1FDLH

Crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
218
Chain Sequence
b'QVQLKESGPGLVAPSQSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLHTDDTARYYCARERDYRLDYWGQGTTLTVSSASTTPPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA D1.3 FAB (LIGHT CHAIN)
publication title Crystallographic refinement of the three-dimensional structure of the FabD1.3-lysozyme complex at 2.5-A resolution.
pubmed rcsb
source organism Mus musculus
molecule tags Complex (antibody-antigen)
total genus 42
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1990-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fdlH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fdlH01
4J2XA 3DV6B 1U91B 1KV3A 1R3KB 1JWMA 3K2MC 3T3PF 2HAZA 1JYVA 1T66C 2B1AL 3LEXB 3SDCC 4B7LA 3U4EB 1HZHH 4OCWL 2Z9TA 5ICYA 4JHAL 4Y5XA 1KB5L 2DWDB 2M1KA 4FN0A 4MNHB 4QEGA 1QA9B 4HAFA 3FMGH 3L3JB 4GKNA 5GGVL 3NVQA 2DTML 3U9UA 5C8JB 2XQBH 5B39G 4G6AC 4HPOL 2IC2A 4L4JA 5DRWA 5IROA 4ZOEA 4CMHC 1ZEAH 1U8QB 4DUXA 4E41D 5FGCE 3TH3T 1RUAH 4DFIA 4M6ML 2FJHA 4TPRL 3RL1B 1LO0L 3O81A 3VD7A 2CK0H 3QG6A 2R1XB 1EAJA 3E6FA 2DLHA 4JFEB 2R29H 1Y18A 2AXHA 5E8DH 1V3KA 4JFDE 3PWNA 1CDYA 5J1AA 1PG7H 4EIZC 1IGIH 4NHUB 5FA3A 3P9WB 3OBAA 3L3DB 3GSOA 1A7RL 4P3DB 5BV7B 2V7NA 5EOQH 3JTSA 1F11B 5DRZA 1MOEA 1T1ZB 1HXMB 3DURB 4HIEA 1KIUA 1UZ8A 5DT1H 1J11A 2PO6B 3PQYD 1G7PB 3FOMA 2ZSVB 5ITBL 1AFVL 1HOCA 1OAKH 4Z7VA 4LPWA 1XGPB 4AIXA 3KPQA 3NCJL 4ONGL 3REWB 5GRUH 3BKML 1Y6KR 3SCMD 4KTEL 3RBGA 1D9KB 4AEHH 1OM3H 4CADB 1CK0H 5E6IB 3H9ZA 4EBQL 2X4TB 2AK4E 3QCVL 1Z9MA 5GZND 1XIWD 4L3AA 3IAGC 1OF2B 5IQ7L 2I9LB 2W0PA 2VLRB 3LQAH 1UWXH 4NM4H 1TCMA 1I4FA 3QDJD 4M00A 1M4KA 3CSGA 3FO9A 2FX8H 4JRWA 3U4BH 2QTEA 3G6AA 2VABB 4JFDA 2YC1B 3ARGD 4WWKC 5ESVB 1QO3B 2VO5A 4HIXH 2BVPA 1K3IA 4H5SB 4I9WE 1FN4A 3PGDA 5E24E 4LLAA 2CRMA 2VH5H 5C0JB 2AGJH 1EGJA 2HFEB 4I4WB 1WIOA 1G0YR 2GEEA 2PO6C 2J1KA 5DLML 2OJEA 1RVFH 4KVCH 1IM3B 5EZIL 1JYWA 5KN5A 3UTZA 4F57H 4OCYH 1AO7E 4LIQE 4OLZH 3H9YA 2QV2A 4JB9L 3I50H 4TQEL 5JORB 3H7BA 1TJHH 4KI5C 3D9AL 3UAJD 2APWA 1D9KC 1W72L 3UYOD 4CRPA 2C3GA 1VFUA 5CCKH 5EO1B 5A2KH 3OR7A 4JQXA 4KHXL 3MLTA 3G6DH 2PYEA 5CMAB 5D1QA 4KY1H 5KTEH 2D9QB 4KV5F 3CCHA 3O2DH 1AR1D 5T1MB 3ULSB 1S7VA 4MSWB 5EWIH 3L6FB 4IMLB 1BZQK 1GGBL 1JGDA 1HHKB 3A6BL 1KTLA 4Z7WE 1NCNA 4UT7H 2C3VB 2NY3D 1BFTA 1NCCL 3GSNB 4PBVC 1KTKE 4LL9A 5CP7B 5FYKD 4UMGA 3VGAB 3CFIC 4PGBA 2P5WD 5IT2H 1NGXB 1NEZG 1RUKL 1HILA 4D9LH 4JFFB 4RQQB 4KMQA 5T1DH 5IVZB 4XX1G 3ARZA 1G6RH 1IC7H 3VRJA 2C1PA 2NMSA 4KK5C 3EOAA 4WTZG 1DEDA 2ITCA 4HAGA 2NXYD 1A6UL 1OAYL 4L1DA 3GMMB 2J8OA 3VG9B 3TPUB 3HC3L 5L2JB 2ESVA 4FP8L 1A7QH 3H42L 4YHNA 1CXFA 1P2CA 2QHRL 2RFXA 3IDXL 5F9JA 4FQJH 3K81A 3KXFD 2VL5A 1ZA6B 4KI5F 2NTFB 1XF1A 2YEZB 1FE8L 2FO1A 32C2B 3MRIA 5FGBA 1MQKL 3F12A 4JM2D 5MEND 2Q8AH 4QXGL 2P47B 3S35L 1KN2H 3V7AG 1F2XK 3L3GA 3RIAK 3ULVC 2DM2A 4WHCA 1PSKH 4AT6A 3DO7A 1P5VA 2YUXA 1AQKH 1S7RA 1U2CA 4Q2ZA 5L2KE 4HCRL 1N7ML 3QISA 3C8DA 1OSPH 3VGAC 5AWNH 5IG7B 2BFVH 3TO4D 3SO3B 3PWPB 4KK6D 1RAMA 4I77L 5JPNA 4WV1A 5GGSB 1CT8B 3JWOH 4LAQL 5EU7E 5MHSE 4HHAA 1NEUA 4MJ5B 1CFBA 4FQHA 1FQ9C 4X6BA 5BJTA 4OD2B 5FGRA 4DKEL 3S96B 1HEZB 5DQ9A 4UT6L 3P4NA 4JVUA 1GZQB 1HINL 1U93A 1JJUA 5EIVA 5GHWH 4F9PC 2YRPA 4HWEL 5F21B 1I3GH 4WFHD 4FXLA 2ZWLT 1WWAX 1KLGB 5IVXE 2VR5A 4IIQB 3HHRB 2E9BA 3ISWA 5D7IB 1KPVB 5DDHA 1CFQA 4M61A 1OY3B 1EK3A 3W39A 4LLMB 1FNFA 3QAZB 5KSVB 3SE8L 4LGSB 2FHFA 3RTQB 4WHTB 5KJRH 4FMKA 5ID0A 1WZ1L 1L4IA 1CDJA 4JRXB 1X5YA 1EO7A 4QRQB 3ULVF 2ZUSA 4QHNA 3RUGA 3EOTL 3DUSB 5L2KA 4HUXA 3RNKA 5FM8A 3RVVD 1EHAA 1Q9KA 3SO3C 1C16B 2Q1EA 5F7EH 4BH8A 1R6VA 2GIYA 1MFEL 3D85D 4BH7A 1YJDL 1PKQE 3VWJD 4QT5A 5GGRB 3VD9A 4X7SL 3MA9H 1IQWL 5C0FB 1DFBL 5DD0L 4XP6L 1IKNC 3O2VL 5CEZE 1KXTB 1TZIB 1BBJA 1U8OA 4YHOL 3WYRA 3L1OL 2D31B 3EYFA 3V4UL 5FECB 5IFJB 2R2HB 4M1DL 2R4RL 4L9LB 5IVXA 3G08B 2HKFH 3QUMH 3GJFA 2IH3A 3V7AE 1DBJL 4PS4L 3SKMA 4Z0BH 3GSUA 3VXSE 1NGYA 5D71L 4RMRA 5HHNB 1AGCB 1S7UA 3QAZC 3AM8A 2CJUL 1JPGA 3RTQC 3K4ZA 5J89A 3MYJA 4LFHD 2A73A 4XCCH 4JFOB 1SYVB 4PB9H 1QLFB 5SWSB 4XMKH 4MQSB 2V5TA 4JFPA 5TGBA 3GRWA 3MRQA 5ECJE 3DWTA 4WTZA 2FLRT 3QIWA 3LN5B 5I71C 2H26B 5DVOA 1EFXA 2VDNL 4I3SL 2MSPA 2KQMA 3QULB 5FKAB 1DLFH 3DO3A 3KPRA 5B3NA 2VISB 4UOW0 3T0AA 2BMKA 5I19H 5EORH 3ETBF 1CZ8L 1YQVH 2DLGA 4X7FC 3LSOB 4FOMA 4LARH 4PB0L 3ZE1F 5DJ2B 4JQVA 3C5ZA 4OI9A 4XNXL 4L4TD 5E0QA 1YC8A 1KXQE 2CDFB 1CTNA 3KWWA 1OCWH 3U83A 1R5IB 1MQ8A 1I9RL 1YEJH 1PQZA 3L3KA 5CLWA 4L9LC 1YC7A 1G9MH 1HWGB 1ADQH 3ROLA 3FQXA 2JJSA 5FDWB 3NACL 4RWYH 5D7IF 4I0PD 3VXRB 4GXVL 4OZHB 4O00A 3OJ2C 3VXSA 3IF1B 5CKGA 3O3BA 3QDMB 3STBA 5CP3A 4HULB 2EH8H 4ZFOL 1QZ1A 2ARJQ 4HG4K 5GRXG 5JOPD 4LSVH 5C07D 1TZGH 4NZJA 3VFWA 3HTLX 5D1XB 4UUJB 1CLOL 2BNRB 4X4ZA 3R1GH 4XCEB 4FTVE 3A6CH 1K8DB 2FL5A 1UM4L 2E7CA 3O6FA 1G9EA 3D0VB 2ENYA 1T1YA 5CHNB 5TDNA 5A43C 4LNRA 4UZGA 1BMGA 5JW4Q 5IVNA 3GJFK 4NSKA 3S37L 1A6TB 2P24A 5ALCH 5DMJB 3L3IB 2H9GB 1ZK9A 1NMBH 4HS3B 4UILL 2VC2H 3C5JA 1TZHB 1FZMA 1FL5B 2Y6SD 1SBSL 1RZFL 1UB6B 1EHXA 1UYWH 3GO1L 