3T0XA

Fluorogen activating protein m8vla4(s55p) in complex with dimethylindole red
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
EPVLTQSPSVSGTPGQKVTIFCSGSSSNVEDNSVYWYQQFPGTTPKVLIYNDDRRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCLSWDDSLNGWVFGGGTKVTVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin variable lambda domain M8VLA4(S55P)
publication title A variable light domain fluorogen activating protein homodimerizes to activate dimethylindole red.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dye-binding protein
total genus 22
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3t0xA00
4PY7A 5IQ9B 4DK6A 1BZ7B 3L3DB 3KVQA 3T2PA 4L8BB 3MBXH 3BZFB 1QLRA 2X4RB 3GJFA 3WNOA 1NFKA 5J57B 3L7EB 4Y2DB 1JTPA 5FHBH 3BOVA 2V2WA 5I6XB 4X4YB 4XBPA 1I1AA 3MLTA 2PYFA 1ZV5A 1T6WA 5C0BA 1SJXA 1DBML 3WIHL 3ZKXB 1KJMB 3DGGA 4NUGH 2DJSA 2ZOKB 3FO9B 1GC1H 4QHLA 1TZGH 4Y5YC 4PJGF 1RFDH 2WZPD 1PEZA 1NCCH 4NOFA 4PRBA 1SYSB 3O11B 4OF0A 4XH2B 4Z9KB 2AEIT 4K2UH 5D93C 1A6AB 2MCPL 2BVOB 3C6SB 3UPRB 1DN0A 2J6EH 4APQA 3MACH 5DJXB 4XNMB 3RWEB 4WV1B 2HN7B 2H32B 3VXMB 1EFXB 1GJIA 2Z31B 1I75A 4I2XE 3ZE1E 1ZLSH 4UV4L 4BZ1L 5ICZA 5FM8A 2P5EB 3SDYL 4OZ4A 5DGQA 4KMLB 2X2YA 3ARXA 1F58L 1YECH 4OB5L 5SV4A 1B2WL 2DQCL 3IDGA 3T0VA 3EZJB 4OUUB 1CE6B 1SY6L 2LQRA 3FMGL 3HI6L 1KNOB 3BKCL 2ZSVA 3MV9B 3UJTL 4HWEL 4WGWB 1RULH 2DBLH 4MNQE 2ICWB 1KFAL 1U3HB 3MMEA 1B0RA 1V8HA 2NLJA 1J1XH 1XCQB 1UB6B 3AS0A 4F3FB 3T08A 5IB2A 1WQVT 2NY4B 3MUY1 4L4TD 4BFGA 3RA7H 1PG7H 4OI7A 3JBG7 4GS7C 4N9GA 1MAMH 5T3XE 1S7RA 4WY7L 4LSPL 3CMGA 2V5RA 2VL4A 5GGTL 1LVEA 5AZ2H 5HXMA 1DUYB 4TSCL 4LNRA 3OB0H 1I7ZA 1WWAX 1OSZA 3MNWA 2NX5B 1SEBB 3KJ6H 4W4OA 2FO4B 4G43A 3U6RA 3MRDB 2EDDA 2A6JB 5EZOL 4ODVH 5F88B 4MA8L 1NGPL 1K4CA 3CXHJ 1J0JA 1OF2B 1OM3L 3HN3A 1LO2L 5IJKC 4XCYA 2R2EB 3P4MA 5IGXH 1F2XK 3HZYB 1IAOB 1J5OH 4UB0H 3QDGD 4R2GD 3BIKB 5DK0A 5EUOA 5C1MB 1QBMH 4OZHE 1GZPB 2BJML 3DSFH 3QDJB 4KUZL 4HUWB 1PJ9A 1UQSB 2B1AH 4UAOB 3BH8B 2WINB 1ZGLP 4HKZB 3WDIA 4D0CA 2BCKA 3Q3GB 4DWHA 3IJSB 4MJIE 1NMAH 4K8RC 4PJIA 4YFDB 2YS4A 5JMOC 3MCKB 3AREA 5IESH 3GGWB 3L3HA 5C0CA 4FQJL 1AGEB 1NGYA 2B2XL 1QRKA 2L7JA 5D5ME 4QRUB 4QF1A 5CBEB 1MCDA 3CFJA 5DD6A 5D5MF 5I75C 2YUVA 3VXUD 5C0AB 5DJCA 3RAJH 5E6ID 3SKNA 3RWJB 4TRPH 4DN3H 3QCVH 1DTUA 2R0KL 3NABH 4H88H 3JTSA 5J6HB 2ESVA 4JGMA 1FNLA 1X9QA 3A6CL 