3T0XA

Fluorogen activating protein m8vla4(s55p) in complex with dimethylindole red
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
b'EPVLTQSPSVSGTPGQKVTIFCSGSSSNVEDNSVYWYQQFPGTTPKVLIYNDDRRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCLSWDDSLNGWVFGGGTKVTVLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin variable lambda domain M8VLA4(S55P)
publication title A variable light domain fluorogen activating protein homodimerizes to activate dimethylindole red.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dye-binding protein
total genus 22
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3t0xA00
1AGDB 5ITBL 2AS5M 1A7RH 4CDHA 2VH5H 4HX1A 4KZEL 3BQUC 3GMRB 1TFHA 1ITBB 1U3HA 1X6LA 4FHBD 3T77A 4NBZB 4MA1C 3ARZA 3MLRH 2YPVL 2YD9A 1IKNA 1P7KB 1UVQB 4P5TB 4Y4FB 2D0HA 4OZHB 4P4RA 5C8JA 5B4MC 5HGDA 1NGYA 5IVXA 5KOMC 4EI5B 4F33A 1KPRB 1WAAF 2NX5B 4HXAL 1A6TA 3H9SE 2BFVH 2VDPH 2IPUG 3HC0B 2W92A 4CUCA 3OX8B 3VD3A 1P9MC 2Q3AA 5B3JF 3BEWB 4HWBH 4X83A 2WSKA 5HHOB 4HXBL 5DFWH 3BQUB 5IV2A 5T3ZH 4LMQE 3R1GL 5C0AA 4MA3A 4MA1B 4KDTA 4P2RA 2Y1VA 4PG9B 2I25N 2HG5B 1MCFA 4X6CB 3V9FA 1GJIA 4Z5RB 5CIPB 3CCHA 2NYYC 1U42A 4MAUH 3IFPA 2DJUA 1P6FA 1BD2D 4N0FB 5JXED 1T0NA 1MRFL 1VFBB 2FIKB 4MMXC 5F6IC 3ROOB 3L5IA 2ZUQB 5CBAA 4PTUA 4KJQC 5MEOA 1C1EL 4FTVD 4JRYA 4EQ3A 5J6GB 4UINH 4Q9CA 1XH3B 3VA2C 2DIBA 4LP5A 3KJ6L 3BP7A 3DROA 5IGXL 3B9KC 5JUEL 3TV3H 3L1OL 4Q9RH 4P5MA 5DRWB 3EOBB 3O6FA 1MOEA 4WU5B 2C3GA 1CFQA 3FO2B 4G8FB 4M93C 5E2UL 1UQSA 3UTZB 1J8KA 2J2ZA 3KPMB 3OXRB 3VW3L 5CJBA 3CK0L 1PSKH 3T09A 5A43C 4OCLC 5JZ7D 4Z0XB 3D18B 5DJXB 1BFVL 1LEGB 2YRZA 5F6IB 2NR6C 4JFXB 4IMKA 1HWGB 3ALWA 2B1HL 3O45A 3RKDD 4YE4H 3LKNB 3IAGC 3LH2H 1KEGH 4OZGA 4PLJD 5IVOA 4G3YH 4KK9D 1H3PL 1EJ6A 1DBAL 1CD1B 3QUXD 4WWKA 4GLRI 2DLGA 2DM2A 1G6VK 4XP6H 5F7UA 3FTGA 3WD5L 2J8UF 2BSTA 1JFQH 2C7UA 3SCMC 1DBML 1IAMA 5I1LB 3O0RH 1A6UL 1RZKL 5HI4D 4LAJH 5DC4B 5I8OH 3BGMA 3BN3B 4PJHA 3S4SB 3QDGE 3MGOB 4YDIH 2HA1A 4XP5H 4MD0B 3RWFA 3VJ6A 4CAGA 4ZUSB 3S34L 4MS8C 4OLEA 5HI5D 3E6HB 1AE6H 2IAND 4X9HA 3EO0A 2HRLA 3MRNB 4OSUL 4WW1A 1T1YA 1LK2B 4K3JL 4GKZA 3NABL 4JKPL 4X4YA 4P3DB 4KHTH 3OPZH 4H0IA 4OZHF 3WFDH 5ERWA 5C9KA 2OP4H 1NCAH 1IEAB 1A3RH 4HGWA 2HFGH 3SCMB 4IMLA 5J8OA 3QPQC 1QFWH 2VDQL 1CVRA 3NN8A 2EDDA 4GG6A 3HG1D 4Z7VE 2GCYA 1UWGL 2PCPA 4OCSL 4DAGH 1R0AH 3BN9C 4M6NL 5KVDH 4NC1C 4Y2DD 1TZHB 2EDTA 3L3JB 5EZLA 5I1KH 3QQ3B 2O93L 1F4XL 3WHXA 4CMHC 1QLRA 3TO2A 2VLRB 4UT9H 4HH9A 5BMFH 4LCUB 4K94C 4XAWL 1E28B 5KG9B 3W2DL 2UWEA 4JFDE 1NCWH 1OD7A 3QXTA 3V5HB 2D7QA 3UAJD 2X4QA 4MNQD 5TDNA 5ADPL 2GK0A 4NO2B 4TSBH 3W0WA 3M1BA 3MRQA 1YEFH 2YK1H 4MQ7B 5TQ0H 4ZS7H 2GY5A 4P4KD 5FB8A 4LLUA 3MNWA 4HD9A 4OGYH 3JZ7A 1BHGA 3QJHB 4CMHB 3O9WC 3BKCH 5L2KA 3KPLA 3PWLA 1YEDB 5IMKA 1CFVL 2NY7H 3LMJH 3MLUH 4D8PB 1MJUH 2FZ3A 1Q9KB 1QLFB 1JHTA 1KTDA 1CL7H 1VFOA 1NAKL 1TJGL 5C70A 5HYJA 5KSBA 4LNRB 4HSQA 4ODUA 4P23C 4ZTOL 5IVZA 1ZMYA 5GRYA 5GSRB 3GIVB 4OQ1A 3GSNA 3N50A 4DUVA 4YUEL 1RUQL 3KR3H 1BD2E 3O9WB 2FD6L 4RZCA 3VFGL 1P2CA 1LEKB 2HLFC 3SJVA 5HHNA 4PJCA 3MO1B 1MI5D 2BNQE 2X4UB 3P77A 1YECH 1RUAH 3QBTB 5E00A 1ZGLB 3QEHB 2VWEC 2PTTA 3O2DL 4Y19B 1R3LA 1ZS8A 4G6AC 1I8LC 3SO3C 3UC0L 1ND0A 1TNNA 4P23B 2YN5A 1XF4A 5C08E 4F2MB 1T1WA 5ALCL 2F54A 4JB9H 3RNKA 1JGDA 1BM3H 1M05A 1XEDA 1IC5H 2W9DL 3E0GA 4OF0A 4MAYC 2C26A 3ETBF 3FT3B 4EDXA 1J9CT 3U6RB 3OR6B 2MMXA 1QPXA 3G6JB 3MV9E 2HT4C 4QCIA 2A77H 3FQXB 1ZE3C 3RPIB 2DYPB 3SO3B 5FO8B 5IEKA 4KK6C 3WXVL 3RWGB 3O8XC 4OD2B 3RBGA 4XMKL 3W39B 4X7SL 3O3BA 1OARH 3C09C 4LSTL 5IOPA 4ZAKC 1RJLB 3VFWB 5HYFA 3VG0H 2XRAH 4R2GD 1J1XL 2AV7A 4M8QA 3BWUC 2LU7A 1F00I 5DMKB 3B2VL 4MAYB 1UACL 5E24E 1A7OL 3IDMA 4H1LA 2APBA 1NEZA 1K3ZA 4J2XA 1T21A 1YEHL 4G8GA 4QY8A 3FMGL 3O8XB 5JW5A 1F02I 1I8KA 4BA8A 3WFBL 3VD9A 4HPYH 5BV7C 4MA7L 3PDGA 3C09B 4GMSH 1FORL 1I1YB 4NN6B 4BH7B 4EIGB 1U8QA 1QSFD 2ESVE 3RWHB 3KPRB 4NNPL 1ONQB 3T0ED 2X10A 2Z9TA 3PJSA 3CFIC 4HBCL 4Z7WE 3FZUD 1VESA 3SN6N 1HQ4B 4J3UA 2AJSL 2FWOB 2V9TA 1X5LA 3UYOD 3SDDA 3BJLA 3CVHB 4HHAB 3W11D 1MCRA 2FJHA 1SJEA 5ID0A 1C8PA 1X5JA 4TUJB 5F97E 4NQVA 1A6VH 4WFFD 2DBLH 3KPSD 1VB9A 3GO1H 3MFFB 5TDPB 2XV6B 3A6CL 2YC1A 4YXKL 1KJMB 2X2YA 1ACYH 5BV7B 5FCUH 5DTFA 4KTEH 3HNTH 4E41B 1LEIB 4DN3L 2X70B 4LSUL 5ILTL 4Z7NF 3QIUA 4XB8A 1EK3A 2FX8L 5MEND 2A73B 5C0CD 2FRGP 2I07B 2V7HB 1M7IA 1NGQL 3PWUA 5D7SL 1AQKH 4R90H 3DV4A 3RVUD 1C5CL 1V7NL 4NM8H 3IU4L 1BJ1H 1G9NL 2A0LC 2IAMD 3JXAA 5JTWA 1KTLB 1KYOJ 2CIKA 1X5AA 4NHUB 5JQ6H 4AG4L 1ZVSB 3QUKB 3FAWA 2FH6A 5KN5A 4LDEB 2R9HC 4X5WB 3TVMC 3DV6A 5D1XA 4KHXL 1NFIB 1NH6A 5D7IB 1MVUB 4WUKH 4ZSOA 1NCDH 4J1UB 4OGAD 3GBMH 3QUZA 4FQJL 1OLZA 4OCRH 3FHQA 5EZIL 3OGCB 4J7RA 2IC2A 5FAAA 5IHZB 3D3VE 3IDYC 1AJ7H 1NBVL 1P5UA 1XAUA 1E4JA 4NCC1 1J8HE 1YY9D 1GSMA 4Z77A 2QKIA 3DXAB 4Z95L 3BPCB 1PX3A 4XTRC 2B20A 3TVMB 2PW2B 1RUPL 5KTEH 3GSUA 2ORBH 5H37H 3DRTA 2Q8BL 2ZZUT 5D96C 2VDLL 5KVEH 4JPIA 1BIHA 3GRWH 3BAEH 1MFCL 3QG7L 3SKJH 4U6TA 4OBSA 5K9KB 1RZ8A 1HILB 1QG3A 3L5JA 2HLAA 1J05B 1FZOA 3DX7A 2R23A 3OKOB 1H15A 3JWDL 3C5JB 3QFDA 5I1CH 