5E1HB 1GIGH 3GMPB 3ME0A 4DK3A 5INDB 2GTZB 5IQ9B 3MFGB 3RX5A 3OAZK 1P6FA 4ETQB 4K2UH 4XWOC 2VE6B 3RWGA 4PV8B 4LSPH 4JFYB 1N6UA 4Z7VF 4P2CG 2Y06H 3LIZL 1BF2A 4HIJA 4YAQB 3HCVB 4OCMC 2NY7H 3L5XL 3OB0K 4RGOL 4K23H 4CL7A 4QHMA 1OT1A 5D1XC 1GHFL 4GRWF 4QHLB 3BD3A 4V2CB 6FABH 3CUPB 4FTVA 1TDQA 2RIKA 2ARJB 3QDGE 4OD3L 1IGML 4IEFB 3DX6A 4NGHL 4MA3A 2IH1B 3Q3GB 4QLRA 1J0YA 4U1JA 2NY5C 2UWEB 1E6JL 2VQUA 3RIAF 4XP5L 3MGOB 4X7TB 5F9OH 4P4KB 4HJJL 2QSCH 4LPTA 4OLEA 3RWEA 5I2IA 1EBAA 3BFOA 3EW3B 5EOCH 4L3EB 3HE7A 3FQWA 1AE6H 2WZPD 2B4CC 4LQ1A 3EO0A 5AAWA 4OFVA 1PFCA 4OZHF 4ZUWB 1OPGL 1HNFA 1X4ZA 3EOYG 1YEIH 2YHGA 2IMNA 4KKLD 1MHHA 5ELIA 5CGTA 1FV1B 1JGEA 5IB5B 3PGCB 1HYRC 5F6HJ 3G5YB 3VXPB 1JN6A 1ZHBA 1T6WA 4JHBA 4AIZA 4C56B 1QFWI 4GS7B 3QDAA 3VFUB 3WHXB 3GMRA 4JM4H 1VPOL 3VFTB 3C60B 3UXFA 2VQ1A 3TZVD 3RY6A 4XNMB 3Q2CA 1FAIL 5E8NB 3MV8E 2VYRE 4EDWH 3KPTA 1XF3A 5B4MC 2FWOA 1ACYH 5EOCJ 4D0BB 3IJSA 1FJ1A 2J4WH 1IAOB 3O4LD 2FATL 3TO2B 3BE1H 3NIGF 3ZHKA 4DTGL 5CAYB 2R0LH 5E2UL 2QBWA 3O2WL 3UYRH 2BDNL 3SE9L 3V6ZB 4G9DB 1KOAA 1JWSB 3HRZB 4YGVB 2A6DA 3NTCL 4K7FB 4IS6B 1AHWB 2J6EL 3U0PB 1FFNA 3EKCA 1Z0NA 4M8QA 5E2JA 4FQ1L 4G6KL 4M9OA 4OFKA 5LXGL 2H2PC 1AKJA 3HZVB 3NCFB 5JDSA 3DUHA 3BKYH 2QKIB 1UWGL 5D9SB 2A6JB 1XMWA 3MRDA 2KPNA 3NN8A 3BH9A 4FABH 5I6XB 4S1RL 5E03A 1LO5B 4L8CA 2NW3B 4GS7C 2NXZD 5J6HA 5KSBE 4GW1B 5FCSH 1RHFA 5HHVL 3C60C 4HIHA 4BUHA 3LS5H 4RFOL 3MRMB 4G8GD 5JIKA 4OCSH 1PYWA 1ERNA 2R9HC 4GUPA 3RGVB 3WN5B 5E95B 3C2AL 2DDQH 3LMJH 1HIML 5EIIB 2O5ZL 4OT1H 3C8KA 1HHIA 3SDAD 2WV3A 3VJ6A 1QYGL 1QSEE 3RU8L 4HV8A 1NDGA 1HE7A 1TETL 2GJ6E 4NYLB 2EDFA 4ELMB 3BT2L 4HWZB 4FMFA 1A3RH 5DD1H 1AHWC 4CVXA 1YMMB 3HAEA 4PGDB 4POZC 4YBHA 3ZT7A 2AVGA 15C8L 1DBBH 3QBTB 3BRDA 1JZ6A 2PTTB 2B2XL 1ZT1B 4U05A 5BXFB 2BVUA 4XNZC 2PW1B 2EIZA 3H9SE 3WCYA 3DSFH 3MCKB 5IR1B 4P2RB 1JRHL 3NCBB 2LTQB 1AD9A 1E27A 4JZOB 1T21A 5I6XC 3IU3A 4ZPTB 1JFQH 4BKLA 3QIBB 5BS0B 3MLXH 3QRGH 2K7PA 1E6OL 4FQ2L 4E41A 3BESR 5JNYB 5EUKB 4ZDHB 3O3DA 4K94C 2NY2D 3WXVL 3MRNB 4M6OL 3QNXA 1P5UA 3K1DA 4XAKE 2GSGB 2UY6A 5JIPA 4WTXA 1LO3H 3CLFL 3RGVC 1P4BL 4X5WB 1T04B 4DZBA 4ZTPH 3WFHB 1QD0A 2BY1A 3O6ML 2A38A 4PD4J 3RUGF 4XI5D 1UH3A 3WJJA 4PLKC 3RA7H 4Q7DA 3BAEH 4P9ML 4OCRH 4DGIH 4JRYB 4XTRC 1NCAH 3NA9H 2BVQA 2UZYB 1CICD 5DMGD 3GDBA 1QSEA 5I18L 4O4YL 4PJAA 4ZODA 1KENH 3WDHA 2V2XA 5SX4I 4G80A 3PQYA 4NM8H 2VSDA 3KPLA 2OQJA 3V8OA 1AGEA 4TYUA 1RUQH 1YN6A 4KV5E 2DQTH 4NJ9H 1YEKL 4LHQB 5GS1A 4KDTC 4Z8FH 4MJ2A 3FRUB 4U6HA 4L3CB 3QWOA 3H9SA 1EZVY 5E2VL 2DB8A 1XGTA 2D0HA 2LTQC 5DC0A 1KB9J 4P23B 4NKIH 3OPZL 5I66A 5FKPA 3VGBA 3NCYP 4QRRB 1XAUA 4LLQB 4L8SB 1E4KA 3M17B 1EFQA 5GRJL 1EGJL 3KPMA 1PKOA 4LU5H 2VDQH 5ENWB 5D7JB 2CLVB 4UQ2B 4PJ7B 3EYUH 3TIEA 2DQJH 3HG1B 1U3HB 3V79C 1CL7L 3ARTA 2QQKH 3PHSA 3C5SB 4OI7A 1P7KA 3ARDD 4WUUA 2J88L 3O41B 1NUDA 2YRZA 3BGAA 4MD5B 4XAWL 4YIQB 3C6SB 3EDJA 2HP4A 4DW2H 4ELMF 1CG9A 1PVHA 4MNHA 5IIEB 3IFOB 4KUZL 2DI7A 1MREL 4KI5E 4IRJD 4IOFD 2AJYH 4S11A 5HGHB 3B83A 1MFBL 3QZWB 5ESQA 5I15H 2VLME 3SGEI 3WL9A 2DWEA 1SJEA 4PYHA 4D9RE 4P23C 5I1IL 2YN5A 3KYNB 3MODH 2NQCA 2YPLD 2VLRE 4FXGA 4OFYD 4BQ6A 3W0WA 4L8SC 4UT9H 5F1OB 4KAQH 4AG4H 2H32H 2XXCB 4XCYA 1TCRA 2R1XA 3O0RH 4EI6B 5TF1H 1A6AA 4NWTH 1UWEH 5D2NA 5DMKA 5D7JC 5GZOD 2DQFB 2EDJA 4ORZC 4ZOBA 4LCUB 3ARPA 4Y1AE 2X4SA 3HNSH 2P5WA 3QWRD 1BQHG 4G5ZH 5JUEH 1U3HC 4ZD3L 3VCLA 3KGRA 4LIQL 4WI3A 4EUPG 4NRXB 5F7DA 3I6LE 4QHKJ 4R2GD 5JPMB 1FCGA 1WZKA 2H3NA 5I76A 3B9KB 4YHZL 2ZJSL 1EJOL 3UJJH 4HUMB 5CD5C 3BISA 3U6RA 4J1UB 4JFXA 4HT1H 1UM6L 3DECA 3V5DA 4LKXB 4PRHB 5L88H 3CX2A 4Z7QF 3GB7B 2HKHL 3TJHD 3NABL 1MRDL 4CADA 4NFCA 4ZFFB 4L8DB 5E6IA 1MAJA 3FN3A 4MMXC 4K9EL 3JUYA 4LQFH 4PGEB 3HNVL 4D9QE 4UBDC 1OF2A 1LP9F 2R15A 5MENA 2I9LA 5FOBA 1YPZB 3MCLL 5FHBH 4F7EB 1NGWB 3RL2B 3MOAH 5BO1H 2GT9A 1F3DH 3T2OA 2VRAA 4Q9BA 5HYSA 1G7MB 4NRZA 4R3SA 2EDDA 3BI9X 3MOBH 1L9MA 4CJ1A 3AXLB 1VACA 5HGGS 4ZMAT 4G6ML 5GSVB 5JOEA 3SPVB 3E6HA 1KPRB 4M5YH 4Y1AA 3TO4A 3T65B 5TPWL 3AS0A 3BW9A 5CEYA 4OSUH 2E9WA 4X7CC 2WUBL 1QQDA 5F7MC 2FH6A 4U1MB 3P4OA 1FFPA 3SY0A 3FO1B 4H20L 4JO4H 4LCWB 1KC5H 1DQQB 3FQUA 1JGLL 2AEPH 5C1MB 4LHUD 5FA4B 1IGCH 5CIPB 3TEUA 2EKJA 5DO2C 3C2SA 4YHMH 4U6XB 3PABA 2PW2A 5EO1A 4HKJA 4Z7OE 4M62H 4P3CH 1HH9A 5LWYH 3UTTD 1AXTL 1T1XB 3UCRA 1BECA 3CSBA 3CH1B 5SV4A 3ET9F 4KRLB 1HHKA 4ZYKB 3MRGA 4XPBH 3WS6A 3S35X 5C7XL 4WCYL 2XNAB 1MLBA 2EDYA 3OR6A 4JHAH 4JAMA 1A1NA 3MUZ1 1I8IB 1QG3A 4GFTB 5BOZG 5JQ6H 3CFCL 1ZTXL 5K9QI 2OTWB 5MEQA 3D2UA 1L0QA 2FYYB 2R0KH 5D2LB 4APQA 5FHAL 3CNKA 3D39B 4ELKB 5E7BA 4LNVA 2DTMH 1F8TL 3TIDA 1T03H 5TH2A 4MD4A 1UGNA 1WWCA 4MQ7B 1WBYA 2FEEL 4RNRB 5FUCC 1WQVT 4M7KL 3KHOA 3VWJA 4TUJA 4NNYA 3O11A 4MMZC 4HWUA 5EBMB 4M6MH 4HIIA 4H88L 3FCTB 4XNUL 2V7HA 4UB0L 3TNNA 4P5TD 2R0ZL 2ICEB 4K3JL 4ENED 1R3LB 3SJVB 2FEDC 5GGTA 3W2DL 4AQ1B 4RFEB 1S7TB 5IB4B 2NW2B 1H15B 5I1AA 1A2YA 4D0DB 1A7RH 3OKKA 1TVHB 3MBXL 3GRWL 1OP3H 4KQ3L 3DI2B 2FR4A 4Y8DC 2NLJA 3L5HA 2P5EA 4JRXE 5C6TL 5JW3L 1ORQB 1BQHA 4I48A 1YPZF 5ITBH 2WP3T 5DJYA 4MA7H 1AFVH 3GNML 5I1JL 3ULUC 2Z91B 1T0NA 4R97B 