4L9DA

Crystal structure of the pkd1 domain from vibrio cholerae metalloprotease prtv
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
IAPVARFELKVEGLSVMSQNTSSDSDGNIVSYLWDFGNGQTSTEAAPTWSYTKAGSYSVTLTVTDDKGDSDTHQQTIKVDTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Calcium binding by the PKD1 domain regulates interdomain flexibility in Vibrio cholerae metalloprotease PrtV.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Cell adhesion
molecule keywords Protease
total genus 16
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l9dA00
3HI5L 5ICYA 5IBTH 4TSAL 3UJIH 4V1DB 3DYMA 1MI5B 4JQIL 5FYLD 5SV3A 3OR7B 4HXAL 2DQIH 5JOPE 2CRZA 2WMPA 2FATL 5KSUA 4F7EA 3MUHL 1PSKL 3GJFK 5I1DA 3V6BR 4OB5L 3ME0A 1OLZA 4OIIL 4LHJB 3IFPA 4OF7A 5EOQL 5C0GA 3PWUA 2JCCE 1P4BH 2GEEA 5IKCA 5GGQH 5E00A 2BRRH 2J88L 2QQNH 3LN5B 2QSCL 3FN9A 3PV6B 3S36X 4FQ2H 3LEYH 4PJ9A 1WFNA 4G3YL 1EFXB 5GISL 2B1AH 3PWPD 3NH7H 2XWBB 4ETYA 5FIEA 1YEIH 4OAWB 5JZ7C 3D3VA 1OT1A 1T04A 5F88A 5ICZA 3RWJB 4UB0H 1FFOA 3ARBD 5KSAD 3VH8A 3G5VB 4Y5YA 1H0DA 2W38A 4NHUB 1S7TB 3HKFA 1RUPL 1Q0XH 2CR3A 4U3HA 2IF7A 4M48H 4R96A 1OAUH 4PJ8A 3FQTA 2PW2B 4F33A 4G43B 3PIQA 4M43H 4JZJA 1A1NB 1U8KB 2VZ1A 1OPGH 1RZFH 2H1PL 2B7DT 1S9YB 3OPZL 1JPGA 3JWDH 4HSQA 5ITFA 5IT2L 3BZEA 3V6OC 1R5WB 2IMNA 3ZYIA 4JFYA 5F96L 5ALBH 4NT6A 5GJSL 5I1EH 1GIGL 1KTDB 3MGTB 5D6CA 1S9VB 3RWFB 5ADOH 1AR1D 4NC0B 3HZMA 1XGYL 3UZVB 2NY1D 4H1LH 4POZD 3NZHH 3NCJL 1QYGL 3NIGF 4JLRA 3GRWA 3VA6A 2FEEL 1TMCB 1IEHA 1OP5H 2CRMA 2AJZB 5CWSA 4LASL 4BZYA 5F7MC 4XVJL 4JM2A 4L5FL 1X3DA 5J6GB 3UX9B 1Z9MA 5I2IA 3MRHA 5KS9B 4L1DA 1D5BA 5SX4I 1IQDB 2V7HB 4U6YB 4ERSL 5CEZD 3HG1D 5GGSB 1OD9A 3FO2B 4F9LC 2O61B 1JHLH 2X09A 4FQHA 4ODUA 2Q6WA 3PJSB 4JANB 1A7PL 3QEHA 4NNXA 4JRYE 4J7RA 2FSEA 4X7TB 4YDIH 1MI5A 2RHEA 1CD0A 3PQYE 4PPTA 3L3KB 4I5BB 3U7YH 5B3NA 4UOW0 1AGEA 5D5MA 1ZHNB 3O6MH 3NPZB 4AK1A 4PJFE 1YZZA 3QWOA 2X89D 4HD9A 5F9AC 3ARFD 3I02A 1DTUA 4QRSB 4WEBL 5IFAH 4LLDA 2BCKB 1U8IA 3BYTA 3LN4B 3TJHC 2F58H 1UJTA 5I75B 4L8SC 4QOKB 3HZKB 3IS1X 4QRPE 1RJYA 1MFNA 3TIDB 1WWAX 1BQUA 2AAVA 3O3BB 1QR1A 2JK5B 2R69H 1AJ7H 5DFTA 2X4PB 3UZEA 1EK3A 5EC2B 1E4XL 5CIPB 3WO4C 4XBGA 2DBLL 4WCYH 1BIIA 5CD3B 4ELKA 3SPVA 4OUUB 1YEDA 3PABB 4Y5YC 5KVDL 3KYNA 2CMRH 4AIOA 1ORQB 1RK0B 3QI9D 3SDYL 5J11B 2HT4C 4M6NH 2RJMA 5J4MA 1U3HA 3JZ7A 4OT1H 4GG6F 4N1CA 4UTAL 1MHPH 3L3IB 5HYFA 2GAZA 1FNEA 2BJML 1SBSH 5CJXA 2VYRE 1J12A 5IBUG 1A6WL 4PRID 4JDZB 2JF1A 1VADA 3MBEA 5F7WC 4E5XA 3U0TA 4JN1L 4HKXB 5L2KD 4NGHH 1R3JA 1GZQB 3QIUA 2D2OA 5TPWH 2EIDA 1YEJL 3MRBB 4TVPE 1U3ZA 1IC5H 2BXYA 3MQIA 3SOBH 3V6OA 3F7YA 3RGVB 4PJ5E 3JWOC 4YNYB 3BVNB 1I1YA 5IHUH 4R7NB 1H15B 3UTZB 2VDRL 2NW2A 3DSFL 5IB4A 3C09C 3GJEA 3IXTB 4FQQB 1Y18A 2Y4SA 3QIBB 3T8XB 4HIJB 4ZTPH 4HIXH 4X6DF 3QXUA 3KWWB 4W6XB 4IJ3C 4YEEA 5KSBE 4ESKA 1P4LA 5D1ZA 3U2SB 4PB0H 2EDRA 3WFDH 4FFYL 3FTGA 5LGJA 2F54A 5EDXA 4Y19A 4WI5A 3GSNB 3L3GB 4MDIB 5FO9B 4YDJB 2AXGA 5CGMA 5DXWA 3HZYA 2QBWA 2FX9H 5LGHH 3W0WE 3O2DH 1OAQL 4KGJA 3NBNA 5DS8B 3MX0A 3PJSA 4W68A 1BEYH 2I60H 3LY6A 4NQEE 3GSOA 4RAUB 5SWZD 4AEHH 1JZ6A 4HC1L 4MD4A 3PGFL 3H42H 1TTGA 3M1BA 4QKXB 4DQOH 3ARBA 2ATKA 1FGVL 1T5WB 2DLHA 2EDBA 3I50H 3P73B 4NZRL 5FO7B 3STZA 3BO8A 1TVDA 3ISWA 5I1KL 4XBEH 2E27H 4HZAA 2PTTB 2COQA 4PRHE 3F7VA 4W4OA 4XHQA 4UT9H 4JFFB 4PD4J 5ID1B 2QR0A 4XI5C 1FGNH 4N9GB 4Y2DC 4U6VL 2JELL 1TETH 4Q6IA 3FQWB 4F7CA 5JQHC 5IG7B 4KTYA 5JA8B 4NM4L 3CFDB 4Y19E 2QTEA 2VXQH 3FT4A 2GIYA 2IMMA 5IROA 4G9DA 1BIIB 1PX3A 3AS0A 5ADPL 3OAZK 3QUYC 1FZKB 1T2QL 4QRQB 5C2BL 5LJYH 3ZTJG 3WBDA 1M7DB 3MYJB 3P4MB 4HUUA 3IJHB 1YUHB 1JPTH 3C8DA 2R2HB 2VERN 3BH9A 4APQA 3VFUA 1A4KA 1YA5A 4NUJB 2G2RA 5AYUH 3Q6FB 4GRWF 4OZFB 2CLZB 2LE9A 4PG2C 1B6UA 4HC1A 1G7MB 3HE6D 3RTQD 2YD4A 2G75B 4GAJL 4F58H 3I3DA 5DHYA 3V6OE 4OLVH 1MQ8A 2APWA 4XC3L 5J13C 3A6OA 4K3GA 1HYRC 3AS1A 4WI4A 2CO6B 4KKCD 1XCTA 1LO4L 1DN0A 4Y1AD 4LHUA 4YNYA 3A6BH 3KXFE 4K8RH 2HFTA 2ZOKA 2NW3A 3BD5A 1LGVA 1VEPA 3PL6C 4D9QE 4HXBL 1NH6A 5ESQB 5CAYB 3BEWA 2HMID 4ZO8A 5DD0H 3KPPB 5C07A 3TNNA 2YN5A 1XZ0A 5FUCE 3WNMA 4HK0A 3GMNB 4X80H 5K59F 5KVGH 1R3LA 1CTOA 2H32B 1L0XA 2ITDA 1CI5A 3RIAK 2DQTH 5F6IC 2B20A 2VDLH 2XA8H 5D72L 1UENA 2V9RA 1BM3H 2R0ZH 1T20A 1RU9H 1RZ7H 5MP6H 4BFBD 3BUYA 3PWLB 4DK6A 4YDJA 4U33A 1Q9WB 4JGJA 4CAGA 3QHTC 4R3SA 1ZT7B 3X3FL 5FGBC 1IFHH 1FAIH 5A40E 3T4YB 2IAMB 4PJEB 2IADB 3DO3A 5J1SC 4PGCA 5EU5B 4ZAKB 2DI8A 1C16A 2V17L 3MJ9H 3QXVA 5IWLC 3LKSA 1AI1L 5HVFB 1NJ9B 1LK3L 2P4AB 4L8BB 3SCMD 1H9VA 4JG1L 3NCFB 3P4OA 4Z7UE 1FNHA 5EN2B 4ZDHB 4NQXA 1E6OL 2ZUWA 1DQQA 1M6OA 3UROR 1J5OL 1G9ML 2BNUB 4M03A 2YPLA 3PF2A 4MJIB 4WW2F 4JPIB 1BGXL 4LCYA 5T5FH 1JPST 3RX7A 2ESVB 2WAHA 4ELMA 5CEXA 2Q7NA 3F12B 4LIQE 2IPUK 4G9DB 1D6VH 4DGVH 2YMXL 1NFKA 1QR4A 2Y6SC 4UINH 2V5RA 4JHBA 2A83A 3P4MA 4HUUB 5IESL 3TBYB 2HVJA 4XPHH 1PQZB 4NQCD 2EDJA 1VPOH 5J1AA 5JXAL 4U1SA 1QSED 1NC2D 2XKUA 4JDVB 4J4PA 2X9WA 3HFML 3K46A 1G7MA 3GMMB 1KCSH 2YKLL 1QSFE 2I25N 4Q58C 2VIRB 2A73B 4HKZA 4Z7VB 4AIZB 4JM4H 1QPXA 1GH7A 1Z5LA 3OKOB 3FN3A 3WIIH 5F9OL 4BKLA 3DXAA 