1FDLH

Crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
218
Chain Sequence
QVQLKESGPGLVAPSQSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLHTDDTARYYCARERDYRLDYWGQGTTLTVSSASTTPPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA D1.3 FAB (LIGHT CHAIN)
publication title Crystallographic refinement of the three-dimensional structure of the FabD1.3-lysozyme complex at 2.5-A resolution.
pubmed rcsb
source organism Mus musculus
molecule tags Complex (antibody-antigen)
total genus 42
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1990-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fdlH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fdlH01
4JRYA 2MFNA 5CSZA 4YX2H 4ZAKA 2XN9D 5IB4B 4XTRD 3TVMC 4OCWH 1WZKA 5T1DH 3OZ9H 3TT3H 5HPMB 4LIQH 1AI1H 5EZJA 2F53B 3RX8A 3MLTB 3OKKB 4PJBA 1H8NA 2O5ZH 3QUZD 4OCXH 4LQ1A 5IHUL 4KHXL 3C09B 4LEXH 3AY4A 4JZOB 4WFGE 5F71A 1HHHA 4XHJD 3TZVC 1G84A 5I30L 3RX5A 4S2SB 1A6WL 5DMKB 2H41A 3SGJC 5D1XB 1TVBA 3GO1H 3Q5YA 5EU5A 4NN7C 5B39G 5C9JB 2CDEB 3PL6C 5GISL 5H37G 1GOGA 4R4BA 2F5BL 3GKZA 4YDLC 2X4UA 15C8L 3GI8H 1CXKA 4ZFOL 4U2ZA 1QRND 4TSAL 5TDPB 1YEHH 1ED3B 3FB8A 3ARUA 4X5WB 4LBEB 3HG1D 2DQUL 3B83A 3FN0H 4XX1G 5GS1B 1OM3L 3BI9X 2BHZA 3OKLA 3TCXA 4WU7A 3ZDYF 1CDYA 2VLJB 1GSMA 1W8OA 2VABA 3JBG7 1JTOA 4PY7B 4Q6IC 4JG0L 3IYLW 4P2YA 3EW3B 1MREH 4F58H 1XF5A 2AJUH 3HE7B 3SHSA 3W5MA 5MENE 3T0EE 1MVUA 1X5GA 2HN7A 5JW4Q 5T1KB 1UWXK 4ALAH 4UV7L 2F58L 5HHPB 4HUWA 3DHJA 4M1DL 3TBWA 2NNAA 2IWGA 3TEUA 3LIZL 1CYGA 1OB1A 1TJIL 3EZ8A 5IGXL 4G8GD 2R0LL 4M6MH 4Y8DC 5EIIA 2HFFB 32C2B 5D72H 3UC0L 2DLGA 3KYOA 3RGVD 1MRDH 2H45A 2QQLH 3DX6B 1YUHA 5C0RL 1QHPA 3VXME 4QXTB 3IJHB 3ZHLA 2VDLH 1HZHH 2H2SC 5FO7B 1YMHA 2FSEA 1B0GA 3MJGX 1A6VH 4ZO6A 1C5CL 4RMQA 1GZQB 4QT5B 2N56A 1T0NA 1U8LB 4HJ0D 5FYLL 4UDTB 4LGPB 3KHQA 3VRIB 1BX2B 3UPAA 5IVNA 1D5XB 2EDNA 2FHFA 1XR8B 4N0RA 5EU6D 3INUL 4HKXB 4LRIA 4LF3B 2P7TA 3CSGA 3QHFL 3BZEA 1MFCL 4YO0A 3KLHD 3HNSL 4JR9H 4W4OC 4CDHA 3IAGC 3OKEA 3BXNB 3C6LC 3V4UL 2IC2A 1BIIA 1XMWA 3OXRB 2BC4B 4Z78A 4ZDHB 3MXVH 4QNPF 5FO9B 1BGXL 3NIFE 5BV7C 4N0YH 1AY1L 1KIQA 4OD3H 2X4TB 1OT1A 2D0GA 3AS0A 4JPWH 4H20H 2G5RA 1HKLH 2A74B 2W0FA 4C57C 3DLQR 3GSRA 4MSWA 4PJDA 3WNOA 1IC7L 5C0FA 2FBOJ 1TENA 4MNGB 1CS6A 2IADA 4TPRH 2YD6A 4TOYL 3X12B 1PVHA 5ADOL 3EFFA 1ITCA 4FZEL 4Y4HD 1KB5A 2IH1A 4YBHA 2DTMH 5DVNA 4LEOA 3TZVB 2VDPH 4LCYB 2G5BB 3V6OC 5GGTL 1IBGL 4XAKE 1UB5A 3MOBH 1KPRA 3DV4A 1QBBA 4O58L 2EDRA 4NN7B 3HN3A 1FNGB 4LLMB 5EUOA 2AEQL 2MWCA 2HRPH 5D2LF 1KTDB 5GGTA 2PETA 4RMSA 2EDTA 2H8PA 2E9BA 1XR9B 1N3NA 1AR2A 2IPTH 1HIML 1T89A 2XNAA 1J12A 2W9DL 4Q74A 1FO0B 3KLSA 4PREA 1FBIL 1MHPH 1WCQA 1M1SA 3SJVA 5ACMA 5DQDH 4UB0L 4XNYH 4MJ5A 5JORB 1R3JA 4PLJD 5GGVY 3VXTA 1UXWB 3ZE2E 2X4QA 4QRTA 1I1AC 3LZFL 4PJ8A 3EYUH 3O2WH 2Z8RA 2IAMA 3KLDA 1U8KB 2JIXD 1CVRA 5CJOH 4MMXC 4CNIA 3BSZL 1MNUL 4P5TD 1HYSC 1UJ3B 2APTA 1BBJB 3DX9A 1JRHH 1F58L 5CCKH 5FGBC 1MCIA 1ZHKB 3SE9L 3SKJL 4ZFZA 1Y6NR 2J8UE 1MHHB 3S3PA 5SX4H 4XWGH 4FXKB 5CEZH 3RWFB 3UEZA 3C60D 4LP4A 5J57B 4DUVA 5CIPH 5SWSA 3D0LA 2K7QA 5DRXA 5C0GB 1VPOL 4IMKC 1V8HA 3MJ9L 4LSTL 4U1LA 1VFMA 2Z35B 4PB9L 1HILA 1CGYA 5ADPH 4X6DF 4P46A 4WIQA 4JLRB 3V6FA 4DOHB 4GRLB 4WFGD 5ICZA 5DJ0A 3HI6H 3PJSB 3MJ9A 3OXSA 4D0CB 1CDJA 5T5FH 1ZLUH 1NANH 1GPOH 2G9HB 2W59A 1SEBA 1RZFH 2XV6B 1YEIL 3O6FA 1W72L 2DDQH 5I17A 4R8WH 3PWUB 4R2GC 3MRNA 5BV7B 3KPTA 4PJ5B 3S4SG 5HJ3B 1J0HA 1FNSH 3RBSA 5KSAC 3ZYZA 4XGZA 3V0WL 1X3DA 5HHME 3P0VL 2BY2A 3FHQA 3QH3A 4HFWB 4DTGH 1WAAF 1YEGH 2LTQC 5IESH 5CBAB 1P9MA 4M3JA 4U1HB 1X5LA 4M7JH 4YHNA 2P1YA 3S36X 1BAFL 3KPLA 1O5DT 2BNRE 2ZG2A 3JV0A 1ZTXL 1CF8H 1F42A 4CW1B 2HYMA 1KCRL 5K9QI 1V7NL 4XCYA 1U8IA 5ICXB 3MODH 3GDBA 1RI8A 4U3XA 1NBZA 2C3VB 2D7OA 3EO9H 3V8CA 2JB5L 4WW2B 1MELA 5MEND 4E42B 3T0ED 1VEMA 3BYTA 3ARVA 1KNOB 4HIHB 4FABH 1TCRB 4OKVB 4UIMB 1NGPL 3ECBA 1GRWA 5CD5C 5J0BA 4HWEH 5TGBB 3IFLH 2C4FT 4UOJA 4G6MH 5HVHB 5JDSA 1FC2D 5HHOB 3E1F1 2UUDK 3T2NH 1AO7A 5E1AB 2VISA 3ZDXE 3BYYA 3MV8E 4P4RB 3VRLE 1F2QA 3N9GL 3HZVA 3VXMD 3WNMA 4HWZA 2O93L 1HXMA 1UWEL 3GSNB 2KL6A 2PTUA 1VENA 4E5XB 2PO6C 2ZUQC 1XEDA 1Y6MR 3PQYB 3F12A 4X8JB 4DGIH 5D70H 5HGGS 4YR6A 4AIOA 5T1MB 1IAIM 3W11C 1WFNA 4NQSA 4OCRH 1PG7X 1T1XA 3U0TB 3O6KL 3PHQA 4N0CC 3BP6A 1UB6A 2FATH 5D8JH 3FT4A 3C2AH 1MRCL 1UT9A 3N85L 3QXDA 3HPJA 5FECA 1I7UB 3FT3A 4XPFH 5E2VH 4QRRE 3W39B 1FNEA 3FFDA 1E6OL 2ZPKH 4Z7VB 2Q8BH 3I85A 2WUCL 4YHIB 4MD4B 1OTTC 5K59E 2RIKA 5F7UA 5E6IB 3EYFB 1DN0B 3SE4A 2GJJA 3GUTB 4WHYG 1YNTB 4L1HA 2BVOA 5I73B 2C1OB 4PTTA 1JWUA 1YECL 3O9WD 4CJ1A 3W9DA 2V7NB 3VA2C 3KLAB 3QULB 4BH8B 3LKSB 3ESUF 2B2XH 2ZKHL 3EDEA 1FDLH 4HS3B 3CXDL 3MMEB 3FQRA 1VFAB 2H32A 3ROOA 5IW3A 4PTUB 2I27N 4ZODA 1BVLA 3GHEH 2EDHA 3Q1SL 1AXIB 3BP5B 3LAFA 3KVQA 4TTGA 5I71B 3IDXL 4RA0C 4XAKD 3TLRA 1CU4H 2BVPA 1D9KC 2WINB 3TCLA 4V1DA 4FQJL 1CL7L 4OQTH 1A3RL 4NO0D 3ARBA 1NBVL 4JDZA 2V17L 1FNHA 3O41B 1ZLSH 3U0PB 5BRZD 4YFEA 1SHMA 2CXGA 1CFNB 4YJZL 5KSBA 3KPNB 5KW9H 3KG5A 4KK5C 4X6CA 3L3JB 4JPKH 3VXNB 5KSAB 1FV1A 4HX1B 4TUJA 5GIRB 2NY1B 