4A6YH

Crystal structure of fab fragment of anti-(4-hydroxy-3-nitrophenyl) -acetyl murine germline antibody bbe6.12h3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
220
structure length
215
Chain Sequence
b'TVQLQQPKAELVAPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTAYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGGSYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY BBE6.12H3 LIGHT CHAIN
publication title Structural Elucidation of the Mechanistic Basis of Degeneracy in the Primary Humoral Response.
pubmed doi rcsb
molecule tags Immune system
total genus 35
structure length 215
sequence length 220
ec nomenclature
pdb deposition date 2011-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4a6yH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4a6yH02
3OJDA 1IT9H 4JFFA 1B4JH 5SX4H 4OLVH 4OZIE 5DMIH 4Y19D 3UTOA 4O2CB 2E7HA 3QZWA 4Y16A 1ZA6A 4OGYH 4P2QE 5IJVB 2Z8SA 4PJ8D 1RULH 2HFFA 3WIHA 5IB4B 2VDNL 4IEFB 1OCWH 3RDTC 1UM4H 2VB5A 4XMPL 1IBGL 1JZ8A 4JM2F 3BP5A 1X4YA 2DKUA 1A7QH 5DZNA 1AJ7L 3E3QC 1NBZB 5F3BB 1DBJL 3CPLA 3EOYG 4RAUB 2R0LL 2QADD 3D3VA 2PXYB 5HPMA 3O3UN 3U0TA 2Z31A 1CR9L 3CX2A 4MJ5A 5C0DB 4XMKL 2NY0B 1I3GH 1JGVL 5IKCA 4NO3B 4IIQA 4GG6F 3AREC 4Y1AA 2UWEB 3P9MB 3VDAA 1R24B 3BEVA 2HTKC 3GM8A 3EYVB 3VWKA 4KTDL 4PV9B 1C12B 4D0CB 1UH4A 4X83A 1OGAE 1EXUA 4P99A 5D7IE 3QUXC 4XNUH 1AE6H 2VISB 3CSBA 1QFWM 2NMSA 2IQ9H 7CGTA 3R0MA 4NZJA 5A2KH 1NC2B 4S1DD 3A67H 3DMMA 1KJVA 1J8KA 2ARJQ 5JXAH 3GM0A 1ZT1A 2XN9A 5FXCH 3LS5H 1C5BH 4OCWH 3LV3B 1XR9A 3K2UH 5DURB 3GMLB 4U1LA 2IBGA 1I7TB 1LEKA 3QCTL 5JPMA 1J0JA 4HKJB 4PJEB 4NRYB 4GW4A 3TNMA 4Y2DA 5CZXD 4XB7A 4NNXA 4P2RB 4APQB 5BZDA 3OB0H 4XHJD 4HUNB 4IS6B 5D8JH 2YS4A 3BGAA 1EFXD 4HS8H 3CXDH 3D0LA 3QYCA 3GSVA 2DWDB 1WC7A 1IEBA 2QQKL 4QRRD 2YKLH 3ILPB 1JL8A 3DO7A 4NM8L 2W0LA 1TJGH 4IRJD 2OR7A 1MIML 4XWOD 2VDRH 4X80L 2R1YB 1CD1B 2NY7H 4ORGB 5C0BB 1NLDH 2PYFA 1H3WM 1AGDB 2XKNA 1WFOA 4LIQL 4OLXL 3HLAB 5KVFH 2X4RA 2AXHA 4LCUA 32C2A 4PBXA 4KUCF 1HHKA 4G8EA 4JM4L 1FL3A 4NRXA 2G75A 1B3JA 3GIZL 1GGTA 2BNQB 1XR8B 3EO0A 3P0GB 1SM3H 2RB8A 3IFNH 3PQYB 4ZFFB 1TJIL 3V52H 5ICYB 2YOCA 4N0FB 4U33A 3TT3L 3NAAL 5FHBH 5BMFH 4HJJH 1F90L 1JNNL 4LRNL 5IB2A 2GY5A 3QB7C 5EOCH 2C1PB 3PDDA 1M71A 2FYYB 1J8HB 2YR3A 5EZLA 1JZ6A 2X40A 5BV7C 3N50A 4X5XB 3QISA 4J6RL 5HDQH 4NFBA 4HLZG 5JHLH 3BGMB 3H6JA 4XPFH 2ADFH 4HWNA 4LHUA 4P2OD 4X9BA 3VRJB 2I5YL 1ZT7A 3VXQB 1FCGA 3TWCL 4NWUH 2DD8L 3T1FA 2YBRA 3NMEA 3QZWG 4IRZL 3RDTB 5LGJA 5F7EH 3SKJL 5AD0A 4L8CB 1WWCA 3QPQD 5FYJH 1JWMB 3M17A 2CD0A 3CIQA 5F70A 4FQIH 1HKFA 5CMAB 5E8DH 1ZHBB 4NZTL 5CEYB 4LLMA 4ELKB 4HC1A 4OD2B 4PRPA 1PSKL 4C4KO 3BN9D 5DEZA 4I9WE 5GHWH 5LCVH 2CJUL 2NZIA 3BKJL 4NJ9L 1YPZB 5J9PA 1KIPB 2Z91B 4MD4B 4LDOB 4PREB 3FTGB 1OARL 3HNVH 3LH2L 3TV3L 4ZYKA 3AREB 1K8IA 4MDJA 1YN7B 2HFGL 3BXNA 4KKCC 3BDYH 4NC0B 1UWEH 3R0NA 4MA8L 4TUOB 3OAZK 1FN4B 4PGJA 2N56A 1EMTL 1ZGLA 5EORL 5F96L 1PQZB 1R5VB 1F6AA 3CZFA 1BQLL 4WTWA 4CKVX 1XFPA 5TGBB 4F7PA 5F7HA 4F7MB 5I8OL 5E2VH 3ULUE 3PWJB 5MENE 3FHAA 4ZS6D 3BH9A 5DYOA 2W92A 4RA3A 5DC4B 5EOQH 4ODXA 5DRZB 5SWSA 1XGYH 1FGNH 4JHAH 4XNZC 2YN3A 4PJ5A 4HXAL 1FC2D 1S9KC 4ENEC 5D2NA 5DK2B 2R2EA 3DVGB 1ES0A 3GBNL 5DJYB 5C07D 3UC0L 1P69B 5DJ8B 5FYLE 4LAQL 3MRLA 1TLKA 3WNNA 3T09A 5DMYA 2DQGL 4RAVB 4YBQC 2BNRE 5KW9H 1WCBA 1LO5A 3GEWB 3NCCB 1YUHB 3RIFF 4Z7UF 3PNWB 1UB6B 1F3JA 1N2RA 4K3GA 5HI4C 1T0NB 3ISWA 3T2OA 5C0JA 3ZT7A 4PP2B 2D4FA 4UIMA 2YPKA 2ESVA 5IF0A 4G3YL 5JQ6H 3RVUD 4MNGB 1KIRB 5FOBA 3MCG1 3S34L 4U1JB 5IT2H 1IM9D 3AGVA 3I02A 5TQ0L 2C3WA 1U95A 1G0DA 4YDIL 4JHZA 3C8KA 1ZVSB 4HS3B 4E41E 3RPIA 2LVEA 4NHUA 4X6DE 5E99H 1XF2B 1A14H 4HS6B 5C08A 2EEAA 5ICZA 3H7BA 1C5CL 1VKXA 4H20L 4GXUM 2WMPA 2W9DL 2Z8VC 3MLZL 4R7DB 4HF5H 5MERA 3GMPB 1BZ7B 2XI9A 4E42B 4PB9H 5KSBA 4Y5VA 1N8ZB 1OTSC 2I27N 2Q76A 4BH8A 1VPOH 3QIUD 3L7EB 1HHHB 5BV7B 2MCPL 3J7HA 1U92A 5C9KA 1D9KA 3HG1E 4X6EB 3C9NB 5EU7E 5MHSE 2DI8A 2DS4A 5H94B 2V17L 1UENA 3WO4C 4FQLH 4IOFD 1QEWA 1FFPB 2F9BT 4TTDD 3UTTE 2WNGA 5EWIL 1GGIL 1NAMB 1HH6B 1OGAB 5AYUH 4NRZA 1AD0A 5HYIA 3S88L 3ZHLA 2APVA 5FYJD 4QO1A 3MOBH 3ZE2E 4HUUA 4O2FB 4F9PA 1YMME 4BSVA 4GKOA 5D7IB 2D7QA 5HI5C 1YEGH 4OV5B 2XRAL 3C5SA 1M4KA 1FIEA 1A6ZA 1SVZA 3ULUC 4JAMA 4ZO8A 5SX5K 4XC1H 5KOVC 3HB3C 4LARL 4I3SH 5FUCE 5ENWB 3AB0C 5IIEB 4KROB 4JJ5B 2Y5EA 4KJQC 4HUWA 5C09E 4HPOH 3THMH 4N0UA 1QD0A 5C0CE 3AVEA 2FCBA 5IK3A 3KPTA 1RZKC 3QO0A 1WIOA 3VRLE 5FCUH 3VXSE 3KPLA 5D7SL 2ZUVA 3PABA 2YUVA 5BRZA 4UTAH 4QHMA 1UA6L 1ED3A 2IPKB 1J8HD 1XF4B 1CGSL 5CJ8A 3UO1L 4I5BA 1K5NB 5JW5B 3LEVH 5A2FA 5DJAA 2P8MB 1OAQH 3U4BL 2WIIB 5BV7H 5IM7A 3RVVC 1KEGH 1F58L 2YC1A 4M43H 4QHNA 4R8WH 3MRGA 3G5XA 4ELME 1OAXL 1P7KA 1HI6B 3CSYB 4NSKA 5IBTH 5I1KH 2IADA 1BLNB 4KAQH 5DFVC 1EHLH 3MV9A 1T7XA 1F02I 1NAMH 1TVHB 4XNZB 3FO1A 1JNJA 3C2AL 2CK2A 3S5LB 2A74B 2G9HA 4KK5C 3D25A 4NC2B 5FEBA 3LQAL 5A43C 3CLFH 2JJUA 1YMHB 5DFWH 5LVEA 3T3ME 3LS4H 5I8KH 3VFSA 5MEOA 1GZQB 4UOW1 1FYHB 4KMTL 4JFPA 5CINH 2ITCA 2JF1A 4KZDL 3VXRA 2A83B 4G43B 1BFVL 4XCFL 2NTFA 3EO1A 1VCAA 2RCSH 1J5OL 2EDJA 1X4ZA 