3UTQA 1AQDB 4UU9B 3G5XA 5DEGA 1CTNA 1IGJA 3MOQA 4JM4H 3KXFD 4QOKB 3UO1L 4X99A 5FGBC 2BMKA 2X4SB 4WO4C 5C0RL 4MJ6B 1DVFA 5D96B 1A2YB 1B4JL 1NCCL 4LRNH 4JREC 4LHUB 2MCPL 1OT1A 5K33A 2UUDH 4F7CA 3CXHK 2DLIA 1OP9A 5T1DL 1KPVA 5D93C 1XIWA 3AROA 5DJCB 1UCBL 1Z0MA 4RMVA 4K3DL 5LQBH 2WBJC 3OKEA 3T8XA 3UCRA 1LE9B 4PJXB 3DURA 4OLVH 2O5YL 1DEEA 2X5PA 1IL1B 3CFJA 2IQAB 4U2YA 4X7DC 4N0YL 4QHMB 4JE4B 5M95B 3ET9F 1T1ZB 4Y5XC 4L8SA 1T2QL 4WTWA 1YNKH 2BP3A 4NKOA 1G6RA 5IW6B 1PLGL 1NDGA 3MUGB 2Y5TB 3ZL4H 5FUZH 4WO4B 5CEZE 1FO0H 1CDBA 3BPOC 4XBPA 3C8KB 1VERA 4WI8A 3ULUE 2WIIA 3CGTA 1BFTA 2A6JB 4JREB 3MV8B 4GBXA 3G5VB 1NFKA 1C16B 4XVTH 1IGML 2IFGA 5T1LD 1V3LA 1B0RA 1RURH 1S9WA 1Y6NR 3M17B 5D93B 2AK1H 4B41A 1V5JA 8FABA 1X44A 2WBJB 3JV4A 1ADQA 5CILL 1J0JA 3SE8H 3WV0A 1BVKA 4UQ3A 2ZUSA 4K7PY 1JWUB 3LHPL 2YRLA 3RJQB 4HS3A 1QSFE 3OAZH 3T0EE 4XCEB 3DUUB 2NY3D 1NUFA 4NQEA 4Y5XB 2ZWLT 3FO9B 5EPMB 5FYJE 2KDGA 1U91A 4XNUH 5I1AB 5LXGL 1E6OH 5D7IF 1HZHL 2Z4QA 3GMMB 2EDEA 3BPOB 4YFDB 4Q2ZA 2X6MA 4PJFA 4A6YA 1XR9A 3QIBA 2ENYA 3EHBC 5F7FA 5I8KL 4OFVA 4BZ2L 5EFIA 3V4UH 3PWNA 4JFEE 3UJJH 1UKTA 5H37G 4ZTPH 4HWZA 3EOYG 4TYUA 5I1IL 2WUBL 3NACL 4G6FD 4KPHL 3ZYJA 4RWYH 4D0CB 4HK3J 4HH8A 5HYQA 4KJYB 5J6HA 4PRPA 1S7TB 2OK0H 4MSWA 3STZB 4JRXB 2AXGA 3IB4A 5DRXA 4EI6B 5J13C 3VFPB 3TEUA 1UJ3A 4CMMA 2VLJD 1M4KA 1BEYL 4DJMA 5KAQF 2P5WB 4JFFB 4CDGC 2BXYA 3DSFL 4RFEA 4OFIA 1EXUA 1AO7E 2EIDA 4OZIF 4LLAA 3ARXA 3WFHB 2ATPB 2IH1B 2EDRA 3EJZD 4MB4A 4L4TD 5ETUA 1Q8MA 1IEHA 1KC5H 4UOJA 5AUMA 5EBWA 1X7QB 4PYHA 2JB5L 1T03H 4U1HA 1NEUA 3GHEL 1RJYA 3WUWA 1KJVA 5J13B 1F58L 1TZIA 3N1FC 5DJ2A 3VCLA 3ULVL 1WFTA 5D1QA 2FECL 4G9FE 5IBTL 5LWYH 4PD4K 3FOMA 2AGJH 5ANMA 3FQUA 4PJ9A 3S35L 4U1NB 5AEAA 3AFLA 3LKQB 1PY4A 1INDL 2EO1A 5E8NA 2HJKB 4KQ4H 1YPZE 1MHHA 4KI1A 5E2TL 4PJIF 5IUSA 3ULUH 1IGCL 3D85D 2MJWA 4YHOH 2G2RB 1IQWH 1CLOH 4ODXB 4PY8I 4FQLL 1QRNB 3NCCB 2CIIA 1T20A 1KIUA 1LO4H 1F2XK 2R69L 4G7VL 1OLLA 3MLYL 5DWUL 1S78D 4PJAE 2QADD 1MRCH 1OTSC 4P2QB 5HDOA 4NQDD 3X3FH 5SWSD 1OSPL 5EIQA 2E5EA 3VWJC 4Q9QH 4XNQA 1SY6A 3QZWB 2H32B 3RY6C 3KXFE 5FYJH 1EGJH 1X4YA 4R96B 3B5HA 2BVQA 4ODSL 1DQDH 4RAUB 1BBJA 4JANB 5I17A 4LCCA 4S1QH 3T2PA 5BXFA 4QRTB 4TVPD 1CDJA 3MLXH 1EBPA 4GXVL 4P5KB 4DCQA 2H6PA 1YY8B 1R5WB 3OKDB 3MXWH 1EO8H 2ZG3A 2PO6A 3PGFH 1ZSDA 4LSSL 4EUPB 4MCZB 5C3LD 1DL7H 5FHAH 3HUJB 3VWJB 4LSRL 3K4DA 2XZCL 3GKWH 3OHXB 1K8IA 4ZO6A 3KNBA 3H3PH 3J7HA 2AQ3A 3T1FB 1A0QH 4JKMA 5D2NC 2VQTA 3C2AL 3CSYB 3F6IA 5JPMB 1MCOL 1R5IB 4HIEA 2Q86A 2Z8VC 3CC5A 4PRBA 4S1DC 5DQ9A 4ZDHA 1F2QA 1NCTA 5TPWL 4IOIA 4XPBL 4LPTA 4QT5B 5E5UB 4Y4KC 3R0MA 3HZKB 4ZXBD 2BC4A 4GMTL 4YFEA 2X4PB 2R4SL 4RBPH 5EOTB 3S36H 2DS4A 3BEVB 1IGFL 1RZIB 1MFBL 2VL5A 4L4VB 4LKXB 4C56A 5D2NB 2AJXL 2G5BA 2DKSA 1IAKA 4DVRH 5E99L 3EGSA 3Q0HA 3H9ZA 1PZ5B 4KTDH 5IM7A 1QSEA 5IB4A 3P9MA 2QHRL 3LOWA 1BGXH 2GYSA 4C59B 2FGWH 4TSAL 5ICZA 4U7SA 1IJ9A 4Y4KB 5DLMH 5IVXE 2XYCA 1T5WA 3PV6B 6CGTA 1OB1B 5FCSH 15C8L 4ETQB 3F7VA 3O2WH 2DQTH 3LEXB 1CGVA 1BZ7A 5GGQH 1FHGA 3RKPA 2OQJA 4MHHI 3UEZA 3L3IB 4KVCL 2LQRA 1VFUA 3WDJA 4KROD 3N9GH 2Q76A 4JEGB 4FA8A 1QEWA 4YZFF 1NDMA 3BYYA 4YDVB 2EC9U 4D9QD 4YDJA 5F3BA 3L9RB 1JNHA 5C0AE 4P2RE 4PJ7B 2PYED 1EHLH 4F7TA 4N0UB 3TNMA 2G9HB 3SBWA 4RMRA 4X98B 4KZDL 3T0DA 3TCXA 3I02B 1QQDB 2OSLA 5D7LB 5DD1L 3ARFD 3VGFA 4JQXC 3HE6C 3VXNA 2CDFB 4FQIH 3NTCH 3A0OA 3BH9B 5DMJB 2YXFA 3KPNA 3R0NA 2BNRA 2EYTB 3D2UA 3SJVD 1NCBH 4RCAA 3GMQB 5GGRA 2XKNA 4JRYE 4PLNC 1JYVA 3ES6B 4OF5A 5ESAA 4I3RL 1F4YL 2XNAA 5IK3A 3GSQB 3IETA 3B4NA 3OKMA 5ACZA 3IDXH 1VKXA 1QVOB 4EZMA 2X9XA 3TZVB 5DD0H 5EO1B 3HE6B 5IFHH 3BXNB 2ZCLH 3HUJF 1EEYA 3S3SA 3T4YB 1H3UA 1D6VH 1OAKH 1KENH 2YD2A 4UILH 2IH3B 2A9NL 4TSCH 2AJZB 2HTLD 2M8XA 3C08L 5TE7H 3TN0D 4HS8H 3QRFM 1VFAA 1S7RB 1EVUA 5T5FH 4UT7L 1HHJB 4L9LB 3PHSA 4OZGE 4TTDC 5ALBL 5DYOB 5KVFL 1GGIH 5FHBL 5E1AA 1A6AA 3U0WH 2GHWB 4ODTL 1I9IL 1J1OL 1TDQA 5GPRA 1V05A 4MNGB 5LKNA 1YEEL 4YEFA 3QNZB 3SKOB 4X80H 4Y89A 1MELA 4NRYB 2D7PA 3G6DL 2WMPA 3ARBD 5CP7A 2XI9A 2OI9C 1AP2A 2W9EL 3NH7L 3SGJC 4HJGB 5IHBA 5IKCB 3FCTA 3CFEA 2LU3A 4PJHE 5HYSA 4PJ5A 1VHPA 3GJFA 2FR4A 3RUGB 2FB4L 3GMLA 4NQXB 1KULA 1MCBA 1RULH 1BWMA 1WBZB 4LCWA 3SGDH 4UUJB 4EVNB 2VXSL 4FQXB 3N85L 4JN2A 4GAGH 3SQOH 1B6UA 3QO1A 1RU9L 1OGTB 2C1OA 3DVIA 2PYFB 3NA9H 1MCHA 2CLZA 2X4NB 2NW3B 4U1JA 4Z7OE 4GG6E 2OI9B 2M26A 4UB0H 2JELL 4N8CL 3MBED 4DKDC 5DJDB 3AMLA 4PGDA 5F88B 4PJGB 1C5BL 3S88L 3FB8A 2YOCA 3IDNA 5EBMB 3CMOH 4GW1B 2ICWJ 3GMOB 3NZHH 3TIEA 4PJ7F 2A38A 4DK6A 1YJDC 1GZPB 3NCBB 1OAZH 3GI8H 4X8XA 3GMNB 1DE4B 2QJDA 2Y7QA 2APTA 1KN2H 1F13A 5D6DA 2UWEE 4ZOAA 3MACL 4MNHA 2VKXA 3BE1H 4G42A 4G8EA 4E5XB 4RA3A 4H5SA 1RQ5A 2QSCH 3PGCB 1PQZA 3W0WE 4P9HC 1KXTB 1JUFA 1T2XA 5BJTA 3E1F1 4ELMA 2VXQH 5HHVH 2F8VA 4JDTL 2NY0C 5CHNA 4X4XA 4ODVL 4Y4FD 5C07B 2QQNL 5L2KE 1J87A 3JUZA 4JO2L 1K5NA 2XN9B 3L6FB 1RSFA 4HK3N 2NX5D 2EH8H 2HH0H 2DQGH 1MWAL 3BZFA 4AEFA 4W4OC 5EU3B 3GM0A 3WLBB 4F9PC 3MV11 3A6BH 5AYQA 3RZCB 3R8QA 3QUZD 5HHOD 3D39A 5HYJE 5KSBE 2H3NB 2ADFH 3BQUD 2YBRA 5D6CA 3FQNB 4NJAH 3WKML 4HFUL 3DETD 