1FDLH

Crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
218
Chain Sequence
QVQLKESGPGLVAPSQSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLHTDDTARYYCARERDYRLDYWGQGTTLTVSSASTTPPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (antibody-antigen)
molecule keywords IGG1-KAPPA D1.3 FAB (LIGHT CHAIN)
publication title Crystallographic refinement of the three-dimensional structure of the FabD1.3-lysozyme complex at 2.5-A resolution.
pubmed rcsb
source organism Mus musculus
total genus 42
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1990-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fdlH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fdlH01
5HJ3A 4BH7A 4EUPH 1IAIH 1MIEH 2BFVL 1UJ3A 1L9MA 2WUCH 2UYLB 2E9JA 2AV7B 2X4UA 3G5VB 1BFVL 4IRSB 3KXFD 2WP3O 2Q3AA 1RIUL 2AJYL 2YRLA 4UILH 4KMTH 4P59L 2GTWB 4PRPB 2E7HA 1O7VA 4Y4FC 3NA9H 4NJ9H 2WV3A 4S1QL 3SN6N 3TT1L 3MLTA 1IGCL 1WJ3A 1RK0A 1RZJL 43C9B 3SPVA 5KSBE 2H6PA 2W0FA 4MNHB 4LKXB 4OUOA 4MA8H 3H8NA 5C0AD 3L3GB 4RRPA 5L6YL 4G9FD 5GGRB 1TVHA 5L9DH 4KVNH 4MJ2A 4F7EA 3GMLA 3IDYC 3QUYB 3KPRB 1A6TB 1M05A 3VG0L 1P53A 4RZCB 2YRPA 3G08A 3CFCL 4U1IB 1G7LA 4H20L 1J1OL 1YECH 3D25A 3BT2L 3HRZB 2XTJD 3RL2B 3M17A 5B3JF 1QFWI 5C0BB 5C8JB 1HXYB 1ACZA 2AKRB 3H9SA 1I1YA 2R9HC 3PIQA 5C7XL 1V3JA 3LPFA 1DBJL 4I8DA 1KJ2B 2HVJA 3UJJL 2FEDC 4RBPK 4LCWD 2V9QA 4HXAH 5GRJH 3CPLA 1DQQB 2GEEA 3IDXH 1XGPA 2VAAA 1AFVH 5JHDA 4NQEB 3LCYA 2R4RL 4U4BA 1UWXH 4WU7B 5DD5L 4GSDH 5FYJL 3QT2A 1WISA 3KPSA 4OI9A 4GKSA 4H0IA 4M00A 3MRPA 5DK0A 3BMVA 2VDOL 3VWJB 2QTEA 4TUJB 4R2GD 1CGWA 4PJGB 3GKWL 3ZDZF 4KJWC 4LVEA 1KPUA 4JLRB 4PP2A 1CXLA 4HWNA 1KJVB 2HMIC 5IEKB 1H5BA 4OTXH 5D71H 5EFIB 4GRWB 4TRPL 1C12B 1MCCA 1KLFA 1D5XB 5GJSH 1UH2A 4IMLB 5I1CL 2ADFL 2PO6D 5D7LD 2XOTA 8CGTA 3RWCB 1U8JB 2IFFH 5I1LA 1JZ3A 4G8EB 5E6ZA 4UDUB 4OF8A 3CVIH 3ZYZA 2A2QT 2VZSA 3KPPA 3FHQA 4P2RE 3J7HA 1EBPA 1ZS8B 4LASH 5K9QI 1IL1A 4LRIA 2A1WL 4IRJD 5TDPA 5ITBH 5I74B 2GTZB 2BNUA 3TZVD 3BO8B 4LHQB 2CUHA 5HDQH 4ZUTB 1R0AL 5DJXA 1EZVY 5A2KH 3WJJC 3TN0D 1S7TA 1IC4L 4UB0H 1L4IA 4YEFA 4LCYB 1TCRA 4X9FA 4ZPVA 1DBBH 4UNVA 2O5XL 1HCVA 4PJIA 5BRZE 2XN9A 3RUGE 4ZNEA 3CCHB 4D0DB 4GLRH 4PUBL 3VFRA 3EYUL 2G60L 2YPLD 3R4DA 1AP2A 5D2NB 3L1OH 4ZUVB 2F5AL 2W60B 1D9KC 5I17A 3HMXH 2IPKB 4XP4H 4OFKA 1H0DB 1QLRA 4H8WL 4N5UA 3RNQB 2ZOKB 1JJUA 2O26U 5HHMD 3C5SA 2E9BA 4ZUSA 5IMOB 1WLHA 5EBMB 4LSUH 1AGEA 5GGRY 1A9EA 4X7FC 2WBJB 1AIFB 3SKJH 1HHHA 2MTPA 2X89A 1FSKC 4Z7VF 1HOCA 4QXTA 4OI7A 4MJ5B 4OZGA 4BQBA 5DO2D 1MWAA 1R5VA 3N85L 5CSBA 3EJZC 4O51A 1FG9C 4QXGH 4PJ9A 4BKLA 4LFHG 1UB5A 3V0WL 3PV6A 2J8UB 5MEQA 3T3ME 1G84A 1HHGB 4DW2L 2QADB 4JKMA 1MAKA 4R7NB 4G8GD 5DT1H 4MJID 2C26A 1K8DB 2P5ED 5CSGA 4XZUA 1UZ8B 2G2RA 4HS6A 4YXHL 2R2BB 2HLFC 4PYHA 4IDLA 1S9VB 3EFDL 3FZUC 4JHAL 4QRQB 1RJYA 1YN6B 2HJFB 5J06A 1NAML 4OF7A 3A6CL 1MCPL 4G6FD 1F6AA 3D39A 3C60C 4PJGF 4WI9A 2ZWLT 4JQIL 3ZKQD 4HK3J 5DS8B 2QSVA 1U6AH 4GQ9H 2Z91A 5MHSD 3U79A 3HN3A 3O45A 4WEUD 1FZJA 4HFWB 1IAIL 1MIEL 3QIUB 2WUCL 5ICXB 2X4PB 1PG7X 3EOAB 4LDEB 4U6YB 5KSUA 5CJQH 5IK3A 3V5KA 5ESQB 3TH2T 4LF3B 1KT2B 4UILL 4KMTL 1F11B 3WLWC 2AJUH 3DTXA 3NA9L 1CWVA 4NJ9L 3EHBD 4CVZB 1U8HB 1IMHC 1UM4H 3LRGA 5IBLC 4RMQA 4K23H 2VXVH 4KDWA 5EZLB 7FABH 4L3AA 4GW5B 4PRDA 2VLKD 4LU5H 2EECA 4MA8L 5CBEB 4K94C 4JM2C 1JIBA 1EHAA 3MCLH 5L9DL 2VUYA 1W72B 4FHBD 4KVNL 1AQKH 5IB3A 2IBZX 1BX2A 4HX1B 3KJ4B 1MVFA 5ESVB 3X17A 2OTWB 1YYMH 1LP9B 3AMKA 2HN7B 3IFNH 3TVMD 1JNLH 1N2RA 3EYFB 5FO8B 4PLJD 2C4FU 3NZHH 1GGYA 4PRIA 3S37X 4HS8H 5LCVH 1C08A 1YECL 3E6HA 4EIGB 4LLAA 2W92A 3K4AA 1MHEB 1R3LA 3QQ9C 2H45A 3ROOB 2BSTB 2CSPA 32C2B 4W6YB 3AU1B 4APQA 4XWOC 3NCBB 3BP5A 4HUKB 3DURB 5D4QA 2A6IA 4HXAL 5GRJL 4XMLH 1N4XH 3EGSB 3IDXL 1AFVL 3GJFH 5CSZB 2AV7A 1AD0B 3G5VA 4GSDL 1I7ZB 3OB8A 5D7KE 4IRSA 4WHYG 3TYFB 1C8PA 3P9MB 4L4VD 2YBRB 4XBPB 4PRPA 4JRXA 1F02I 1I8KB 1FNEB 43C9A 2P4AB 3TF7C 5CILH 3TO4A 3QIBC 4MAYC 4LKXA 5D71L 1WC7B 3PQYE 3L3GA 4P46D 3BN9D 1I8IB 5DTFB 3UJIH 2FJFB 3ZT7A 1CDCA 5EOQH 5DGRA 5GJSL 3QUYA 3KPRA 3ARBB 1A6TA 1A7PH 4U1HB 4D9RE 3DMMC 1OWWA 3HE7A 5HDLA 2FJGB 2DWEB 3LRSB 1IBGH 4BSVA 1KTLB 2WWMD 1FFRA 2IFFL 4Q2ZB 4RZCA 4C54A 3DUUB 4U1IA 3CVIL 3HRZA 3RL2A 5C09D 4YJZL 5C8JA 3X12B 1BLNB 3MJ6A 2AKRA 3BP6B 4LASL 1L7TH 4E41B 1ZT1B 5BW7C 2NZIA 2CO6B 1TZHB 4G7YH 1JNNH 3KGRA 3GMRB 5ITBL 5EH1A 4Y4KC 2ADJB 5HDQL 2AJ3B 1VKXB 1Y6KR 1OAUH 1TDQA 1MSPA 1MY5A 1DQQA 4UB0L 4KRNA 3WHXB 4TTDD 4NQEA 5JW4N 4K3HA 1DBBL 2EKSB 1Q94B 4WU7A 4WY7H 4XP1H 1JZ7A 2NR6C 3BQUC 4X5XB 1LWRA 4MXQD 8FABA 1T7VA 2A0LC 1HI6A 2V9RA 2PCPB 3UTSD 3CUPA 3L1OL 3HG1D 3VWJA 3HMXL 4N0RA 4XP4L 4TUJA 4PJGA 2CDGB 3OF6D 2QKIB 4JLRA 3DHMA 2MFNA 5IEKA 3B4NA 5EFIA 4LSUL 4LBEA 1G7JB 1JF5A 3SKJL 5SWZD 1C12A 4M8VA 1D5XA 5HHPB 4O2FB 5HVHB 1QR1B 3AY4C 3DX9B 2G5RA 2AAVA 4QXGL 3RWCA 1U8JA 4G8EA 1VFAB 3O4OC 1IGIH 4JHBA 4UDUA 3ARXA 4MCYB 4WO4D 4OCWH 4NKMB 1NLBH 3PL6D 1VFOA 5DT1L 4GBXC 4MQ7B 3PWPE 4L3ED 1ZS8A 5T1KB 1VEPA 3V6ZA 1WWBX 1JZ6A 3L5HA 3MTRA 3JWDC 2GTZA 2MCPH 3BO8A 3RVVC 3WUZA 3VXNB 4JFFB 4ZUTA 2X2YA 2W1NA 