4QO1A 1SYVA 4EI5C 3MRKA 4FTVD 3MV01 3UTOA 1I7ZA 4ODSL 1T1XA 1G7HB 3K2MC 1ZKAA 1Z0NA 2W65A 3TPKA 5JHLH 5FUZL 3IYLW 1PVHA 1RIHH 1VGEH 1WISA 1T7VA 2B4CH 4OF3A 3WNNA 2C3WA 4TTGA 2M1KA 1C12A 4UI2A 3QUXC 4FMKA 3MA7A 3BXNB 2FZ3A 4HJJH 2BFVH 1EVUA 3UZQA 1U3JA 3EYVA 3CLFL 1KIUA 3SKJL 1D5XA 4M1DH 1NGQH 3C5ZD 2X4RB 3BP6B 4LLWB 5L2KE 4RAHA 3CIQA 4XP6L 4BK5A 1BP3B 2DKMA 5I16B 4D94A 5BV7B 2Q76A 5EZIH 1MUJB 3IAPA 5TDOA 4LCWE 1MF2L 5FYKL 2FYYB 4YAQA 1CE6B 1I1AB 1JGDB 5H37H 5GGSY 3T4YA 4QXGH 2IADA 3LSOB 3V4UH 4M1DL 1VFBB 3TCXA 4L9LB 2R0ZL 1NCWH 2AV7B 3BT2L 4ZOAA 4D9QD 2YEZB 5IMLB 4WFED 4LVNB 5IB5B 1NJ9A 1BAFH 5LAXB 3QUMB 2X4OB 3SDDB 4CUCA 2FLRT 4D8PB 1RIHL 4IMKA 2DN7A 4JGUA 4F7TB 3QIWC 1GGCH 4LSSL 4IOIA 5C0CA 1DLFH 2AEQL 3VRLE 1LEKB 3OL2A 3VFRA 3G5YA 4OD1H 5GS0D 4ZPVB 2IH3B 3LV3B 3VFWB 4Z7NF 5F8RC 3QJFB 1AGCA 4P9HL 3JV6A 4AH2B 1UH3A 4XCNB 2UVEA 5L0QC 3KXFD 4JCMA 4C56E 4M3JA 3D2UD 4S0SD 4FXGA 4JY5L 4ONOA 4LSTL 4GAJH 1BFOA 4G8IB 5HDOA 3UTTE 1SY6H 3WNKA 2EE9A 5IGXH 3WIHA 2DQDH 3L9RB 1NMAH 5C6WH 3MTRA 2NY0D 1F4YL 2ZSVB 1PGRB 1B9ZA 3L5IA 4PRHD 5HYSA 1MRDH 2ADIA 3MV8A 4Z7VA 3BZDA 1FFQA 5IB3B 4MSWA 3EYSH 1BLNB 4EUPH 1N5AA 2YA1A 3CLEL 4GRMA 4LLVA 4NSKB 3HC4H 5DMGD 3QISA 4RDQF 4TUKL 4QYOA 3QJHB 4MQXD 4HWEH 5IJVA 2WUCL 4C55A 1J0ZA 5IHBA 5ANMA 3FFCA 3ARXA 1DQLL 3BN9D 4JFEE 5D6DA 5FOBA 3MFGB 3QAZB 4CKVX 1N2RA 1FFNA 1YN7A 4GQPH 3VG0L 3ZTNH 5HYJA 2UZIH 4XBEL 2I5YL 2QJDA 4JY6B 5C6PB 3RGVD 2W0LA 5EZLA 1R3KA 1P7QB 2VLKA 4U1NB 1KC5L 2KBGA 4LSQL 2CRYA 4S1DD 3ZO0A 2NR6C 4XGZA 1IEAA 5K33A 5HGAB 3UPCA 4I77H 4IRSC 1GJIA 1KEGL 3RZCD 3ZE0E 3SHSA 3JWOH 3WUWG 4M5ZH 1FH5L 3JWNC 4HEME 3SKNB 3IDYB 3O11A 4M1CD 1TQCC 4HGMA 1JBJA 3DGGB 4HIHA 1EA9C 1HSAB 2A6IB 2NY4C 2QQQA 3BQUD 2BY3A 3FFCD 3I2CL 2X05A 5J0BA 2ED8A 2M8XA 5HJ3A 2XXCB 1Z9OA 1ZHLB 1WVZA 4KQ3H 2AV7A 4ZFZA 3SGJA 1H3GA 5E2UL 1E6JH 2ICWJ 2BC4B 5EIVA 1KB9K 3GK8H 2XRAH 1AQDA 5DGQA 1RIUL 4WUUA 2OR7A 5DHVA 4ZTOL 1BX2A 5TFSH 1QKZL 4TNWK 3GSWB 3P9LA 4OCMC 4KRLB 3GRWL 4BZ2H 2DJSA 1S9XB 5CSBA 5FCSH 2OR9L 5KAQF 2PYEE 1CICB 2XPGA 5HHNB 2YR3A 5DJ2B 4DJMA 4FTVE 2NYYD 3AU1B 3KLDA 1DANT 3QJFA 3ILPA 2IANB 4ELMF 1HYSD 1NGXB 1G7JA 4D9LH 3QDGE 5K9JL 4LCWD 1YEJH 1A5FH 5E6YA 4NJAH 1LQSR 1F6AB 4LCUA 3IFLL 2AJUL 3QSKB 1JK8B 1CFNB 3V0WH 3T77A 4YQXH 1ZOXA 1KB5A 2GK2A 1F2XK 2D03H 3T0EE 4YXHH 3RTQC 1WBXB 4Z7UF 4ZXBD 4OQTH 5HPOA 1EXUB 3K8KA 2DB8A 4LVHC 2Q7YB 3KYOB 1B0GA 5TGBA 2H3NB 2BVTA 2L7UA 3S96A 4DOHE 3EBAA 5E8OA 4FZEL 5F7UA 3TNMA 2BVPB 4XMLH 1G6RB 2PO6D 3BKJH 1E4XH 5HDBE 4QYOB 5C08E 4D0CB 1S8DB 3B43A 3BYYA 1ZEAL 1UA6H 1K8IB 1T0MB 4NZTL 3QDGB 2YSSA 3ULVC 5DUBB 3DVGA 1WAAE 5FOBB 2FCBA 4UBDC 2XIDA 1XGPB 4AQ1B 3C6LA 3VMOA 4J8RB 1CIUA 4PV9B 3MJ8A 4OZHB 3P9WB 5GRVL 5B4MD 3S5LA 4E9LA 3L3DB 4MMXC 3RVWC 2HVKB 1LD9B 4XTRC 3HE7D 3PDOB 5EZOH 2CJUL 4U49A 4XGZB 4ZUUA 5MEQB 1MAML 4ORGA 5DSCA 1OP3H 4L8CB 3RRQA 4H8WH 4YHYC 1YC7A 2MTPA 2YHGA 4GKZA 4GXUN 1FNSL 5L88L 1P2CA 1A1OA 1BQHB 1CR9L 1TZIA 2UZYB 4K3EL 4NRYA 5DMYA 3ALPA 5GGTL 2F74A 5IFHH 4JVPA 1XIWA 3QULA 1YC8A 1NFDB 1UA6L 4HUXA 3JTSB 4KHXL 2AJXH 5DHVH 4ZO9A 2QADB 1NUNB 2Z8SA 5AAMA 2NY3C 3H9ZA 3ESVF 1XF3A 1GOFA 1RZKC 1BX2B 5J12B 3OKNB 4PGZA 5ADOL 1M7XA 4OKVA 4PJ7A 2HMIC 4NKIL 5JPNA 3B9AA 4BFGA 4J4PD 4K7PH 5IQ7L 4LARL 2XPGB 3IDIB 5DJ2A 3LDBB 2FEEI 1WAAA 2C3HA 3EOTH 5TE7H 1WBYB 2VLRA 4GRLB 4V2BA 1T1YA 1NGXA 3VI3F 1II4E 1NEZB 1P84J 4MHHG 2R0WL 2LU3A 2V9TA 1F3JA 4FQXA 3NIDE 4ZFOA 5IQ7H 4K2UH 1JK8A 5MI0C 3BHBA 3QUZC 1AGFB 1C1EH 1XCQA 2AGJL 2BOCA 1JNHB 1I3GH 1KB5B 3SDYH 5I1AB 4EUPB 1ZWIB 1WT5C 5F7DA 4OGZA 2FX7H 2VISB 4MAYA 3SE3A 1R3HA 3TH4T 3GRWH 4BZ2L 1EXUA 1TCMA 3QH3B 4ZPTB 1U8LB 5L8KB 2DBLH 4WCYL 5AEAA 2I9LB 2AABH 4M7ZC 4WEUD 4MZ2A 2H6PB 4MJ2A 2AJXL 1AJ7L 4PJAA 5LXGL 4NO5A 4O2FB 4Y1AB 1RUQH 5I1LA 2CXKA 1CR9H 4OM0L 4S1SH 1INQA 1FZOB 4NQDD 2XNAB 3BPLB 5CMAA 2FJHA 5CEZL 3BDYH 1MCWW 4MB5A 4Y2DD 3UTTD 3SCMA 1CCZA 1K4DA 3Q1SH 4PLJC 3VXRB 2VWEC 2VZSA 1V5JA 3BWUC 3OMZA 3GIZH 1J0KA 4MLSA 4H88L 5HHME 1MFCH 4P5TB 1ACYH 3RTQB 3QCTL 3FO0H 5BQ7B 1OOAA 3MLRH 1QBAA 3RDTB 1S5HB 4Z78B 4P23C 2ARJQ 3I6GA 4L8CA 1IC4L 3ZYOA 2MCPH 2AJVH 3TZVD 4LCCC 1MREL 2HJKA 1YYLH 4CDHA 1EO8H 4KC3B 5J06A 4TULL 3BKJL 4YIQA 1AGDB 1QFHA 3C6SB 2AJSH 4I13B 5JW3H 3VFGL 4G8FB 1DJSA 5FKPB 3MPCA 1BPVA 4Y5VB 3TA3C 4K9EL 4GW4A 1RHHA 4TNVK 5GRUL 4I9WE 4KXZI 3X3GH 3OKDB 5TDNA 1X6LA 1G0YR 5DR5H 1IGCL 2X4QA 5D6DC 5T1KA 1D9KD 5JW5B 1T22A 3P4LA 5J11C 3PGCB 4PRNB 4U4BA 3IDIA 4ZFGH 3N1GC 3TVMD 4GRLA 1WBYA 2A6KB 4MCZA 4OGXL 3WO4B 3BIKB 1BF8A 3UC0H 1MFDH 1J87A 2MJWA 1JTPA 2EXWC 1Q0XL 3AM8C 3VH8G 2CIIA 3QXAB 3LS4H 1WWWX 4NQED 4IRSB 3SE9L 4WI8A 5T1LD 1GHFH 1NDMA 2CKNA 1QPPA 1G7PB 4X6DB 4RRPA 4XZUB 5E0QA 4QHKJ 5KVFH 4Z7VE 3MV8E 1I3RA 4PRPA 4ZPTA 1RIUH 4FQ2L 5F7EL 1QSFB 2WWMD 3AS2A 3GUTA 1KACB 3WS3A 2DQCH 3MODL 2I9LA 3UAJC 5ISZB 1JNNH 1RFDH 3GMQA 4NO5B 4O2FA 3DJ9A 3IF1A 3RIFK 4M6MH 2BSRA 5SWZA 2GT9A 1WIPA 3I2CH 4OCWL 3SDXA 3SY0A 5F1IB 4AENA 4PJCE 1Q9OB 2XQBL 1NAMB 3RA7H 3DBXA 1W0YT 1PSKH 5CMAB 4M6ML 4JDTH 2XOTA 1QFWM 1MF2H 3LN9A 2XWTA 3BH8A 3MLYH 4WWKA 5BVJA 1K4CB 1CFSA 3VFPB 