4X6BB 5DD5L 1H3GA 2NX5B 2YD3A 4KJQD 3EJZC 3SDXA 1MCOH 4CVWA 1KULA 3WIFA 1QBLL 1D6EA 4HHAB 1T66C 4H8WC 1NCNA 4XXDB 1G9MC 1EO8L 3R0NA 4QRQA 1YQVL 2FH6A 1ZS8A 2V5RA 4EQ2A 4S10A 1XGRA 4HIEB 2OK0L 2NY6C 3HCVA 2JF1A 3MRJA 2J6EH 1YEFL 4TSCH 5KJRL 3WHXB 4Z5RB 3LN4A 3QR2A 4KUZH 3BFOA 3LMJH 1XCTA 3GMOA 3LS5H 4WW1A 1NEZG 1D5BA 3PNWA 4PRHA 3QO1A 3QIBD 4GQPH 3DI2B 5ANME 3PABB 1ERNA 3SDYH 4GAJH 4EUPG 5MEOB 1AD9A 3AMLA 4YPJA 3X13B 1Q94B 4KRLB 2XA8H 4XBEL 3H9HB 5I1IH 3O2VL 5F1OB 1IFHL 4P9HL 3Q6GH 5CJQL 5TE7L 2EKJA 4OZFG 4PRBA 3PV7A 1GHFL 3BEVA 5JHDA 3PV6A 4LKCB 1A7NH 2YD1A 2R2HA 4TNVK 2XWTB 1RJZB 3D25B 2D0FA 5A16A 5B8CA 2FYYA 4LPTA 4KDTC 4IOFC 1AP2A 4RAVA 3QDME 5EOCL 1KIRA 2EDXA 4OZIE 4HLJA 4JFDB 4PRIB 5DK0B 1CBVL 3QA3B 4UDUB 4UQ2A 2ICWB 1YNKL 5MEPA 1YN6A 1U3HA 2IALA 4PP2B 5F70A 2PCPA 2ZNXA 3C87A 1C12A 4NJ9H 4XMKL 4ZPTA 4BFGA 5KSVA 1ZHNA 3MCKB 4TULL 4IIQC 4G7YH 4R9HA 4RGNB 4NZDA 3CFBB 5EFIB 3G9AB 3U6RA 5HYEA 2V5TA 3CFCH 5I0ZA 3NFSH 3OJ2C 3KXFA 3DXAE 5HHMD 4XP6H 1P1ZA 1RFDL 3NIDE 5FGCE 1CXIA 5BVJA 2C3WA 1MHEA 1NGQH 2I60L 3O4LE 3ALWA 2IFFL 3VGDA 2BNRD 3IDMB 3G5VA 4DGVH 5ILTH 4EXKA 3IJSB 4EN3B 1JNHA 5E2JA 2QTEA 5IMMB 3ARDA 3S7GA 4NNPH 4AEHL 4OGXH 3QG7L 3NVQA 5D6DC 4WTZG 3FRPG 1CCZA 2VLKB 5EZOL 1ZLWK 2PKDA 3ARGB 3MJ8B 3DO7A 2DJUA 2OSLB 3RNKA 3HI5L 5DXWA 4EEEA 3VXRB 1AXSA 1BD2B 4PFEA 3TV3H 1EAJA 3NTCH 5LAXB 3DETC 5E8EB 5FUCE 3TIDA 3IJYB 4HIXH 5ALCL 3ROLA 5F1NA 3MV8D 1TPXC 4YAQA 8FABB 1FIEA 1F6LL 1MVFA 1JGVL 3LKQA 5L0QC 2IGFH 4X6DB 1NFIA 4C55A 1MEXH 3HRZA 2PR4H 4ZTPL 3V5KB 1QG3A 2VDOH 3GHBL 4PJBF 1DANT 4ODVH 5HHVL 4OM0L 3N06B 2MHAA 4KKBD 3ZE0F 4MD0A 3WFCH 3VFPA 2B7DT 5EUKA 4OIIH 4JQXC 5LKNA 3FFCA 4ONGH 3VI3E 5I8KH 4I2XE 2NW3B 1JPFB 5DJZA 1G7LB 2IANB 4PGCA 4MVBD 3NFNB 2R4SH 1RZGA 2X1WL 1U93A 5F93C 5AAWA 1NKRA 4OGAD 5F6HJ 2W65B 3BUYB 4NKQB 2C3XA 2EH8L 5SX5H 4QRRD 1MFNA 3G08A 4F3FB 5J13C 4NZTH 5INCA 3H9SB 3QUXD 1JGLL 3DMMB 3RPKA 2LU3A 3MJ7B 4K3DH 4MXVE 5J1SC 2O26U 1ROWA 1MH5B 2JJUA 4GW1B 3GK8H 2PXYD 2ARJA 4QRPE 1TZHB 4FFWD 2CKBH 5DD0H 5MEQA 4KQ3L 4PGZA 5HPOA 4XNMA 3HE6D 4K3JH 3SDAC 1NC2A 1DVFD 2AP2A 4HC1H 2W60B 1I4FA 3PDGA 3B6SB 4WWKD 2B20A 1LE9B 1K8IA 4FN0A 4MXQD 3RJDA 2D31B 1WISA 1A7PL 4RFEA 4KZEH 2DLFH 3DUUB 1U8JA 1Q0YL 4JRXE 1OGAB 3V5DA 3ULUE 1F3DH 3QNYB 4UAOC 5C3LD 2DRUA 5D7LB 3RVTC 2R0ZL 1NUDA 5L7XL 1OP5K 1R3LB 5GGRY 2CLVB 5FK9A 2ZCHH 4F8QA 4UV4L 5L6YL 3DTXB 3RGHA 1B90A 1UCBL 4G9DA 3H7LA 3EHBC 5GQBA 5I18H 1VKXA 2XICA 4GG6E 2PYEE 1OP3K 2HWZL 1VADA 1JFQL 1T3FB 4MAYB 5CZXD 3HG1A 3C6SA 3MX0A 4RGOH 1RK0A 5E8DH 2X7LB 5IM7B 4Q97A 5HYQA 1R3HA 1T7VA 3OJVC 2E7LA 2AJ3B 5HYJE 3MR9B 3L3GA 1FFOB 3MV7B 4Y2DA 2AVGA 4L3CB 5FOJA 1TFHA 5TH2A 4GAYA 3UBXA 4H1LH 3TH2T 1FFNB 5I16B 4DZ8A 2ADFL 2ZJSH 4NC2B 5AWNH 3QQ9C 3F5WB 3SOBL 4LKXB 4MDIA 1ZEAH 4L8BA 3MZTA 4XC3L 4YH6A 2VNCA 2DQFB 1EHAA 3OKOB 3NH7H 1X7QA 4ZUVB 1TPXB 3QT2A 5EU7E 3IKCB 1LD9B 2J5LB 4LLAA 2HFGH 3V4PL 2WANA 4OLVH 1LK2B 4JFQA 3RGVA 3WE6B 1WIPA 5L0QB 2F53E 2FWOA 4PJDF 4LMQE 4L4TA 4LCUA 1FH5H 2W0LA 3RWIA 3HAEB 3WJLC 3CPLA 4C56A 4OBSA 1BWMA 5DQ9A 5DJ8A 1RUPH 4KRNA 3MXWL 1HN1A 4MGXA 4ZXBD 4W6XB 5F7HA 4OIAA 4XNQA 3TPUA 3KPRB 2OM5A 3RU8L 3QDMD 1QSFA 4XMPH 3VFTA 3WEXB 1S8DA 1T5WA 4G6KL 4ZTOL 5DHXB 5ABDE 3DECA 5FUZL 3X11A 1LO0L 1KJ3H 4G42A 3ZT7A 2FX7H 3QZWA 5EUOF 4XP4L 1Q38A 2DLHA 4HW6A 3MRCA 2NZIA 1FZJA 4RISL 4YHYC 4U6HB 4UIKL 1H8OA 3UTZB 3MRKA 5DWUH 5A2FA 2Y06L 3NAAL 2IEPA 3KWWA 3QJFA 4P5KA 3OF6D 5J9PB 1KPUA 1D5MB 4HBCL 1A6AA 4PRNA 3O4LD 2ZCLH 1S5HA 3MYJA 4PD4K 5D2NB 3QBTB 3DYPA 3TH4T 1RUQL 1ES0B 1IAIL 1QNZL 2HLAB 4A2LA 3BKML 1NMBL 1U2HA 4K23H 3BD5A 3T0BA 1NFDA 2X70A 1QPPA 1T21A 3L3OB 2M1KA 3RY6C 4QTHA 1XT5A 3HC0B 4FQHB 2DS4A 4LPWA 4N0FB 4JJHA 1FZOB 3IB4A 2CRYA 4NN5C 5E5RB 43C9B 4GRWH 1MHCB 4F7PA 4KI5F 1K4DB 1TETL 4OF0A 3QUKA 3P9WB 5HGAB 2NY7L 4EI5B 3S5LA 2FH8A 4NUGL 4R4FL 2H26B 1KF9B 4QHUA 5KS9F 1VSCA 4HG4J 3WMSA 4WNQA 1RD6A 4JKPL 4CVXB 4NQEB 3ZLQC 4TVPE 4YFDB 1NC4B 5IQ7H 4R3SB 3LQZA 4EUPB 1ORQB 1HI6B 2IG2H 2G60L 2YD2A 3VFWB 3FO0L 5HGHA 1F4YH 3RPIB 1UM5H 3O3UN 3HNVH 4JFEE 1K8DB 3H6JA 4OZFB 4Z7UE 2NTSP 4S1SL 3NIGE 4GMSL 5F6IC 1MAKA 3QNZA 7FABL 2CMRH 4F9PA 1MCKA 2FX8H 5JOFA 5D7SL 1JGUL 1WWCA 2MJWA 4JKLA 5IFHH 1S9VA 4C4KO 2YSSA 3QIUA 1CK0L 1CL7I 4P5TA 5C0BB 1ZLWH 5IEKA 3HMWL 3HUJF 2BSRA 1ZLVH 2BJMH 3W81A 1MCPH 1NGXB 1R5WA 4JM2C 2VLRB 2DI7A 2BFVH 1QZ1A 1HHKB 3ZDZF 1C8PA 2XIDA 5FYKE 5BCAA 3HC4L 3STLB 4PJAA 1XGPA 4MNGE 3C60A 4LRIC 1CFQA 4YDJA 4Z9KB 4K71B 2BOBA 2IPKB 1F11A 4KAQH 1MWAL 4GRMB 5JW4M 5GZOC 4WCYL 2VDRL 4Q9BA 3MSPA 3CMOL 1G7MB 1L9NA 3WDIA 2DI9A 2R8SH 3ULUD 1CD1A 1MLCB 3WD5L 1LWRA 4K55A 2R1XA 4PJXE 2D7TL 1MWAA 2XXMB 4LQFH 4JRYB 4F57H 2RJMA 5CSZB 2BXYA 4ZAKB 5CP3H 5LGJB 2JK5A 2FHBA 3M07A 3CK0L 3UJTH 5MERA 4NO3A 5E8OA 3RTQD 5EZJB 2YUZA 4FFVC 2CO6B 2PYED 2XZCL 2DYPA 4Y4FD 2CKNA 4TTDD 5B21A 1PAMA 1HHHB 2DQIL 4Z7OF 3MCLL 4BQ8A 4NJAH 2VLME 1TVBB 4GW4A 4CVZA 3CDCA 4YFLI 4U7SA 5HYJD 2E9IA 5BW7A 2ED9A 5F7EL 1EJOL 2OZ4L 4R4BB 2X4UB 1OF2A 3TO4C 4OKDA 3TIEB 4I3SL 5MENA 4Q7DA 3T0EA 4LK4A 4M1CD 3EJYC 4G8EA 1BREA 4PV8A 3FB8B 5FA3A 3AXLA 