2X10A 2V5SA 2BMKA 1RVFH 1UKQA 3BEWB 4UQ3B 4LCYA 3B8YA 3FB8A 3C8KB 4WU5B 5DC0A 1CLYH 2WWKT 5D1ZA 1U6AL 4GQ9L 3GSXA 3CCHA 4U6VH 4D0DA 3SEPA 3RRQA 1F4WH 5MENE 4ELME 5C86A 2E7LC 4FFVD 1H15B 2CXKA 5ICZA 2X4RA 3MOBH 3UTTE 4EZMA 3Q6GH 1RJLB 2IPKA 2IBBA 4OQTH 2NY3B 5KVMC 3TBWA 5CJQL 3RNQA 2ZOKA 2J7LA 2EDOA 1QFUH 1WV7T 3HS0B 4KROD 3IXTB 4ODBD 5EBMA 5IMOA 2AW2A 2AJUL 1OTUD 4UIMB 4W4OA 1AIFA 1UM4L 3HC0A 3IDMB 3W9EA 1LQSR 3ME0A 4MJ5A 1NEZB 4K23L 1BZ7B 2VXVL 4O2EB 7FABL 4LU5L 3I6LE 3WNMA 4X0KB 4B53A 3MCLL 3MSPA 2XWTB 5EOCH 2J8UA 1AQKL 2DMKA 1HHGA 3WLBB 1GOHA 4P4KC 4PJCB 1SYSB 4R7NA 1GZQB 4EI5B 1K8DA 1YYML 3SKOB 3IFNL 3R0MA 1UZ8A 1JNLL 3ZE0F 4U7SA 3NZHL 4HS8L 4MXVE 5D5MB 1S9VA 5LCVL 4B50A 3RWDB 4QRQA 4CU8A 4RNRB 5JZ7D 1YN6A 2HJFA 2VLRE 4PJXB 5EU6E 1ZLVH 1TJHH 3W5MA 1JNJA 3BP7A 3GSOB 3WD5H 5J57B 2AK4D 1YPZF 3DARA 1VSCA 2FH6A 5DS8A 4EN3C 4PP1D 1S7QB 4X98B 4PPTA 4DOHB 1SY6A 3SDXE 1DN0B 4X6CE 2W9DH 1KF9B 4XMLL 1N4XL 3QIUA 5ICXA 3O41B 2X4PA 3EOAA 1NFKA 3T0EB 4Y2DB 5ESQA 3FOLA 4LF3A 1KT2A 1IAKA 3BX7C 1F11A 4CVZA 1U8HA 3GIVA 5DMYA 4KDTC 5I1DB 2FIKB 5EZLA 5CILL 4XVUD 4GW5A 3ILPB 4BQ6A 5CBEA 3QDHA 3MPCA 4LSTH 3UJIL 4RMUA 1W72A 5EOQL 3D87B 5AZEH 2R23B 4M3JA 3QUMB 5F7YC 1A7PL 4HX1A 5GISH 5LGHH 3MV01 4UUJB 5ESVA 2OTWA 3LD8C 4PGDB 5B8CB 1LP9A 3ES6A 1IBGL 4PREB 2DMBA 5FO8A 3MJ9H 4ZYKB 3P77B 5K9OA 4YWGH 4PJEE 4WWID 4Y1AB 1MHEA 1FC1A 1YJDC 3EJJX 4JRYA 1XR9B 2C9AA 3BDXA 3EUUA 2CRIA 4IOFD 4PRHD 1L7TL 3O6KH 2CKNA 3GSNH 3LOWA 3P4MB 1YC7A 3ROOA 1VADB 4G7YL 1JNNL 2WQRA 32C2A 1H3WM 1T3FB 5DC9B 3AVEA 3AU1A 1CE6B 3TBVB 3DURA 2J1KA 1OAUL 2P46B 3JWDH 4U1GB 4JZJB 4U1KB 1F4HA 3EGSA 3OB0K 3OKMB 2H2SC 5SV3A 3AREB 5CSZA 4PJBE 1AD0A 4WY7L 2XKNB 1FJ1A 3L95B 4XP1L 3WO4B 1I7ZA 3TYFA 3P9MA 1QRNE 2YBRA 3VFNB 4XBPA 4JFPB 4PJCF 4LCUB 1CL7H 3QEQA 5GGSY 3RY6C 2DM7A 3RVUC 2NY1C 5ETUB 3DROB 1YY9C 3WNPA 4Z7WF 4QT5B 1I8KA 4C58B 3CVHH 5D5MF 3RJDA 4Q9BA 5JO5B 4KKBD 3OAUH 4F33A 4HJJH 3NFNB 4PJXF 5FDWB 4YPGB 1WC7A 5DTFA 1I8IA 1ND0B 5D7SH 5C0DB 1FFNB 4U0QB 5CD5D 5DMKA 5I8CB 3ARBA 4U1HA 3QCVH 3VXRA 1LO5B 5K9KB 5DLMH 2FJGA 2DWEA 3LRSA 1KTLA 4ZO8A 1MCLA 4XPAH 1IGIL 4PRBA 3DUUA 2VR9A 2ADIB 3R0NA 3ARPA 3NA4A 4OCWL 1NFIB 1NLBL 4WWKD 3BPOC 4G9FB 1A22B 3X12A 2V2TB 1UH3A 1KCVH 3BP6A 3MGOB 2YKLH 3QULA 3V5DB 2FD6H 4E41A 1ZT1A 2GK0B 1TZHA 1LK2B 2Z0BA 3GMRA 2MCPL 2AEPH 1UB6B 4G6MH 2ADJA 2XY1A 4DTGH 1N3NB 2AJ3A 4N9GA 4XHJD 1VKXA 3N0PB 2XTJB 4NQDD 3O6FA 1RVFL 1VFBB 4WFHD 2Y5TA 3MREB 4M8QA 2NXYC 2YD8A 3WHXA 2AJZA 2A38A 1P7QD 2EKSA 3BIAX 1Q94A 1CLYL 3B9KC 4HG4J 2FX7H 4X5XA 4U6VL 4YBLC 1F4WL 1J8HD 5E8EB 3TA3D 5FYKD 1QFWH 4QRRD 3MOBL 4JANB 3T2QA 3Q6GL 4LCWB 2DYPD 2DBJA 4OQTL 5DZNA 4WEBH 1YPZA 4K2UH 2CDGA 2QKIA 4HWEH 1HQRA 2EDYA 3S3PA 1XFPA 1QFUL 3V0AC 3SE4C 1G7JA 2VXTH 3IDUA 3D2UD 1XZ0B 3FL7A 5HHPA 4O2FA 1T83C 1CE1H 1B88A 1NEZG 3G04B 3DX9A 4R2GB 4PS4H 4O02H 4M6AA 3T09A 3A6OA 2X5PA 1VFAA 4Z78B 5EOCL 4MCYA 4BJLA 4NKMA 1EEQA 5C0CA 3UZEA 1QO3B 4MQ7A 2MCG1 5T5NF 5T1KA 4UNUA 4LSVH 1PG7W 2LE9A 3QHTC 4X7CC 1RZFH 3QPQD 2VL5B 3ISWA 2PO6B 5D7LB 3BPCB 1K5NB 2Z93B 4KI5E 4WNQA 2IBGA 5GGVY 3VXNA 4LK4A 1TJHL 4H1LH 1FFQA 4U0RB 3O0RH 3WD5L 2YZ8A 1YJDH 4P2QA 3BEWA 4UQ3A 2AEWA 5CJXA 5TDNA 4ELKB 5GPRA 3C8KA 4WU5A 5F89A 4HIXH 5TE4H 1PYWB 1DQMH 2W9DL 1U8MA 3TZVB 3VI4F 2CDFB 1MFDH 1H15A 3PHSA 3TN0B 1IZJA 1T2JA 3T04D 2QSTA 1T7ZA 1FN4B 2VSCA 4OT1H 4LCCB 2F54E 3B3IB 4YXLH 3IXTA 4V2CB 2BJMH 4MNGE 1BJ1J 4LPWA 3GSWB 2ICES 2UZYB 1CT8B 4UINH 1BZ7A 5HVGB 5KS9E 3VXOB 4B5EA 4KJQC 3H7LA 4LSTL 5JOPE 1WUNT 4CW1A 2FZ3B 2XWTA 5T3XE 5AZEL 1TZGH 3WLBA 4PJCA 5GISL 5LGHL 1T03H 4NO2B 1GZQA 5I9QC 4ONHB 1GHFH 3SKOA 2DIJA 2GUOA 1HILA 2DI9A 3FQTA 3MJ9L 4S0TD 2FYYB 2W59A 5A16B 5D5MA 4YWGL 3RWDA 4RNRA 4Y19A 4MJ4A 3UTOA 4PJXA 4FRWA 2NY6B 3IVKB 5HGAB 4PTTB 3O6KL 3GSOA 3GSNL 4HIEA 5CJ8A 4G8GB 2VXUH 1T5XB 3DYMA 4MJIB 2P5EB 1MI5E 4GRLD 5EC2B 1S7QA 2X40A 4X98A 4PRAB 2DLHA 4GFTB 1RULH 2VR4A 5EUOE 4OM0H 3JWDL 2VUOA 4WTWA 4M9OA 1G6RH 2P48B 3BZEB 3WV0A 4G6FB 4KVCH 3O41A 3VFPB 5CWSB 5JHLH 1LK3H 1IT9H 5GXBB 4Y2DA 3DX8B 2EDJA 3UTQA 3NFPB 4ZS6C 4G6KH 1CL7L 3O9WC 3K7UA 4POUB 5IHUH 1GGBH 5IB5B 5I1DA 1X4YA 1EIBA 3CVHL 1ZT4A 2XXMB 5E6ID 5JIIA 2FIKA 3C5ZD 4PY7B 3ILPA 4XMPH 3OAUL 2APBA 2EDBA 4HJJL 4MA1B 5D93B 3PDDA 3U4EB 3PWJA 4H0GA 2VO5A 5D7SL 3PP3K 4EJ1C 4Z7VE 3QCVL 4D9QE 4PBXA 4PGDA 5B8CA 5DLML 3ULVD 4PREA 3ALPA 1VEOA 1AHWA 1M6OB 4XPAL 4DKFH 3P77A 1DQDH 1I1AD 5EO0B 2VLKB 1QSFE 4Y1AA 4Y5XC 1XR9A 1PBYA 1KCVL 2CKBH 4L8SC 2YKLL 3WFBH 1JCKA 2FD6L 3SCMC 3P4MA 4LIQH 1CGVA 4HMDA 1LD9B 4P5TD 3RVWD 2HTKC 2AEPL 4HUUB 1T3FA 4G6ML 4YBQD 4DTGL 3TBVA 2I26N 3MNWB 4U1KA 4X9BA 4JZJA 5E70A 1SM3H 3C2AH 5FUCC 1BQHB 2X1QA 5DK2B 1AGFB 1PG7H 5IM7B 3SJVB 3WS6A 3AREA 5M7QA 2ARWA 1AGDB 1P7KA 2YZ1A 2XKNA 5ILTH 3L95A 5LWYH 2FX7L 1G7IB 1O5DT 1U58B 3C2SA 3X3FH 5F6IC 4JFPA 2HT4C 4HWBH 1QFWL 3MRDB 2A9NH 1RJZB 2UUDK 5ACLA 4HZAA 5ETUA 3BZ4B 2Z8WC 3DROA 3MZTA 3TFKD 4QHUB 2OJEB 3MLWH 4QT5A 4WEBL 4K2UL 1PKQB 2FO1A 4HWEL 4L4TB 4I9WE 5JO5A 1T0NB 2V5TA 5JORB 3GRWH 3NFNA 3ZT5A 4D0CA 5FDWA 4YPGA 3O4LD 1X5YA 4XP5H 3ZMRA 4L4VB 3WFEH 