1NKRA 4D0DB 1AP2B 3S7GA 4MA1C 5D7IF 3VFVB 3WFZA 2EO9A 4MDJB 1MQKH 4N0FB 1LNUB 2LQRA 3CH1A 3TIEA 3ZTNL 1UWGH 2W9DL 5FA4B 1QQDB 3QBTB 4TSBH 1W0WB 5C08D 1N4XL 1GSMA 5D7JD 5H8DA 4MCYB 2NPLX 5SX5H 5DYOA 3IKCA 4PJEE 5MEPA 4YFLF 1EH9A 2O26U 5E1HB 4R8WH 3U4BH 4N1HB 3VA2C 3TJHD 3DRTA 2EDHA 3O8XB 4OM1L 2CDEB 4DZBA 1RULL 2WBJC 3EYSL 4IDLA 4TUOB 4XCEB 1I1FA 4FZ8H 1ZMYA 3NN8A 2DQFA 43C9A 5EU7C 1MAKA 5F9OH 2W60B 2G9HA 4U1LB 1JF5A 2DLTA 5DJYB 4KK5C 4WU5B 4TRPH 8FABB 1FBIH 4JO3L 3E3QC 4YO0A 4YHNA 5HHVH 4EN3A 2GY7B 4GS7C 4KQ4L 4CVXA 2CH8A 3EO1A 2A6KA 1WAAF 4RSVA 3C2AL 3KXFB 2Z92A 5HGBA 3IAGC 3U4EB 2P7TB 4UQ2B 4EDXB 1AC6A 1KJMA 1OGTB 4NN5C 4M93C 2HJFB 1FL3A 4N0YL 1Q72L 5ICYB 1TJHL 1JWUA 4WV1A 4JRXE 1MHHA 2WM0A 5EO0B 4BH7B 5BW7A 4HGWA 5DTFA 2A0LC 1GGCL 4LSSH 1MJ8H 1DBMH 4M1GL 2G5BA 3FO0L 1E4KA 1SEQL 3HMXA 1CDIA 4EKXA 1OGAD 3EOAB 4HJGA 4N90E 1R0AH 4P4RB 4X6FA 2HJLA 3BIAX 1XGQA 3D2UB 3TBVB 3OKEA 5GHWH 3BDYL 4WJ5B 1MI5D 1H5BC 3N50A 3MJ9L 1OSPH 1CZ8L 3O45B 2NY0B 5EZIL 3VFOB 4UTBL 5MENB 4NJ9H 1G7QA 3JV4A 1JMZA 1XMWA 4ZS6D 2APVA 2VRAA 3O4LE 3HC0A 3LQAH 5LBSH 3B5HA 4OD3L 3WNLA 1GGBL 3BAEH 2YRZA 5B4MC 1XF1A 1X5AA 4JFFE 5IW6B 1AP2A 4PUBL 1HDMB 5F9WB 4E0RB 3MC0A 4CN6A 1BM3L 5GGRB 3V5DA 4MQSB 5KSAB 4LKCA 3OX8B 1EHLH 4OUOA 2YPKA 3VFTB 3VFSB 1J0HA 3QEQD 4DZ8A 3DURB 4H0HB 1S7SA 5FYLL 4Z76A 5DZOA 2E9JA 3PP4H 5EA0L 3CDFA 3PNWB 2DM7A 3G08B 3B6SB 2DF3A 4G80A 2A6DA 4MXVF 3W0WB 2IC2A 1KXVC 4NT6B 3O2DA 2CDEA 5B8CA 3WJLC 1DFBH 5DVMA 5HYSG 1R6VA 1IM3A 4OTXL 1RUMH 2GTZA 3S5LG 3IU3A 1IEBB 4E42B 3MMEB 1UB6A 1XGTA 4XMPH 5D1ZC 5DRZB 3AREC 5TQ0H 4JLRB 3RUGA 1C5BH 2YKLH 3KYAA 3LKRA 1IQWL 4X5XA 3QUMH 3U9UA 3D85B 3WFCH 1MFBL 4WU5A 3Q5TA 1VPOL 4HK3J 2FIKA 1T04B 5F88B 5D7SL 4LLAA 1FO0A 5C0RL 1HKLH 5CJOH 4Z77A 4QNPE 2BNQB 3GSRA 4NHUA 5DJXB 3MRHB 5KS9A 2IAMC 2EYTA 3FMGH 5A2JH 4DGVL 3RU8H 3ROLB 2OP4L 4IRZH 3B3IA 2WW8A 2V5MA 4HMCA 5EBWB 2P8LB 5SWSD 2YXFA 1HCVA 1T2QH 5L9DL 4OZGF 2PETA 4ODXB 1SJEB 5DURD 3RY6C 1KYOJ 3QEHB 1U8KA 5F9WC 5T3XL 1NSNH 2M26A 1I9JH 1WFTA 4QHLA 3QZWB 5DUPL 3RIFF 3MFFA 2QSTA 1R5WA 4AMKL 3FB7A 3TFKC 4GAYB 2WP3O 5CHNB 5C6TH 4CMHC 3MRRB 5HHXH 5F70A 5D2NC 2Z93B 5E2VL 4OGYH 4QGYA 2BX5A 5L6YH 3DYOA 3I50L 1TQBC 4J12A 4LSRL 5IROC 1I85C 1DQML 2EKJA 3DIFA 4I3RH 3SQBA 2MPAH 2QHLA 1VFAB 1G7LA 4M61A 4U1JA 4K8RC 1MJ7H 5FDYA 5MENA 2OZ4L 5KSBA 2W0KA 3T0VA 4LSVL 3STLA 4U1KB 5HPMB 4LPTA 4JFZL 4MD0A 4P46A 1DDHB 3OGOE 1M4KA 1QLRB 5JQ6L 4LQFL 2O61A 4JDZA 4JO4L 4RCAA 5GGRA 3V5DB 3MBEB 4X7TA 1PKQE 1KJ2B 2Q1EA 4HKXA 3VJ6A 3V0WL 1X4YA 4XX1E 3PQYB 4G7VL 2IAMD 2OM5A 1MLCB 3IFLH 1KIPA 4N8VB 1D5ZB 2X42A 5T1KD 2P49B 4F9LA 3MV8D 4JRYB 4WVRA 2VTFA 5KN5A 2J7LA 3IDXH 5F9DC 1RZGB 3HRZA 1RPQA 4KY1L 4U3XA 3TH3T 1XF4B 3L3OA 1FNGA 1FZJB 3GJFA 3SOBL 5BJTB 5KS9E 3DETC 4M8QB 3SJVD 1YMHB 2XFXB 2OR9H 5CBEA 2Q86B 3T2NL 2JB6B 3MJ9A 4L3CB 4MXQC 4HEPG 1R5VB 3R06B 3RUGB 4C83B 3GIVA 4NGHL 4XP9L 1NMCC 2BSSA 5CJ5A 5E08L 1H3XA 4IS6B 4JHWH 2BDNH 1E0OB 3VXOB 5ETUA 1FVDA 3CJJA 4OZIF 5DJ6B 3HPJA 1TXKA 3OHXA 2ITCB 5D7LA 4YX2H 2H2SC 3ILQD 2X70B 1U93B 3VWKA 1XH3B 2KQMA 2VXQL 1MCQA 3GGWA 3QO1A 1WEJH 5CP7A 1JF1A 3D69B 1GZQA 1RZIA 5BV7C 2OJEB 2OZ4H 4B53A 1YJDL 2E6QA 4MA8H 3O4LD 4K3JL 2BK8A 1M71B 4P5KA 1BBDH 2EDLA 4BSJA 2EKSB 1BQHG 5J6HA 4XNQB 4OSUH 4HIIB 4K3HA 3MRLB 4NZRH 2P45B 1X5YA 2FWOB 4WEBH 4NC1C 3KHQA 3DV4A 1FL5A 5IB4B 4AEHL 5H35A 1GCFA 3IXTA 1ETZB 3D1MC 2OTWB 1EO5A 4R4BA 4JG0L 2EZ0C 1EAPA 3U7YL 1KTRL 1YYML 1NANI 4LGPB 4AMKH 2V5YA 4ODHL 1P4LB 3VI4E 3FZUD 2FIRT 3GKWL 4BM7A 1G7LB 4W70A 1I9JL 4PS4L 5SWSE 3SDCB 1KPVA 2EIZB 3TBTB 4MDIA 4HWZB 2D4DA 4KJQC 3K2UL 5EFIB 3DOSA 4RRPG 1WCBB 5L9DH 4PJIA 1TVHB 1FYTD 2JCCB 1F4WH 1K8DA 1U91B 3OJMB 4PB0L 4JFEA 2VXTL 5HDQL 5JXEC 3T0ED 1CT8A 4J3UA 2NY5L 3BGMA 4EIZC 5E6ZA 3ES6A 3INUL 3HNTH 1CFVH 4NNYA 1F4YH 5FM4A 4ISVA 2E6JA 3MRPA 3L3JA 4NHCH 2ATPB 1MI5E 4V1DE 5IHUL 5E8DL 3FB8A 4JFOA 5F1NB 1UH2A 3KR3H 3VXRD 5I66B 1WC7A 4DEPC 1REIA 4MNGA 3D39D 4H1LB 4G6KH 4JFFA 4LHUB 3L3OB 1MHEB 5HI4C 3AREB 2DTSA 1VENA 5DD1L 2EO1A 2YRPA 3HG1E 3DO7B 4PLKC 4DWHA 3PP4L 1YEEH 1Q94A 2AEPH 3SDCC 2GJ6B 1FYHB 3MLZL 4OLUL 5EIIB 1A6VL 4YHLH 3U30B 1EDQA 4CGTA 3BP4A 1ES0A 3OGCA 3U46B 3VGEA 2FJFA 5KVDH 2P8PB 4LNRB 4OJFH 1QD0A 1YDPA 1L9NA 4KKBD 5C1MB 5DD6A 3QO1B 4LHQB 4HWBL 5DHYB 3TJEH 3MRDA 3CK0H 1T7YA 3MLZH 2C1PA 2OXHA 3BMVA 2AI0L 5GGVL 1SYSA 2J3SA 4HZLB 3U1SL 2X40A 2VLJB 2ZG2A 3NFNB 1E4XI 3NFPA 3QIWA 3WYRA 1RUKH 2PYFB 3SKJH 2NW3B 5SWQB 4LPYA 4LPXA 5EN2A 4ZDHA 3ULSB 2P5EA 3ROOB 4NFCA 1D7FA 5C9JA 2HAZA 4R4BB 1ONQA 3AGVA 4JEGB 1XZ0B 1Q1JH 4ZO7A 4N5ED 4BQ8A 1CDHA 3OJDA 3DRQA 4I1NB 4HFUH 4JVWA 2MHAA 1EFXD 1CGYA 3W81A 3HI1A 5F6HI 4QTIH 3MLXL 3W9EB 3SDXE 1A8JH 1YEKH 3T2OA 5BRZE 4HUVA 3EOBB 1Q9WA 2YBRA 1FLRH 3QUZB 5D1QC 1A7RH 4LHUD 1HILA 2NNAA 3LRSB 4S2SA 1HK6A 1VKXB 1JHKL 2BZDA 4CDGC 3WFEL 3NCBB 2VQUA 3JXAA 1J0YA 1KCSL 1KJVA 3LKPA 4AIZA 3PL6D 1CLZL 1FBIL 4ZAKA 5HHVL 3DROA 3RL1A 4F8QA 3WHXB 2C3VA 3MR9B 4XPHL 1EJOL 3K4ZA 4XP4L 4BFIB 5IHZA 4TOYH 1AGBA 4RX4D 4JJ5B 3RWHB 3TPUA 3S3PA 1U95A 5E1AB 5J12C 3O3DB 1MHEA 4PRBB 2NY4D 2VJXA 1NC4B 