2E7LA 1UEYA 3O3AA 1U8HA 2NZ9C 4FXKA 3FB6B 5DMIL 3H6JA 3ZTNH 5F9DC 1JWSB 1YA5A 1DBKH 1QR4A 1LWRA 2NY0B 3ZDZE 5MEQB 1NSNL 1Z3GL 5B4MD 5FF6A 4OGZA 4NN5B 1L7TH 3EKCA 3SJVE 4PJCE 5JW3H 5F1IB 2VABB 4ZUWA 3W81A 1G7JB 4YNYA 1N5AB 4NO5A 5KJRL 1IT9L 1KIQB 2FX7L 2XKSA 2RR3A 1NKOA 1KELL 3P0YH 2Z35B 2R4RH 3RWEA 1MAKA 1OP5H 1RHHA 3QFJB 1VGEH 3Q6GH 3DMMC 4JR9H 2XTJE 4UTBL 2F54E 1YEJL 2JJWA 4TULL 1O5DT 5HVGB 3S36X 1MCCA 4OLUH 2PF6A 5F3HA 3WFZA 3TJEH 5ECJE 4LF3B 2D9QB 4AL8L 2VXUL 1KLUB 4CRPA 1T83A 4K23H 2DAVA 1JRHL 3MUHL 4X7CC 3PG2A 3OKLA 3VFVB 4KJQD 5JHLL 2RBLA 4M7KL 3O2DA 1CFNA 1LO0H 1T7VA 4GOSA 1T22B 1UM5H 3B9KD 4MD5B 3BUYA 2R0KL 3HNSH 1OW0A 5HY9A 1ORQA 4PY7A 5GGTL 4DW2H 1YZZA 4YIQB 1VEMA 2NY1C 4KK5D 3H2WA 1IFHL 1HXMA 3MA7B 1A3LH 2E8YA 5HDBF 5KBNC 4F7EA 3IFLH 1F4AA 1TCRA 1XCTB 2VZTA 4JFOB 4P57B 3VI3E 4EN3C 5F89B 3MRBB 3MA9H 4N9GB 2ICCA 4CN1A 3LIZL 5EU7E 3IFOB 2V9RA 4O4YH 3VH8B 5CJ5A 2X40A 2ZG1A 4LQFH 4OD1H 4DVBB 3INUL 1KIRB 2GSGA 4MA8L 1IM3A 1MAMH 1QRKA 4G8GE 3ZDYF 2R56H 4DGIH 4PRIA 2XZQH 1I3VA 1ODAA 3PQYA 3H9HB 4NSKB 1QKZL 5L88L 3MRKA 4HKBA 2NY1B 3IDGB 3QA3B 4QHNA 3IGAB 3S5LA 4JPWH 3SCMD 4NQED 3ABZA 2A83B 4YQXH 3ZDXF 5GGUB 5E2JA 2Y36H 3VXTB 5JHDA 4QRRD 2E3VA 5I30L 3CLFL 5FYKL 4YX2L 5FDWB 2CLVA 5DJYB 3VMPA 4NQTA 4KH2A 4UQ2A 3U4BL 5JQHC 2C4XA 2G5RA 1DBBH 4ACPA 4Y1AA 4ZO7A 1RJCA 2IADB 2EIEA 5E8OA 2BDNL 4F3FA 1NGWB 2BVYA 4PIRF 2JB6B 4HUXA 1A7RL 4M4RA 1AGFA 2FIRT 2W59A 2X1XR 4XP4H 2X05A 3BN9D 1FFQA 3MLRL 1LE5B 1IGYB 1I7UA 3SDAD 5FO7A 4KVNL 4F7MA 1KB5A 1WITA 2R8SH 2VDPL 4L8DB 5ISZD 1MHEB 1QUNA 4NO0A 2Z31C 3BGFC 1CFTB 4YHMH 3CIQA 2AK4A 4U3CA 1KJ2A 3GJEA 4ZSOE 4DTGL 2W0PA 1N6VA 4HWBL 2OTPA 4J8RA 4JFYA 1F97A 3GNMH 4J4PC 4JHWH 2VISA 4EQ2A 3P3YA 1Q0XH 4NJ9H 4ZFOL 3S3PA 4WI7A 2OZ4H 3L3GA 1RK1A 4Z7QF 5A3IC 1NFDF 1K8DA 2NY5H 4LDOB 4Z7UA 2DL9A 5IQ9A 1DLFH 4MAUL 3EO9H 5DK2B 1KB9J 1D5IL 2Z31B 1SEBB 3U2SB 3BGFB 3QUML 1KCVH 4XCNA 4OLWH 3VRJA 1KG0B 3DARA 2BOBB 4H1LH 4NQSA 4HIXH 2EKSB 5FEBA 4UINL 1SYSA 5JA8B 2ATKA 5F9JA 1CWVA 2D03L 1ZT1B 1BJMA 2CDGB 2W07A 3TV3L 5JMOC 4Q9RL 1RK0B 1R3KA 5IFJB 1QP1A 4Y5YA 3GSVA 3PABB 1CXKA 1KLGA 4M4PA 4OM1H 1KN4H 1ZGLP 2FO1A 4HWUA 3O3DA 1PKQA 1PSKL 3FQRA 3RWIB 3SE4C 3MRCB 3RTQC 4R8WL 1L9MA 1B0GB 4P49A 2HLFD 4QNPF 1CS6A 2YPLD 4AMKH 2FL5B 5CGYD 1UA6H 4YE4L 3LH2L 4YC2C 5HGBA 4AM0A 1KEGL 1PYWB 3OL2A 4UIMA 3DTXA 1R6VA 4D2NA 4G6AD 1IZJA 2Q8AH 2ZNWA 4XP6L 1WSST 2P48B 3C5SB 3VFOB 4FG6C 1XGUB 5HPMA 3SO5A 4UV4H 1G7MB 1DBJH 3FB7A 4K7FA 1JFQL 2F8OA 1JPFB 3RTQB 3O0RL 5JORB 4LBEB 4XPAH 3EBAA 1YC7A 2VSCA 3V6FB 5I8OL 1WT5A 5FV1L 1JV5B 4EBQH 3G6AB 4YDIL 3B3IA 3PF2A 5JOFA 4XP5L 4YC2B 4HZLA 4R0LC 4TNWF 3X14A 5L9DL 1FZKA 3ARGA 4ELKA 1J7VR 3TBWB 2GTZA 2JIXA 2DIAA 4NKQB 4KHTL 3LKOA 3SPVA 2XWJA 3OPZL 3O8XD 5IBUG 3WFDL 4OJFH 2OP4L 1NCAL 1A3RL 2HFGL 4NQEE 4X7EC 4WU7A 1QFWL 4ZAKD 3L5XH 3KPRD 3D9AH 2B4CH 4XWOD 5KS9A 4DAGL 1N6QL 3BW9B 2WINB 2EXYD 5KVDL 1IMHC 4PJFE 4ODHH 4R0LB 5I1KL 5CCKH 4JFQB 1WZLA 3P73B 4TUOA 1X5IA 4ZUVB 1AH1A 2GEEA 5DJ8A 4UT9L 3K8LA 1RY7B 4OCXH 4JHBA 5BMFL 5F9AC 3NCEB 3NFSH 2ARJA 3P9LA 5DUMH 5EU4B 4JQVA 3HE7A 2F53B 3MRHA 4YH6A 3GSOA 3P4MB 2WWKO 1NJ9B 1NCWL 1QSZA 4M6OH 4PRPE 4XZUA 5EZJB 3KLAB 3NZ8A 1A8JH 5T3XE 1KEML 1WWAX 3QDHA 5C0BA 1JK8A 1HI6A 4TSBL 3GMPA 2YUZA 1A9EA 1YEFL 5HGAB 2YK1L 1P84K 2J5LC 4ZS7L 4CVZB 2ADIA 5F7YC 3U46A 3EDEA 5D7KD 3RVXD 1CR9H 4EKXA 3MRIB 3TJHC 3MRJB 5T1KB 3UX9B 1XGTB 2H8PB 2NY7L 5ID1A 3LMJL 3MLUL 3VFSA 2E7CA 1JF1A 2HMIC 3OAYH 4U31A 1FVEA 5C0GB 1ORSA 5I1GH 3U0TA 1CL7L 3ZKNC 4OBRA 2XA8H 1FPTH 1KGCD 3C60C 4WTZA 2J5LB 3HC4H 1EEQA 2Z91A 1GGUA 2EKJA 2GT9B 4ZFFA 1I7TA 1S7VB 1SYVB 5EA0L 1H3TA 1R3JB 2HT3C 3KR3L 5ANME 4O2FB 1WGOA 1G6RH 2DQUH 3H3BC 5C0NC 4L8CA 4IRJA 1ZT4A 3IAPA 1YECL 1RUAL 2W38A 2EDJA 2HP4A 3NCFB 3BHBB 4U1IB 1AR1C 3VFTA 1A1OB 2D7TH 4WFHD 4AH2B 3DX9A 3BH8A 4X7TA 3PL6D 3EIFA 1CIUA 3C60B 3IJHA 3CDCA 1ADQH 1KLFA 4Z76B 1MJ7H 4JZJB 4AK1A 2VLMD 5F72S 3O41A 3RWJA 4V1DB 5I16A 2X4OB 3DX6A 4NQCB 1HCVA 1FNSH 1BM3L 4Q9BA 3I50H 2K9UA 2XTLA 5TJWK 3UJIH 4TVSa 1A1MA 3UPRB 1UCTA 1FSKC 4WUUA 1CDIA 1R5VA 2YSSB 1WC7A 3N1MC 3NAAH 1Y0LB 5AYUH 4PREA 4IRZH 1EMTH 4LHUD 5IBLC 1HKFA 1D5XA 3RL2A 4S10A 4N8PA 4PJ5D 2IBZY 3PP4H 3GUTA 1HCFX 4WI2A 4MZ2A 1P1ZB 2XZAH 2ZP0T 5T1MB 3NA4A 2Z92B 1D9KA 2MHAA 4EJ1C 4OZ4B 3RDTC 2RB8A 2XRAL 1FL5B 5E94A 1FSKB 1MY7A 2WIMA 4HIJB 4O2EA 4UIKH 2VLKA 5I1HH 4WO4D 4C54A 4YO0A 5HHMD 3PWPB 4K7PH 4CU7A 3TNNB 2QBWA 3TBYB 1BQHB 3TYFB 4XMLH 4PV9A 1FZJA 3UTTB 3QEQB 5E95B 3VWKD 3V7AE 2HVKA 1BAFH 3HZMB 2BVEA 1OTTC 4WDIB 4HPYL 2JCCA 5L8JB 3O6LH 3NFNB 4GMSL 1TITA 3RDTB 3GMRA 3ZYIA 1RD6A 1S8DB 3MBXH 1SJHB 4C56E 4IDLA 3E8UH 4NO3A 1MH5A 1AKJA 2DLFH 3IF1A 2HTKC 1QSEE 1UVQA 4QGTA 3QNYB 4PRNB 3TIDB 4EI5A 1Q94B 2WANA 3KPPA 3TBTB 5GRUH 1A6VL 2VQ1B 3RWDB 3GO1L 3HC0A 4RX4D 1FE8L 4JDZB 3K2UH 4HDIA 3OX8A 4J3XA 5FCUL 4KTEL 3HNTL 3OF6A 4WNQB 4DK3A 4MJIB 3D25B 1BVLA 2DQIL 4NRZB 2GJ6A 4QRQB 2VDMH 4QTIH 1AXTH 1L7IH 3B5GA 4JRXD 1BF2A 1AQKL 2Y6SC 3ZE2E 1QFWI 4R90L 4OZFB 4X6CA 1A21A 1CFBA 1KTRL 4JZNB 4OT1H 4Z5RA 4TNVF 3RNQB 1SY6H 3LPGA 5CIPA 1ZLUK 1GXEA 