4E0RA 2ZUTA 3V5DA 4U1GC 4ZAKB 4ELME 4RRPG 3V0VA 1C1EL 3ZDYE 3OAUH 3DYOA 2NTSP 4AYFA 3PL6B 5E2TH 4X5WA 4ELMF 3SBWC 3ZDYF 4LLMB 5KBNC 3RVTD 4RZCA 2IEPA 3P4NA 5F7DA 3BVNA 3VWJC 3OKKA 4UTBL 3WE6B 4FN0A 5IIEA 2ADIB 1NBQA 2IQAA 3HRZA 5AG9A 1BQSA 2CR3A 5MP6L 2CKBL 5J89A 5F7NC 2JJTC 4CADA 4L8DB 1MCIA 5DRNA 3TYFA 3QHFL 4POYA 3ETBF 3RVUD 1K5NB 4FQHA 3WN5C 1YNTA 1UC6A 3ZE2E 3PWPD 3DUSB 4BSVA 3CVHB 4O2EB 4I9WE 1INDL 1NGXB 2YEZA 4P2CG 4X7DC 1R6VA 3CSPA 3U36A 3GI9L 4DUXA 4R7NB 2PYED 2Y4SA 1I1CA 4ODBD 4U6XB 4IMKA 3V2AR 4JY6B 2AGJH 1MI5B 3EOTH 4PD4J 4GG6E 4I0PD 1HQ4A 4OBRA 2E7BA 3JV4B 1D5MA 2QR0B 4OZIB 1BBDH 3O9WC 1CZ8H 1A1NB 3W82A 1NCDL 5CMAB 1KC5H 4F37K 4QRPE 5I8KH 4NUJB 4QXTA 4DW2H 2JJSC 4UUJA 3MOAL 5C0RL 3ZTNL 4WEMB 1BFTA 4OLXL 4OF8A 5EUKA 1F3DJ 1YN7A 3BGAA 1V3JA 4HXAL 2WANA 5D7JD 5INCA 4JZOA 1UH4A 3TV3L 4JM2C 3U0WL 1P84K 3ZYJA 3VXNB 4AEIL 1JRHL 2E27L 4ZDHA 4U1JA 3QH3B 2GJJA 2FBJL 2AI0H 3IB4A 1CGSH 3CLFL 4OQ1A 4Q0XL 4B7IA 4ERSH 4JRXB 7FABH 5T1DL 1CR9H 3WEXA 1HHHA 4Y4FD 5TDNB 1FN4A 3D39D 2LE9A 4OFKA 3X3GL 2J3SA 1S7QB 3V6BR 3OAZH 1VFBA 3P9LB 5TQ2L 5CIPB 4CN1A 1FV1B 1XGPB 5I1JH 1PKQB 4HC1H 5D2NB 4RWYH 2HVKA 1FLRH 5L9DL 3CFBA 5JOFB 1AP2B 3UZEA 3LHPH 3JZ7A 2XXMB 2HRPL 1R3KB 1YPZB 4ALAH 5GJSL 3SDDB 2D03H 3NFNB 4PJBE 4Y0GA 4WIQA 4TVPE 3IFPB 1BECA 1DQTA 3O6LH 2A0LD 3VH8A 2VDKL 4KHXH 4PJBF 4BA8A 1T1YA 1HHJA 4Z95L 4OAWB 2W65B 3PJSB 2ENSA 3ULUC 4G8FB 3VXSA 4RMWA 5D70L 2WQRA 2QADB 3IDIB 5DJAA 3NIGF 5KOVC 3LIZL 2V9RA 3O6FC 4NPYB 3K1DA 3WJLC 1B0GB 5FKAB 4P49A 1KT2B 2W60B 2AJYH 4DZBA 2X44D 4PRAB 2P49B 4GQ9L 5EFIA 5MHSE 3RL1B 2A1WL 3T1FB 1C16B 1M7DA 1CLYL 2GJ6A 4HZLB 1CQKA 2AJUL 4JFPB 1KCUH 3FB8B 3V4UL 6FABH 5L0QC 1RJYA 3QSKB 3RU8L 4MHHG 2FECI 1I1YB 2F8OA 2VXSH 4P46B 4R7DB 3H7BA 2VLJD 4Z0XB 3UTOA 3VXOB 4KQ3H 4P2QA 5IVXF 2Q76A 4ELKB 4GG8B 3M1BB 3RTQD 5L7XH 2WBJD 3V4VH 1MRCH 2BNUA 1NEZG 3C5ZB 3I2CH 3B43A 3FQWA 4LASL 2A77H 4PRPA 3ARFC 4KQ4L 4M7LL 1T2XA 4I48A 4LKCB 4MNHA 5SWQB 5LWYL 4QRTA 4QTHA 5E8DH 1U93B 5EU5A 4XRCA 3P9MA 4MYWB 4NJ9L 3VXME 4EXKA 4I18B 4JANB 4XNYH 1T2JA 2Z91B 5ESAA 3RIAK 3RY6C 3VE0A 1AR2A 4JREC 3RPIA 3RVVD 2OTWA 5GZOD 1KB5H 3E2HC 3BQUD 5EZIH 1JTOA 2IH1B 1UCBH 2A74A 1FNGA 1JHTA 3GMPB 4DGIL 4J3WA 1URLA 2H41A 3MV9E 3SKOB 3ULVH 2Y7QB 4ZFFB 4XI5C 1MCPL 3MJ9L 5A16B 5TF0A 3EFFB 3BJ91 4JCLA 1WZKA 4AY0A 1BHGA 2FECL 4AT6B 4Q9CA 2V2TA 4KKBD 4LIQL 1YJDH 