4A6YH

Crystal structure of fab fragment of anti-(4-hydroxy-3-nitrophenyl) -acetyl murine germline antibody bbe6.12h3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
220
structure length
215
Chain Sequence
TVQLQQPKAELVAPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTAYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGGSYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIBODY BBE6.12H3 LIGHT CHAIN
publication title Structural Elucidation of the Mechanistic Basis of Degeneracy in the Primary Humoral Response.
pubmed doi rcsb
total genus 35
structure length 215
sequence length 220
ec nomenclature
pdb deposition date 2011-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4a6yH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4a6yH02
1ZWIA 5FB8A 1AGCA 4Z7QE 1JMXA 3MMEB 3CU7A 4GRLD 3WL9B 1S5HA 5JOFB 2EDEA 4Q9RL 4YHNA 3WUWB 1F4XH 1TITA 1B2WL 1D6VH 4LHUB 3BHBA 1SMAA 2ATKA 2IC2A 4ZFFA 1P7HL 2W9DH 3RPIA 2NY7L 1WAAF 5DEZA 3PJSA 1DUYA 4OCYL 1WFTA 4I48B 1T83A 1JK8B 3S4SB 5DTFB 2I24N 2HJKB 4DKAA 3TO4B 4HGMA 1AD9A 1FNHA 5D2NA 3O6KL 1OGTA 2X4RA 2EH8H 1QLEH 2H32H 1S5IH 2R1WA 1KN4L 3S34L 3R0MA 2NX5D 2C26A 5DGQA 3JUZA 1WK0A 1JPGB 3BX7C 1QLRB 2VDKH 4Y1AB 4HJJL 4NM8L 1QSFE 2X1QA 1BJ8A 3GMNB 3KPMA 5LBSL 1INDH 3U79A 3C9NB 5INCB 1QNZH 3DURA 1MCSA 1JZ3A 1T03H 2IMMA 1A3LL 2P24B 4CUCA 2AK4E 1M7IA 2NY2B 3U7YH 3OXRB 4E42B 2VQUA 3DNKA 3GSQA 4KXZH 3I50H 3IDIA 1MCPL 2CK0H 5GRYA 3QDME 2JJTA 2NXZD 1AQDB 2F5AL 3O6FD 3JTSB 3I3BA 3BP7A 3F5WB 3PL6D 1Q0XH 3RVTC 3KJ4B 1NDGB 4MVBD 2Y36H 3QHTC 4FTVB 4GOSA 4GRMA 1ZVHA 1A6VH 5LWYL 3SKNA 1DBJH 2WINB 1DVFD 1MHEA 2FZ3B 5C0GB 4JN1L 3WMSA 3RTQD 3VXMA 3TCLB 3L3DA 5FO8B 4CJ0A 2IFFL 1FC1A 4LHQB 5D7LB 3VFMB 1U3JA 3O3EB 2MTPA 4DKDC 4EIGB 3DO3A 1E28A 4LCWB 3SN6N 4MA1B 3VJ6B 2VDOL 4RGNE 1W0WA 1FN4B 1FHGA 1A1NB 4OLXH 4R96B 4NZRH 5DQ9A 5TQ2H 3VWJD 3NCFB 2X4OA 5FM5M 1UB6A 1X4ZA 4KJWD 4KI5D 4XTRD 3V4UL 4IS6B 3WV0A 1XGTA 3R06A 2JK5B 1R24B 4O00A 1HQ4B 3RNQB 5INDA 4MDJA 1CFNA 3KLHD 1IQDA 4JPWH 1KJVB 5IW3A 4ESKA 4PG2C 1SBBA 3UPRA 1FG9C 1YMMB 4TUKH 3TH2T 1GRWA 5EBWB 1CLZL 4HKBA 1YPZF 3MLWL 4YHKL 1GGUA 4NRZB 1F4WH 4JREC 2XT1B 1M4KA 3IDGB 4LQ1A 2C1PA 4PG9A 4JFFD 3WLBA 4I3GA 1CD8A 1D9KC 1KB5H 3GMLB 4HWZB 5BZWB 2D4DA 3SDCB 2V7HA 1JPSL 3I84A 3ZTNH 5C92A 3F58H 1QACA 4GMTH 3LDBB 2AXFB 2X70A 5HY9A 1FO0H 2ED9A 2CJUH 1OAZL 5HHPA 2G60L 3LKRB 1MJ8L 1ERNA 4HJ0D 4PD4J 2HT3C 3OMZA 2P8LA 5F7UA 1MCOH 1C5BL 3KR3H 3MJ6A 4HFUH 5IHUH 2VYRE 5GGRA 2APWA 4MLSA 5ESAB 3A67H 4HV8B 5T3XL 2VO5A 5IVXF 2O26U 1FLTX 3O4LD 1Z9MA 4LFHD 1P2CB 2UY6A 4LCCA 1G0DA 2XFXB 3ARUA 4YZFE 3TIDB 1IC7H 2Q87A 3KWWA 4F9PC 5GS0C 5KOVC 3H0TA 4XGZA 5AEAA 1BLNB 1F58H 4POYA 3KYMB 4KUCF 4GRLC 3VFGH 4K8RL 1T0MA 3B9KA 5T1DL 5FYKU 1GVIA 1T80A 3FQRB 5EC1A 5MP6L 4JM4L 5GSVB 4NKDB 2VQ1A 3T2NL 4KROD 2W07A 3HZVA 3PHOA 4U33A 5GHWL 4CMHB 3LSOB 4LLQA 1UJTA 4IRZL 4PIRF 1DCLA 2V9QA 1RULH 4HT1L 3QI9A 4N1HB 4Z7WE 2GSGA 2YKLH 5DMGC 1T3FB 1NMCB 3MUGA 5DHVA 3KLSA 4BQ8A 1G7JB 4HKJB 4OZHB 2EC8A 1NGWA 2QHRH 3SBWA 3QXWA 1J5OL 4Z7QF 5JIIA 1EGJL 2QQKL 2V7NA 4QY8B 4JRYB 2A74B 5JQHC 2EYSB 3MV9B 5LGKA 1LEGA 1WITA 2Q1EA 4AEIH 1TTFA 1OAXL 1IZJA 4GAJH 3TVMC 5BCAA 3D25B 2JJUA 4Y2DA 5J1AA 4BZ2L 3GBNH 1S3KL 3BKCH 1VFOA 5BRZD 5L0QB 3L7FA 4FQ1H 2D31B 3KPLB 4RA3A 4PRID 2CUMA 2ZUQB 3CFJA 3UDWC 3OKEA 4PR5A 4HG4K 1CFTB 1FORL 3UTZA 1UCTA 1CTOA 4F9LC 3RFZC 1FL3A 5HDQH 1ES0B 2NXZC 3PWUB 4LVEA 4KQ3L 2Y7QB 4PRHB 3JV6A 4LLMA 3WSQL 2VAJA 5J7CC 3QA3A 3O6FC 4OIAA 1LDSA 4LQFL 5F7MC 5KSAB 3ABZA 3PL6C 2FEEL 4MVBC 2W9LA 1MHCB 3QZWA 4HGWA 4PRPA 5M7QA 4KHXH 5DFTA 4M5YL 4M1DL 1QSEA 1G84A 3SCMA 1BJ1J 1SJHA 1RZ7H 4WU7A 1K4DA 3LMJH 2WP3O 5HGAA 2BC4B 1L7TH 3EFDL 1EERB 2X4PA 5ISZB 4UILH 4QGYA 2PYFB 3SE9L 4JB9L 3ZYOA 4HS3B 5GGUB 4I5BB 2EICA 2ICEB 2OSLB 4XP5L 3HAEB 1E27A 4X7DC 4FXGB 1NCWL 3CFBA 1DE4B 1J05B 2C9AA 4K2UL 2D0HA 5MEPB 4CGTA 3Q6GH 4OBSA 3F65A 1NC2A 1A2YB 2VTFA 3PWPE 1NC4A 3RY4A 5EU6E 5IJVB 1IGCH 1W0VB 3IFOA 3VWJC 5KSBA 3SDDD 1RIHL 3WNLA 3C2AH 4OV5A 3QUMA 3D87B 3D9AL 4KI5C 4S2SB 4HXBH 3WUWA 3OGCA 5CIPB 3NA9L 3UJIH 3BAEL 1ZANH 5CEXA 1DBAH 1MPAH 1OLLA 3U4BL 4DCQA 1T20A 5F9OH 3ZKQD 4UAOB 3SQOL 1J8HA 3FO1A 3MLYH 4Z7UE 3KLHC 3GGWA 1NLBH 2CSPA 3CH1A 3L3HB 5GGSB 1OSPH 4ZOEA 5BVJA 4G43B 3S4SA 5SWQB 2L4OA 2DM2A 3S37L 2HJKA 3EO0A 4Y16D 4YQXL 4PJ5A 1HKLH 4X99A 1NAML 2MJWA 1A14H 4AL8H 2P8PB 4PLJC 4Q7DA 3PQYD 4QTIH 1TZHB 3I6GB 5LAXB 3OR7A 4DZ8A 2UUDH 2Z31A 4P3CH 5D7IE 1YC8A 5FECB 3HC3L 4Y1AA 3U7WH 2K7QA 3TO4D 4PJFE 3BVNB 1GZQB 2WBJA 4M7KH 3X14B 1B6UA 4FQJH 3VXSB 5INCA 5C0CD 3DIFA 4PBXA 4CVXB 4FXKB 5DMJB 3FQWA 3MBEC 3QXVA 5D7SL 3TEUA 1EJOH 3G5VA 3ET9F 2BJML 5JR1H 4X6CB 5T33L 5H35B 2XQBL 4YFLI 1Y18B 4LOUD 4TVSa 5IMOB 1BPVA 3AB0B 3EYVA 3AY4A 1CT8B 5JNYB 4NQEA 5A2LH 4DGYH 3GHBH 4JJ5B 4D8PA 5DJAA 3VGBA 3WN5A 4UTAL 1ZHKB 1KTLB 3RBSA 1BFOA 5B39A 2V5YA 5C0GA 3C08H 4CADA 5EZOH 3QQ9D 3Q2CA 4IIQC 5IQ9A 5JXEA 2FJGB 4PB9L 1S7TA 3HI6H 4K3HA 5IBLC 4L8SC 2G5BA 2Z8RA 4QRSB 4FTVD 2DWDB 3U46B 4M1GH 4RZCB 2ZOLB 2P5WB 4HWBA 4B0MM 3HN3A 1MRDH 2NW2A 4M6OH 1NFDB 1GGIH 1SEBA 2K9UA 3VJ6A 