3FO1B 2DDQH 5GS0H 4E42A 5JQ6L 3EHBD 4N0FA 1Z9LA 5F71A 1VFBA 5H35A 2FIKA 3QEUA 3C8HA 3ROOA 1BIIB 5I1JH 2HRPL 5A2LH 4WUKL 4RGNC 5J6GA 1MEXL 3SDXF 2BNRE 1NCDL 1U92B 3GBML 3Q2CA 4OCRL 4U3XA 3BZEA 1UADC 4LOUC 5DRWA 2E9WA 6FABH 4JKKA 1AJ7L 1PG7H 4WU5A 2HT2C 4QLRA 1FNGB 1UXSB 2WAHA 4G8FA 3MLPA 3DVNB 1T7XA 3OXRA 4L8BB 2W9LA 4OIIH 1JGLH 4Z0XA 5DJXA 1LEGA 3GZKA 5SWZB 4XGZB 5KTEL 1PW3A 2XQYK 4Y4HA 4RGNB 3RY5A 2AKRA 5KVEL 3QWOA 2AEQH 3GRWL 4JJ5B 3BAEL 1KFAH 1I75A 3EYQC 4GAJH 4UNUA 4WCYH 4PB0H 3SKJL 1KNOA 1CL7I 4X6FA 2MTPA 1O7SA 4AEHL 2CK0H 1KOAA 5IFAH 4KQ3H 4I18B 3WLWC 1G0XA 4JM4L 4AIOA 1U6AL 4YJZL 2H9GB 3DWTA 4MD0A 5C6WH 1FG2B 2AV1B 4ZUSA 2QQLH 4LRNL 5FGCE 5TGBB 4M3KB 3LKPB 4PJ5E 4ONOA 3T0AA 1LK2A 2BVPB 5FUCE 5CJOH 4IRSA 1V3MA 3QWQB 5LQBL 1T66D 3AAZA 4I3SH 4LCWE 4KK8C 1F42A 1G0DA 4OLVL 1MLCB 3MZGB 2D31A 3BVNB 3QXWA 3PQYD 4X6EA 2APFA 1YNKL 5CBEB 4HUMB 3ZL4L 5FUZL 4LLDB 1NLDL 1FO0L 3MNZA 4Q97A 1Y18B 2LTQC 1TZHA 3L3JA 3VFUA 1EERB 1J0IA 1S7WB 2HKFH 4XVTL 5HHPB 2P8PA 1I1AA 2FHBA 1RURL 4HBQA 2AK1L 2B5IC 2VLRA 3N1PC 3WMSA 3DBXA 2ITDB 3SE8L 3H9SB 3I6LE 5BW7C 5CINH 2CRIA 1NGPH 4XNUL 1EEZB 4NO2A 5AD0B 4I5BA 4HXBH 1CVSC 1A47A 2LTQB 2CKBL 5C0IB 4HKJB 4KV5E 5K59F 3QJHA 2MPAH 4S1DD 4ELME 2B5IB 3V4UL 1YEDA 3F5WB 2ICWI 3QDAA 1JMZA 1TZGH 3UJJL 2Q3ZA 4D8PA 1FVCB 1Q9KA 2N1KA 1QLFA 5TF0A 5L0QC 1L0XA 1NBZB 2D2OA 1I8MA 2NLJB 4R7DB 5INDB 4WW2B 5EU5B 4NO0D 1EUUA 2WM0A 4O5LH 3RGVC 3G5ZB 2OK0L 3DVFA 3V7AG 4AT6B 2V2TB 4LNRA 2PXYC 1Z2KA 5B39A 3D0VB 4S0TD 4QRSB 4WV1A 4ISVB 3KJ6H 4GKSA 5GSRA 3SGEH 2J8HA 3GIVA 4GRLC 3D39E 1JHLH 4GRWE 4ORGA 4HV8A 1XGYH 5EB9A 3QO0B 3O9WA 5GJSL 2BRQA 4YBLC 4BUGA 4NFCA 1QBBA 4UDTA 4U6YB 1LEKA 2BHYA 2P8LA 3MO1A 3VXRA 2X4UA 2XQBL 2DQFB 4XAKD 1GPOH 1ZGLA 5GS3A 5L0QB 4XPTL 2X42A 4L3CA 4Q6IC 1MWAA 2HVJB 4Y19A 1GRWA 3GJFH 3RGVB 1T03L 4ZS6C 1HXYA 4UTAH 4K7PX 3RIAK 2Y9RT 2PXYB 4P23A 1DQLL 4GRLB 2NNAB 4AEIH 5TFSL 3ZKQD 2V2XA 5LWYL 2NY6C 4HJ0C 3QIWC 4YBLB 3W9EA 2AGJL 5HGHB 5MHSD 4WY7H 3WD5H 4U1SB 3HCVA 2CRMA 3EUUA 3ZYOA 2WWMC 1J10A 5DEZA 3ULUL 3VDBA 3GDBA 3U6RA 4YHOL 3ARWA 4LCIH 3QDGB 1I4FB 3QCTH 1IQWL 3G6JA 3RX5A 1CLOL 2J1KA 3FQXA 3NIDE 3RPIA 2N7AA 1M7DA 3F8UB 2DYPA 5FO8A 5FDYA 1OWRM 1LO4L 1I7RB 1KTKE 4CW1B 3W39A 3CUPB 1MRCL 5EN2B 3X3FL 4JKPH 1RZJC 2NY6B 4Q9QL 3QIWB 1JPST 1RJLA 2F15A 5FYJL 1QNZH 5JOPE 1EGJL 1DQDL 3IDUA 4MAYA 1OAQL 2VDQH 1U3ZA 4IEFB 4S1QL 5JO5B 3QWRD 4AYFA 1JZ3A 4ZQKB 1S9VB 3FFDA 3SDYL 4F9LC 3HI6H 5A1AA 1EO8L 2P49B 3PGFL 4TTDD 4RA0C 1ES0B 5E4IA 2BSSB 1DL7L 5C3TA 1F45A 2VO5A 5FHAL 4BH7A 5C71A 1PFCA 4CL7A 4PRIE 3L3HB 2CXGA 3GKWL 3PQYE 4PG2C 3H3PL 1A0QL 1PBYA 5I75C 3ULSB 5LCVH 1WWWX 3CVHA 4GRWH 3VI4E 5JHDE 3BIAX 1NGXB 4WJ5B 1PG7X 1J11A 1QR1B 3F12B 2E27H 1NC2B 5DK3A 2BCKB 3MFFA 2ICWB 1KJMA 5JXEC 4L29B 4I4WB 3REVA 5EOQH 4FZ8H 4E41A 1LEIA 4Y1AE 4WWID 4NUJB 4BFEA 1LO5B 4CN6A 3S37H 1WQVT 2I07A 5J1TC 1NAKH 1OL0A 1A7NH 1WWBX 1KTLA 2Q1EA 4KTDL 3B9VA 5IB3B 1T04B 5FM5M 1JGUH 2F5BH 4JKLA 3MCLH 5CJQH 3CU1A 4X5WA 3B5TA 2EO9A 2FEEL 2FGWL 2DQHH 4HMDA 1H8OA 1BD2B 4QF1A 1X6NA 3S9DB 1MVUA 4XCYB 1I3UA 4JHZA 4RNRB 2EC8A 2VTFA 2AEIT 2FO4B 2OL3L 2XN9D 1KSRA 1O0VA 2AK4E 4FTVB 3OGCA 1ZA3B 5BRZA 4PLJC 4KK9C 3VFNB 3N9GL 3O2DH 4MWFB 4WFGE 5BQ7B 3UC0H 3TO4C 2J12B 1EHLL 3CVIH 5HTSA 3TVMA 4OFKA 4Z7UE 1EO5A 2F19H 5E2VH 1E6JH 3ME0A 4FQIL 1E27B 3NTCL 5HI4C 1X5XA 3STLA 1U8PA 2HYMA 1NCBL 2XIDA 5KSAD 1SBSH 4HWBA 5ICXB 3QUXB 5FKAA 3U7WH 1HILA 5K9KA 3MV9B 4R4ND 2JJTC 4Z7VF 3NBNA 1CU4L 3DVGA 5I8EB 1ZHLB 1JZ8A 3O4LA 4QEGA 3V5KB 3WXVH 3C5JA 4BQ9A 4PP2A 5DQDH 5CEYB 4ZFOA 5MHSE 1A22B 3QFJD 3IDXL 4UU9A 3MREA 1LMKA 1RUMH 3E3QE 2NZ9D 1PDKA 4QOKA 4LSTH 5DD0L 1BPVA 2X4SA 3MJ7B 1F4HA 4KY1H 5IFHL 1PKQE 2ZCLL 4ZOCA 1A2YA 1J1XH 4LASH 1D6VL 1OAKL 3MJ8B 2QSQA 4UILL 4TNWK 1RZGA 3OQ3B 3IJSA 3QUMA 5EUOA 4X9IA 5DJCA 2IANB 12E8H 4L3EA 3HS0A 4HS8L 3VFRA 5T5FL 1CICA 1LE9A 2PNDA 4PJXA 2DLTA 1GGIL 1GYAA 3FMGH 3BSZH 5AG8A 3CXDH 1IL1A 1KF9B 4QHMA 1VADB 3U0WL 3QUYA 5I73C 2X7LB 3TPKA 3DMMD 1FORH 2BSRB 1S9KC 5IW6A 1XF5A 3MUGA 2EE3A 4F7PB 4NNPH 1H3WM 3WNOA 4X80L 4GAYA 4HBCH 3CFBB 1WCQA 4R7NB 3G5VA 1C16A 1S9YB 1F11A 5JOEA 2YR3A 4P4KC 1MFNA 1YUHA 1R24B 1OAYH 2Q6WA 2E8ZA 2WBJA 2DTMH 2B0SH 1RULL 1KB5H 1I3GH 4G9DB 4X0KA 5I73B 1JIBA 2CO7B 3UZQA 5JPNA 4GAGL 4NNYA 3SQOL 1KJ2H 4FFYH 1XMWA 5I1AA 4QGYA 1FCCA 4DGVH 2FX8H 4DZBB 3GMMA 4MNQB 3NA9L 5C0EA 2NY1D 1NGQH 3FN0H 1DP0A 2R1YB 4UB0L 4BSVA 2AW2A 2DN7A 1Z5LB 5KS9E 4EN3D 4QYOA 4P4KB 1AKJD 5GRXG 2CO6B 1EAPB 4BFGA 3TM6A 2ZUUA 1EH9A 4H8WC 4MXVE 3LN5B 4GW4B 1WJ3A 2FSEB 3G9AB 3NZHL 5CEXB 2M1KA 3I6GB 2QR0B 4KHXH 4YLQT 1OAZL 2A6DA 1S7TA 2BZDA 5DFVD 3STZA 4OAWA 1L0YA 3VFPA 1KN2L 2OTWB 2YRPA 5D5MA 1CLZH 2RFXB 4PRAB 4EEEA 5INCB 2R2EA 3BE1L 5C0BE 4HW6A 2P5WA 4LFHG 2QSCL 4JFFA 2WBKA 2ZOKA 4PJEA 1J8HB 2WP3O 2CKNA 4I48B 5DK0B 2VXQL 1E4KA 1RFDH 4ZYKB 1GHFH 3THML 4Z95H 3CH8A 3UTSD 1YYMH 2AXFA 1RUPH 2DD8H 1MI5B 1X5ZA 4I9WD 3CJJA 2EH8L 2G60H 2DQGL 4YXLL 2ZSVB 5LAXB 3VXSA 1HK6A 4QRUB 3KLHC 3QHZH 3A6BL 5I2IB 5DMYA 1JBJA 2OJZH 2ADFL 4NJAL 4NPYB 3P0GB 4NRXB 4AENB 1G0YR 5E1HB 1I8IB 1U8IB 4U1NA 