5IBLC 4L4VD 5GS2H 4P2RB 5B8CC 1CXHA 3PNWA 3TO2A 2DJ4A 2CQVA 3KXFB 4YHKL 3GSRA 1LO0L 1Q9WB 4N0FA 3GSNA 3X3FL 1LK2A 2O61B 3O8XC 1TQBC 2EDLA 5FIEA 5CHNA 5IEHA 3RWIB 1UZ8A 1W8OA 4KPHH 2CXGA 3V95A 3K4DA 5F7HA 4AL8L 4NZRL 2X9YA 5MI0C 2EXWC 1DANT 3S8WA 5EU3B 1RZIB 5E1HB 4HGWA 4HAFA 1AY1H 1E4KA 3NZ8A 5CJQL 2PW1A 3SDCA 2XY2A 2X4TB 5EBGA 4MNQD 3RX7A 1HIML 4Q6YA 2DQHL 3MRKA 2NX5E 3JWOL 4B7LA 1IC4H 4KHTH 2APTA 4JFHD 1TPXC 3MZTA 3BZEA 2Q86A 4XP4H 4OFYA 5F1KC 2OL3B 4PIRF 1MRDL 5EU4B 5T3XD 1GGUA 4ZTPL 5DO2D 3QJHA 1H3XA 2NY3C 5F9JB 2XQYK 1CVRA 1MCOL 3IXAA 1L0YA 4I3RH 2L0DA 4JJ5B 2UZYB 5IM7A 3QDJE 4KK6C 2P46B 4XNXL 3HUJB 2IAMB 2UUDH 2CDGA 3H9ZA 1HKLH 4NQSA 4KMTL 4KK9D 2FEDC 4ZFOB 5IHUL 3UROR 1RV6X 1DBAL 1LEKB 2HLFC 2IJ0C 4HSQA 4NRYB 1A4KB 4LNVA 2R8SH 1I7RA 1R24B 2AS5M 4F7EA 4GBXB 3PDDA 4J4PC 4LLYB 3WS3B 4TSAH 5KAQF 5KJRH 1TJIL 5LBSH 3NFPB 3QQNA 1FL5B 4HIHB 4KDVA 4U6TA 3CFKB 5HVHB 1JI1A 4QHUB 4HPYH 1I8KB 1T0NB 4N1CA 3T65B 3S98A 3CUPB 4O51B 1BX2B 4P5TB 2V5SA 4G8GD 5C0AE 5IV2A 3QUKA 1RZFH 4XNUL 5IMMB 4C56A 4DZ8B 2IFGA 3BW9B 3QUZD 4F8QA 3G6DH 1MREL 5CLTA 5KTEL 1IAKB 3DOSA 1P2CA 4PYGA 1ACYL 3PWNB 4E42A 4KZEH 3CX2A 4PB9L 4CMMB 2DQDH 2XA8L 4BFEA 5EN2B 4NDMB 3RZCB 3THML 2R9HC 3TNMA 2GTZA 3Q48A 2O5ZH 4QT5B 2HH0H 1F45A 3UC0H 3WKMH 3MRGA 3BPOB 2AKRA 4WJ5A 1N64H 2DQIH 3G5YB 3MV7A 2R56H 5F9OH 2HJKB 4WEUD 1NC4B 4L8SB 2WIIB 2F53B 1NAMA 4BQ8A 3RWGA 3SE4C 5F1IB 4MJ6B 4Z6AT 1RHHA 3INUL 4X6BA 5IF0B 4PJFA 5BCAA 1MI5E 5HGAB 1R3LB 4HWNA 5K93A 3L9RA 3PHQA 4HUVA 1KJ3H 4OZIE 4I3SL 4F80A 1ND0A 3ECBB 3CXDH 4PRNA 3O3BA 1F97A 4U1NB 3WHE1 3TVMA 4KJQC 1MHHA 1EERB 5C0DA 1UJ3A 4KJPC 1DBBL 4ZOAA 4WNQB 3FT3B 1I7TB 4TULL 4PJDB 2I24N 1IKNA 2XXCB 1JNLH 1NCTA 3VFVA 4P5KA 3LEVL 1MOEA 3AXLA 4XPFH 5E1AA 4Y8DC 1JWUA 3C60A 1U2HA 1GAFH 1H8NA 5I6XC 5J9PA 1BWMA 5DTFA 1I8IB 1G6RA 5ADOL 1JNNH 1ONQB 1HXMB 3GJEB 4XX1G 2WWKO 1RJZB 1QR1B 1RZ7L 1FNSL 2NY5C 2R4SH 4O9HL 1TDQA 4KDTA 5DQ9B 4RSVA 4FXKA 4NO2B 5L2KA 1GH7A 4ZPVB 4QRPD 4ZODA 4JRXE 4PTTB 5EBMB 5CSZA 5FK9B 1BAFH 4XC3H 1OTUD 2H9GB 4ZYKA 4XC1H 1AIFA 4Z0BL 1EAPA 2X9XA 5IQ7L 4ORZC 1PKQE 5D2NE 1TCRB 2AV1A 3I50L 1AR1D 2BY2A 1TENA 4YEFA 4KROB 5T5NG 1IC5H 4PJHB 5M95B 2EYTA 1J0YA 1BD2B 3TIEA 1YPZE 4YE4H 3FFDA 1F3DH 4K7PY 3VFOB 1J18A 1FZKB 2GK2A 5DF0A 1BQHA 3VG0L 1YPZF 4LHUA 4JPIA 1P7KA 1QPPA 1CFVL 3PP4H 4R3SA 4QGYA 4P23D 1CE1L 2I26N 4P3DA 5GGUA 3RIFF 