2VXTL 3KXFA 1ND0A 1OP9A 5HYJE 5MI0C 5C0DA 1FFNA 4FA8A 3BD5A 2B1AH 5I8CA 1WF5A 4M43H 1RJCA 4PLNC 1CE1L 1LO5A 1L0XA 4O02L 4PS4L 4LP4A 2ADIA 4WEMB 2F74A 4H26B 5HPOA 1NFIA 3OAZH 5C0AA 4P46B 1EFQA 4G9FA 2V2TA 4PLKD 4FP8H 2G75B 2BCKB 5LJYH 1KV3A 3MGOA 4CADA 2C4FT 4LSVL 1JPSH 3KYKH 4BELD 1NCDH 1RZFL 2GK0A 4FXKA 3ELAT 1U91B 3HE6D 1LK2A 3FOMB 3P11H 4IIQB 2DRUA 1UB6A 4KKLD 1VFUA 3OGCA 1E28B 3ARGC 3AGVA 5IV2A 3O0RL 5C09B 3VGAB 1VFBA 1YJDL 1EX0A 3Q0HA 3MREA 5DURB 1X6LA 2CLRA 2NTSP 5GIRB 2M1KA 3BUYB 3N9GH 3RZWA 2NY2B 2HLAA 4UBDC 4XNXH 4HIXL 5TE4L 5E8EA 1DQML 1MFDL 4JANA 4LCWA 1DJSA 3HRPA 3QUXD 1GJIA 1SEQH 4FQCH 4PGEB 3C6LD 3HNSH 1JMXA 1XT5A 4OT1L 1UWXK 4YXLL 1JTPA 2BJML 5CJ5A 1DQLH 4E9LA 4B0MM 3O3BB 2GYSA 3KS0J 4JVUA 5D7IB 1EO8H 4YHIB 1XZ0A 4LGSB 4ZUUB 4JO4H 2NYYD 4LMQE 4UINL 1F3RB 1PKOA 5ITFB 2N1KA 1VENA 1Z5LB 1MEXH 4Z78A 4N0UE 3H3BC 1RZIA 3CU1A 1TZGL 3QZWA 1T03L 2VWEE 1CDGA 4IDJH 5SWZB 1QO3A 1GHFL 1QSEE 2BX5A 3WE6B 2VL5A 2PO6A 5D7LA 3BPCA 5IESH 1OAZH 1ZHLA 3QI9C 2N4IA 3BDBA 4DN3H 2AP2A 3CH1A 5J13C 3CFJA 4WO4B 3LIZH 5AYQA 3L3HB 1OHQA 3GGWB 1FVCB 3D5OF 3FB6B 2VXUL 2PETA 4L3EB 2XZZA 2PW2A 3FRPA 1YEFH 4ELKA 5ISZD 1P1ZB 3QIWC 1RULL 3BXNB 4XMKH 4M7KH 3ARWA 1PYWA 4OM0L 3VXME 1Z9SA 5BOZG 1WT5A 4R7DB 3TZVA 1RIHH 4OFYD 3MBXH 1G6RL 1WTGT 1K6QH 4KVCL 5E1AA 3TN0A 5DMGD 2VXSH 1EUTA 5DJ0B 5JHLL 1LK3L 1IT9L 1FN4A 5BVPH 4LCCA 3A6BH 4NQXB 4J3SA 4G6KL 1S78D 4PIRF 5IHUL 3ZE2F 4G7VH 4L4JA 3GSWA 5CKGA 2NXZC 1GGBL 2B8OT 2YPLA 2KL6A 1MRFH 1QNZH 5J3HD 2YA0A 3RVTD 3UCRA 4K07A 3VXOA 4NQTA 2C3HA 2R1XB 4XMPL 3NN8B 5A2IH 3WO3B 4K71B 2FZ3A 4HPYH 5IKCB 2FX9H 4OZFG 4KROB 2EZ0D 2XQBH 3GBLA 4JFDB 1LEKB 1D3CA 4Z7QE 3RVXD 2QQKH 1U3YA 4HLZH 1FL6B 4DKFL 4BSWB 1DQDL 1JHLH 5A16A 4HK0B 1MQ8A 2ORBH 2Y23A 4KKNA 4NHUB 1MFAH 3HUJE 1UJ3C 2CKBL 3IVKA 4HHAB 3WFBL 2KQMA 4PTTA 3VJ6B 4LIQL 1BECA 1INEH 4G8GA 3TCLB 4NSKB 4MJIA 2P5EA 4P23D 2CLZB 5C9KA 4JN2B 5EO9B 1NKOA 2BVYA 1BVKB 2N7BA 3KLHD 5C0EB 5D7IF 5L8KB 1XR8B 4ZSOE 1SM3L 2XWJB 3C2AL 1SJEB 5KVEH 1PG7L 4M5YH 3BZEA 1BQHG 3IS0X 3CXHJ 4FXGB 4MD5B 3JSSA 2AK4B 3VFPA 2YOCA 5ILTL 2ZCHH 5LWYL 4D0BA 3O2VH 4I77H 1MJ8H 1X3DA 2D9CA 2DL9A 3ZO0A 3OKDA 3X3FL 4HWBL 2A9NL 1F90H 2CIKB 2HFEB 3VGGA 4EUPG 1QHOA 3MLWL 5IB5A 2R8SH 5ANMB 5E00A 1YEHH 4ODHH 5F3BB 4PY7A 4Z77A 3FCTB 4NKDB 3GRWL 2VLLB 3U4EA 5B22A 4XP5L 2DTSA 4ZTOH 3WFEL 3EYSH 2EH7H 4YZFE 2B1AL 4M43L 2W0LA 3KPQB 3VGHA 4CKVX 4ODXB 2VZTA 2VRAA 4XPBH 4BQ9A 5D2LB 1M6OA 3RWGB 2Y4SA 5KSAD 35C8H 2VLKA 5LKNA 4M7ZB 1J0ZA 3RWJB 4FP8L 3GM0A 4P2RD 2HTLC 3IJSB 4MSWA 5FYJU 5A2FA 1JPSL 1YY8B 4MB3A 3KYKL 3ZE0E 1NCDL 4OCXH 3OBAA 4LGRB 3FAXA 3TVMA 3P11L 2AJXH 1Z3GH 4X7DC 4HUUA 1YEGH 1ZVHA 1Y0LA 3MNWA 5DVKA 3L3IB 5DZLA 3O6LH 5C1MB 5JA9A 3VDAA 2J4WH 1DUYB 5DK2A 2HJKB 1AGFA 2IAMC 1HNGA 3I3BA 1M7IB 5IM7A 4P48A 1C16B 5FGCB 4PRHB 5AAMA 3OMZA 1H5BC 3N9GL 1AGDA 4WI6A 4DN4H 5BRZD 5F71A 4XNXL 1J88A 1G7IA 3FQNB 2IPTH 3GHBH 1U58A 1CICC 3WIHH 3MRDA 1X6NA 1RJZA 4K7PX 5HY9B 1YDPA 4HIJB 1NGQH 4P3DB 3V7AG 1SEQL 2OJEA 4QHUA 4FQCL 1OSZB 5F7MC 1F6LL 3HNSL 1PKQA 3GJFK 2R69H 4LVOC 5JORA 4HMCA 2EDNA 2X09A 1HYSC 1DQLL 1ZHNB 4L4VA 3NCCB 1EO8L 2O5YH 1RK1B 3RTQD 4PTUA 4NC1C 2CDEB 4JO4L 3WNLA 4OGAD 3BGMB 4LRIC 5JQHC 4TNWF 1LILA 2R1YB 4ONOA 3I50H 4ZNCD 1MEXL 2NPLX 2OSLB 4LSPH 5I18H 3JUZA 4H26A 2YA2A 4NRXB 3LKPB 4HEME 4P46A 4YBHA 4JPWH 4IDJL 3IS1X 2G75A 2BCKA 3ZTJH 3DV6B 2FBJH 2YR3A 1R5IA 4ODVH 4F37K 3EYVB 1U91A 2F5BH 5IESL 3FOMA 4IIQA 1OAZL 1IC5H 4ZO9A 2DOCA 1FP5A 3HCVB 5HGBB 2VDRH 4DN3L 2YPKB 1E28A 5EO1B 2P24B 3LIZL 3MJ7A 3RPKA 1M71B 5C09A 2H26B 4I0PD 3SDCD 3LKSB 4WWKB 4FQXD 4G3YH 3HZKA 5HI4C 2EXYD 1C5BH 4L8BB 1W0WB 3BUYA 3DGGB 1YEFL 1H3VA 1RQ5A 5FUCE 1T66D 4XMKL 4M7KL 1CIDA 4X4MA 4DK6A 1ZAGA 3T77B 1RIHL 3CAFA 3RGVD 3MBXL 2E27H 1DVFB 1K6QL 1E27B 3RWIB 3MA7A 4NQDB 2BNRE 4PJ9C 2VXSL 1PDKA 4PGEA 5BVPL 1A4JB 1X5AA 1P7QB 1OARH 3A6BL 4XCYB 5DHVB 1WCBB 2FGWH 5B38A 4G7VL 3EDFA 5D7IA 5HGDB 3TA3B 4YHIA 3UTSA 4ZUUA 4QRRB 1AC0A 1MRFL 1QNZL 4OLYH 1ZA3B 4QRUB 3HG1A 4PV8B 4Q6IB 2DYPB 2W9EH 5ITFA 1Z5LA 4NBXB 3OF6A 1A0QH 1EERB 4MB4A 4HPYL 2FX9L 5I71C 1G7QA 4N8VB 3MLVH 5FM4A 4UT6H 3LN5B 5JDSB 2XQBL 5SWZA 4ZQKB 3Q48A 4J12A 1XGYH 3C08H 3D2UB 1SVCP 2QQKL 4I18B 3DPBA 4Z7UB 1U92B 1JHLL 2W91A 3CSPA 2Q6WB 2OR8A 5ID1B 1AR1C 3I9GH 4AENA 3BI9X 1S7UB 2ORBL 4X83A 4QRTB 1MFAL 4HPOH 1NBZB 4WO4A 1TNNA 2UVFA 3L3HA 3GGWA 1A3RH 3PL6A 1FVCA 4V1DE 4YFLF 1INEL 1LE9B 3OJMB 4URTB 3MBEC 4XPHH 4L3EA 3E3QE 1NC2D 5BXFB 2EDXA 1FO0B 1EHNA 3KR3H 4HV8B 1XMWA 3BXNA 4FZEH 2PXYB 1NLDH 5A3ID 3QDJD 4R7DA 4L9LB 4HC1A 2LU7A 5KVEL 4YGAB 3RWFB 4M5YL 5IB1B 1AXSB 5DJ0A 2ZCHL 1BVZA 1JFQH 2YN5A 3O2VL 5D7KD 4I77L 1MJ8L 2R56H 2ICCA 1GL4B 1LO3H 1MJ7H 1F90L 1HIMH 3ZKXB 2R8SL 1YEHL 1ZT7B 4ODHL 4OCYH 4X80H 3G6JE 2B1HH 2R1XA 4HEPG 4JFEB 3JV4A 3NN8A 4ZTOL 3PQYD 3DO7B 5IKCA 3EYSL 2EH7L 3NOIA 3SE3C 1F00I 1VHPA 1CYGA 3A0OA 4D9RD 4CGTA 4HUWB 5KG9B 2YUXA 1CFTA 3E8UH 4JFDA 1LEKA 4XPBL 2FR4A 4APQC 1GIGH 1FL6A 4BSWA 1A7OH 4QF1B 1GXEA 2YMXH 35C8L 4EQ2A 2X1PA 3FQWB 4NHUA 4AY0A 3GB7B 1YNKH 4HHAA 4ZFZA 4BH8B 1A1NB 5DJZB 1WCQA 1X5HA 