5DJXA 1CD1B 4PGDA 2HLFD 1UWXK 1Z0MA 2UYLB 4ELMF 4MXQD 3MBXH 3DUSB 4QXGL 3FFDA 1NGPL 1HEZB 1BZ7B 3EYFB 5D7LD 5I1JL 3RVXD 3TIEB 1U2HA 5HYJB 5I1LB 4IS6A 4QO1A 1NBVH 1RUMH 4LCWD 3GNML 3GSUB 1A6ZA 3L7EB 3AFLA 1HQ4A 2Y1VA 4B5EA 5FYJH 2VXUH 4N0RA 5JHDE 4Z7WF 5H94A 4BELD 1UM5L 5CEZL 1AXSB 3KPSB 4OM0H 5MENB 1M05B 3OPZL 4HSQA 4ZNEA 3EYQD 1RFDH 3LB6D 5HJ3B 3VXRD 3TT1L 5BJTB 1DUZB 5BZWA 3L9RA 3LKOB 2VNCA 3D69A 1RQ5A 4LCUB 2YPLE 4OGAD 3D48R 3QH3B 5C07B 5EUKB 5I17A 1OSZB 2HKHH 1G7QA 4DZBB 3QIWC 4DN4H 3LN5B 4XPBH 2ITDB 1FZOB 2H8PB 4DFHA 5ENWB 2NY5L 3VA2C 3C6SA 3GI9H 3SDCD 5FM5O 5FHBL 1KC5H 3MROB 1UZ8A 5LCVL 1WV7T 5KS9F 4MA7L 4ODXB 5CEYA 4F33A 5F6HI 3WIHL 4YHZL 1SY6L 3IDJA 4HCRA 3C60D 4JO1L 5F7KC 1YEIH 2HJFB 3AU1A 3UYRH 1I9EA 1I7ZA 1G7IB 2QKIB 1WBYB 1C5DA 1EMTH 2XFXA 3DHJA 4GW1A 3TF7C 2AEWA 1A64A 5EU5A 1KIQB 1U8JA 3TZVA 3EDFA 3U0WL 3SJVA 5IP4A 5ALBL 3RWFA 4KI5E 4UV7L 3SDDC 3MJ9L 2DDQH 3P77B 3O6LH 1CDGA 1EA9C 4ZNCD 3WFBL 3MOBH 4D3CH 5HYFA 1NKRA 4WUKL 25C8L 3BKJH 3PV6B 4LEXL 2APFA 3LSOA 5TE7L 2HKFL 3ZE1E 2WUBH 15C8L 4RRPA 4R4BB 2CIKA 3FAXA 4QF1A 2E9WA 3MRRB 4GXVL 1FFPB 1EZVY 1LEKA 4KVNH 1G7JA 4JGJA 3G5YA 1IGML 4QT5A 4ZPTA 4TULH 4HF5H 5FOBB 4F80A 4P2OA 4BSWA 1OCWH 2DS4A 3AS2A 3BPCB 4QRRA 3X3FL 5GISL 4MA3A 3W5MA 1NEZA 2BCKA 4OZGE 5CP3H 4YNYB 2V2XB 3IDUA 4OSUL 4X6BB 1AD0B 3J8F7 3G6AA 4PJGE 1BF8A 3SPVA 4MX7B 3VGEA 4Z7UF 1UH4A 4PGBB 4NNYB 1NANI 4JRYD 5C9JB 1YY8B 5CLWA 3U9UB 5GS1C 2BNQE 1QSZA 1FGNL 4Y89A 2FYYA 5CBEA 2D03L 5DI8B 1V3LA 1I8LC 2MSPA 4UIKH 3VFOB 5JHLL 1K85A 4OT1H 5DEGB 3UAJD 1TJIL 4F7CB 4S1QL 5EZJB 1FDLH 1GHFH 4FQCL 1G9NC 2NY3C 2OTWB 2FECI 1T5XB 5GRVK 1UCBH 4KDTA 4FMFA 1TDQA 2P46B 3BP4B 3U9PL 2IH1B 1N2RA 2Z4QB 5KSAA 3ME0A 1ND0A 3OKYA 3TNMA 4PJDF 4FA8A 5HGBB 2DJUA 1D6VL 1QLFB 4ZTOH 1GOGA 1F11A 2X4QB 1HE7A 4L3CB 5DR5H 1KJ2H 3WJJA 1IQWL 3QDHA 3QUXB 1YZZA 4PRHD 3CPLA 3ARFB 2BRRL 2BC4A 3VCLB 1DQLL 3LN9A 2PYFA 3TWCH 5I73B 3ZKMD 4PJXB 3BPOB 1R3KA 2QQLH 1OY3B 4MJ6B 4QRQB 2OQJB 5GGTA 2EDFA 2YC1A 2FIKA 5HPMA 4Y0GA 3O11B 1S5IL 4Y4FD 5EO1B 1EAPB 5HI5D 4X0KA 3GI8L 4K07A 2HLFC 1S78D 3WD5H 1H3VA 4QHLA 1W0VA 5ISZD 2VC2H 3ULUD 2VDKL 4S2SA 4OBRA 1I1FB 5C8JB 3F12B 4LHJB 1INDL 1AGDB 3KXFA 4FRWA 4HZLA 3VFSA 5BRZE 1NGYB 3K7UA 5J9PA 4GKSB 1QNZL 4WFGD 3KHQA 1T03L 1BHGA 4MYWB 1OM3H 4PRIE 3TNNB 5ICYA 5K9OB 1DQQB 3UTOA 1S9WB 3RWHA 3U7YL 1FGVL 4M5ZL 2VLMD 4P4KB 4X8JA 2H2SC 5L8JB 5SWQA 1U8NA 1FFNB 1NCDH 3JWOC 4K7FB 4WV1A 4XB7A 3LB6C 4IMLB 1QG3A 3QHFH 2Y06H 4OKVB 1T1WB 4LVOC 5FYKD 4DVRH 3NCJH 4AM0B 4KRPC 3Q6FB 1O0VA 4P9ML 3D85B 3MRCB 2XWBB 3N1FC 5TF0A 1Q0XL 5DQJA 4K3GA 3WEXA 5CCKH 1KPVB 3I6GA 5LAXA 3JWOH 1QBAA 4K3EH 4JANA 1G7MA 1A6VL 3U0TA 1TVDA 3QWRD 4PRNB 5C0IB 3X13A 2ESVB 4Z7VA 1DBJL 4JY6B 2J5LC 4LKXB 1P84K 3BVNA 1FYTB 1ZVSB 5D7KD 3VXSA 4WNQB 4JPIB 4PJIB 4ONHA 3SDAD 5I9QC 1P4BH 2VLKE 5I1HH 1T04B 2MWCA 3B3IB 3NH7L 5F44A 1QBBA 3VRJB 5JTWA 3C60C 1JGEB 4IRJB 3DXAD 4FXKA 4OQTA 3P11H 3T2OA 1D5MB 5F1SA 1KCSH 4FQHA 4XI5C 1F45A 2F54A 4Q58C 1QVOB 3ZTJG 5FF6B 3FB6A 3OB0K 3I2CH 4X6CA 5DDHA 4M3KB 4OGYH 4RQQB 4NZRL 5TQ2L 1NAKH 4Y4KB 3ARBC 5JNYA 5JUEH 1P9MA 5BS0B 4JJ5A 1IAIM 1KN2H 1OPGL 3FN0L 2Q86A 1KTLA 2X89D 4E0RB 2VIRB 3WO4B 5J12B 3GHEH 4JPWL 4PRDA 4XH2B 3AUVA 4PJHA 2BSSA 2ZSVB 2GJJA 1CICB 4IMKC 3X17A 2M1KA 1CD0A 3KHOA 1YJDL 1F4WL 2R2EB 4R9HA 5HHQB 2CH8A 2CR3A 5FA3A 4NQVA 4WENB 4LIQE 1KB5L 4KKLD 2GTWB 4Q97A 1WZ1H 3W0WD 5C0AE 3ZTNL 1KLFA 3F58L 4GMTL 3V6OC 4XMLH 4CNIA 3HCVB 3PQYE 1FO0L 3VMNA 2CJUL 3W9DA 2D2OA 3N50A 5B22A 2ITCB 4E5XB 4YBQD 3RKDC 4GH7B 2JELL 2IQ9L 3G6DH 1XF5B 2XN9E 4UZGA 1JPFB 4GBXB 4HFUL 5IHUL 4Z7OF 3GSUA 3L7EA 1H0DB 3ZE1F 1NQBA 5D7JD 4M7ZC 3A67L 5C0CE 4MNGA 5L88H 5I0ZA 4WTWA 3L3IB 3DX7A 1HHIB 4MMXC 2C4FT 1M05A 3GSRB 4N0FA 2IADA 3T4YB 4QRUA 4XMKH 4EN3B 5HJ3A 1JZ7A 5KVMC 4M48H 3VFPB 4WHYH 3UAJC 3FN9A 4Z0BH 2OZ4H 1NLDH 3WJLC 3OAZH 3UBXG 5C07A 1WCQA 3BW9A 4M7LT 1I1YB 4OZGF 1A0QH 4DZBA 3KPTA 4R90H 2VMFA 3VFGL 4QRPE 5MEND 4ISVA 3LZFH 5FKAB 4UNUA 3HB3D 6FABH 5ID1A 3MO1B 2H8PA 3ULVD 1JP5A 4TSAH 2FEEI 2Q8AH 5ENWA 5DK3A 5DA0B 1OGAD 2ZZUT 4J7RA 1BZ9A 1KIUA 2CLZA 2X4NB 4PS4H 5HGDB 3PIQB 4D9RD 1RULL 4J3OC 5C0BA 4MAYB 4TVPH 1CS6A 5A2FA 2VLJB 1YEKH 2YKLL 4XBEH 1U3HD 1QRKA 4NKQB 4LBEA 4U4BA 4WHDA 2UWEA 3FCTB 3D3VB 3AXLA 2J6EH 1HXYA 1INQB 2ERJB 2Z91A 5L9DL 4PJ7E 4OFYD 4OF6A 4YDKL 4Y4FC 1E4JA 2HRLA 3O2DL 3GSOA 2V5TA 4RDQG 1S78C 3BPNB 4GAJL 4JRXA 5I0DA 3NIGE 1H9VA 4G9DA 3BEVB 5F89A 4EDWH 3BKCL 2R9HD 1VB9A 1M7XA 4RFEB 4XNYH 3ULSA 3F7VA 4FQ1L 5C0FB 3RP1A 1Q9OA 2PYEA 2K3TA 3UTSB 4KJYA 3REVA 4AIXA 4HZAA 4WDIB 4MCYA 1I3GH 1MEXL 3VXRE 4FP8H 3MRRA 1FH5H 3MGOB 5HDQL 2QV2A 3DX8B 1OARL 2DTSA 4WWKD 2E6PA 4LP4A 1NUGA 4NNXB 2J12B 4KHTH 5CJXA 2IQAB 4Z18A 3LPWA 4AEEA 3HLAB 1WAAA 4IHOB 4P2RE 5JORB 3LD8C 3L5WA 3CVHH 5CLTA 4NC2B 2V2XA 3V2AR 3MRGB 4X6BA 1Z9LA 5C0ND 4X6EB 3HNVL 3P9WB 2JIXB 4MS8C 4MX7A 1RZ7L 3EFFB 5I1KH 3B9EA 3DJ9A 3MRHA 4HPOH 1DBMH 1L7TL 4UIMB 5L8KB 4HKZA 4BZYA 1A7NH 3AMLA 4TUOB 3S6CA 3VFOA 4NO5B 3IFPB 3CSGA 5DEGA 2H6PB 3M17B 1S7XA 3Q6GL 3QDGE 2NYYC 4BSJA 4LLVB 2HRPH 4HAGA 1EGJA 3UP1A 4GG6E 3HRPA 5C0EB 1G9MH 