3T8XA 4F9LC 1N0XH 1FJ1A 1FO0B 2D0GA 2WP3T 2ZOLA 3C87A 2I5YL 3RPKA 5T3XL 5EOQL 1DE4B 2IADA 2P4AB 3QUXC 4WHYH 5EU7E 4WO4B 3GMLB 2DLFH 3JTTA 2PO6B 3MJGX 4QLRA 3ULVE 2GSGB 3P2TA 1U3HC 2HFGH 3AS3A 4FFWD 3A67L 4Y5VC 2G60L 1HOCB 1OAUH 1HH9A 4F2MB 3ULVF 4LQFL 15C8L 3MYJA 4KJWC 3ARWA 5IMKA 5GGVH 2NY4C 3CK0H 5DLMH 3U82B 2I60H 1IMHC 1PG7W 3GRWH 1U3ZA 3MLWL 5E4EB 3QXDB 1FFNB 2EZ0C 5JW4Q 2ZCLH 1NANI 1KIRB 2VUYA 4G5ZL 3GIVB 5HYJB 1A6VH 4YNYA 5C7XL 3LEYH 1U92B 5INDB 3GBNL 3S37H 4M02A 1XF4A 4D94A 4LVOB 1UYWL 1T03L 1EGJH 4WWKB 1CK0H 1ODAA 4DKAA 1YMMB 3SE9H 5C0EB 4R26H 4UIKH 3GSXB 4NHUA 4NZTL 4YAQA 3L7FB 4X0KB 2D7QA 4LCYA 3SDAA 4IIQC 3GMRA 2OR9L 5DEZA 4XVSH 1CBVH 2WWMC 5MHSD 4FQXA 4U2ZA 1G7HB 3H0TA 3WIHA 3IJHB 4Y2DD 4MD5B 5E5MB 5F6HI 2XQBH 4IRSA 1F3RB 3NA4A 4CN4A 3RVXD 5CLWA 1NMCB 1X5KA 4S1SH 4NP4H 4LLUA 4XHJD 4AIZA 4R9HA 2F54D 3AS2A 1I8MA 2YZ8A 3DECA 4WUUA 1MJJA 3IDMB 5HYSB 5EOCL 1CDBA 1KOAA 5JXEA 4ODWB 4L1DA 2GJZB 4N0UB 3GSVA 4LPXA 5EC1B 4POUB 3R1GL 2Q8BH 2AJZA 3V9FA 1CXFA 2R29L 1S5HA 3MSPA 3MV01 3QUMH 4XWGH 3ARVA 3FQNA 3NCYS 4PGBB 2DWDB 2DKMA 3OHXA 4B41A 2KZWA 2VLLB 2GCYB 1YUHB 1S7UA 1HWGB 3G6JE 1EFXD 4P2RE 2GUOA 1T1WB 1JYVA 2Z31D 5IB1B 2Q3AA 4UINH 3KXFE 2W59A 1SY6A 4HWBL 4MZ2A 4LP5A 1QFWM 1QA9B 3G6JF 3B4NA 5I8EB 4U1KB 3V6OA 5SWSA 4MHHI 4OZFH 3L3KB 5TDPA 2BVTA 3BSZH 3G5ZB 4X4ZA 1IC1A 4GRLD 3TA3A 1IAIL 4RCAA 4H1LB 2OYPA 1UZ6E 3QQ3B 4HKXB 1YEGH 4K3JL 5JNYA 4UT6L 3PP3H 2FIKB 2VMFA 4YPJA 2W0LA 3RWFB 4FQIH 4L3CA 3PP3K 1OTSD 1BFVL 3C09C 3NTCH 5GGTA 5H94B 5FYKU 1OAXH 4PLJD 4PGEB 3CH8A 3L5XH 3QA3A 3B6SA 3QR2A 3MJ7B 2NY1D 1Y18A 2XKUA 3ARBD 4U7KA 5T5FL 5T1MA 3V0WH 5M94B 1XH3A 2J88H 4CVZB 1T1ZA 3BT2L 3N1GC 2AEWA 2NXYB 5AAMA 4EI5D 1DN2A 1DSFH 3AAZA 1J1OH 1F4XH 3X14A 1QSFA 4JM4L 4X7SH 4EDXB 2J8UA 4MWFB 3FN3A 4X4XA 3WIIL 3VXTA 2DIAA 4IBLT 4OTXH 5I30H 1HEZA 3ALXA 2HJFB 1UVQA 4OGAC 3KPNA 5D9SA 3LKQA 1PYWA 4NQED 4J3UA 2M8XA 3OMZA 4JDTH 4BFIB 1NPUA 3MRFA 4GAGL 3U4EB 1VADB 1DVFD 3IU3B 1MFCH 2VDRH 3E3QE 3IETB 3Q2CA 3I6LE 4GKNA 4KRMB 4GJTB 1YEHH 2H2SD 2EC8A 3KPOA 3L3GB 1P1ZA 4U0RB 3NFSH 2FBOJ 2Q3ZA 4KGLA 5I1AB 1AGDA 2AXFB 2NMSA 2VDNH 2Z9TA 1MCHA 2FJGB 5ITFA 4U1IA 1XGYL 1A4JB 1CFTA 3PQYA 1YN6B 1CF8H 1MUJB 3FZUC 4LLDB 2NPLX 4YH6A 1DEEA 4RNRA 5C6PB 5GRUH 4PG2C 1OW0A 2NR6C 3RWCA 4K3HA 2IALB 5IB4B 4FZEL 4X6EA 3VCLA 2YXMA 2VZSA 5D2LB 5K33A 2EKSA 2BSTA 3ULSA 5FO7A 3CLEL 3WL9A 