4X6EB 5A2FA 3DX6B 3NABH 4GRWE 4YHMH 5K59E 5D5MF 4JPIA 1BBDL 2A74B 2R9HD 3SKMA 3MA7B 4XPGL 5GZOC 2Z0BA 3BE1L 3B5TA 3QQ4A 3UXFA 1RUPH 4P4KA 3EDKA 3TWCL 4O2EA 4XAWL 1UWGL 3RUGF 5EU3A 3FQUA 1E4WH 4JKWA 3RZCA 4BK4A 1X5ZA 3V4PH 2XZQH 1QNZH 4TTDD 4FQLH 4JDVA 1P1ZA 3NOIA 2DIJA 3IETA 3UYRH 2F5AH 4CL7A 3HMWH 1N6UA 2VDMH 5D93C 1BD2E 2YK1L 2BDNL 1BZ9A 2NY1B 5D7KE 2BY0A 3SE4A 2DIBA 1VFBA 4NCC2 4Q9RH 5C86A 1YNTB 2BSED 1U41A 2VLJA 5CGTA 4PG9A 1AQKL 3WDJA 1T1XB 1FVEA 5F1KC 1G7HA 3SKOB 1D5MA 3SE4C 3Q0HA 5DURB 4LLUB 2R9HC 2X44D 2P5EB 1KLGA 3ROOA 4PJIE 2VZVA 3IDXL 1LO2H 3L5WB 4BQCA 15C8L 1I7UA 1L0YA 3RWGA 3S3SA 4EXKA 4OZGA 4HXBH 1F2QA 2FZ3B 4NUGH 4DFIA 1FORH 3R0MA 2IH3A 3VFWA 5IW1A 4R6UA 4HS6A 2PO6C 5K9KA 4XHJD 4FABL 2XY1A 1S7UB 3D39E 4LOUD 2VQ1A 3LS4L 4M7JH 3WKMH 2HTLC 4GLRI 4Z7WA 4GBXB 4JN2B 3CPLA 2R0KH 3C8HA 3DMMC 5D7JC 1T6VN 2WINA 4P3WA 1I1AA 4QXTB 4UT6L 1FCGA 1ZA3B 3HNVH 4XNXH 3M8OL 4UDTA 1BVKB 3V79C 4L4VD 2APBA 3MV9A 4HH9A 3T65B 1U3YA 4MSWB 3RL1B 4RMWA 5D7JA 5DJ8B 3ZDXF 1FC2D 3WHE1 5AD0A 3HS0A 2EYSB 1I8MA 2P5ED 5C2BH 3PG2A 3JTTA 1PEZA 5CINH 4L3ED 3TF7C 4UNUA 3RFZC 1V3KA 1U95B 2Z35A 4NZDA 1MHCB 1W2KT 7CGTA 2H41A 5JW3L 2CDFA 4NBXB 2WBJA 5CZXD 4X6BA 1OY3B 5T5NG 3WXWL 3EDEA 1N2RB 4U6VH 1I8LA 3SDAA 4PJXA 1IL1A 4HH8A 1IRAY 4L8DA 1HOCB 1OQOA 4ZUSA 2NX5E 5H94B 3S4SB 3AXLA 2NZ9C 5BS0E 2VAAB 4KH2A 3DHJA 1G6RL 1CXEA 3UPRB 4X98A 2FO4A 4V1DD 3I84A 4LCCB 1C08A 3IETB 1MFCL 1V7MH 4HV8A 4QRRB 1B2WH 3N1PC 1YECL 1A6PA 5HYSB 1ITCA 4L29B 1OAQH 3O11B 4X9GA 5D7SH 3EO9L 4OI7A 3GSNH 2LVEA 3CZFB 4PP2B 1MOEA 1ADQH 4J1UB 1J1OL 1LWRA 4WI7A 1HHIA 5I0ZA 4NQCB 1PD6A 5BV7H 4ZUWB 1PKQA 2P42B 1UH4A 3CZJA 3QJHA 5FV2A 5MERA 4FFYH 1DLHB 3WDHA 1QHPA 3DXAD 3DVIA 2Y1VA 3RWDA 3QCVH 4QGTA 3PHOB 5C0IA 1G9NH 2VDQL 3G6JA 4AEIL 3CFJB 3LKQB 3ULVD 4AEFA 4FQJH 3UTSA 1S7VA 5B3JF 4OCLC 2CGRH 3OAZH 1QEWA 1PLGL 4I9WD 4M4RA 4OLYH 3UJTL 1S9KC 1FNFA 4YGAB 2XN9B 3TBSA 1AO7E 2RCSH 5GQBA 3TYFB 2AXFA 2IBBA 3TBWB 1S7UA 2EDFA 2R56L 1JYNA 4LEOA 3U36A 1YPZB 1IEAB 1VDGA 1T66D 2X1XR 1S7RB 1AD9A 4GFTB 2BSTB 4Y16B 3E6HA 1FYTA 4JM2C 5ALCL 3QFJE 2R0WH 5GS0C 1U8OA 3EYUH 5J8OA 5AZ2H 3K8LA 5CGYC 2XWJB 1OTUD 1TQCB 4U6HA 4RISL 5E4IA 2ILLA 5TE4H 3SGKA 4G9FE 2H45A 4HUWB 2X10A 1MRCH 2DKSA 5C9KA 2BJMH 4XCYA 4QLRA 3MV9B 4OD2B 5E5UB 2YC1A 4MA3A 4OLWH 4Q74A 5D2LE 3HR5A 5HVHC 4IIQC 1OW0A 1NGPH 2NTSP 5AD0B 2D31B 4KK9D 2DLFH 4WI6A 1JIBA 5BS0A 3JTTB 2H9GB 5L2JB 4OCSH 3WS6A 1MVUB 2CLRB 1T5XB 1TZHA 4LSUL 4JZNA 1SEQH 1L0QA 3CU7A 2FB4L 3K3QA 5DK0B 1LK2A 3TC9A 1YEFH 1D3CA 1RMFL 5DO2C 1CFTA 3CSGA 3EZ8A 4FXKB 5J1TC 5GS1A 5J3HD 1X5IA 1I1AC 1YQVL 4I8DA 2XV6B 2ZNXA 5IVNA 1TLKA 4ONFL 3CFEA 3AB0B 3VXUD 5IB1B 1ADQA 1T3FB 2VL5A 3QNZB 5H37G 1FL6B 4L29A 3VXUB 3IU4L 5HHQB 2HLAB 4BSVA 4J3TA 4GSDL 1DEEA 1QFWL 4ZODA 2ICWA 3BGFC 3VRJA 2F19H 3D25A 1UXWB 1WZ1L 5C0AB 1ZLSL 1VEOA 4Y5XC 3QUXB 3SJVA 1MWAA 1B0WA 4S1RL 4ZQKA 4D0CA 4BH8A 1F8TH 1NCCL 3IDUA 3MNWB 5HGHB 3D39A 3KPQB 1WWCA 2OSLB 2YSSB 3HB3D 4FZEH 1EMTH 1F6FB 3QUZD 1A0QL 4BZ1L 1UKQA 1CIDA 1URLA 3E1F1 2VL4A 2YUVA 1S7VB 2EDDA 2KQNA 2UWEF 1DP0A 4LQ1A 4OZHA 4OQTL 4F7PA 1I8IB 5I1JL 4ZFFA 3DV6A 1IKFL 4JO1H 3MRIA 3H6JA 3WSQH 4PY8J 1MQKL 1WJ3A 3FONA 1U8JB 2X7LB 3OBAA 1AFVL 5E8EB 2WZPD 3FQNB 3X11B 1K2DB 3IJSA 4APQD 5FM5M 4MWFA 2CK2A 3BHBB 1TZIB 1OF2B 2HRLA 4NRYB 1XGUB 4P2QA 3LZFL 3I6KB 3ZL4L 1XIWB 35C8H 4E41B 3CSBA 4P2OB 1U8LA 4OZHF 4OV5B 4JKPH 3M07A 1M05A 2EC9U 3TA3A 4I2XB 4JRXA 3ULVH 5CCKL 1KSRA 2QQKL 1UADC 5D2NB 4OCWH 2JJSA 3DVFA 4HKJB 4PJXF 1HHKB 4X5WA 3IXAA 4QTHB 1JHTB 4G6AD 4N90D 3LEYL 3QDJE 1S9WB 1A4JB 2YK1H 2W0FA 2WK2A 2Y07H 3N85H 1HKFA 3HUJE 4XBPB 4APQC 1BBJB 3NACH 3UDWC 5HHOE 2VH5L 1PZ5A 1ZTXH 4KRNA 3C6LD 4UAOC 2Y23A 4FQ1H 2DQEL 2ZP0T 2H8PB 1GZPB 1M7IA 4L3EA 2EDKA 2WBWB 4X4XB 5BXFB 3QWRA 3LD8B 2EDYA 4UBDD 4UNVA 1YNKL 1YEHH 3ARED 4C57C 4LVHB 3S4SG 2ZUQC 3HI5H 2VC2L 5F7DB 4LLMA 1IKNA 1OT2A 1HXMA 5EWIH 5DK2A 3BESR 3QDME 1B3JA 1QVOB 1I9IH 4NIKB 3DVNA 3RP1A 3J7HA 1IGCH 1VA9A 3MLSL 2L7JA 3VG0H 3BKYH 1CGSH 1FJ1A 4PJAB 3QPXH 1KT2A 3SJVB 2DYPD 3P0GB 5FYJE 2D0GA 1UACL 1C7TA 2HKHH 3IT8D 1J05A 1DANU 4R4NC 5TDNB 4NO0A 2OS7A 4U1GC 1CDJA 1BFVH 3CLEH 3WN5C 2CDGA 4I3SL 3UTPD 2DJ4A 5K93A 1U3HC 4M62H 1CD1B 3WLWC 1MRDL 4R2GD 3U4AA 3C9NA 5KSBF 4R7DA 3RTQA 4CNIB 1HHJB 3MBED 4PRIB 2ZUVA 4YWGL 2EXYD 1RY7B 4LBEB 4Z78A 5LWYL 1YEHL 1DCLA 4GOSA 2MNUA 3BQUA 2JIXD 2VR5A 4H88H 4U0RB 2VAJA 4QRTA 3H9HB 2HP4A 5BZWA 4ZS7H 3MJ6A 5JMRA 2EH7H 1KBGH 1Y0LA 3DTXA 4OV5A 2BY2A 3KPSB 3MXVL 4GLRH 4G8FA 5I8EA 4OM0H 5SX5K 4FFVD 3VRIA 4ZS6C 3NGBC 3GI8L 4Q6YA 3KPSD 5JORB 2R4RH 3C60A 3MGOA 1RHHB 3L7EA 5IKCB 4JFDB 3QZWG 2BSRB 5SWZB 3N06B 4PTTB 1C5DA 1O5DT 3RHWK 1RZJH 3GBLA 2W0FB 3PV7A 1B0RA 4ONGL 1BREA 4PJ9B 4TTDC 1V7NH 5KS9F 5CSZA 3V4UL 3CDCA 1I3GL 4UV4H 1K4CA 5HHPA 2D7NA 3GMPA 3R4DA 5JDSA 4OLWL 4MJ5A 4YC2C 4NKMB 1B90A 2UY6A 4JKLA 2WIIA 1GZPA 1M7IB 1ZVSA 4Z7UA 4RX4A 4R96B 1YEGL 4RISH 4PJDB 1KJ3L 2KUTA 2QLVB 4OKDA 3SJVE 4IRSA 1HQ4B 1JNLH 1KIQA 1SY6A 1AKJA 3MROB 4PJAE 4OZ4B 4DKDC 5IEHA 3MUGA 5ALCH 5IP4A 4OCRL 4MCYA 2N7AA 1H3PH 4P2QE 1E28A 4WHYH 3UO1L 