3KPSD 2XZZA 3GSNA 2X4NA 1AKJA 4M1CC 1Q9WB 5CIPA 1EAPB 3TBVB 4OCLC 3WIIL 4O51A 5IMOA 2CRMA 3EJYD 1KTLB 4BKLB 3P0VH 2V7NB 3MRPB 4JN1L 1D5MA 4JRXE 1LWRA 4ZTOH 3WBDA 3GDBA 3DHJA 3QUXD 4ZD3L 4XCEA 3DUSB 3RPKA 2H2PC 5JORA 4RFOH 3LKRA 4U0RC 2V5MA 4IMLA 5IG7A 4ZQKA 3MJ7A 5EU7C 1KCRL 4AEEA 2X70A 1RURH 5IVXA 5IBUG 1LNUB 1PLGH 4WY7L 1FZKA 4RWHA 1MF2H 5DLML 1UZ8B 4L9DA 1DN0A 4GQ9H 1MVUA 5JDSB 5ACLA 3IGAB 4XZUA 4DKEL 1DUZA 1XGPB 3BO8B 5B3JF 3MJ9A 1RZ7L 1LDPL 4OZHF 3GSNL 2P7TA 4JO3H 1QHOA 4V1DB 1HXYA 5I73C 2VTFA 5FUCC 5LQBH 1DANT 3VFRB 1TZGL 1SJHB 2Y6SC 1ZMYA 3TBSB 4M02A 5BVPH 2WBJC 3C6LD 5CFHA 1T6WA 4MAYC 4XMLL 5CBAA 1MQ8A 1G6VK 1R5IB 4OUUA 3WO4B 4LPTA 4ZAKA 1IEHA 5DZLA 3QRGL 5TDPB 5GRJL 1VGEL 1T2QH 5KSAB 2I60H 2C7UB 3EZ8A 3FT4A 4L8BA 1NCWH 4HXBH 3OZ9H 1QNZL 3LRHA 5HJ3B 1UWXH 4QXTA 2HMID 2WUCH 5MENB 3VCLA 2ZUXA 2VUYA 1NMBH 5KS9E 2V2TB 5FB8B 1ORSA 1HOCA 3DGCR 4P2QD 2Y5TA 5HYSA 5TPWH 3AB0B 3OWEA 5F9JA 3UX9B 3PWLA 4G8GB 4FFVC 1BOGA 1UXWB 4JFEE 5JO5B 1E4KC 2VJXA 3SJVE 3C6SA 2YD7A 1CE1H 4XP1H 1P9MC 3T0WA 2HFEA 4DN3H 3MV01 4NQXB 3RX7A 4ETYA 1G7JB 2A6JA 3QDGE 2P46B 3QNXA 2GAZA 1R3KB 2GJZB 4NQDD 1UWGL 1SBBA 2BNRB 4FFYH 1QRKA 4LRIA 2GFBB 5E94A 5EA0L 3W39B 1BGXH 3CVIH 1OL0A 4OLZH 5HYJE 1XF1A 2PR4H 1ZHLB 3S96A 5IVOA 4Q9QL 3F7YB 3O41B 4GSDH 2AJZB 3QQ3B 3MXWH 1FE8L 4W4OC 4UILL 4R90L 3PHSA 5DQDH 1WBYB 3GSRA 4S1QH 3TF7C 3N9GH 4MNQB 3QFJE 5JR1H 3REWB 4MS8C 1WITA 3QH3B 3EOBA 4GKNB 4F58H 1LO0L 4LSPH 3ULUH 3ARZA 1F4WL 4E41B 2X4QB 4X6DB 1J11A 5GRUL 5CP7B 4QNPF 1BIHA 4MA7H 5IQ9B 1YEKL 1FNGB 3HA0A 5AWNH 4L29B 1PZUB 4KJYA 4K7PH 4TULL 1ACYL 1G6RA 3CFBB 3QXDA 1RZKH 1MRCL 1H0DB 1CBVL 4HWBH 3ZYIA 2GY7B 3OPZL 3IJHA 2DQJL 4M6NH 2D0GA 4RMWA 5E03A 2M1KA 5FYLH 1MLBA 3QWRA 3BD5A 1F3DH 1FJ1B 1UZ6F 1QFUL 4K9EL 3HG1B 4U0RB 5EIIA 4XVUC 3S9DB 2BVOA 4NQSA 3VFWA 5I17B 2VN7A 4LAJH 4QLRA 1H15A 1BD2B 3UTTB 5T33H 3ZKND 3KS0H 5CCKL 4YDVB 5DRXB 1QKZH 2PYEE 4M1GL 3WN5A 5L8KB 3MLXL 3IKKA 3H42H 3WCYA 1YMMB 2DDQH 3X13A 3Q5OA 1TETH 2FL5A 3FQRA 4OQ1A 3TBYB 4H8WL 3ROOB 1Q9LA 4DFIA 2R4RL 3C08L 2FBOJ 3RGHA 1Q9OA 3QIWC 3GNMH 1G6RL 2Q20A 1MH5A 5I73B 4M62H 4P23A 4DGYL 4P59H 3MNWA 4NFDA 3CU1A 5GGSA 1U3ZA 3IS1X 1WV7T 4ZUTA 4M5YH 4KDVA 4OCYL 5C09B 1MCBA 2WBJB 4E9LA 2VH5H 4MAYB 5C0CB 4Y4HC 1BVLA 3W82A 2AKRA 1A7OH 3QCUH 4PJ7A 1IGJA 3ARVA 3ZL4H 3VXSB 3H0TB 4F15C 1VB9A 2MTPA 2YD6A 1GAFH 2FATL 4IM8A 2X7LB 1REIA 4JCMA 3OR7A 4DZBA 1GC1L 5F7KC 4GKZA 5DJ0B 2HVKA 3VXOA 3G9VA 4ONHA 1IEAB 3GJFA 1TQCC 3P0YH 4KXZH 4N8CL 4ELMB 1XEDA 3RNQA 5FO7B 5TQ2H 4JKMA 4MJ6B 3VWJA 3KLAB 2C3VA 4C57C 2EICA 4JB9L 4WU7A 3TNNB 3SE8H 2CMRL 2H45A 3DX7A 4KGJA 3RIFK 2C5DC 5HYSG 1KLGB 3N1MC 4LCCA 1PW3A 4XBPB 4D0BB 3U9PH 3T65B 3RWEB 5DEGB 3FZUC 4XXCC 3RWDB 4RGNE 5FA3A 2ATKA 3DETD 5E0QA 1HCFX 1OTTD 2CLZA 2HH0L 4ZSOA 2HAZA 3VI4E 5LGHL 2BHZA 4P46D 4OCRH 5HD8D 4WO4C 3OJVC 4K3DL 3ARGD 3FRPA 5F3HB 3H9SB 3C5JA 3RTQC 4DKDC 5IFJA 2CRIA 5C0GB 1BFTA 3TIDB 4QTHB 4P5MB 4X99B 4UINL 4LHJB 5SWZD 1N5AB 3DROA 3H9HA 4JPKL 4MXWH 2IH1A 1JIBA 4JRXB 3A6BL 3B43A 2A38A 2F8VA 4TSBH 5HGBB 4QY8B 2ZUTA 2X9YA 2OSLB 3PWVA 3T77A 2MHAB 4ODVL 2M2DA 2FJHA 4HAFA 4DWHA 1NBYB 3MLTA 4YDKL 2GUOB 2VOTA 2YA1A 4QT5B 3OKMA 3DSFH 5MP6L 4KJQD 5GGTL 1O5DT 1C7TA 5EUKA 2F19L 1INQA 3W0WD 5FO9A 5C0RL 4A2LA 1IILE 3MOQA 1QFOA 4QXGL 1GIGH 4HGWB 4X4MA 4QHLA 1MCWW 5EIQA 5ISZA 1D5ZA 4CVXB 4KRMB 3RZCC 1OP3H 3MRIA 1IC4L 1T4KB 4QOKA 1GHFL 5D1ZD 5EFIA 3S37H 2V2WA 1RJLB 4PD4K 5I8EA 3NCJH 4MD5B 3V6ZB 5JOFB 4UB0L 5C0NC 1T1XB 1T3FA 3UMTA 4KXZI 5GGVL 4N68A 5KVEH 3GK8H 1X5JA 3L3OB 3GKWH 5DFVD 3VFVA 3K81A 5C3TA 3GMNB 3VG0H 2V5SA 4O4YH 4LKCA 3IJSA 1IAIH 1MJUH 3B3IA 1DQTA 4HX1B 4C56D 1BP3B 4L8SC 4PJDA 2F53A 3TZVA 3OR6A 4DEPC 3QFDB 3QIWB 3QEQA 5KS9B 1RMFH 4CADB 3MC0A 5KSVA 3V5KA 5H35A 3SE3A 2A6KB 4X5WB 4WEMB 4QXUL 2X89D 4JFEB 5KVGH 4G6MH 4Q0XL 4Y4HB 3SJVB 1NDMB 4Z7WA 4M1CD 4RGNC 3ULSB 2I26N 4F15B 5ECJE 4IMKA 3QUKB 5DJZB 3SKOB 3IJYA 4LHQB 4LP5A 2AEIT 1LGVA 4J1UB 5ERWA 2MQCA 1AI1H 4JFYB 1ZEAL 1T5XB 2H2PD 1IGCL 2ZSVB 4PV8A 3HG1D 1IL1A 2A9NL 1WIPA 1IKNC 1IQDB 4ZO6A 1TQCB 2A9ML 4BK4A 1ETZB 1QYGL 2P48B 3LKSA 3MSPA 5D2LE 1U93A 2FECI 3UTTD 1G9NH 3LQZB 3CDGB 4OKDA 4UV7H 2IPTL 4P0DA 1H3GA 1U8PA 3FFCE 4FA8A 3OF6D 4G6JH 4GBXC 4QRPA 3TN0C 3UYRL 4KHTL 4X9FA 3O3BB 1OWWA 3QFJB 4PRNB 4HKZA 1E6OL 3AAZB 5ELIA 3CCHA 2A6DB 2NY5C 2XG4A 2L0DA 2B1HL 4HUXB 4WO4B 1Z9MA 3O6LL 3TH2T 3VXNB 4JQIL 3RTQB 5C09D 4IHOB 3VFUA 1DQDH 3IDMB 5GJSH 4YX2H 4JZJC 2IAMD 3K4AA 2ZUSA 3EYUH 4FXLA 3ECBA 3VXSD 3LKNA 4JDZA 4ZG1A 3KPQA 1Z3GH 5LWYL 1O0VA 2ZNXA 4EDXB 3WJLC 1P6AB 3BE1L 4ERSL 4F9LA 4X8JB 4F3FA 1IAII 1KF9B 1INEL 4HZLB 2EIDA 3RUGF 5F71A 4JQXA 1T1YA 1M7IA 3G6AA 5DK0A 1KLUB 5BJTA 4HUVB 3ES6B 5HDBF 3ZKMC 2Y07H 4L8DA 1U8QB 5F1NB 4WFEE 5L7XL 1RZGB 3LKPB 4Z95H 4MLIA 3L1OL 4BUHA 3BUYA 2PO6A 2VN4A 1Y0LB 2PYEB 1U3HA 1R3LA 2WUBL 4FABH 2G2RA 3HRPA 2QKIA 5D1XC 3GSXA 5E8OB 4U2ZA 3MZTA 3RZCB 1CLYL 1MELA 3JV5A 4YHIA 4OI7A 2VLJD 3SPVB 4FFZL 4N8VA 4X4YB 1QSEA 4MJID 4P3DB 4ALAH 2F54E 1H3VA 5ACMA 4BSJA 5JW4N 5TDNA 4NQCD 1Y6NR 2ZCKH 1W72L 2G5BB 1RSFA 3MRDA 4PY8I 4JFQB 3BZ4A 3HAEB 1DQMH 1QSFE 1BZQK 