1ZT7A 2HJLA 4JM2D 3VXPB 1OP9A 2PO6C 1EX0A 2AJYH 3EJJX 2FO4A 2IH1A 1WIPA 1EXUB 5HI3D 3C2AL 3GMMB 1HH6A 5E8NA 4M61B 4Y5VA 1VCAA 5GIRA 4RBPH 5L6YH 3TGXA 3UJIL 1ZANL 1DBAL 1MPAL 3QAZB 1SM3L 5F9OL 3GJFA 3I75A 4L3CA 3LRSA 3C6LD 3MLYL 3QUXA 1PG7W 1CIUA 1NLBL 3HHRB 4EOWL 1FSKB 1AKJA 3DTXB 2OP4H 1TVHB 1A4JA 1OSPL 3ZE0E 5JIPA 4UMGA 1FVCA 3UO1L 2VAAB 2L7UA 3WS3B 2YA1A 1XZ0A 3GKWL 3MLPA 2VXQH 4KKLC 2J8HA 1A1MB 4QRQA 5CD3A 3P4MA 2DMBA 3O0RH 1UT9A 1HKLL 5EUOE 2Q3AA 4NHCL 4U3HA 1A14L 2HMIC 4OFDA 5EO1A 4AL8L 4U7SA 2AJSH 1JF5A 4QTIL 3ARFD 3BPLC 5D1ZB 2DM3A 4P3CL 1OAUH 3HUJE 1N4XH 3U7WL 2MKLC 4YBQC 5MHSD 3RWDB 4L8BB 2VABB 4MJIE 5HYSG 4YXLL 3V4VH 4LARH 3QCTL 4FQJL 4L4TD 3U82B 5IEHA 2DQFA 5BV7C 2OK0H 3TNNA 5DJ6A 5E95B 3C5JA 1J0KA 5F97E 1DQQA 1XGPA 1S9WA 1K6QH 3M45A 2XI9A 3NN8A 2W59A 2GFBA 4RFNB 3S8WA 3SGJC 2PCPA 1EJOL 3RVWC 2GTZA 3VXUE 5JR1L 1T1WA 4XNUH 2CK2A 5DD3H 4HUXA 5IVZA 4AM0A 1VACA 3Q6FA 1K8IB 1KYOK 5JOPD 5DK2B 1ZT1B 5LJYH 3BXNB 4DGYL 3GHBL 1VENA 3B8SA 4MWFB 4P4KD 4OI8A 1YPZA 3RHWK 3HB3C 1ZLWK 3ULVC 1LNUA 5IMLA 3QRFM 4PRNA 5C0IA 5IEKB 1YNKL 3NGBC 4K94H 3OKLB 5I8KL 4DTGL 2FWOB 1FYTA 4M00A 2A73A 3BZ4B 3C08L 3PABA 4R7DA 4WNQA 5EZOL 1IGYB 5EB9A 4PJIA 1GGCH 4NQXB 3DMMD 9CGTA 3HI6L 3N9GH 2XTJB 1JGUH 3B3IA 4OLEA 4MGXA 3VRJA 3F7PC 2ZNWA 4M1GL 1TQCC 35C8H 2ESVD 1CXIA 4QHKI 4M6OL 5FF6A 1X7QA 3FFCE 1NAMA 4RQQA 1NDMB 5FCUH 2UZIL 3MBXL 3KLAB 4YHOH 3B9DA 3MGTB 4R0LC 4OF5A 2FB4H 4KMLB 4IRJD 5D9SA 4PJ9C 3S5LB 5DVNA 3TESA 1XGQB 1NBVL 5BS0A 1RUML 4KI1A 5A43C 1JUFB 4UNVA 5F7HA 5DRNB 2Y23A 5FYJL 2VXUL 1V3JA 3B2VH 5D96B 4XH2A 4OLYH 2IAMA 5IHLB 2VZVA 4OM0L 1RK1A 2FHBA 3QFJB 2VLME 4XAWL 2P8MA 4Y4KD 2R0LH 1AHWB 2IPKB 5HD8C 1HYSC 2I07A 1RFDL 2R2EA 3RWJB 4ALAH 5HDBF 5CWSA 4E9LA 5ILTH 1TPXC 3CC5B 4YBLB 4IBLT 3UPAA 5E1AA 5F8RC 2JJSA 2E3VA 4WWKC 4HG4J 1QQDB 2X9YA 4D0BB 5ADPL 3NIGF 4JY4B 4DN4L 4CAGA 1E4XH 3ARPA 3DX9A 3RWCB 4P2QB 3HPLB 1WWCA 4UV4H 3CXHK 2AJUH 1MREH 4HC1H 2E9JA 1H5BB 1QTYT 3LQZB 1TQBB 1XF5A 4I9WD 3GI9L 1NGZA 1JPFA 1KC5L 1NL0H 4KC3B 2BVEA 3EUUA 1H0DA 2EDTA 2NY6C 1BOGA 4TUJB 3RVVD 4UINH 2ARJQ 3QEQB 4HUNB 1CFQA 4ZD3H 1MH5A 5AZ2L 4GUPA 3MV7A 3DXAE 1YEIL 2X40A 4YDJA 1NSNH 3VXMD 2DRUA 3GSRA 1CFVH 4NT6A 5CHNA 5C09D 3T4YA 4P5TC 5FO7B 3MCKB 1JZ2A 1EMTL 3VFPA 3O4OC 1TJHL 3EO1B 1MI5B 3MREB 4R4NC 4N5EC 1XCTA 3DRTB 2UZXB 1L7IL 4JM2C 1A4KA 3DLQR 3GSVA 4OZIA 5DO2D 5JW4N 4RGMB 2WK2A 1RU9H 3O6LL 1LE5B 3MO1A 3MOBL 5TDNB 4D3CL 5DVOA 4S1SH 2GK0B 3BKJL 2FX7H 3X3GH 3HE7B 5HGDA 2DF3A 3C6LC 3NACL 4X80H 3WNMA 4JFQB 3RVUC 3FONB 4CVZB 1RUKH 3BIKA 1PKQA 4I4WB 4X6DF 2RBLA 4KVNL 1FL5A 3GSNH 3R4DA 5EBMB 3W0WE 1KENL 3FCTA 1RK0A 3MXVH 5GSRA 2FX8H 2B4CC 3QG6B 4HF5L 3HZYA 1T66D 4YGVB 1OF2A 4WW1B 4XVTH 2X4TB 3VRLF 4WO4A 2VDQH 2FR4B 4P46B 4LLDB 5AD0B 2VLJD 3W39A 3CUPA 3HZMB 3MRNA 4NBYB 2IANA 3VDCA 5AUMA 2I5YL 4WI6A 1EO5A 4H1LB 2RB8A 3D3VD 3VXQB 3U6RB 1FNFA 3D2UA 1PGRB 2LTQC 1X5IA 1EEZB 5HI4C 5C0FA 5C2BH 3OAUL 4QOKD 4GO6B 3ZE0F 5DXWA 1P7QA 4UIKL 1SY6A 2A9NH 2PUQT 5DZLA 2PXYD 4JPKH 4LFHG 4OT1L 3LEXB 3VH8A 3LEVL 3FOLB 3DVGB 4WCYL 4KXZI 1JTTA 4TSCH 5DT1L 1DBKH 1GHFL 5DJYA 3NZHL 3NABL 4JO4L 5FEBA 1G6RH 2GW5A 4H5SB 4NNXA 2CDGB 2LVEA 2EDXA 1BGXH 3BSZL 4NN6B 5IB1B 3ES6A 3HUJF 3UTSD 4G8FB 4IHOA 5MEQA 3ULVE 5FM8A 3MJ9A 5BOPA 4YDLC 4ZTOL 3U0PB 5C08B 4NO2A 1OGAE 4MD0B 1XR8A 2NTFA 4I2XA 4NBXB 2JIXA 5DR5L 2H3NB 4XC3H 1KJ2L 1K3ZA 4DUWA 3GMPA 4D9RE 1MJJA 2R1YB 2NY4C 5DC9B 1OT2A 3LS4H 4E41E 5MI0B 2XY2A 1VFAB 5M95B 5ESQB 5HHOB 1YEDB 3IJYB 4XCNA 2BMKB 1K2DA 3IFPA 2QQLL 2H6PA 4LPYA 5JO5B 4KTDL 1T83C 1S7QB 1CXHA 4K3DH 1IGJA 4PUBH 5IK3B 4LPXA 3ZKND 3QJFB 4Q6IA 3GB7B 5C0EA 5IROA 5E2VH 3WD5L 3S9DB 5HHVH 5D2NC 2VC2L 5ETUB 3RJQB 1A6UH 4CN6A 4Y7MA 3FB8B 1DEEA 1RY7B 5ABDE 1I9IH 2AXGA 4OUUB 4P9HH 4TQEL 4UU9B 5F3HA 4Q2ZA 5D5MF 3O3UN 3HS0B 1JVKA 1HHGB 4LVNC 1EFXB 1BQUA 2CMRL 3MUJA 1Q94A 1ZLUH 1BIIB 3ZT5A 4Y8AA 5EWIH 5CJOH 1Q72H 1QUNA 4NQCD 4V1DB 2HAZA 1MVFA 3NFPA 3UPCA 1S7WA 4DVBB 1TLKA 3E2HB 3SKUD 3QHFL 4K7PY 4DVRL 3A6OA 1BQHG 4PTTB 4D2NA 3D39E 3FMGL 3ZT7A 4LLWB 1GIGH 3LPGA 4JVPA 1QRNB 1KJ3L 2JJTC 3HMXH 3C5ZB 5ACZB 5JDSB 5CCKL 4ODWB 1KSRA 3WFZA 2VZ3A 4ZPVB 1MIMH 1I1RA 3O9WB 2VZUA 3L3GA 4K3EL 4DK3A 2XZAL 2Y72A 4GG8A 4XPTH 5DEFB 4L8BA 3RWDA 2D0GA 4AEFA 1TMCB 1JF6A 2ATPA 1QSED 4HD9A 3SCMD 1TIUA 4LSDA 4HHAB 1P4BL 5D1XB 5I1HL 4EUPB 2VLRB 1SYSA 3QIBA 3RL2B 4ELMA 5C0JB 1HHKB 1JZ5A 5I18L 2CIIA 2FL5B 5D1ZD 5DJ2B 5IFHH 1F00I 3OB8A 5HBBA 4IRSB 5SX4I 5E1HB 3PUCA 1KCSL 4OCXH 4IOIB 1OWRM 4FZEH 1MWAL 4JG1H 3I2CL 2J8UF 5IV2B 2H32A 1B88A 4M43H 1KIPB 4OCSL 4UTBH 1NAKL 5GRVL 4LPCA 1U8IB 1NC2D 1IEAB 5JUEL 1NC4D 2BNUA 4EI6A 2Y5TB 2BNRA 2NY0B 4OZFH 5FM4A 1VGKA 2YBRA 5EBLB 5E8EA 2IBZY 3BWAA 3TM6A 3HE6A 5GRJH 3OKLA 1T5WB 1DN0A 1WJ3A 1FE8H 4G7VH 4OKDA 3NPSB 4PJ8B 1IGYA 2YPKB 4X4MA 4WVRA 1XMWA 4NKMB 2F58H 5DSCA 1FFQA 3C8KA 4G9FB 4EI5A 5F72S 3BH8A 3WUWG 2FJHA 3H9YA 3DOSA 4RGOH 1OB1B 1WZ1L 5CBAB 4LHUG 3GBLA 3WFDH 5H37G 4CDGC 2R8SL 1ZK9A 3V4PH 5CD5D 4C58B 1N7MH 4XMLL 1S7VB 4QWWD 5BVPH 1T66C 4PJ5D 5KS9A 4UDTB 5HSFA 5K59E 3S98A 3S4SG 4ZSOA 2I9LA 5MHSE 1C12A 3UTTB 2VUYA 3OKMA 2Z31D 