3JWDH 1QYGH 3I75A 4F8TA 2B2XH 3ZTNL 1EFXA 3MRFB 4HFWA 2HJKA 1DBKL 2GJZB 2VZ1A 4R2GC 3IKCA 3UO1H 3K7UA 5GRWA 1OP3K 1EPFA 4N1CA 2G2RA 1RPQA 3D48R 1L7TL 5K9OB 3FB5B 1P7QD 1QRNA 3I85A 5JW3L 1B4JH 2Z31D 5ADOH 4P2OD 1LD9A 2AERT 2GSIB 2D9CA 5J57B 3VMNA 4Z7WF 1PZUB 1BFOB 1T80A 2CLRB 2UZIH 4P2QA 2WUCH 3P0YL 4CKVX 2R4RL 4PFEA 1EAJA 4JDVA 4K3DH 3DUSB 3QZWA 1VGEL 2CRYA 3Q6GL 3ZKXC 1HHIA 1D5MB 4FN0A 1WTGT 3ULVE 2O5YH 4JR9L 1WIOA 3D0LB 1AY1H 5I1DA 2EDBA 2EEAA 4RAUA 3T0EC 4OLUL 3ILPB 3T3ME 4R2GB 3DGGB 3S37X 4QRTA 4ODWB 4KMQA 3AY4C 5DJAA 3TJEL 3CNKA 3EYOB 3T65A 2HFTA 4N90D 4WUUE 3UBXI 4OV5B 3ROLB 3OKDA 4K23L 3PDDA 4O51A 2YA1A 3NPSC 4GKNB 3LRHA 1KYOK 3LRSB 4EUPA 1W0VB 1NMBH 3VWJA 3F7YB 4R3SB 1UM5L 4ALAH 2J6EA 4KXZI 5B22A 3ZKXB 4PB9H 5C2UB 5IWLC 1YMHB 4TPRH 4G80B 5IHLB 1QSFB 4X6DB 3IXAB 3T0EB 4DW2L 3X13B 3BWAB 1A6PA 3AS0A 5JPMA 3IU3B 3T4AB 5IF0B 4P46D 2R39A 1A3LL 1R5IA 3DRQB 4MQTB 3IFLL 3G04B 2DKUA 3MA9L 5IQ7H 5EBLB 2VLKE 1JTPA 3WN5C 5EDXA 1CXHA 4O4YL 4IDJH 3NPSB 4LQFL 3QULB 4OD1L 4QT5A 3WNMA 1NAMB 5C0JB 4RMSA 3T08A 3KPSB 4HMEA 2X4PA 1MAML 3DYPA 5EOTA 2R56L 3BEVA 3S96A 1RZIA 2EXWD 4L4VA 2XZQL 1OQXA 2WUBH 4KPHH 4LKXA 2JCCE 4OGAC 1MHPH 5D2NA 4FG6D 1U8MB 2Z8RA 5C0CB 4D9RD 3WIFA 4JPWL 5EZOL 3EOTH 4YQXL 1PZ5A 8CGTA 5E03A 4QXTB 5D2LA 2Y36L 1REIA 1YY9C 4NBYB 3WFEH 4TOYH 3WN5B 1AIFB 3HZVB 1YEIH 4PJ8A 4HUWB 5IT2H 4Y4KA 1R3IH 1QO3B 43C9A 1AO7B 4PBXA 1OB1A 3VXOB 4KRLB 2R2CA 4ETQA 1UH3A 1U2CA 3LEXA 4PUBL 1DBBL 3L3IA 5JIPA 3Q3GB 3ALXA 4YXHH 2ZSWB 4AJ0A 1MFEH 2JB5H 3BT2L 4YDVA 3GHEH 1TTUA 1ZHNB 5EOCH 2GJ6E 4X8JA 3L9RA 5DT1H 3CDYA 5FM4A 3ULVH 4X6CE 4JFZH 4X98A 3I6KB 5D7LA 4G9FB 1T1XA 2CDFA 4PJBA 4I2XB 3BH9A 3U7YH 1K4CB 1OOAA 2R8SL 2YS4A 5T1KD 2JJUA 3GMQA 4YHML 1HEZB 1YMMD 4KI5E 5DFTA 2WQ8A 4FXGB 4RMUA 5DD3H 5F7KC 1TVHA 1QFWM 1GC1H 4QXUL 3GNML 1AD0A 4JHWL 1B4RA 2R69H 1ZT7B 1Q0XL 3MLYH 3H0TB 1S7UA 5DWUH 4PJAB 4X7FC 1A4JB 3ULUF 3RIFF 1QVOA 2OZ4L 1UXWB 5EULV 4TTGA 2NY5L 3L3OB 3TZVA 7FABL 1EIBA 1IKFH 3HE6A 1AHWB 3BXNA 3UTPE 1MFAH 3KXFB 4HS6B 4M62L 3LKSB 3T4YA 4MB3A 1Q9LA 1XGQA 1NBQA 1RIHH 3L3DB 3T0WA 4Q58C 2IH3A 5SX4H 2VUOA 3DUHA 3UBXB 2AJZA 1KCVL 4OLWL 4NGHH 1JZ7A 4GXVH 1S7RA 2PTVA 3BFOA 4LRIC 3ZYZA 1BX2B 1HHJA 4L9LA 4HIXL 1T7ZA 1XF3B 4NBXB 5DYOA 5A2FA 4OD3H 3RZWA 2F74B 1C08A 4K9EH 4YHNA 5I15H 5TQ2L 3C60D 3AU1A 3JUYA 1C5DB 4OM1L 3LB6D 1KN4L 3QNZA 3SKOA 2AJUH 2HT3D 4RIRA 3LS4H 4WTZG 1IBGH 4JY6B 5TE6H 1W72L 4JZOB 3RHWK 5C0ND 3RUGA 2WP3T 1U3HC 4AMKL 5MERB 4XX1E 1UA6L 3DSNA 1H3GA 4WI9A 1IQDB 1JPSH 5AZ2H 1IC4H 1WBZA 1AR1D 1CK0H 4Q7DA 2GTWB 4EVNA 1OGAD 4LP4A 4FQXA 2Q8AL 3S97C 4KFZC 4RMTA 4GMTH 5HJ3B 3UZVB 3I3BA 1YDPA 4GRMB 5IESH 2PYFA 1Q38A 1W8OA 3MV7D 4G43B 4UV4L 4XMPL 1DBJL 4XPHH 2AJXH 4XPAL 5DJDA 4HX1B 5F88A 4PJGA 3VXUD 1U3HB 3LN9A 5CIPH 5CP3A 4KDTC 5EBMA 3PWPD 3GMOA 4WHCA 3EJZC 1UZ6E 4LPCA 5J9PA 2VLRE 1MCJA 5IBLD 5J0BA 2VDKL 3HR6A 5C8JB 4W6XB 3UTTD 3GMNA 4G6FB 4F33B 3QDJD 5E9DD 4F15C 3HN3A 1A6TB 4JPVH 4WEUD 4OJFL 3EFFA 4D9RE 4YGAB 3BESR 1X5YA 5BOZG 1J0YA 3F7QA 4MMZC 1YPZF 4E5XA 3BRFA 3PGCA 5C09A 3L5XL 3DGCR 3D9AL 1FO0A 3ARUA 2AJYH 4MA3B 4YHZH 4L4TB 5C07A 4PJAF 3ESUF 4XPFL 5FYKD 3QR2A 3AREA 3L6FA 4OCXL 5EU6A 4F15B 5CLTA 3NFSL 5IJVB 1T0NB 5EU3A 1DANU 2F5AH 4KDWA 3RZCA 4M6OL 5CBAB 3FL7A 4MJID 1S78C 2H3NA 1CGYA 5F7LB 3FQNA 3RX8A 5BRZD 2EH7H 1RUKH 3M07A 1MCQA 1A14H 3FB6A 5I0ZA 2HTKD 2CKBA 5IG7B 2MKLC 3VRLE 4MDIB 1NMCC 4JFPB 5MEQA 3BIKB 3KAAA 1Q9OB 2DICA 1CR9L 1DQMH 3U4EB 3D5OF 4C58B 1FL6B 3VXRE 4M1GH 5E6IA 2VABA 4XCFH 3D85B 1G7JA 4F9PA 5I1GL 2CD0A 1KIQA 3L5WB 2HN7A 4Y19E 1CDCA 2Z35A 4OLZL 1P6AB 3FFCD 2XA8L 1ZLWK 1FPTL 4LSQH 3UPAA 3WE6A 4K3EH 3T1WA 4OZGB 1ZKAA 2AAVA 3P40A 5SWSB 2Y6SD 1F4WH 2P42B 4WGVB 4ZFGH 3HC4L 3ESVF 5J1AB 5T3ZD 4L4JA 3TA3D 3O4LD 1NMCB 2EDLA 1UH2A 1YEEH 4J3TA 1G6RL 2BSTB 5CSBA 1KLUA 1L6ZA 1ZWIA 3CSBA 2DOCA 5SWZD 3BGMB 2H2PC 1DJSA 4MJ4A 2H41A 3G6JE 4NZTH 2V9QA 7CGTA 3RWFB 2B1AH 5IMLB 4ONGH 3VJ6B 4F8QA 4NZUH 4ZXBC 4MD5A 3WJLA 3OXSB 4LOUD 1MJ7L 1T1YB 5D7JA 1J0HA 1GIGH 2VXSH 2HT2D 4NNXA 3GSRB 4YIQA 1FNSL 4OCWL 2ZJSH 3I50L 3MA7A 3QUYD 5IVXF 4KKBD 1XCTA 4MYWB 4HGWB 4JFOA 4P57A 5F89A 3UJIL 5JIHA 4IMLB 4N9GA 3BPNC 1YEKL 4UDUA 3RU8L 4S1SH 4DVBA 3NAAL 2PCPB 5AYUL 5IEHB 3BO8B 1MFDH 4IRZL 1U36A 1KIRA 3S88H 1EMTL 5ICYA 3DJ9A 5EZLB 3EYQD 4K94H 4ZXBB 3OJVC 3WHXB 3SKMA 3PP4L 1QLRB 2DM7A 3TO2B 4U05A 4NSKA 2XZAL 3FQWA 4HH9B 1T7YA 3P2TA 2DJSA 3IDGA 3FO0H 5DXWA 3IGAA 4GJTB 1JYWA 3K1KC 5DHYB 2A83A 5GGUA 1EGJA 4CJ0A 4RGMC 3VXTA 4LHJB 4ONFH 5FGRA 5EO0B 2EDHA 3BPNB 4UIKL 3EJYD 5JW4Q 5TDNB 5FDWA 2GK0B 1BLNA 4K7PL 3W0WB 5DJYA 4ZD3H 3DYMA 1N5YL 2V2WB 1Z0NA 3S4SG 3ARFC 5FB8B 4JDTH 1BAFL 4XX1G 3RL1B 3X11A 3VD4A 1W0YT 2I9TB 4E41E 5IMKB 3BDYL 4KK8D 1MWAH 3H9SD 2JB6A 3EJJX 3O6LL 2E9BA 3WL9A 3DHMA 2RGSA 2V6HA 4KRPC 2GIYA 1JHTB 3SGKA 4GLRH 4RGMB 3MBXL 4P2YA 1N64H 3E8UL 4EOWH 4Y5VC 4JO1L 3MOAH 4CADA 3LN4A 2A2QT 4ODUB 1IGYA 1AGCB 1HKLH 4OZGF 3ARFB 3GSNB 1VGKB 4QHKJ 1IM9A 1MHEA 5GHWH 1NSNH 4RZCB 1P2CB 2LFGA 1G84A 3SJVB 5HHNB 4PJCB 2R1XA 2HTLC 3W9DB 2O61B 3IAQA 3ISWA 5BRZE 2Z93A 3U9UB 2VDML 3LQAC 4QTIL 