3VJ6A 3MGAA 4XNUH 3TCLA 4P57B 4NSKA 4IRSC 4OCXL 5F88B 4CU7A 2CLZA 4NKIH 5EO9A 2AJXL 1Z3GL 2DQUH 4OZHB 1YEGL 1BVKA 4HH9A 5C0EA 4QY8B 3QRGH 1OGTB 1P6AB 2VQTA 1G7MB 3O6LL 2ZZUT 2J4WL 2XWJA 3STZB 1SJEA 3F7QA 1ZLVK 1G0XA 4FXGA 4MD5A 2AK4A 1TLKA 3FO2B 4DN4L 2YSSB 3OKOB 2IPTL 3GHBL 4GRLB 3GEWB 4NKQB 3QUYC 4FFZH 3VFTA 3WIHL 1UXSA 1VGKB 3GMPB 3K8MA 1CD9B 4NJAH 4ODWB 4X6BB 1NGQL 4LVHB 2HFEA 1MWAH 4PJFE 4QCIB 4Z7UF 3RU8H 1F3JB 5ANMA 2Q86B 2R69L 3B83A 4WHDA 5E99H 3FCTA 4NKDA 1KPRB 4M6NH 4CDHA 1MCDA 1DLFH 2O5YL 1UGNA 4XGZB 4XAKE 3WUWG 1F4AA 3KPQA 3UJTH 4ODXA 1G1YA 1TVBB 2ATPB 2OZ4H 1WZMA 4MNQB 3I50L 5D2LA 3RWGA 3RJQB 5E6IB 3C5ZB 3EOBB 4LSPL 4X4YB 5I18L 4HBQA 4UTBH 1IARB 4XP6H 1X44A 4S10A 4JPWL 2FRGP 3IJSA 4Z7NF 3DX7B 1LEIB 2ILLA 3PWPD 1YY8A 2FBJL 1KNOB 3PGDB 4ODVL 4K3GA 2F5BL 2B7DT 5CS7A 1XF3B 3LRHA 1IC5L 5B4MC 3R8BB 3F8UB 2VDRL 2IWGA 3QISA 1I1AB 2OCFD 3VWJC 1RI8A 3L3IA 1DUYA 4IEFB 2HJKA 4G3YL 3GSNB 1C5BL 1GAFH 1I3UA 5SWSE 4PRHA 2DKMA 3GBMH 4M93B 3RPIA 4P5TB 1ZKAA 3FQNA 3RX8A 3BSZH 3LN4A 4NWTH 3MRCB 1LGVA 3CFEB 2E27L 5DJCB 4WJ5B 3UTTD 5HY9A 4KAQH 4HIJA 1NCUA 1CDIA 3U1SH 5CD3B 3KAAA 4UTAH 1OARL 4D8PB 2FGWL 3FO1B 3CDFA 1QACA 3EYOB 4LEOB 2IH3B 3O3DA 5FIEA 1RK1A 5FCSH 2CDEA 4OLYL 3BGMA 3BGAA 3F5WB 3CVHB 1P2CB 5I74C 5TJWK 2W9EL 4OZHF 4LLQA 3I6LD 2OSLA 4HBCH 1A0QL 3U6RB 3QO0A 3TP4A 3MLVL 4NRXA 4UT6L 1PQZB 3LKPA 3O4LB 1HE7A 3MMEB 2UWEB 1INQB 4MD4B 1XGYL 4PJ7B 3C08L 5FGRA 4FXLA 3DV6A 3RDTD 4MS8D 5T1LD 4DEPB 4JFZH 1IEAB 5IVOA 3I9GL 2ZUUA 3N1MC 3HCVA 5D2NC 5IT2H 4HPOL 5EU6D 2VLRD 2P24A 5D8JH 3UPCA 1A3RL 1M71A 2KUTA 1OD9A 2H26A 2BNQB 4WWKA 2Y07H 4XPHL 4L8BA 1W0WA 5DWUH 1Q9OB 3DGGA 4Y4HD 5J6GB 3KR3L 4W4OC 2WBJC 2QSCH 4FZEL 1NLDL 3HE6B 4K9EC 4DUXA 4QTIH 3ZDYE 3T77A 1A7BA 1DVFA 5E7BA 3P0VH 1E27A 3RWIA 3GMMB 4NQDA 1VFMA 1OTSD 5IFJA 3BH9B 1LDPH 3DVIA 1JFQL 2H9GB 4M1GH 4POYA 3FO0H 1A4JA 1P7QA 3MC0A 2O61B 4XCYA 2R56L 5DHVA 2QADC 1GGTA 3EJYD 4G6AD 1LO3L 4OD1H 1MJ7L 1NGWB 3VRLF 2Q7YB 1J8HA 5FM5O 5HGDA 3TA3A 1IEBB 1HIML 4QRRA 4QRUA 4KGJA 3ULVF 1KIPA 2HYMA 4PV8A 4OCYL 4X80L 2DYPA 3QUXB 5DVOA 4DKAA 2B1HL 3RL1B 2BVEA 1I8MB 3C6LB 3CLEH 3I84A 1M4KA 2CGRH 4N8VA 1LDSA 5JDSA 4U33A 4ZQKA 1V8HA 2EE2A 3E8UL 3D2UA 2WNGA 2EIEA 3ARSA 1GIGL 4I18A 2MKWA 4YHMH 1A7OL 1NMAH 1U92A 4Z7UA 4YH6A 4IHOB 1A02N 2YMXL 2Q6WA 1C7TA 5ID1A 1ZE3C 5T5FH 4KWUA 4KRPD 1S7UA 3QIUC 1YNKL 1NBZA 5D96B 3LPGA 2HRLA 3AB0B 3LVEA 4XNUL 5MP6H 1LE9A 1AR2A 4KRLB 3LQZA 1R3KB 3TT3H 5BXFA 4NKIL 1FO0A 1I1RA 2DQUL 1QPPA 2D4DA 4HV8A 4P99A 3QRGL 1OW0A 5I8OH 5FK9B 4L9LA 1DQTA 1FZMB 4E0RB 5IB1A 3EAKA 5FXCH 1AXSA 1MOEA 2P5WE 4JHZA 1FNLA 2ITDB 3LPWA 3TH4T 4FFZL 1QRND 25C8H 3KJ4C 5JW4R 1HQ4A 1EAJA 4AJ0A 2UWEF 5CEZH 4NJAL 5IHLB 1FAKT 4OLXH 1IM3B 1KIUA 1MWAL 3DV4A 3RU8L 2NZ9D 1KEGH 2F19H 2A6DB 1ZT7A 3EYQD 3SY0B 5E99L 3DI3B 6CGTA 5AUMB 3LSOB 2VDPH 4M6NL 5KAQF 2GI7A 2HVKA 5HYEA 2A83B 5KSVB 2FEEI 5IFAH 1MH5B 1DLFL 3DO7A 1G9MC 4NN7B 4X7TB 1Q9KB 4I5BB 3UJTL 4CMMB 4HUWA 5KG9A 3SDAD 4JM2D 2OZ4L 3ECBA 3SGKC 3JTSB 4RAUA 2ED8A 4JG1H 2X70B 4UTBL 3FQWA 4XP6L 2DQDH 3CLFH 3GB7A 3AROA 3U7YH 4BH8A 1A1NA 5IW1A 3NIGF 5DJZA 4CN6A 4NZTH 1IILE 4NM8H 2YPVH 4P57A 2HA1A 1AO7E 5F88A 1VERA 1PY4A 3ET9F 4X9GA 4OZHA 2EEAA 4GUPB 5IF0A 3QQ9D 2OXHA 4QY8A 5H94B 4JKWA 2OBGA 1OGTA 5EWIH 5L7XH 1G7MA 4UU9B 5F8RC 4CVWA 1GAFL 1T1WA 4TNVF 3CDGA 3GBML 4C56E 1GYAA 1OT2A 2RHEA 3FO2A 3BH8B 3LN9A 5HVWA 2YSSA 2A6KB 3OKOA 4P23B 4WHTB 3UYPA 3BSZL 4GRLA 4NWTL 3ARBC 5HBBA 3GMPA 4Q9QH 3OHXA 1XGRA 4K9EH 1G6RB 3BMWA 4KAQL 1TTFA 4X6BA 5HXMA 1ZANH 4QCIA 3U1SL 1JGVH 1F3JA 5F1IB 4UTAL 2Q86A 3S36H 3N50A 1NCBH 1KPRA 1IGFH 4G43A 4XGZA 5JTWA 5I66B 1TVBA 4GAYB 3MRFB 3RHWK 2FBOJ 3W5NA 4BZ1H 4HIIB 1UWEH 5HYSB 4HBCL 5E6IA 1A6ZB 5INCB 3C5ZA 3EOBA 4UDTA 4X4YA 1MCIA 1BJ1H 4DKDC 5SX5H 3MYJB 3RKDC 2E3VA 1ZVYA 1KB9K 4KV5F 5DXWA 1LEIA 3DX7A 5E94B 3BW9B 1EEYB 3O2DA 4ZG1A 3BJ91 1KNOA 3OJDA 4FQPA 4KK6C 4OF3A 4JFZL 1QUNA 4LSSH 1T6WA 1XF3A 3KVQA 1SY6H 4KI5D 4Z6AT 2GCYB 5IT2L 2APXA 1WWWX 5KSAB 1I1AA 5D8JL 1QG3A 1YYLH 2CKBB 4QO1A 2Y25A 1EV2E 2K7PA 4S1DD 4Y4KD 1NC4D 2Y07L 4P2RB 1EVUA 5GRYA 5DWUL 4Q7DA 2DS4A 5CLWA 4P5TA 2QSCL 5TE7H 4LHUD 2BP3A 4OBSA 1LEGB 4G8FB 2ATKB 2AXGB 4NP4H 3MRCA 4QTIL 5HVHC 3CFEA 2VH5H 5DJCA 1WIPA 3P0VL 4PD4K 4WJ5A 1LDPL 4XNYH 3CMGA 4KFZC 2R2CA 4M1GL 3FO0L 5KSBF 4OD3H 1A21A 3HZYA 4D8PA 1WBYA 4LLDB 2F54D 5BRZB 3FO1A 4OD1L 3EYOA 4LEOA 3RUGB 1W72H 2IH3A 1PY9A 3PWUA 1ERNA 5DHYB 5C0BE 3F5WA 2P44B 3WHE0 1P2CA 3RFZC 4ENED 3QCTH 4PBVC 1YN7B 3CLEL 3V9FA 5JOPD 1RHFA 3U6RA 4NN5B 4YNYB 4PJHE 2CGRL 5T3XD 2BC4B 1PQZA 3O4LA 4QWWD 1NFDE 1WAAE 1IAII 5CJXC 1FNAA 3MMEA 2UWEA 1INQA 4MD4A 4PJ7A 1G9MH 3RTQB 2Z35B 4HUVB 1NBYB 1A3QA 2A9MH 2JJSA 3PWVB 4YHML 1NMAL 4DFHA 1IEAA 1R5WB 4OGZA 4Z0BH 5T5FL 1CXKA 2KQNA 1DQJB 4JN1H 4JPIA 1H3TA 2VE6B 2C1PA 4MDIB 2NY3C 3OAZK 2P8PB 5MP6L 4LOUD 3TT3L 3GIZH 1JZ8A 1Q9OA 5LVEA 5J6GA 1MI5D 1ZLWH 4QGTA 3BUTA 5CGYC 3HE6A 5EZJB 5I8OL 2ID5A 1HWHB 4NOBA 3MFFB 4GRWE 4KI1A 4AEFA 5F21B 3RI5F 3GMMA 2JIXB 1NGZA 1WK0A 4I0PB 3SDCB 3BH9A 4FQXB 1XF2B 2BY2A 4U1NB 5IP4A 3FQXA 2H9GA 1XGQB 3SDYH 2X9WA 