1Q9LB 5CMAA 1F6AA 4L4TE 2AI0L 1RJYA 4KRMB 1B0WA 2WBJD 5L88L 1QFUH 1V7NL 3U4EB 1S9YB 3MNVB 2DYPA 4J4PD 3P0GB 5E6YA 2EYTA 4M48L 2F74B 2MQ0A 4Z0BL 2OZ4L 1NLDL 4DAGL 3QHZH 3BT2H 4XCEB 2Y9RT 2BVQA 5CINH 4RMVA 1EEUA 2JLLA 4LCCC 5JOPE 1QQDA 1A0QL 2GQHA 2W0FA 4LLUB 3FRUA 3LZFL 5D2LB 6FABL 4P2QA 3HPLA 4TSAL 1R5IA 5HDOA 1Z6JT 3BO8A 2Q8AL 1NMAH 5E6ID 2JCCB 2HWZH 4ZS6D 3B9KC 4PS4L 3F7QA 4TUJA 1QPPA 4HIJA 4TVPL 1U8LA 4G7YL 4QYOA 3K0WA 4XBEL 3TYGH 1XF4B 5JXED 1KB5A 1X5HA 2EEDA 4LDLB 1H15A 1RUAH 3QI9C 2J6EL 1RHFA 5EZIL 3BH9A 1BM3H 1JYVA 4MD4A 4JFZH 3MRLA 2CRZA 5F1OB 2Z35A 4OZ4B 1HXMB 3LQAC 5D2NE 4O2CA 3FOMA 4QNPE 3SBWC 1FO0A 5EC2A 2EC9T 3TBSA 5K9JH 4JFOB 4F8QA 2A6JB 3OJDA 4EDWL 2GCYB 3JSSA 4AK1A 1KNOB 4BH8A 2GK0A 1GAFH 3LQAH 4JLRB 4XNYL 1SYVA 2OJEA 1MI5D 4GKZB 4Y2DC 2JB5H 4PY8I 3RU8L 1B0RB 4I18A 5F9WC 5I2IB 2PTTA 3AC0A 4RDQF 1OOAA 1I3GL 3BZFA 4FP8L 1FH5L 4HUUB 1QFOA 2D9CA 1R3HB 4PJDA 3S35H 3ZO0A 3UJTH 4WU5A 4J3UA 5FFLA 4ZUUA 1HIML 1IEHA 1AJ7L 3HE7D 4KHTL 3JWDH 1EH9A 4U1NA 3BUTA 2JB6A 1I1AB 2GY5A 1TTGA 3ZT6A 3ZKXC 1F97A 3CVHL 5AD0A 3CMGA 3EJYC 3HZMA 2XZCH 4I9WE 4ZAKA 2X1XR 5I1KL 2K7PA 4HPOL 3E1F1 4JGUA 3GBML 1AFVH 1DBML 4NN5C 2O61B 2PR4H 1QSVA 4F57H 1S8DB 5HHXL 1A7NL 5CAYB 3VXME 4NZTH 1P84J 4O9HH 3RJDA 3R1GH 3RWGB 1S7SB 2KL6A 3IYLW 1J9CT 2HRPL 3OQ3B 4UBDC 2YWZA 1A22B 3ZE2F 1G9ML 1VSCA 2CDGA 3QUKA 2AJYL 2EKSA 2MOVA 3BZEB 1DSFH 3PWLA 3CFCH 3TZVD 4QRTA 1YEEH 4WJ5A 3K2UH 1C7SA 1I7UA 2A6IB 2VR4A 5L6YL 4YPJA 4TOYH 2DMCA 1IGTB 3QP3A 4U1HB 1R3JA 1U2CA 4D9QE 3KNBA 4J3WA 1XIWA 5B21A 4YE4H 2OP4L 3VFRA 1A6AA 1U8QA 3H2WA 1RIVH 4PP1C 4NO0A 4M93C 2DQGH 2B1HH 4B53A 2VXQL 3O0RL 5C08D 1ZXQA 3CFIC 1FNGA 1WC7A 4XWOD 3RGVB 5CD5C 4TTDD 4FQIH 5H37H 3DV6A 2XXCB 4YPGA 4RRPG 1RUPL 3L3OA 4ZOAA 4F7MA 1OAUL 4F7EB 1JHTB 2OX5A 3PWNA 1RUQH 5LGHH 4WTXA 3DSNA 2W0PA 4OUUA 3T3MF 3CDCA 4UU9A 1A3RH 3V4VL 4LARL 2Q8BH 2Z31C 1KPRB 3B5GA 3MV01 2X1WL 3HS0A 4QOKE 2OK0L 1IM9B 4PJCE 2ZOKA 4U6YA 2WBJC 4L3EB 1KLGA 1R3LB 1NEZG 2DLIA 2OTUB 3CLEL 2F9BT 5C71A 1K6QL 1SMOA 3GSXA 1VKXA 1VEPA 4V1DA 3G6JB 4U05A 1A7RH 5KSUB 4YGAB 5EOCH 1QZ1A 1RVFL 2R0ZH 3WNNA 2M26A 3L5JA 1TETH 4XNUL 5EA0H 2NY2C 5DD3L 4F15C 4P23A 1LO5B 3QULA 1LO0H 4KVCL 1M6OB 3LKNA 5ESVB 2HG5A 1IFHH 3EO9H 1KCUH 4H88H 3T4AA 1UJ3A 3LH2H 3IKKA 4ZS6C 5HYQA 3WN5C 1X6NA 2JJWA 2QL1A 5F6IB 1QRND 1GGCL 3O3BA 4HHAA 2AXJA 5D1XA 2D7MA 3N9GL 2VLRA 4EKXA 1JGUL 1HHKA 1TXKA 4XHQA 5DURD 2H9GB 3O9WD 3MRMB 4JFEA 3UMTA 1MIEH 1XGRB 1BX2B 5JXEC 3CLFH 3VD4A 2EYRB 1WFOA 4XC1H 1M7DB 3QXAB 3WDIA 1KIPA 5F7NC 2LVCA 4YHOL 4YR6A 1JYWA 3KGRA 2PTVA 5SWSB 1IEAA 2IF7A 2ILLA 3MLZH 3PHSA 5BMFH 2A38A 3T77A 3HAEG 2HTKD 4IRSD 2FRGP 4GQ9H 4XPAH 1CDJA 1UYWH 1QR1A 2DD8H 3IKCA 5F9DC 4FQXA 1CDHA 4C54A 4Y4HA 5T1LB 4MNQB 2ZSWA 1FZMA 2G5RA 4HWBH 3VWKB 1HDMB 2RHEA 3B2VL 2C4FU 1Z9SA 5CZXD 4OLYL 5SWZB 3GZKA 2ADFH 4PJ8A 4N0UE 3ISWA 3TYFA 2NNAB 4ALAL 3VMOA 5JIKA 4G9FA 4YHPA 1Q9KA 5L8LB 1MWAB 3S97C 2EIZA 5J6HA 1C16B 1T22A 3L6FB 4QHUB 1WBXB 4GAFB 1AIFA 4KZEH 1KLUB 1SJEA 1BEYH 3ARZA 1NEUA 3D1MC 4HKXA 4NO3B 3O2WH 3ARDA 2VDLH 1CI5A 4UV4L 3Q3GB 2AJUL 1UXWA 4Y5XB 4NSKB 4XNMB 4BFBD 1MREL 4HC1L 4OD1L 3V6FB 5FGCE 1K4CA 2VZOA 3UTTA 4PRPE 1FAIL 3EOAA 1NL0L 5FDWB 4NQDB 1AGFB 1YUHA 5SX5K 2NY1D 1QSEE 4JO3H 5F88B 3QUZB 4JFDB 2VN4A 5IM7B 3T0EA 1EUTA 4MQ7B 3S3SA 3VD3A 4ZD3L 3VG9B 5IB5A 2P43B 2XG4A 1KCLA 1NSNL 3T09A 1CFVL 5IVXB 4HS6B 2DBJA 2WW8A 3QNXA 3MLXH 4GMSL 4EQ3A 4RNRA 1ZEAH 5BQ7B 3BGFB 4XCEA 4WY7H 3RUGF 2F54D 3EHBC 1DLHB 4LEOB 1RZJH 4LLUA 4LSQH 1RU9L 3TZVC 4L4VA 5KSBE 4A2MA 4HCRH 5D2LA 1HHJA 3HI1A 3T1FA 2COQA 3HC0B 2BP3A 1YECH 2JCCA 5D72L 2FX7L 4R7NB 1VESA 3X3GL 1Q38A 4BYHA 5FYLD 2EZ0D 4X80L 4M03A 2FX9L 5FA4B 2AEQH 1F42A 1J8HE 5LGJA 1RUKL 1D5XB 3QIUA 2ADGA 4OF7A 1ZA3A 3NPZB 3RWEA 3V7AG 4XNZB 1KXTB 3QQ4B 1GGTA 1LEIB 5T3ZD 3GSNL 2XWTB 3BIAX 1U3YA 3MXVL 4QHMB 1MCQA 2XA3A 2YD6A 3LIZH 4Y19B 3ZHKA 2GT9B 2ZUYA 4XWOC 3NTCH 4KK9D 4WGVB 4XVTL 4PJ5E 4U1JB 2VDQL 3C5SB 5EZLA 1NBZA 2RCSH 5H8DA 4P2OC 4X4XB 2XKUA 3NZ8A 2GCYA 3K8LA 5F9JB 3SDYH 5EN2B 2ORBH 1YEJH 4Y1AE 3IJHB 2Q7YB 5AWNL 4DEPB 3QO1B 4RAHA 4TNWK 4EQ2A 3GMOA 4MZ3A 4HEME 4ZDHB 5C2BL 3K3QA 4X9IA 2E7LA 2A9NL 4JPKL 4NKIH 4HULB 3WIFB 1A7QL 3OF6D 5DD5H 3DROA 4TSCL 1SJVA 1JCKA 2ZUTA 3M1BB 3W9EB 3S96A 5TGBB 4PJAA 3WDJA 3QWQB 1L9NA 1I1AA 2A77L 2FIRT 3SGEI 4KDTC 5L7XH 1UC6A 4NQEE 5GRWA 5KSAC 4BQCA 1CR9H 5I15H 1FJ1A 3BDBA 1KYOJ 5L2KA 4XC3L 3QQNA 4JQIL 5DRXB 2IGFH 1QSFB 3TN0B 2Q6WB 3QXUA 2DIAA 5HGGS 2YSSB 3MOQA 2EE3A 4M8QA 5TF1H 3LS4L 1AH1A 2CLRA 2GITB 2I9TA 2Z92B 1PSKH 1S8DA 3FO9A 4P3DA 4PTUB 4POZC 3WJJC 3M8OL 1YYLH 5KG9B 3I6KB 5D1QD 4K3DL 3BP6A 1BWMA 3QDMB 3SDXB 5DS8A 5DWUH 1N0XL 5F96H 2DAVA 2V5SA 1J11A 3KPOB 3DGCR 3VFVA 5JXAH 1A6UL 2BY2A 5CP3A 3UCRA 4NC1C 4YDVA 5IW1A 1I9IL 4LSSH 1I3RB 2A6IA 3W11D 1W72L 3ULUH 4P59H 3HAEH 5ANMA 2X05A 5JZ7C 1I4FB 3KAAA 2R1XA 5EWIL 5CJOL 1Q72L 2AQ3A 5B8CB 5T1KA 4H8WH 1KTDA 1HZHH 1AO7D 2PYED 1T7YA 5T3XD 1GGYA 3TBVA 4U2ZA 1XGUB 1HOCB 4MJ2A 4GAYA 4GRWE 4ZNEE 1LVEA 3VG0H 2APTA 1GIGL 1KEMH 4GKNB 5CIPH 5FYKH 4WV1C 3SEPA 3CFDB 2ARJA 3HMXL 4K9EC 1KG0A 5I8EB 3MZGB 