4OV6F 4LOUC 2NY2B 4Y7MA 3PWNA 4LGRB 2OZ4A 1MRFL 4FRWA 4BSWA 1MFBL 3ARFB 2QQKH 3OKLB 2GJZB 2DQGH 2MSPA 2Y4SA 4PGJA 4QRUB 1T4KA 3OAUH 3THMH 2BSSB 2VABB 2G75A 4G8IA 5DEFA 4POUB 1KN4H 5KVEH 2DOCA 2P5WE 1EGJL 1XF5B 3T3PF 3VXMA 2F53D 4KK8D 4OF5A 5DDHA 4U1SA 1MVUB 4ELKA 4KRPB 4HMEA 2HN7B 4OT1H 4NSKA 2IPUK 1LO3H 2KKQA 4FG6D 3BUTA 4ZO7A 3CH8A 4PBXA 3Q5OA 2H1PH 4HUWB 4OJFH 5IVXF 3TBWB 2NNAB 2XKNA 2CUHA 4OLYL 5D1XD 1OB1B 4KVCL 3TYGL 3LHPH 4YGVA 5BO1L 1WUNT 3ETBF 4QHMA 5B3NA 5F6IB 1J18A 2WIIA 4HUMB 4KI5C 3QUML 3SEPA 5EIIB 3OWEA 3CU1A 3QRFM 3KYOB 5DMJB 1JYXA 1YUHB 4I13B 4FQCH 4NC1E 1CD0A 4YWGH 1YMHB 1Q0XL 2FSEB 4EXPX 1SJVA 3PP3H 5KSBF 2F5AH 3MLVL 1RHHA 1DP0A 3RAJH 1CD8A 1T0NB 3I3DA 5C6TH 4Y4KA 3SDXF 1JF5A 2P7TB 1GZPA 4LPYA 1ND0A 3BZEB 3HE7D 4YO0B 4UMGA 4JY5H 1NUNB 3K1DA 3NFPA 4QTIH 4IRJD 3MLWH 2ZG3A 4OZHA 1HNGA 5DZNA 3QQNA 4G9FE 1BIIB 3K74B 5T1KD 2CSPA 5L2KE 1KUMA 3O6FC 2X44D 3VXQA 4HAGA 2I9LB 3PE9A 4NGHH 5H94A 1FAIL 1FFPA 3UO1L 5GXBB 1KIQB 5HHOE 4K8RD 2OTUA 2AQ2A 1GH7A 3UZVB 4Z7QF 4NO0A 3IDNA 3R0MA 4JGMA 5I8CB 1P9MC 1U3JA 3IXTA 4MSWB 3GSRB 5DHVH 4PJDB 1QA9A 2VDQL 4KXZI 2Y23A 5C0FB 1MUJA 2APXA 3PQYE 2IADB 5JA8B 3I6LE 3M45A 1MIEL 3EFFB 2FHCA 1Y0LA 1KB5B 2IH1B 5KAQG 4TVPD 4LEOB 4OSUH 2I25N 1UB5B 1PGRB 1KPRB 2ZUSA 2YKLH 2P43B 3LKPA 1L7TH 1OAQH 1PDKA 3DV4B 3T8XB 1A6UH 4JFED 1HEZA 3D2UA 4P5MA 3ULVE 3EOTH 5GJTH 2BNUA 4ENED 4YFLF 5EUOB 3AB0B 3I2CH 3OSKA 4R7DA 2H8PB 5KAQF 1TZGL 1N3NB 5F9OH 1RHFA 4HAFA 2YUVA 3GI9H 1CLZL 4YXKL 1T03L 3C2SA 5AZEL 2XNAB 4FQ2L 1BOYA 4UTAL 2HMID 4PREB 3V52L 3QIBA 3TJHD 3GB7A 3SJVB 3EFDH 3RVWC 3N1PC 4MJ5B 9CGTA 2A77H 4Y5VC 1R3JB 2IQAA 3VXTB 2X1PA 3FO9A 4PRPB 1OL0A 1RUKH 5GGQH 4QRTB 5L8KB 3RVUC 4LVHB 4YQXH 1U36A 3BGAA 4FQ1L 4PJ8B 1S5IL 2PN5A 4MCZA 2IAMB 3UBXI 3ARRA 4CNIB 4OLUH 3FRUA 3VWKD 2BVTA 1N59A 1RZJL 2OS7A 4U6YA 3DX9B 1URLA 2A9NH 5JQHC 1HCVA 4NP4L 4KJYA 4ZFZB 2EXWC 1CG9A 3UZQA 3SE4C 4D9LL 5JIKA 2WAHA 4Y5XC 3BD4A 2OJZH 1A7BA 5SWSB 3D0LB 2X05A 3SE8H 5DRXB 1E4WH 1FRGH 5DFWH 4K9EL 5C07E 5H37H 1SY6L 2NX5E 4U1LB 2NTFA 2WNGA 5AG9A 5GS0D 1DFBH 1HILB 4DK6A 4M5YH 5FYJU 1OTSD 3C08H 1F97A 4P46B 4MJ6A 3M17A 1QFUH 2BSED 5ICZB 2H9GA 1WVZA 3MV11 4F37K 3OXSB 2BNRA 2VXSL 4M8QA 1OARL 2VLMD 1IAMA 4HGWA 4XI5C 1BJ8A 1SEBB 1GGCH 2JJSC 3IVKA 3O6FB 3PIQA 4MS8D 1X5HA 5I17B 1RU9L 2VDNH 1S3KL 4OTXH 5D7JB 3MRNB 1FGVL 5EC1A 1DQLH 4XGZB 2GT9A 4GKOA 3QH3B 5IHZA 4JFYA 5I6XB 4BQ6A 1OAXH 1IKFL 4L8SC 4KJWD 4YHNB 4B0MM 3KPLB 3UTSB 3VD3A 3GIZH 5IMOA 4XCYB 1U8IB 5HVGB 3OKMA 4BZ2L 3MV8A 4L4VA 1JZ7A 4Y1AE 3IU4H 2HT4C 1NBZB 1J5OH 1Q9WA 3AUVA 1ACZA 1KENH 3OB0H 1KN2L 2VWEC 4K2UL 1E0OB 3MBXH 1KEGH 2QSCL 1KLUA 2GEEA 5ACLA 3PWPA 1I9IH 5GRYA 1J1PL 4PRIE 3ECBB 3VDBA 4HKZA 1IAII 2YA0A 1NCBH 3K3QA 2I26N 1P4IH 4APQA 2E6PA 3V9FA 5IB3A 4WVRA 4HPOL 1BFTA 3QYCA 4UINH 1AO7B 1RZ7H 2VISB 4RGNE 3ILQD 3CSBA 3SCMC 3RHWF 1QHOA 2R0WL 3HZVB 5B38A 3F6IA 2DD8H 1HXMB 2RCSL 4PJ5D 5I1HH 1LP9F 2B4CH 3BN9D 5TFSH 1F6FB 2BDNH 4QRRA 1YEEL 1EPFA 3F12B 4YR6B 1UYWH 4NZJA 5ETUA 3QUXA 2FBJL 4AM0A 2LU4A 4AG4H 5GRXG 4MX7A 3UBXG 1BQLL 5CINH 5DGQA 1T1XB 4S1DC 1UXSA 3PHQB 3MRQA 5B8CC 3G9VA 3BP6B 1UB6B 4RIRB 3FT4B 1G7IA 3U1SH 2UVFA 1UWGL 2PXYA 4P9HC 5C2BH 3D85B 3HE6A 3QXDB 1CR9L 1DQMH 3HPJB 4G9FD 5FECB 3QRGH 3N1FC 4M1GH 1YJDH 3FT3B 4WWKA 4UOW0 1ZXQA 3FFDB 3BHBA 5GJSL 3IFOA 1FE8L 1MAMH 3MBED 3NPZB 4KVNL 3SY0B 1BD2E 4HZAA 1FGNH 5CGMA 1AC0A 5HHOD 3U7YH 4WI6A 4HFUL 4QF1A 4LASL 4NKDB 4EBQH 1V7ML 2BVOB 1JNLH 5D1ZA 4PGBA 4V2BA 4N8VG 4PTTB 1J8KA 2BX5A 3QWRD 1JWUB 3NPSC 2N7BA 3W9DB 1EX0A 3DRTA 5DA4A 2NXZD 4HWBH 3PQYD 4CMHB 3OAYK 3BPLC 3MRIB 2ERJC 3FQRB 3Q3GA 2H32B 3ROOB 5DRZA 3ZT6A 1E27A 1F8TH 1BVLB 2AXGB 1CIUA 3VFRA 2F9BT 3QZWG 2DAVA 3BH8A 4OFPA 2BVPB 4H25A 3TCLB 2YZ8A 4V1DB 4U1IA 3ULVD 2JB6A 2X9YA 3D39B 3ARBB 2IANE 2ZUXA 4JDZB 1FSKB 4JGJA 4OCSL 4AMKL 2OL3H 1AQDA 3OAZH 1LO4L 1T5XA 1TIUA 2OLDA 5KSBB 1ADQH 2SEBA 4X6CB 3BAEH 1D3CA 3GNML 4F7EA 3GSXA 1FV1B 5CSGA 4TUJB 5E6ID 1P84J 2NXYB 3QISA 3SDXB 2RR3A 3BPNC 4NRXB 1E4KC 2K1MA 5IFJA 3WIFB 1D6EB 4GFTB 3DV6A 4QRQB 1KCVH 2XRAH 4TQEH 2F15A 4FQLH 1ZS8B 4H8WH 2EIBA 4LPUA 1XGRB 3SDDA 1G9MH 3HCVB 4LRNL 5HHNB 4CN4A 4BZ1H 3MRJB 1UH4A 5TE6H 2ATKA 3LN4B 4Z0XA 3EJJX 4DJMA 3S5LG 1KCSL 1NSNL 5F7FA 5J8OA 1UFUA 1XCTB 4KK9C 4POZC 2F8XC 3GMOB 4WW1B 1D5BB 5L88H 3PNWB 1ZMYA 4PRHB 1FC1A 3QO1B 3WS3A 5J7CC 1OSZA 3QDMA 1SM3L 5AYUH 4R26L 4OZIA 2R2CA 3CU7A 4NC0B 4N1EA 1AD9B 2V2XA 4MJ2A 3S88L 4A6YH 1RUAH 2Y07L 1LK3L 1I8IA 2MCPH 5J89A 3BT2L 2NY1D 2WLYA 5C07D 3VXUA 2NX5D 4P3DA 4PRBB 3BEVB 4X4YA 3PV6B 5JHDB 5JR1L 5HI5D 5D93B 1F3JA 4XTRC 2R2HB 4NM4H 4LAQH 3DXAA 5A16B 1KJVA 4ODTH 4XPGL 2FYYB 5B8CB 1AP2B 3OF6A 3QCUL 4RAVB 4GSDL 1KIRB 5E7BA 1XIWD 1FIGL 3V5HB 3QUZC 4XPHL 3E8UH 4LPVA 1NCAL 5MEPB 1YN6B 3VFSB 1U3HB 4XHJC 2DQHL 2PCPB 3BH9B 2BRRL 2XG4A 4X6EA 3MNVA 4ZPTB 5KSVB 1NAKL 5IG7A 2HJLA 2GTZA 3O81A 4L8DA 1NCCL 1MPAL 5DD3L 1VFOA 3BE1H 3U6RB 3ABZA 4CMMB 3NCEB 4S1QL 5ENWA 4FQIL 3VH8A 5IFAH 3KXFB 5I1AA 4Q9QH 1P1ZB 1JPTH 4HXAL 3QFJE 3VFVA 4JN2A 5BVJB 3T1FA 4U6TA 5DJYA 1MHEB 3NPSB 3HFMH 2YD8A 2MPAH 3CDGA 3G5VB 2XWJA 