4HKJB 2RJMA 1NGYB 4JGUA 4PR5B 2O61A 25C8L 1S8DB 2ICEB 2J3SA 5IIEB 5DFVC 1I1FB 4X4XB 1NGWA 4EI5C 1E6JH 2Q7YA 2J5LB 4OJFH 5CEZL 4ACPA 5D1XD 1IEBA 4OLXL 2VZUA 1KEGL 2F19L 1WGOA 1RUKH 3QUXA 5T3ZH 3B2UC 5K9QG 1FIGH 5GZOD 2VDPL 1I8MA 3C6LA 3OR7A 1I75A 1NCNA 1BAFH 1WFTA 5IFAL 1NDGB 3S9DB 4O00A 3V52H 4JEGB 3VFVB 5MEOB 4D9QD 4XX1E 3CIQA 1KACB 3HC3H 4RA3A 2NY4D 2WQ8A 2RCSH 3W9DB 4P4KD 4JG1L 4IHOA 4PB9H 2GK2A 1QSFD 4LPTA 4LDLB 4PJ5D 3W0WE 5A1AA 2DQDL 3CLFL 3FONB 1TQCB 5JMRA 3BEVB 2D2OA 2AI0H 1EFXD 4WTZG 3U7YL 2Q20A 4YFEA 4NZTL 4NM8L 3F7VB 2YPVL 3T0EC 4Y2DC 5D2NE 1R3KA 4RGNE 4XRCB 1S5HB 2VDKH 4NDMB 1ZHKB 1BFSA 5EWIL 5FK9A 15C8H 1TZIB 5L7XL 5EDXA 1JYNA 1XIWD 5JW3H 4J8RB 4E0RA 4J4PD 4FFYH 3ULUC 2H2PC 1AXIB 3WIFB 1FNHA 1P5VA 2ITDA 3REWA 1NC2B 3I75B 4OBRA 3G5ZB 5ISZA 5CEZD 4NQVA 3HB3C 4Q9QL 4AL8H 5B8CC 3KPTA 3QDJB 1OF2B 4K9EL 1IM3A 1DDHB 2ZUWA 1ZANL 1ZGLM 4PYGA 4OFYA 1CQKA 1JGVL 2A6DA 3S36L 1NCBL 3SY0A 4TVPH 3IDJA 5AUMA 4I9WD 5JR1H 2FCBA 2A83A 5KSVA 1IGFL 1MH5A 3FQUB 2IPUK 2GSIA 4GOSA 3T3MF 5HYJD 4ONGH 4X7TA 2MJWA 1Q9KA 3MUGB 4I5BA 2GY5A 4CMMA 4JZNA 4M5ZH 2LTQB 4BZ1L 4J23A 1RMFH 1UWEL 2DLIA 1JPGB 1SEBB 3T0BA 3KS0H 3VFGH 4U1GC 5KSBA 4JZJC 5HPMB 4UOW0 4LAJH 2X70A 4WTZA 4OCNC 1REIA 4U2YA 3WS6C 3PQYB 3AREC 1NGXB 3PHQB 4S2SB 3V6OC 3MRLB 4P2OD 1NMBH 3WO4C 2ED9A 4LSSL 2ZNWA 4WRLA 2WP3T 1SY6L 4FQQA 3S4SB 4DZBB 4GUPA 5H94A 4FQIH 1XAUA 1E4WH 5F1OB 5F7LB 4UU9A 1YYLL 4AIXA 3T0WA 5CEXB 1OB1B 1A1MB 1RHHB 4JY6B 3BH8A 4F7TB 5TE7L 2A6KA 4P23A 4WHTA 5IMKB 4NP4L 3UBXA 5I1KH 5JPMB 2VH5L 5EG6C 2H32B 3K1DA 4XNYL 3L9RB 5F1IA 4BM7A 4OD3L 1MHHB 2EKJA 5TPWH 4POZD 3V5HB 1DP0A 3DVGA 4F2MB 1W72L 3IJHA 2CQVA 1SBBA 3IAPA 2W65B 3ILQC 3MLYH 4QNPE 1KC5H 4NCDA 3CZFB 4GAYA 4QHLA 1BFOB 1UCTA 3QCTL 4HIIA 5HYSA 1A6ZA 5INCA 4LSQH 2O93L 1HDMB 2XTJC 4ZO6A 3AXLA 1FDLH 3ZHKA 4F9PA 4ZXBB 4NN6B 1G9ML 3PE9A 4XTRD 2DJ4A 1J7VR 5C0FB 5E94A 3BW9A 1EEYA 2A9ML 1QSED 4OLVH 4Y5YB 4Z0BL 3MV8E 3K0WA 3HR5B 4JN1L 2GCYA 5F72S 1IM9D 5KSAA 3JWNC 4TVSa 1X9QA 2QBWA 1IAOB 3RY5A 4P2RA 3HFMH 3QA3A 3GIZL 3PWPB 1K4DB 3QNXB 4GRMB 1FFPB 1JUFB 5IW3A 5CIPB 4M9PA 3RP1A 3ARZA 2IH1B 2OLDA 1LEGA 2DJUA 4JRWA 3VXMD 3OG4B 4G8FA 2ATKA 2AXGA 2KDGA 3B9KD 1IRAY 4R2GC 2V5YA 3SDYL 3GBNH 3FT4B 1J18A 2CRYA 4LLDA 5BRZA 4BQ8A 4HKZB 4Q58C 4FQJH 3RUGA 1E6JL 1U8IB 4OJFL 4ELMB 1U8KB 4Y88A 3VGFA 5DHYA 2PO6C 1RUKL 5T3ZL 4DGYH 1FGNH 1FIGL 2VQ1B 3KDMB 1RUMH 3IDGB 4O4YH 1BAFL 1YN7A 3R8QA 1JYVA 4WCYH 3NGBB 4U0RC 1U42A 4HJGB 4YNYA 3V52L 1CGSH 5J89A 1N6VA 3IAQA 4OZ4B 3RTQA 4RX4D 5H2BB 2Z35A 3MX0A 1EO5A 3HC3L 4NFDA 1MUJB 4OCSH 4PGZA 5C71A 3PWVA 5HYFA 5E8OB 2RCSL 3B9DA 4PB9L 3D3VB 1WT5C 1QVOB 1R5WA 4NZUH 5TQ0H 3TZVC 1DQJA 3LKNB 5GGVH 5AWNH 2VE6A 4MDIA 2AI0L 4MVBD 3TN0C 4Z7NE 2P8PA 1AGCB 1WWAX 3GMQA 1JZ5A 1A6AB 5F44A 2BOBB 4LCCC 3RDTB 4KTYA 5CZXD 2VDKL 4F8QA 4W81A 2BOCA 3B5GA 5EZJA 15C8L 1CVSC 3MO1A 2VZ3A 3MFFA 4X6DE 2YS4A 2VLRB 3MJGX 5JW3L 3VFMB 3I6KB 1EH9A 3K80A 4FFYL 4I0PA 3SDCA 2Z92B 4FQXA 1XF2A 5ALCH 4U1NA 4U6TA 5GGQH 4X6FA 2XG5A 4B7LA 1XGQA 3ZYIA 3GSUB 1T4KB 4HKJA 4Y4HB 3JBG7 1S8DA 1X5ZA 5TF1H 5IIEA 1IEHA 2Q7NA 3SDXB 1I1FA 4X4XA 5ESAB 1JMZA 2QQNH 1CTNA 3KYAA 4AL8L 4X6CB 5DO2C 1A47A 5JXED 3RGVA 1DEDA 2P43B 4KK5D 2XZAH 3SPVB 4TVPL 5EA0H 2H6PB 1I3RB 5JR1L 2P7TB 1F3DJ 2NY6C 2IPUG 1TVHB 2CR3A 1NDGA 4U3XA 4F80A 3GMLB 4ONGL 3PWLB 1KBGH 4JFFE 1DANU 5MEOA 3VXSE 2GT9B 5DA0B 4M5ZL 1D5ZB 3V4UH 1RMFL 4OKVB 3G08B 5E8PB 3VFGL 1G7LB 4WFGE 4MJ6B 4XBEH 3FONA 1X5GA 2EE9A 4JE4B 3BEVA 1Q1JH 3WDHA 4CMHB 3O3AB 1NMBL 3H9SB 4F8TA 3F7VA 2KZ1B 2VSDA 4IMKA 2D3VA 4XRCA 4HLZG 1S5HA 4NDMA 3LQMA 5DF0A 2HVJB 3BKCH 1ZEAH 1ZHKA 4FQIL 4DCQB 1E4WL 1BBJB 4ELMF 4AEEA 5E24E 4KRPB 4PJEB 4U6XA 1R3JB 1XGPB 3QJHA 2VAAB 2YRZA 5I1GH 4YHPB 5D93C 4LLUA 1U8LB 3WIFA 1HWGB 1NC2A 3S8WA 3G5ZA 3KPSB 2ENYA 3QB7C 2BVOB 5HGGS 3GUTB 5I1KL 3EHBC 3MRPB 5DMIH 4NNYB 3QDJA 1OF2A 1Q9LA 1CR9H 5TPWL 1HSAB 2GKIA 3CJJA 4OB5H 5FA3B 1SQ2N 3FQUA 2FHCA 2X7LB 1QRNB 3VXUE 3ARFD 4PG2A 3MUGA 3NZ8A 3MLYL 5F7NC 2JJTA 2ZG1A 1KC5L 3EO1B 4CBPA 5JIKA 1EGJA 3CDCA 4XCEB 4PLJC 1BJMA 5DC4B 2GIYA 1KUMA 4J3TA 1JPGA 4KRMB 1SEBA 4LSQL 4MXVF 1FV1B 5DJYB 3Q5YA 5HPMA 1X4ZA 5FCUH 1BP3B 3KPPB 1FDLL 3IKKA 3PQYA 3UPAA 2FLBT 2ZSWB 3W2DH 1NGXA 1PX4A 4S2SA 3C09B 1EK3A 3FKUS 2AABH 3QH3B 3SDAB 5DHXB 1ZSDB 4OLVL 4N5EC 1ULVA 1OP5H 4HSQA 3WXWH 5JW5A 4GXUM 3RNKB 3S4SA 4DZBA 3AAZB 3DX6A 3SDXF 3RWHB 2EDRA 3T0EE 4X6CF 3VG9B 1JBJA 2DLEA 5CEXA 5I0ZA 1OB1A 3HFML 3TYGH 1TCRB 1A1MA 3P4NB 1X7QB 1RHHA 4JY6A 4PJIB 4F7TA 1FLRH 1XF5B 1OPGH 3NCYS 5J6HB 3F6IA 3ULUE 1KCSH 1K3IA 4ONFH 3QXWA 4AQ1B 5JPMA 2HKFH 5I17B 1TITA 4I4WB 2H32A 4KK9C 2BNRD 4GKOA 1I8LA 3L9RA 1JL8A 3GBNL 1MHHA 3V5HA 3CU7A 4R4BB 4LRNH 4P46C 3BN9C 4NQSB 4FQJL 1HHHB 3O11A 4PGCB 1HOCB 2W65A 4DK3A 2WK2A 1MWAB 1R3IH 4YDKH 3CZFA 2WWMC 4IIQC 4DGYL 1FGNL 1BD2E 1BFOA 5DEFB 3QWQB 1F8TH 2IADA 3QXUA 3Q2CA 1RUML 4O4YL 1J05A 2V6HA 1MCSA 3MUHL 4WCYL 1EJOH 4PJEF 1OM3H 5F7HA 5MEQB 3VGAC 2ZUSA 1CGSL 1Q8MA 3N06B 3IRPX 1E6OH 2XNAA 2APWA 2G2RB 2NY2C 4HS6B 4OCSL 5EIQA 1ZK9A 1FPTH 1I4FB 4Y5YA 3IB4A 4NZUL 5TQ0L 4I0KA 4JKLA 3PDOA 