4AG4H 4RGNB 4L3AA 3IFLH 1X4XA 1LE9B 3T0BA 1MIML 1T0NA 2B5IB 1RZKC 4LSTH 3QEGH 3ROLB 4DKFH 1JF1A 5ITFA 3A6CH 4EDXA 1FQ9C 5F7EH 5IT2L 4ERSL 3B9AA 3SKJL 1CLCA 1KJ2A 1CTNA 2HT4D 3RGVD 2ICCA 2NY1C 5BXFB 1FNEB 1IM9A 3CXHJ 2VDMH 4RAUA 4L3EA 3KPRA 4M8VA 2OTUA 4X6FA 5IFHL 5DZOA 3VDAA 1OTSD 4FN0A 5SV4A 2XOTA 4OCXL 4M9OA 2P5EB 1BBDL 4FZEL 4LF3B 1YDPA 1J88A 2J88H 4DN3L 4JG1L 3H9SA 4M43L 4UTBL 3EOBA 2CO7B 2APVA 3B43A 4M3JA 1UFUA 2CPCA 4JFHE 4UOJA 2Q3ZA 2XNAB 4D0DA 2CDEA 5JMOC 1RJLB 3SJVE 4HH9B 3TO2B 1BD2A 1ZS8A 4C55A 3BJLA 1CFSB 5GJTL 2EDDA 1UACL 5GRJL 1NFKA 1X5KA 5KVGH 3ZDYF 3Q48A 3VGDA 4BQ9A 3AROA 1P9MC 3BQUA 4M6AA 5DHXB 4YAQB 3H7LA 1JWSA 3MTRA 1KN4H 4QCIA 4R6UA 3S34H 4I0PA 2F58L 1N6UA 2GIYA 3IU3B 1ZGLP 5T1MA 1RIUH 4RGOL 3P73A 3QXDB 4V2CB 2F53A 4WWID 3WFDL 3AAZA 1PLGL 1TNMA 1J18A 4NUJB 4HJJH 2BSTA 3T8XB 3QXAA 1N7ML 2NLJB 4PJBF 4WFED 3ECBB 3MJ7A 1P69B 5LBSH 5BVPL 2ID5A 4ZODA 4EJ1C 5SWSA 2ARWA 4QRRE 3NCMA 2IG2L 3K8KA 3S36L 3PDDA 4PV8B 2XRAL 3VGHA 4UQ2B 4NN7C 1TZGH 4MQXD 2GSIB 3P9LA 1QFUL 4KK6D 2GYSA 4DOHE 2P7TB 4QLRA 5EOTA 4MNHA 4GW4A 4ZUWA 5FHAH 4ZG1A 5E94B 4Z7WB 1GH7A 4L29A 2AEPH 1CDUA 2IPUG 4P5MB 3GIVB 3BT2L 2ZP0T 4R8WH 5T1LD 3VWKD 1J0HA 2HLAA 1FVEB 5SWZD 1H8SA 5J8OA 1WZKA 4G42B 4JN1H 4OLUH 2E7MA 4NQSB 2LU7A 1NMAL 4X6DA 1T4KB 5IB3A 2HWZL 4M62L 4LMQI 3S88H 4ZFGH 3DO7B 3K80A 4X98B 5FKPA 3AREA 1FPTH 3F6LA 4JAMB 4ACPA 2X4SB 5F88A 3I6LD 3OKNA 3ARBA 5IM7A 2C3HA 2VDOH 3LN4B 3DI3B 1VDGA 3PNWA 4PBWD 5B38B 4LKCB 3WO3B 4NRYA 3CH8A 4Z6AT 1GL4B 5FK9A 1RUAL 2H2PC 5I66B 4GW5A 4HIHB 5E03A 3V4UH 5I76A 4JFZL 3OSKA 3O8XA 4KJQC 3QDJA 4NQDD 4PJEA 2C5DC 5EU3B 4XVUD 1NBYA 3HR5B 3VXTB 1PDKA 4BZ1H 5K9JL 2BOCB 4HH8A 5DRZA 1HI6A 3SE3A 1VADB 3FL7A 4RX4D 2YD3A 1R3IH 1XFPA 5FGBA 2FJFA 8FABB 32C2A 3GMQB 3MNZB 4LVHB 3V6OA 5EH1A 3RIFF 3FTGA 3KXFE 2E9IA 4ZXBD 1JPSH 2G75B 4MXWH 3QPQD 2V9TA 1D5XA 1MRCH 1JHKH 2IAMD 2AJVH 1WQVT 4EXPX 3QQ4A 1ZMYA 1YC7A 3QO0B 1LEIA 2XWTA 2VXVH 4ORZC 2HH0H 1M71B 4NPYB 2OZ4A 4KUCD 3UJTL 2FGZA 3LS5L 5DD6B 1Q9WB 3FT3B 5DGRA 5IJKA 4HK0A 2GT9A 1FVDA 2RFXB 3VGGA 1N5YH 1C5BH 1QOKA 2NQCA 4ZFOL 3PWPB 4C4KO 2L7JA 4P57B 1E4KA 5EU6B 2XZCL 5CJXC 3IRPX 2Y07H 1G7LB 2CKBB 4K8RC 4Z7VE 4P3WA 4Z0XB 1AFVL 1W8OA 2PR4L 4PRBB 4F57L 4C56A 4ZFZB 4P5KA 2E8YA 5DHYB 1NKOA 5ID0A 4Z7UB 3I3EA 3IDXH 4O9HL 3EW3B 4DJMA 4L8CA 1AE6H 4JREB 4OCNC 1BJ1H 3R1GL 3DVNA 3MV7D 3RX8A 5F1IB 4FQ2H 3LY6A 1FZKB 2J6EA 3M1BA 4UQ3A 5MP6H 2F54E 1A7OH 1OQOA 2VERN 5D5MA 1AXIB 3RI5F 1X44A 4LSVL 5K9KA 1DSFL 3CFCL 1YEEL 1A47A 1CQKA 4AENA 1KF9B 4HT1H 3FT4B 5D7IB 1EHLH 4P2CG 5GZOC 1II4E 2X42A 1U8KB 3N1MC 4Y5VC 4PJFB 3GMRA 5DJ0B 1QSFA 2XG5A 5FYLE 2NPLX 4KAQH 4YE4L 4X5LA 5L2JA 4O2FA 2A0LC 4PJHE 1N5AA 1RIVL 3QUXC 1RZGA 4O51B 2DQGL 2B1HL 5CEZD 3I6KA 4DW2L 4MA8H 3ZZ1A 4PBVC 4LIQL 5AG9A 3MV8A 5I1AB 1S3KH 2OR9H 4FQIL 3SDXA 1QHOA 3TN0D 4ZYKA 4WI5A 1AP2B 2DMKA 3ILPB 4ODHH 4GRLB 3T65A 5JQ6H 3CVHA 3V0VB 1RUQL 2AK4D 2AK1H 4CVUA 3ZKSD 4HUWB 1PKOA 5I1EH 1A3RL 3DETD 4XCFH 1EHAA 3QDMD 4U0RC 2X2YA 2XPGB 4MQXC 1V7MH 2J8UA 4NIKB 4D94A 4FG6D 3D2UD 4KK6C 5B8CA 4XP4L 1VFBA 3WLWC 4MNGE 4X7TB 2OL3B 1ORQB 1WIUA 3IXTB 1A7RL 1P7QD 4HIXL 5EOCL 4OZHF 4U1KA 4K23H 5EO9A 1RSFA 3K2MC 1TETL 5EA0L 4YFLF 4ORGA 3W81A 4M1DH 3RWIB 3L95B 1LO0L 2VL5A 5I8EA 4MJ5A 1FAKT 3GJEB 3B2UC 4LASH 3EO9L 1CG9B 1KCUL 3MCLL 3TVMB 4H88L 4FOMA 4JB9H 3SY0B 1W72B 3C8HA 5GGRY 4GSDH 1S7RA 3LH2L 3H9HA 3RX7A 3KYNA 4K2UH 5J06A 1U93B 4HAFA 2C1OA 2VXTL 5JHDB 3GM0A 5C0BE 1MIEL 3CFKB 3DBXB 1RIHH 3CLFL 3IT8D 4A2LA 4XC1L 5DUPH 3CX5K 1G6VK 2W65A 2P5EA 1J12A 1HN1A 4MDIB 2NXZB 1AR1D 4JHBA 4MXVE 1R0AL 2UWEE 3MNWA 4U6HB 5DYOA 2YPLB 1QFPA 1KBGL 1S9XB 3O6FB 1IC4L 1U8OA 4HS8L 3ARGD 4XVUC 3SQOH 3VW3H 2BFVL 3PL6B 2XNAA 3MLZL 5DJDB 5BMFL 3TO2A 4Q74A 4XPAL 4JRXE 3DV4A 1ZVYA 2DD8L 5IFAH 5KN5B 1NGQH 5DK0B 1XCQB 1U91B 1B4JL 2DI7A 5FUOH 3TBYA 3KJ6H 4I0CC 2FH6A 2ADFL 4YQXH 5IMMB 2EDHA 2J4WH 5DVMA 5GRXG 4X9HA 2BVPA 4F37K 2PYEE 3WO4C 5T3XE 3LOWA 3LKSB 4BFIA 1R5VB 2IAMC 3E0GA 4CL7A 3QEUA 2GJZA 2D7QA 1CGXA 3EOYG 5EFIB 3QXDA 1NUFA 1O7VA 3HC3H 2J7LA 1DDHB 3PWVA 4ENED 4PY7B 4J12A 4FQLH 2NLJA 5MEOA 1G7HA 2XICA 4XAKE 1BEYL 5FGSA 3UBXA 1U92B 1D5BA 3VWJB 3O2WL 1U8HA 4IJ3C 4YHYC 2JJSC 3JV4A 1ED3B 3MGAA 1WAAE 3MJ8A 1ORSB 5EOQH 1RD6A 1WT5A 5D7SH 1VGEL 4JO3L 2BJMH 3G5XA 5IMKA 1AGEA 3TA3A 3WS6A 3T0WA 4XP9L 2BXYA 3DUUB 3RZWA 3QIBD 3FQNB 3V8CA 2D0FA 3PXHA 1ZEAL 5D6CB 1I8MA 2EC9U 1IM3B 4WY7L 4UTAH 4JZNB 4XPFL 4MAUH 5J89A 1FVEA 4PGEA 3WYRA 4Q0XL 4NFDA 4J3SA 2W1NA 4NQTA 1ZHBA 4OZGB 4G8GA 4NWUH 1YECL 1OT1A 3QXTA 4PJGB 2BNRD 4MCZB 3Q5YA 2KH2B 1YN7A 3HE6D 3PDOB 4WW2A 3STBA 2AEQL 3WFEH 4JFXB 2IBBA 3LN4A 2SEBA 1R5WB 4BM7A 4J1UA 5B38A 3GM8A 4LKCA 3C09B 1YMHB 4UUJA 1OQXA 2A6DA 2YA2A 3MBEB 5I66A 2IALB 3LIZL 3IDMA 1X5LA 4X6CF 5ADOL 2BHYA 1OAKH 2ZCLH 3NMEA 1J10A 3PGCB 3EYOB 4ZUVA 4TPRH 5EU4B 3VXTA 4X4YB 2F15A 1XF3A 2DQEL 2RCSL 5FO9B 3CFEB 1UM5H 2YXMA 1VADA 2Y6SC 2MFNA 4UDUA 5GJSL 5IBTH 4HFWB 4WO4C 3SDYL 4HC1A 5JOEA 2ORBL 8FABA 3BPNC 3MNZA 3GK8H 4YWGL 3TT1H 1CDIA 2J2ZA 4FQQA 4KROB 5I71C 2Q76B 2AKRB 1I85A 1IAKA 5JPMB 2G75A 3WKNA 3MR9A 3MRJA 1EFQA 4LSUH 