4DKFL 4I3RL 5CP7A 5F9DC 1JNHB 3L7EA 2ERJB 1Z0MA 2E7LC 1EAPA 4JN1H 1E4JA 1WFOA 3ARDB 4Y1AD 1EEUA 3S37X 4JM4L 5TPWL 1I3GH 1MFEL 1FAKT 4PJEB 3GM8A 3UDWA 1YNLH 2PYFA 3LQAL 1PSKL 4ONHA 5GS3A 4M7KH 1B4RA 4AQ1B 3DO7B 4OB5L 4PRID 4NO2B 4C4KT 3RNKB 1EZVX 2CGRL 1IAOA 4I8DA 1AXSB 5CUSH 5E5MA 1JI2A 2EICA 2EYTA 4M8VA 2BP3A 1HHIA 5EOTA 4I2XA 4RGND 3LY6A 3MOQA 5F1NB 2YR3A 4YAQB 2PW1B 3BRGC 3NABL 4N8CL 1CGSH 1DLFL 3G5ZA 3LPGA 4O02H 3NCJH 3LKQB 5GRJL 3BPNB 5JIPA 3CCHA 3D0VA 3RUGA 1RZKL 5E7FA 4G80A 1CIDA 1NFIB 4DKEL 3F62A 3HRZB 3WSQL 1IEAA 5BZDA 5D2NE 4XWOD 2MHAB 1TDQA 4EN3D 4KDVA 4GAGH 2V9TA 4HJ0C 4KPHH 4LPCA 3VFPB 2CO7B 5EUKB 4WHYH 3FFCB 4GLRH 5DJZB 4KV5E 4QRPA 2EE6A 4MA8H 4PGCB 5I1DB 3BQUA 1RZGB 1U93B 5FCUL 4X5XB 3RKDC 1KCKA 4YZFE 3KLHC 4D94A 3ULUL 4HLZG 1YEDA 3CVIL 4FQXA 4YUEH 3G08B 5INCB 3SE3A 1BD2D 3CDYA 3G6AA 4G5ZH 1AXTH 1P4LA 3O2DH 4JRXA 3A67L 4LARH 4ORGA 3CVHA 3IDYB 5EBWA 5TF1L 4ODUA 2ARJB 3QFDA 5MEQB 1G0YR 1R0AH 3BZ4A 4YXLL 1DCLA 2CDFA 5C86A 3G5XA 1NC2B 2JJTA 3MCG1 4BUGA 4XPAL 3A6OA 3V2AR 5DEZA 4CJ0A 4DWHA 1FQ9C 3RTQA 3SGKA 1K8IB 3DSNA 1YC7A 2PYEA 3BWUC 2QADD 4MB3A 4R4NC 5C3TA 4Y4FA 3WIHH 3CFIC 4Y4HC 4RFEB 3QXAA 4QXUH 1U8JB 1XCQA 2DN7A 4AQOA 3V5DB 2KZ1B 5I1LB 2J88H 5DUML 2IAND 3MTRA 3SKOA 1B4JH 3RBGA 4L5FH 1PKQE 3K1KC 2D4FA 5FK9B 2B1HH 1I85A 5JHLL 1P69B 1E6JL 1XGQA 4GT7A 2XT1B 5EU3A 3DMMD 1KYOK 4G9DB 4XVTL 1VKXB 4HUXA 1DBKL 2APWA 3W0WE 3C6SB 4YNYA 1RK0B 1ZANL 5HYQB 1RIVH 3NIFF 3S36L 4HH9A 2AKRB 1MJ8L 2HJKA 2EDEA 5DC9B 3C8HA 5F3HA 1RQ5A 4J4PA 1MJ7L 4Y2DB 1BP3B 5TH2B 3UBXB 4GAYB 5F1IA 1TZIA 3OAYH 4DZ8B 2VAAA 1JUFA 4U3HA 1QR1B 4F9PC 2ADGA 4OF3A 1AGBA 3OB8A 3TNMA 2ZOLA 4MDIB 4LSUH 3ESVF 4L8BB 4F15B 4QYOA 3QCTH 2APBA 5CD3A 4I0KA 5D7LD 4N1CA 4R96A 1X7QB 2CK0L 1HYRC 3T2QA 3MOAH 1JHTA 1KB9K 2PNDA 4P0DA 5F21B 2AK4E 4LSSH 4XPTL 3VFMA 2ZNWA 2E8ZA 4P59L 4UTBL 3RGVB 2AGJH 4K7PH 2LAGB 2W07A 1MCWM 2DM4A 3C60C 4L4TB 5DRNA 4LCUB 4TYUA 3RWIB 1RV6X 4ERSH 4O5LH 3CPLB 4C56B 2QSVA 4MAYD 4LBEA 3T65A 1YYML 5DQ9B 5DJ8B 4OI8A 4YHLH 4MWFA 5IQ9B 4L1DA 5F7DA 5GS1A 4MA7H 4FXGA 4QOKE 1BVZA 4XNQB 1PG7L 3TPUB 5JOPD 1QSFB 4IRZL 1S8DB 1YY9D 4B7IA 2G2RA 4O9HH 1BQHG 1DBMH 3ARYA 4JDTL 3X11B 1XGYL 2QQQA 4G42B 4LSPH 1BLNA 5CZVL 4M6OH 4K8RL 5FFLA 4WI2A 4IRJA 3ZE2F 5C08A 4JJ5A 5T1KA 3D3VA 4Q58C 3JUYA 3L6FA 1AJ7H 3MRCB 1F90H 1I3VA 3MA9H 2CR6A 4HPYH 1FZJB 1KJ2A 1CLCA 1R3IL 3TFKD 5IVOA 3MRKB 3KWWB 3QJFB 4P5KB 3QFJD 1KPUB 2BOCA 5JO5A 5HBBA 1A6AB 4HK0A 4PRNB 5FKAA 1JL8A 1N4XH 5E70A 1S5HB 3MYJB 3VDAA 4TVPL 3DX6A 5DA0B 1H0DA 1QYGL 5C0JA 1DN2A 2J8UF 4M62H 2Q87A 3QWOB 4MLIA 1JI1A 1NFDB 2X70B 2C4FU 1T21B 3DX8A 1U6AL 1U8LA 1CQYA 1BHGA 3JWDL 4QTHB 3CJJA 3KPRD 3RIFF 4KGJA 2AK1H 3T0EC 4HQQL 3UJIH 4XVSH 1JWSA 2R29L 4KHXH 2Z31D 4JFEA 3RZWA 1IC4H 4F7PB 1K2DA 2EIEA 4DW2L 2IMMA 1T2JA 3QUKB 4Z7UA 1A6WH 3MJ6A 2WQ8A 3S5LB 3O8XA 1DQQA 35C8L 5GISH 4ZDHA 5KZCB 5AYQA 2F5BH 1HH9A 1G6RA 1X5KA 2D4DA 4TSBL 4UT7L 4TRPL 5IHLB 3GZKA 4WNQB 15C8H 1DQDH 3LQZB 1KBGL 1I7RA 4ISVA 2C4XA 3N1GC 2DQUH 5D4QA 1RIHL 3GBMH 3NA4A 1EIBA 4WO4A 1T20A 2CQVA 3UYOD 3GRWL 4P4KB 1AGDA 3QNZB 3KPPA 5JW3H 3QQ3A 1R24A 3TM6A 5JOFB 5AUMA 3O6LL 3C5SA 1DUYA 1BEYH 1EFQA 4M3KB 2EDDA 3VWKA 3QIUB 4I0PD 5FF6A 5LGHL 4P5TB 5IEKB 3JUZA 2BSRB 3GJFA 3GRWA 2EDOA 2F58H 1N5YH 1R5WB 5KVDL 2ADJA 1SJEA 3LIZH 4JY6A 5IWLA 4EI5D 5DC4B 4LLMA 5GHWL 4R7NA 5IGXH 3ZKQD 5GS0L 4W70A 2GHWB 4PJAB 3WNKA 1MCNA 2R0LH 4JZJB 1XGPB 4PJXA 1TVHA 3C60B 5CKGA 2MKWA 5ESAA 1CFQB 4LCIH 1ZGLM 4YDJB 2EYRA 3ZDXF 5C0RH 3O9WC 5K9KB 1F11B 1I9JL 3B4NA 1U8OA 3ZKND 8CGTA 4KY1H 2X9XA 5T1DL 3OZ9L 1T1ZA 4NNXA 5FYLH 4FA8A 4XCEA 1G6VK 1PG7W 4XAWH 3WKNA 1YEKH 5JPMA 4GXVH 1CD1B 3TBTA 4NKMA 4Q9RL 2R1XB 1MWAB 3INUH 1N6QH 4HV8A 4LEXL 2NZ9D 3QHFH 3K2MC 1VEPA 3HNSH 4FFYL 4QXWA 3SGDI 4Q2ZA 5MERB 4NO3B 5E8OB 2WIMA 1NMCC 2OQJB 4PJ9A 3B8SA 2DYPB 3SJVE 2VLRD 1ZVYA 4U3CA 1ZHKA 3GI8L 5F97E 5CKAA 3W0WD 2WWKT 1BGXH 1T2XA 2OTWA 5SWZA 1YEHL 5K59F 4HDIA 1AY1H 4KJQC 4PRPE 4H88L 2ITCA 3EYSH 4JFOA 1NCDL 2EH7H 4CVZB 4GW4B 1WBYA 3TBVB 3VD9A 3MRRA 1WITA 1IC7H 1EEZA 2P5WA 1OF2B 3AMKA 5IUSA 5MENB 3T0EB 1R5IA 4Z77B 1QBML 2AJXL 3LPFA 1KXTB 5ADOH 4FZEH 4G8EB 4CU7A 4PV8B 5FA3B 3AXLB 3NCMA 4HJGA 2A9ML 1IBGH 3PWNB 4DKDC 4PIRF 3BD3A 4BSWB 3RDTC 5C0EA 4ALAL 5MHSE 1N8ZA 4ZAKD 1P7QD 1T4KB 2AK4D 4PG2A 2G75B 4G8IB 5DEFB 2AEQH 2L0DA 3B5GA 1P7KA 5E95B 3VXMB 5HJ3A 3O3BA 2X6MA 2ZUYA 4ELKB 3AS3A 1EHLL 1BQUA 1MRDL 2QQLL 1WV7T 3MV9E 4NSKB 1MOEA 3O11A 1HIMH 1BZ9A 4U1HA 1W0WA 2VDLL 1JCKA 2W9DH 1A6PA 1JGDA 2XKNB 1FBIH 3NACL 3MRDA 2Y5EA 1KACB 4YGVB 3MFFA 1J0KA 4PGEA 1KGCE 4QHMB 3SN6N 2WIIB 3L9RA 4UB0H 3B5TA 4CL7A 4ZO9A 2XFXA 3FOLA 1K3ZA 2HT3D 4E42A 3TJEL 4G9FA 3HZMB 1RZJC 2COQA 4R0LC 5L2KA 1IM3A 3MGOA 3BW9A 2NY2D 1RHHB 3GSNL 3BSZH 1WGOA 1MNUH 2AJYH 5D71H 1N26A 2VH5H 4RA3A 3MBEA 3TH3T 3ARFD 3UTSE 4Y4KB 4LHQB 3N50A 3CSPA 3T3ME 3MRFA 4OLZH 2WP3T 4YXHH 4YBLC 5EOCJ 4OF7A 5L9DL 3UTTA 3LOWA 1GZPB 1SMAA 2EYSA 2J12B 3T08A 4K9EC 2UY7A 4D0BA 4JB9H 3NFPB 4KRPD 4OZHB 5ESQA 4GUPA 4JPWL 1CFVL 3GGWA 3C5JB 3ULVL 4HUNB 1G9EA 1VPOH 4LSTH 1P4BL 4PJHE 1F4WL 3FAWA 3PWVB 3VXQB 