1AXTL 2PTTB 1L7IL 1G9MH 4Y5VB 2PKDA 5JNYB 1R3LB 1ZS8B 1MHCA 2BVUA 4PJHF 1JZ6A 3BP5B 4FMFA 4OT1L 1XF4B 1SY6L 3DX8B 1FGVL 2DDQL 3ELAT 1UB6A 3RNKB 1JGDB 5DK2A 3LCYA 2LV4A 2N56A 3VXMA 1XR8B 5GZOC 1SEBA 2IPTH 3U2SA 5L7XH 3ARBC 3KLSA 4JFHE 3GHBH 5I1JL 2BOBA 4UBDC 4XXCA 3HMWL 2DI9A 2EKSA 4Y2OA 2OL3A 5FIEA 4J4PA 2RCSL 4EDXB 2CDGA 5HVFB 3BD3A 2V17H 4M7KH 4GG6F 4Y16A 2PXYD 6FABL 3RWCB 4M8VA 1PG7L 3PABA 5IEKB 3O4LE 4GRLD 1KPUB 1FDLH 5M94B 2ICEA 1PAMA 3JWNC 3EZJB 3TFKC 5DC0A 1WBXB 4QOKE 3PHQB 3O3BB 4OIIL 5E4EC 2CQVA 1JGLL 5IOPB 1OF2A 3PXHA 3ARBB 1JHKL 4TQEL 3ZKMC 3CVHH 5K9QI 2AV7B 4M8QB 2LU4A 4OM0L 4HKXA 4PTTB 3LIZH 1DQQB 2AEQL 2UWEF 5EUOE 1JTOA 1KFAL 3LV3B 3RAJH 3QDGD 3IDMB 4GAJL 4L3EE 1NEZB 4WCYL 4PB0L 4RMQA 1T21B 2CPCA 1LHZA 4PJXE 5BV7H 4G8GB 3C5SA 3AM8A 4PRHA 5DRNA 3VFOA 5E0QA 1M6OA 5JW5B 3EYVA 2BHUA 3SE4A 5IFAL 5E4EB 1JPFA 4HJ0D 3QIWD 3RTQA 5CGMA 3V6FA 3QIUC 1JV5A 1NC4A 3PJSB 2D0GA 1UKSA 2ZUWA 3G08B 3KWWA 4NHCH 1RJZA 3OKYA 5EUKA 5I30H 3U0PB 1CD0A 1G7LB 3K4ZA 4YK4C 4WEBH 3JTSB 4P59H 5CJOL 1WEJH 5KSBF 3TBSA 3CDGB 2J8UB 4I3SL 2OR9H 5DGRA 3BUTA 2EC9T 3HC3H 5D1XC 3TLRA 2YC1B 2Z8WC 3KVQA 2BDNH 1HH6A 1EUTA 1T7WA 4M1DH 3ZDZF 1ITCA 3QIUB 1ZOXA 3HRZA 2APVA 4MJ5A 5ELIA 3QUZC 1I9JH 4JFDD 2WINA 4PJCF 2DQDL 1M7IB 2Q20A 3C5ZD 2DWDA 3DETC 1YN6A 4I0PD 4HAGA 1FFNB 2WBWB 2B4CC 2HKFL 1B0WA 4RFNC 2CIKB 4YK4B 1WZKA 4APQA 3FONB 1NC2D 4CN4A 4KVNH 5BS0A 3BI9X 3SHSA 4CNIA 1CCZA 5F7MC 2F53A 5D1XB 3P4MA 4JM2A 1NJ9A 1YNLH 5CINL 5E8EB 5HDQH 2PW1B 4NKDA 5EZJA 4ZSOB 3SE9H 1NGPL 4DTGH 5I66B 5D5ME 3QUZB 2C4FU 3NVQA 5CWSA 5GS2H 5HGAA 1AI1H 4ZUTB 1KCUH 2P5WE 4JFFE 4HF5H 4CVZA 4NOFA 2FJGB 4PJEE 4RFNB 4BKLB 3MRDB 2MPAL 5F93C 2AEPH 1BOYA 3RI5F 1XGTA 2XG4A 3H7BB 5BVJB 1TZGL 3GI9H 1KUMA 1Z6JT 5CJXA 2P5EA 3GSUB 4OI9A 3QP3A 5J1SC 1D5IH 3QUMH 4Y8AA 2XZZA 1DVFC 5H94A 3FN9A 3DRTB 3LRGA 4FP8H 2BNQD 4N8VB 4O5LL 4XP9H 3VXSE 3C2SA 1DUYB 2BVOA 3QQ9D 4HLJA 3VI3F 2D03H 3WIHA 1XIWC 1UJTA 1JHLL 2GT9A 1SYVA 2VNCA 1RZ8B 1NKRA 3ARTA 4BSWB 2HLAB 1XGYL 1FZOB 2R23B 1H15B 5C08D 3QFDB 3KPTA 4KK5C 1X3DA 3G5XB 1IGJB 5BCAA 3IS0X 1AFVH 4R8WH 2BMKB 4PS4H 1CXFA 5FUOH 2FJFB 1GPOL 1P7HL 4U1IA 1DVFB 1S7SB 1QRNE 1A1OA 4AH2A 4KRMB 3V6ZA 4UTAL 1JN6B 1UC6A 1Q0YH 4JZJA 1KPVB 1XIWB 3B9KB 3MV9D 4XNXH 4AEIL 4V1DA 4L9DA 2ZNXA 5DZOA 3T8XB 3DURB 4UT6H 3HI1B 3TO4D 5E7BA 4M93B 4WY7L 1IGIL 3CFJB 1YN7A 3UPRA 1RV6X 4M7LT 3QI9A 4LAQH 5IIEB 3UDWC 4NKOB 1NDGB 3MCKA 1NANH 2YHGA 4XBPB 4LCIL 4BQ6A 2E9JA 3QCTL 5I9QC 4ONHB 2F8XC 2XFXA 2WIIB 1N59A 3QIBC 1TVDA 1B0RB 5L9DH 1NUDA 5KVGH 1BMGA 5T1MA 3JV4B 3T2NH 4OZ4A 5CMAA 3GIZH 1X5KA 2FEDD 4NKIH 1CZ8L 2MOVA 4HS3B 1FL5A 1QNZL 3NIGF 4HIJA 4NQEB 4QTHA 3TWCH 5FYLH 2ESVD 4QRRB 1RZFH 3TBYA 1BQHA 1N6QH 4Q2ZB 1FN4B 5I9QB 3LKRB 4PJFB 4A6YB 1AD9A 1XR9B 2HJFA 3QEQA 4HK0A 3HI6L 4JLRB 3SDAC 4X5XB 3HZMA 3MOBH 5EFIB 3PWNB 4LHUG 4JAMA 4WDIA 3NFNA 1ZXQA 3AGVA 5DZLA 4L4VE 1KB9K 1E4XI 3HAEB 4OUUB 5C1MB 2R2HB 5HYQB 5D2NE 5F7HA 1CFSB 4MSWB 1XCQB 1KEMH 5LCVL 2R29H 4X6BB 3ZT5A 5D2LE 5C09D 3QNYA 4PRNA 4JGMA 2HKHH 3JWOL 5D1QC 3TBTA 3V5DB 2E27L 3RWDA 3SDAB 1EXUB 3QCVH 4JDZA 2YXMA 4WHDA 5ISZB 4ZPTB 5EOQL 4FZ8L 1BF8A 4LSVL 5EBWB 4FQ2H 4NRZA 4LLWB 4HUUA 3S37L 4QRQA 1ZK9A 5J3HC 4LL9A 3RIFK 2EYSB 1L0QA 1RJYB 3DECA 4OZFA 3WUWB 1KJVB 2N7BA 4OFYD 3RNQA 1A7NL 1CYGA 1CGWA 1M71A 2H32H 5E6ZA 3D3VD 1JGUL 2F5BL 5E6YA 3MCLL 5CJQL 5D7LE 1J8HD 3PWVB 5EA0H 2ITCA 2DQHL 1BIIA 5H2BA 4PJBE 1BBDH 5GS0C 3FQUB 5IP4A 4RWHA 1JGEB 4ZPVB 2OR7A 2P45B 1OWWA 4QRPA 1U92A 5CGYC 2C1PB 2CDEB 4KJWC 1HSAA 1A1NB 3MUJA 3N1QC 4EUPH 3C6LA 5C0FA 1ZLUH 2CIIB 4KC3B 3R4DA 1UXSA 2A6IA 2FATH 3DVNA 1INQB 2J6EH 3VG9C 5BZDA 1GAFL 2PO6C 1GGBL 3CVIL 2F19L 2PN5A 5E2VL 1E6JL 3WCYA 3VGEA 4G8IB 4U33A 4M3JA 5GRZA 2NPLX 5I17B 4M7JH 3JV5A 4WI6A 2YPLB 4HZAA 4Z9KB 1GGTA 1SBSL 3U7WL 3KLHD 1J12A 3L7FA 4KGLA 4OKVB 3VG9B 4PJFF 2PO6B 5DQDL 3SGEI 2OZ4A 1RUML 1UWEH 4I18A 3QEGH 5D7JD 3QDMA 1DQJA 1QHOA 5IROC 1OPGH 1K8IB 4KY1L 3K8KA 2H9GA 3KNBB 4XC3H 4LASL 2AV1A 1CE1L 4RFOH 4XWOC 3TC9A 5TGBA 2WZPD 3LKPA 2EXYC 2E9IA 5CEZD 3RUGE 4Z0BL 2WNGA 4HIEB 12E8L 2X89A 4XHQA 3GEWB 3ULUD 4ODBD 4ZDHB 2AJ3A 4GQ9L 1MNUH 2P7TB 3BSZL 3CXDL 1MLCA 5F8RC 2ADJA 4ORZC 4UNTA 1U8NB 2GITB 4HMCA 1NLBH 1QA9A 5CBEA 1K6QL 4ZAKB 2VL5B 4LLDA 3QZWG 4WFEE 4GSDH 4KMLB 5FYJD 2VZVA 1S7WA 4HUVB 1IAKB 2K7QA 1W72A 4PJGE 5HHPA 3EGSB 3U4AA 5IM7B 1QSEB 4ETYA 4KGJA 3OSKA 5IB4B 1X5GA 3P9MB 1OAYL 3RVXC 2ITDA 4MJ2A 3SBWC 3SDCD 3V4VH 2DTML 2B0SL 2XWTA 5ICZB 1KB5L 1I3GL 1D3CA 1FE8H 4JFED 5CD3B 4S1RH 1HHKB 1MRDL 4PP1D 1KJ2L 4FFYL 4EUPG 1EEZA 4MXWH 4PGEB 4DGVL 5AD0A 2OQJB 3ORJA 1EHAA 3HKFA 2DQIH 1ZANH 1WZMA 5C09E 3HI5H 1A6ZA 1HDMB 1NDMB 3FN0L 4HUKB 1IRAY 3WXWH 5F3BB 1HQRB 4M61B 4OF7A 4HPOH 2BOCB 4BQ8A 1DN2A 4F7TB 3TNMB 1FYTA 2EZ0D 5C07E 1JL8A 1AO7D 1JI2A 3TPUA 4FQHA 1PVHA 1VEPA 2ZG2A 3AVEA 5INDA 4WW2A 5EU6E 5LGJB 2HRPH 3DIFB 3KPNB 1MEXH 4ESKA 1HHGB 3D2UB 1CLZL 4ISVA 4H0GA 5GGRB 3PL6C 2VXVH 3FOLA 4O2CB 3QO0A 2Y5EA 5DD6B 4OTXH 4ZO8A 2XQYG 4U6YA 1AC0A 4PPTA 1BZ9B 2V5RA 1SJXA 2FGZA 3OKMB 2W0FB 4TVPL 4G9FD 3MRPB 1RFDL 1GHFL 1D5ZA 1YYML 5DDHB 