3GUTB 1FVCA 4RMTA 4S1QL 4QF1A 3H0TA 1IM9A 2B4CL 4UQ3A 4X6CB 3SGJC 1CD8A 3UJTH 1IAMA 4BJLA 1A0QH 4NKOA 2GT9B 1CU4L 3ZKXB 2CGRL 3QUYB 4NKQB 4N5EC 3ULUE 43C9B 2HT2C 5CLWA 3NIFF 1F8TL 1NCCH 3DI2B 2BVOB 1NAMA 3P0VH 3H3BC 1T89C 2NY5H 1EFXA 2P5WB 5IFHL 3MZTA 2XWBA 3N1MC 4K55A 4PJCF 2AJZA 2OI9B 3DMMA 5D1QB 3D9AL 3QUKA 5J3HC 5HHOB 3S35H 4JM2B 3VFPA 4RAVA 3HUJB 3VD9A 5GIRB 1H0DB 3N1FC 2HT4D 4PS4H 4H8WL 3D3VD 5EU6E 3CXHJ 1CFBA 4HS3A 3PDGA 4XVTH 4XPBL 4ODHH 4KTDH 3QQNA 3TIEB 4Z0XA 1KJMB 1OGTA 2ED9A 2O93L 3D18A 1C5CL 1A1NA 2BNRB 2O5XL 1RZ8A 3FO1A 1VHPA 2JJTA 2VLME 5LKNA 5EOCL 2APFA 2FSEB 4I2XE 3GMRA 2QHRH 4UINL 5KG9A 3ILQC 3EYQC 1AGEB 5D5MB 1LP9F 4KDWA 3WV0A 3WMSA 3DRTB 4WHTA 1RMFH 2ERJB 3ARDD 4LEXL 2E7LC 5BOZG 1Y0LB 3DTXB 5I71C 1S9VA 2FB4H 3KPSA 1M1SA 3TO4B 5D7LE 5HXMA 3LMJH 3ARWA 2FL5A 2HJLB 4LU5L 3OKEB 4MA7H 1F00I 1GL4B 4GBXD 4JG1H 3BRFA 4IJ3B 4PTTA 1P7KA 5I1IH 1FNLA 1AI1H 4G6AC 3MJ7B 2GSIB 5AAWA 4L3AA 3UYOD 5CD3A 2DQUH 1OGAB 4G6FD 1JTTA 2KZWA 2R23B 4FQPA 2ENSA 3DYPA 1MCRA 3GMPB 3EAKA 4U6YA 5JDSB 3EJZC 1SJHA 3JVGA 5E08H 2VLKD 4NBYB 3SO5A 5DGRA 2GAZB 1ZE3C 2VDKL 4PGDB 1HDMA 5EO1A 2AJUH 2WBKA 3M8OH 4RQQB 1YMMB 1VADB 1FL3B 5HYJD 3MOAH 1N8ZA 1PG7X 1N3NA 12E8H 5L7XH 3ARDB 2IPTL 2R15A 4G9FA 3QDJD 4M7ZB 1FO0L 1G6VK 5JO5B 4HS8H 5HYQA 4ZSOE 4WFGE 4KJPD 2JKXA 3B6SA 1VACA 3PWJB 3PXJA 1CDYA 3T0EA 4HLZH 2IPUG 1RJYB 1P7HL 4XPAL 4GW1B 3BVNA 1IM3B 3MV7D 2HN7B 3MZGB 1KF9B 1TVBB 1D9KC 2JK5A 4WJ5A 2NW2B 3QXDB 4XVUC 5DC4B 1JGVL 2VSCA 5EIQA 2AXHA 1EFQA 3O4OC 3UPAA 4IOFC 3WUWB 3D85A 4OLVL 3UTSE 4GRLC 4PRDB 1AIFA 4QCIA 1S7XB 4WTXA 1ND0A 2EIEA 2F54B 2PYEA 2D7TL 4BFEA 3L3GA 3TFKD 1FH5H 4U1MB 2GFBB 3AY4C 1J8HA 3LH2L 1ZAGA 4AG4L 2EYTB 3CVIH 3IDGA 1I8KB 3EIFA 2UY7A 2EDTA 4RFEA 5EU4B 3ULVF 2GY5A 3CXDL 1R3JB 1KC5H 3MRQB 4GW5B 5JW4R 3ARQA 5D2LB 4X7DC 3QG6A 4OLZH 4LPUA 4K23L 4H0GA 3V52L 1N5YH 4FFZL 3WL9B 3O3EA 3CXHK 2PXYC 2CSPA 3MXWL 1JZ5A 4KRMB 1IE5A 5DF0A 4HWEL 4FFZH 4GG8A 5EO9A 4FQQA 1XGTB 1IT9H 3MACH 3TV3L 4PJGE 5I1KH 3H2WA 2NY2B 3KWWA 2K9UA 3FT4B 2CR6A 5E8PA 5E7FA 3REVB 3OR6A 1EEZA 2O5ZH 2WWKT 1MNUL 1BEYL 1K3ZA 1KELL 3ZDZE 4K3DH 5ENWB 3F7RA 2WWMC 3IJHA 3RNQA 3NVQA 4PJHE 1QHOA 1NMAL 1AXTL 3ULUD 3RPKA 4OZFA 2ZUQB 1CLZH 1QLRA 4FP8L 4PGDA 4PJ5A 4OI9A 5BRZD 1XR8B 4PG2A 5IMKA 3VD5A 1ZT1A 2A77L 2X4SA 2R2BA 3D9AH 4ZD3H 2VN7A 4QHLB 4M7LT 3FRPG 3VJ6B 3WFDL 2E8ZA 3QRFM 1T5WA 4U0RC 5DWUH 2E8YA 3NIFE 2EYRB 1KIPB 4N8VA 5JO5A 3MO1A 5C8JA 4M6OL 5EA0H 4GH7B 4HFUL 2P8MA 4ONHA 1QO3A 1K3IA 5IWLA 2DL9A 1D9KA 3EJYD 2UV3A 2ZCKH 2IPTH 3HTLX 1AXIB 3UO1H 1JZ2A 3GMLA 4TNVF 5IM7A 5C07B 1H8NA 3BT2H 1P6FA 2VDNL 4OI8A 3R06A 4C83A 3RZCC 4M3KB 3GIVB 4YGVA 4LCIL 4YHYB 4QXGL 1YY8B 1MCEA 3CDGA 5EB9A 4IS6A 4PGBB 2R2HA 1Z3GL 2EEAA 3FB5A 1X5JA 3VFUB 1A4KB 1ZLVK 4J3XA 2D7QA 4YBHA 5JOEA 4HBCL 5A1AA 5A16B 1T0NB 4HWBH 4HCRH 3UYRL 2EC8A 1P4IH 3KPLB 3QEUA 5GHWL 2RIKA 1RJZA 4YDKH 3ULUF 1RZJL 1EV2E 2E3VA 1L7IL 5GJTL 3GB7A 1FFPA 3UTQA 2R69L 4XNQA 4KROB 3QQ3B 4WO4A 1FFRA 4NQVB 1FZJA 3CVHL 3GJFB 2APTA 1YEEL 4UILL 2HG5B 5F3BA 4JB9H 4GG8B 4MQ7B 3V9FA 4C56A 3VFNB 5FCUH 3VWKD 2EH7L 5IIEA 3WS6C 5E8PB 4PFEA 4MAYD 1EJOH 3D48R 3VXNA 4JM4L 3O6FC 4NFBA 4OZFG 4X4YB 4ZXBA 2E6PA 3U7WL 5EUOE 3VE0A 5DD5H 2I27N 3VCLB 5HDLA 2E9BA 3C5JA 5INDB 1A22B 4PJIB 3MLVL 2P5EE 4ERSH 1FIEA 3S35L 1KNOA 4Y0GA 4N8VG 1FLRL 4NCC1 3T0WA 4R97B 2C3GA 3H7BA 3ZKMC 3N9GL 1D6VL 2DD8H 5EBLB 4I3SH 1BGXH 3ARGB 1JL8A 2YWZA 1RULH 1BFVL 4LFHG 1RZJC 3DXAB 5E2WH 2HT3D 4L4VE 4MNQD 3T09A 3BEVB 3NCJH 3LCYA 2FH6A 3HE6A 3HC3H 3IS0X 5KZCD 5DJAA 4F57L 3ZE2E 4P5MB 3DV4B 3FT2B 5A3ID 1OHQA 5HGDB 3ZHLA 2YPLB 3VGAB 5DC9B 4H20H 1KCUH 3MRJB 1K5NA 1CQKA 1JNLL 2GSGB 1JWSB 4DAGL 3BIBX 3HNSL 1D5XB 4K71B 5EIIA 4LLWA 5D1XB 2EDXA 2LTQB 1PQZA 4GRWB 2VXUH 5E9DA 3VWJB 1HI6A 3CSYB 3BP4B 4GMSL 3U46A 3NCYS 4K7FA 4TVPL 5GS0L 3ZDXE 3KPRA 3NPSC 5BMFL 4J6RH 5AG9A 3S34H 4OBSA 5DD6B 3NIDF 2XA8L 4PIRF 3MCKB 4RGMC 3NACL 2AEWA 2ARWA 1SYVB 2O5YL 3HE7A 2QSCH 5IMLA 3GBNH 1PX4A 1EERB 2QV2A 1RURL 5KVFL 4YDVA 2PYFA 2E7LA 3CCHA 4XP9H 5J13B 1KLFA 4LP5A 4BSWB 4X4MA 1JRHL 3ULSA 4IOIB 5GRVK 1PKOA 4OIIH 5DJDA 1LP9B 3WNOA 3LQZA 3HB3C 4RA3A 4GG6A 2DBJA 5SWSA 3H7LA 5DMIH 4UIKH 4IMLA 4Y8DC 3NTCL 4UU9A 1NGZA 2V5TA 3ULVE 3BP6A 2X4RA 2XG5A 3VXNB 1IGJB 2PO6A 4JQIH 1A7QL 2X1QA 4OGXH 4Q0XL 1LO3H 2A1WH 3PGDB 2CXGA 4MS8D 3BUTA 2OCFD 2Y6SD 2FJFB 9CGTA 5CFHA 1I9RH 1CFVL 4U6TA 3L7FB 4RIRB 1AO7D 2ZPKL 4Y4KA 1YDPB 2ZCHL 1MUJA 4P2RE 3TT1H 3GMOB 5DR5L 4Z95H 1JGDA 2VXTH 4M62L 5HDQH 2GI7A 4KI5D 1R5IA 3L95A 3RVUD 4JO4H 1DZBA 2F5BL 4L9LA 3CMOL 4XXCC 1JZ8A 1AHWA 4W4NA 4X0KB 4Z0BL 4F2MA 3ARGA 4BQBA 4PJGF 3KPOA 5IB5A 1EMTL 4GRMB 4NSKA 4EEEA 4TVSa 4G9FD 3MRMA 5EORL 3W39B 1BIHA 1OQXA 1OL0A 1MJ7L 1YYMH 3VGGA 3TLRA 1BECA 1G0DA 3DX9B 5C0GB 5C0CB 4OQTA 1N59A 4NKDA 4WGVB 1GOHA 1ZS8B 5FKAA 3QXWA 3BP7B 1WZ1H 3FKUS 1ZLSH 5FF6A 1FFNB 1YN7B 5L6YL 2DIAA 3GFUA 3PV6A 3TESA 4QHMA 2D7MA 3OB8A 4Z5RB 4NWTH 5JR1L 1IGTB 1JWSA 3MBEC 4QOKD 4UNTA 4MGXA 1NC2B 4PJGA 2PTVA 5D1XA 4MA8L 2FBJH 2ADJB 2A6JA 3O2VL 3EYQD 1MCKA 4JPWH 3W5NA 2V2XB 4F33B 3B8YA 3TO2B 2Z4QB 3AAZB 