1S7XA 3LEYL 4LF3B 3BT2H 4CU6A 1IAKA 2W60A 4HFWA 4L8SB 1KPVB 1VGKA 4DEPB 2VAAB 3MBEA 3OGCA 5BS0A 1IKFH 3L3KB 3E6FA 4N1CA 4PB0H 4NUJA 1ULVA 4DKAA 4LSVH 4P2CG 3X3GH 4OIBA 1N0XH 1LE5B 1TZHA 4NQED 4KQ4H 2AQ3A 5E9DE 1ZXQA 4XPBL 4RGNB 4UZGA 1F6LL 2BVYA 1PD6A 3HI6H 3L9RB 3R4DA 2BC4B 1IGML 4KVNH 4P9HC 2Y06H 1BZ9A 1NJ9A 4XVUD 5K9JH 4Z7NF 1I3RB 4FQ1H 1M7DA 2BK8A 1YPZF 2DQDH 3MGAA 3SDYH 2XQYG 1FV1A 1FFOA 1KPRA 3NFPB 5HYQB 4F37K 3HZMB 1F4XL 4LPYA 3BHBB 5DQJB 1G7LB 4GBXB 3TN0B 4G7VL 2YPVH 2P42B 3HAEH 5E6IA 1PYWA 4BQ9A 1SYVB 4EVNA 2X4TB 5I66A 1KCSH 5L8LB 1NGXB 1JN6B 2DTML 2XPGA 2E7LC 4OFYD 4JFZH 4WEUD 1JHLL 1UYWH 2W9EL 5F7UA 2BFVL 1Z9LA 3PIQB 4JZJB 1AGCB 1RJZA 2WIMA 3S36H 3QDGD 4TOYL 3E8UL 4XXDA 1I8MB 1ZA3A 1JPGA 1PJ9A 2E7BA 3SQOH 2OYPA 4U49A 1WEJL 3MLRL 1IM3B 5GIRA 3GIVA 3SDCA 5HGDA 12E8H 1FYTB 1YY8A 3DIFA 4J2XA 3IFPA 2OJZH 5HYJD 3V0AC 1DVFD 2EDBA 2WINA 1YQVH 3HKFA 1JBJA 1FNAA 2OXGA 3T0ED 2KL6A 1OSPH 3CH1B 4R3SA 9CGTA 2QHRL 5A2LH 4Q74A 4BFGA 3PL6A 4KV5F 4AZ8A 1GPOL 3QFJD 4OZFB 2O5ZH 1VACA 1CGXA 3C8HA 4WFFD 5D1XB 1KTDB 2RR3A 3D39A 4G8FB 5FYKL 1CDGA 2IGFH 4XNXL 3OXRA 4KPHL 2AEQH 4PRHE 1EK3A 2NY5H 1NCAH 3GHBH 4NO5A 1UVQB 3C60D 4DVRH 3RTQD 4OZIF 3TO4D 2YHGA 3QPXL 4LSUL 4UNUA 3FO0L 1QSVA 2CKBA 2WV3A 4MAUH 1JK8A 5C0IA 4JEGB 2Y36L 1CG9A 4LMQE 4LU5L 5I1GH 4N8VG 4LLWB 2GJ6E 1MRFL 1UC6A 2BSRA 4KK8C 2GT9A 4U1HB 3W9DA 1TZIA 4N0CC 2FGWH 5F6IC 4QHKJ 4Q2ZB 2NY1D 3PWPD 2ZNWA 5JPNA 2FR4A 3UTZA 4D9RD 2YWZA 2FX7L 2OMBA 4YHNA 4HHAA 3REVA 1LMKA 5ESVB 4JO2H 3MCLL 1BQSA 5D2LB 5CWSA 3SKNA 4X7CC 1JPTH 5HHQA 5JHDE 2CIIB 2GSGA 3BSZH 3G6DH 3TIEB 3KYKH 4OM0H 1V3MA 1CN4A 3FFCB 1ZTXL 3VJ6B 4FP8H 3MFFB 2X44D 2AV1A 5FF6B 5GS0C 4DFHA 3HE6C 2VL5A 2X4UB 4MXVE 2RGSA 2DM2A 4Y5XA 4NNPH 3MLUL 4HWUA 3HMWL 1PZ5B 3A6CL 4U6VL 3RZCD 3NA9L 2X6MA 4JKKA 3RVTD 2P1YA 5CJBA 1MREL 5D7IF 1RIUL 3FOLB 4KRLB 1WT5C 4Z78B 3S3SA 2AABL 4Y2OA 4QRSA 5J4MA 4E0RB 2EIZA 4YXLH 3IDNA 2FO1A 4YDJB 3EO9L 4QRQB 4OI9A 1U8JB 2JK5B 4C59B 1S8DB 5H2BB 5DA0B 4G6FD 1QSZA 1U41A 4JM2A 4LASL 4WDIB 4P5TA 1WK0A 4G9DB 4NT6B 1U9KA 7FABH 1KCKA 3X11B 2DYPD 3WFHB 3E0GA 2QSVA 5J13C 1N7MH 3I6GA 4G80A 1A1NA 1U8NB 1JPSH 2EXWC 4WWKC 4X0KA 1KCUL 2GKIA 4MWFA 3DBXA 1FAIH 1A5FL 1K4CA 2H2SD 3I75A 4LEOA 1MUJB 5GISL 4ODTL 3BRDA 3HUJE 1FL5B 1ZS8B 3V2AR 5J12C 1AQDB 4K07A 4G6KH 2HTLC 1YN6A 1BQHG 3JVGC 2NQCA 3VD3A 4U6YB 2OR9H 5I1HH 2WP3O 3Q5TA 2OJEB 1ZLUH 4X6CE 1DSFH 2VXUL 4U1MB 5I71C 4R9HA 4K3EL 5IB5A 2AI0L 3WXVH 5IHZB 2ADJB 3I9GL 2BNUA 1WBXB 3ZYOA 4XWGL 2BJML 3EDEA 4P9HH 1I8KA 3AC0A 3HN3A 3VW3L 2VR5A 3MREA 5GJTH 2F54B 3TCLA 5DMKA 4R97B 3F12A 3WFBH 5KSUA 4EN3D 3VXPB 4HFUL 1QRND 2QSCL 4HV8B 3QDMA 3P77A 4I77L 1PKOA 1NFDE 3GMRA 1F3RB 3TN0D 3PGFL 1QSFB 3I2CL 3UYPA 2MOVA 1E4XL 2VZSA 3MUZ1 5BQ7B 4JY5L 3SCMA 3MRKA 1MFDL 5I2IA 4WENB 3ALWA 2GTZB 4JO1L 3KLHD 5FM5M 1NAKH 4XGZB 35C8H 2FEEI 4LSQH 1J1XL 4KJPD 3IDXL 3GFUA 5CHNB 4RGOL 4ACPA 1D6VH 4LKXB 3Q3GB 3OB0K 2HT4C 5IR1A 2K1MA 4ZPVB 2YN5A 1H3PL 4HIEA 3QDAA 5DO2C 5F9DC 4LLQA 4EUPA 3X17A 1Q38A 3C87A 2YZ8A 4LCYB 3T4AA 3KPRA 3M45A 2V6HA 5F6IB 4XBGA 2AGJL 5DDHB 2QHLA 3AM8A 3SDAA 1D5XB 4WFGE 5INDB 4MA3B 3IXAB 3ARYA 1B2WL 4XAWL 4J4PC 2B0SL 2E7MA 3DRTB 4H1LB 1KIQB 2O26U 2P24B 3NIDE 5IB1B 1DUYB 4M4RA 3MRCA 1MY5A 1IGTA 4MCZB 3U46B 3QDHA 4WV1C 4DKFH 4Y4KA 4JRYE 3TYGL 1DQLL 4D0DA 4M7KH 2EDHA 3HE6B 4I2XE 2D7NA 3HE7A 3SN6N 2F5AL 3MJGX 3NZHH 2J8UA 3DXAD 4FXGB 3SGJA 4UOJA 2P8PA 1TTUA 3MFGB 1JWUA 1N3NA 3I50L 4U6XA 4FOMA 2VL4A 2Z92A 5D4QA 1LO2L 1LO3L 4YO0B 1B0WA 2Z4QB 3FO2B 1E0OB 1CL7L 4LCIL 4PJGE 3O2WL 3TO2A 3P30L 2FX9H 4ZUUA 3HC3L 4GKSA 4Z0BH 3QULA 1MIEL 5DHVA 4DVBB 1DBBH 2RJMA 3ZTNH 5AZEH 1FIGL 2NZ9D 1KNOB 2EZ0C 4QRTB 4CW1B 3SKMA 1BF8A 4Z0XA 5J13B 3WS3A 1TXKA 2AEPL 3TA3A 1KXVC 1QLRA 5F7WC 4ZUSA 4NZUH 5JOPE 3FRUB 4WWKB 3L95A 5KTEH 4ONGL 2CH8A 2NLJB 5GRZA 1JHKH 4H1LH 2OZ4H 4GRLC 4N9OB 1L6XA 3X14B 4LCWE 2EKSB 1A22B 2GTWB 4EBQH 3QI9D 3IU4L 2AK4D 5J12B 5D1QD 4HIXL 5GS0H 3O3AA 4Q9CA 5BCAA 3TYFB 1NEUA 5MEQB 3IDIB 5DJ2A 2X42A 4PRHB 5I71B 4FNLH 4HH8A 4MQSB 2VDOH 3LN9A 3HI5H 3LEXA 5HHPA 4UT9H 2B2XL 3VRIB 1T89A 1YYMH 1RHHB 3BMWA 5IGXH 1XGUA 1QFWH 1QO3A 3DV4A 4X6DF 5L9DL 4IDLA 2GJ6B 3BYYA 1S3KH 1A9BA 3JWDL 1BBDH 4A6YA 1CGTA 5DK3A 2DQIH 2W65B 4DTGL 1Z5LB 3OBAA 2DI9A 5D5MF 1AFVH 1UM5H 3MXVL 1BX2A 1EEQA 5GGUA 4H25B 4H26B 4Z8FL 4ZNCD 5I1DA 4EDWL 3UTQA 3CFKB 3FO9A 4PBWD 5AG8A 1BVKA 5DUBB 5DJ6A 4RIRB 3UBXI 4XVJL 1FPTL 3JXAA 1WQVT 3KYOA 1CDCA 5K59E 1NLBL 4X7SH 5JHDB 4ZFOA 1KEMH 3BD3A 3WD5H 1ORQB 5I18L 1A6AB 1P84K 3IRZA 3SO3C 2ICCA 2F5BH 3FB5A 2NY3C 3OKNA 3IFOA 3DECA 5C7XH 1W0VA 3IAQA 1H3TA 2QR0A 4PJCA 5TJWK 1FVEB 4FG6D 4KC3B 5B21A 4I3GA 3FQWB 4G7YL 3CFCL 3EUUA 3ZE2F 4CVZA 3FONA 4JFFE 5T1LA 2EH7H 2DL2A 3MYJA 4NGHL 2NY2C 1T2XA 1OM3L 4RX4A 1T6VN 4OD1L 3IF1A 2DJ4A 1RZFH 2IFFH 4WU5A 3IFLH 4WI8A 4ZDHB 2APWA 1KELH 3MRMA 5E1AA 3RY6C 3FB7A 4PLJC 4WV1B 4BZ2L 1SYSA 1JGUH 5T3ZE 4N9GA 1QSFD 1OF2B 3MJ6A 1H8SA 1P2CB 4M7LH 5C0AA 4ZFOL 3VRLF 3OKOB 2DJUA 1CFTA 3IDYC 5EBLA 3O3DB 4GFTB 4UU9B 4XPGL 1TIUA 3DVIA 3NFNA 4AT6A 3LIZH 3D3VE 1AD9A 1EBAA 3JV6A 3S6CA 1ADQA 1E6JL 4X6BA 4AG4L 4X7TB 