2DD8L 2F9BT 1LP9A 3K81A 1JNNL 2HVJA 2G60L 3RGVA 1J0ZA 4RQQB 2X1OA 4C4KO 2B7DT 3BZ4A 4XH2A 3QHZL 1TJIH 4ZMAT 3PL6B 4LKCA 1VFAB 2OJZL 3NIFE 5FUCC 1L9NA 5KSUA 1EFQA 3IDYB 4OZIB 5LGHH 1XF2A 4AEHH 1A6AB 4U1SA 1DUZA 5C86A 1QYGL 1GVIA 2B2XL 1CD9B 2Z8SA 4QHLB 3V6BR 5IR1B 4HC1H 5GIRA 2QTEA 1BECA 1S3KH 2BVTA 1U6AH 4DEPC 3WYRA 5CP7B 2V7NB 1RZKC 3UPCA 5CP3H 1UEMA 5ADOL 2W60B 5A40E 3FCTB 1I7RA 3CFEB 5JXAL 5HYSB 4JQIL 4PJ5B 3GJFB 2FR4B 2UZIL 2OMBA 2WUCL 5EN2A 3VWKC 4PGJA 3EOAB 2BHZA 3V2AR 1LNUA 5HHQA 3PE9A 4LCWB 5MI0C 1FNHA 4I77H 4PJIB 1AY1L 3JV0A 3SKNB 4JN2B 3FQTB 1K2DB 2VDNH 4XBEL 2C1OB 2IALB 3BOVA 5D1ZA 4N0CD 3AC0A 5DHVB 5HHMB 1NLDH 4DEPB 1S9VA 3DNKA 3K8MA 4LSPH 1CG9A 2NMSA 5A2IH 2X1PA 3M8OH 4MB5A 1QD0A 1YJDH 3F62A 3VWKB 3ZE2F 5IJKA 4OCYH 2BSSA 1NMBL 5F7DB 4ALAL 3OV6A 1IVLA 3L3HA 3K80A 3TIEB 4PB9L 4TPRL 2FYYA 4POUB 5C0DA 5TF1L 2A6KB 2Y7QB 2LVCA 4P9HH 5HGGS 4DGYH 4WJ5A 4XWGH 5IQ7L 4G42B 2CKBH 4H5SB 3A67H 1TIUA 1QR1A 3ARDA 4F9LA 3T3PE 2E7LC 4IDJL 1U3HD 4JY4B 1JUFB 5BJTB 4E0RB 1MIEH 3O11B 4FNLH 3HHRB 4L29A 5F7EL 2P46B 4JVPA 2KBGA 3MNVB 5CHNB 4NUJA 5AAMA 4Z8FH 1G7IA 1LO5A 4QHUB 1GOGA 4PG2A 4JN1H 1K5NB 3BP4B 3B6SA 1IEBB 1MHPL 5E08H 3MJ9A 1Q72H 4JM2D 3EOTL 4WHYH 5IB3A 1T04A 2VLLA 2BY2A 1D6EB 3GGWB 3WFEL 4TOYL 2EDWA 4U2ZA 3ECBB 1J18A 3O3AB 1YEIL 4WTXA 5IT2L 3PWJA 3IYLW 5C0AD 3KPQB 1R3IL 4FXKB 4P2RD 5GJSH 5JXEA 2XWBA 4OV6F 5ESVA 4XCYA 5TDOB 4M6AA 1J86A 4U7MA 5LG1A 3FT2B 2XQBH 5FF6B 4FTVA 1RIVH 1FNAA 1ZA3A 5BO1H 4XPTH 4YXHL 1BQUA 1MFEL 3VFNA 5DUBB 1T83C 4ZUWB 3CFKA 3OZ9H 5BQ7A 4NO5B 5EOCL 5F96H 3X12A 3REWA 5DT1L 4MHHG 3MLTB 4JRYD 1DQLH 5F8QC 3RWEB 2D4DA 3KG5A 4JFZL 5TFSH 2CGRH 4MCYA 1OW0C 1E27A 3O6FD 5IB2B 4QHKI 3VXME 5DJ0B 2FLBT 3U7YL 5GGVY 2ICES 5JW4M 4YHLL 3V0VA 5DD3L 4W70A 3QUXA 1DDHB 5FV2A 1GC1L 3UXFA 1FFRA 3V5KA 1T66C 2ADGA 3DO7A 1MUJA 4OCNC 5L8KB 1IKFL 4WWKD 1FV1A 5B3NA 1IGTB 3MJ7A 2X44D 4BK5A 1MFAL 1ORQB 4O9HH 3MJ8A 1RIHL 1HWHB 4WI3A 1ZHBA 5DO2D 5ABDE 1OAQH 5DSCB 4F7EB 5GJTH 1T5XB 3C9NA 1RHFA 1X4XA 2IANA 4NGHL 1CGUA 5C7XH 2D3VA 1N4XH 4OD3L 4PBWD 3MGTA 4ZFZA 3SDYH 4K9EL 4M7LH 3MPCA 1VADA 4R97C 1QTYT 2GSGB 2X7LA 1IM3B 1CQYA 4KV5F 5I15L 4PRHE 1KJ3H 2Q7NA 4ELMF 3TBVA 4PRIB 3HMXL 3PQYB 4KKAD 3HG1A 4FQQB 4WHYG 3CFBA 1G7HA 3BKMH 2AJUL 4R7NA 3IRPX 2ARJQ 1S9YA 3LS4L 4QHNB 3S5LB 1IBGL 2VC2H 5TE6L 4Y2DA 1S5HA 2HJLA 4BQBA 5JHDB 1G1CA 1NL0H 1INEH 2H2PD 4ZNEA 4XVUD 1JPSL 5AZ2L 1IC4L 1VACA 2EIZB 4G9DA 1CK0L 4G5ZH 4K8RH 4R97B 4GRWF 4LEXH 5DEFB 2JJSC 2K7PA 4Y1AB 4OQTH 4EXPX 1WCBB 3QPXH 4DZBA 1U2HA 5IESL 4MNQA 1S7QA 2A74B 2YPKA 3TH3T 2VOTA 4XPHL 2VE6A 2GAZA 3NCMA 5EBGA 4WGWB 2R1YA 4HUXB 2VAAA 1Z5LA 1JPTH 4P4KA 1AGFB 4PGBB 5GSVA 4W4NA 1EAPA 3O81A 3RI5K 3MMEA 4XC1H 3O3EB 2QSTA 3BD4A 4YHIB 3R06A 2FSEA 3W0WD 5HSFA 1G9NC 2X41A 2D0FA 3LAFA 3WBDA 3I6GA 2QR0A 3VH8G 2IBGA 5BS0E 4F7MB 3VDAA 1N7MH 4JPVL 4G6JL 5L2KD 5FA3B 2F53E 4JHAH 2OL3H 3QXAB 2DF3A 4GKOA 4NO0B 4PRAA 1CE6A 1NGZA 5INCA 2AK4B 1BQLH 2BXZA 4LVHC 5GXBB 1UZ8A 1A3QA 2OCFD 4J8RB 4JFYB 1CDUA 2VISB 4I0KA 2B39A 3V0WL 1QZ1A 3SEPA 5HHXL 4I48A 3NIDF 2AJYL 1XZ0A 3V0AC 4YHZL 1YQ2A 5HYJD 3L3GB 1RK1B 5DGQA 1K8DB 3LSOA 1J1PH 4HGMA 3E3QC 1FFOB 3GB7A 3U79A 1MI5A 1C12B 4L1DA 2I60H 2ZSVA 5LAXA 3AXLA 2P5EE 2K1MA 2F5AL 5D9SA 4QRUA 4XCNB 3ZSTA 4W6WB 2IG2H 4LVHB 1FC2D 5GRVK 1ZLSH 4KRPD 4D0DB 1TENA 3ZT6A 2EH7L 1RUKL 2ATKB 5F9JB 1CU4H 4FFWD 3C6LD 4NRXA 4R4BA 1I8IA 1A14L 1U8IA 4UAOC 4U6HB 1JMXA 1N3NA 1R3KB 4CVXA 3SY0A 1KLGB 1CT8B 4YPGB 3NFPA 2WK2A 3QCUH 1UYWH 2OS7A 2XTJD 3JWDC 2F54D 3LDBC 1DQML 3O3DB 5K9OA 3FB5A 3FQRB 2AXHA 1DCLA 4M1GL 4XCFL 1AGEB 2GSIA 2QSVA 2Y23A 3D69B 4F58H 1BFOA 1WT5C 3MROB 4M5YH 4LARH 3TYGH 4KAQH 3ZMRA 4RGOL 3OBAA 3OKNA 4LSQL 4GQPH 3DUSA 3OG4B 4K3EL 4AM0B 3VI4F 4UIMB 3ARGC 1F4WL 4UAOB 2W1NA 4ZFGL 3UYPA 4V1DE 3ZO0A 2OJEB 1OP3H 2Y25A 1DSFL 2NCMA 4ODWA 2FECI 4OFPA 4B0MM 1WBYB 4U1MA 5IMOA 3QG6B 1I7ZA 3B9AA 4MGXA 4BFBD 5CGTA 4OV5A 4PJDA 1MY5A 5GZOD 2EDKA 4Z78A 3VRIA 1I1RA 2VIRB 4GKNA 3HR5B 2UZYB 2VXTH 4UBDD 3FKUS 4FXLA 1SEQH 4KRNA 3B3IB 4NZTL 5JOFB 4O58H 2B1AL 4OUOA 1TPXC 4ONGL 3F7YA 4LLVB 1FLTX 4NZUL 4R3SA 3OJMB 1AGBB 1JZ2A 1ZLVK 1KCLA 1MF2L 1YMHA 4G80A 2GTZB 1GIGL 2DM4A 1IZKA 4G8GD 4WI5A 4X6DA 5F7NC 3T0EA 1N8ZB 4LLQA 3ZE1E 3LKOB 4L5FH 3T4AA 5IF0A 3AY4A 4D0BA 2ZJSL 4JQVC 3DRQA 3TFKD 5J06A 3LEVH 5EBLA 2XG5A 3ZKMD 4S1SL 3QULA 5SX4I 1NAMA 4FFVC 5C0JA 2DQEL 1MFDL 3KPSA 1FRGH 1TPXB 3QRGH 3QEQE 3SDDD 4B53A 1UB5A 2AXJA 4K94L 5L8LB 3L95B 4TUOB 4DWHA 3OKKB 2VR4A 4GG8B 5FOBB 3ARVA 1QBLH 1UM4L 5MENA 2I5YH 5C0CA 4Z7UF 1A7QH 3FO0L 2BSED 3P9LB 4JPKH 4JO4H 4ZOEA 5ESQB 3MRHB 5D72H 3GSOB 2DQCH 3KJ4C 2ZOLB 4U6XA 3VD5A 3RBSA 2IAMA 3WIHH 3QIUD 4ONFL 3NZ8B 1AIFA 2DLEA 4MXQD 4HUWA 1JK8B 1HI6B 3PXJA 3Q6FA 1QO3A 4ZD3L 3GMPB 3JBG7 2C3VA 1WFOA 5KSVA 1TLKA 1JWMA 1WV7T 2ADIB 4I8DA 2R2BA 4UI2A 4Y88A 3THMH 3CLEH 3P0VH 2H26A 2ZSWA 3MXVH 3VFSB 4C83B 4IRJC 4YXLH 2DMKA 5D1XD 3SKUD 5KSAC 1H5BC 1FVEB 3V95A 3CFCH 3TCLA 4N5ED 5HI3D 3KJ4B 4LIQH 4LLYB 3U0TB 4R4NC 4U0QB 1N64L 5SV3A 4EOWL 1F90H 3I6KA 3MOAL 1DLHB 2QQQA 4CJ1A 1CD8A 3MLSH 2JKXA 4I2XA 4KMTH 3ULVC 