3IVKB 2X89A 3LKPB 1JWMB 4PRPD 2I9TA 4I18C 1BMGA 4BA8A 5I1GH 3OXRA 5E2JA 1NUGA 3BZEB 4GAGL 1IMHC 4HMEA 3RDTD 4PG9B 4G8GB 4HHAB 5IJVB 3RGVC 3WFCL 2QQKH 2CUMA 2ZCLL 4WUUB 4WY7L 32C2B 5JIHA 3DX6A 2F8OA 1JYVA 2FDBP 4QHNB 3UTPE 4XNMB 5SX4H 4JM2D 2Q87A 3SKMB 2F53B 4JQVA 4GG6B 3DPBA 5SWSB 4F80A 1MCPL 1ZK9A 4NO0D 2X9YA 4N9OB 4PBWD 3SQOH 1VESA 2E7MA 5DI8B 1AD0B 2YUZA 4X8JA 1CK0L 1AFVH 4EOWH 4KVCH 3WD5L 4G7VH 3IKKA 4KTEL 5E70A 5FYLH 1LO5A 4OCYL 3QUYD 3ZLQC 4AL8H 3MLPA 4Z7WB 3EOYG 1CFNA 4UTAH 5EBMA 1D5IH 4FQHB 1PYWA 1PBYA 3DGGA 3WJJC 4YDLC 4P23D 4OIBA 3SKUD 1BVKA 1S5IL 1LE9B 4JQXA 1JUFA 5DJ8A 2OJZH 1U58A 5I75C 1N6QH 4P3CL 4Q2ZA 4QRSA 3ECBB 2G5RA 1G9NL 2MPAL 3MRMB 2BCKA 3LN4A 3RPIB 1GVIA 3WKNA 4ZNCD 4NM8H 1DQMH 4GAFB 5I9QC 2AJYL 5FO8A 1CZ8H 1AH1A 4JAMB 4YBLC 1CLOL 4OGYL 1JZ7A 5A2KH 3IJYB 2X4PA 5IOPB 3LHPL 4KI5F 4QY8A 3AU1A 2ZNWA 1HOCA 3KYNB 4MX7A 4YDIL 1ORQA 4YH6A 3BKCH 4D0BB 1PJ9A 5ESAA 3L3DA 3TEUA 2FECL 5T33H 2B5IC 1N7MH 2ADJA 1TITA 4M1GH 3V5KB 3ULUH 4KPHL 1NSNL 1WGOA 1MFEH 4X7FC 4UOJA 2V2XA 1G6RH 3T77B 4ZSOA 3MCLH 1PAMA 2HA1A 1BQSA 2FNBA 4E5XB 4HV8B 4QRRA 5EC1A 1FHGA 1T1ZB 4NZTH 1JWMA 2VKWA 4UV7H 2I9TB 3BKCL 3BPCB 1NBVH 5EUKB 1CGWA 1NL0H 3TNMB 5ISZD 1PKQB 1NBZB 3IDJB 5DA0B 1DBKH 3HUJF 4JO3H 5DA4A 4FQCL 3FOLA 5C0AD 1DQJA 4HKBB 1FRGH 5FYLE 3KPNA 3UTZA 3T08A 4FFWD 1NGYB 1F4XL 4YXHL 5JDJA 4UT7H 4NM8L 2HT2D 4Z9KB 1S7WA 3HE6C 1O7VA 5JPNB 2F53A 4C4KO 1PG7W 2AJ3A 3JWDL 5I74C 1N0XL 4X99B 3MOBL 4GQ9L 3HNVL 43CAB 1FV1B 4NP4H 1LEGB 1YNLL 4R90L 3LKOB 3PWVB 4LEOB 4KKAC 1DQDL 5DSCB 4NQDB 1AY1H 4QRPA 4ZMAT 4FXLA 4OCYH 3M17B 3EFFB 4JZOA 5I1AA 4PJFA 4G6MH 4OD3H 3QULB 4MD4B 5IB2A 4NQCA 2X9XA 1W8OA 4ZG1A 1IAOA 2J8UE 2YC1B 3NFSL 4MA3B 4YFEA 4YHZL 3V6ZA 3STZB 2W9LA 2ESVD 2BRRL 3R0NA 2QADC 1DLHA 5C0JA 3C6LC 2PF6A 4MQTB 3BPNB 4Q2ZB 1RD6A 2PTTA 3G5XA 4XRCB 4RFOL 3SDCD 3QP3A 4MJ6A 1XT5A 3IAQA 3RHWF 2H26B 1WSST 1SEBB 3G6JB 4GKNB 1FN4A 1ADQL 2ZCLH 5DJCA 2KH2B 3DUSA 3JWOL 3BX7C 5IR1A 1G1CA 1A3RH 4NPYA 4G42A 3SCMB 2BMKA 4RWYL 5I8OH 2ZOLB 4HXAH 4I48B 1FG9C 2XN9A 3TBSB 4MX7B 1M7DA 3MYJA 1DBML 4JPVH 1PG7H 5DVKA 1S78C 1QRNB 5ILTH 5GS1B 2PKDA 4NUJA 3CU1A 1WK0A 1F97A 4XPTL 2UZIL 5IEKA 5MEOB 1SJXA 3QCUL 2V2TB 4JPWL 1QFPA 3CX2A 1X4XA 1CGUA 4HUWA 1A6TB 4PJIF 3TA3D 2HLAA 2CUHA 4YHPA 2NLJB 2K1MA 1IGFH 1V3JA 2HTKD 3OKMA 3RIAF 2JJUA 1NANH 3QUXA 3IDJA 4OZIB 1H3VA 1FCCA 3MNWA 2ZUUA 5FUOH 4D2NA 1U42A 3KPNB 1VFUA 1T5XA 1TZHB 1KIRB 1ITBB 3X3GL 1K4DB 4KK6C 1YN6A 3UTSD 1LK2B 4PJBE 4PY8I 1RK1A 2Y06L 2YPVL 4OM1H 5I1HL 2LAGB 5JW5A 4L4TA 1R3LB 4JY5H 4WFFD 4EI6B 1DL7L 4ZFFB 43CAA 2RB8A 5CZKA 1J8KA 3VGFA 3L6FB 4TSBL 3RDTA 4BQ9A 1Q9LB 4MNHA 2IG2L 3ZDYF 3GI9L 5E8EA 2VABB 2K7QA 3X11A 4Z6AT 2DWEA 5DQDL 4Y4KC 5IVZA 3IGAA 4CN4A 4BUGA 5ACZA 3EFFA 4YBQD 5BOPA 4DTGL 5DUMH 3S35X 4X6DA 2N1KA 4WTWA 2ICWB 3VRJB 1EBPA 1IAOB 4AZ8A 1UJ3A 4J3OC 3V6ZB 4PJHF 5GGUA 1NCWL 2YWYA 5ISZA 4QRRD 3ZDZF 1OAZL 3B4NA 1J1XL 4XPFH 2ZKHL 1DQQB 1OAKL 5ICXA 2H26A 3MUZ1 3Q6GL 1OTTD 2X4QB 4EDWL 1JNNL 3DUSB 2CLVB 3VD3A 1SBBA 2CPCA 4YHZH 3CK0L 4AM0B 5LXGH 4XP6H 3K81A 3OJVC 1FFOB 4KJPC 5LGKA 2XZQL 5HGGS 4WFGD 3OKLB 2A83B 3CFIC 2Y72A 1Q8MA 2AKRA 2X7LA 1SVCP 4ENEC 4K7PY 1F4AA 3CC5A 3EO0A 3GSQA 1UT9A 2Q8AH 4OZIE 3VW3L 3FQTB 2CIIB 3QXAA 4J4PC 3GSUA 1I7TB 4RNRB 1Z6JT 4RGNC 5B39G 3DUUA 3HPLB 4LF3A 4OLUH 2G60H 2C7UB 1VGEL 4O4YH 4K2UL 3I6KA 4YHML 1OW0C 2C9AA 4NP4L 4E41A 1J0JA 5D8JL 4TSCL 4ODSH 1RJLB 1BJ1H 4D9RD 4NQUA 1IGYB 2PXYB 5BW7C 5D96B 2BVQA 3GMQB 1DUZB 4XP4H 2FJGB 2DQFB 1A4JA 1QRNE 4YEFA 4F57H 4FQCH 1A02N 1T89A 4DGIH 1WTLA 5BVPL 4U1LA 2IAND 3HFMH 2NTFA 1T4KA 3QFJD 1AR1C 1F45A 1PZ5B 4XWOD 1JF6A 1CD1A 2AV1B 4EI6A 1CFSB 2EDWA 3QDJA 2H8PA 4UUJA 2NZ9D 5ERWA 5J9PA 2NCMA 1T1WB 3EYOA 2V7HA 3EO1B 4PRIA 4K94H 3QEQA 2PW2A 4K3EH 3MOQA 3LIZL 2J8UA 5DZLA 5ISZE 1HH9B 3MLRL 1W0WA 3HA0A 2JJTC 4WV1B 1HNFA 5T3ZL 4YR6B 4U7KA 3LSOA 2IJ0C 4PJ9D 3DVNB 5EZOL 2NXZD 5A2IH 3O8XA 3QWOB 4EQ2A 1UGNA 1Y6MR 2CIKB 2DQHH 4FRWA 4X6FB 1CWVA 3PHQB 3HZKA 3ZKMD 1SM3L 1MIMH 4WO4C 1C5DB 2AK1H 2G9HB 2AI0H 5ICXB 3UP1A 3O45A 5DLML 4YC2B 1ZEAH 5LQBL 4P3CH 1KXTB 1B0RB 4CVZA 4U1GB 3SPVB 2VKXA 1IAKA 1UYWH 4YK4B 3K1DA 3QA3A 3UDWA 4OJFL 5I2IB 3B2UD 4RA0C 4F15B 5D72H 4DGYH 1CVRA 5DEFB 1CL7L 3L3IA 3U4EA 1WWBX 3F6IA 2AGJH 2P1YA 2JIXB 2Y7QB 1ZVSB 3GSQB 4JANA 1P69B 5F7YC 1K6QH 1IILE 1I7TA 2AEPL 3HAEA 2R29H 4JHWL 5BZWB 2WUBL 1CD9B 3U48A 4DVRH 1GC1L 4MHHI 3Q6GH 1OAKH 4K8RL 5FEBA 4DKAA 5M95B 4KAQL 1OAZH 4S10A 5I8EB 1MCPH 3G08A 3VMNA 3TO4C 3QFJA 2VDNH 4QF1B 4LVEA 3RWEB 2J5LC 5E6IC 2B1HL 2AS5M 1I1YB 2YXMA 4EI5B 3KR3L 2DQJH 3VXMA 1NLBH 2DTML 1NGWA 1AO7A 1S7QB 4OFYD 5DUML 4NHCL 2B4CC 1BZ7B 1NCAL 4K07A 2X4UB 3INUH 1EEYA 4WFEE 5D1ZB 4LHUG 4LLYB 2XRAL 1S78D 5C7XL 3RX8A 3G6JE 1RIVH 4YHOH 3VXPB 4U2ZA 3BRDA 5I1GL 2VXSH 5GRYA 5GIRA 4KQ3L 3AY4A 1TZGH 1EZVX 3AFLA 5ADPH 1FNSH 5L88H 3GNMH 5GZOD 4XVSL 5C08A 4OCNC 3PWNB 4OZFH 4LKCB 4P2OC 1HQ4A 3VXMD 4PLKD 3O9WC 2GJ6D 3GKWH 1MWAH 5F1SA 2A9NH 1QACA 3D0LB 2LU4A 4A2MA 3GMRB 3TN0D 4I77L 5TDPB 3ARBB 3DI3B 4G6JH 6FABL 1JV5A 3P73A 2RFXB 5EH1A 3I75A 3FRPA 3F5WA 4UQ3B 5GPRA 