3TM6A 3RQ3A 2V9TA 2DKUA 4HQQH 2EDQA 4TVPL 2C9AA 3LKSB 2C1OA 4ODXA 4LCCA 4J1UB 1Z9LA 3QIUD 5DJ6A 3W9EA 5C2BH 1FLTX 1Z6JT 4RAVA 1JMZA 3KAAA 1N0LA 4DVBB 4HIIB 1P84J 3K4ZA 4DUVA 1CICA 1SEQH 3W9DB 3HI1B 3SCMC 4JKLA 3R06B 3UZVB 4O58L 4XBGB 1SJHB 4NJAH 2VLKB 5ALCL 3I75B 3U79A 5GJTL 3MOQA 2X1XR 1WICA 4CW1B 4OF5A 3HZMB 1CGWA 5ERWB 1YZZA 3MUGA 2DLEA 2BFVH 3C6LA 2F53E 3TBWB 4C57C 3V79C 1DEDA 3MLRL 2I27N 3F65A 5FO9A 1T0MA 2ZKHL 3PL6D 2CKBA 2YK1H 4AEHL 5FFLA 3DVIA 1UWGH 1MJ8L 2ICWI 1QNZL 1VHPA 2P44B 1RUKH 4JFDA 3O2DH 2F58L 1NCUA 1KB9J 2OI9B 1OL0A 1WCBA 4FZ8H 1AC6A 1U0QA 4Y89A 4A6YB 1WAAA 1O5DT 3FN0H 3V7MA 2NW3A 1UXSA 1FIGH 4RISH 3K8MA 2WM0A 1MLCB 4WTZG 1H3GA 1ZHBB 3K80A 4WU7B 5TE7L 5AYUH 5IR1B 2A6KA 1D6EA 4O4YH 1G7MA 4HIJB 4N0CC 4P46C 1ZGLA 2UZIH 3GMMA 1MI5D 3MRJA 4CBPA 3ARDA 1JYXA 3L3OB 2B8OT 4DKFL 3FQUA 3EYSL 1DUZB 4E41A 5C8JA 1P7QA 4KVCH 2YMXL 1Z9OA 3C5ZC 1N6UA 2HT4D 5HDBE 1T21A 3JWDH 1HYSD 3VFUB 3T2NH 3VD4A 4GSDL 1N59A 1MIML 3EO9L 3P0GB 2P7TA 1XIWD 4EBQL 3K74B 2KQNA 1QLRB 1CXEA 2WW8A 4YHLL 1BFOB 1E6JH 4XBEL 3R8QA 1F6AA 3QO1A 1IT9H 3IXTA 3KLHD 4K94L 5KSVA 2Y23A 4CAGA 1YNKL 3NH7L 3HAEA 3VG9C 4RGMC 3MLTB 4JPKL 4G42A 1S9YB 4PJHE 5HGHA 1BD2E 3L1OL 3FJTA 3EJYD 2FO1A 4LVNB 3DX9A 4JKPL 1CD0A 4WFGD 3CDFA 5BW7A 1PD6A 3LQZB 1TZHA 3QPXL 4JVWA 3ALWA 1HQRB 3H9SB 4UDUA 5HTSA 4KJYB 1KTLA 1VGEH 2DIBA 3MLSL 2BRRL 1S9VB 2XWTB 3MX0A 3S34L 2WV3A 5KANG 4QXUL 4Z7NE 1WCQA 5IFAL 4G7YH 1XGQA 3ZTJH 4AH2B 3H9HA 4O2FA 5EU6E 4CN6A 4NGHL 4POZD 3G5XA 1RZ8B 1ORSA 5KVMC 4B5EA 5GPRA 3I6GB 5E2WL 3TPUA 3IF1A 5ICZB 5B38A 5GXBB 2F8XC 1TVBB 2Q8AH 3SDDD 3G6AB 3D1MC 1JGUL 4P9HH 4BELD 1MHPL 1TTUA 4FHBD 3CZFA 4V1DD 1NDGB 1IGMH 4JKKA 5GIRB 5HYJE 3T0DA 5BS0B 5JO5A 3VMPA 4Y5YA 1NLDH 1J0ZA 1I3RA 2RIKA 1L7TH 3MRIA 4DK3A 3A6OA 3KPSD 1NCBL 4WHCA 3EFDL 3MBEB 3ULVD 4D3CH 4LRNH 2MQ0A 5IMOA 1MCQA 5IFHH 1AD9A 1IGYB 3UPAA 1N7MH 1NSNH 2NLJB 1J0HA 2PW2A 2C5DC 3GJFH 1QG3A 4LPUA 5GS2D 1A5FL 1H3PH 1HH6B 1L9NA 1BLNB 1ES0B 1IBGL 1MF2H 1P4BL 5CP7B 2J8OA 2X4PA 1P6AB 4JFXB 5A40E 5FUCE 1S7RB 3UO1H 4IDLA 2XG5A 2VXVH 3AFLA 3WNNA 2EDKA 1ZT1A 1NBVL 4K9EC 4K3DL 5I1IH 1NKOA 1QRNA 4DFIA 1I7ZB 5ESQB 4M6OH 3EYFB 4D8PA 25C8H 1FH5H 5JW5A 2WSKA 4HCRL 3I02A 2X42A 2XNAA 4M8VA 1A21A 4RFEB 4WW2C 5A2IH 1OPGL 5ID1A 2IAMC 1G0DA 3QZWA 2VNCA 2DYPA 4N0UE 5I1LA 2EIBA 1E4JA 1G7JA 2FX9L 4Z77A 4HUKB 2FH8A 4XPTL 1M71B 2R2HA 2YBRA 