2Z91B 3IVKB 1BJ1J 1HKLL 2OLDA 4ZFFB 1T4KB 1K4CA 5GHWL 4RDQG 1HEZA 5CSZA 4LPXA 4FXGA 3MV01 4QRPE 3VD7A 4IRJB 1MAJA 3JV6A 1JTTA 5KSAB 1H5BB 1P5VA 2R1WB 1OQOA 1HN1A 3I3EA 2NW2A 3H0TA 3CAFA 4BFIA 1GOHA 1G9ML 3BZDA 5D4QA 1UXWA 2EYRA 5DJZB 4U1KB 3BH8B 1M1SA 4YBQD 3GSXA 3IJHB 1AHWA 4YAQA 3O41B 3RWJB 3AS3A 1D9KC 3DX6B 1B88A 5B38B 3ZT7A 3UBXA 2IPTL 5L7XL 4RGNE 3GHBL 4H0HB 4LU5H 1X4ZA 2GQHA 2FHCA 1A1MB 4J3WA 4M9PA 2Y72A 1BX2A 1XF3A 1G7QA 1WC7B 1DVFD 1NFDB 3LQZB 1LDPH 2V17L 4U3HA 3RL2B 1S7XB 5JIIA 5KS9F 4BJLA 4U1GC 3S6CA 1XIWD 3DLQR 3DMMB 1FDLL 1J0KA 3MYZA 4MXVF 2PR4H 1D9KB 2MHAB 3QDME 5IVNA 32C2A 2YD1A 4JY6A 4JZOA 1SM3H 1I1FB 5T33H 3CVHL 5E5MB 5MERA 4LRIA 5T1LA 2NXYD 4BH8B 4CBPA 2YD7A 5GRJH 1GH7A 3MODH 4JVWA 4YO0B 4XHJC 1I85A 2XACC 3RAJL 5KANI 3QQNA 4ENEC 3U82B 4HKZB 4GBXD 4PV9B 3JTTB 3WDHA 5BV7L 3CPLA 4GRMA 2AQ2A 4YR6B 3OAUH 5HYEA 2H1PH 4G43A 5DFVC 4YBHA 3WSQH 4D3CH 2EDOA 2JCCB 2GUOB 2YMXH 2ZUVA 4OZFH 2E7BA 4L1HA 4HIIA 1P4LB 1ZV5A 5EZOH 4J3SA 2O26U 2Y4SA 4NO3B 4EN3B 1MH5B 2UVEA 1AKJB 3E6FA 4NHCL 3IF1B 4NT6B 4KKCC 3Q48A 4OLYH 4ERSH 1A6WH 4DOHB 4ZG1A 3ARDD 3OG6B 4WEBL 3QIBD 4P59L 1WEJL 4Z18A 5DA0B 5DI8A 3OMZA 3KPPB 4NM4H 1ZHKB 4PUBH 2OR9L 2MQCA 3HC3L 3MRRA 4HDIB 2ZUQC 3BISA 4H25B 3MR9B 4KI5C 2VLJA 4M1DL 3EO1A 2CH8A 3BT2H 1UH4A 5FXCH 4X4MA 4IJ3C 1I9JL 1BVLB 4PRPD 4YWGL 2GJ6B 1UG9A 3RP1A 4HG4K 5T3XD 4HWNA 4L4TA 3U7AA 3W5MA 3UTSB 4E42B 1FYTE 2KPNA 1K4DA 3UP1A 1N2RB 1BQHG 5IJVA 5H35B 3QEUB 4LCYA 3ULVF 2P24A 4MX7A 1U93B 2VQUA 5EIIB 3DPBA 1YNLL 5HDQL 4P2OC 4Y4HC 1HIMH 1HSBA 4NUGH 3T3MF 3SE9L 1EA9C 4QXUH 3V6OA 2E6PA 4IJ3B 3UZEA 3KYMA 5IG7A 2HWZH 1AI1L 1WWCA 1KCUL 3BZEB 3FHAA 4HF5L 3SE3C 4MDIA 4JFPA 3BIKA 3RX7A 7FABH 1Q9OA 2AEPL 2A1WL 2DBJA 2BJML 5D1QD 3U4EA 3O2VH 4IIQA 1FL6A 4M62H 1I3RB 2DLHA 3D85A 3ARPA 3GI9L 4PJ9D 5E8DL 1LP9E 1P7QB 3L5WA 3OJDB 2EE2A 1KIPB 2XICA 1K85A 4LEOA 4P2OB 1EEUA 1K3IA 4Y4HB 1FJ1B 4F80A 3WEXB 4FP8L 2AKRB 4TRPH 4XP9L 4FS0A 3QWOB 4GS7C 1JZ4A 4NQDA 5J3HD 3BRGC 5SWSA 1WF5A 1B6DA 4XNMB 43CAB 1KNOB 4IRSC 5J1AA 4X6FB 4OB5H 5TQ2H 4PLOB 3MTRA 1X5FA 2BY1A 2K3TA 2CK2A 4OZFG 5GS1A 2XT1B 4P46C 5GS0D 1AFVL 3FT4A 4PS4L 5FUOL 5JIKA 2JCCF 1FNEB 1ZLWH 1W72H 5IMLA 4KJWD 4GS7B 5HD8D 3OXSA 1CLYH 1LO3L 1Q0YL 1I1AC 3T2QA 4IRSB 1GCFA 3GSRA 1JPGA 1P69B 2EXWC 4XNXL 4CGTA 3VGHA 3AAZB 4UT6L 2PO6D 3QT2A 1S5IH 1C7SA 2X4TB 3IDJB 3X3GH 1CTOA 1GL4B 4XMPH 4P46B 2D31B 2P43B 2VZSA 5FO9B 4LAQL 5DA4A 4X6EB 2BNUB 5I8CB 5IEHA 1W0WB 3BO8A 3MNZB 5SWQB 5GISH 1T0MB 4X9GA 4ZXBA 3OR7B 1XGPA 3VFUB 1CDGA 2P8PB 1I1AB 1JRHI 3KDMB 1H9VA 2VDKH 5KVGL 4X6CF 4D94A 3WHE1 3DBXB 1AXSA 4GFTB 3T2NL 4UMGA 2B8OT 1FGNH 3GIZL 2VDRH 5DHYA 5TH2A 4NKIL 2XA3A 5EO0A 5FYKU 3TWCL 5FYLL 5SV4A 4I5BB 1RZFL 4KI5F 4C56D 4WV1C 5FKPA 1ZAGA 5J12C 2V2WA 4GUPA 5JDSA 1CIDA 4PGZA 1KCSH 1QSED 4M43H 3RL1A 2ENSA 4CU8A 3MOBL 4XPFH 2EDQA 2I9TA 1KCRH 1MJJA 2C9AA 3GKZA 1Q1JH 3GFUA 5J89A 4QO1A 1I8MB 1MLBB 3KYNA 2MQ0A 4S11A 5A16B 5J11C 2Y07L 1HHHA 2YUVA 2PYEA 3U36B 1KV3A 3GJFK 1QFUH 2R29L 4XI5D 5B39B 1AGCA 1FL3B 4WV1B 4GKSB 4K3HA 1NCNA 2VDOH 5J12B 1PD6A 1OSZA 2HKHL 3ARFA 3B8YA 4ORGB 3WJJA 3HZYA 4HV8B 4BZYA 1VGKA 1BZQK 4NCDA 4IS6A 3QCVL 4UDTB 2DWEB 3P4OA 4MQXC 2P8LB 3VXRB 3W9DA 2P8MB 2O61A 1YMMB 1U0QA 4G6KH 4FTVE 3OB8A 4FQ2L 3U9UA 1BJ8A 2NTFA 4L3CB 1MWAB 4Y5VA 5JNYA 4OLZH 2BNRD 5J11B 4LDLB 4RAVB 1HXYB 3D2UD 1KT2A 4HAFA 3BP5A 3WUZA 1WAAA 1ZA6B 3DX8A 5GGSB 1G9MC 4QXGH 3GK8H 3LB6C 2V2XB 1XR8A 3W9EB 1BBDL 3I2CH 4HCRA 4KUCD 4XBGA 1U58A 5SX5K 1F3JA 2AQ1A 1G7PA 2C3HA 3HCVB 3L7EA 3QQ4A 3TN0A 4XXDB 3IXTB 4K07A 2X4RA 3RWCA 1M7DB 1RZJH 4R6UA 4JY5L 1KPUA 2FATL 2EDFA 2J6EL 5FA4A 3ALPA 1WBXA 3HPLA 3PHQA 1D5BB 1UZ6F 4NN6C 5T5NG 3ARBA 3LZFH 4OCWH 5E2WH 3SDXB 5HVWA 3TH4T 3CX5K 3CFDB 4M7JL 4PTTA 1U3JA 1DQQA 2O5XH 1YEKH 3RU8H 1NBYA 3LV3A 2IANE 1EV2E 3J8F7 3VE0B 4OLXL 3RVVD 1FAKT 1OGAB 3FFDB 4HT1H 1LO2H 2NY2C 2CR3A 1HYRC 3MV7B 4LNVA 1UWEL 4LCWD 1A7PL 3QEGL 1IAIH 3O4OC 1OAXL 3MJ9H 1OPGL 5FK9B 3QB7C 3HG1E 3MBEA 3G08A 4XVSH 4XC3L 3VXUB 1DN0A 4RFOL 3PGDB 3BP6B 3U0PA 1V7MH 3CSGA 1G7LA 3EYFA 1T89A 2ZKHH 3JTSA 1N5YH 4ZNEE 3CDGA 2J8UA 1VSCA 2NY2B 5JR1H 3QDJB 1MNUL 5E9DB 1ETZA 5B8CC 3VRLF 3REVB 1F6LL 3BDYH 4NDMA 3O4OB 1AGDA 1NLBL 3I6LD 4MNQE 3HMXA 5DQJB 2R15A 4GSDL 1FFNA 2OR8A 2OMNA 2YUXA 4JO1H 3N1GC 1CGSH 5F70A 1P7KA 1NANI 4ZODA 2CMRH 3FONA 1TNMA 4P5TA 4OZHA 4Y4FA 5AWNH 5I6XC 1KPRA 2NX5A 2ZUYA 3V4VL 4R26H 1OD9A 5JLZB 5MP6H 1EJOH 4QF1B 5B8CB 1A4KB 5E8EA 2PW1A 2YEZB 1WVZA 4S1RL 3BEWA 3MSPA 5I66A 4MXWL 5HHOA 1CXEA 3BQUA 4ZUTA 3OB0K 1ZANL 3CH1B 5BRZB 3HI5L 4BZ1H 3K0WA 2FJGA 4PG9A 4UZGA 2YN3A 4LMQI 2HG5A 3WXWL 4BKLA 3MRDA 4PLKD 3G6JF 3TA3C 3D39D 4HPOL 5I6XB 1FGVH 3UYRH 3H7BA 5BVJA 4LGSB 3VGGA 3DHJA 1EVTC 3VXPB 4GW5B 4W81A 1FAIH 1MI5E 3BD5A 3RRQA 2YKLH 5IW1B 1P9MA 3CSPA 4N8VA 3HMWH 1T3FB 3STLB 2IGFH 4RRPA 1DUYA 1U8PB 3FFCB 1XH3A 3ZHDA 2RCSH 1IAOB 3HA0A 3UTOA 2VXVL 4U1LB 3EDFA 3NPZB 5FKAB 4BSWA 3EOBA 1CICC 5GGVH 3WS3B 4NWUH 3DVGB 2MKWA 3DYOA 3FO2A 3O4LB 4OTXL 3TA3B 4AQ1B 3UTZA 4PP2B 4ZFOB 3KPMA 4A2MA 3ZE0E 1LILA 3PUCA 3QUYC 3MREB 1NQBA 4KKBC 3VGAC 1JNJA 3NCYP