4LSRH 2V7NB 4WWKD 1H15A 4D3CL 1AQDB 4XXDB 3QPQC 4O51B 4KJWD 5ID1A 4P3DB 1HQRA 3P9LB 6FABH 5C6TL 3C60C 4K3JH 3F8UB 3GSVA 2J5LB 1F6LL 4O2CA 5DD3L 4WW1B 3WIFB 3ARYA 3QT2A 2V5SA 4FMFA 5EORH 5D1QD 4LLQB 2Y5TB 1T7XA 2GSIA 3R8BB 4PY7B 4CVZB 5LGJB 5AWNL 5C07D 4XPTH 3ILPB 1RJCA 3QA3B 4OLZL 1I4FB 5CEYA 4R2GC 5C09B 3G5ZA 1TJIL 2VXSL 5GZNC 1UZ6E 2VR9A 5ABDE 3CXDH 3TVMA 1RIVL 3IDMA 3O6FA 3TZVB 3NA4A 4YQXL 2HKFH 2JIXA 2EIBA 4P99A 2Y7QA 5CBAB 3E6FB 1SJEA 3SE8L 4G8GE 5I8OL 4HWBA 1U92A 1NFDE 5K9JH 5CKAA 2Q7YA 2X1OA 3FB7B 1C5BL 4O9HL 3Q5OA 1JFQL 3BKMH 3QHZL 2H3NA 1DQTA 1ZHBB 3TO4A 3T3PE 4ODVL 4UIKL 4UIMB 1IC5L 1VACB 1IGIH 4MAYC 4YHKL 3RWEA 3SE3C 2ZOKB 4JFHE 3DWTA 5C0DA 3NFSH 5E94B 2W92A 4WW2B 1KCRL 1T0MA 2HH0L 5ID0A 5IG7A 3WXVL 2VQTA 1QKZH 2Q86A 5CBEB 4ZTOH 1GC1H 2JB6A 4WHDA 3HZVB 4GT7A 1DLFL 3KPMB 3WHE0 1BHGA 4HGKC 1EEYB 1MHPL 1OP5K 3Q5YA 1DQDH 1ZT4B 4O00A 4MD0B 4P46B 3OAYK 3BUYB 3PWLA 1SJHB 1BJMA 4U1MA 3U6RA 4U6XA 5L0QB 3RY6A 4KZDH 4XCFH 3NCCB 1YMMA 5C08B 1BJ1J 2DDQL 3PWNA 2XT1B 3L3HA 4GW5A 3PQYA 1WFUA 4C56D 4Z8FH 3REWA 1X4ZA 4MXVE 4CADA 4JRYA 4KK9C 3I85A 4HUXB 3JTSA 3Q2CA 2ED7A 3T0EB 1INEH 4Z7WE 4H25A 1AE6L 2NY2C 3IFNH 1KG0B 2V7NA 4P2RB 4Y2DA 3UTTA 1YMHA 2XFXA 4KXZH 1HQRB 4P2RD 3OAYH 3D85D 2IQ9H 4KI5C 5FA3B 1JGUH 2JCCF 3LPFA 1UEYA 1CGVA 2C4FT 1ZGLP 2EXWD 4XNZC 2H32A 2IANE 2C4XA 2IALA 4PGEA 4GG6E 5CEXB 3REVA 2Y5TA 4PY7A 2ICEB 5ETUB 1TJHH 1MFEL 2PYEB 3SDCA 5IJKC 1KPVB 2YD8A 1U8QB 4KPHH 3RU8L 4EUPG 4I0PA 1LE5B 5EOCH 2OMBA 5I30H 3RY5A 1LEIA 2ZJSH 4RGNB 4XB7A 5C09A 2Z31B 1HKLL 1U93A 3C2AH 4U1SB 5EU4A 1XH3A 3TM6A 4DW2L 1PW3A 2EZ0D 4P23B 3MRQA 4JFFD 4HKZB 5GXBB 3WUZA 4B41A 1LDPH 1ZT1B 1UM4L 1C16B 2E7BA 5FV1L 1XF5B 5TQ0L 5HVHB 5DD5L 5I73B 3VRLF 2UWEB 2XTJC 5JOPD 1EUUA 5K9OA 4H26A 5JHDA 3P4OB 5CP3H 1QTYT 4H8WC 2VXVH 5F89B 2NYYC 4OD1L 4P46D 2MQ0A 1TNNA 5E9DE 3JWDC 5F21B 4PLJD 1VFMA 5BRZA 2JB5L 2DL2A 4JREC 1F3DJ 1OARH 5I1LB 3D3VE 5ID0B 3DGCR 4MJIA 4HAFA 5E4EB 1C12B 5KJRL 3BMWA 1E6OH 4WDIA 1KFAH 4ELMB 1KUMA 2YA2A 3MBXH 3GMLB 3F12A 2NY6D 3BXNA 4MMZC 3MSPA 3SGEH 4HAGA 5B39A 4Y4FD 3B9KA 4QHUB 5BO1L 2GITA 4F37F 2IPKA 1DR9A 5ENWA 4PGBA 2P43B 4RMUA 2HVJB 3FB5B 4FS0A 5C0CE 5J1AB 5JZ7D 1MH5B 5I16A 4X83A 1HXYA 3U6RB 1CT8B 4U6XB 2IEPA 1T80A 2QQLH 5J57B 2R0LL 3I6LE 1CE6A 2X4SB 4L4VB 1BVLB 3L3HB 3S3JA 5CJXC 2ATPA 3MREA 1WBZB 2AP2A 2VO5A 4KJYB 3O3AA 3MO1B 1A3LH 4WY7H 5I66A 1V7NL 4UDUA 4YIQB 4WU7B 3T3PF 4G6FB 4NNPH 3WFHB 2VDLL 4H1LA 2X4OA 2W65B 4ONHB 2ZCKL 5SWQA 3VXSE 2Q3AA 3MLTA 4GAGH 1MLBA 4P2RA 3RVUC 5JPMA 1FE8H 3LS5H 4P9ML 1VB9A 1AXSB 3S36H 3G5YB 4H0IA 3VFNA 3GSXA 3KJ6L 3EYVB 2GJ6A 3QDAA 3DRQB 1HHHA 3BOVA 1GHFL 4OLXH 3PGCA 4PRNA 1MVFA 5DMGC 1T2XA 4XNZB 3O2VH 4OFPA 3VMPA 1U8QA 4ZUVA 4TQEL 4WIQA 2A77H 5DJZA 1W72B 5DRNB 4P0DA 1IM9D 4FXGB 5HVWA 4FN0A 1U8HB 1LEIB 4KQ4H 4RZCA 3L9RA 4NWTL 4MLIA 4XXCA 1CXHA 5I1HH 3G6AA 4ZFGL 2NY1C 3T0EC 1F58L 4ALAH 1XFPA 2EDOA 3VGHA 1LO0L 1RJZB 3CMGA 1MCIA 5TQ2L 3WHXA 2C3VB 5T1DL 1I3RB 1CGTA 3HE7C 4H5SA 3QUMA 4N1EA 3LRGA 3RKPA 3ELAT 5GRUH 4IIQB 4LCWB 1PEWA 1KJ2H 1OAYL 3TPUB 5D2LF 3U7AA 3LDBC 3FFCB 3O3DA 5F9JB 2AVGA 3CMOH 3VFRB 2JELH 4X7SL 5L2KB 4LFHD 1BVZA 2MHAB 1AGCB 1CDCA 2M2DA 4KKAD 1N5YL 4ZXBB 4X4YA 2R2EA 1EO8L 1O7SA 4WWKB 5BVJB 2YPLE 4K23H 4XCNA 5C07E 4KK8C 5IMMA 3LRHA 4LDEB 1ZANL 3C5JB 4U7SA 5INDA 3O6LL 1FGVH 3GM8A 4MNGE 1TPXC 1MJJB 2A1WL 3QFDB 3ARVA 3QNXB 3X17A 3QCTH 4KMTL 4MDJA 3T04D 1NLDL 4G43A 3CVIL 1AHWC 2F8XC 1GGTA 3OR7A 4HIHB 2A6IA 1A2YB 1ZXQA 3P77B 3O9WB 3VD4A 2R4SH 2ID5A 3QO0B 1HINL 4WFHD 4RMVA 5F7LB 5IHZB 3BEVA 4KKCC 4O58L 5B3JE 4UDUB 5K9QI 1UCBH 3V0AC 3WN5A 3RWHA 4WTZA 3U9PH 4PJHA 4JKMA 3HZMB 4W6YB 1U6AL 1VEMA 3O6KL 5E99L 4G6ML 4PBXA 1KTKE 1LP9A 1NQBA 1QFWI 4JFDD 2A74A 3DSFH 1W72L 1U36A 3JUYA 1IVLA 4U1NA 1IC7H 4UU9B 1G9EA 1NGZB 1B6DA 2IBZX 1IGJA 4MJIE 4Y5YB 3VWJA 4HT1L 3IRZA 4F37K 4PJ8B 5FYJD 4ZNEA 1KEMH 3EDFA 5FFLA 4JN2A 4RIRA 5I1CL 5TPWL 4UQ2A 4N8CL 4PRHA 3OTTA 4XNYH 3SKNA 3EDJA 4M1CC 2WANA 2UUDH 4OV6F 1W8NA 1HSAA 4ODTH 1A14H 2J6EH 2CK0H 1JPGB 3MRFB 4NDMB 4NBZB 5E6IA 4H20L 5ITFB 1GGUA 2RQ8A 1ZHLA 3VXSD 3KYOA 3BFOA 4IRJD 1WICA 2EDEA 4XNUL 4X0KA 1IAIH 2DYPB 1HWGB 3G04A 4HUMB 1BWWA 2BVPA 1G6RA 1U8IB 2CMRL 4K8RD 1J8HE 1WTGT 1AKJD 2AJSL 1KGCE 5I6XB 1IC1A 1N59B 1QUNA 1MCWM 4CBPA 3BD3A 2UZXB 1T7ZA 4UT9L 5F9JA 4CW1A 5KAQG 3RL2B 4KMLB 1BZQK 2F19L 4PJXB 4ELKB 3VFOA 4POUB 4JE4B 3TCLB 1G7QB 4MD5B 3CVHA 2F58L 4P57A 5T3XE 3K4AA 1KB5H 4ZUSB 1EIBA 1T21B 1F6AA 4HC1H 3ULUL 5I8KH 1JE6A 5B22A 3KS0J 2FR4A 5MEQA 4Y4KB 2YZ1A 5E95B 5KZCB 4HBQA 4M5YL 4YUEH 4XVUD 1A64A 1QSEB 1R5IB 3U0TB 3CSPA 2AERT 1JHLL 3Q1SL 2MCG1 4RGOL 5D7KD 4HH9B 3T65A 4LGRB 3T3ME 5TGBB 4MQXC 1OTSC 2BHZA 3EJZD 4UILH 2I26N 4L5FH 3I3BA 3C5ZA 3BSZL 5I19L 4LVOB 4LSUH 5T3ZD 2VDPL 4E42A 3DVGB 32C2A 3MMEA 1CU4H 1UB6B 2J12B 1S5IH 2R2CA 1MCJA 2VDRH 4OKVB 3QIBA 1F4HA 2NY0C 4HIJA 3NZHL 3LKQA 3T8XA 4FFWC 4XAKE 3UBXI 1MY7A 4J8RA 1KPUB 3W9DB 5D1XD 4DUWA 1OB1B 5B38A 3S88L 1NGPL 1H5BB 3QAZC 1IAIL 3RWCB 1C1EL 3SBWA 4HCRL 5DMKA 5GRJH 2KL6A 2PUQT 5F3HB 2FD6H 4DFHA 4I0KA 1EGJA 1NC2A 3I6LD 4KJQD 4PJGB 