1M71A 1QVOA 5H94B 2UZXB 3FB5A 2XTJB 4TPRL 1FFPB 4X4XA 2OTUB 4N5UA 1WF5A 2DTML 2CPCA 2VDPL 2FO4A 4YIQB 1OPGH 4NO0B 3IDNB 3REVA 3HB3D 4PRAA 4OZIF 2BCKA 1QA9B 1ZHLA 4K7PY 1MUJB 2AABH 1NMCB 3WFHA 1YEIH 4DEPC 1W72H 1DANU 2HRPL 1Y0LB 3MO1B 1Z6JT 2FL5B 4KJPD 1QD0A 2AXJA 5CBEA 3U30B 3EKCA 5LWYH 2IPTL 2OBGA 3P0VH 5J6HA 3DUSA 3LKPB 1QUNA 1A7OH 1HEZB 3D2UB 4P5MB 3NIDF 4PG9B 4M4RA 3VH8G 1BAFH 2BNUB 1C1EH 1F00I 3P2TA 1KCRH 3ZKSD 5F7LB 1V7NH 5DQDL 4MHHI 4XNYL 5IJKA 4R7DB 3EUUA 2AJSH 1QTYT 4Y16A 1A47A 2B5IB 1S7QA 1OP9A 4RQQA 4C83A 4OGAC 1KFAL 3EYUL 3RWCA 3CAFA 3O2WL 4HT1L 3BX7C 1NGPH 3CX5K 3QIBB 3GB7B 3QUXC 1A9EA 5F8RC 1U8MA 1JRHL 2IQAB 2XTLA 3FO9B 3L3JA 3JWNC 2V2TA 4LSVL 5CLWA 1CXLA 4R97B 5C07A 3T2OA 2PXYC 4MCZB 2WSKA 2NY3B 3C5ZD 4FFWC 4KKAD 4ZOEA 1XF3A 2MCG1 3S98A 3TA3D 1BBDH 1UWEH 5IB2A 1B0RB 3HE6C 4LMQI 1DVFC 3FRUB 3RHWK 1A3LL 1N59B 4FNLL 1GJIA 4U6YB 2EIDA 3D39E 5B3JE 4MXQC 2ZCKL 1XIWA 4KJYB 1CG9B 1IAKA 2AS5M 5CIPA 2MOVA 4X6CE 1U42A 2BHUA 1JP5A 2WV3A 3HI6L 1MRCH 2XWBB 3VI3F 5T5FL 3KGRA 1GPOL 3N85H 4MD5A 2NTFB 5HSFA 4LSQL 3VFNA 2VZSA 1E6OH 4BFIB 4JHAH 3S96A 3SJVD 2WUCH 4R8WL 5GS2H 4YBLB 4HUVA 4MJ6B 3M17B 3VW3H 3ALPA 3EYVA 5MEOA 1FNSL 4MXVF 4PRPD 2R2BA 5CZXC 2BNRB 4M4PA 4M8QB 3BIAX 1V3MA 2P4AB 4CU6A 4DTGL 1YEGL 4JVUA 4PJ8D 2HKFH 5IESL 2IAMD 4M7JL 3RNQA 5FOBA 3MV01 5A2IH 3WDJA 3IVKB 4XHQA 3PIQB 5IT2H 4Y1AA 1CF8L 4URTB 1NGYA 2IFGA 3CXDH 4F7TA 3K7UA 5EC1B 5ISZB 2GK2A 2GT9B 3Q1SH 1IT9L 5IHZB 4JFYB 3AGVA 2V9QA 1S7RA 2R9HD 3BZDA 5FV2A 4YC2C 5CMAA 2EDKA 5MHSD 1T83A 5IMOB 4KRMB 3PXHA 1NBVH 3MCKA 3VXOA 3ULUF 3OKMB 4G6ML 3MV8B 5JHDE 4L4VB 1MI5A 5ICYA 4F9LA 4KMTL 1Q9WB 1B2WH 2MQCA 4NBZB 5TDOA 3VJ6A 1HWHB 3B9AA 4RRPA 4WTXA 4K7PX 1KLUB 3MV9D 4P46D 3ET9F 1O0VA 3PWPB 1GIGL 3MUZ1 5DD5H 2DTSA 1QSEB 4RFOH 4GG6F 1JPSH 4HKZB 4RAUA 4WJ5A 3PWLA 5K9OA 3IFNL 4DGIL 4U1GC 4ZXBC 1KGCD 5IIEA 4APQB 1EO8H 5IB3B 4I4WA 1IGFH 4OCRL 5GGRA 1YMME 4ZUSA 4Z0BH 3RKPA 1IMHC 1OD7A 5D7JD 5B38B 3C2AL 3IS0X 5T33H 3RIAF 1YPZE 3MJ8A 5DQJA 4QRRB 3G6JB 1NUGA 4M9OA 5ETUB 3QUXB 4AM0B 1H8SA 4QHLA 4MX7B 3UTSD 3TNNB 5E2VL 1QFOA 2HAZA 3WO4C 1YN7A 4NRYA 1MAJA 2J3SA 3ARTA 3MRQB 4WV1B 1QQDA 2VRAA 3WNNA 2O61A 5DI8A 1G7IB 1X5JA 4X7EC 3KNBA 4M00A 2PXYB 3QO0A 2HFEB 3C8DA 1J10A 2VXUH 3HE6B 4PJEE 4UILH 4AZ8A 5TE4H 1J8HE 3O2VH 2DQDL 1IFHH 4WWKB 4P9HH 2YS4A 5CJQH 1S78D 3BHBB 3IFOB 1GHFH 4WUKL 2B2XL 2ZSWA 1FDLL 3S34L 4OZGE 4JY4A 2XKUA 2XQBL 2HG5A 2XG5A 3GHEL 2DKUA 4QF1B 2VE6A 5EOCH 2NW3A 4Z8FH 5DUPH 5BJTB 2IANA 5D1ZB 4UT6L 4PGBB 1CU4L 2HP4A 4TNVF 4EVNA 2W65A 3DRTB 4NKIH 2P24A 4OQTL 4C54A 1X44A 1FL5A 4Q9CA 1ODAA 5FUCC 1ZLSL 5A3ID 3Q3GB 4TULH 5DRZB 3L3HA 4X7DC 5HHXH 3VFRB 5D96C 1MF2L 4JO4H 1SJHA 3TN0A 1PW3A 3UDWC 1IZKA 4HUKB 3AAZA 4OQTA 1RFDH 4H25B 4ETYA 3FFCE 5LVEA 4JQVA 2EZ0D 4U1IB 1EDQA 3WS6A 2JB6B 5EZLA 3CVHH 1MCOL 5HVFB 2I60H 3D85D 2GY7B 3U4BL 4WTWA 3IDIA 3MYZA 1AQDB 4Y19A 4Z6AT 2YHGA 4NDMA 3UPRA 2VZVA 5IVZA 5J3HD 2SEBB 1ZGLA 2DM2A 3LQAC 3ARSA 4GMTL 5HYSB 2OR9L 2RBLA 3OJDA 1PEZA 1EO7A 2WUBL 4M7LT 3QG7H 4HK3J 4TSCL 5E0QA 3WUZA 1YZZA 3RL2A 5EZOH 5IFJB 4Y5YB 3TWCL 4KUZL 3DV6B 2YEZA 1VESA 2ED8A 2Z91B 2CLVA 4RGMB 4JO2L 3KYKH 1FVEB 4EZMA 3IFPA 3SDDB 2J6EA 3DTXA 2YD5A 4GAJL 5ALCH 3B9KA 1EK3A 1RZKC 1NL0H 1FCGA 2ATKB 5KVGL 4Z0XB 1JGVH 1T3FA 4L29B 4MAYA 5I1IL 2BK8A 1MCJA 4MMZC 5D7KD 3Q6GL 4BM7A 1FLRH 1CZ8H 2IQ9H 3D39D 3ARBD 3I3EA 4J6RL 1A7NL 4ZTPH 3WS3B 1AFVL 3JXAA 1OSZB 3QDMB 3GHBH 4HS6A 5HHVH 4J1UA 3HZYA 4OZIB 3QDGE 1ACYL 1FVDA 1FFOA 5GSVA 4EDXA 2V2XB 4AEEA 4QHKJ 5J11C 3ULUC 1I8IB 4Z7UF 2P5EA 4WENB 3NIGF 2FRGP 2DBLL 3GMLA 1ZVHA 4DUWA 3CGTA 5AD0A 3VXUB 2NXYD 4P3DB 3NGBB 2YC1A 3TF7C 2JELL 4X4YB 1MCEA 2JJTC 5FXCH 2EH8H 2HLFD 3QXVA 4NJ9L 5E8PA 1F3JB 4G7YL 4HULB 4BH7A 3DXAB 1KJVB 3RTQC 3SGKC 5FGCB 1HYSD 2FLRT 4PLKD 3QFJA 2DM7A 4RBPK 4Y4FC 4I0CC 3NFSL 1CFSB 4TTDC 5D7IA 2NYYD 1LE5A 4HKJA 2P47B 2XZZA 3HNTH 1C5BL 4X6EB 3MNVB 1NGQL 5IG7B 4Q6YA 4KQ3H 5FM4A 5CEXA 4QGTA 2GTZB 4L8DB 3TT1L 4DGVL 3SKNA 1WT5A 5C6WH 4XRCA 1I85C 4CDGC 3MLYH 3DIFA 5ENWB 5EZIH 5I66A 3U0WL 5DLML 4NNPL 1INEL 5I1AB 3WEXA 4OGXL 1U95B 2IBZY 3VFVB 4JN2B 5DJ6A 1W0VA 4M1CC 4NCC2 3T1FB 1A7PH 2Z31A 5DJYB 4DQOL 5F7MC 5JW4N 3CDGB 5M94B 2XWJB 5D6CA 3RY4A 5E2WH 5CP7B 4Y89A 2FR4A 4QRSA 3T1WA 2R0ZH 4NFDA 1AH1A 1EAPB 1T04A 4PJXF 5JHDD 3BISA 1KEMH 5L7XH 4K94H 1GYAA 3TV3L 1OSPH 5IMLA 4BELD 4LU5L 3S3SA 5E4EB 2PYFB 1KJ2H 3K0WA 1JNNL 4ONHB 4KK8C 1NCUA 3UTQA 5JXEA 4LSRL 3VXSE 4FG6C 3C09C 2XACC 1IAOB 1U3HD 4OD1H 1ES0A 5E5MB 3UAJD 4PV9B 3I50L 2VYRE 4O51A 5D1XC 3MNZA 2EYTB 2QKIA 2VDOL 4NN6B 4ODVL 1HHIB 1YMMD 3BPOB 5EOTB 4I2XB 4ZYKA 3QCVH 3CFDA 2R1YA 3KAAA 4MA1C 3EO0B 3WBDA 1N6UA 3G5ZB 1X5IA 3U9PL 3D0VB 5DR5H 3RUGB 2V2WA 1IL1A 1PBYA 2LABA 1IE5A 1I9RL 1FG2B 4I0PA 1HCFX 5DMYA 3PHSA 2R2EA 3SOBH 5A40E 4E9LA 5CLTA 1B9ZA 5EO9A 4TUKH 5BZDB 4XC3H 5GS1C 2YK1H 3ARDD 4QRPB 1DBBL 5F89A 3BQUB 2OP4H 2A38A 3V8OA 1VDGA 3HE7C 5T5NF 1HI6A 1K5NA 1YEDB 2CKBL 4FQXB 1X4YA 4IRJC 3FB7B 2PO6D 3VWJA 2FD6L 5F96H 3G6AB 1NGZA 4OFVA 1P4LB 4JRXB 3RU8H 3JV5A 4ORGB 4G6KH 4ZTOH 3CVHB 2CKBA 4K8RC 5EBWB 4KZEL 4ODUB 2DLFL 