4EUPA 5CJ5A 2ZNXA 3SCMB 5IG7A 3NCJH 1G7LA 4ONGH 4YE4L 1YN7A 1OAXH 4HMEA 1U0QA 3GMLB 4KTEH 1X5ZA 5CWSB 2AXGB 4Y2DA 5EOTA 5DJ0B 3VI3E 4WO4B 4GG6A 2AV7A 4QGTA 5AZ2L 5F89A 1U58A 4E9LA 1XIWB 4CGTA 4EBQH 3UPCA 2HT2D 3QCVH 4ISVB 4ZPVA 3V6FB 3QDJB 3EFDL 4LSSH 5JQHC 4WU5B 2BC4A 2Z8WC 4IIQA 4O51B 3RKPA 4LLYB 1NCDL 1U8LB 2BOBB 3FT4B 3ARGB 2WK2A 1VEPA 4MXWL 5C0ND 1I7TB 3WJLA 1TTGA 2WINB 3WJJC 5HHPA 1N6QH 3OKYA 2ZG2A 3MRHA 4QCIA 1DCLA 2Z35A 4Y88A 4YGAB 4N0UB 1C7TA 5DUPH 3H8NA 4JDZB 1JP5A 4K8RD 4TN9A 5B8CA 3HA0A 3G5VB 4Y4KD 4OLVL 5DLMH 3W9EA 2ZCLH 5EZIH 2ITDB 1PAMA 5SWSE 4CNIA 5GS0L 4X80H 4ZFZA 1AGFB 3FB6B 5FM5O 4JR9H 4R97C 1BVKA 3THMH 5ANMB 3AB0B 4JFHD 3SCMC 3MRKB 5JTWA 4JKKA 4GKZA 1FORH 4JB9H 4QRTA 1W2KT 2WIMA 2NR6D 2QSQA 4J23A 4JN1L 4CW1B 3U9PH 3QHZH 5D2LF 1W72H 1TJGL 3VD5A 1WZLA 3PUCA 5C0GB 1I9JL 9CGTA 4KHXH 5SWZD 3HE6D 1X7QB 1KJVA 1IKFH 1XIWC 4GT7A 5GZNC 3NFNB 5MP6H 2X89A 3L3OB 3MPCA 4C58B 1LE5A 1RZKC 1OAUL 1ZWIB 3D1MC 1FVDA 1GGBH 4N68A 1JHTA 1T6VN 2NY3B 4RZCB 4OZ4B 2GQHA 3PV6A 5E9DE 3JV6A 2MMXA 3H9HA 4NZTL 3FQNB 2Q76A 1NCCH 1JZ4A 5EU3B 1J8HB 4XBEL 5LKNA 1SY6A 3ARGC 1FIGL 1T7YA 1UKQA 1NC4D 4HQQL 2CKBA 1E4XL 3VXRE 3QPQD 2OZ4A 1YY8A 1CXKA 5D70L 1RUKH 3G6JB 1GPOL 1KCSH 1HSAB 1T4KB 4ODXA 2DM7A 1N0LA 3BIKB 3D3VA 3QDME 4NQUA 3IETB 2I07B 4ZSOB 2NXYB 4PJAF 2P43B 1Q8MA 4KK8D 3OKEA 5T3XL 1A6UH 1OAYH 3R4DA 4HKXB 1L7TL 1KG0B 1MF2L 1H5BB 2WBJD 5FYKU 4F9LA 5DTFB 3LEVL 4FP8H 4GKSA 3UAJC 2V5SA 4CMMB 2XG4A 4IRZH 5I9QB 2BNRE 2H26A 5E56A 4JO1L 3CVHB 1XF4B 2OTUA 2BVYA 5DJ6A 4DCQA 1KUMA 2EZ0D 1RK0A 5EZLB 1AR1C 5J12B 2VLKD 1FE8H 4JM2B 4OZGB 1NDMA 1MQKH 3V0VA 3RHWF 1T7XA 1QPXA 4JDVA 3S35H 1NBYA 4AMKH 3T0EB 4Q9RL 3BP6B 3F7VB 2NY3C 3MRJB 43C9B 5J6GA 5D2NC 5LAXB 5E9DA 4MS8D 3RQ3A 5DHVB 3FO0H 4G6FD 4PG2A 3IDYC 1FG9C 4M4PA 5H94A 3S37X 1EUUA 1JIBA 3IVKA 4JHZA 4ZNEA 4HF5L 5LVEA 4I77H 2ZCKH 3VGGA 4OLXL 3AU1B 5EZJB 4LAQH 5KSAB 5DI8B 2ZOKA 4L29B 3MO1A 1Q38A 3QDMA 1JGUL 4DKEH 2NXYC 3BZEA 2EXYD 3BZDA 5T3ZH 2ATPB 4PJ9B 1G7HB 1H0DB 1H5BC 2QR0B 4PLJC 2R0WL 3VW3L 3HMXA 4S1QL 3RWDB 3NZ8A 1BX2B 4PTTA 1BOYA 2BNRA 2XACC 1HHGB 3BQUA 4G8EB 4P57B 3ROOB 5C0BD 2F53D 3STLA 1NGZB 5J12C 2ATKB 4JM2C 3SHSA 4TSCL 4Y4FD 3TZVA 3X3GL 3KYOB 4WEUD 3SE8H 2GW5A 1EHNA 4WNQB 1E4WL 3FQRA 3T0EC 3OJDA 1WZ1H 1NUGA 2MKWA 2UWEE 3F7PC 3DNKA 4MQXD 1N5YL 4AEEA 1I3RA 3N1QC 5ICZA 5E08L 2GCYA 3L3IA 3TO4C 1MAMH 3FQTB 1D5XA 4KK6C 1JTPA 4HS3A 4L3EE 3WIFA 2VLJE 5FYLE 4NNXB 2DMCA 3QEHB 2EYTA 1RJLB 1V8HA 3T3MF 2NZ9D 1MFEH 5KZCD 4WHDA 2MHAB 1NC2D 2X4NB 1YJDH 4R90H 3G6JF 3O6KH 1LO2L 4QTHA 4X9HA 3T0WA 4D0CB 1IQWH 2P45B 1DFBH 5DD0H 4XP6H 2ZOLB 1KTDB 1MFCL 2XICA 4PV8A 1RULL 3QG7L 1X6NA 4YHOH 1LVEA 4U1LB 1A9BB 4OM1H 1WFUA 3HCVA 1WT5C 3TVMD 4GAJL 3CFJB 5DEGB 4M1DH 4A2MA 2R4RH 3CXHK 1YEDA 4J3UA 1QR1B 1H3UA 4DVRL 2OXHA 5KOVC 1DBJH 4U1KA 1KJ2H 4U4BA 2M2DA 4PS4H 5GJTH 1CDGA 3GJEA 4C4KT 3KR3L 5D71H 2IGFL 3WS6C 4BELD 1XGQB 1OSZB 2CJUH 4JM2F 1AQDA 4OZGF 5DS8B 2DN7A 4U6VL 2HT3D 4KWUA 1WAAE 2IH1A 4MWFA 1SM3L 1ZGLM 5EPMB 5DK2A 1WJ3A 5GSRA 1H3PH 5DEFA 1K2DB 3U82B 3RVVC 4P4KA 3WBDA 1IJ9A 4J8RB 2VDLL 3B9VA 4OZIB 3TM6A 1U8IA 4N0RA 4M4RA 4NC0B 2VLJA 1ZT4A 3LRGA 4OZFH 1PLGH 2FJGB 2VDNH 4I3SH 2ZKHL 3QNYB 5TDOA 4P2QE 1LK2A 4ZUWA 3TCLA 2NY6D 2Y25A 2H6PB 4L4TB 3JZ7A 4PB0H 3JVGC 3JWNC 4LCYB 4XNXH 4RRPA 3MR9A 1FV1A 1U92A 1RZ7L 4YHPA 5B3JF 4R4BA 1HDMB 4I5BA 5KSUB 1RZ8A 2O5XL 2XZCL 4C55A 2OBGA 4BFEA 3LQMA 3STZB 4I0PB 4JKPL 3AVEA 3WIIL 3NACH 1RQ5A 2P44B 4R7NA 3Q6GL 4BQ9A 4PP1D 4OAWB 2HN7B 3UX9B 5CD3B 3H0TA 1KEML 3TBSA 4J4PD 4NBZB 1QUNA 1ED3A 1J5OH 2QQQA 3TO2A 4AM0A 1MCOL 2V17H 3UBXI 4HK0A 2GITA 5C07B 2I9TA 1MHCA 4UU9A 4ZTOH 2AJSL 2N4IA 3H3PH 3SDXA 4X8XA 5MERB 1A7OH 1RHHB 4MLSA 1NJ9B 3MLUH 1NBQA 4ELME 3HRZA 1MHEB 4DKDC 2ZUQB 3M07A 5JHDE 1YMME 3HI1A 3V4PH 1MY5A 1HSBB 1O7SA 3BSZH 4P2QA 1UM4H 4KC3B 1BEYL 3RX7A 1U8HB 5HDQL 5GRYA 1N2RB 4ERSL 5F96L 1OGAE 2HT4D 4K7PY 5DR5H 4NO0D 2CD0A 1P7HL 1KCUL 4GRMB 4ODHL 3MCG1 3BUTA 4X6EA 3S37H 1D5BA 2R23A 1WIPA 2WWKO 1MCLA 4G7VL 2HH0H 4I0PC 1Q9OB 1SBSH 2X1OA 1KCRH 3MRMA 4RGMC 5FK9B 5C08D 4EVNB 1DBMH 4JZJB 2W59A 2KUTA 3WN5A 4ZUTB 2LE9A 5TE6L 3VFVB 1GXEA 3PIQA 4RWHA 3P77A 3TN0D 5EC2B 1RIVL 3LIZH 1CWVA 3HI6L 4JRYE 4U7MA 1T5WB 4I0CC 3MA7A 2YPVH 3L5XH 4LLUA 1HKLL 1MCFA 2P8PB 3CC5B 3BDYH 1GHFH 2ZUQC 3R06A 3U2SB 3VXTA 5JHDA 1RURL 1X5AA 1PD6A 3P73A 1EMTH 3LN9A 5HGAA 5JHLL 4OD3H 1S7WA 1IGMH 4PJGB 4HUVA 4YXKL 4ZQKB 1J1XH 4YC2C 3WFEL 2OL3A 2NYYD 4NGHH 4K3DL 4OBRA 2VXVL 3QFDB 1CGVA 1OGAA 4RMWA 1BOGB 2CLZB 3IKCA 2V9TA 3DBXB 1J9CT 2E8YA 3GGWB 4GRLD 2VSCA 1IM9D 4QRRE 4OIIL 4HJJH 3SGJC 3MJ8A 2Y6SC 1XCTB 2F8XC 4RDQF 5KVEL 3VH8G 2YPLA 3ARSA 3FN0H 5BV7L 1YEGL 2Y07H 3MJ7A 5J4MA 1MIEH 1YMHA 3U0TB 2GSGA 4PJ7E 5GGQH 5JR1L 4M7JL 4UIMB 4JZJC 1OPGH 2X7LB 3HMWL 3DXAD 4X6CA 5AEAA 4PY8J 4X5WA 5EU6E 5DSCB 3WFHA 4PJ8D 3HG1E 3ZDYE 4NQXB 1M7XA 2HWZH 3PL6B 1IE5A 5KAQF 3TA3A 4R8WL 4IHOA 4NRYB 1IAMA 4N90D 5EC1B 4ODWA 3DHJA 4V1DD 1K8IB 5GRVK 1OP9A 2FO4A 2YD9A 3DVGA 1ZS8A 1ZT7A 4HDIA 2LVEA 2XWTB 2F54A 1T5XB 5BRZA 3HLAB 2A74B 3ZL4L 3FFCA 4PRNA 1FAIH 3CLEL 2VKWA 3O4LB 