4U1HB 4YHPA 3O6KL 2BNQA 4U3XA 3DWTA 4GBXC 1DQDH 1EXUA 3E3QC 2NYYC 1GVIA 4GH7B 2D0FA 2R1WA 3F7VA 3RVTC 1PZ5A 2DQUL 1NEUA 1S5IH 1P9MC 5I1GL 4JHZA 1XZ0A 4LAQL 5HVHC 3MJ9A 4K71B 3GZKA 1D5IH 3UBXB 1RUML 3IKCA 4NO0D 3D2UB 4H5SB 3RVWD 4P5TC 4XPGL 2NY6C 3LRSB 3CFCH 4G8IB 4JY4B 3OGCB 5DYOB 4L3EB 2DQJL 4PJCB 4Z7UB 1WBYB 3FQTB 5DEGB 4J3OC 3VW3L 5FGBC 1NC2D 4QNPE 1PLGL 1DR9A 5D6CA 4M3JA 1NDMB 1U8QA 2KH2B 1C5BH 4P2RD 2FJFA 3CVHL 4OM1L 5IK3B 4J2XA 1LHZA 1QO3A 5DD6B 1NGQL 4OLZL 5I1EH 5FM5M 5L6YH 4HT1L 1AHWA 5J12B 3X13B 1XT5A 1Y0LA 1A6WL 2R23A 4N8CH 5DJCB 4U3CA 1A9BA 2NCMA 4I5BA 4DTGL 4YHML 2G5BA 4PFEA 5KVDH 4QXWA 5AAWA 5FYLH 4YXLH 1KEMH 3HE7D 4L8SC 2Q20A 3PABA 1WWWX 1KN2L 3V0VB 4YO0A 5E2VH 1L6XA 1QSVA 1YQVL 2FATL 5H2BB 2V2XA 3KPMB 5HYSG 5FECB 1R5IA 1VEMA 2R0WL 4P57A 1OAYH 1PVHA 2FZ3B 4GW1B 1JZ2A 3DVGB 4GRMA 4Q97A 4DEPC 1WITA 5FB8A 2BSRA 5GS0H 5F7DB 3O45A 5I0DA 5DK2A 3HRZB 1MEXH 1G7IB 3T4YA 1GHFL 5IT2H 1T89C 4AMKL 1BF8A 1CXKA 1MSPA 3OKLA 2VQUA 4XPAL 2XPGB 2QQNL 1K85A 4ZPTA 2UWEF 3PHOB 3K8KA 1KCRL 3QEQD 1RQ5A 3K1KC 2YEZB 3TO4C 1DQJB 1A6TB 2PR4L 3HMWH 1HDMB 5K9QG 1UKTA 1KACB 1GIGH 3H6JA 5HDQH 1RVFH 5IEKB 2M2DA 1JWMB 3VFRB 4ODTH 4CVXB 3UJJL 3BN9D 3MC0A 2A0LC 4JN2A 4D0BB 3L6FB 4X80L 5D2LE 3C08H 4RAUB 2A83A 4H1LG 1ZT4A 4XAWL 3CX5K 2JE8A 3MROA 1JL8A 5DJ8A 1CU4H 3UYRL 3VWJA 1ACZA 4ZTOH 5EUKB 1JK8B 1M4KA 2JJTA 3I3BA 3CCHB 2WNGA 4IDJH 1HK6A 1FFOA 5DD0H 2CK0H 3WN5A 2EE6A 5E8OB 3BO8B 4XNQB 2CDFB 1OGAA 3HCVB 1IVLA 1FVDA 4ONGH 2VLKE 4LF3B 1K3IA 4R4ND 3WO4B 3S96B 3ZKSD 4IRJB 1CGYA 1JHKL 2YC1B 1PSKL 3RWHB 5LQBH 3T04D 1A6PA 3WIFB 5DJZA 3DMMC 3NCFB 1X5ZA 5I71B 4HS3A 3O9WA 3LZFH 3BE1L 4QYOB 3RTQC 1CVSC 2VR5A 4MAYB 1JJUA 3WFBL 3P4OA 1JWSA 3V6FB 4TTGA 4MSWA 2JJSA 3CVIL 3OX8A 1OHQA 2PO6C 2K3TA 4J6RH 4X7TA 3RZCD 35C8H 3S37X 1EMTL 5CS7A 2KQMA 2DD8H 1NCWL 1YQ2A 1E0OB 2XOTA 4MB5A 1UM6H 2NZ9C 1LWRA 3SN6N 2DQFB 2OQJA 3FB5B 4XPHL 4UOW1 1WBXA 4XMLH 1BVLA 1NC4D 4JM2A 4XXDB 4Y2OA 1OWWA 3SOBH 3TIDB 4J3XA 5CEZE 2X09A 1J12A 3VFTB 1YMHB 5C0NC 3VXSB 3BQUA 3BYYA 2V7HB 2FEEL 1KTDB 4J3SA 1ZXQA 5EIIA 3OKDB 1H3WM 3E6FB 4YR6A 3IDNA 3FB6A 4WU5B 2AJSL 1JI2A 1UA6L 2HT3D 3CDYA 2A73B 3STLB 4UQ2A 4ZO9A 4JJHA 3MLUH 2BY3A 3RJDA 4NQVB 4I2XA 4PLOB 1CDYA 2IANB 3W2DL 1A0QH 4P5MA 2B1HL 1KCSH 5EA0L 5FUCC 1CFNA 1W0VA 1WISA 1NMCC 3I6KA 4PYHA 5ISZA 1KV3A 4JO3L 4ZUSB 1WWBX 2Q76B 4OGXH 2H8PA 3CH1A 3LN4B 