3QQ4B 3TVMD 2DLFL 3VGEA 5TE7L 4TSCL 4XTRC 4Y1AE 3HUJB 3D85B 5T3XL 1SY6L 5E9DD 1UXSA 4R4NC 2CIKB 1FDLL 2ZJSL 2JJSA 4X6CB 4U1IA 1BJ1J 2R1WA 1WF5A 1LHZA 4H0IA 4NWTH 2CDEA 3OG6B 3QUMB 3OHXB 4EIGB 3KXFD 1KBGL 1BF2A 1FBIL 1IARB 5GS1C 3UJTL 4O9HL 3KYNB 1CDUA 1NCBL 1RUAL 1HHGA 2DQTH 4KDWA 1DR9A 2ZUYA 5BXFB 1KXTB 2XN9E 4LIQE 2YPLD 4YQXL 1MEXL 3FT3B 2NY6D 3HS0A 2WWKT 3G5ZA 3MLWL 2YUXA 4GRLB 1OAUL 1NFDB 4OF8A 1ADQL 4ZXBC 4LSDA 5GS0D 4JRWA 4YPGB 25C8H 4L4JA 2R0ZL 5FA4B 4OIIL 3HZYB 3V5HA 3O9WC 4LOUC 3DYMA 1QR1B 5IMKA 2YSSA 4AQ1B 5BW7A 1CLOH 3LRSB 2V5RA 4LPVA 3QG6B 1DBKL 1U8IA 2CDFB 4GMTH 5I0ZA 5T5FH 4C83A 2GSIB 4OLEA 3JV0A 2XTJD 2JB5H 4LMQI 1LP9A 2VLRA 5E5MA 5FGCE 4F2MB 3L3IA 1P4LB 4JHWH 1FNFA 3QUZD 3CFEA 3QUMH 4LDLB 4OGAD 3L3GB 3QIBD 2X4PB 1CIUA 1QQDB 3O6FA 1R3JB 4OT1H 4Y16C 2EDWA 4NHCH 2H6PB 1U8OB 1UKSA 2FHCA 2NXZC 3GSOB 1EDQA 3U7YH 3NACL 1EZVX 3QBTB 3SO3B 4JRYB 4U31A 4YHLL 4WI4A 4P4KD 5HHME 1NANI 2NY3B 5DD5L 5CUSH 4HIJB 4HPYL 4I2XB 1I1AD 2HTLD 1N59A 2YEZA 4HGMA 1VFBB 1MFEL 1A7PH 4WJ5B 3VFOB 1YEJH 4PD4J 1X7QA 3PDOB 2XG5A 2UVFA 2Z31C 3NIGE 4G5ZL 1NPUA 5L88L 3LZFH 2NY2B 5GGSY 5HI3C 5KJRL 4IIQC 4EIZC 2AJXL 4P4RB 3MV7E 2VLKA 2JELL 5KS9F 1K2DB 1TCRB 2H9GB 2ZSWB 1XCQA 3WFCH 3VWKC 2NPLX 4PJGB 3RL2A 2VXVL 4YHMH 5IW6B 3U9UA 1AO7D 4WW1B 3HZVB 5IFHL 5C2BH 2EE9A 5GGQH 3I3EA 1NGYB 3OX8B 4JKPL 4OZHA 3C5ZD 4BFIA 3WDHA 2JJTA 3IDYB 3DMMC 1A6UH 3QEUA 2A73B 1QPPA 3H3BC 1XMWA 5I15H 1HHJA 5IROC 4H5SA 3MGOB 4JY4A 5CILH 3UTSA 2DQFA 2XY1A 1MAJA 1BBJA 5J0BA 1KG0A 1NL0H 1G84A 3HCVB 1UM6L 3IVKB 4LCWB 4JE4B 3MNZB 3FQNA 1G7PB 2DLTA 3ZDXE 1S7VB 2R2HB 5HVHC 1Q94B 2MCG1 3UZVB 4AJ0A 3BD4A 5I1IL 2QQLH 3OTTA 4FN0A 2HT4D 4Y2DC 2W0PA 2GITA 3G5YA 3H3PH 4Z77B 1OAYL 2IBZX 3OGOE 3BZEA 1JGLL 5ACZA 4R6UA 3Q5YA 3EDJA 3TJEL 1FZJA 2R0KL 2NX5D 5GS1B 2I07B 4KHXL 2CLVA 4EQ3A 3L5HA 1OAKL 3VFPA 4K94L 4YHKL 3EAKA 1UWXK 1F8TL 1VADA 1U8MB 4AIXA 1MNUH 2FIKB 3WIFA 1V7MH 2YA0A 3ILQC 5E2JA 5F44A 5FK9B 3VMNA 3VXTA 4PJ5E 1DANU 4ZXBB 1P7QB 2FZ3B 5D2NE 3ZKSD 4GW5A 4NFCA 3FFDB 5LBSL 1WUNT 4JPIA 3RVXD 5DUML 2R2BA 3MRRA 5GRVL 1HNFA 2DQUL 2XWBA 5GGVY 3PGDB 3O9WB 2A6IB 1T03L 5BO1L 2VDMH 5KG9A 4I0PA 2QL1A 5KANG 1EV2E 1V3LA 1NCCL 1GH7A 4FXKB 5EZIL 3BH8B 4UMGA 1T21A 1ZHKB 3FCTA 1A6VL 2YK1L 1MFBL 2YD8A 3JZ7A 4Q9BA 2F58L 3UCRA 2ESVE 2R29H 1E28A 4ESKA 2NNAA 2GCYB 2VLMD 3CUPA 4XPTL 5I16B 3MA9L 1GZPA 2J4WL 1IGIH 1JPFA 3FQUB 3OJDB 2BXYA 2WWMD 1LO4H 4JFFB 3LB6C 2FB4L 4YH6A 3V4VH 3QJHA 3Q6GH 3QZWB 4Y16B 2ZG2A 1ZA6B 5HHVH 4Y19A 2VDKL 3HNTH 5C08E 2HFFB 2NXZB 3ZTJG 4GRLD 1DLFL 1KC5L 1MCEA 4PJ8A 3EOAA 3VGAC 4EI6A 3LMJH 2BDNL 4TSAH 5EIVA 4CRPA 4PS4L 4FQPA 4OD3L 3BP5B 4OZ4A 5KSBE 3S8WA 3B9VA 4P5KB 2F74A 1T7WA 4H88L 3U4AA 3BZFA 3D3VB 1IZKA 3K4ZA 4DW2H 2OP4H 1M6OA 3U0TB 2NXYD 2Z31B 1ZVYA 1N4XH 4MJ5B 2YD5A 1IBGH 2JCCE 5JIKA 5IKCB 4IIQB 1TTGA 4Y8DC 4Y1AB 4PG2A 3BEVB 5GZOD 4JLRB 1KPUA 3VWKB 4HKBA 4KKLD 5C6TL 5AUMA 2R0LH 1OTUC 3OAUL 2XZCH 1RUKH 1S7QA 1CZ8H 3B9KD 1CK0L 2B4CL 3QHZL 4GLRI 3ALXA 4C4KT 4WFGD 3DMMB 1KJVB 2FWOA 1B9ZA 3S4SA 1DDHA 3VI4F 4FTVD 1ZT1B 2XN9B 4XVTH 4EI5D 3NN8B 5DGRA 4M61A 1MCWM 4D9QD 1JI1A 5T5NF 2ARJA 1XR9B 3WIHH 4U1LB 4N0UE 4JFXA 4X4ZA 5HHOD 1RU9H 2R4SH 4ZPTA 4JRYD 5JPMB 4QF1A 3Q48A 2AXFA 5HVHB 5D2NC 1I8IA 2NY3D 5T3ZH 1BPVA 5K9KB 4X4XA 3TNMB 4Y2DB 3B83A 4NNXB 4HMCA 1MWAA 5LKNA 1LE9B 2OL3A 5FKPA 1INDL 3D0LB 5DS8A 5SX5H 3CVHL 3T0BA 4BQ6A 3G5VA 2HWZL 3GSVB 1WC7B 1IEBB 4N5EC 2DQCL 4NPYA 3F7VA 1WLHA 3MLYH 3DO7B 1EFXA 3MV9E 1IZJA 1HIML 4WUUE 4QRRA 4PLJD 2PYFB 2XKNB 4IRJA 1A7NL 4JCLA 5GZND 4LCUB 1NGZA 3AMLA 3RIAF 1HHKB 4G8EB 1OVZA 4HLJA 3RU8H 1FL3B 3QDJD 2G75B 3WEXB 2ORBL 1EO8L 2UZIL 3U0WL 1MIMH 5JOPD 3EO0B 4YHOL 5ADOL 4YIQA 1RIHH 3BAEH 4GUPA 4LIQH 3VXRE 2ED9A 4OLXH 1I8LC 2VZUA 1MWAL 4L4TD 3SGEH 5C92A 5TFSH 1FORL 1LK3L 5L0QC 5DD0L 3NGBC 5HHMB 1S5IH 1GJIA 4NKIH 4JFDD 3KJ6L 1M71B 2AJ3A 4EKXA 5EZLB 5LXGL 3SDXA 3RWIA 4UTBH 1A7RL 4HIIA 1V8HA 3O6KL 1D9KC 3TT3H 3V0VA 5DEFB 4Z76A 1QOKA 4TVSa 3RWHA 3WUWG 3ZLQC 1JNNH 1OQOA 1R3HB 1XT5A 1JVKA 3EBAA 5LAXA 3TC9A 4LHUB 5CJOH 4EZMA 2HVJA 4MB4A 5IVXE 1ZT7B 1FO0A 4NDMB 5DHYA 3T1FB 1VDGA 2YBRB 2E27H 1RZ8A 4P2OA 4N0YL 2OTUA 5LGJB 1CXIA 5AD0B 4F9PC 2BY0A 4ZXBD 3ARPA 5E2UL 1P7QD 3VGAB 3M17B 3RBGA 3FMGH 1YEFH 3N85H 4LLMB 1XZ0B 3PWNA 1JFQL 2CRZA 3RAJH 3E6HA 3GGWA 1TVBA 3TWCH 2VC2L 3VXUD 1F11A 5J9PB 3F58H 2V9TA 2J88H 5D6CB 5BZWA 3SKJH 5A2JH 2Z0BA 1ZAGA 4ZYKB 1EPFA 3B6SA 1K8IB 4MDJB 3B2UC 3BXNB 5J6GA 5LGKA 1OP3K 3VFTA 1IT9L 5D2LF 4OLVL 1FZMA 4OFDA 1RK0A 2CJUH 3QQ9C 5DMIL 3ARBD 3I6LE 4RISL 1HCVA 1FO0L 3TV3H 1F6AB 3CZFB 4ZMAT 1E27A 1AGBA 1RULL 3S7GA 4LPWA 2OXHA 3JBG7 4FRWA 4OKVA 4GO6B 4S1SH 5GQBA 1OCWL 2P45B 5TE4H 2GI7A 1MCOH 1EMTH 5DYOB 3BP4A 2NXZD 5F96H 2PW1A 4ODXB 5SWSB 1NFKA 1A7QL 2HRPL 4IRSC 1YNKH 4LLUA 5T3ZD 5I8OH 1MHEA 1IC5H 4PJ5B 5D2NB 3R06B 1ZK9A 2R2EB 3PGCA 5H37G 3DLQR 3B4NA 3N1GC 4HC1H 1I3GL 5ETUB 3WLWC 1LVEA 4BJLA 5C07A 1WCBB 1LO5B 4ODWA 3DI2B 4F8QA 2HN7A 4LQFH 1N2RB 2ZZUT 3ARFD 1R5WA 4G8IA 3UC0H 5C0JB 4NJAH 4UIMB 2YPKB 2ESVB 4XNUL 1AE6L 5IF0B 2A0LC 5IHBA 2HLAB 2ZCHH 2IQ9L 5T1MA 5HPOA 3P9MA 4Y4FD 2VSCA 3BPCA 