3FB5A 1TENA 4EN3A 3R0MA 2BVOB 5T1KA 4HC1L 5D8JL 3QIUD 3O2WH 4J12A 4KROD 2O61B 5DMIL 3NTCH 3MJ6A 3LRSB 2IBZY 4U0RB 4MD0B 4NUGL 4U6YA 4FQ1H 3DVFA 3NFPA 1KT2A 4KKLC 4PJ7A 3LH2L 4ODSH 4U1NB 4MAYB 4ZS7L 3NBNA 3N1GC 5DJAA 4M1GL 5EU6A 1MRCL 3MRLA 3RJQB 1UWGH 1W0VA 2BSTB 5H37G 2XRAL 3GZKA 3LQAC 4KJYA 4RIRB 2P1YA 5AYQA 2DQUL 4YUEH 2NXZB 4PRID 5J13B 3C6LB 3DMMA 3HUJE 3QP3A 1BIHA 3C6SA 4MJ4A 1IGJA 2YA0A 3I02B 3UTPD 3MRCB 3TZVC 1UH4A 3WD5L 1CF8L 2X6MA 5F97E 3VWKB 2YUWA 4QRSB 2ZUVA 3QJFB 1BZ9A 1AP2A 1DTUA 5EO0B 3LKNB 1CFNA 1X5XA 3GSVA 4JDTL 3UTSB 1G6RB 4MVBD 4Y16B 2H8PB 2X42A 5DYOA 4OKDA 3SDAB 4XPFH 1YYML 3KYNA 1YPZE 4UINH 1QYGH 2JKXA 2IAMB 2Z31A 1TETH 3HC4L 4OUOA 4POYA 2P46B 2R4SH 4NKOB 4WU7B 2VZSA 4DAGL 4U0RC 4LCUA 15C8H 4NZUL 1J87A 1VERA 3NIFF 2B2XH 2LFGA 2OLDA 3KVQA 4KH2A 5IKCB 4DN3H 3FONA 5EZOH 1MCJA 5FUCE 5MEPB 1JRHH 4Y5VC 6FABL 5GGTL 3I3DA 3K4DA 3UBXB 2NXZC 4PRPD 4QF1A 5J13C 2AV1A 3C6LC 4LCWE 1V7ML 2EH7H 3HUJA 5EH1A 1J12A 4OQ1A 5JOFB 3GSQB 1E6OH 4XVJL 1LEGB 5A2IH 1MLCB 2FSEA 3WXVH 1GOFA 2WNGA 4M6OH 1JF1B 3I2CH 1S9VA 1OTSC 3HPLB 3SKOA 3CLFH 2FX9L 5L6YL 1P4BH 1TITA 4P5MB 3VH8A 4ZFFA 1Q9WB 2FX7L 3PP3K 3QUYB 1INQA 3O6MH 3SDAC 3EDDA 5CINL 3MLRL 5DD3L 4WFGE 1QVOB 2DLIA 2EKSA 1CICB 2MCPL 5C0RL 2IFFH 3MRPA 2F58L 4P9MH 1XF2A 2IAMC 1NGWA 4GRWH 5I18H 2DM3A 4O4YH 5BMFL 1BJ8A 3ULUE 2VZOA 1NAMA 1G7MA 4MJ6B 5GRWA 5LBSL 2BRRL 2X4OB 2ICWI 2XOTA 2FBJL 3D39E 3EJZD 3QHFH 5GSVA 4NO3B 5FYJH 2DL2A 1GRWA 2EDOA 2GTWB 4BYHA 1YEKH 2WWMD 2EIEA 4F2MB 2VDRH 2XY1A 1P84K 4G6JL 4MNGA 2GY5A 4Z0XA 4KPHL 5BZWA 5E2VH 3ARQA 3GUTB 5IJKC 4PJIB 1CCZA 1S5HA 2ADIB 3OPZH 4DGVL 3AUVA 4LASL 5J9PA 2R2EA 3FO1A 4JEGB 3VXNB 1DBAL 2NY2C 4FZ8H 5HVGB 3HPJB 3WSQH 5IMOB 5CIPA 1MCWM 3SJVE 5GRJH 4YZFE 1EGJH 1FL6A 5F6IB 4NKDA 3U0WL 3JWOC 2IQ9L 4NUJA 3MROA 5JXED 5GJSL 3INUH 1B4JL 4JZNB 4N5UA 3QUYC 2DJSA 1DL7H 4XI5C 5M95B 2BOCB 1FYTE 4HX1A 3ZDZE 3B2UD 3ARDB 3DX7B 1CICC 2NNAA 4FFWD 1T0PB 5B22A 2D03L 3QUZB 2VIRA 4FFZH 2J88H 4ODTL 4OKVB 4X4XB 1RZJL 4O2CA 2YPKB 3MC0A 5F7KC 1D6EA 4XAWH 5E8OB 1MI5E 5L8JB 5I1EL 3QEQD 3QUMB 2BX5A 3WHE1 4IRJB 5HTSA 4G8IB 2Q3ZA 1ZMYA 4XC3L 4KUZH 12E8L 1MREH 1RK1B 2EIBA 3KPNB 3D39A 4YX2H 5DMYA 4U0QB 1DQML 5ACZB 1QBMH 3CMOH 1XEDA 3E2HC 3O8XB 3MBED 3OAYK 1MFBH 3VRLF 4XVUD 2AW2A 4F37K 1TXKA 2ED9A 4U3HA 2PNDA 4NN7B 3GMOA 1SY6L 3U1SL 1KCKA 3HZMA 2X70B 5I1IH 2CKBL 3QDJE 1F6LL 2OZ4L 5EBMA 4FXKA 4XNYL 4TSBL 3NA4A 4P48A 4DQOL 4F7CB 1JUFA 3HR6A 4TTDD 5EUOE 1ZHNA 5IFAH 4Y5YA 1QHPA 4YQXL 4G9FD 3WIHA 1R3LA 5F6IC 3QUXA 3KDMA 1DVFD 1GC1C 2X9XA 2ERJB 4GW4A 5IHZB 4PY7B 3QFJB 3OGCB 2OTPA 3TYGH 4E0RB 4JPVL 5D7KE 1U3YA 1FYTA 1OD7A 3SDXF 3ARDC 4N0UE 4LIQH 5J11C 1BLNA 1EPFA 3HB3D 3OXRB 4MJIB 3RNQA 1YUHA 1Y0LA 3OKOA 1B4RA 2ZJSH 4LPXA 5DD5L 1MI5A 1CGUA 5ANME 1ZSDB 4IRJC 1UM6H 1QSFE 2GAZB 2W9DL 3PNWB 1PY4A 1J1OL 4MB3A 3TBWA 1QEWB 2HKHH 1YYLL 2IALB 3GMLA 3D18B 4GG8A 2ADJA 3RJDA 1E0OB 1YQ2A 1A14L 4WO4A 5DD6A 1TQCC 2YZ8A 4X4YA 4X6DE 5KVMC 3SGDI 1Q0XL 4NN7C 2VLKA 3DPBA 5IESH 1EXUA 1BZ7B 4K9EH 1GGIH 5TE4H 5HYIA 1NGQL 4X6FB 5FYKE 1G6VK 1I8MB 3W9DB 1J8HE 2R69L 1UQSB 5EUOA 4ONHB 5GZOC 4UQ3B 4CJ0A 4KU1A 3DV4B 4FQCH 4CBPA 1DR9A 3T3ME 1A5FL 3PDDA 4G6MH 5IW6B 2ERJC 2CUMA 3UTQB 7FABL 3TESA 1AY1L 4KZDL 3G6JE 1MY7A 2BP3A 4W70A 5I75C 5TPWH 1MFDL 2JE8A 1MNUL 1UCTA 3MLZL 2BNQE 3HMXL 4ZSOE 1R24B 3I75A 4N0UA 4BJLA 4YR6B 3QR2A 2EYSB 5IB3A 1CD9B 1JNHB 4U1HA 1TTUA 2UY7A 4PP2A 1QLEH 1FPTL 4LHUB 4RISL 3VFGL 4BFIA 5IEHB 3HC0B 1G9MC 1E28B 1JGLH 1GGUA 1T80A 4EIGB 4X4ME 3VGEA 1QSFA 4BZ2L 4PFEA 3MRKA 4YEEA 3OHXB 2CDGB 4TVPL 5CUSL 3RY5A 2AXFA 1DQDH 2A0LD 3LEYL 3N1MC 5F9WB 2NY4D 1LDPL 3U7YH 4PLNC 4OZGE 5C0BA 2DKMA 4N9OB 2Y1VA 1AXTH 3NFNA 1REIA 3K74B 4X6DA 4MCYA 4OD1L 1XGUA 4LEOA 5EBWB 1ZLVK 3T0EE 4KKCD 5JZ7C 2B4CL 1BVLA 4RZCA 5E2TL 2YD1A 5CZVL 5C7XH 2BNUB 1I9EA 1JGVL 4XVSL 1CR9L 3CXDH 2NZIA 3KLDA 4G8FB 4K3EL 3L9RB 3QI9B 3DGGA 4X6CF 1ZTXH 2CUIA 1FFRA 3NIDF 5FHAH 4IMKA 1B90A 1T89C 2VDOH 3P30L 2HFFB 4ALAH 1PY9A 4P2OD 2EDXA 1GAFH 4QY8B 1TQBB 1HSAA 4G3YL 4FZEL 2RCSL 1C1EL 3SEPA 3OKMA 1CLCA 3ZTJG 2BNQA 4E5XB 3GJFH 5FM5M 1BJMA 3IXTA 1KYOK 4Q58C 2EDLA 2CRZA 4WFHE 4LGPB 4Q6IC 4HSQA 3PWUB 3QJHB 1WCBA 3DROB 3K0WA 4P5TB 4XCNA 1UXSA 2O5YL 3G04B 3NPSB 3MV01 1B88A 1CFVH 4H88H 4QHKI 4XNUH 4ZXBD 2DLFH 3WXWL 5C0CB 4BUGA 2R0ZH 5GIRB 1G84A 4ZUUB 4QYOB 3O3AA 4HS6A 4DVBB 3WKNA 4HGWA 4XWGL 3W2DH 2R2CA 3RVWC 2ICWB 4YDIL 3QQ3A 4D8PA 1XCQB 2DJUA 3OAZH 5J8OA 5F1NA 1YNLL 4N1EA 1U95A 2A83A 1P9MC 5FYLL 2CIIA 25C8L 5C6TH 3MUGB 3OB0H 1RZGB 3G5ZB 3GNMH 5EIQA 4UOJA 3WEXB 3JTTB 2UZIH 5LGJA 1NL0L 3MRFA 4NT6B 3MZTA 5E5UB 1FO0H 3IDGA 4YLQT 4W4OA 1TQBC 1S7QB 3AU1A 2OI9B 5IWLA 5KSAA 2XWBB 4O58L 3ES6A 3TWCL 3IDJA 2APXA 1MVUB 2ATPA 2FGZA 1WC7A 5F8RC 4PJ9A 1N8ZB 3VGDA 1OB1A 2LV4A 3EFDH 3DYPA 1C5BL 4L4VD 4P5TC 5J1SC 3NPSC 3B6SA 1ETZB 1HI6B 4NQED 5DWUL 4CU6A 1BX2A 5HVHC 2EE3A 3KPOA 1MPAL 4MXWH 4G8EA 4P57A 4K07A 3BP4B 1JE6A 1A7NL 2QL1A 5C0AB 3KJ6L 4QRUB 3RWJA 1NFIA 4L5FH 3GSWB 2XIDA 3E8UL 2V2WB 3SE3A 2AKRB 1QLRB 5DF0A 3ARED 4EQ2A 3V52H 5DUBA 5I1LA 4Y4KB 4WNQA 2Q20A 1AGBB 3VI4F 4PJXB 