5FUZH 3QFDB 5CEYA 3CC5B 4HC1A 1PKQA 3BZ4B 2CDFB 3G5XB 2H3NA 4S1RL 5I19L 1NLBH 2HA1A 4XP4H 4UQ3B 2JTDA 3RTQB 4QKXB 1L0QA 1NGXA 1U58B 2Q6WB 4ZS7H 4Z7NE 1JPGA 4Y4FB 2DQEL 2YRPA 1JRHI 3W0WA 4YGAB 1VACA 3QXAB 5I18L 4P2QE 2Y06H 3STLA 3BESR 1XCQB 3FFCD 4M02A 4PJGB 4HS8H 5SX4I 3SKOB 4RGOL 4O4YL 4PJ7A 3ZE1E 1ZHBA 1RUQH 1U3YA 4JKMA 1LVEA 1XGQB 3JWDC 1QFHA 4ENEC 4WW2F 5EU3B 5BVPH 4HUXB 3WCYA 3PWJA 4YE4H 4NIKB 4OUUA 4YHPA 5DURD 1H3UA 1BMGA 3HI1A 4YNYB 4PJAE 5AWNL 2HMIC 3OBAA 1IEHA 3RIFK 4NPYA 2HJKB 5F3HB 2EO9A 1P7QA 1NC2D 1NANI 3TJHC 5LGJA 2AK4A 4Z76A 3NH7L 4H1LA 2P8LA 4R4FH 5F1IB 2A6JA 1TZIB 5DUBA 2HFGL 2VAAB 1JUFB 2NMSA 2ADGB 2FZ3A 3F6LA 4JKPH 1AGBB 3TYFA 3TNMB 2ZOLB 3UJJH 1LILA 1F5WA 1FH5L 4QYOB 1KPVA 4RWHA 4B53A 5CD3B 4QOKA 3VWKC 1YYLL 4R96B 3FO0H 2ICWI 1JHTB 5C0CE 4MA1B 3VFMB 3ULVF 1MIML 4XMPL 4NQVA 3TIEA 4NYLA 4GMSH 4JREC 3UX9B 3X14A 3EYOA 5DK2A 7FABH 1P5UA 5DRNB 5D7SH 4Z7VF 5T1LA 1JGUH 5AEAA 3T65B 4BUHA 2FX7L 4L4JA 1P53A 2HVJA 4MWFB 1FYTA 5F7DB 5AZ2L 4A2MA 3ARFA 4FXGB 2GJZA 3HMWH 3VG9B 2YWZA 2OYPA 5GS0C 3N1MC 4LVNB 3VFOA 4QRUA 4HEME 3G04A 2BSSA 2O5XH 3K2UL 5JIHA 1OTSC 2G2RB 4XNXL 1CTOA 5EH1A 4Y2DD 3V79C 1QACA 1TVDA 1BLNB 4H26A 3WKML 2ZCLL 4WFFD 4IRJB 5E56A 5C08B 3HPLA 4JJ5B 1OAUL 1A2YA 3D3VB 3L6FB 3L7FA 3SDCA 4D9QD 4MS8C 4LLVA 3L3DA 1KJ2B 2NW2A 3Q5TA 1FJ1A 1MCBA 1UJ3C 1IM9A 3FHAA 1BECA 2YMXL 4WCYH 1WFTA 2BOCB 3TBSB 2EDWA 4NRZA 4WFHE 5JO5B 4HK0B 5FKAB 4IOFD 3CMOH 1H0DB 3F7YA 3EYQD 5C0JB 4KJWC 3WD5H 1IQDA 3FKUS 4L4TD 5C0ND 2D7TH 3QPXL 1C08A 3KPMA 1MFDH 4C56D 2Z0BA 1KG0A 3NZHH 4DAGL 1AHWB 3IAPA 3LEYH 3DX8B 3P4OB 3SKUD 2AW2A 1V3KA 1QSFD 1A1OA 2PTTA 2XZCH 3KPOA 1JWSB 2QQNH 4GRLC 2VL4A 3B2VH 5CILL 4JFEB 1K2DB 2VDML 3LH2H 4OI7A 5LJYH 4Z7UB 2Z8VC 4X7SH 1DQJA 2QSTA 5BXFA 3O8XB 3HNVL 1DQQB 1MQKH 4JO3H 3O6ML 4KKNA 2CIIA 5F7EH 1EJOH 1HH9B 2I9LA 1G6RB 1K3IA 1KLFA 3GSVA 3ILQC 1JZ8A 1YC8A 3FQUA 5IF0A 3BRFA 4NC1C 5KTEL 2CMRL 4I3SH 4FFZH 1NAMH 3CX2A 1I7RB 1GVIA 2ORBL 4ISVB 1KB5L 5IFHL 1BZ7A 5I8CA 4WO4B 1T20B 1MRFH 1P2CA 1MFBH 5E94A 2BJML 1MCPL 2HFTA 4OZHE 4RFNB 1AGDB 5DMGD 2BFVL 3KPPB 2IPUG 3BJ91 1QRKA 3K80A 3FQTA 1R24B 3OR7A 3QQ3B 2GSGA 5AUMB 3C5ZA 1ONQA 1EGJH 3TA3A 3C5SB 2XTJE 5I1GL 4WW2C 1DUYB 2R1WA 2BRQA 2IJ0C 5EBLA 1DTUA 4PYGA 3VWKB 5FF6B 3WLWD 4KDWA 3T8XA 3GJFB 4KAQL 4W68A 5IROC 1DEEA 2YPKA 2WBKA 4F33A 2ADJB 3GSQA 4RRPG 1SJEB 4JY6B 3MBEC 5HYIA 4R7NB 5HVHC 1K4CA 5BO1H 4JREB 4PJXB 4DGYH 5KZCD 1TVHB 2NY0B 4Z95H 2C1PA 5ESAB 4QEGA 2EYRB 1C7TA 4LGSB 3OV6A 4F57L 3OGOE 1U8OB 2DF3A 2NXZC 1I1YA 3CXHK 1FPTL 2AEIT 4YDIH 1LNUA 1UEMA 4P57A 1RZIA 2VITB 3GJEA 3LEVH 1T1ZB 4NNXB 5EDXA 1D5IH 4P2QD 4XCEB 3H0TA 3WJJA 4PRPA 4P4KD 4X6FB 5JPMB 3TBTB 4NKMB 3T4YA 4HV8B 1CE6A 4FQQA 5CP3A 3ULVC 3QUYB 1J1OL 4NJAL 3STZB 2ICCA 3QIUD 2GSIA 4Q2ZB 5C71A 1OAYH 4PJ9B 2APFA 2DJSA 4OCMC 4RWYH 1OW0A 3QG6B 3KR3H 5E6IC 1TTUA 4OBRA 2OTWB 1FAIH 5SWZB 3UO1H 4HDIB 2GI7A 2ITCB 4JFOB 4MNQA 2LQRA 3P11L 5I73C 1WBYB 5CWSA 2R15A 4CAGA 3RVTD 3SGJA 2NPLX 2DQGL 4WEBH 3HMXH 3MRRB 1EEZB 2P5WB 4LP5A 3LRGA 3OAUL 3PL6A 3S37L 3RFZC 4AJ0A 2V6HA 1VEOA 2ZOKA 3U7WH 2ZP0T 1R5IB 4AH2A 5IJKC 3EDJA 3ISWA 1KN4L 3MV9A 1N0LA 2CLRA 4PY8I 1VFBA 4KFZC 4HKBA 4H0HB 5I71C 1L9MA 4HJGB 3E0GA 3K4DA 5HYFA 4OT1L 3IDGA 1LO3L 5BOPA 5C0EB 2WMPA 4HCRH 2H1PL 1N8ZB 5C0CD 5BS0E 1KXQE 5D7JA 2VC2L 1P7KB 3TO2B 3P40A 3O3BB 1YDPA 4Q6IA 2DYPD 2VUYA 3WN5A 1FZMA 1TZGH 3MRBA 2NY1C 3O11B 1BZ9B 5AZEH 1W0WB 2VR9A 4FQ2H 4YWGL 4UU9A 3UTSA 5HI5C 3LKNA 1JGDB 4OM1L 3MRDB 3MFFB 4PGEB 5DJXA 1IRAY 5C6TL 4XPBH 2OR8A 3L9RB 3VD5A 2QBWA 3QI9D 2XFXB 3P9MA 3FOLB 2AQ1A 4PS4H 1WZ1L 5F8QC 4KKLD 4G9FB 4XNZC 5ISZE 4PPTA 3DGCR 4EI6A 5L2KB 3T2PA 3BKCH 1IM3B 3MGOB 4JY5L 3BW9B 4PJHA 3DBXB 4AT6A 2AERT 3MLWL 5EA0H 3MBEB 3LRHA 4NGHL 1U8QA 1HK6A 3MRFB 1PD6A 1DL7L 3U83A 3QDJA 1CTNA 3ILPA 2VOTA 4L4VE 1DR9A 3UTTB 2EYSB 4XXCA 4D9LH 2CJUH 5DC0A 4D0BB 4MAUL 2NXZB 5IB1A 5ESQB 4GUPB 3GGWB 3PWPE 3QDHA 2VUOA 1SBSH 2EEAA 3GIVB 3P4NA 4HF5L 5E9DE 1SY6H 1QSEE 3MRLA 3C6LA 2HTKD 1M71B 4IJ3C 3H3BC 1QVOB 3MRPA 1DEDA 3FB5B 3WDHA 3D48R 3ARXA 5E24E 4X4XB 4LSDA 4RIRA 4WI4A 5JUEL 2E6QA 4M6NH 2O5YL 2FO4B 4NBYB 4KMQA 5DGRA 2OXHA 3ARED 3REVB 5DF0A 5DHVA 2YKLL 3D85A 4PRAB 2VXSH 4R90H 2BCKB 1ZHLB 3G6JE 1T83C 2D0HA 3WFHB 4F37F 4RGNC 1E4XH 1UWXH 1IJ9A 1Z5LA 3GMRB 4Y4KD 4F9LC 3I2CL 3SY0A 5CJ5A 4TNWF 3HAEG 3ME0A 2QJDA 5CBEB 1A4KA 1S7UA 1FGVH 1PZ5A 2FJHA 3C9NA 2A6IB 4NKDA 5J6HB 1MCQA 2A83A 2Q76A 3DUSB 3WV0A 1T80A 1IKFH 2GJ6A 3DVGA 3V4VH 2ZWLT 4ODHL 5F7YC 4XWOC 4G6JL 4EN3C 2DWDA 5I1KH 3MRIA 1O7SA 3EFDL 4JAMA 5I8EB 1C16B 3FOMA 4BZ2H 5CJXC 2AXGA 4Y16B 4JKKA 2XTJD 2X42A 1RUKL 1S7QB 2Z9TA 1M7DA 1KN2H 4RQQB 4YQXL 4C83B 5EU4A 4LNVA 3KPSA 5F9AC 1NCWL 2QSCH 3RWCB 3L5JA 3ARGC 1FFRA 1J1PH 3D39A 4CBPA 2HTLD 4P3WA 4OLUL 3VGFA 4B50A 2FB4H 1A9EB 3BMWA 3F8UB 1KJMB 2QHRH 1B0WA 2CIKA 1U8MB 1ZV5A 1T1YA 1Y6KR 1PQZA 5K9QG 4HPOH 4X98A 4BA8A 2A0LD 4FS0A 5JNYA 2V2TB 3OL2A 4U49A 3NA9L 3MACH 5DHYA 5C07B 2W92A 2A6KA 1XF3B 1I1AA 1VFUA 3BMVA 5IB2B 3OMZA 4NRXA 1E4WL 1FRGL 1YEEH 1T7XA 4AY0A 3D2UD 4S0TD 3RIAK 3CUPA 1BQLH 3E6FA 2QADC 1DFBL 