5C2UB 1RVFL 5FOBB 2R0WL 4UT6L 1FH5H 4V2CB 4CJ0A 1U95B 1KB5H 3O0RL 3LS5L 3IRPX 1MFAH 3HPJA 4JY6B 2DWEA 4OCWL 1NGQH 3K2UL 1IM9A 3C8KB 3K0WA 5L2KE 4G3YH 3RPIB 2UV3A 4G9FD 4NHUB 3IAPA 3ZT5A 5ID1A 2KKQA 1QA9A 5C08B 5BVJA 4XRCA 5ICZB 2VO5A 3H7BB 1VKXB 1FNSH 1Z9SA 5TQ0H 3QO1A 1IQWH 3RX5A 1S9WA 5L0QB 3LV3A 3NGBB 3P2TA 5D8JL 5KSBB 3PV7A 1LDSA 4HS8L 3CXDL 2Q76B 5K33A 3RUGA 4BH8B 4BFBD 3D48R 2J6EA 3KPMA 4QRUA 2D2OA 2YKLL 3ZKQD 5JXEA 1C5CH 1P1ZB 2KH2B 1U92B 2FSEA 1D9KB 2JCCB 5KOMC 1TJGL 1X5AA 3QIUA 3BYTA 2CXGA 4RA0C 1C8PA 4IS6A 4ODSH 4ZAKC 5KVFL 4NRZB 1AD0B 3JWOC 3ILQD 3ILPA 4RWYL 5EO0B 4TVPD 1I9JL 1S5HA 3C5SB 1CD1A 1SM3L 4KFZC 1A6ZB 3V4PH 3IFNL 2V17H 4JAMB 3L7FA 2R39A 3L6FA 1C1EH 3V52L 1F4HA 3UDWA 4U7MA 4S1RH 5BMFL 4I3RH 1H9VA 3TPUA 3FQTB 4CN4A 4W68A 4HUWB 2DOCA 2J6EL 4N0UB 4RMSA 2IF7A 5IK3B 4PJ7E 3QO0B 2PN5A 2FLRT 3KPLB 4NM4H 3PABB 1P6FA 4LGSB 2AV7A 4QHMB 4X98A 4LARH 4N0FA 1ED3B 5HDQL 3JUZA 1MHHA 4I5BB 4XPFL 2ADFL 2DLEA 1WWBX 1YDPA 3MRQA 2LV4A 5DJAB 3VFMA 2LFGA 2YRLA 1J8HA 3RVWD 5JZ7C 1GGCH 4TQEH 4J12A 2YC1B 1DBMH 3GZKA 4QHNB 1WVZA 3G5XB 3EYQD 3MRGB 3MV7D 1P7KB 5F7EL 1UA6H 2RQ8A 2IADB 5FYJL 4K71C 3UO1H 3MV9B 3W11C 4FQIL 5B38A 4YAQA 4MB5A 5E8DL 4U2YA 1I4FA 1URLA 1WSST 3MRJA 3D25B 5GHWL 5ICXA 1F58H 3MRFA 3AROA 3FT2A 5LCVL 3AMKA 4OSUL 1X5IA 1Y18A 5DT1L 3VFSB 4KKAD 4ZSOE 3HNVL 1VERA 3L3DA 5MEOB 4K23H 5CMAA 5EOCJ 4BZ1H 3D0VA 4HJ0D 4OD2A 1T7VA 4JFPB 1UWEL 3IB4A 3VXRB 2VXTH 4Z5RA 2NTFB 3EO1B 4R4FH 5K93A 2B39A 1AXSA 5CIPB 2X4NB 1AKJB 1AP2B 2VITB 4O51B 5IMOB 2AVGA 3MOAH 1YN7A 3UBXA 4QWWD 4W4NA 5E2VL 3KPSA 1D5MB 2BERA 1ZLVH 4KMTH 3KWWA 5FDWA 1BFVH 4XCEB 4XCFH 4U3HA 3UTPE 2QQQA 5JORB 2O5YH 4XCNA 3LKRB 5IG7B 4IMLB 5EOQL 5HY9B 1XGYL 4ZQKB 4JHAL 3QUXA 3MJ7B 1BOYA 2P5ED 1NEZA 2X70B 1MCNA 2OK0L 3PWJA 5IVXB 1OT2A 3TT1L 1FZKB 1B0RA 4OZGA 3WN5C 4ZD3H 3F5WB 1JGEB 4DUWA 1DN0B 3IU3A 1MVUB 4XZUB 3NH7H 1DUZB 4NQVA 5KW9L 5D96C 1KCRH 4X4ME 3SE9L 2P7TB 2BSTA 5ISZE 1MCRA 4CNIA 1HXYB 4P23C 4EXKA 5DLMH 3GRWA 1RAMA 3MV8D 5JQ6L 2DF3A 5F7MC 2BRRH 4RAVA 5CBAB 2LVCA 6FABH 3B5HA 5HDLA 3QUYD 4OUUB 1RZ7H 1LDPH 5CIPH 5IT2L 4ZAKB 2IG2L 3C6LA 4HH9A 2JE8A 4EEEA 1TZGH 1L0QA 2Z93A 1BWWA 4L8BB 4L1DA 1OY3B 1NGWA 4QXTB 1MAMH 3HFML 4PJDE 1WWWX 4MXVF 2APXA 1A14L 3VCLB 3QEQE 3AU1A 1ORSB 1HOCB 4OZIA 3VWJC 5HYSB 2CGRL 4UQ3A 1OAZH 4PG9A 5F9JB 3PWLB 4HEPG 3QCVH 4HS3A 4P2QA 4CJ1A 2VABA 5L2JA 2W38A 4LCCC 3GRWL 4Z9KB 4Z7WE 3C6SB 4MCYB 1N64H 5FV2A 4AM0A 1S7UA 2HFEB 5EDXA 2Q8BL 4Y7MA 2A6JB 3QNXB 4POZC 3MJ9H 2GAZB 5GS2H 2BP3A 3U36A 4Q9RL 1JRHH 1VFMA 4GMSL 5HGAA 4FQLL 1HYSC 5E94B 1DLHA 4NQDA 2CKNA 3L7EA 4K2UL 1WGOA 1CT8A 5DD3H 3MOBL 5GS3A 3DV6A 3S96B 1JTPA 1ROWA 3RNKA 4K71B 1YEGL 4X6EA 3K46A 1AC0A 3MYZA 3CK0H 1WZLA 3I6KB 4QRPE 3JWOH 3GSRB 1FFPA 2OX5A 4XC1L 5EA0H 4O2EA 3HUJF 2EDFA 2VXQH 3VD9A 5B38G 4M1DH 1JNLH 2PW2A 5IESH 3HZKA 3EOBB 4Q9QH 4O2FA 5D7IA 4MNHA 2OCFD 4MYWB 4GRMA 4UILH 1BFOA 4R90H 3TJHD 5FCUL 2OQJA 3DOSA 1JZ2A 1WAAF 1LILA 2AAVA 4HEME 1G6RB 2FHFA 3QXDB 4PRDA 3LEVL 5D7LD 1OAQL 5BV7L 1KEGL 3W5MA 4UAOC 4M43L 3RGVD 2BXZA 4F57H 4R8WL 1MLBB 4TRPH 4CL7A 4ZS7L 3NFSH 5IBTL 3TPKA 2D0HA 3RZWA 1XF4A 4TULH 1EHLL 5DRWA 4UDUA 5EIIB 2D03L 4OF7A 1NAML 3HC0A 2BVOB 4NQSB 4KK9C 1JWSA 3CLFL 1H15B 5T3XD 4WUUD 1MJJA 4ZOCA 3LS4L 5I8KL 3WN5B 1QPXA 4IRSD 5E4IA 1QFUH 3HMXH 4WNQA 3X13B 2FL5B 3FQRB 4Z7VA 2Y72A 1S9XA 1Q9LB 1TVHA 2I9TA 5D96B 2VKXA 1CFQA 2A74A 5CINL 1Q9OB 1IAOA 1MH5B 2RCSL 4P23B 1AGEB 5CCKH 4PGCA 3SE3C 1A1MA 4ISVB 2X2YA 3MNWB 4M1GH 1G7MB 5GGSB 1QBLL 2L7UA 1A6WH 3P0VL 4UV4H 4ZUTB 4PJFE 4D3CH 1XF3A 1BVLB 1A6TA 2AKRB 1AKJD 4KI1A 3BESR 3C08H 4PJ7B 1ZLUK 4CMMA 1IGJB 4ZTOL 5TF0A 4PRAA 1G6RH 1GSMA 3CJJA 3ORJA 1P53A 1C5DA 2XZAH 4QCIA 4RFOL 4IMKC 1PVHA 2C1OA 3NIDF 1YNLL 2YXMA 3HC4L 5DUPH 5IEHA 4YLQT 5IJKA 4DZBB 5FAAA 2MQ0A 4GKZB 2DMBA 2HVKB 1SJVA 4ONHB 3VXOB 1PLGL 1MAKA 4KDTA 3GJFB 4XB8A 1MF2L 3RNQB 1Z2KA 5BS0E 3VWJB 2C3VB 1EHNA 5I1JL 4XX1E 3LY6A 5DD6A 4WU7B 3EW3B 3DX7B 4JO3L 4MXQD 4LCCB 1LNUA 5DQ9B 2ITDA 5LQBL 4JGJA 4PJGF 5FA3B 4L5FH 3D69A 4M8QA 2ATKB 2CLZB 4ZSOB 5JDSA 3QWQB 5BVPL 3T1WA 3BO8A 1TJHH 2O5XL 1JMXA 3SY0A 4XAKE 3C5JB 2VNCA 4RNRB 4EQ2A 5IFJB 3MRHA 1JYNA 1L6ZA 1T2QL 4P46A 1EGJA 4OF3A 2I60L 5EO9A 3O4LD 3ARGA 4N5UA 5DMGC 1MI5D 1NCWL 4HXBL 3OZ9L 3PJSA 2HH0H 4RFEA 3RKPA 1J05A 3DROB 3H9HB 5LGHH 3ARQA 2IH1B 4D2NA 1R5IA 4K3DH 3QHTC 4F9LC 1NMBL 5SWZA 2HKHL 5EU6D 1QBBA 4JQXC 1MCKA 3PWVB 4PTUA 3T77B 3O8XC 2Q6WA 2IPUG 5E2WH 2FJHB 4HWZA 1A7BA 3U0PA 2X4OA 3GJFH 1W8OA 2Z8RA 1D7FA 3OKMB 4L9LA 3MX0A 1DTUA 2PO6C 1CE1L 4XP1L 2NR6C 5C0BE 4DN3L 3ZDYE 4FZ8H 1U3HC 1MCPH 5EUKB 1INQB 4ODVH 5FYKE 3CDYA 4ONFH 2FBJL 4WTZA 4FFYL 3G9AB 5L6YH 4HIHA 4QHLB 4XPHH 4UAOB 1BGXL 3W0WA 5MP6H 1D5ZB 3CVIL 3RWJA 5ISZB 4HWBA 3T8XA 3MRIB 3PHOA 4P57A 4QOKB 2PR4L 2ILLA 4GSDL 4KKBC 1G7JA 2V2WB 1R3KA 2A1WH 3V79C 3MXWL 5I8EB 1RUQH 4TNWK 4KK6D 1WZ1L 1FFNA 1T3FB 3S35X 2H41A 5D1ZA 4S1QL 2BVQA 4U7SA 3N1FC 3N9GL 2Y4SA 1P4BH 3VFVB 3W11D 1IC4H 2MKWA 3O2VH 4LKCB 1D5IH 3IJSB 2YMXH 3B3IB 5EZJA 1U0QA 3GJEA 1PGRB 1DQQA 4MD0B 4PJDB 3SOBH 3D39E 2VSDA 4MA7L 3OR6B 4L3CA 3MBEC 3QEQB 1KFAL 3G08A 