4QKXB 4H8WL 3PGFL 4OLVH 4J7RA 1MAKA 2VXTL 5IB2A 2COQA 1LEKB 5F1IB 4F7MB 2N7AA 1X5LA 3OF6A 4OZIE 5GRVL 4Z78B 1HK6A 3RWFA 1G7IA 5DRNB 5ILTL 3O3EA 2Q6WB 4JN1H 5C09D 3UDWC 2VLLA 3CFDB 4CN4A 1X5HA 1XGYL 1MIMH 2JJUA 1TJGH 5SWZB 5JIHA 4V2BA 1I7UA 1XF5B 2OI9C 2VXUH 2PR4L 2CDEB 3BUYB 2GK2A 1MCKA 1V5JA 3KNBB 4L4TE 4MXVF 5F88B 4B50A 2HT2C 4WY7L 1EO8L 3IFPB 2ZOLA 4F37F 1OAUH 4WTWA 4P46B 2ADGB 5DHYA 1QRNB 1MJJB 3QUKA 4M7ZB 3FZUC 5I0DA 3IJYA 3NGBB 3D0LB 5KG9B 4XHJD 5ISZB 5C0NC 4XBEH 1NC4B 1X5KA 2DYPD 1I7ZA 2CMRH 1FIGH 2ID5A 3QXTA 4HQQH 5C9JA 3KYMA 3VFRA 2FB4L 3EYOB 3GBNL 1A47A 1I1FB 1S9WA 1I8KB 4K8RC 4D3CH 4JQIL 4Y4KC 5C08A 4XVTL 3CDCA 1XR8B 4WENB 2Y7QB 4PREA 4ZOCA 5T3XH 2WBJB 1DEEA 1MF2H 4HZLB 4N9GB 3TN0A 2JCCB 4Z77B 4RGND 4B41A 4MB4A 3MJ9A 1ZLWK 2NR6C 2QSTA 4J8RA 5JLZB 4C83B 4IOIB 4LP5A 4E42A 3ILQD 3FL7A 4OLUL 4JO1H 5IMMB 3W81A 3HE6C 1WFOA 1ES0B 1KJMA 2B5IB 4PBXA 1NFDB 1UACH 3MQIA 5JIIA 3VFPA 5BVJA 2W65B 4P46C 3ARBB 2HG5B 4M7ZC 4Q9RH 1W8OA 4LCIL 3NGBC 5KSUA 2BSSB 2IPTL 4NHCL 1NCTA 4QXWA 2PETA 3PWLA 4S10A 4LLVB 3BXNB 1A4KB 4FQIH 1VKXA 3PP4H 3QPQC 3P0YL 1IM9A 4ZO7A 3MX0A 1S8DA 3RDTA 5CEXB 4HF5H 5SWQB 5GISL 3BPLB 3F65A 1F42A 3QXVA 4PJCB 4LKCA 4OAWA 2HN7A 2AJVH 1J18A 4UIKH 4KK8C 3V4VH 4LDLB 1EVUA 1JGUH 2XFXB 4X9BA 3DRQA 2WBJC 5D5MB 4UNUA 4X98B 5HVFB 4K7PL 5IOPA 2R0WH 2OK0L 4JFDD 2P8MA 5K33A 4S1QH 1NJ9A 3FAXA 4F15C 5DURD 5HPMA 3BP5B 3FHQA 2EZ0C 2F53B 4L8BA 2SEBB 1S9YA 4S1DD 5E94B 5JO5A 1F4WH 5BW7A 2EE6A 1NKOA 4V1DA 5CGYD 5EO9A 3LPGA 2IANB 4OCNC 4Y4FB 1JF5A 2FCBA 2KZ1B 2E7BA 2G9HA 4PJGE 1CI5A 1VADB 2PYFB 3X3GH 1R3JB 3W11C 1WZMA 2WIIA 4EZMA 3VXMB 3ARBC 2CIKA 4RAHA 4XXCC 4DN4L 1J0JA 2NY1D 4M48L 3L7FA 3V7MA 1N5YH 5HHXH 3IRPX 5E08H 3VU2A 4H25A 3QIUA 1IGYB 5D1QD 2PYED 1VA9A 2VNCA 3JV5A 1TTFA 1I1YA 2P7TA 3Q6FB 4NBYB 3LB6D 1NC2B 4HBCL 3BPLC 3ZE0F 1DN0A 3DIFB 4IDJL 4UDTA 3V5HA 1RIUL 1D3CA 3K46A 1CD0A 1Z3GL 2EXYC 2AP2A 3SOBL 1IZKA 4XT1C 1OW0C 4O5LL 1D5MB 1T83A 1MFCH 1RULH 3QG7H 3TVMB 5ERWB 3A67L 1FHGA 5E00B 4Y4HD 4F80A 43CAB 4PUBH 1FZKA 2H32B 5C3LD 3K7UA 1EZVX 4AENB 3UEZA 4DVRH 2ZPKH 4MX7A 4ESKA 4PRIA 4HKZB 2PXYD 2XWJA 1KF9B 4LRIA 5CJXA 4Y4FC 3RRQA 2WBWB 2A6IA 4JFQA 5HYJE 5IMLA 4WJ5B 1MFAL 3ILPB 3KR3H 3MNZB 1Z5LB 4WEBH 4PJGA 1C08B 1NFDF 3UBXG 5C0EA 4ZQKA 3O4LE 2AXJA 1C7SA 1MCRA 2MJWA 1RU9L 4YK4C 5CSZA 5T1LB 4ORGA 3TBYA 4Z7NF 4MQXC 1SM3H 1JPFB 3HAEH 1KCVL 3V6OA 1QFWL 4I3RH 4IMKC 4N1HB 1C12A 2Z8VC 4QO1A 5I8CB 1NQBA 1VGKA 1CU4L 2JLLA 1FCCA 2OYPA 3VXOB 5D1ZD 3ZKSD 2NZ9C 3QCTL 2PF6A 2AJ3A 2AEWA 2ZKHH 2LU4A 3U0TA 4PJBB 4PJCF 3CSYA 2YBRA 1KIQA 1ZV5A 3MFFA 1R0AH 3HZKA 5DHXB 1RSFA 2YK1H 1A21A 4AYFA 3PL6A 3TVMC 1RZ7H 4PJFE 1N3NA 4JCMA 2ICCA 1MH5B 5D5MF 5E5RB 4NKQB 3ALXA 2O5XH 2XZCH 3F7QA 3CFBA 1DE4A 3GSRB 3QRFM 1KIPB 4ZUVB 1MJUL 4PRPA 1INEL 3FOLB 1BIIB 4JKPH 2N56A 3BZ4B 1T5XA 2P48B 3Q6GH 4LEXL 4OTXL 5HYJA 4HLZH 1YECL 1L7IH 4R4ND 2XKNA 3UTSE 4PBWD 3LHPL 4DOHB 1NAML 4ZUSB 5D7LB 1MCOH 4LBEB 3QXAA 5KW9L 1UB5B 1F4AA 4PJDA 2AJSH 3MLVL 4MHHI 2Z92A 1KLFA 4Q0XL 1G7QA 4LRNL 4MNQB 4NO2B 3CDGA 1OQOA 2DQGL 1OQXA 3B8SA 2A6KB 1K4DB 1T3FA 3LRSA 4YHLL 1JHKH 3L7EA 2NY6C 1XZ0A 3X13A 1WIUA 3VRLE 4MAYA 5HDQH 3O2DA 4ERSH 4DZ8B 1CXLA 1A3LL 4HJ0D 4NO0B 5F96H 1R3IL 4JVPA 3CZFA 1RZKH 2QQLL 4GSDL 3V5KB 3BP7A 3GIZL 5I1HL 5DJDB 5L2KD 3U30B 4PJFA 4BFGA 4FQXB 4RIRA 5HGDA 2BERA 2HVJB 3QO1A 1N5AB 1U36A 2CXGA 1KB5B 3I02A 1I85C 5MHSD 4PP1C 1QFHA 4JGMA 2VN4A 3AS3A 4GAYB 1A7PL 4J4PC 3VWKA 3FHAA 1LE9A 1F4XH 3FFDB 5KANI 1A1OA 5HHOB 4W6YB 1AR2A 4LVEA 1G6RA 3V0WL 4Y16A 2H8PA 1IGTB 1R3HA 2IJ0C 3LY6A 1RIVH 3FB8A 5ACLA 5KOMC 1M7IB 3HI6H 1CIUA 3N9GH 2VOTA 1GZPA 1A9EB 4HW6A 3TFKD 1HKLH 5FGSA 1KIRA 3VFNB 4WU7A 3EFFB 3PHOA 1L6ZA 1UXWB 2O26U 1T1WA 4ZAKB 2W38A 1FZOB 2ZG1A 4NQVA 3SKNB 3S88H 1M71A 1CLYL 4FG6D 5EDXA 3GMQA 2HT4C 2FRGP 3TBVA 1FC2D 4JLRB 4YXKH 3WFEH 1KFAH 2ED8A 4HUWB 1FVEA 3PF2A 3IFNH 4GRLB 3U30C 1P4LB 4X5XB 4PJIE 3WIHL 1LGVA 3KPSB 3QIWD 4OGXL 1G7JA 3FB7B 1PG7W 1T20B 5IV2B 3VGFA 1EFXD 1AD0A 5M94B 2R56L 4U1GC 3AY4A 4KRPD 4NDMB 2C4FU 3KPRD 3JUZA 5KVEH 1JI2A 1F13A 4XP9H 4YNYB 1DSFL 3LKOB 1FFQA 1P4IL 3C5ZD 3DXAB 3MV11 1LD9A 4MDJB 1IT9H 5DEZA 2V2TB 3MV7B 1IFHL 4TUKL 3TN0C 1DVFA 2XZQL 2GJZA 3ZSSA 3OGOE 4OB5L 5F3BB 3T77B 4MDIA 3ZDXE 2DQEH 4B53A 2MKLC 1I7RA 4R4FL 4R8WH 1ZAGA 1Q1JL 2V9QA 3EO1B 3WUWB 4GQ9H 3RPIA 3VD3A 3VXSD 2J8HA 4MJ6A 5LCVL 1WFTA 2W9EH 4NQSA 1CQYA 3HKFA 1FFOB 1HH6A 1JK8B 3ZL4H 2W0KA 2DMBA 4WWID 3Q5OA 2NYYC 3UO1L 1GYAA 1KPUA 1CGYA 1KELH 4GRLC 5IMKB 2EC8A 2VZ3A 4EOWH 1BHGA 2GSIB 1CXIA 3RWHB 4J3SA 3S34H 3ARFA 3HFMH 1VSCA 5EULV 5I74B 5GS0D 4G43B 2J5LB 5DMIH 3O6FD 2X05A 2JELL 4N8VB 5IMOA 1SBBA 4NQCE 4KTDL 1W72B 4NFBA 4NKMA 3AFLA 4OF7A 3QFJE 4PJ8C 3GKWL 1IMHC 5I16B 3HR5B 4ZS7H 3DUUB 3QCUH 1UT9A 2BOCA 4LLWA 3A0OA 3O9WD 3PDGA 3IT8D 3WNPA 3VFMA 4PRAB 2G75B 4NWUL 2XRAH 4GH7B 4MJIE 2NX5E 3ZE2F 4W4NA 3QUZA 1TIUA 4LSTH 2DQUH 4FNLL 4PJHB 2YPKA 4JY5L 2J8UA 5E8OA 2OSLB 2DQCH 2ADFH 5C0IB 5FCUH 1NKRA 3S7GA 4G8IA 3LKQA 1Q9LA 1CF8H 5DRXB 4FQQA 4HXBL 4RA0C 1F4YH 5F1SA 3O8XA 5B38B 1KEGH 4KRMB 4JDTH 2ICES 2R1WB 4M5ZL 3T2PA 