3N50A 3ZLQC 5DURD 3KPRA 5GISH 1GXEA 2BNUB 2AK1H 2VXQH 1LO5B 1N5YH 3GMQA 1ITCA 1F11B 3FQWB 4PRPB 4M1CD 3T0EB 2YN3A 4KKAD 5MEPA 3V5HA 3FQXA 3HTLX 1FC2D 5DVOA 3LN5B 3IU4L 2C4FU 2MPAH 4NC1E 5F9AC 5CD5C 3FT4A 2APFA 2EH7L 3WJLA 4MXWH 3HC4H 3HB3D 1OAKH 4EOWL 1TJHH 4E5XB 4YDLB 3EYVA 4KROD 5C2UB 5HHOB 5EORH 4Y16B 3D18B 3BHBB 5D1ZD 1G9NH 2GKIA 4U33A 2OTWB 1FVEB 3HG1A 1CI5A 1O7SA 3BPLB 4LKXB 5L88L 4NO5B 4KUCF 2DS4A 1AKJB 4ONFL 2AW2A 3QXTA 5DUPH 2RAMA 3TNNA 3LPWA 3NACL 4PG9A 3O41A 1K8DB 5GZNC 5DO2C 5D72H 1IE5A 4RRPA 2A74B 5L2JB 4LCUA 4ODSH 1BF2A 1R3HB 2AJVL 2OL3L 5IVZA 1NQBA 1HZHL 1CDJA 1HHGA 2DQTL 3QIWD 5EPMA 5F7EL 3VGDA 4FQQA 3FHQA 5BS0E 4GW5A 1FNEA 4JPVL 1WFOA 4RFNC 4K9EL 3ARFA 4XPBH 4ZS7L 4WO4D 4OGYL 5EU6D 4KK9C 4HS8L 4JO4L 3QXAB 1C5DA 1IM9A 5BXFA 5FO8A 4JQVC 1MIEL 1QFWH 3DNKA 2G2RA 2ADJA 3S36L 1B4JH 4YFLI 1IGIH 3HFML 3LAFA 2JIXB 1ULVA 4LFHG 4GLRH 2YN5A 1NGZB 1QBAA 4BH7B 4ZFOL 3IKKA 3LY6A 5C70A 1IEBB 1T83C 3ARPA 4OZHA 1Q38A 2NXYC 5D1XB 3V0AC 2PW1B 3CFEA 4NO3A 1DBKL 1ZHLB 4G8EB 3OTTA 4R96B 4LOUC 2CGRH 1BM3H 5KANI 1NL0L 4WWKD 2E6PA 3EO0B 2WUBL 3VRIB 4M9OA 4MJIA 2BP3A 1CL7L 4I3GA 3LQAC 2YWYA 5FOJA 1S9XB 4U1SA 1Q1JH 2JTDA 2UYLB 4YHZL 1NGWB 4ZFZB 3AM8A 3D69A 4HBQA 4F7MA 1L7IH 3HNSH 5I1DA 2LVCA 1ZSDB 3MQIA 4PP2B 4UV7L 4ZXBC 4P48A 4NFDA 3WFDL 4FQLL 3DX7A 4XVJL 5TE6L 3SGDH 2XTJE 2FWOA 3MLZH 2X40A 4NYLA 2E6QA 3MRHB 1MFBH 2X1WL 4N0YL 3BUYB 4KK5C 3UPCA 3MYZA 5EUOF 1F02I 4YXHH 4LCIL 1I3VA 3DETC 2CDGB 1LEGA 1S7XB 2AEPL 2EO9A 2H1PH 4HH9A 4NNYB 1A7RH 4HWBA 4L3EE 3C5JA 4PJCE 4Z7UE 4Y19B 4ZD3L 5CJOH 4P3CL 2AQ3A 4YWGH 3VXRB 4L29A 4TUKL 5E8PB 3MFGB 3CC5A 4Z7UF 4PJIF 5C0CE 3GSNH 2YKLL 3QRGL 2X7LA 5E2UL 2AVGA 2FRGP 3MA9H 1CFQB 3P0VL 1PQZA 2VDOH 4K7PH 5LCVL 1IGJB 4JFEB 4OKDA 5ETUB 4LSVH 4P2OC 3NOIA 3NVQA 1D5ZB 1G1CA 3FO1B 1JGEA 4I4WA 1AGBA 4HPOH 1Q72H 2YPVL 3HS0A 1TETL 4X83A 1ZMYA 4LVHB 4GW4A 2HFTA 3LEXB 4X6FB 3OR6A 1TTGA 2OP4H 4MJ4A 4P4KB 2X4UA 1LILA 4EXPX 5LGHH 1P2CB 1RSFA 2Y07L 4JFZH 4GG6A 4Z76A 3FTGA 5C86A 4XCEA 4JFFD 3NCMA 4RGNC 5F3HA 5F89B 4YHOH 4J4PA 5E9DB 4QRPA 1TNMA 3UZQA 3SE8H 1I4FA 3U0PB 3SJVB 2FGWL 1ZS8B 2RHEA 3TZVB 4P99A 3W81A 1NLBH 3RI5F 1KJ2H 5IROC 1XF5B 4WI9A 1T5XB 3IYLW 1BIIA 1OAZL 3NAAH 2VITB 1W72B 1AR1C 4FFZH 5BRZB 2IG2L 1Z3GL 4JFOA 1EJ6A 3WUWB 2I07B 1NAMB 4R4BB 2LABA 1ERNA 4G80B 5JIIA 1NEZA 1JPGB 4QRRA 4TYUA 3TJEL 3IDYB 2BC4A 4NKDA 2FX7L 