1A2YB 5L2KD 4AENA 3PHQA 4C56A 5EOTB 5KSVB 3V5KB 3REWA 3SBWA 4F33B 4K7PL 3U82B 4GKNA 5H35B 3OKKA 5HTSA 4NUGH 3WFDH 2VR9A 4HWBL 2RHEA 5IBLD 5ALCH 5HHNA 3UJJH 2X4QA 1B90A 1U2CA 4Z7WB 4M6NL 5IHUH 1K8DB 3B8YA 5C0FA 5D5MA 5EU5A 3IJYB 5ERWB 1MJ7H 3MRNA 4Q0XH 4PV8B 5KVMC 1IL1B 1U6AL 5FGBC 2HT2D 4ZTPH 3LKSB 4JANA 3H42L 1U93B 3HG1A 5JA8B 1TETL 1T66C 1U91A 5DJXA 4OV6F 1XGTB 1ZEAH 5KBNC 3UP1A 1U8PB 4QRPB 3GO1H 1IGCH 3CMGA 3UTTA 2A9NH 1MOEA 3MUY1 1UGNA 5E6IC 1PDKA 1Y6KR 4P59L 4Z7QF 4HKZB 4YHYC 2W0FB 2EDQA 3OF6A 4HCRH 4W70A 4LVEA 4XPAL 3BZDA 5GSRA 3P4NA 3OJMB 3CCHB 3ROOA 5I1CH 4L3ED 4M7JL 3QCUL 3EDFA 4HKXA 5F6HI 1II4E 3ZL4L 1QVOA 1LD9B 3VFUB 2YD3A 5AYQA 5D70H 1HWGB 4S0SD 2P49B 2LAGB 3LKNB 3MCKA 5C09A 4JDZB 3QXWA 2HFTA 3KPQB 1P4IH 4O5LH 2GW5A 2V9QA 2B1HH 3RY5A 2IAMA 1YY9C 1N6VA 3P0YL 3VXSA 4HWEH 4PJXF 3KS0J 4LEXH 1G9MC 5TQ2L 4F3FB 4G6AD 1T1YB 1M7IB 3G6AB 4M4PA 5DK0B 1NFIA 3O8XB 3SDCC 2E3VA 4KTEL 2X7LA 5BJTB 4MVBD 4L8DB 5CEZD 1YEIH 1HXMA 5MEPA 1IGYA 5E8EA 1KSRA 3BUYB 2PO6B 5C9JA 3BE1H 1CDYA 1FQ9C 5T1KD 2HT3D 1NUNB 2E7CA 1U3HB 3PL6C 1R3LB 1VEPA 2YD4A 4PR5A 2G2RB 2QKIB 4LGRB 5L7XH 4JHBA 2VUOA 3GSXB 4KMQA 2Y25A 3L1OH 4POZD 2KPNA 5D9SA 4BELD 4TUJA 4WTZG 3QEGH 4POYA 4YHIB 1S78D 4ORZC 2WLZA 4N8VB 3ARRA 4GT7A 5F21B 4HDIA 4FQCH 4PJFB 1CXKA 4MXWL 3L5XH 1QFHA 4JN2A 2HKFH 2P44B 2VLJA 5TDNB 1JZ5A 4XHQA 4TSBL 4TPRH 1O7VA 4NN6C 3QDME 4MJIA 4JO4H 1CLYH 1FNLA 1TMCB 4NO0D 1ZLSH 2Q1EA 3MRDB 2FO4B 4FFZH 4NQCA 4YHZH 3BZ4B 1S7XB 1JI2A 4U3XA 1S7WA 4RSVA 2VR4A 3DSFL 1IAKB 2W60B 4HFWB 3GMQA 1VGKB 1FLRH 3MBEB 1FNEA 4LK4A 3OGCB 4QY8A 1ND0A 5BS0B 3E6FB 3LN4A 4PLKC 4NUJB 4AEHH 5EU3A 2DBLH 3MODH 4MQ7A 2HP4A 3EIFA 3Q0HA 1TZHB 4JZOB 3ROLB 4HULB 4DK6A 4Y5XC 4XP4L 2C3HA 2ID5A 1X5GA 2JJVA 1S9VA 3PP4H 4NQEA 3NCJL 2D9QB 2W59A 3KPRE 5KVEL 3GK8L 2DTSA 3GKWL 1EO5A 5HXMA 1BZ9B 1I75A 1NJ9B 3VG0L 4O4YL 5CSZA 3MO1A 1OB1A 4BSWA 1M7DB 5AZ2H 5MI0C 1FV1B 1KPRB 4JM2C 4LSTH 4MSWA 4P5TC 3N1QC 2OI9C 2CK0L 1RMFL 3ZDXF 4BQCA 3TP4A 4OCSL 5TE6H 4UUJA 5E6IB 1PYWB 2FJGA 2WM0A 4YHYB 5I66B 2J8UE 3TBWB 4HX1A 1RIVL 3WKNA 1JP5A 5KVGL 4G6ML 5CEXA 3RWFB 4JQVA 4Z7OE 3HRZA 1CGYA 4G7VH 5DR5L 1ZKAA 4OFYA 3CFDA 4X5WA 5JW4M 1AI1L 1XF5A 3IS0X 3UAJC 3TESA 2XA8H 1RJZB 2DTMH 3BRFA 4XXDB 2E9BA 1JPGB 2PTVA 4PJ9C 3QDGA 2F8OA 5GIRB 4LVOC 3GIVB 3SDCB 1G9NL 5HGDB 1LEGA 3QXAA 1YY8B 4UV7L 3DRQB 3IFPB 2V7HA 3C2SA 1T1ZA 3KR3H 1F42A 3CDFA 5B3NA 2WINB 4MQXD 5FYJU 3TEUA 1T5WA 2BVEA 4R3SB 5HYJA 4HMDA 5FKAA 4WHTA 1WEJH 1DVFA 3PL6B 4RFNC 5FECA 3T0EA 3GSWB 1JF1A 3RWGA 4R2GD 1CICD 3SCMC 2WP3T 3D39B 3EOTL 3GI9H 2FEDC 2NYYD 3OXRB 2QBWA 1DQDL 4I4WA 3QFJA 5GJSL 4YX2L 3MV11 4FQXD 4KRPD 4NO5B 4DZ8A 5E08H 4OFVA 4LVNC 43C9A 4YFEA 3LHPH 1Z3GL 2CKBB 4R96A 1JK8B 4QTIH 1CG9B 4BK5A 3C60A 5FYKH 3RTQA 3TO4A 4IHOA 3BKYH 4KPHH 2X10A 3OV6A 4NN6B 5IV2A 4TUKL 4V1DE 2GT9B 3RKDD 2HJLA 3W9DB 4LFHD 3VD5A 1TZIB 1IC7H 4Z95L 4PY8J 3QPXH 4LSUH 4KROC 3FO0H 1G9MH 3O8XD 3AM8C 3SDAC 2XY2A 5JPNB 2Y36H 3WYRA 3HNSH 4LU5H 2FR4B 3UTZB 5KSBF 3QNZA 4YHNB 1A4KA 1MRFH 1I85A 3LPFA 4HHAB 2ZUUA 4PY7B 3REVB 3PWPA 3VFGL 3U30C 5CWSB 2P5WE 3SKNB 4FABL 1U8QA 3SQBA 5HHQB 2GSGB 3GBMH 1GOHA 2JCCF 5INCA 4PP1D 4Y4KC 5J3HD 2RIKA 2K7PA 2AV1B 4L3AA 2EXYD 4I0CC 2VL5B 3HE7C 1MQKH 3MR9A 4Y5XB 3IT8D 4PJCE 4PJAA 3MCLH 4JREC 5D7KD 1FRGL 5CP3A 3SDDC 3SGJC 1R0AL 4PGBA 2B1AL 1RJCA 2D7PA 4G8GE 4GAFB 1IAMA 2ZCKL 5EUOF 4QRSB 5CZKA 2BVPA 1L7IH 1VHPA 4HK3N 2EDTA 2EIZB 5TF1H 3IDNB 2CKBH 4RZCA 5B39A 1DQML 4U6VH 3L3JA 4P3DA 3BT2L 3NZ8B 5MI0B 4U3CA 1MREH 1P5UA 4X7FC 2EC9U 4KJWC 1RIUH 4JM2B 3WE6A 4P5TB 4L1HA 2PXYD 2OI9B 4R7NA 5C0AE 4PB0L 2NY0D 4MX7A 3SE4A 4AH2A 3I6GB 1CXFA 1KJ2A 1A1NB 1ZE3C 4G80B 4LSVL 3TA3C 4XNYL 3JWDC 5CD3A 4FMKA 4Z6AT 4ZNEE 2DYPA 4KQ4L 4MWFB 2VZVA 2VAAA 3DBXB 2BY1A 1K4CB 3I75B 3L3KA 4LEOB 3FN9A 2J5LC 4L4VE 3DX6A 3HI6L 4MNQE 4WHDA 1KCLA 1YN6B 4HJGA 1NC2D 2WK2A 5FOJA 3MZGB 5IMMB 4OLYL 3WNKA 1KCVL 4PJ9B 1QFPA 4XAKD 5DURD 4HUKB 4R26L 2BNUB 4LVOB 2DIBA 1I8KB 3SDYL 3MREB 3TCLB 5DMKB 3F12B 2YPVL 5KSUB 4F7TA 3E2HC 1KJ2L 1T66D 3QDMB 4P2RD 2SEBA 4FQ2H 3P77B 4K3EH 1HINH 1K6QH 2AI0H 5KN5A 3WUZA 2DQHH 4X6FA 3GMRB 4APQD 1EIBA 4EN3A 3S3JA 4QEGA 1QRNA 5F9AC 4RFNB 2VQ1A 3VW3H 2XZQH 4HQQH 5IMLA 3SCMB 3QNYA 4HT1H 3MRKB 1UYWL 1G7LA 1UG9A 3VGHA 5I2IB 2QSCH 4LVHC 2NW2A 2GEEA 4NP4L 3ULVE 2ZWLT 1BD2E 2X4TA 4PBVC 1I3VA 1XGQA 5KSAC 2W1NA 4NNYB 5C0BD 3PGFH 4LVNB 1JN6A 3I2CH 3K80A 1MCDA 2E9IA 4JY5H 3K3QA 1MFDH 1EEZB 3SQOL 5DC9B 3EGSA 1LP9E 4XP9H 4HIEB 4JZJA 3T0VA 2BNQD 4CN1A 4LLQB 1J1XH 4D94A 4EUPB 1MSPA 3IDXH 3T4AB 2DLIA 1E4WH 2OJZL 3KPRB 3NCYP 3PQYD 4XBGB 1QBMH 3SDCD 3SDAB 3BW9B 3GMMA 3LKOA 1OSPL 5F93C 3PE9A 1X4XA 3V9FA 1HZHH 3U30B 1NBVH 5B8CA 5F1SA 4NN5C 2O5ZL 3MRCB 2WQ8A 1IGTB 1J1PH 5F1KC 2NY4C 2IGFL 4Y4KB 2YD9A 2AEQL 4PRBA 1MLCA 4KZEH 4D0DB 2VZTA 3U83A 3CH1A 3HE7B 2JB6A 3IXTA 5EBWA 1MPAL 4XAWH 1NCAL 1CFBA 3GHBL 4DVRL 2B0SH 2J8UB 4LSRH 1A47A 4JREB 3AS2A 4YFLI 1R3IH 3SDDB 4MMZC 2WBWB 2P8PB 5L8JB 1JWUB 4MAUL 4XCCH 3VD4A 1N3NB 3MLVH 5I1GL 3BIAX 3P3YA 3VFNB 4G8FA 1S7TA 4U6XB 3DXAA 2Z92B 3WS6A 2DIJA 3RDTD 3TYGH 3FN0H 2AJUH 2VLKE 2FGWL 4YWGH 3TO2B 