3OJVC 1UJ3A 4X99A 4KROC 1DDHA 1MCPH 4IRSD 4R6UA 2Z93B 1H8NA 5I74C 2J5LC 4FTVD 1KJ3H 5K59E 4JJ5B 2C3HA 3TP4A 1FL3B 4NOBA 4DAGH 5BCAA 4NQCA 1T83C 4KFZC 4ONOA 1O0VA 3CD4A 1A1MA 5IHZA 4AH2B 4D94A 4NZUH 3S4SA 3QFJA 3SKJL 2HFTA 4W6XB 1IC5H 2D7PA 3F7YB 5IBUG 3QA3B 5D93B 3BO8B 4M93B 1ZVHA 3NCCB 3DSNA 5FXCH 4Q9QL 4PY8I 2UYLA 1ZVSA 2HFGH 3HE7D 2NX5A 5GGTH 3V95A 3VXQB 5I1GL 4Z76A 5CBAA 3MNWA 4JKLA 4HKBB 4P4RA 1EEZA 1C5DB 4OCXL 3IDIB 1T2QL 3M1BA 1JMXA 1ZSDA 3QO0A 5INCA 3C9NA 3X11A 4XVJH 1EIBA 1Z9OA 5BZDB 4XMLL 3BIAX 1DBKH 1NPUA 5HHQA 1NAKL 3D18A 3MGTA 4PV9A 3V6OC 4R26H 4MVBC 2FX9H 1BVZA 4YFEA 3MV9A 4YDKH 5TFSH 1NCWL 4ODVL 4J3VA 3QXDA 1WLHA 3VI4E 4EUPH 3MLRH 5DD3H 1BZ7A 2R2BA 4UOW1 5C0RH 4PRBA 2PCPB 2F58H 3UROR 4Z7UB 2IQAA 3AAZA 1ZOXA 4M6NL 1I8MA 2AABH 4OLYL 4R0LB 1UQSA 3SQOL 5ADPL 1WCQA 3QDGD 5LBSH 3WFCL 3DV4A 1IAIL 1NANH 5IGXL 3UTOA 5K93A 2FBJH 3R8QA 3UTQA 1CGWA 1Q72L 3D69B 2EE9A 2DKUA 3F5WA 5TDPA 5F7HA 1JV5B 1NGPL 5D93C 2ZUTA 4XH2B 4M93C 3K2UL 5ESAA 1EAPA 1ZANL 2YXMA 5DJZB 4JANB 4KPHH 1ZGLB 4GBXB 2EYSA 4RMQA 5IF0B 1CFTA 3SDCB 4DGVH 4LASH 4O2FB 4WVRA 1CE6A 1DBAH 5IEHA 2DLEA 3QXUA 1QBBA 4PJHF 4Y8AA 5C0CE 5TQ0H 1AKJD 4MCZA 2X44D 2MCG1 2AJXL 1OTTD 3RI5F 2CDGA 2BVEA 1K9TA 1IGFL 3HI5L 4NQEA 4XBPB 3U0WH 4Z5RB 1KACB 2YSSA 5HY9B 4I2XB 1UG9A 4HFUL 5GJSH 3GMNB 1M7DB 3PWVB 1LILA 5FO8B 3HZYB 4AK1A 2J6EA 3QPXL 5ADOL 1TFHA 1AJ7H 5DXWA 4CMHB 2AERT 3E0GA 4NQDB 3CX5K 2X4RB 3SGKA 2GK0B 3LZFL 3CFKA 3RZCA 1ULVA 3G5XA 4ODTH 1ZLSL 3QEQB 2R8SL 3MRBB 4R0LC 4KKBD 5GGUA 1CBVL 1HQRA 3QI9A 2KZWA 3EJZC 3MV8D 4GAGL 4XRCB 5BQ7B 4KKAD 1EDQA 1KJ2B 2I60H 3GSXB 4EDXB 5HI4C 2AI0L 2VN7A 2WWMC 2RJMA 4PG9B 1DQMH 1HHJA 4KMTL 1OGTB 4YDVA 3DETC 3T09A 1LO4L 4UDUB 3QNZA 5I1KL 4GBXC 5K9KB 1F58L 1MWAA 3BGFC 3U1SH 5FUZH 3MUJA 2OZ4H 3X12B 5FO7B 2H45A 4TSBH 3DROA 4TNWF 1MFNA 3MNVB 3G04A 5C0DB 2Q8BL 4G9FB 4ZO6A 4H0HB 4OZFB 4YQXH 3RVXD 3LS4L 5JXEC 1KNOA 5JW5B 1YJDC 2R1YA 2DYPA 3KLAA 5C0AE 4OF8A 5CGMA 3B2UC 3GIVB 3KPPB 4JPVH 3PWJA 4FFWC 3MJ9L 4UTBH 1LDSA 1R5VB 5E2WH 4PJXE 5DA4A 4MXQD 5J7CC 4TSAL 4K3HA 1UH2A 4Z7UF 4JY6A 2Y23A 4GW5A 4IOSD 5DD5H 4U1SA 3O45B 3VE0B 1NBZB 3JTTA 3MREA 3VD4A 1N4XL 5E1AB 3UPRB 1J1OH 4NT6A 3MTRA 4WWKB 3MBEC 5SWZE 4XVUC 5EB9A 4PJ5E 1T66D 1CTOA 3OKLB 4XXDB 1QSED 1KLUB 1RPQA 4ZFOB 1MVUA 1QRNE 1WBZB 3REVB 3JV4A 5HGBA 3WLBB 1NGQH 3LV3A 4TTDC 1N6VA 4Y19B 5DK0A 3BD5A 3WFBL 2G5BA 5ISZE 1ETZA 5EFIB 4A6YA 2ZNWA 1A5FH 4JVWA 4DKFL 2K9UA 1AY1H 3BWUC 4KZDH 3H9SD 5KVDL 1FIEA 4LLDA 1MFDH 5D96B 2ZCHL 2F74A 3CXHJ 1X5IA 2RBLA 5HI5D 3HB3C 3MLZH 3HMXH 3SDYL 3V0AC 2D7TL 2JK5B 5HHME 4NC1C 5DQDH 4BM7A 4YFDB 4F8QA 4OUUB 1U8KB 1FPTH 2JCCE 3D5OF 3P9MB 1LEKA 3VFGH 4XAKD 1BJ1H 4I18A 1JYXA 1F6AA 4TVPH 2CLRA 5CUSH 2NY4B 4RBPK 1MCEA 3F6LA 3LEYH 3OJMB 4NC2B 3IAQA 2CDEA 3QH3B 4PJ5A 1FVCA 1LDPH 4W6WB 5E5MA 3ARVA 1CD1A 2YUZA 4QXUL 4WUUD 5T5FH 1HXYA 3ECBA 3PHQB 4U33A 4OD1H 3EDKA 3IFLH 2IPKB 1QRNA 4NZRL 5E2TH 2AJZB 4X0KB 4N0CC 5CZVH 5DZLA 3E3QC 3RPKA 1F3JA 1JGVH 4XVSH 1MUJB 3TT3H 5ISZA 4KJPD 2APFA 4LPYA 2APVA 4LOUD 1FG2A 4Z6AT 3I6GA 4K71C 4NCDA 4HUKB 1ZXQA 4PJCE 5DGQA 3OX8A 3MMEB 2WUCH 5D96C 4F7TA 1SJVA 1RUAL 3AS2A 4FZEH 1S7SB 2RCSH 1C1EH 1I8KA 5E8PB 2E7LA 4YDJA 2AK4A 4BSWA 5E8EB 3W0WD 3DRTA 1BJ1J 4YHKH 3S5LG 5F7UA 1N64H 5E8DL 1U41A 1FZJA 4ZXBB 3BEWA 1FGNH 1OAZL 1JNLL 4P5KB 1ZLUK 3WDJA 3X14A 1PZ5A 5IW1B 3IXAB 3Q5TA 4K7PX 3LN4B 4Y4HA 5A16B 5HJ3B 4C83A 2F53E 2A0LC 1HNGA 3IU4H 3BVNB 2BXZA 3ELAT 2NY4C 4HFWA 4XMPL 5F7FA 3VFSB 1QHOA 2IANE 3EHBD 1I1AB 3RAJH 4WI9A 1DQJB 1ONQA 3OKDA 2PXYA 1URLA 2AEIT 4Y7MA 3T1FB 2PO6D 4XPGL 4KKCC 3GBML 3VXME 5A3ID 2YN3A 3TLRA 1EUTA 5B39A 5GRUL 2P8LA 25C8H 4B0MM 1OM3L 3K8LA 1AO7A 1NCUA 2E27H 3M8OH 3QWQB 2KL6A 1S9XB 4Y89A 1VENA 3NFSH 4R9HA 4P2OC 5E6ID 4N0FA 1YNTB 2VLMD 3MLYL 3QEUA 2XPGA 5D1ZA 2JF1A 1T7WA 1AIFA 4D9RD 1UZ6F 4NM4L 4D2NA 4C57C 3C08H 4GKOA 2LAGB 1SYSA 4LCCB 1EEYB 4O58H 1ZA3B 2VDPH 2VLRD 4N0YL 4BZ1L 5FO9B 1HQ4A 3EYVA 2FX8L 5HD8D 3BRGC 4RSVA 4Z7WA 3U4BL 1CVRA 4L4VB 3S8WA 2X4QB 4ZXBC 5FF6A 1M05B 2JJTC 1C5BH 1UCBH 1Z0MA 3RWCA 5T5NG 3SE4C 3PDOB 4Y1AD 1LEIA 5HDBE 3EGSA 2VH5L 2SEBA 2AGJL 1WICA 1FLRL 5A40E 1I1AC 4RCAA 4YWGL 1A7NH 3KJ6H 1GGCH 3I6LD 3AREB 3E8UH 4F57L 4OCYL 4HH9A 5F8QC 1S7XB 3I6KB 2PKDA 2GYSA 1CFSB 2VWEC 3I50L 4WW2A 4RAVA 3EDEA 3DX8A 3UP1A 3PGFH 1I8LA 3L3HA 2WP3O 4WW1A 1QBAA 3B3IB 1A4JA 5EU5B 3G6DL 2Z4QB 1JYNA 5KTEL 2HTLC 1BREA 3O2DL 5C71A 3VFOA 3ARRA 1XGRA 3F7RA 5EWIL 4GLRH 3BH8B 5ILTH 4HUUA 1JWMB 2K3TA 1XGYH 3HN3A 4PJBE 1YEHL 1BD2B 2YOCA 5C92A 2EYRA 4LCCC 4D9QD 4WY7H 1EO8H 2Q86A 2DICA 4Y5XB 5ICYB 5IW3A 4EI5A 2EEDA 3TYFB 1CE1L 4PTUA 5ERWA 4M1CC 5IT2L 4GKNB 3D2UD 4APQD 3DVNA 4D9LL 3CVIH 43CAA 5T1DL 1U8JB 2GUOA 5I71B 1G6RL 1IC7L 5DRWB 4RX4D 4O2EA 1GC1H 2EC9U 2JIXA 2FB4H 5D6DA 3AREC 2FJHB 4HMCA 4JQIH 2IBZX 3NAAL 4DOHE 2VB5A 3QG6B 4DEPB 1D5IL 5D7LE 2XQYG 1Y18B 1JPFA 1H3VA 1T22A 3PWNB 5J1AB 1B0GB 5FA3B 4TNVK 4XGZA 3KLHD 3GSOB 4PRDB 4MNQE 3JTSB 3S5LA 3NPZB 2OL3H 5DRZB 2YWYA 2Q8AL 4OLUH 4HIEB 1KN2L 1UZ8B 3CH8A 4PJBA 4HJGA 2FEEI 2P5ED 1PSKL 3FOMB 4Y5XC 4Z7VB 1HOCB 2AQ2A 4NPYA 5AUMA 