1XIWB 2VXQL 4JM2D 5HHNA 1IAKB 3C08L 5CIPB 5FGBA 1QFWH 5DSCB 2MQ0A 3WXWL 1QFUL 2Y9RT 4XNZB 4XNUH 5B39A 5CSBA 1JV5A 1UWGH 1I1RA 1N64L 1QLFA 2UYLB 4KV5F 2J4WH 4XP1H 5CHNA 2B39A 1CR9H 1ZT1A 3V6BR 2VZ1A 4MD5B 4IMKA 1CE1H 4YZFF 3VFNB 5FDWB 2LVCA 3DI3B 3S96B 3DMMC 4OTXL 4HUVB 5M95B 2F54E 4KVNH 3EYVB 1K9TA 1IVLA 3MQIA 1DQLL 2EDFA 3UMTA 2R2BB 4HFUH 4FTVA 1KCLA 4LASH 3ZO0A 4U4BA 1OAXL 4JQVC 1V7MH 2NY3D 3RNQB 5FOBB 2QLVB 3DYOA 4Y1AB 4IJ3B 1NGYB 4OFKA 4XT1C 2PTVA 5CZKA 4F7TB 2DLTA 3HC3H 1J5OL 1KENL 3MUGA 5HHQB 3V5HA 2F19L 3MBXL 3RWDA 1KEGL 4LCCB 4JKWA 1S7RB 3DOSA 3F58H 4OIBA 3VFSA 1I9IL 5CMAB 3BH9A 3D9AH 4MB4A 5FYJH 4PGDA 5JXAL 3VXOB 1YMMA 3VXUE 4B41A 1U9KA 1HKFA 1D7FA 3P9LA 4OCSH 5FHBL 4AMKH 1MI5B 4NKOA 5ICYB 1P4IL 3P30L 3LS4H 3MFGB 3LKOA 4CMMA 4WDIA 2UZYB 3CLFL 4UINL 5ERWA 5TDOB 3U2SA 3VFGL 3VJ6B 1YPZA 3GNMH 4B7LA 5C0DA 4HSQA 1SYSA 1I1FA 3GMNA 5DJ2A 2B4CL 4MAYC 2E7MA 2BDNL 4RAUB 4KROB 4WJ5B 2V7HA 3PWLB 5K9OB 1UYWL 2WZPD 1Q72L 5IIEB 1GGIL 4AG4L 4I4WB 5HGDA 1CICB 4I1NB 5GGRB 5EBGA 4N5ED 4ZUSB 4G43A 1YY9C 1S9WA 1A3QA 4PJEA 1JZ5A 3FONA 2N1KA 1XGTA 1J8HA 1A7QL 3U1SL 1RY7B 5ISZD 5DQJB 4WFEE 4JHWL 4NO2A 1KCSH 1NSNH 2PO6A 2BVEA 4QHLB 4XH2A 1YJDL 3SGDH 4OZGA 3CFEA 4U1NB 4LLYA 1REIA 5C2UB 1JZ4A 1YN7B 4JVPA 4NRYB 3TFKC 1QQDB 2WM0A 4L4VD 2O61B 3R06A 5DI8B 5JTWA 1FGNL 2PW1A 3KNBB 3EO1A 5ALBL 2J5LC 3QO0B 5FA4B 4X9FA 3HA0A 1PYWB 1H3VA 1EFXA 3S88H 1S7SA 1F3RB 5LBSH 4NZUL 1I8LA 1LK3H 1JNLL 3PWPD 1RVFL 3BT2H 5D2LA 4J3OC 2AAVA 3WFDL 2V5SA 1QSED 4KQ4L 4HWBL 1A7RL 2QADB 2ZSWB 2C5DC 3F7VA 5DEGA 2VZUA 2W9LA 4KK6D 4JY4B 4MQXD 1IGMH 4APQD 2HG5B 3QCUH 5A1AA 4GSDH 2VE6B 5GRUL 1FIGH 2WBJD 5I1DA 3DGGB 1NCAH 2Z31C 4EVNB 1DUZB 4X5XA 4HWBA 4KHTH 3B2UD 2DQHH 2P24B 4YK4B 5JDJA 5GRVL 4X8XA 3SQOH 1FL5B 1WSST 3RUGE 3T0XA 3UYPA 5F6HI 5HDBE 2P44B 3MRMA 2OL3L 3L3HB 1PX4A 4ONFH 1NCCH 5DD3H 1J9CT 3RY5A 3O4OC 2K3TA 4S1QH 1BFVH 1SJHB 4NQTA 3TN0B 4FQIH 4JFZH 3AAZB 3U36A 5BMFL 3QEGL 2UUDH 3LKRA 5EZLB 4KKCD 1GGUA 1D9KA 2OL3A 2H2PD 3MLZH 5D2NC 1QSZA 1MJUH 3IDIB 1II4E 3C8KA 4ZPVB 5E8NA 4Y19B 1ADQA 4B5EA 4I3RH 3BDYH 3GJFK 4NDMB 4DKFH 5IJVA 3UPRB 1RAMA 5IVZB 1MCRA 1ZGLB 1JWMA 4TQEL 3CZFA 5T3ZH 3JV4A 3OJDB 5HI4D 4O2FA 1B3JA 4BZ1L 5TE6L 1PSKH 5HGBA 3RL2B 5C09A 4OD2A 3WL9A 5I1LA 1BFOA 4N9GA 1VGEL 4OB5H 4I0PC 5D1ZD 4RMUA 4CADA 2YEZB 4XVJH 2CGRH 3QDGA 4GAFB 1QPXA 5L88L 3IFPB 25C8L 2P45B 4EI5C 4ONOA 4PB0H 3CH1A 5CGTA 4QO1A 3B9KB 2Q3AA 3NABH 4ODXB 4M6AA 4N8CH 1RUAL 4IOIA 4IMLA 5GRJH 3H42L 3CLEH 4J3UA 2AKRA 1IILE 4NNYA 2B1AH 3ZKNC 4PJGE 2PW2A 3NCFB 1A0QH 1U2CA 1ZT4A 4HS6B 4J1UB 3HZYB 5HY9A 1ORSA 4NM4L 1FVDB 1TCMA 4A6YA 5I8OL 5JA9A 4ZOCA 1WAAA 5GSVB 4EDXB 1U92A 4XC1H 4XZUA 5KBNC 3QPQD 1D5ZB 1G1YA 2CLZA 2P5EB 1N0XL 1O7VA 1QR1A 3GMLB 5AD0B 1IGJA 2NZ9C 3FQXA 2YC1B 1UEYA 1IEBA 5E8PB 2VB5A 2XA3A 5CJBA 3S4SA 3CVIH 4BH7B 1KT2B 1H3WM 2F54D 2EDYA 3QFJB 2A6DB 4M61A 2J1KA 1DDHA 3LDBB 3SDDD 5IFAL 5D7IB 4Q9QL 1JPTL 1LE5B 3A67H 3O3DA 4IEFB 4HKJB 3ZSSA 5TF1H 3DSFH 2MPAL 5LXGL 4ETQB 5CEXB 4YXLH 5KVMC 4K71C 4IRSD 3PGCA 1ETZA 5IQ9A 3VGAB 2D7PA 3SKNB 1GC1H 4XRCB 5EB9A 1CLOL 4IIQA 4JN1L 4OF8A 3DIFB 5GS2D 5I66B 3OJMB 3L5IA 2VJXA 1OHQA 3DROA 5I2IA 1X6LA 1QKZH 2DQCH 5DJ6B 5F1SA 4S11A 3VXSA 1W0VB 4WI5A 2Z31B 3OHXA 4M7KL 5FKPA 3VG0L 4UT9L 4NUJB 3P73B 5D6CB 2RB8A 4YHOH 5DUMH 1VA9A 2FR4B 1N2RA 4QRSB 3DNKA 1GGYA 3VXUD 4AYFA 1T04B 5CUSL 4ZAKC 2ITDB 1IZJA 3O4OB 3OKDA 4HJJH 3OKNA 2Q20A 5IMLB 5JHLH 1GAFL 3BWAA 3TBYA 3DXAD 1CDGA 1N5AA 1QEWA 2FIRT 4XVTH 5A2LH 3MLPA 1D6VL 5DMIL 1CGSL 4O02L 3UTQB 3NCJL 5F88A 1UVQA 4NQXA 2KUTA 4JQIL 3AY4C 2YD7A 5IHBA 1ZANH 4BYHA 5DD6A 1BPVA 3S36H 3VU2A 4O51B 3QWOA 3SKMA 3MNZB 2QKIB 5E6ZA 1OAKH 4ZYKB 5C08E 3FN3A 3D3VE 4GAGL 4KPHL 3CFDB 2R1YB 4M7ZB 1MJ7H 3VMPA 4D8PA 2GTWA 1WIUA 2HT3C 4MA8L 4WFED 2V2WB 3ARPA 1IL1B 3LCYA 3Q6FB 4I0PB 1ZOXA 2R2EB 3JTSA 4KTEL 4IS6A 1X5ZA 5EO9B 4YUEL 2NY2C 2GYSA 3FB6A 4PD4J 5EWIH 2LVEA 4WGWB 1ZVSA 3ARFC 4L8CB 3ZKXC 1LEKA 1MSPA 2ZUUA 4U0RB 2CK0H 1CGWA 4RSVA 3K8LA 1R3KB 4JANA 5F89B 4JQXA 4P59H 3G6DL 3VD4A 4RNRA 12E8H 5ITBL 3SCMD 1LHZA 1K5NB 1R0AL 1PZUB 4KRPC 1MCLA 3VWJB 4OGYH 3WIIL 1YYMH 4JFFA 4O2CA 3JV6A 3SO3B 3U46A 2BXZA 1GGBH 1NGWB 3O2DA 1NGZB 3CSYA 4P2QA 5AAMA 1UACH 2UZIL 2I5YL 3U48A 3KPQA 5EIQA 4P4KA 5FB8B 1RJCA 5H2BA 4DZBA 4ZNCD 3K8KA 2CKBB 3PP4H 3JVGA 1EEYA 1I7TA 3HRPA 3QJHB 2D03L 4JDTH 1HOCA 5CEYB 1PKQB 1S7TA 3W2DH 3HB3C 1KXVC 5CZVH 2R4RL 4H0IA 2VQTA 2H3NB 4G6FB 4L5FL 1OQXA 6FABH 2EIZA 5DT1L 3KJ4B 2AJZA 3WIHA 4HXBL 2XI9A 1JPGB 2Y5TB 1R3IH 3W0WB 1OOAA 4ODWA 2EECA 1VACB 4E41B 1A22B 4KJPC 4JZJA 1UM6H 4U7KA 4QRPD 3D18A 3BGMA 3BQUD 3T3MF 5KOMC 1SEQL 4RMVA 1T22A 4PJ7B 3JWOL 1RIVL 5D5MB 1ZHBB 2D7QA 5C0AA 5K9KA 1J1XH 3T0DA 4O2EA 4FQXD 4HIIA 3QNXA 5E2UL 1AKJA 3RVXD 3CFKA 3L5WA 1G1CA 2C3HA 3PWJB 1U6AH 4AK1A 3JWDH 2W91A 4JRXD 4OUUB 1NEZA 2Y25A 4PJHF 4YHPB 3HI1B 1DBAH 1I8MB 1DQTA 4NPYB 4LSUL 3HR5A 3QCTL 5C0CA 2IH3A 1P7QB 2X5PA 4KZDL 1BWWA 3CDFA 2AK4B 4Z76B 3MNWA 4P2OD 2KBGA 4H1LB 2XZQL 2P8LB 2E3VA 2A6JB 3L95A 2OQJA 3GMQA 2P46B 5DUBB 35C8H 4LSSL 4ZMAT 2R69H 4UT7H 4K7PL 2FZ3B 3C5ZC 4QHNA 3TYFB 