2XWJB 5DD5L 1P1ZB 3OKDB 3RZCA 3S5LG 2QSTA 1H3TA 2W91A 3EYSL 4WUUA 4HLZG 2NY5H 5DD6A 1Q9WA 1NFDF 3EYUL 5FHBH 5E99H 4APQA 4OLZL 2R0WL 1XF2B 4LAQH 4BFEA 3WIHH 2B7DT 2OR7A 4YHZH 1SY6H 4GJTB 1CR9L 4JO2L 1YPZE 1HK6A 2FSEA 5J6GB 1N3NB 2IGFL 2WIIA 3HMWH 2AJXH 5ICZA 4XBGB 4N1CA 5BRZB 1T7XA 3T0AA 4CW1B 4F7TB 1PSKL 3HI5H 1MELA 4PRIB 2B39A 1P7KA 5EU6D 4NDMA 1B0GB 1CFBA 3GSNA 5GRUH 4ELKB 3EDKA 3I3DA 1CE6B 5E70A 3IDNA 3IETB 5DWUL 3QBTB 3WFBH 1UWGL 5F96L 5J13C 2EDOA 25C8H 2W92A 4ZFOB 5TH2B 1MCWM 1PFCA 5JXAL 1JGDA 4PLOB 4Q6IC 15C8H 3ZSTA 4LSSL 4KGLA 5IROC 5J56B 4Z8FL 4OCWH 3ULUL 4BSVB 1X4YA 4GXVH 1A5FH 5DRWA 1D9KD 1U8KA 2Y4SA 1IGMH 3RQ3A 4F3FB 3L3JB 1JRHL 4H8WL 1HZHL 5IB4A 3X3FH 5IIEB 1JN6B 2V2WB 4QTHA 1ZHNA 4MXVF 2HT3D 4OSUH 1EEYB 1KEML 3BGMA 5FYKL 1A1OA 5I1AA 1G6RA 3MACH 3VFNB 1OP3H 1AP2A 4WI9A 2IPTL 4HUVB 4LSTL 3TPUA 5A40E 3QEGL 4DKFL 3SDDB 2KZWA 2P4AB 2DI8A 4Z77A 1RZIB 5F7EL 5KANI 2OCFD 5JHLH 4XZUA 4NRXA 1DANU 3CJJA 3L5XH 1S9VB 2QSCL 1MAKA 2HFGH 4XCYA 2C7UA 1FIGH 3WHXA 4Z5RA 2VZTA 5GS0D 2QADC 2VDML 1FNSL 4TSBH 3WFHA 1WCBB 3U9PH 4KJPD 3MV7E 5E24E 2DJSA 3QIBC 2J88L 2PN5A 1IT9H 1MFBH 1RZ8B 4RIRB 5FUZH 2VE6B 2CD0A 4Y16B 3QUYA 5EO0B 5GQBA 1HNGA 5C0AB 1FZJA 1EVUA 1IQWH 1GCFA 1BVLB 2DLTA 1DL7L 3BYTA 2NX5A 1TJGH 4QHNB 3PQYB 2BRRH 1LO4L 3K1KC 4KZDH 5AAWA 5TDPB 5DMGD 5HVFB 1DQLH 4OZIE 3MRQA 3SY0A 3BEWB 2C3VB 2PW1B 5F21B 5KVGL 1TVBA 1MY7A 3MRPB 2BXZA 2XN9B 3TLRA 3TCXA 2WAHA 5IKCB 3IS0X 1T1XA 5BO1H 2APBA 5GS1B 3MSPA 2D7OA 1U8PB 3HE6C 4YC2B 5DJCA 1FLRL 5C0CB 4ODVL 3HRZB 1XIWD 3GI8H 3LV3A 2R15A 3VE0B 4C83B 5CEZE 1RIUL 3TVMD 1PKQE 3CFKA 1G7PA 3CGTA 4CRPA 1JTPA 4JHWH 1I75A 2M8XA 1ZA6A 1LK3L 3CCHB 4EI5C 4MDIA 2NY3B 3KLDA 5I1GH 3HR6A 3HMXA 1LK2A 2H26A 5F93C 4OLWL 3U83A 3HZKA 4F7PB 5JHDD 4Z76A 4O2EB 1QEWB 5E00B 2EDYA 2R2HB 5HVHB 3MLVL 4QRPB 1FGVH 4M5ZH 2IANE 1FV1B 5KN5A 4PLKD 1QD0A 1TZGL 5E7BA 5DK0A 1FL6A 2HYMA 2FECL 2OMBA 2XXMB 2P47B 4KK8C 1DVFA 4LLYB 1JWMB 2YPLD 3OG4B 3RUGA 2VN7A 4P9MH 2MNUA 3RTQA 5I19H 5FHAL 4JFYB 3GFUA 4K3JH 5IF0B 3LKSA 4PJXF 4PP2A 7CGTA 2AEPL 2HVKA 1IGFH 3D18B 1ZSDB 3P0VH 1EK3A 4R8WL 1NJ9B 1WTLA 2O5YH 5J11C 4HPYH 4YXKH 4PJ7B 4HLZH 4NOBA 4OLUL 4P23D 1HH9A 3OL2A 2DKSA 3MRBA 1JGVH 4EXKA 2D7NA 1ZLVK 1Q1JL 2R2BB 3NH7H 4OZFA 3ESVF 3ULVL 4MSWA 3S88L 4ZFGL 4AIZA 3FHQA 2LFGA 3MRIB 1FPTL 3O2VH 1CGSH 4OFVA 3WE6A 1X5XA 4I2XE 4WHTB 3ZL4L 5IW6A 3LKQA 3IXAB 4IDJL 4NJ9H 4JN2B 2ADIA 1TQBC 3DRQB 1BZQK 1C08B 3FKUS 4HWNA 3KPNB 4PV9B 1WLHA 4XRCB 1ACZA 2V2TA 1N8ZB 4KK5C 2W60A 2GUOB 3RDTA 3VXRB 4HK3N 3IDYC 5C70A 3IJSB 4JFFA 1VEOA 4JFED 4LVOB 2AJ3A 2NW3A 1OPGH 3FN0H 1UVQB 2E6QA 4G80B 1TZIB 2GJ6D 4BZ1L 2OR8A 4L8DB 1MQ8A 1R3IL 1GC1H 3MRKB 1YJDH 4F2MA 1CLOL 5DMKB 4PGCB 3OBAA 2J5LB 1LD9B 2G9HB 1MHHA 4FQXD 4JHZA 4Y4HD 4PJIF 2UVFA 4MXWL 5I9QB 5A16A 1I1CA 2DLFL 4PLJD 1MRCL 1JHKL 5IB2A 3WNKA 2ZG3A 1X5FA 2AJVL 3C60B 3O4LA 4I18C 4TNVK 3VGAC 2C3XA 2VXVL 4PB0L 2HH0L 3MA9H 1P4LB 5LVEA 1O5DT 1VHPA 4XXDB 2JELH 2IQ9H 1MCRA 5IOPA 43C9B 1N5YL 5ITBH 2VLLB 3CSYB 4BH7A 3PGCA 3EYOA 2X41A 3X12B 1FG2A 2PW2A 3OR6B 5KJRL 4GG6B 5I1CH 4MD5B 2BNQD 5JLZA 4HUMB 5SX4H 2Y07L 4DGVH 3I9GH 1YN6B 3MBED 4AT6A 5E4EC 5F7LB 4RMTA 5MERB 2DQHH 1MCLA 4RWYH 4ZUSB 4U6XB 1NFIA 1S7UA 3SKMB 3VI4E 5GGSY 4ZAKC 1LP9B 2AKRA 4LGSB 3DVFA 2ICWJ 3IDXL 1OWWA 1AE6L 4X7CC 3K74B 4ELME 3KPQB 4KJPC 3P9MB 3OX8A 4FQ2L 2HTLC 2VISA 5DJ8B 4I3SH 1ZE3C 4LCYA 1WFNA 3O45B 3ILQC 1JNJA 1A7OL 4H1LH 3SKOA 5EIIA 4BA8A 4QXTB 4HDIB 1GZPB 4YHIA 1T1ZB 5EUOB 1HINH 5FDYA 5HTSA 1NPUA 5IBLD 5EBGA 3P30H 1EHLL 2QR0B 2XKNB 2NZ9D 1KIRB 3VFTB 4M9PA 3KYOA 2BNRE 2VJXA 4KPHL 3QNZB 3BUYB 3V5HA 3CU1A 3B5TA 4KAQL 4M7ZB 4Z7NE 4JDVA 3RIAF 2Y5EA 2NR6C 5L9DH 4CW1A 1PYWA 4F7TA 4YDKH 1JBJA 5CUSH 1W0YT 3O2DH 4FXLA 2RGSA 4X4ME 1XIWC 1IAOB 1B0GA 4MA8L 3QIUD 4J3VA 4MHHI 4JPVL 5MI0C 5I8CA 2EDQA 3G04B 2OR9L 3L3KA 3SO5A 3T0XA 1BQHA 4N9GB 3N06B 4ZFOA 1FFOA 4ODHL 1UM6L 5JQ6L 3MFFA 1CU4L 1NH6A 4OZIF 5KS9E 2AK1L 5C9KA 4EEEA 1QA9B 1PZ5A 4ZSOE 1MEXH 3INUL 5DD1L 5I1EL 1QYGL 4XCFL 4IOFC 4PREA 4JHAH 3BP5B 4PLKC 4EVNB 1N6QH 1V7ML 5IHZA 3HG1A 1XR9A 1OARH 3TBTB 5D70H 5DA4A 2AV7B 4NZUH 3QIWD 1U95B 3MXWL 3MLRH 3L1OH 1LGVA 5EPMB 2KQMA 1VFMA 5ICXB 3P4NA 4K23L 1KCRL 3I85A 4X5WA 3U7AA 3MUY1 1N59A 1CBVH 4AH2B 3BESR 3HNVH 2IMNA 5F1NA 3V6ZB 3CVIH 3EBAA 3N1QC 4OTXL 4Y4FB 2J3SA 4P4RB 3FFCB 3PGDA 4LASL 4HUVA 1T2QH 4P23C 1KEGL 2VLKD 1MUJA 3AM8A 4GSDL 3QFDA 2V9RA 5KVFH 3UTQB 5F7DA 2YUXA 1I8KB 4JY5H 1INEL 2Z8WC 1NUNB 5L2KD 1UJ3C 4PJBA 2FHCA 1K5NB 4JKWA 1QP1A 1WUNT 3V0AC 3MMEA 2YPVH 3WL9A 5JDJA 1SJXA 5DUPL 5JOFA 5D1XC 3PHQB 1WF5A 1J1PL 1GPOH 4LHUA 4Y16A 1J0ZA 1F2QA 4JZOB 1SM3H 1PQZB 4CMMB 3VW3L 4XVSL 3CAFA 4EOWH 1F02I 4XX1E 4EUPH 4ODUB 4YK4C 4I48A 1JK8A 5IFAL 2R23B 3I02B 1X5ZA 5DTFA 1NGQL 3UO1H 2C3VA 2WQ8A 1I8IB 3AMKA 5FUOL 3KJ6L 3GKWH 3TO4A 3ARTA 3MRPA 1A6TB 3TBWB 2NY0C 1IRAY 3MRFB 5C0AD 4FQXC 2J4WL 4NHCH 4Y4HC 5F3BB 1LO3H 3SDAB 2XACC 4JKPL 1RZFH 1ZV5A 4NYLB 4C83A 3NPSC 1JPGA 3DXAB 4PJ8C 5T1KD 1QLRA 1MLBB 1A7BA 4M4RA 4NQUA 5CZVH 4PJDE 4FQLL 5I1IH 3AS0A 2XN9D 1W2KT 4WTZG 1ZOXA 3GMNA 4YXLH 3QCTH 5KBNC 3STLB 5J1TC 2PO6B 