1NEZA 5AWNL 3KPQB 2BFVL 3EOBA 4XHJC 5F3HA 2IPTH 3VDAA 4WHYG 4GRWB 1EH9A 1J05A 1D5ZA 1B2WH 5JA8B 1A6WL 5I17A 3T4YB 4Y2DD 3P0YH 4H0GA 2HLAA 5DUMH 5IROC 3FOLA 4NO5A 5KS9F 4R7DA 3SDDA 1PKQA 4QOKB 5FGCB 5HHOE 1I4FB 4CU7A 1I3GL 4NP4H 4XP4H 4DEPC 3FO9B 1IEBA 4DGYL 5TF0A 4ZUSA 4N8VG 3G6AB 1UB5A 1J1PH 4JFDB 4YBLB 4K7PH 2PTUA 4H1LH 2YD3A 2OK0H 3ILQC 4POUB 1FN4B 3PGDB 5F7LB 4YFLF 4RMUA 4MNQA 5IJVA 2RR3A 3DVIA 3H3KA 5FEBA 5FYJU 3MXWH 2OJEB 1BWWA 2RAMA 1QFUL 2M26A 4RA3A 5KN5B 3PP3H 4JRXD 3UTZB 4J6RH 1JL8A 5DJDA 4P59H 4PJEE 3H7BB 3B9DA 4FQXA 4RAUA 4M48H 3KPSE 1DUYA 3KYKL 1S3KL 3OR7B 3MLTB 5D1QB 2PYEB 2P42B 4URTB 4X9GA 2VXSH 3WKMH 3CCHB 5B38G 3MA9L 1V3JA 4WFFE 5AZEH 4GAYA 1A22B 1JGDB 3DXAE 3P0GB 2X89D 8CGTA 1KTLB 5LGHH 2Y5EA 3MV7E 2XA3A 4HPYL 3SOBH 3O6LH 4O5LH 5FB8A 3QUML 1IGTA 1WITA 3L95A 1PEZA 4PGBB 2V6HA 4YBLC 3O9WA 1A9EA 1HILB 2VJXA 3SBWA 3UMTA 4S1DC 1VEMA 2MFNA 2MPAH 3VRJB 2C1PB 3M45A 4Z9KB 1J88A 1UXWA 4LGRB 3D3VD 4XCCL 2ITCB 3WE6A 4ZAKA 1FZOA 1ND0A 3NCMA 1A0QL 4PB9L 1MFAH 1NSNL 2ZSWA 4XMKL 2ED7A 4HUWA 2ESVB 4YHNB 2NY1C 5F93C 1JTOA 4MHHG 1DUZA 1P2CB 1P4LA 2RFXB 4F33B 4PJEA 1KCVH 1QFWH 2VL5B 3N85H 1IILE 3FB7A 1T20A 2Z0BA 4JQXC 5D1QC 1F00I 1YQVL 3LB6C 4IRSA 4CVZA 4LARL 5IB1A 4U1IB 3MRIB 3QCTH 3F12B 1P84J 4YNYA 4LF3B 3L3GB 1N0XL 1H3XA 2QEJA 3OAYH 1U8NA 3JV0A 3ZYOA 4U7KA 1S78D 2X40A 4Q2ZB 5E9DD 5I8EA 2E7HA 1WF5A 2BSRA 3BWAB 1ORSA 3BZFA 1P7QA 4QXTA 4RWYL 1SEBA 3ZHDA 5JPNB 2C1OA 4WV1B 1L9NA 3TBTB 1SVCP 3EO1A 4HHAB 2HVKA 2MTPA 4FQHB 5BJTB 5KANG 3D25A 5DQ9B 3VXUB 3P4NB 3QDMD 2W92A 4C4KO 3BHBA 3W5NA 2ENSA 4TULL 1U93B 1YECH 1RZIB 4TOYH 3LKRA 4H26A 2XN9E 3LHPH 1HHHB 1NAMH 3WLWC 3OXSA 1CFQB 5D1XD 2FJFA 4M61B 3RWHA 1LK3H 3A6CL 5TQ2L 2BNRD 3MLVH 3BQUD 4XZUA 3OKNA 3W39B 5AG9A 2X4PA 4Q0XH 4WI5A 3Q0HA 4LRNH 5FGBC 3BRFA 2DQGH 1A6PA 2YUVA 3LKPA 3MSPA 4MAUH 4YHLH 5FUOL 5ID0B 2IF7A 4Z95L 1BAFH 3QDGA 1H8OA 4TVPD 4M7LT 5DZOA 4QHNB 3RUGB 3T3PE 1A3LH 5L2KB 4HUXB 3RNKB 4GMSH 1R3IH 4YHYB 2QQLH 4GSDH 4K9EC 1Q9KB 3GIZH 5I1HH 1CDHA 3ALWA 3BEVA 4L9DA 1AC6A 1FC1A 4WV1C 4BH7B 2A77L 3U36A 3IJHA 1JZ3A 2BCKB 5DFVD 2L7JA 3IGAA 2MQ0A 4LSPL 5DJ8A 1A7PH 3TJEH 1BBJB 1U8OB 4R4NC 5D6CA 2CO6B 3P9LA 3PJSA 3BMVA 1SJHA 3EYFB 4P99A 4K8RH 1NMCB 4K23L 4XNZB 5IVXB 2XN9A 2C7UA 3HS0B 5LQBL 5T3ZE 3GJFB 2IH3B 2XQYK 4OZFG 5IBLD 5H37H 3U7AA 1R5WA 2QHLA 1NCBL 5E70A 3GSUB 2XKUA 4BSVA 1NGYB 1L6XA 3NMEA 4N8CH 1SEQL 2DIBA 3CFEA 1S7UB 5I1CL 3P11L 2ORBL 1JPGB 4YHIA 4QRPE 3JSSA 5LGKA 3IDNB 1JPST 2Y5TA 3BN3B 3MYJB 1QOKA 1MWAL 2A73B 4YXLL 4AH2A 3MV8A 4HJ0C 1U8PA 1W0WA 2QSCL 2YD5A 4JFPB 4F7PA 3MRQB 3BO8A 1WBXA 3N06B 4YHYC 2VUYA 4P4KD 1ZLVH 3QIWB 1AE6L 1EFXB 2HYMA 2VLJD 5FYLD 4KRPB 4YBQD 3KPRB 5ALBL 3RWIA 1WFNA 5CSBA 2FZ3A 2GJJA 5EU7C 2BMKB 1U42A 1C5DA 1MJ8H 3VRIA 1YEIL 4NNPH 5D7SL 3FTGA 1AGDB 4HXAH 1FO0B 2GKIA 3KWWB 3IDMA 1P4IH 1BPVA 4Q97A 1UADC 3QEGL 3UJTH 4LSQL 1U8MA 4I2XE 3BD4A 1PQZB 1B6DA 1IFHH 1NMCC 3L3KB 3WNMA 2W0FB 4TUKH 1FNAA 4U7SA 3SO5A 5CZXD 5IBTH 3LKSA 3ROLB 3FQXB 5JXAH 3TFKC 1WVZA 4NQDE 1CDCA 4OF0A 4R4FH 4YDLB 5FIEA 1Q1JH 3VXSB 3VG0L 4AL8L 3AM8C 5KSBA 3O3BB 3RIFK 4QRPA 2YXFA 4JN2B 2FIKA 2J4WL 4FG6C 3BE1L 3IAPA 2R0LL 1M6OA 1YNKH 1TVBA 1F90L 3VA2C 1G9NH 3CAFA 4YPGA 3VFWB 1YDPA 2DTSA 3QIWC 2HJKA 4ZNCD 4A6YL 5IF0A 5AD0A 4KRPC 2FL5B 4O2FA 4GQPH 2GJ6A 3UZVB 4WIQA 1XR9A 4BSJA 2NY0D 1T1YB 4P2QD 8FABA 4JQVC 3C5ZC 3DX9A 4LNRB 2Q7NA 3BKYL 3V8CA 5ITFA 1KYOJ 4NSKB 3CMGA 5HY9A 2P24B 1M7DA 1U3ZA 3W82A 1FNEA 3BGMA 4BA8A 5H35A 1WEJH 1FH5H 2GFBA 5IVXF 1LP9B 2YMXH 3ZKXB 2ILLA 2JJSC 5HYQA 3C5JB 1FZMB 5DQJA 2AEQH 1EHLL 2FECL 4NWUH 2X4RA 3LS5L 4NC1E 4YDLC 2JB5L 4OCSL 1A64A 5IM7A 2VDKL 1FRGL 4XNQB 2VUOA 1CLZL 4JFEE 1UM5H 5H2BA 5E6ZA 5ID1A 1AXSA 2DDQL 4CDHA 3FN9A 3RWGB 5CILL 4KKNA 1OARL 4S2SA 2C3WA 1RMFH 1N59A 4HXBH 1TMCB 4HIJB 1I9IH 1F5WA 3LPFA 4QHMB 1VFOA 3DV6A 1U91A 1QSVA 1R3KA 3Q48A 4OM0H 3LEXA 4XB8A 3KJ4B 5GS0C 3U4EA 5JHDD 1WWBX 1DBBL 2BRQA 3O6FC 4Y19E 4XPTL 3EO9L 2DWDA 4CAGA 1O5DT 2JB6B 3S9DB 1QA9A 3DX6B 5CJOL 4YH6A 3L3JA 4MA3B 3DSFL 6CGTA 2OJZL 4U1JB 3ZO0A 4WUKH 5C8JA 1OGAD 2VERN 3MXVL 2G2RB 1OP5K 3O9WC 3SKJH 3KPPA 1B9ZA 2DD8H 3RWEB 3N1PC 3MLXL 5I2IB 3QRGL 3QIBD 3ZKXC 3HE7B 1R5VA 2BJML 3FQWB 1U8QA 3TT1L 4ZS6D 3EO0B 5I1GH 4UV4H 5MI0C 1QRKA 3RL1A 3RFZC 1LO3L 4ZTPL 4JFEA 1DANU 4BZYA 3JBG7 1NBZA 1MHHB 5F71A 4XMLH 1JGEB 4WWKA 1KCLA 1FGVH 3RA7L 4NHUA 1FDLL 3BAEL 1KN4H 3ABZA 4OCRL 1LMKA 4LAJH 3NA9L 3L3DA 4P3DA 1CIDA 3TA3D 1F11A 1JN6B 1ZHBB 1NCWH 4JRYD 4ODVH 4JY4B 3IS1X 4WFEE 2MQ3A 1KENL 1T1ZA 1FLTX 1HXMA 3DURA 4LSRL 4IRSC 4WI8A 2VMFA 3GMRB 2PO6A 3KJ4C 4KUCD 2OX5A 4FA8A 1G7PA 2ZSVA 2H41A 4M6NH 2F54D 5BRZD 2H2SD 3U4AA 1XGPA 2DQTL 1ZLWH 4NJ9L 3FFCD 1XF3B 2A9ML 5ADPH 3REWA 3WFCH 1IAIH 2FWOB 3IJSB 1D6VH 1D9KA 5F72S 1EA9C 1Q72H 4EN3D 3C87A 1KXVC 2BY2A 1NGPH 5T1KD 5HXMA 3K2UH 2X4TA 1ZANH 3HE7C 2A6DB 3RZWA 3ULVE 2VLRA 2QQNH 2KBGA 4M8QB 1M1SA 2F5BL 4PGCB 4CN1A 4JGJA 3D6GA 1AKJB 5D7JD 5JDSB 4HC1A 1WGOA 3BJ91 2VABA 5EU6D 3QT2A 2QQKL 2YC1A 5ESVA 3HG1D 1QO3A 5I8KL 1MCCA 1IGFH 4JFFE 3MRDB 4NJAL 3NN8B 4H5SA 3BH9B 3AMLA 4HFUH 4W68A 5C0JA 3QPXH 