3HR5A 2JJUA 3V6OE 1T7YA 5GGVL 4WUUD 5AWNL 3NCJH 3VWKD 5E8NB 2VC2H 1URLA 4R96B 3D39B 4ZOAA 4V1DD 1ONQB 5E6YA 1IAOA 4TTDC 1ZLUH 3ZTJG 5GS0D 1EA9C 5C3LD 3PWPA 1K4DA 2NLJB 3QNXA 1JUFA 4PJBF 3D9AH 5CIPA 4MXQC 2Z91B 2IH1A 4QEGA 5IQ7H 3O45B 1Y18B 3E2HB 4CJ0A 3JZ7A 4UBDD 3QO1B 2BDNH 3ZYOA 1QPXA 5ALCL 5DJ6B 5GGQL 1MVUA 1NC4B 3MROB 3QQ4B 5IK3B 5F7KC 3VRJB 1G6VK 5TF1L 2DTMH 4GS7B 4HKZA 5IFHH 2QQNL 1U8IA 1OTTC 4ELMA 1U8KA 2XI9A 3QDGE 4AIZB 5JA8B 4D9LH 5JLZB 2CK0H 4JM2F 2ZUTA 2ZOLB 3UTTA 2XZAL 4LL9A 5EA0L 1TIUA 3EDJA 5AEAA 3IDGA 4WO4C 2EXWC 4HJGA 2F54B 2VZOA 3IFLH 1KBGL 1JN6B 1J1XH 2W9LA 1I85A 4MNGB 4OZ4A 5FYLE 2AJSH 2OL3B 5H2BA 1MUJA 1N2RB 3V4UL 1P6FA 5LGJB 5KS9B 4WENB 2XKUA 4GAGH 1QVOA 1C08B 3E6HB 4XBEL 5D6CB 3LKNA 1RIVH 2BY0A 1HKFA 1Q1JL 4PBWD 1YNTB 1TXKA 4NOFA 4HT1H 3QI9D 1A6AA 2VOTA 1PEZA 2JLLA 4BQCA 3RDTA 5T1LA 3BKCL 1ZEAL 3VU2A 2A6IB 1RV6X 3DLQR 4FFVC 1CI5A 5EU6A 2VLRA 3QIWD 4NYLB 3VFMA 3I6KA 3CD4A 4U6HB 3V8CA 5I1GL 2Z92A 3P30H 2DI8A 2NW3B 1BEYH 2LV4A 4K71C 1MLBB 3GSUA 1T4KA 4Y4HA 1MI5B 3VGDA 4C4KT 4KROC 2BVUA 1NUDA 1OTUC 3C8DA 3CNKA 3SDXA 3WKMH 4JRXB 5DMIL 5ESAA 5EUOB 4ZPTB 5DD1H 4X6CA 1B2WH 4DVRH 1G7PB 4MZ3A 1HN1A 1QFPA 5E8DH 4Y5VB 1IC7H 3RX5A 3TO4B 1CR9L 1I3RA 4OB5L 4E5XB 4BUHA 2P7TA 3ARDD 2IANE 1EAPB 4XAKD 4HAFA 1IC1A 1QFWM 3BFOA 4OLZH 3PWLA 1NGPH 2F53E 2DQGH 2GT9A 2PF6A 3DWTA 5D1XB 3HE7B 1CFBA 1ORQA 4BSVB 3SHSA 1D5ZA 4YR6B 1KFAH 2YN3A 4OKVA 4JJ5B 1BQUA 2WLZA 5E8PA 4MJ6A 5EU7C 3ZKMD 5JZ7C 4KI5F 5FCUL 4KK8D 2QHRH 1NAKH 1KLGB 4L9DA 3W2DL 4RDQF 4ORGB 4Z7VB 3O3AA 2AABL 1P84J 3FFCE 3RBSA 43CAB 4PP1C 3WXWL 3JTTB 1QLEH 3K81A 2NY4B 2FEEL 2CIIB 4DCQA 4QHNA 1BBJA 4K3DH 4KKCC 3J8F7 5FYJE 1M7DB 4PJEA 4U1MB 4PJ5B 4CN1A 1R3JA 2B2XH 4OLEA 4FG6C 2ZCLH 1EFXB 3MNVB 1OT1A 1GRWA 4XH2A 3TYGL 5SWSD 4YHPA 3WDJA 1U8LA 1FLRL 5EBLA 1OPGL 1E4XI 8FABB 1HI6B 1QRKA 1NCWH 4J6RH 1KCSL 2BVOA 4Y8DC 3L3JB 4R90H 3JV5A 4ONFL 4DZ8B 3GUTA 1MFCH 4NNYA 3CUPB 2HKFL 3N1QC 2YD3A 2N7AA 1XIWB 5KS9F 4LPYA 2L4OA 4XVUC 2V5RA 4M7ZC 1HSAA 4LRNL 1U3HD 5FA3A 4S0SD 4LBEB 1VGEH 4IBLT 2X7LA 1QRNA 1KYOJ 1UENA 3EO1A 4OGXH 1R3IL 4YDKL 1OQXA 3MCG1 3RBGA 4XCEA 1F8TL 2E7MA 4HG4K 5FKPB 1FV1A 1E0OB 2ZUYA 1EJOL 4RGMB 5DJYA 1OM3L 4EVNB 2O5ZH 5BV7B 3WSQH 2ZSWA 1E6OL 4IOFC 4YHOH 2NY7H 4RBPH 3V6ZB 3LEXB 3DO3A 3QH3A 4JM2A 3SDAA 1ZSDA 1FPTL 3Q5TA 1MY7A 3I85A 1CXIA 1UA6L 4YPJA 3RNKA 1J12A 1U8QB 2HFGH 3AAZA 1J86A 5EUOF 3RWHA 3NCJL 2VC2L 4HC1H 4NUJB 3MNZB 2BMKB 2OMBA 5DD6B 1KXTB 4AH2B 5AG8A 4OIAA 3FB8B 3D69B 3P4NA 4P2OB 4OZIF 1X7QA 3D9AL 1VEMA 5D1ZB 3VA2C 3GSXB 1XF5A 3VH8B 2IAMD 3WHE1 5IQ7L 5J6HA 3QDAA 4I1NB 2BERA 5ICZB 2X4RB 4YDLB 5IOPB 1O0VA 4I4WA 2FSEB 1I9IH 2BDNL 3FFDB 5CP3A 3TBWB 1FH5H 1CICD 1UT9A 3OXRA 4UNTA 5AG9A 1N8ZB 4R4BA 3CSYB 2DTML 3C9NB 1NBVH 4NQSA 5IFHL 4BZ2H 2X9XA 3HC0B 3W9EB 4PGCA 1MRDH 1H8SA 4D9LL 2CK0L 1UKTA 2EEBA 5DEFA 2PYEE 5ADPH 5I8KH 5GRUH 1N26A 5HHNA 1P9MA 4UMGA 4JY5H 4Z7OE 4WWKC 1CXHA 2X1OA 3IFLL 1BMGA 3LKQB 1J1XL 4BFIB 2AJSL 2OZ4A 3EO9H 5GS1B 1RZ7H 5JPNB 3SJVE 4GAGL 1I4FA 4YEEA 3MODH 2XZQH 1RIVL 4KC3B 4N0UB 1DVFC 4FQ1H 4XHJC 1Q72H 5E8NA 4OAWB 4R96A 5SX5K 3BP7B 1MF2H 4HT1L 1ONQA 4QOKE 4U49A 1ZVSA 3TNMA 3BVNA 2NLJA 3DIFB 5IB2B 5TFSH 5GS2H 1QSEB 3VMPA 3KLSA 1WBXB 2ZP0T 3LQAH 5HI4D 3TA3C 4L4TE 4Y7MA 4GKNA 1CGXA 5F1SA 5CP7A 1EHLH 1IM9B 1Y18A 4KJYB 1B0GA 4Q6IC 4ZDHA 2W0KA 3QO1A 1IGTB 3P30L 2X4SB 4Y4KA 5DJ6A 1A6WH 4D94A 1NC4A 3MROA 3MRQB 3QQ4A 1BEYL 2P5WD 3VRJA 1B9ZA 3FOLB 1U2CA 1IAKB 4M1CD 3WKML 3I3EA 4LHUA 3VXMB 5DD1L 1B2WL 4DVRL 3GIVB 4I18C 4AIZA 5JLZA 2BZDA 2ZOLA 3HNTH 3WKNA 5E8DL 1IC7L 2HT3D 2L7UA 4F57H 4N0FB 2GJ6E 2FNBA 3ZLQC 2F54A 4DJMA 4OLZL 4JPKH 1TFHA 1NGPL 3EDKA 1JN6A 2DQGL 1K2DA 4MNGA 2OL3A 3ES6B 1SMAA 1KFAL 3MYZA 4OLWH 5LGJA 2PXYC 1OW0C 5KS9A 5K9OB 1T0MB 4L9LC 5D6CA 2C7UA 1N0XH 2QHRL 1NAKL 4JRYB 3IFOB 4X4ME 1YNTA 3P40A 1OY3B 3AY4A 2CK2A 2R0KH 2LU4A 5JUEH 1AO7D 3TC9A 1QLEL 4KXZI 4LVNB 1T7WA 2VR5A 4K3DL 4WW2B 3LB6D 3MBED 4LLVB 3QJFB 3ZKXC 2B2XL 2ZCLL 3HUJB 4NYLA 5E08H 3K4ZA 3C8HA 4U6HA 4C56D 1FJ1B 4MD0A 5D7JD 2NW3A 1MLBA 4A2MA 1AKJD 1MI5A 4LFHD 1NCWL 4J6RL 4R90L 4B7IA 3QEQB 3BESR 3HR6A 5F1KC 1MFCL 5EUOA 2LAGB 4ZPTA 5IMMB 4ZSOB 4UOW1 1G7PA 2WZPD 1QSZA 3ARYA 12E8H 4Y5VA 5HDOA 3VD9A 1IGJB 4NQCE 2C3WA 4F33B 4OTXL 3NABH 4IM8A 4E5XA 2B0SH 3W11D 1RAMA 1VGEL 4IJ3B 1EAPA 3U36A 2WINB 2MQ0A 5DMKB 3MRRB 4M4PA 1KELH 1DE4B 1IE5A 1GGIH 4OGXL 2V2WB 3HZVB 3VXRB 1S7RA 5D1XA 5IEHB 4HS3A 1CDUA 4YR6A 4LCIH 4JJ5A 4PRBB 1NUFA 2X05A 2D7TH 1ETZA 3WN5B 2O5ZL 3JVGA 4I3SH 4EDXB 1KLGA 6FABH 3WSQL 3VW3H 4FOMA 3BKMH 4YHOL 1X5XA 2NY7L 4ORGA 4K8RD 3SGEI 3QULB 4Z7VA 1SJHB 43CAA 4GRLC 1YEEH 3D18B 4P5KA 1B4JH 3REVB 3JTTA 5HHOE 3ETBF 2HFGL 1N59A 2FJHB 2DQCH 1MFBH 2A6JB 1DN2A 3K2MC 4P4KA 2CIIA 4N9GB 5IVZB 4HC1L 1M7DA 1PEWA 4LVHC 4U1MA 1QSFA 2YUZA 3O6FB 4GMSH 4PJ5A 1U2HA 2Y5TB 4M8QB 3OTTA 1EFXA 3MNVA 4YQXH 1KCKA 2AJZB 3QEHB 3RHWF 3B6SB 3EIFA 2LVCA 1CBVH 5DHVH 3W39B 1CD1B 2Z31D 4FQHA 3VH8G 1MLCB 1PLGH 3L3JA 4DZ8A 1C5DB 1ROWA 4JB9H 5IJVB 1LO0H 5FYKH 1JWUB 1I9IL 1FGVH 4X99B 5DRZB 1FH5L 1XIWA 3C5ZC 5E6IC 1YPZB 4P0DA 4J4PA 3PJSB 