3C9NA 3FQTB 3K4DA 3RNKB 5FAAA 3O41B 2P24A 4Z78B 4G6AD 3SO3C 1BP3B 3OXRA 4E42A 1E4WH 5EOQL 1LQSR 2I25N 3ARDC 1FV1A 1T7WA 2ZCKH 6CGTA 3KPPB 3VU2A 1DQJB 1AQDA 2NY3D 4W68A 3GUTB 1JWMA 1I9RH 5E08H 3JTSA 4WEMB 3F5WA 3DX6B 3NCYS 3G5ZB 3RL1B 3T0EC 1NDGA 5JW4R 4LRIA 4QRPD 1KCKA 4FTVA 4I77H 3STZB 3TP4A 3MV11 3W0WB 4MAUL 1YNKH 3F7YB 2WINA 5I8KH 4DTGH 4N1EA 2KKQA 2FZ3A 1BIHA 3BPLB 1HSAB 3TCLA 5T5FH 5FO8A 3HKFA 1Q8MA 5D7LA 4NWUL 2GAZB 3VFMA 4XBPB 3O3EA 2NZ9C 3VI4F 2FATH 5BZDB 4LCWA 3NIDF 4K71C 4OD2B 5IFJB 4P0DA 5D4QA 5BV7B 2FH8A 3NFSH 5D7JB 3WFEL 3S7GA 1FN4A 3GRWH 1A1NA 3KPNA 4R96A 2UZIH 2WV3A 5DVKA 1J1XH 3IRZA 1F3RB 3OHXB 1KPUB 2GUOA 3QIUC 2IH3B 5T3ZH 1A9BB 1OAKL 2OJZL 5TDOB 2F53D 2JK5A 2DQUH 2ZCLL 1RJZB 1R24A 3LKPB 1TZIA 4TPRL 4P49A 3RNQA 1C7TA 4N68A 2XQYG 4N8VB 1KJVA 2CXGA 4HJGB 1YMMA 4HIIB 3RY6A 2CLVB 3GSWB 4MJ4A 2H2SD 5EBWA 4XAWH 3E6HB 5IBTL 4NRZA 3AS1A 3IDGA 3GK8L 3NGBB 2ADJB 2ICWB 4Z7NF 3GMLA 4HWZA 1OGAB 2O93L 3SDCA 2CR6A 2DOCA 2UZYB 4KRPD 4YUEH 3U1SH 5JPNB 3ARWA 4YO0B 3U36B 4LSUL 2AXFA 5ADPH 4E41B 1JRHI 4ZQKB 4R2GD 1L0QA 5I1DB 4P2RD 2QTEA 1U3HB 4PRAB 3MYJB 1TQCB 2E7LC 2VRAA 3LKRA 2P42B 3ORJA 4JQVA 3QEHB 3NIFF 5E99L 3KVQA 3O6ML 4GG6A 3FB5B 5EIQA 5ESAA 4HV8A 4LAQL 4MD5A 3U2SB 5AZ2H 4PJ9B 5ECJE 1I1AC 1JPST 1YN6A 3ZYZA 1P2CA 3A6BH 4XI5D 5MERA 3HMWL 2AJXL 4S0TD 1LO2H 1TJHH 3EAKA 3L5IA 3QDGD 3TIDA 3GJFK 2ENSA 1LP9A 3HI5L 4OCRH 1JNHB 3ARBD 1BLNA 3IAPA 1L7IH 3TV3H 2VLRE 3KYMA 2CRYA 3NFNB 1DEDA 1HSBB 5GRUL 4JFEE 4U1SB 4NFCA 3R8BB 3FQRA 5C3TA 4ZS7H 5GSVA 4NKDA 3D39B 3FO2B 4JDZB 4WWKB 2GJ6E 1WFUA 3QG7H 3O8XD 3QDJD 4Z7OE 2HVJB 4J8RB 3CX5J 4WRLA 3NACH 3X11B 2UVEA 1T1YB 8CGTA 4OCWL 2W38A 1A5FL 3DYPA 1F8TL 4CN1A 1T3FA 1WTGT 4OZHA 4HKJA 2X7LB 1KENH 5AAMA 2NY6B 2VB5A 3REWB 4QY8A 4JRYA 5JW5B 1AXTH 2E8ZA 2A74A 3O3AB 2EYSA 3MV9A 3GDBA 2B0SH 4JFPB 5DC0A 1UWXH 1PG7X 4H26B 4P5TB 3RKDD 1MNUH 1A21A 3D25A 3O4OB 2LU3A 2I5YH 4OJFH 3FRPA 3MACL 4MJID 4KWUA 4TRPH 4RAVB 1I7TB 2JKXA 4JM2B 2D31A 4ZTPH 1HHHB 3THMH 1MCCA 3OAUH 2ZJSL 2JJVA 3KPLA 4WI2A 4GXUN 2QSQA 4WHYG 3V5KB 4FFZH 4G6AC 3L5XL 4B7LA 4KDWA 3LEVH 2HFGL 1CFTA 4LPVA 1FIGL 2BVTA 4WCYH 3UTTE 5DT1H 2HP4A 1ES0A 3VXUD 3PWUA 3NZHH 3NABH 4JO4H 4EIZC 3C6LB 2Y7QA 4PRHA 4U6TA 3T0EE 3ZSSA 2WM0A 4TSBL 4HIEB 1Z5LB 3O3DB 5E9DD 1BBJB 1U95A 3BSZH 4I0KA 1MVUB 2E5EA 1QO3B 2X6MA 1T2JA 2EDJA 1IT9L 1MFBL 5FUZL 1MHCA 4MB5A 2LABA 1ZHLB 5IQ7H 3VXNB 3V6ZA 5I6XB 4KY1H 5IR1B 1TJGL 5HYSB 3DVIA 5DFWH 4KZDL 5ISZA 4XNQB 5HHMD 4NNPH 5DJZB 4O4YH 4BKLB 4L4VE 2N56A 4HS3A 5GGUA 5D2LE 4I5BA 1OTUC 2AJZB 2ICEA 2OSLA 3HAEA 3HC4H 3UTQA 4FXGA 4KTDH 1DE4A 1J05A 2HT2C 2JCCE 1ZTXH 2LTQB 4L4TB 5MEPA 5BO1L 5FYJE 2MHAB 3FFCD 1A2YA 5CFHA 3BQUC 5IJVA 4X4ZA 2A9MH 4JHWL 1NCUA 4I0PC 5I16B 2WWKT 4TQEH 5CIPA 2XA8L 4WHCA 5C0DB 5I1GL 5F7WC 2LU4A 1U58B 2ZPKH 1PQZA 1REIA 2AVGA 5LG1A 1ZWIB 1WWBX 5FB8B 2R2CA 1AGCB 2CMRH 12E8L 4YDLB 3L3HA 2CRMA 5GGSA 3PP4H 4G43A 1S5HB 3QWRA 2MMXA 4H20H 1L6ZA 4YHNB 3FMGH 1J0YA 3BHBB 1PEZA 1KJ3H 5I19L 2P8PA 3OJVC 4K3JL 3DMMB 4ZFFB 3SGEH 5K93A 1TZHA 3RAJH 1CZ8H 4R2GC 3PJSB 1IGFL 1AI1H 3P0VL 5FECA 5E56A 2XZAH 4MS8D 2HA1A 1GZQA 2O5YL 4O02H 3DSFH 4HPYL 4YXKL 3X14A 1AD9B 3STLA 4PJAE 5D2NB 1JGVL 1OGTB 2X4RB 5C7XH 4XWGL 3RNKA 2R1WB 1U0QA 2NXYC 4Z78A 4U1GB 5I18H 4CVXA 5KVEL 3HTLX 4YFEA 3O2VL 1CGSL 1MLCB 2NYYD 2X89A 1MWAH 5L2KE 4NJ9L 3F7RA 4LVNB 2BX5A 3PV7A 4HW6A 1CN4A 4OCSH 5H35A 2PO6D 3KPMB 1Y18A 4X7FC 3SE8H 3AREC 1U6AH 5IMOA 3DURB 1CT8A 3U30B 1UGNA 3B9VA 1M7IB 4AQ1B 2BY0A 1BQSA 3GSQB 3IDIB 1ZHKA 3F7YA 2K1MA 5FGRA 3ELAT 3ALXA 4ODSL 3W82A 1RURL 2DLGA 3O8XC 3T2QA 4G8EB 2DIBA 1GC1L 4TYUA 4KMTH 5E7FA 3BP7B 2FJGA 2E7BA 4QRSA 3SE3C 2DWDA 5CP7B 3U46A 2XIDA 5B4MD 4RZCA 2ZOLA 2N1KA 2P5WA 5FGBC 5LXGL 1EAJA 2R8SH 5ANME 4OD2A 5E4IA 2HMID 3OZ9H 1NFDA 5D7JA 4ZOCA 4NZJA 3SKNB 1CD1A 2UYLA 4I8DA 1MHEB 4ZUTB 3DUSA 3VXMB 3QQ3B 5C09B 2A6KB 1HEZA 1BZ7A 2UV3A 3EYFA 3MA9L 5I1LA 3TIEA 5HYJA 5I74B 5ACMA 1F4AA 4KTEH 5ITBL 3VXOB 1RJZA 2AI0H 5IJKC 2ZCHH 4N8VA 5I1CL 1TTUA 4UT6H 1W0WB 1V7NH 1AXSA 5DQ9B 3KPSA 4TN9A 5MENA 4DGVL 2X4OB 3I9GL 5E2UH 1P5VA 2DQHL 1E4KC 1UB6B 4NCDA 3RVWD 4RWYL 1OVZA 4XPGL 5BJTA 3QJHB 4ONGH 1OGAA 1DUZA 3R06B 3LKOA 4LCUA 1IKNA 5JMRA 3QH3A 4DAGH 5EUKA 5HVWA 1OSZA 5INDB 4MDJB 3VDBA 4L3EE 1IQDB 4ETQB 2EDRA 1UQSB 4S1RH 3TA3D 3KPRE 3UPRB 3LN5A 2ITDA 1FZOA 1X9QA 3BISA 4I3SL 1V3MA 4WGWB 1QFWM 3FQXB 4HKBB 1D3CA 1MJ7H 1RMFH 2EDBA 4PG9B 3WLBB 1P5UA 3H9SE 1CD9B 1CGYA 1HINL 3MROA 4ODXA 4YJZL 1U3ZA 3MODH 3U2SA 4E41D 4KV5F 3P30L 1RHHB 4G7YH 1HCVA 2X70B 5DQDH 4N90E 5HY9B 2HJFA 1YQ2A 2O5ZH 1BD2E 2XYCA 4OGZA 3UTPD 1X5AA 5HDBE 4G8GD 2EH7H 1G7IA 2QKIA 1WBYA 1X5JA 5EORH 5EZIH 4M7LH 1UWEL 3FO0H 1KIQA 5F70A 2DQCL 3OB0H 4QOKB 5CUSL 4PJCB 3WHE0 2PKDA 3EJZD 2PXYB 4V2BA 1YEHH 5FUCC 4LCIL 4PJ9D 2CXKA 1HSBA 3TJHC 3P77A 2YD1A 2F53E 4G8IB 3ARVA 4HWEH 5CSBA 1IJ9A 3V5DB 3V79C 1JJUA 4FNLL 4LCCB 3PV6A 5CILL 3RU8H 5B38G 3ZDXF 3KWWB 5HD8D 4XGZB 1HYSD 4R4BA 5D2LF 5SWSE 4OD3H 3V52L 1FFPA 2JCCF 4JGMA 4JHAL 1T0MB 1N6QL 2H41A 3D39D 4RSVA 3HNTH 1HIMH 5D70L 2VQ1B 5FOBA 4NZUL 1KULA 1AJ7H 4HQQL 3HZVB 3PHOB 3MLRL 3L1OL 