4ZUUB 1RK1A 2AK1H 1CFVL 3QULB 1Z0MA 2VZ1A 1K4DA 3I50H 2JJSC 4CDHA 2DL9A 4OI8A 4KU1A 3M8OH 5B39G 4EUPH 3H9SE 1LO2H 4JO2L 4XVSH 5F1OB 1LO3H 3WSQH 3SKMB 4Z0XB 2ADIB 1JPTL 2BZDA 3ARED 4XP6L 1CL7H 2E6QA 3WS3B 3BSZL 2VZ3A 3O45A 4WW2A 3KYKL 4IOIA 4JFHE 4BYHA 3O2WH 3TA3B 5ILTL 1QLRB 1CD9B 3P30H 4OM0L 4X9GA 4ZUSB 4FP8L 2HTKD 3VMOA 4PLKD 3L95B 5IQ7L 1HQ4A 4A2MA 3ZKXC 1S9YA 3HAEG 4NNPL 5JLZB 2AJSL 1A1OA 1FIGH 5D2LA 2J5LB 3DPBA 3OKDA 5DSCA 1E4XI 3TIEA 2AEPH 1HYRC 3EYFA 3O3AB 4H0HB 2ZG3A 3QI9A 1J86A 3QWOA 5DJ2B 5F89A 2AK4A 2X4UA 5D1QA 1MFCH 3WFEH 3ULVC 4YXLL 5BW7C 2AJYH 1PZ5A 3LEXB 5HHPB 4HIXH 1F2QA 1KYOJ 4JG0H 1X6NA 3D2UB 3L3HA 1XGUB 4Z78A 1QO3B 3DV4B 3EKCA 3WNPA 3E2HB 2J8OA 4E5XA 1L0YA 7FABL 2LE9A 4OBRA 4NKOA 3DVNB 4A6YB 5T5NG 2JK5A 1BX2B 5GGUB 5H2BA 1S7SA 5JIPA 4FFWC 1D5BA 1G1YA 1JCKA 1FAIL 5I1DB 2O61A 5L9DH 3FO9B 4NKMB 4LVHB 1BVKB 4OUOA 4XP5L 5DJ6B 3JWDH 2P5WB 3KYOB 1CGVA 2VRAA 5I1AA 5E8NA 2OR9L 4ZO7A 5I1HL 3STZA 1CLCA 3FB5B 2R9HC 1DSFL 1NSNL 3OKNB 3IFOB 3WXVL 3J8F7 1W0VB 3GHEH 2QR0B 4YUEH 4PJCB 4GAGL 3ZMRA 4XVJH 1FPTH 2EDKA 1NLBH 5GJTL 5EPMA 3FONB 4CVZB 5T1LB 1HSAB 3BWAA 4PJ9D 1RUPH 3MYJB 3WFBL 3V7AE 4F80A 3IF1B 1G0XA 1GCFA 2ADJA 1CL7I 1UKQA 5J56B 1QACA 5EH1A 4LNVA 2XWJA 4RRPA 4Y19E 3MRMB 4NN5B 4PJIA 5E1AB 2EH8H 3FB7B 3QHFH 4OGZA 2NY4B 1SYSB 4JDTH 4N9GB 4A6YH 4HV8A 1XAUA 35C8L 5C0AB 4X7DC 5IW1A 1HILB 1QLFA 2MNUA 1F4YH 4LSQL 2EEBA 1V05A 2JJTC 3H7LA 1QSFA 1BVZA 3NFNB 4AT6B 1BEYH 1AD9B 4LLVA 3JV6B 5J1AA 1OGAD 4X6BB 4BZ2H 3B8SA 5I19H 4PTTA 2GQHA 3ELAT 4L4VB 5DD1H 5C71A 3WLBA 3GUTA 3TVMA 3C8DA 4J3SA 1UXSB 4M48H 1XH3A 1F5WA 1AR2A 1WZMA 1G7IA 1E6JH 3K4DA 1AIFA 4AG4H 4U1IB 2R1WB 1T0MA 5E9DA 1TNMA 5EC1A 2CDEB 1CQKA 4KROD 5TE7H 3U7WL 4F37F 1I7ZA 3RA7H 4LCYA 4S2SA 4KKCD 1HHGB 1EAJA 2JTDA 3KXFA 3MUHL 1FDLH 1I9RH 4M7KL 3ZKXB 1JZ7A 3G5ZB 3NZHL 1MHPL 1KBGH 2YPLA 2OZ4A 1FBIH 2QQNH 1DUYA 2DKMA 3HE7D 1TPXC 1NCDH 5A2IH 1AHWA 3V5HB 3SDDD 3O3EA 1MEXH 2YSSB 43CAA 5BOZG 1NC4B 4I0PC 4OGXL 1OAUH 4NBYB 4R4BA 1ADQH 1U8IB 5CD5C 5A16A 5J11C 4JZNA 2UYLA 4NC1E 4C83B 4Z0BL 1TDQA 3VA2C 4PYGA 5ITFA 4ENED 5F88A 1TENA 2P43B 4WI9A 1J12A 1DBBL 1RPQA 3MMEA 5AZEL 1OHQA 4QRRE 4D8PB 1LP9B 2VLRB 5E5MB 4KJWD 2Z4QA 4O02H 3QQNA 4YBQD 5HHXL 1DEDA 1PG7W 3L3IB 1HH9B 5E24E 3KDMA 3CFEB 1FL6B 5HI4D 5K9OB 3W5NA 1JHKL 2OZ4L 1KN4L 4DAGH 4EBQL 3QUZA 3QIBA 1U8KA 5GS0L 1ZWIA 1FLTX 4I13B 4I0KA 4HD9A 3L5WA 1N59B 4FNLL 4WI7A 1MFNA 2YEZB 3EYOA 2GHWB 4RQQA 4MQTB 4NZRH 1ZGLM 4P4KA 5D7JC 3SDXE 1IFHH 4UT9L 1I1AA 1X7QB 1T2JA 1YYML 3V5DA 4MJ2A 5I30H 2UUDH 3ULVH 3TBTA 1QFWL 1N6QH 5MEQA 2IFGA 4YHLH 2M8XA 1BBDL 1ZLVK 2VLKB 2NTSP 4PG2C 3D2UD 2X41A 3T3PF 1AFVL 1UM5L 3BVNA 5T1DH 4K8RC 3U9UB 1OTSD 4V1DD 4I9WD 4YHPA 3MLSL 2D0FA 5GGTA 3T0AA 4RRPG 1WFUA 4YXHH 1PFCA 4BFIB 1AO7A 2Q87A 2VXVH 4YEEA 3C5ZA 1DN2A 4H26A 1HHJB 2F5BL 5F7DA 5IFHH 4H5SB 1YC7A 2P5WD 4JY4B 3UTSB 4S1DC 4ETQA 5KSAD 5EO1A 5C7XL 4KQ3H 1BBJB 3BP7A 1T0PB 1KG0B 1MVFA 5M95B 3FQNB 3ZSTA 5HI5D 2BMKB 1HHIA 2EYSB 1BM3H 1RZIA 5MEND 2EH7L 2H8PA 3ULUD 3VE0B 4BZYA 2GITB 3G5YB 1UQSA 2LQRA 3BZEB 3HB3D 5ACZB 1WBZB 2IFFL 2VDLH 3DGGA 3IFLL 5CZXC 2UVEA 1FZJB 4G8GD 4YGVA 4WGWB 1KELL 4ZUVB 4M3KB 3QA3B 1G7HA 4NC1C 2V9RA 4B7LA 5D72H 1JGUL 3VFPB 3CMOL 1RY7B 2R15A 1VADB 1JGLH 1KENH 2NX5A 2XOTA 3PP3K 4M7LL 4ODBD 1CS6A 4PLNC 3WIFB 5FYLD 1YJDC 2NY4D 3VXTB 1B0GA 2BNRD 4DOHE 4XWOC 3LIZL 4GW5B 1VSCA 3RVVD 4JPIB 1TPXB 3MRRB 2R2BB 3NIFE 4KHXH 1FYTE 4WV1A 1DBAH 2XWBB 5J89A 3KYMA 4H1LG 5KG9B 5KANI 2VERN 3LD8C 2IEPA 4I0PB 1CXLA 1CIDA 5C07E 1OGTA 3AXLA 2QSTA 3UPRA 5J11B 2ZCLH 4KK5D 3FCTB 5LBSH 4L4VD 5D93C 4MNQD 4N0RA 4GW1A 5F72S 4GG8A 5BO1H 4NWTL 1E28B 2NNAB 3CUPB 1SJXA 1GZPB 4K7PY 2APFA 2DICA 3IDGA 4YR6B 4J3VA 1JPFB 4E41D 3OQ3B 1RQ5A 3EFFB 3QEHA 2DQTL 1I1FB 1JUFB 1OLLA 2CIKA 4JG1L 3F8UB 4W81A 3MACL 5ITBH 3NCMA 3QJHB 3RHWF 3X12A 5E8PA 1WAAA 4Y19B 4WEBH 25C8L 3DX8B 4P2OC 3WHXA 1VESA 4PJFF 4LSSH 3EOAB 4EI6B 3FT3A 3NABH 5DTFA 4AEIL 3K1KC 4WUKH 4GRLA 3RBSA 1CLOL 4OZ4B 5C8JA 1KUMA 3QPQC 3RUGE 2FJFA 5MHSD 4J3XA 3RI5F 1V5JA 3QG7L 2F74B 5T5FL 5D7JB 4JGUA 3BZFB 2DQEL 1NC4D 1BD2D 4PLOB 1M6OB 1ZV5A 1HKLH 2R8SH 3BN9C 3SKUD 4FZEH 1YMMD 1CU4H 5EC2A 3JTSA 2UWEF 1AQKH 3QG6A 3ARUA 1MRDL 1KPUB 3MA7B 4HKBB 3D18A 3LKQA 4JHWL 4ZFZA 3FKUS 5HGHA 3QUML 4KVCH 3G6JE 4PGDA 1S7QB 4OT1L 3KLSA 4NHCL 4DN4H 2Y6SD 2WBJD 2AQ1A 4MAYD 5ABDE 5C0CD 2EYTA 2V2XA 1EJOH 3U7YL 3B9KA 3S4SB 1DDHB 1BIIA 4M61B 2FX8H 1QQDA 1YYLL 1AXTH 4AK1A 3P4MA 2H6PA 4JFXB 4FTVA 4ZPTB 4EI5A 2CSPA 4ONOA 3GSOA 4PJEF 2AXFB 4QF1B 3WO3B 2R9HD 3RP1A 2AQ2A 4C54A 5B4MC 4LPCA 4X4XB 5FIEA 1W72A 5HHOA 3M1BA 3LZFL 3DTXA 4DGIH 5E6ZA 1MCSA 1A9EA 4PJBA 5ALBH 1MWAB 2DLGA 1MJ8H 3A0OA 2OL3B 2EIBA 5FKPB 3KPPA 1NUGA 4S0TD 4FFVD 4WJ5A 4YHML 5DS8B 3G5VB 1V7NH 4NPYB 5GGQL 3F7VB 1EFXB 1H3XA 5DVNA 3H9YA 4P4RA 3R8QA 4QRRB 1OPGL 1ZT4A 3KYAA 1TCRA 4XI5C 4PGEA 1YECH 2H9GA 4K8RH 1A6UL 2Z35A 5EBMA 1TTFA 5I1EL 4PJHA 4YGAB 3H9SD 1KOAA 2XKUA 1CTOA 1NGZB 3D87B 3RVUC 5I15L 1A0QH 5CILL 1NGYA 1N5YH 1T1WA 1YEEH 1L7TL 3I85A 1ZSDA 2ZPKH 1NL0L 3LD8B 4YIQB 3W81A 3QDJA 4GUPB 2QQLL 4ODHL 4JRXD 4BQBA 3PV6A 3H3PL 2XT1B 