4L8CB 2D4FA 2HFEA 4IBLT 3VGHA 4I4WA 5GGSY 4DW2L 1X5GA 3DMMD 1WWWX 2IPKA 4HIHB 1Q0YL 4G7YL 1IM3A 3RY6C 3LZFH 1C5CH 2DF3A 2AJYL 2AJZA 4X0KA 3LQZB 1PYWB 2R8SH 3ZTNL 5DC4B 5JORA 1CD8A 1IAIM 3L5WB 4GAGH 2B7DT 5D72H 3C8KB 1HHIB 5CMAA 3VJ6B 3FRPG 4P9HL 2HLFD 2VKXA 5T1MA 3ULSA 2EO9A 4HV8B 1NDGB 4MSWA 2DQIL 5E8PA 4KAQL 3L6FA 5I1KH 4IMLA 2XI9A 3O0RL 2Z31D 4CVXB 2B1AH 3HAEB 4AQOA 1UWEL 2C3VA 1BQUA 3TV3L 4OCWH 3GSNA 4OF6A 4WI2A 2CRIA 5CP7A 1KB5H 3HNSL 1OTTC 1P1ZB 5CFHA 2Q8BH 5JUEL 2DJ4A 1TJIL 2D0GA 3PWPE 4XPHL 2EIZB 5GGVH 4F58L 2CQVA 1NGXA 4JFFA 1AD9B 1E27B 3ZE1E 3GI8L 4RQQA 4HPOH 3IU3B 5IVZA 4RX4A 4KGJA 4BKLB 3WFZA 5J57B 4BFBD 1IEAB 3B9KD 4OGZA 3ZTJH 4GJTB 2GY7B 4E41B 3ZKQD 3FJTA 3O3DB 3RGHA 5GGRY 3GMMA 4KKBC 4TSAH 3QNXB 2X4UB 1PW3A 4F9PA 4TPRH 1LO0H 3TPUA 5K9JL 5IEKB 5L2JA 4KKAC 4DZBB 1J0HA 2BK8A 5D7IE 3DJ9A 1ZA6A 2NTFA 1YNTA 4LQFL 2YEZA 3CZJA 1BD2E 2BVQB 32C2A 1P53A 1QSEB 4PJAB 1OOAA 2V2XB 3MOBL 4G80B 3JWDL 3PQYB 3KPLB 2OQJB 4NCC1 1AGEB 4J3XA 3IDUA 4M5YL 5TE7L 3WFBH 3RVXC 1YN6B 2VITB 5GS1B 3PWPA 1QR4A 4OSUL 2YD2A 4U6HB 4EQ3A 5CEZL 3BKMH 3QWOB 4DKFH 1XGTB 5GGSA 4MQTB 1CT8A 4MJ5A 5I66B 5FKPB 2D7OA 4JO4L 3N1FC 4OD2A 3S96A 1HEZA 4MXQC 1IKNA 1IGCL 5C9KA 1DN2A 4FFVD 1GZQA 3KPMB 5IQ7H 4YHML 5IK3B 1KLGA 4LSUL 3B3IA 2Z8RA 3TIEB 1NANI 2Q7YB 4P3CL 5C70A 5LWYL 5D7IA 1KPVA 2B8OT 4OF3A 3BH8A 1GJIA 4I3GA 4LLMA 1P7KB 4WUUB 4PGZA 1BD2A 4WFGD 4XPBL 5GPRA 5KSVA 1JTTA 4QXUH 3RTQA 4Z7VE 4WHTA 2AK1L 5BVPL 5JQ6L 1CG9B 4JRXA 3TYFA 3WUZA 3ULUD 2R0KL 3G9VA 4QRQA 1GCFA 4NZRH 3F6IA 3DUSA 4GRWE 1T03L 3D39D 3CDYA 5GS1C 1U8JA 5ESQB 4AEIL 4TQEH 1C16A 3WL9B 3S3PA 3D9AH 3GHBL 2DWEB 1SJEB 3K3QA 5CBEB 5FYJE 1OWRM 5LJYH 4QOKE 4FXGB 5GGRA 5HI5C 3W0WB 1Y6NR 2ZG3A 5C0FA 3U7WL 2D2OA 1E4KC 3QB7C 4XCYB 1TCRB 1TZIA 5M7QA 1A6AB 5KSBF 3A6BH 5D2NB 5HYFA 5DMKB 5DA0B 2D31A 3FRPA 1U3JA 2DOCA 4Y2OA 5FECA 2R2HA 3D87B 5IFJA 3SJVD 3QUXD 1OAZH 2X4SB 1JNLH 3IDYB 4L9LA 1B0GA 3G08A 2P5WB 5I73B 2HJLB 2WLYA 2I26N 4PRDA 3U48A 3OAUL 3VCLB 4OV6F 3EAKA 4OZHE 1NUFA 1FYTD 5F7DB 3J7HA 4XMPH 3ARWA 5HHNA 2EEAA 2H3NB 5I76B 1AGCA 2AAVA 4XPGH 1EJ6A 3U6RB 4MA7L 4JFXB 3GBMH 4JFOA 3V5DB 1SYVA 1MI5D 3NZHL 5KVFL 3DLQR 2YKLL 5KVGL 1QLFA 1OAXL 5SWSA 4KJPC 4LOUC 3HC3H 3H42H 3ZSTA 2PYEE 2QHRH 2V5YA 3KXFB 3IDXH 3LN5A 3T4YA 4WO4D 4HK3N 3QULA 5FKAA 3MLYH 2VISA 4QOKA 1X5JA 5MENB 5FOBB 3LSOA 3B9EA 5DJ2A 4LSSL 3EBAA 2GT9B 4N0YH 4QXGH 4BZ1H 4M8VA 2CDFA 5HYSB 3NIGE 1RIHL 4NRZB 4R3SB 4S0SD 1R5IA 1VACB 3E6HB 1N6QL 4Y1AB 2VXQL 3TO4B 5I73C 4HCRH 1N7MH 5BV7C 2VR9A 4LP4A 3BW9B 5FDWA 5CEYB 2VZVA 5L7XL 3EHBC 3VXRA 1QQDB 4OZHA 1LWRA 5D7KD 5DUPL 1TNMA 3CGTA 1FLRH 2HTKD 3P4OB 4YWGH 1FFPB 3IF1A 3SY0B 2ZCLL 1IQDB 5SX5K 5A3IC 4X80L 1SVZA 1T7ZA 4JR9L 3FQUB 2ESVE 1S9KC 3EJJX 3THML 4UT6H 3OB8A 1FORL 2MNUA 1HINH 4GMTL 1QSFD 3U9PL 4HWEH 3QHZL 3PABB 2PW2B 4HKJB 5D1XA 4Z18A 5E6IC 4UUJA 1HH9B 3Q1SL 1IKFL 5FAAA 5MP6L 1RUPL 4XCEA 5EN2B 5C86A 1K8DA 3S36L 5FOJA 4HWBA 3D0VA 3MRGB 5BOPA 1YEHH 3EIFA 5CHNA 1MLBB 5HD8C 2G5RA 1IARB 2F5AL 3OR6B 1L0YA 4JAMB 1A1NB 4P3WA 1TPXB 1J8HD 5MEQB 3D2UB 1CE1H 1A6TA 4APQB 1MCDA 3EOTH 2H9GA 1IZJA 3TIDB 1KCSL 5TH2B 4MD4B 1TZHA 3D85B 1FL5A 3ZYJA 1WBYB 1UB6A 3VWJB 4TUJB 4OCLC 4NNYB 3VXUE 3O11B 3GMPA 2BNQD 1QNZL 1XT5A 5INDA 3PV7A 2GTZA 5IQ9A 4X7SH 4HIIB 3P4LA 4ETQA 2VE6A 3O2VH 2V7HB 3NAAH 4JFYA 3TNNB 4IRZL 4PLJD 1D5IH 4CU8A 4F33A 4YAQA 3SQBA 3L1OH 3V4UH 1ACZA 5HVWA 4C56E 1A2YB 5I1AB 4QHLA 4RMSA 3OKKB 4U1IA 3CUPA 3KYAA 4LF3A 5J0BA 1NLDL 2FR4B 2NLJB 4AMKL 2ARJA 2P5EB 2OR7A 1BQHB 3T0ED 4I48B 3RUGE 1D7FA 3FO0L 1FNSL 5DJYB 5L8KB 1T0NB 5I30L 3Q3GA 1MCWW 4EUPB 3ESUF 3BWAA 1TPXC 2UWEA 3WDIA 4APQC 4OIAA 1MEXL 1G7LB 1YN7B 3ZKMD 3MGOA 4LK4A 4X7TA 3QYCA 4BK5A 2ZCKL 3TBTA 4Y2DB 5EOTB 1KGCD 3ARXA 4L3EA 4GG6B 2AV7B 1A6WH 2P49B 4OBSA 1U58B 5F89B 1XFPA 3VWJC 5KSAD 5T3ZL 4PIRF 2Y36L 4ZPVB 3VXUA 4M03A 1CZ8H 5F7NC 1P6AB 1RZIA 1KBGL 3VG9C 2E5EA 4PJ9D 5DVLA 5DVMA 3UYPA 3P40A 2BC4B 5IB5A 3PGCA 3I84A 1HHHA 4DGYH 1I9RH 4XB7A 3G5YA 5JA9A 3KLHC 3VXPA 5HHPB 2B0SL 3MRHB 4QCIB 4C56A 2Z35B 3VFUA 1BFOB 3WHXA 3GI9L 5K9OB 1YY9D 3VFTA 3C60A 4GXVH 4XNMA 5B8CB 5E8NA 3F8UB 4RGMB 2I5YL 3W9EB 1QFUH 4CNIB 4OFPA 4ZFZB 4XX1E 1MAML 4D0BA 1BVKB 1IAOA 1WAAA 3WFDL 3OF6D 4GKZB 4QRTB 1FYHB 3V6ZA 2UV3A 4G9DA 3KPRE 3KYKH 1UKTA 1S3KH 4Y2DC 4ODBD 4R90L 1JWSA 3O6KL 4YGVA 2E9JA 1KJVB 4K7FA 4IS6A 1AHWA 1CLOH 2BCKA 3U0PA 1LE5B 1VB9A 1FVDB 4DFHA 1JHTB 4OM1L 1J0KA 3HZVA 3PV6B 4DKAA 3JV6B 3H9HB 4YC2B 4HPYH 2Q76B 2QKIA 4IIQC 4P2RE 5D9SA 3HS0A 2A6JA 5FFLA 1MJ7L 1KJ2L 3I9GL 3QQ4B 2CKBB 3WJLC 5BS0E 1YY8B 5GJTL 3RVUD 1LO5A 2NW3A 2QADD 3EDFA 3MLWL 3QZWG 4UILH 4GW1A 4GLRI 4ODXB 4Z7OF 2ZUYA 4QWWD 3B2VL 1RZFH 3D3VB 5EG6C 1EBPA 3IDNA 1VFAB 3GO1H 5B8CC 3OKEB 2WMPA 1A0QH 4HLJA 3RGVA 1H3PL 1NSNH 1UA6L 1G1CA 1GOGA 5A1AA 4XC1L 4GKSB 5EIIA 4QHUB 4U3CA 1PLGL 1OL0A 2OTUB 4O02L 5DJ6B 4DCQB 1RK0B 1RZJC 4RGOH 2VZ1A 4NYLA 3S3JA 4ELMA 4HWZA 4JPWL 4U6TA 2YA2A 3T8XB 1NDMB 4Z7QE 1YMMA 4GG6F 1YEFL 4PGDA 1AGDA 3V0VB 5IP4A 1FO0A 3EZ8A 2D7MA 4JDVB 2W9LA 5DVNA 1NBYB 2AS5M 5J6GB 1N0XH 2PTTA 2DBLL 5E9DB 1ZT1A 4AJ0A 5BXFA 2W0FA