2VZSA 3BPCA 5KZCD 4LLQB 4M1CC 4HMEA 4YNYA 3K46A 4HBCL 1CVSC 5B8CC 3UJJH 2YD4A 2YRZA 1CBVL 3QI9B 2GSGB 1AD0A 3CVIL 1MY5A 1JPTH 3S36X 4GAGH 5DHVB 2NY6D 1NGWB 4PGBA 4NNYA 5C9JA 1T2QL 2YS4A 3GBMH 4XPHH 1YY8A 3U9UA 2V7NB 2EXWC 3QISA 1G9MC 5HHXH 5DI8A 1LEGB 2ZG2A 4P5TD 2ZUUA 4IM8A 1JNNH 5KVFL 1SBSH 2OI9B 1BREA 5JW4M 4X6DE 4X7SL 4F7CA 4Y2DB 4JY5L 4RCAA 3IVKB 1UB5B 5EZJA 4R4ND 2OTWA 4N5ED 2KPNA 2AGJH 1T5XA 5F9WB 2CKNA 2EO9A 4OF8A 2YPVL 2E7HA 3BP4A 1JI1A 4N0UB 4DUXA 1MCHA 2Z4QA 4NQCB 4JR9H 3VRLE 3PDGA 1E6JH 3CFJB 5HGBA 1QLFA 4PR5B 2X4QA 1GPOL 3UTZB 5DC4B 4GS7C 4PJAF 3QDJE 1FL3B 4PJEE 1RJCA 3RVUD 1CXKA 5A2IH 3ZKXB 3ARFA 3JV6B 4Z9KB 3BWUC 4LLMB 1CQYA 3QA3B 3TH3T 3VCLA 4KKBC 1I9JH 4PJXA 4Y88A 3LAFA 4JKLA 5FGCB 4NCC2 4MJ6A 5EG6C 3QZWB 4HGWB 2OQJA 4PRPB 5B4MC 3V6OE 4NN5B 4KMQA 1UADC 1UA6H 1CDBA 1QSEB 3O11A 3SCMB 1LO3L 1EAPA 1SJHB 3T08A 3HFMH 1RZFL 1F90H 4WU7B 1K4DB 5C86A 1RUPH 5HGAB 1JYNA 3T0VA 3DARA 5CGMA 1U8MB 5CSZB 1L9MA 5CZVL 5I1IL 4K7PX 1I1FA 5KSVB 5C8JA 3F12A 1AGDA 3CZFB 1NGYA 5HI4D 1IC1A 4GKSA 4JKMA 3ZDZF 2YN5A 4MQSB 4B7IA 1NC2B 1IAMA 5K9OA 1NC4B 3CLEH 2D7TH 4XB8A 3IFOB 1E4WL 5KSBB 4P4KA 1FFNA 4K7FA 5CGTA 2ZCKL 4OV5B 3GKZA 4IMLA 3QUMB 4OKVA 1RVFH 1OP5K 2FBJL 3OGCB 4O5LH 3WKMH 1I9RL 4K94C 5E08L 5CEXB 1WT5C 5E9DE 4DCQB 3D85A 1T20B 2R56H 2XWBA 3MRCA 4X83A 4C56E 3N0PB 4RMRA 3DMMA 3PWJB 1J8HB 1NCNA 4KVCH 4TVPE 3FO1B 1KPVA 3GGWB 5FIEA 4M93B 3TA3C 1AR2A 3WS6C 3CH1B 4H0GA 4I77L 5BVJB 2ESVA 4JY6A 4OQTL 4LKXA 1ZVSA 3EO0B 2NY4D 4GFTB 4KKNA 3QUYD 4JPIA 4RMSA 5D5ME 4PJ5B 4X99B 2WWMD 3B6SB 5T5FL 5HHME 4Q9QL 1T04A 1JGEA 4IRJA 1VFUA 1D5MA 1ITCA 2FATL 3OR7B 1MLCA 2Z31B 4DZ8B 4IEFB 4YHLH 2IBZX 1QVOA 3NFSL 1DR9A 2WBJB 5FYLL 3GRWL 5F7FA 3RRQA 1PG7H 1J1XL 2MQ3A 4QEGA 5FUCE 5HYEA 5FV1L 3EJZC 4WW2C 4Y4KA 5J3HC 3WCYA 1U36A 3G6JF 3DIFB 1HKFA 5T3ZL 1RI8A 2ED8A 2DQUL 4F15B 5F9AC 3FQWB 3LVEA 5F6HJ 4CU8A 1H8NA 4E0RA 3MV8E 2VIRA 3G5VB 4HEPG 3SDXE 1P4IH 2YK1H 2CDFB 2ZSVA 1CICA 4G8EA 5F1KC 3UZQA 3EYVB 5HHQA 4NQEB 5E6IB 4HK3J 2YD9A 4LMQE 5CP7A 2GTWA 4NM4L 4OFPA 4D8PB 5DJAB 4J6RH 3TJEH 3WN5B 4YUEL 2XV6B 3U1SL 4LVHC 2J8UE 1BFOB 5BW7A 4KTYA 1FFRA 2MPAL 3HCVA 5B39B 1PAMA 4ZUTA 3ARQA 1J87A 1I85C 4CADB 3J7HA 2ITCA 4E5XA 1FCCA 5IQ9B 3QQ3A 5C09A 2A6KA 3D0VB 1S7TB 1MCFA 4OD1H 2EIBA 3RZCC 2G5BB 1FAIH 3JTTB 4GBXA 1MFNA 3VXOA 4U7KA 1WZMA 3KYKH 2NW2B 4YEEA 1SEBB 5DJXB 4X9BA 4PGDB 3L3IA 1HHIA 1H3GA 1SEQH 2A83B 4APQC 3A6BL 3FFDB 4KKCD 4EN3A 1LO2L 3QJHA 1JGLH 4GMSH 3P0YH 5GRZA 4OCRL 1KB9K 1OP5H 4FS0A 1A6ZB 1T6VN 1I1YA 3TV3L 3BZDA 4ETQA 4OZFG 3DYMA 1UQSA 2GEEA 5H94B 5FKAA 2MQCA 4XP6L 3FQXA 3CSBA 4GRWB 4ZS7L 3RDTD 2P5EE 1ZLWH 2CKBH 3QG7L 5D72H 4OIBA 2X4NA 4D9QD 1KFAH 3L9RB 3D69B 3PIQA 2FX9H 1MCIA 2WUCL 4MAYA 5I17B 2VLJA 1RHHA 1G7QB 2DM4A 4N8PA 1N0LA 4NCC1 1X6LA 3D3VA 1JFQH 1INQA 1AXTL 3C6SB 3KS0H 4RMQA 5KANG 4QOKA 2B0SL 4PJCA 1UZ8B 1L6XA 3R0NA 3OKOB 5CJBA 4FQPA 2PXYA 5CEYB 1MNUL 4F33B 5GS2D 1BF2A 1T7ZA 4I3RH 3FHAA 4DK6A 3IDJB 3BEVA 4OJFL 5CJ8A 1H8OA 4G8IA 4PJEF 3AU1B 1C1EL 4TRPL 4LNRB 5AWNH 3V5DA 4RFEA 1I7ZB 4R4FH 1C5DB 4ZTPL 4GW1B 4PGZA 3THML 5EU5B 1J0IA 3UTSA 3WIHA 1U8JB 3TZVB 3SJVB 4FFZL 4WDIA 3RY5A 5J1SC 3RWFB 1A7QH 3NAAH 3MGOA 2NMSA 4G6JH 3DX8A 1GSMA 4G3YL 4I13B 1OAYH 5GS0H 4JQXA 3ALPA 2IQAA 1DZBA 3HLAA 4C59B 2A77H 2VDPH 3MPCA 5JORA 4R97C 2LQRA 3GEWB 1WZLA 2CIKB 4QF1B 3MRGA 5IQ7L 4X6EA 4KY1L 3B9KD 1LEKB 1CGUA 4BFGA 3BKMH 4JQIH 4G6KH 3EFFA 3G5YB 4QT5B 4ZPTB 4UIMA 3QUYC 2WWMC 4P2OB 4BSWB 4NNPL 4O4YL 4DKEH 4TUOA 2OL3H 2E6JA 3M8OH 4QRRB 3UTPE 2UUDK 4MA3B 4NO5A 1NEZB 2BCKB 1ADQH 2YUZA 3HC4L 3PGFL 3QI9D 4G8GE 3K1DA 1UH3A 1ZTXL 4P9HC 4KH2A 5AG8A 3M17A 3IVKA 1UB5A 4LLVA 3G6AB 3SPVB 3P40A 2WANA 1N0XH 3QPXH 4CU6A 3VXPA 4DOHB 4N0UA 4C57C 4NQCA 1EXUA 3BFOA 3MQIA 2A9ML 2YEZB 2FYYB 3GMMA 5CBEB 3MLSH 4M61A 1ETZB 4S1DD 1W72H 5EU7C 4KFZC 1I3VA 2VKWA 4Y2DD 2ZPKL 2C3GA 1JHLH 1MAJA 4L4JA 2ED7A 3ZHLA 3DTXA 1TVHA 1N2RB 3PP4L 5A2KH 2Z9TA 1ND0B 2VAAA 3WS3A 4H20L 4NP4L 3TNMB 1A1MA 1MFAL 3H42H 1F11B 1JI2A 2FDBP 1QFWH 1XH3B 3HG1D 1V3KA 4FABH 4I1NB 3ZE2E 4OAWB 3RAJL 1CZ8L 1DVFC 5A3ID 5DURB 3CPLB 3EJYD 5D1ZA 1AI1L 3RTQC 5IT2H 1U8MA 5TQ0L 5CSZA 4ERSH 2EIDA 1MCWW 2VABA 3SDXF 4PRPD 4O02L 3DSFL 1R3KB 5KSVA 4WUUE 3SKJH 3CZFA 5C7XL 2YC1B 2FIKB 2X1OA 5HPMB 1BFVH 5ERWB 2OXGA 4YEFA 3CZJA 4X0KB 2BY3A 4QHLB 5IESH 4KKCC 2HFFB 1QR4A 4KJWC 1BBDH 4UBDD 5IBUG 1Z3GH 5D93C 4DN3H 4XTRC 5GGQH 1MQKH 1NCAH 3EGSB 1DTUA 3SE8L 4HZLB 4U31A 3KXFB 1U6AL 4WFFD 3VFSB 4KDVA 4W6XB 1BQLL 1DQMH 5J9PB 1K8IA 1AY1H 1ZT1A 3PWJA 3BXNA 5DK2A 1EUUA 5ICYB 4ONFH 5B3NA 4MWFA 3OXSB 3RWHB 4X8JB 5IEKA 5GJTH 1U8NB 4WV1B 3RDTC 1UENA 1UACH 3T3ME 2YRPA 2FWOA 1HQRB 4LU5H 3BZ4A 4LHUD 3MCG1 3WDHA 3OTTA 4KMTL 2V5MA 4NQXA 5IUSA 3B6SA 1J8HD 2WP3T 4UB0H 4RMUA 4PP1D 1YYMH 5DQJB 3WEXB 5D6DA 1J1OH 3JV5A 4JG0L 1EIBA 4ZO9A 4JANB 1G7MB 1PLGH 3U0TB 3X13B 2NY1B 3OZ9L 4Z7VB 4HJ0C 3G08B 1NDMA 1OD7A 3KLAA 1J7VR 3FZUD 3MGTA 5AYUH 2IWGA 4ONHB 4J4PA 2IG2H 4KKAD 3S36H 3S5LA 4KTEL 2Z0BA 1XGQA 3C09C 3NBNA 2XRAH 4Y1AD 1JUFA 5DRNA 4FQHB 5E2JA 2F54B 2ZCHL 3OG6B 3FB6B 4LRNH 4UT9H 2CDFA 2OS7A 5DDHB 4UT6L 5D8JH 5E8DH