4ZFOB 1HQRB 2XT1B 2NY0D 4JFDE 2I27N 2QQLH 1NBVL 4BZ2L 1IGMH 5CJBA 5C0ND 1F97A 1MRDL 2MWCA 4ISVB 5C0BD 3VDCA 5HYIA 3ULVC 2H41A 4Z7QF 2MNUA 2XXCB 5ADPL 3B5TA 5I8KL 4M61B 5GRUL 1I1AC 2NW2B 4RFEB 3GHEH 5FKPA 4Z5RB 4WW2F 3VD4A 4JY5L 4TUKH 4EVNA 1OSPH 1KIQB 2DMCA 5EZOH 3QUZD 1S7WB 4JFXB 3HUJF 5C0CB 2DL2A 4NT6B 2AGJH 3ARFB 1OLZA 4M93C 3V6BR 2Y36H 5E9DD 3EO9L 3LEXA 4P5TC 1RZ7L 3RVWC 3UTPE 1IFHH 2ZKHH 1FO0H 5AD0B 4YBQC 3MODL 1U8QA 2XZQL 4WNQB 3P4OB 3OX8A 4FQ1L 1Q72L 3FO9B 2XIDA 3UAJC 4LPUA 3DOSA 5HI5D 4NUJA 3MNZA 3BISA 1CVRA 4P2QB 1MF2L 5DD6A 4AH2A 1SYVA 1WSST 2PUQT 4I48B 5TDNB 5K59F 1RD6A 3D69A 5TFSL 1S7VB 4P2OA 3TPUB 1MFNA 1UM5H 3KPMB 2DQHH 3F7RA 4FFWD 5F89B 3WMSA 5EU4B 1HXMA 4F15B 1J0IA 3VH8A 3LQAL 4M7LH 5KTEH 1U8MB 1J11A 4QTHB 1EHLL 1DCLA 5IOPA 2XFXB 5I2IB 2FSEA 3TFKC 3QBTB 2DM2A 4OFVA 3FFDA 1A6WL 3MLPA 4JQXA 3KYMB 1N8ZA 2YA1A 3CSYA 3C9NA 3QCUH 4U2ZA 5DQ9B 4YZFF 4LEXH 1KLUA 3WYRA 4DEPC 2JJSC 4GW1B 3PWNB 3HNTL 4JDVB 4PB0H 4NKOB 4M6OH 3ZHLA 4F57L 5BCAA 1JPST 1JHTB 5F8QC 1ZLSH 4LDOB 4CW1B 1DUZB 1FHGA 4C4KO 1GZPB 1Z2KA 5D70H 1BPVA 1R24B 2QEJA 2DI7A 3JWOH 4JPKL 4XNMB 3MLSH 3LKQA 4KUZH 4H5SB 4BFIA 3H9HA 5HD8D 4KZDH 1J87A 2GUOB 1I3GH 1HILB 3FQTB 1RFDH 4OLWL 5GS1A 3VFWB 4Z7WB 5JPNA 3HE6C 3IYLW 4LPCA 2EYTB 4GMTH 4J3VA 4PRHE 3VGBA 4HD9A 4Y19B 4KKLC 1N0XL 2GFBB 4N0UA 3W0WD 4OAWA 5HI3D 3BD4A 2SEBB 2R0KL 4HIEB 4Z8FH 5JUEL 5GS2D 5C2UB 3U0TB 3DIFA 3OPZH 5IB2A 2D7QA 4RGND 5CFHA 1QSEA 3S35X 1JGDB 4KGLA 4NRZB 1WBXA 3L7FB 3F7YB 5I1JH 1A6UH 1S7SB 4GG6E 5J1TC 4WUUB 2AXFA 1IM9A 3V79C 3VWKB 4KJYA 5E08L 1U41A 3QUXC 3QSKB 2WBJD 1IGTA 1UZ6E 1JPFB 2X4SA 4V1DB 3C6LC 3MRQA 1G7HA 2Q76B 3UTQB 1MCWM 1BWMA 4NRYB 1JRHI 5BZWB 2APTA 1ES0B 5F6HJ 1CFNB 3VXMA 3MXVH 1ED3A 2NYYC 3QEUA 3SBWA 3B9KA 12E8L 1ZT4B 2F8XC 1G9EA 5BO1H 1JZ2A 2VLME 1X4XA 3NABL 2B0SL 3PWJB 4HJ0D 5CKAA 4N0FA 1PD6A 5D96C 3AB0C 3NAAH 1KELL 5SV4A 1GGIL 3O8XD 3CXHK 4RMTA 1V3KA 3O2DH 2LU3A 1AHWB 4LCIL 3ULVH 3SE4A 1KB5B 2D31A 4E42A 1BGXH 2D7TL 1T0MA 4XNQB 5I76B 3G6JB 4L8DB 2JCCE 1MREH 1OGAE 4I3SL 3ZSSA 6FABL 3IFOA 5EU5B 3VW3L 4P3CH 1T83A 3BKML 4BK5A 2B20A 1JTOA 5DJ8A 3GM8A 2HH0H 1MIMH 3BHBB 4RX4A 1YEEL 3GSVB 1B4JL 5GSRA 5E5RB 4R4FH 2EYSB 2DQCL 2X4TB 1MFBL 1RY7B 4X8JB 4WW2A 4OFIA 4LLVA 2YWYA 3QJFA 4GMSL 1Z0NA 4YFDB 3HUJA 4YQXL 3GMOB 1P7KB 5IHZB 3HPLA 5IQ9B 1CBVL 4NN7C 1TVDA 1A9BB 2R2EB 4PJAE 1PLGL 3QP3A 1S78C 4IS6B 5I8EB 2EDFA 3MFGB 2X1WL 5KW9H 1MCBA 4JB9L 1LO0L 5FYKL 5IMMA 4ZSOA 5J3HC 1FGVL 2K1MA 3RVTC 2B4CC 3P0YH 2AQ1A 1AXTH 3QFJE 4HCRA 1IGJA 2QQLL 1KCRH 4ZAKD 4D0CB 4IOSD 1IGML 3KXFB 3MV9D 4XBGB 2WINA 3FB5B 3MRRA 4MA7H 4C57C 2K9UA 1DE4A 1ZOXA 4QRPE 2V2WA 3HZVA 4UT7H 3GSRB 5IEHA 3HLAA 4M03A 3RVXC 5JXEA 4KUCF 3MRGB 4PJFB 3DRTA 5T1DH 5C07E 3GHEL 2OI9B 3AS0A 4TUKL 2F74B 1OSPL 4W6WB 5EZOL 5L2KE 3WN5A 4EDXA 5C0AB 2J6EA 1P4BH 4TULH 3MV11 5ACMA 2AGJL 4CADB 1T1ZB 1NCAH 2Y36L 1SJHA 3P3YA 4FXKB 4P23C 2ZKHL 4YC2B 1FO0L 2YHGA 2PTUA 3D18A 4TN9A 2IFGA 4F9LA 3REVA 2VLJE 3MV8D 2A73B 3KLHC 2FJHA 3PF2A 2A74A 2A6JA 3DVNB 3OGCB 1MAJA 2GITB 5IVZA 5IV2B 4P2CG 5D9SB 4CNIA 3QUKB 5F1NB 2CLRB 3UYRH 3WNOA 3QEHA 1UM5L 5L2JB 1MJJB 3B6SA 1X5IA 2DQHL 2HLAB 2VDNH 4DGIH 2R0LH 5I1AB 4M7LL 3U9UA 5KTEL 3W39A 1CD1A 4JFEE 3ARVA 1MLCA 4JO2H 2HWZH 5CAYB 1C5DA 5IB4A 2Q87A 1T21B 2BRQA 5IJVA 1JWUA 1D5IH 4X99A 5DRZA 1LE5B 1QEWB 4NNXB 4ZFOA 1KG0A 3PJSA 5SWSB 3G6JF 3P9WB 1ITBB 3QCUL 5DRNB 4LEXL 5C0GB 3PDGA 3U82B 2XRAH 4ISVA 1OCWH 4PB0L 4R97B 4N1CA 5E2UH 4HGMA 4M6OL 4PJ8D 4M61A 1N5AB 1ZLSL 2V5MA 2NW2A 5KSAC 4RFEA 4Z5RA 4HMEA 1RUAH 1E4XH 1RZIB 5D70L 1KIQA 3QZWB 1U3HB 3JWOL 1ZV5A 1S7WA 4JFXA 5FUOH 3MLSL 4KUZL 2Y06H 4GAFB 4YIQB 4Q97A 4NT6A 2HKHH 3ARFA 4KZDL 5C0RH 1I3GL 2PN5A 1RFDL 5FYLH 1F3DH 1XCTB 5J7CC 3FN9A 1F2QA 4GMTL 4HF5H 5AD0A 3U30B 2ARJA 4XWGH 4Y16D 3F62A 4GT7A 1ZHLB 2R4SH 3P4OA 4JFQB 1OAXH 3CH1B 3FO9A 5IBUB 5CUSH 3CFJB 3M45A 1T0PB 4Z8FL 4KMQA 1FE8H 4I48A 4LSDA 3OR6B 2PW2B 3OPZL 1LVEA 1S7VA 3TPUA 3KPMA 5KVDH 1P69B 3CFBB 4Y5XA 4IRJB 5EU4A 3ZKND 5I1JL 1A6UL 1CDYA 1OP5K 3UZQA 2VYRE 4QTHA 1YA5A 3OGOE 3P4LA 5TQ2H 5E7FA 2D0HA 3U4AA 2XFXA 5I2IA 5ICYA 5E1AB 4PJFF 1G0YR 2D9QB 4NN5C 3S5LB 3KYOB 3KYMA 4X5WA 3RZCD 1D5BB 4MNQE 1U3JA 3RTQC 4YAQB 5DQ9A 4AM0B 4AYFA 2HT2C 3MXVL 1UXWB 4OGAC 3T1FB 2YPLB 4ORZC 1YEKH 4GW1A 4NZRH 3PWNA 4JDVA 5E0QA 3SO3B 2OX5A 2BNRA 2IJ0C 4NKOA 5BO1L 2YUWA 3HAEA 3Q6FB 2B4CH 1JHTA 4YHYB 1DUZA 2E6QA 1JV5B 3O3EA 1GZPA 5HHMB 3NAAL 1R24A 4XNMA 1TNMA 4JFFD 4H5SA 4PGJA 3VXSD 3LS5H 3O2DL 4Q9CA 3ROLB 3VFWA 4Z7WA 3ULVL 4J2XA 4RMWA 2EYTA 1BGXL 1FCCA 3X14A 4WFGD 1MREL 2GFBA 3FTGB 4P3CL 5FO9A 2PTTB 5C9JB 4I0PC 3SDCC 2ZJSH 4FQXC 3QXAB 2EXYC 2SEBA 1CXFA 2H1PH 2HH0L 1MIML 1KTDA 3HPJB 1H9VA 3PUCA 1K3ZA 3U0TA 4YHNB 4R4FL 5L0QB 1CDHA 1JGDA 2J5LC 4NRZA 3L7FA 3F7YA 1S7SA 1EHXA 3ARRA 4WUUA 1IVLA 1TQBB 2XQYG 2C3XA 5MERB 3VWKA 2FX8H 1T5WB 5CGYD 3TIDB 1W0VB 1VB9A 1JPFA 2FIRT 4OZIE 4V1DA 4F7PB 4JY4A 3AC0A 4UQ2B 3H7BB 5T5NG 4D0BB 1BBDH 2V7NB 2Q76A 4FTVE 5BOPA 3OKDB 4NRYA 5BZWA 3NCYP 1ES0A 5KW9L 1CFNA 3MV7E 1YEDA 4JJHA 4MQSB 4QRSB 3KHQA 3IETB 5E00B 5EPMB 3P0YL 4PJ7E 1AXTL 4EI5D 