3RL1A 4NOFA 5DRNB 5E4EC 3MGOA 5D93B 3V4UH 1PY4A 4IDJH 4MS8D 2ICEA 2B7DT 4L4TA 3GI8H 3MNZA 5C1MB 1G7PA 2R2HA 3KPSE 5BOPA 2X1WL 2AJ3B 1W0WA 3ZE0F 3SDXB 3RWIB 5JXEC 1CD8A 4JFDA 4KUZH 4NO2A 3V0VB 5CSBA 4Z76B 2OL3H 3QIUC 1LK3H 1MNUL 3RWHB 1V7ML 3LPWA 4OBSA 5LAXB 4FQHB 4YC2C 3KJ6H 2HVJB 1BJMA 1FO0B 5DHYB 1FG2A 4MHHG 2VDQH 4IBLT 4OZGE 1UCBL 1ERNA 1RZ8B 4P2OB 1A7RH 2OTUB 5DWUH 3O6KH 4IOFC 1YJDH 3GJFK 5FCSH 1JF6A 1I3UA 3KHQA 4AL8H 1F00I 1JNHA 3JTTA 1MCJA 4YXKH 5JNYA 2CLRA 3U6RA 1NDGA 3N0PB 3PWNB 1HN1A 1Q0XH 2R56L 3B9DA 4JJHA 4ZXBA 5AAWA 1P7QA 3B2VL 4EOWH 3E6HB 3GGWB 1TVBB 3UDWC 3NTCL 2I25N 1OQXA 1U3YA 1F11B 3UZEA 4JVWA 2Q8AH 4N0YH 4GH7B 5BZWB 1EEYA 3B6SB 4I1NB 3VXUA 5J6GB 1EEUA 3VFTB 4MA1C 1JFQH 1LO4L 5JOEA 1F2XK 1PKQA 1H3UA 2C4FU 5EULV 1ZHKA 5CLTA 3QIWD 1FZMB 3DO3A 1RK0B 4UQ2A 1L9MA 3W2DH 2H26A 5C6WH 3Q6GL 4WFHE 4PRIA 1QLEH 4OB5H 5HHVL 5EZOH 1E27B 1AGBB 4HG4K 3ARBA 1BQHA 2V5TA 3HNTL 2DMCA 4JFED 4OKVB 2BOCA 1XIWA 2D7TH 4RDQF 3O6ML 4Y4HD 3SJVD 5JW3H 1QTYT 4OFIA 1EH9A 3BP4B 3LMJL 4TSAL 4RISH 4JKWA 2PW1B 1FO0H 2BSED 4NIKB 3F65A 3CGTA 3WKMH 4LLUB 1MHEB 4OF0A 3JV4B 2XA3A 4DOHB 4G42A 3BFOA 4DW2L 2OP4L 4P9MH 3PGCB 2R2CA 1N4XL 3ZSSA 2L4OA 1CF8H 5D7JD 4R97C 3VG9C 3IKCA 2EEDA 5C07B 2HRPH 4PPTA 2XXCB 4ODWB 4P5KA 1ZANH 4V2BA 4NQDE 2HN7B 1WISA 3OXSA 2XZCL 3OG4B 1R5WB 3FZUD 3SGKA 3U2SA 1RUKL 4G8IB 4U4BA 1CZ8L 4K8RD 5T1MB 3ARFA 1J9CT 3BPCB 1HEZA 1UEYA 4JLRA 3EJYC 4WO4D 2APBA 4Q6IA 2EDXA 4M6AA 3ARDA 4XVTL 3PG2A 4Y4FA 3HPJB 4N8PA 3WXWH 2DWEB 3WIHL 1IM9B 2ICES 2XNAB 1RU9L 1GGBH 2R4SL 1CGWA 5ID1B 1QA9B 1RVFH 5T3ZL 1OT1A 2R0WH 4UT6H 5BVJB 4XRCB 1PAMA 4ODUA 3QXTA 2MWCA 4JKLA 4G9FA 1F6FB 3QO1B 5GGRA 3O0RH 3HPLA 3NN8A 5IROA 1S9WB 5E4EB 2EDNA 1OSZB 1X6LA 3KNBA 4O58H 2E5EA 4PJXA 2ED7A 4AY0A 1OW0A 3UROR 3Q1SH 4HAGA 3RUGB 2XIDA 3WNOA 3KPMB 4QRUB 5K9KA 4UNVA 3RRQA 3MLYL 1KTKE 2FSEB 3GMOA 5HVWA 2PYED 3QIUB 5CGYC 2R1XA 1LE9A 2ICWI 4YC2B 5SX4I 3C6LC 4OZFH 1AGFA 4I18A 2GK0B 3FB8A 3RU8L 4J3OC 5CZVH 3G6JB 2G60L 1MHCA 3FJTA 2XQYK 1S5HB 3T0DA 4Z7VE 4YE4H 4M7ZC 1RIHL 3BAEL 4QHUA 4ZOAA 5C0ND 3L7FB 3L6FB 4JVPA 1M05A 5TFSL 2HMIC 4M6OH 4GAYA 4RWYH 3Q2CA 3ESUF 3DVFA 3TPUB 3WEXA 1S5IL 1AC6A 1QHPA 3BQUC 1I9JH 4NKIL 3U79A 4LDEB 2CXKA 3VGGA 3I3BA 3AY4A 4MA1B 1RJYB 3M07A 4UTBL 2Q7YA 2AV7B 4X98B 5CJQH 5EU4B 1HQRA 5KZCB 2ZOKA 1MHHB 4DUVA 1YDPB 3MRQB 3IETB 4GG6A 3VFMB 5CJOL 2J6EH 2JIXA 3CNKA 2J8UF 2E27L 2IQAA 2KZWA 5DEFA 2ATPA 4Z7OF 4RGND 2FDBP 1R3HA 1SBSH 4YAQB 4TVPL 5B38B 3FMGL 1YEFL 3N85L 3MV7A 4JPVL 1H5BA 1CLZH 4K3JL 1I4FB 1NQBA 3RAJL 4NDMA 3MRJB 5DA4A 3UXFA 5ICXB 1Q1JH 3MRFB 3FT2B 3JUYA 2BRQA 1CDJA 5ANME 1RUMH 4AIZA 1CFNA 1Y18B 3F58L 4WCYH 5JIHA 3S35H 4AMKL 2J88L 4JPWH 2ERJC 3L3DB 2GK2A 2VWEE 1OD9A 2H32A 3DWTA 1YEDA 3D0VB 1XZ0A 2LU4A 4PUBH 3VG9B 3OB8A 1HSBA 5ADPH 2VDPL 2J3SA 4Z5RB 1UADC 4GBXD 4KH2A 4OSUH 5DT1H 1AXSB 5D6CA 3RHWK 4HUMB 3MGTA 3GB7A 3QJFA 3UBXB 3KPSB 3ZE1E 3MBXL 2IALA 2IMNA 4S1SL 4YK4C 3KWWB 5SWZE 1OOAA 5FDWB 2BOBA 5TE4L 3T04D 4UT7H 3JWNC 1MCOL 5JMOC 4XCNB 4QGTA 3BP6A 4NKDB 3QUXB 1KB5A 2PCPA 3U4EA 1NEZB 3RI5K 1OLZA 4CU8A 1YNKL 1PG7L 1IC5L 4OTXH 15C8H 2FGZA 1Q8MA 5HDOA 2A77L 1XGRA 1B0RB 4OZGB 2P5EA 1YNTB 4HC1L 3BKCH 3IU3B 4K7FA 5GRWA 4LGPB 3ZKNC 2OTPA 5B4MD 4NQVB 5D71H 1FYTD 4FQQA 2X4SA 1I1YB 3ZKMD 2OK0H 1H8NA 3W0WE 2BSTB 1NGPH 3TT1H 3R06A 4LQFL 4WI2A 5FHAL 3WL9A 4CNIB 5J57B 3TM6A 3MNVA 4WRLA 2IC2A 4NJAL 1Z0NA 1Q0YL 1KXQE 2CQVA 5ETUA 5I76A 2ZCHL 4M9PA 4LPXA 5IW3A 2DRUA 3SE9H 1FH5L 3MV8A 4HBCH 2DB8A 5D1XD 5JTWA 3C6LB 2DIAA 4HH9B 1KB5L 2HJKA 2B20A 2Z93B 1MFAL 4XI5D 3QUYA 1NGQL 5IJKC 4LLDA 2J8HA 4B50A 4XT1C 5I8CA 2HLAA 4B53A 1NGWB 4JR9L 4M7ZB 5IB3B 1FVCA 4KDTC 3ULUF 1JF5A 4U6HA 4PJCF 3FQXA 2IG2H 3AU1B 4C56E 5I6XC 1FNSL 1DQJA 2F8XC 4OZIB 1IQWL 4RBPH 3FAWA 4UQ3B 1Z6JT 4JY6A 4PG9B 5SWQA 1S7RA 4DGVL 2DM4A 5TDOA 4FQJH 3BQUB 3LCYA 3P4OA 2C9AA 3BEWA 4P2QB 5ESQA 2VABB 2I24N 5L2JB 1EUUA 3HFMH 1KN2H 5F9OL 1I8LA 3EYSH 4AM0B 2OBGA 1KT2B 1S7UB 1KGCE 4MZ2A 1UACH 5IFAL 2CGRH 5D5ME 5ID0A 3O11A 1UJ3A 2VWEC 5A40E 5JXED 5E2TL 3U36B 4CGTA 2H3NA 2EC8A 4ODSL 3DETC 5HGAB 1OTTC 2H1PL 3GRWH 4AYFA 2P8LA 4UBDC 1DLHB 3FFCD 4NQDB 4XC3H 3CX5K 4P46C 1CT8B 1YEHH 1P1ZA 5HD8C 3ARGC 2Q8BH 1AH1A 3DV6B 2JCCA 4I48A 3RNKB 1JV5A 4J7RA 1CQYA 3V4PL 4Q9RH 4RMVA 5FUZH 4GMSH 3BWUC 1FZOA 3O2DA 4XH2A 1C1EL 4O2EB 1EJ6A 4K2UH 2YD1A 2PW2B 3HZKB 4S1RL 5EO0A 4I3RL 4LHUG 4OAWA 1T83A 1AR1C 2BX5A 2ERJB 4MNHB 3UZQA 4GRMB 5IVZA 1BFOB 3VI3E 5J7CC 5EUOA 4L9LC 1HDMA 4C55A 1NCNA 4YNYA 4NM4L 4F7EA 3HR5A 2HJFA 2OQJB 4WTXA 2XFXA 3FQTA 4PRDB 1JGDA 4U6TA 4PYHA 2BSSA 3U7AA 1I7RA 4WI5A 1GGCL 2L7JA 4TQEL 3HI1A 1A3RH 4WFED 5KZCD 1DBML 3OMZA 4YK4B 4Z7UA 5D7LA 4YDLC 1DFBH 1X5YA 2DN7A 5DRWB 3RGVA 1IGFH 3O2DL 4UDUB 1DE4A 3HC0B 5D1ZC 1JWSB 3GSQA 3ULVF 2AJVH 3G04A 1U8LB 5FO8B 2HRLA 3CAFA 3W9EA 3FB6A 3EDDA 1MJJB 2QEJA 4ZS7H 1CYGA 1LEIA 4Y5YA 4K23L 3N1PC 2Z8WC 5EN2A 4BZ1L 4WNQB 2D03H 4WUUA 1FGVH 1SY6A 4Z7VB 1S9XB 2I9TB 1CFQB 4IRSA 2MFNA 1IAOB 1LP9F 2F54D 2VXTL 3BPOC 5EB9A 1RZJL 4R4FL 3SBWC 4PGCB 1A1MB 2IANA 1ZHNA 4OLWL 2X9XA 2WAHA 2HA1A 3DX9A 3MOAL 1J1OH 1XF3B 1A3LL 1A6TB 5K9QG