4KKAC 3TA3C 2E8YA 4FP8L 4JE4B 2CRMA 1KPVB 1KBGH 1NBYA 4O5LL 5EOQH 4JO1H 4MCYA 4QOKB 5E99L 3F7QA 1W0YT 3E2HB 4YHLL 3OGCA 3PG2A 5CAYB 3TBVA 5IV2A 4MA7L 1INQA 3PXJA 3QI9A 1ZAGA 1Q1JH 4LIQE 4P49A 1A4JA 1S7WB 3AB0C 1XF4A 4NQVB 3WUWA 4W6WB 4NYLB 3X14B 4P48A 4O9HL 3EYOB 5DK2B 4Z77A 2X41A 1OTUD 1HQ4A 1ZLUK 3PHOA 5GSRA 5T1LB 1WK0A 4M6OL 1G7PA 3EGSA 2HVJB 1T89C 5SWZE 1FYTB 1DSFL 3M8OH 4KK9D 5LGHH 3ZKXB 1AJ7L 3SO5A 1F90L 1P6AB 3MA9L 3VFOB 4ELMB 3G04B 4HPYL 1PKOA 4OFYA 1CDIA 1FO0H 4J4PD 1OP5H 1V05A 3MROA 4KMLB 4YHZL 5GS0H 3WJJC 3A6CH 3U7AA 1U8NA 2FGWH 5T3XH 4H26B 4LVHC 2J2ZA 4PJ8C 3HPLB 4WHCA 2AV7A 1A2YB 4Y8AA 2IAMC 2VZTA 1OP3H 3L7FB 1I9JH 4WTZA 3SDCB 3FRPA 4LLVB 3L3DB 4MB5A 2NW2B 1FJ1B 3MRHA 4NBXB 1IM9B 1UGNA 4NRZB 2XPGA 3MLXL 5B3JF 1OW0C 3AREA 4LCWA 2AK1L 3F7YB 1MJJA 3UJIL 1CLYH 4XVSL 4G6AD 2R9HC 4Q9RH 1IQDB 1M05A 1H5BA 1C08B 3KPMB 3HZMA 5I1EH 1IC4L 4X6CF 1KG0B 1Q9KB 5C1MB 2ICWJ 4FFYH 1HDMA 4HUUA 7CGTA 4X4ZA 2R56H 5J1AB 2C7UA 3NCBB 4P2RE 4EDWL 3RY6A 1A1OB 2PTTB 4GRWB 5TDNA 3KPOB 4P46C 1JHKH 1RULH 3WNLA 1DQDL 2Y6SD 5JOEA 4WUUE 4FOMA 4PP1D 3VI4F 3FL7A 4H88H 4D9RE 4FQPA 2VZ3A 1DQJB 1NCDH 3K4ZA 5BXFB 5C08D 1A21A 2X1XR 3GBML 3C5JA 4KU1A 3D3VD 1RMFL 2EDQA 4YHML 4C59B 1A1NA 2CIIB 3PWVA 2BY1A 4ZFOA 5EC2A 3GSVB 4H5SA 1TJHL 3W5NA 5D7JC 3FQUB 5IF0B 4AENA 5JW3L 1QBMH 2AJXH 4YPGA 3WN5C 2D3VA 4ESKA 1F4XL 4JPVL 2XQYK 4OLXH 4YIQA 5I6XC 1BZ7B 1BEYL 3P4MA 4TUOB 3GMPA 5DZLA 3UTTE 5BV7H 1T1WA 1WEJL 2A9MH 1P2CB 3QEUA 4PR5A 5E94B 1N5YL 3EDKA 2KZWA 5DD1L 2QEJA 1UH2A 5ECJE 43CAA 3A6BH 4NHUA 2EE3A 3MO1A 2Y72A 3FQTB 3OR7B 2GSGB 2E5EA 3F7PC 3WLBA 2P42B 3C5ZB 1ONQB 2FL5A 3TA3B 3BKYH 2R1WB 5EBLB 4LCIL 1YEJL 1EHLH 2BMKA 3B3IA 1S78C 4PG9A 1DEEB 2YPKB 3BZFA 5C7XH 4F33B 1OLZA 3GSQB 3GMMA 3NACH 4KY1L 3O8XD 1K4CB 2ADIA 4JM2A 1UC6A 2XY1A 2VAJA 2C1PB 4XAWL 2Q7YA 1B6DA 1YEKL 4XXCC 4GXVL 5I1JH 2YBRA 1PEWA 3DVIA 2XXCB 5I75C 1N6QL 3TJEH 1Z9LA 2R23A 5DZOA 3RKDD 3D6GA 1I1YB 1YPZF 5EBMA 5A3IC 1LNUB 4P57B 3GSNH 5CJ8A 4WO4D 3CMGA 1RZIB 3GJEB 4PYHA 2JLLA 4Q0XH 5FYKD 4U6VL 3UCRA 3H0TB 3GSWA 3IETA 3LRSB 1JBJA 3NMEA 3T4YB 4O00A 1CE6B 4FQQB 4CUCA 2EZ0C 5L9DH 3S6CA 2I07A 1B0RA 3EYSL 3QWQB 2EH7L 5L8LB 2GSIB 3IF1A 4LDLB 1JJUA 2A1WL 4PJEF 1CFVH 5J3HC 1OAZL 3ULVH 4U1KA 1WWBX 2ID5A 4FZ8H 4BK5A 2XZAH 3TVMB 2YPVL 1P4BH 1G7JA 1DE4A 1F4WH 5J06A 2WWMD 5TQ0L 2UVEA 1S7VA 4R4ND 1JHLL 1UH3A 2GFBA 1Z3GL 3T77A 2NY0D 4OZGF 1CXFA 5DJDA 4MNQB 2EDBA 2MTPA 2XWBA 1FN4A 1BQSA 5CWSB 5FAAA 1X5XA 5BS0A 1AR1D 1TTGA 3MZGB 1RIUH 2X10A 1QP1A 2E27L 4CMHC 3PL6B 4BFIA 4JGUA 2ZOKB 4AH2B 3K81A 4YDLB 2NR6D 5BRZE 3MV9B 3TO4A 4M48H 2CLRB 2UV3A 1VFBB 1WCBA 1UM4H 4HKBB 5DJCA 5CEZE 5E00A 2QHLA 1WBXA 4MQ7A 3IDGB 4XCNA 4HZLA 5IBUB 4TNWK 3L3IB 3QUYD 1M6OB 3ARBC 1FSKC 4NO5A 1J0IA 2A73A 2VO5A 2X9WA 1OCWL 4DN3H 2HJFA 4X83A 2HVKA 2P48B 4PJ9D 4UOW1 1RJLA 1EA9C 1YDPB 4Q6IB 3MUY1 5ISZA 3WN5B 1FZMB 2YWYA 2X4OA 4F7MA 3T4AA 3MRBB 1S9YA 2X09A 2W9EL 2NXYC 5SWZD 2B0SL 4WHDA 1KFAH 1JGEB 4UU9B 5I15L 3LKNB 2HLFC 1A6TA 4HT1H 4YBQD 1H3TA 2EDLA 1QO3A 2ESVE 4R6UA 3BGFC 5DJXB 3WFBL 2AJYL 5JQ6H 5D71L 2CRIA 2VH5L 4NWUL 4PLKC 1K6QL 2P5WD 3P9MB 4K3EH 4OLZL 4ZS6D 3ZTNL 4YXHL 2AQ3A 2NYYC 4QXGL 3I6GA 2WWKO 4LSVH 4YHKH 1PY4A 4D3CL 4EI6B 3RA7H 5E9DA 1QSEA 4JB9L 4PJHB 4AT6B 4WY7H 5KS9A 3MRGA 4X9BA 1A3LH 3AROA 4FNLH 2Z4QA 2DQJL 4ZSOE 1U8QB 3QDJB 3ILPB 2ZCKH 3FMGH 4PY8J 1MI5E 2WBJA 4JFPA 4GLRI 5BOZG 5I75B 4ZUTA 5GGSA 1OPGL 3D1MC 4XMLH 3G6JA 5IB1B 2LAAA 5JZ7D 4KH2A 4OLWH 1QLEL 3P4NB 2Q3ZA 3LD8C 3MRLB 3C6LB 3TNNA 4DN4L 2AABL 5D93C 3KJ6H 3MRPB 5KN5A 4LSQH 4AEIL 4P2RD 4WV1A 2AI0H 2BNQE 2Z8WC 3HUJA 4WUUD 3FCTA 2HFEA 4PJFE 5LWYL 3MLRH 4ZOAA 5DHVB 1QR4A 4D9RD 1UZ6E 1U3HC 3OG4B 5GZNC 5CGYD 1A7OL 2DLIA 5SWQA 3UAJC 5L2KD 1W72A 2FLBT 4NZRH 1C1EL 2VSCA 4HGKC 4M7LL 1VCAA 2Y7QA 4I77H 1Z5LB 3QEQA 4OGZA 5FIEA 1JMZA 5BQ7A 1KOAA 3SGEI 1KV3A 1A4KB 2UWEE 2AJSL 1S7UB 1WQVT 1PZ5B 2FJHB 3C9NB 2FJFB 2A83B 2P8PA 5SX5K 5C0IA 5BJTA 1IT9H 2Q76B 3AM8A 3UTTD 2GJ6B 3MLSL 1ZWIA 2CDGA 3DVGB 4I5BA 3RWJA 3FQWA 1FP5A 4WI8A 1UA6H 2DWDB 4DKAA 1A5FH 4JAMB 3I6LD 3ARDC 3FOMB 2UY6A 2K7PA 4KTDL 4KMTH 3V7AE 2WP3O 2B4CC 1ZGLP 1M7DB 1GCFA 1TXKA 1MFAH 1SBBA 5EU4B 3KPSB 4NWTL 3RL1A 3QSKB 1U8PB 1RUML 1GIGH 1BBDL 3PGFL 3STBA 4X0KA 3AS1A 2Q1EA 3B8YA 3IFNH 2CIKB 4DK3A 1T1YB 1PQZB 4X98B 5HYSA 1EERB 5JNYB 2C3GA 4Y5VA 1EUUA 5DHYB 1ZE3C 2A6KB 1I1AB 3V7MA 3EOBA 3NN8A 1T2QL 3SBWA 1YJDC 4Y5YA 1I8LC 2Q8AL 2AEWA 4X80L 4XCCL 4OUOA 3BGFB 1DBJL 1R6VA 2Z91A 3CUPB 3QHZH 2F54A 3E6FB 2VSDA 3O3AA 3FQNA 3WFEH 1FVEA 4JHAL 4Y19E 4YDVA 1NMAH 3RWGA 3EOYG 4GKSA 4GQ9L 3VW3L 1IKNA 5B39B 4DVRH 1JV5B 4Y16D 4Y5XA 3E3QC 1QLFB 3AFLA 5KSUA 4L29A 1EXUA 1NLDL 1NFDF 5CHNB 1F3DJ 4IRSA 2WBWB 1ZT1B 2HKFL 3DWTA 4PJIE 1L0YA 2AXFA 2DQDH 4KWUA 1KC5H 3O45A 5IT2L 5FM5M 4WUKH 3BKJL 5F1KC 1INDL 1CWVA 3VE0B 4NQDB 3S34H 2DMKA 3LEXA 2XQBH 5IVXA 5KANI 4KUCD 2ATPA 3HS0A 4FTVB 3IDYC 5D9SA 4OCYH 3VA6A 3BPCB 3KYMA 4UT6H 2R0KL 1LO2H 1X4XA 5A2KH 1W2KT 3LD8B 1HSBA 4U6XA 1DLHA 4JFHE 3PDDA 2JJSA 5GGUB 2FO1A 3L1OL 4R2GB 3LN5A 3H3PL 5SV4A 1A14H 1B2WL 3MUGB 5CEZD 4CRPA 5EN2A 1CFSA 1MF2H