1CFQA 1AD0A 3KVQA 1QBLH 1NEZA 3U36B 1FNEB 3W5MA 5JHDD 2B39A 3HZYB 4XNYL 4ZFOB 3QHFL 1U9KA 3E6HB 4GKZB 5D7IE 4Q9QL 2YD7A 4LARH 2DS4A 5DJ0B 2IFGA 4PTUB 4GKSA 3M1BB 4M6NL 3KLAB 4B50A 2DYPA 3BO8B 2V6HA 1UXSB 4Y4FC 4G8GA 2D31A 3RWDB 4JHAH 2MOVA 1C8PA 2VDPH 3LEVL 3KGRA 1CBVH 3F7VB 1CXLA 4ETQB 5FGCB 5GISH 3A67L 4XH2A 5EU6B 1A3QA 2YN3A 4M9OA 5DWUL 2R4RL 3O4LA 3UBXG 4U1IA 2HWZH 1I3VA 2VITA 25C8L 3BPNC 4CW1B 3MXVH 4WGWB 5DK0A 4P46C 5BV7L 1HEZB 4X8JB 4FP8H 3NZ8A 4ZS7L 1YUHA 5JUEL 4EN3C 1T21A 1ZSDB 1AD9B 3OF6D 4PV8B 2G2RB 3Q6FA 3V5KA 5D1XC 4IDJL 5AYQA 1DVFA 4X6CE 1ZGLA 1KCLA 4ZSOB 5I8KL 2K7PA 3B2VH 3TT3H 5EC1B 1QSFD 4POZC 3CFCL 5HI4D 1R3HB 1LE9A 1HE7A 2J8HA 3QRGL 1BD2D 4PJFF 2LV4A 1JVKA 2VUYA 3MXWH 5KN5B 1XCTB 1DQLH 1UWXK 4LIQL 5CJQH 1R24B 1OP9A 4PJDE 5B38G 4D9RE 1FNGB 3KPRD 2EC9T 2EH8L 3G6DL 1T0PB 4CVUA 5ESQA 1KJ2L 1OAYH 3QNYB 5E56A 2FJHB 4JZNB 5EOTA 5ELIA 1OGAE 4XNUH 4XP1H 3TNNB 2D03L 1CGSL 4ZFOL 2C1OA 2Z8RA 4Z95L 5INCA 3B9KD 3W2DH 2BSSB 2AJ3B 1OSZB 1A14L 1NMCB 4KWUA 4TUJA 1I9RL 1FVDB 5GSRB 4LMQE 3ALWA 5D7LB 4XWGH 4UT6H 3NPSB 2DJUA 3SGDI 3V95A 5I0DA 2GKIA 3I6GB 5F72S 4QEGA 1K2DA 4QRPB 1UB5A 3NTCH 3GGWB 3PP3K 5FM5O 2RR3A 4PJEA 2LTQC 3M17A 4P2YA 4PGCB 2OJEA 5DJ0A 1DEEB 2ADGA 2KKQA 1CXKA 2Z91A 5C0AA 3ARBC 3KDMA 3NH7L 3E2HB 5KVEH 4DEPB 5FKPA 4PJ7F 3C5ZC 3O6KH 4JY4A 3FOLB 4C54A 15C8H 4G7YL 2J88H 1HHKA 3GBNL 1MCOH 4HKBA 2FWOA 4R4FH 4DCQA 5IF0A 5JLZA 5HTSA 5AZEL 1HHGB 1M6OB 3NCYP 1S9WA 2OTWA 4HMDA 1S7WB 4Z7OE 1HINH 3OKKA 3QDGD 4XBPA 5DT1L 1AQKH 5IR1B 2P5WE 4J6RL 3ULUC 4X99A 2ZOLA 4M5ZL 2X41A 3V0VA 1HEZA 1MELA 3HMXL 3MRGB 3S8WA 3LZFH 3NZ8B 5EFIA 2WNGA 4TVPD 1WCBA 3FN0L 3VFVA 3FB6B 5M94B 2F5AL 4A6YH 5JXEA 3THML 5CJBA 2Y25A 4MVBC 1LHZA 3VWKC 3W82A 3GMMA 1ZANH 3RVXC 3MV9D 3S97C 2E9IA 4Y5XA 3QDMA 5EU5A 1NGQL 4P2QB 1I1CA 2JLLA 3NIGE 5FYKD 4GRWH 1T66C 2XN9D 3IKCB 5MEPB 1D6EB 4YHPB 1DBBL 1MCCA 3P11H 4X7SH 2NXYB 2EEDA 4LU5H 5DRXB 1I7ZB 1WC7B 3PWUB 1J10A 5FM8A 4LEXH 2IBZY 4OFVA 4RFNC 4OZIA 4MXWH 3O0RL 4OF8A 1KGCD 3BWAA 5F6IB 2DD8L 1J18A 3WDIA 1V05A 1BBJA 5JTWA 1NAML 3H8NA 4TOYL 4NPYB 2XWTB 3BH8B 4V2CB 1A6ZB 3ARFB 4YO0B 1GC1C 3VH8B 3SCMC 5SWZE 5HDBF 1EEQA 4R7DB 3MV11 4F9PA 2OL3A 1CS6A 4ZUTA 3U7WH 2ZUXA 1QFOA 3QIUD 4TQEH 1A7RL 1IKNC 2V2TA 2HJFA 1B4RA 2VIRA 5D2NE 5TDOB 2NY7H 1UB5B 1EGJH 5E7BA 2MFNA 1CE1L 5CD5C 1Z5LB 3OKOA 3IGAB 5ACZB 1UKTA 3ZSSA 4U1HA 5C71A 5F7HA 2NZIA 3MRKB 4JVUA 3U0PB 4JFYB 2Z8VC 4CJ0A 4DK3A 3S36L 4JFQB 1YEFL 4NRXA 1J5OH 4P9MH 1MSPA 4JKKA 5D71L 1BQLL 3QB7C 5GGUB 3QIBD 1JGUL 2AQ3A 4TUOA 5GJTH 4EIGB 3NN8B 4S1QH 1DBBH 3CAFA 1QFUH 4R0LA 4GS7B 5KW9H 1JNJA 3KG5A 4YDKL 1Z0MA 1H3PL 2XXMB 4MYWB 3AS3A 1ONQB 2OYPA 5HY9A 4IRJB 1RK1B 1X5KA 3LOWA 5CSZB 4EQ3A 1YEGH 2BVEA 3JV6B 5LCVH 4Z8FL 1D5BB 3X3FH 3QG7L 4ZOEA 4DUVA 3WLBB 2QQLL 3L6FA 3OKLA 1EX0A 2P7TA 5GGSA 1EBAA 4E0RA 3HMXH 3SN6N 3CC5B 3EO0B 5FUCC 4UV4L 3CFKA 4JO2L 3FB6A 8CGTA 2BY1A 1CF8L 2VZUA 4QRTB 3OX8A 3P9MB 5C0AE 3SDAD 3DUUB 3HPLA 3L3KA 4I5BA 5DTFB 2I07B 3KAAA 4P49A 4LRIA 1Q9KB 4NO3A 5F7KC 5D96C 4Y7MA 1P9MC 5EUOF 4Z76B 3VXUE 1N5AB 5SV4A 1MCOL 2I24N 4R4FL 3TGXA 2PW1A 3NCMA 1OARL 1IM9B 4YHIB 1IGYA 1WFOA 2PXYA 2LAAA 1JPFB 3D2UA 2BVQB 2C3XA 4FQJL 3TIDA 5FAAA 3M45A 1IEBA 4LRNH 4KV5F 1KBGL 5C3LD 1QLFB 5IBLD 1F90H 1N64H 2H32H 2GJJA 2P5WA 4X5XB 3WIHL 1I1AD 4ODBD 1RK0A 3OAUL 3QIBC 4JY6A 1UM4H 4Q97A 1MEXL 3CFBB 1UC6A 2IGFH 4BUHA 5GRZA 4XWGL 2AV1A 4P4KB 2NXZB 4NKMA 3GSNL 5FGCE 1T1WA 5EU3B 3B9KC 3HNTL 4K3DL 1LMKA 5FGBA 4PJDA 3GSUB 1RUAH 4QWWD 5BZDA 4DN4H 1JPSH 5IVOA 1MCBA 3JUZA 3BN3B 1KIQB 2YMXH 4ODXA 4OZ4A 2VE6B 3PWPA 2C7UA 1F4WL 4DZ8B 1CG9A 3FQXA 3K80A 2KZ1B 3H9SA 1VERA 4YR6A 4IRSD 1G9MH 4QT5B 3F7YB 4NM4H 5D7IB 2IQ9L 2VN4A 3MRRA 3SKOA 3IU3B 2VLJD 1QOKA 2C5DC 5I71B 2Z93A 1LK3H 5ANMB 3QRGH 3VGAC 5EULV 3GSWA 2OTPA 2E27L 4R0LC 1NEZG 5DRZA 4R0LB 1NCUA 3X14B 2V17H 4D3CH 4KGLA 1SVZA 1G7IA 3L5WA 3LKRB 2XN9E 4OSUL 2YD9A 5E03A 1KLUB 2HRPL 3GEWB 5HI5D 5EZLB 1IFHL 5HHNA 5I8CA 3FTGB 1ZLUH 2I60L 2N7BA 1A7BA 4N0UA 1QP1A 3TVMC 2AXGB 1H8SA 5GSVB 1G7JB 2YOCA 2YD5A 1YJDH 2DDQH 4N0RA 3O2DL 2BHYA 4N68A 2D7TH 2DQEH 2PTUA 2P8LA 1CLCA 1QA9B 5DT1H 4NWUH 3RQ3A 1I1RA 3CFKB 4U0QB 3GNML 2VH5H 2NY4B 3HAEB 4JFPA 1ZA3A 5AZEH 4M7JL 3WKML 4UDTB 1JGVH 1IZJA 4NQCE 5HJ3B 3K74B 4YHOL 5DD0L 2RAMA 3ARDA 5DC0A 5B21A 5FHBL 1QSEE 4YFDB 5F7NC 3ARPA 3LEVH 1FORL 3VI4F 1A7OH 2EYSA 2YD1A 1CTNA 3GM0A 4WFFE 1KCRH 4PR5B 2YZ8A 5EZJB 5FGRA 5DO2D 3ULVL 2R1WB 3T2NH 4HS8L 3P3YA 1TVBA 3KS0H 5BJTA 1X6NA 3KNBB 4ODVH 2Z35B 3L5JA 1I7RA 4GUPB 5IBLC 1CDUA 5CZXC 3PL6A 4ZAKD 4JPKL 1JRHI 1NCDH 4PJXE 4TNWF 2FEDD 1VFAA 5GS1C 4U1JB 4Q9QH 4MB3A 4PV9A 2P5WD 1J86A 1IL1B 1B4JH 1UQSB 3AMLA 4PRDA 1DDHA 4KUZH 2DOCA 2VMFA 3SE8H 1J8HB 1QLEL 1N0LA 1V3LA 5HHMD 1KOAA 1K85A 1GPOL 4RQQA 4JO1L 1U8PA 2GCYA 4Q9BA 2G75A 4PRAA 1KJ2A 1QNZL 4RGMB 5CP7B 4DGYL 3MV9E 5H2BB 3A0OA 4WFHE 4G9FB 1TETL 4J1UA 2NMSA 4Y4HD 4LIQH 2P44B 3BE1H 5D7LD 3MRLA 1XF4A 3O8XC 1MCLA 1EHAA 1P5VA 1NAKL 3QDGA 4YZFE 5H35B 1NGWB 3FAWA 3D0VB 4X9BA 1AO7B 3SDAC 1ZLVH 4WRLA 3OKNA 5E2VH 3KPPA 4PBVC 1R5VA 2D3VA 1EAPB 2DQHL 1XGPA 4O2CB