FB 2RCSH 2FQDA 5ESVB 4XNAA 4BWTA 2EIBA 2R0ZL 4TTGA 1AZBA 3O9WA 3BC9A 4TNEA 5C0JB 1A1OB 5LLIC 4R7DA 4M93B 5E56A 1IGML 3BEWA 1EUUA 1FNEB 4NJ9H 5CGTA 5HPMA 4YVUA 2GFBB 5HGGS 3L95B 3NH7H 3X12A 1T7VA 4IIQA 3UGUA 2GTZA 4AX3A 1QABA 5IB3B 1BV8A 5D7LD 3Q1EA 1IAIH 1XSOA 1U41A 1X5ZA 4NKMB 3GWJA 4LBAA 3SE9L 2K78A 4I2XA 1X5MA 4FF9A 4B3VA 3MRRB 4N3TA 1A3ZA 5C09E 2A1WH 4HUKB 5DK2B 1BVKA 3TVMD 2YQ3A 5AEAA 2BX5A 4XHJD 4GRWE 4Z9KB 1JIBA 3NJJA 3RWIA 2CKNA 4HIXH 4LFHD 5K39A 1OQOA 2FBJL 1FJ1A 5JPMC 3IE9A 3UDWC 1SXAA 3BAIA 3I6GA 4Y16A 3IFNL 1CDGA 4S2SB 1CLYH 4WO4D 1GGUA 2X42A 4P57B 2ZONA 1R17A 4TNWF 4LIQH 4U1GB 4A2DA 1QSZA 3KDPB 4M5SA 3TH4T 1NCTA 1DBMH 4HCIA 1T20A 4N1EA 5CCHE 3WEMA 1BJ8A 3OXRA 4XMTA 2IGFL 2UUDK 2GC4C 2VMCA 1WD8A 4KFMA 5BJTA 3ARDB 2JXMA 4TQEL 1DVFB 5T1DH 4B9YA 2J56A 3X3FH 4ZOEA 3LV3B 2X53A 3S37L 4Y2NA 5TE4L 1KXHA 3MCYA 1ZXQA 3ERXA 5CINH 1FNLA 1JGEA 3MBXH 3F6IA 1I75A 3EYQC 3CFEB 5KZCD 4KGJA 1RP8A 1UYWH 4N5EC 2PCXA 1VGKB 1KGJA 4P5TB 4KTYA 2BNQB 1YMME 2ZNWA 3OLIA 5D1XC 4AOFA 4BA8A 2VSKB 4NKDA 4OCWH 3HMXL 1S7SA 1P5VA 3NJIA 2VH5H 1U8IA 1OP5H 4QXWA 1BMZA 3LH8A 5EPMB 1G7PB 3VTMA 4PJGA 4JY5L 4DPCX 5E2VH 1HQRB 5E08L 2EH7L 1IC5L 4WLCA 5EUOE 4B27A 5DVPA 1GTFA 4QHLA 4OF3A 3BESR 3IDNB 5JZ7D 3BWSA 3KYOB 1A7BA 4KKAC 1JOIA 1UJ3B 3ZIMA 2XZQH 3Q5YA 1P1VA 5EC1A 3QG6B 3EDEA 4ES9A 1G7HA 5F7YC 2M8XA 3MLSL 1OTSD 2A77L 3GRGA 2VJ8A 5DDHA 1YJDH 5I1KH 5E1GA 4LCUA 4XAKE 5E8EB 4P2RB 1V55B 5IMOB 1B9KA 1B4LA 3WN5A 2ZKHH 1U8NA 4JFFB 4W9GC 4HUVB 1LM8V 4JZNB 1XR9B 4YLCA 1SZNA 1YMHA 4G8FA 5PCYA 5BRZD 5CF3A 1Q0YL 1L9SA 1Y6MR 1XIWA 3FQXB 4H5SA 3RIFF 4FMKA 1WG3A 3QO0A 4PJCB 3ME0B 3UTZB 4U6HB 1HFUA 1IE5A 1SHWA 1DANU 3DJRA 5L8KB 4A2EA 1LILA 2CHZA 2GKIA 4BA0A 4ZNEE 1K2DA 4M03A 3B1UA 5EWIH 3OZ9L 1HYSC 4BELD 4LARL 3E1F1 5IJVA 1WWCA 2OMTA 4RX4A 1ODAA 3RKPA 3V52L 2P5WE 4ZYKB 1OT1A 2B3RA 3H3KA 3FQYA 4RMRA 3LSOA 4ZG1A 1MFUA 5FOJA 4PJEF 3IJSA 4AI7A 5C0DA 4JGUA 4U6TA 4P9HC 1UWXK 2DLIA 3BQUA 3ILDA 1W8OA 3V0WL 1BLNA 2HT4D 4CRPA 3P69A 4XOCA 5K1JA 4A6YA 1LEKB 4NO0B 2O6CA 4PTUA 4E0RA 1BQLL 2VM4A 4F92B 3JTSA 4QDGA 4ZMOA 2WB1A 4F58L 2Q3XA 1J9CT 3DYMA 3WNPA 3ZMNA 3JWDC 3OJDB 5IM7A 1PPIA 3D52A 2FLBT 3NEOA 4JFWA 4K9EC 2ZE0A 2BXZA 5AAMC 2GSIA 3PL6B 1ASQA 2X70B 1ZLWK 4TVUA 4IBWA 1G9MH 5SX5H 5EHFA 3SCMC 4P46C 1G7LA 3WDJA 3PYCA 5H35A 2WUBH 5HVGB 1GSKA 2DYRB 1CXLA 4TULL 3LHAA 4FNLH 25C8L 3V6ZA 3OMZA 3NK3A 1NSNL 3T0WA 3WTWA 3DURA 5GZND 4BYHA 4OF7A 3EUDA 3ZE2B 3KPRE 4GI9A 1XAUA 4DT2A 5DMIL 4X0KA 2FBRA 4Y9CA 3RVWD 3MRJB 2FYYB 4WFGD 1RZIA 3GBNH 2LVEA 2OXGA 4K71C