3BZDA 3L3OB 1S3KH 4Z77B 1KCRL 1A7RH 5HHXH 1TQCC 1AY1H 2P5WB 3DXAE 5KN5B 1CK0H 2ERJB 1HINH 3G5XB 4MA7L 3VXUD 1JI2A 5JXAH 2JF1A 4IMKC 3RQ3A 1JYWA 4UT7L 3T2PA 2J8HA 2BNQE 3VA6A 4ZS7H 1KB5A 5T1DL 5FGBA 5I73B 3D0LB 4XNQA 5I76A 3G6JA 4L8DA 1AD9B 4N1HB 1P4BL 5EU5A 4LPXA 4TULL 3RWEB 4MSWB 2J8OA 2XKSA 2DN7A 1NCAL 1R3HB 1T1XB 1KXVC 1WZLA 3ARUA 2WLYA 3BE1H 3BHBA 1IKNA 4KH2A 2OYPA 1I1CA 3TVMB 3GSVA 1Q0YH 2EYSA 4QHMB 2X4TA 1FYTD 5BS0E 5A3IC 1Y0LB 4X8JA 3T0ED 2UV3A 1EJ6A 2V7HB 3IAGC 1OLLA 5T33H 3ZDYF 3QRFM 2E9WA 4L5FH 3STLB 4HFUH 3V7MA 3AM8A 3UYRL 5EB9A 3GMOA 5IHZA 3EYUH 4DGIL 2VDNL 3QI9A 1TJIH 2R0LL 3Q3GA 5IQ9A 1AO7B 5F6HI 1A9BA 2R2EA 4PG2C 5DVNA 4JO2L 4YDVA 3ULUD 2JK5A 2HWZL 2JJTC 4IS6A 5I8EA 3L5WB 3ABZA 5ADOH 1YDPB 4JFOB 2LTQC 1D5IL 2BSSB 1I7UB 1Y6NR 4NGHH 3QIWA 3O6MH 1K8IA 1HH6B 2AQ3A 2J2ZA 2VZ1A 2E9IA 4JQVA 4C56B 4I2XE 5HDBE 4KXZH 5D7JB 4M48H 1E4KA 3S96B 4XBGA 3FB5A 4N9OB 2N56A 4PTUB 5I16A 1MCJA 2XRAL 3KPOB 1OCWL 3WJLA 3GSRA 1LO2H 5E2UL 3S37H 1BD2D 3MRGA 3KPNB 4PJFA 4U1JB 4JZOA 1SJVA 2MHAB 4KQ3H 1RUAL 1E4XL 5FM5M 1UCBH 4RA0C 4G6JH 4WW1B 5EN2A 5FUOL 4ETYA 5F96H 2Y06L 3ARDA 3QZWG 4P9MH 4WV1B 2HKHL 1T1ZA 5C0RL 1RZ8B 2VL4A 1M1SA 3ULSB 5FF6A 5KANI 1R5IB 1YMME 3QDME 5FA4A 1F42A 4HF5L 4XWGL 2A73A 2R4SL 3DVNA 1OAXL 3CGTA 3E0GA 3EW3B 1T89A 5CUSL 2GITA 1X5FA 3JUYA 4LKCB 3MJ7B 3QXTA 1TMCB 1I8LC 5IBUG 5D9SA 1FE8L 3HZKB 3QUKA 1NEUA 5F1NA 5DMJB 3IKCB 3P2TA 5L2JA 1FVDA 1MJJA 2DLFH 5KVDL 3FRPG 4GJTB 3BKYH 5I1AA 2F58H 3VCLB 4L1HA 1CS6A 4YE4H 1T21A 5TQ2L 3MA7B 2BRRH 3SGEH 4RFNB 3KLAB 4X7SH 3X3GH 1HHIB 3HI1A 1LE5A 1QEWA 4NNXA 5GGUB 3T4AB 2IG2H 4OCRH 2ZUXA 4ZOCA 5SWSA 5DJ2B 2PW1A 3OKKB 5B38B 5FHBH 3S5LG 4ZXBC 5DRNA 4NN6C 1A14H 2RR3A 5KVFH 5IW6A 2Q1EA 2Z31B 5C0GA 3VFUB 3UTSB 3QDGD 1YEKL 4NZRL 3HG1B 3R06B 2ZNXA 4Y5YC 5I1EH 2B4CL 1N5AA 1WTLA 3F7PC 3ILQD 5GZNC 4UV7H 2NY0B 4M62H 3VD5A 3CX5J 1G7QB 2BVQB 1U3HA 2COQA 4AK1A 4NZJA 4YIQA 3TV3H 4GH7B 3LS5L 5FYLD 2EIBA 4CVUA 4ZD3H 4DQOH 2VAJA 1U9KA 5TH2B 1XCTA 4XC3H 5GRZA 4LAQH 3CXDH 4W6XB 4AENB 3RIFF 4JFQA 1H3PH 2BY3A 5L88H 4XPFH 5DFWH 3GSQB 2ZJSL 1NBQA 4PJHB 5DQDH 3QUZB 3PL6B 5E1HB 3VD7A 3W82A 1H8NA 2WSKA 3BN3B 4RSVA 5F93C 2H1PL 5GSVA 1NFDB 2GY7B 5C6TH 3OR6A 4Z0XB 4NFCA 5EU3A 5E9DB 3CFBA 4IRJA 4HULB 2R15A 2A77H 5F7FA 1BZQK 4KHXH 2H3NB 5FFLA 5KVGH 2FX8L 1F4YH 3UO1H 1N0LA 2P49B 1BBDL 3NGBC 4YO0B 4XVTH 4AIOA 3S5LA 3KYOA 3WNKA 4EEEA 4Q0XH 1D5BA 1GOGA 3RKPA 4XI5D 5I1IH 5CMAB 1I85C 2IAMA 4AM0A 4YAQA 3BP4B 3KLDA 1UXWA 3T1FA 1CLCA 1ZA6B 2JTDA 2ZPKH 5EZIH 3V6FA 1EGJH 4NBZB 3SDDD 1S3KL 1RZKH 1A7RL 3JV4B 3Q6FA 5HHXL 1CICA 1AY1L 1YEIH 2YXFA 1JV5A 1CK0L 2MKLC 1HINL 2IAND 3DGCR 5F9OH 3AS3A 1HHKB 2FH8A 5JXAL 3EO0B 2F53D 1CF8H 1CFTB 3STBA 3RDTC 4MS8C 5KBNC 3ROLA 2FR4B 4ZS7L 4PG9B 3MA9H 4LIQE 2EE3A 3QAZB 3V8OA 3EDEA 4DVBB 3FTGA 2PTTA 4ZFZB 5C9JA 2RB8A 4PLOB 5B39B 3QXAA 5DJAB 3VE0B 3BE1L 1IGYA 3HPJA 3FFCD 4Y4HC 2WIMA 4YHNA 1Q0YL 4HH9B 4TSAH 3PABA 4TNWK 5D1QD 1AQDB 4OFDA 1NCCH 5FYJD 5T33L 3W0WB 2CUMA 4L5FL 5MERA 1OTSC 1DLHA 1T5WA 4HFUL 2H32H 4L1DA 3UX9B 5K59E 3TIDA 1W0VA 4LMQI 3BDYH 4F7PA 1TJIL 4UQ2A 3H7BA 3IU3B 1RUPH 2V7NA 1FL3B 4RGNB 3EJYC 4G6AC 3VFTB 3MJ8B 4YXKH 2ADGB 1UXSB 3CFDB 2B5IB 5ADOL 3MLZH 3WS3B 2G9HA 3G9VA 4P2YA 3CZJA 4NGHL 4QRSA 5J9PA 4L29B 3IETA 2JE8A 3O6ML 5EPMA 3L3OA 2P5WA 4M48L 5KN5A 3ZT6A 3ZE1E 4PJHF 3G5XA 4CMHC 3SKMB 1NFDF 1WAAF 4K7FB 4MCZB 3V2AR 1LO2L 2NY6D 3S37L 4AT6B 5HVFB 1I9RH 4WGWB 5CJOH 4KQ3L 5CBAA 3D0LA 4KRPC 4LLYB 1UCBL 3MRNB 4G6JL 2I5YH 1FL5B 1AD9A 2ARJQ 5DDHB 1MNUH 2X6MA 1JRHH 4ALAH 4CDGC 5F96L 3K1KC 3BZFB 4P9ML 1R6VA 3RWEA 3V95A 1FRGH 2ENSA 1R3HA 1T1XA 3S35H 2R0ZH 3O8XB 4LP5A 4JREB 1MCNA 4ODTH 3A67H 5CIPH 4QHMA 4XNZB 4UOJA 2V7HA 2QSQA 1QD0A 1UJTA 4GRWF 4R4ND 3STLA 3RIAK 3THMH 4JVPA 1Q38A 1J5OH 5EORH 2CRZA 2DLFL 3RPIB 1IJ9A 5E5UB 3BKYL 4OV6F 1AO7A 1A3LH 4V2BA 3LN4B 2F58L 1W8OA 5AZ2H 1FQ9C 4YE4L 5DK3A 1WITA 3L5WA 3DETD 1VESA 3MBEA 2BRRL 4JFOA 1CD8A 1HH9A 2BSSA 1I7UA 2NZ9C 2VXQH 4X7SL 3X3GL 3EYQC 2IG2L 2JB6A 3LEVH 4OCRL 4ZUWB 1HH6A 2E5EA 4C56A 5FHBL 5D7JA 1A14L 3O3DB 5B38G 1AKJA 1I3VA 3S96A 5KVFL 1A2YB 3C09C 3H2WA 3SDAC 4F7CB 3TBYB 4AQOA 3KPOA 3MOAH 5E5MB 5I1EL 2PYED 5A43C 4LLQB 3VI3E 3KPNA 4U1JA 2MHAA 4UV7L 3ZTNH 4EQ3A 3QO0B 3VG9C 4M62L 4ZAKB 1Z9MA 4WW1A 2R1WA 2DBLH 4HKXB 3U46A 3TV3L 3TESA 3B9AA 4WV1A 3MV9B 1RZ8A 4ZD3L 3ULSA 4DQOL 3HMWH 5IJKA 4XC3L 5M95B 5KOVC 2YEZB 1X5LA 3SJVD 4QYOA 2DQFA 4PRNA 4LAQL 3CXDL 3HKFA 3SE3A 1H3PL 1FNFA 5L88L 4XPFL 4LKCA 3OJ2C 3HNVH 5DQDL 4N5ED 3QNYA 1LNUB 3ZL4H 2ESVE 4QOKD 5C08E 3QDJE 5C6TL 3IKCA 5IUSA 3MGTB 1FNSH 4KTDH 2AV1B 3CSBA 5HHVH 3NIFE 3VCLA 3MV8B 2UYLA 4L4TD 2A77L 5E95B 1Q0XH 4KHXL 5KVGL 2J8UF 1F4YL 4WI8A 3UO1L 5JW4M 5E56A 2WAHA 5IFJB 3KLAA 2GTWA 1HHIA 5DEGB 3T4AA 5GGUA 1PGRB 1U8OB 3EFFB 2RGSA 1P9MC 4RMRA 4XVTL 4Q0XL 5DJ2A 1FZKB 2DKSA 1KXQE 3OKKA 4YK4B 5I1IL 4KK9D 1J8HB 3LHPH 3GKZA 2Z31A 4MNHA 3VFUA 1II4E 2ZPKL 5EZIL 3LKRB 5AYUH 3F6LA 1CXEA 1KIPB 1EGJL 3R06A 5GGRA 2EYRB 1RZKL 4JKPH 1SVZA 2FECI 1YEIL 1DBKH 4XCFH 2GJ6D 4NNPH 5F9OL 1QZ1A 1BJ8A 2BVQA 4KKAD 3AUVA 3DYPA 1MCQA 2X4NB 1CF8L