1QLFA 5E08L 5HPOA 5C0JB 5C08D 2X4NA 2JB5H 4J8RB 2AQ2A 3QDMB 1J10A 4Q9BA 1GC1C 1WC7B 1WIPA 2W0PA 4AEEA 5FOBA 5DRZB 4Y4HB 2GTWA 5GRVK 4WWID 3GSQB 4M1GL 1Z5LB 1FO0L 3AXLB 5E1AB 1JF1A 2AK4B 4PJBA 5J9PB 3UTSB 1KTKE 3VFSB 3GNMH 2YSSA 1I7UB 4PBXA 5EB9A 1A3QA 4Y4KD 3B2VH 3NGBB 4LVNC 1AJ7L 3PDOA 5F8QC 3SE4A 5ILTL 4I77H 4NQDD 1DFBL 4Z78B 4YK4C 4ZYKB 1EAPB 5IKCA 1A2YA 5CZKA 4XB7A 5I9QC 1VFAB 3AGVA 2Z4QA 3OPZH 3OB8A 3U1SH 4KY1H 2XKNB 1TVDA 5IQ9A 1BZ7A 3L3DA 1RZGA 4L8BA 4XP6L 5DZNA 4LEXH 1MRFL 1N3NA 3BZFA 2X4RA 3K2UL 2DMKA 3L7EA 3BEWB 4Y2DA 5K9QI 4MXQD 2VLKD 1MCWW 3DJ9A 4PP1C 3QUYB 1BQHB 2D3VA 1MCCA 3RVXC 4JPIB 2HJLB 4X4YA 3CZJA 4PLKD 5FCUH 2V5TA 1Q0YH 4O02L 2PF6A 3T8XB 1FJ1B 2EYSA 1KJMA 2HAZA 1B0WA 3SHSA 5DUBB 3VXSE 2ZOKA 3FO9A 4M8QB 4OCRL 4MDJB 2OJZH 5DS8B 3MBEC 2E7LA 1SYSA 3O11A 3AY4A 4XH2A 3EDKA 2CDEB 3AU1A 4ZS6C 2BVOA 3C6SA 3UTQB 3UPRA 4MB3A 4Q9RH 5DJXA 3RWEA 1NMBL 4WV1A 5DA4A 2HN7A 3FFCB 4NN6B 2H32A 5JR1L 3PV6B 3VXMA 5BOPA 1EFXA 1QBLL 2Z31A 4OD2B 1XFPA 1YEIH 2BNRD 5I76B 2GJ6E 1G6RH 4NM4H 1CWVA 1LDPL 3NCYP 5LAXB 2P5EA 1P5VA 1D6VH 5JUEL 5LGJB 1DANU 1F13A 4P2QE 2KUTA 2EDTA 1PY4A 2MFNA 4YX2H 2CK2A 2D7OA 3QNZB 2GT9A 3HMXL 4FQ1H 1YEFH 1N6QL 4F9LA 4GRLC 4OUUA 1CE6A 3ZL4L 4Z7VB 4ZUWA 3MV9A 4M61B 4LCYB 4PRPE 5F96L 3QUXA 3I3EA 2ICWA 2ZZUT 4PB0H 3QUMB 2EO1A 1U3HA 1UACL 1BGXL 4YDKL 3O6ML 4S1DD 2CIIB 4I8DA 1XCQA 5ICXB 1UB6A 4F3FA 3DROB 3NPZB 2K7QA 4KDWA 5HHOE 1ETZB 1I1AD 2ADFL 4PLJC 4OF3A 5C0BD 4MNGB 3T09A 4ONOA 3W39B 4XCCH 4MA7H 5JZ7D 4EI5C 1X6NA 4KTDL 3WFHB 1DUYA 1VGKB 2NW2B 4WDIB 1L9MA 4WUKH 2QQLL 5FYKE 2WUCH 1SM3L 4KVNH 4RBPK 2E9BA 3TWCL 2W9EH 4J3TA 1VDGA 2NX5A 3FQNB 1SEBA 5FUOH 4U6YB 2ZUWA 4OIAA 4APQD 4PJXB 3MRDA 3KHQA 4IIQA 4OKVA 2R4RH 4U2YA 2A6JA 5F88A 1S78D 3HHRB 1KGCE 3GI8L 4KUCD 1OQOA 4S0TD 4S11A 1ZE3C 1K8IB 5JPMB 2R2EA 3NCJL 5FM4A 1U8KB 3HZYA 4N8VB 2NY2B 3QXUA 4XXCA 1IAOA 5KG9B 3BIKA 4KAQL 2HFFB 3TA3B 2ZUQC 1GZPA 1IGCH 3QDJA 4PJAB 1CGXA 2WP3O 4HUWA 2P24B 1UQSA 5CFHA 3BH8A 1BJMA 4KRPC 2WINA 3MLVL 3PWLB 4HKZA 1S9WB 3Q3GA 1KXTB 1Q9KB 3IJSA 4PJ9B 3RBSA 4ETQB 1DBMH 4FFYL 3WIHH 3MCKA 4KU1A 2EEBA 3I3DA 3H9YA 1AGEA 3EJZC 5T1MB 2BY1A 5I66B 4QRUA 5CBEA 1ZLWH 5B39B 1LD9B 2IBZX 3QQ9D 4W81A 3K7UA 5T3ZE 5C0AA 1JZ8A 5FYLD 3RWJA 1PAMA 1DLHB 1T20A 1UENA 5D9SB 3IDJB 5H37H 3WJJC 4UV4H 4BZ1H 4YBHA 5J6HA 4U6VL 3SDYH 3S97C 1F58H 5DRWB 4ZAKA 4OB5H 1NUFA 1B2WH 2DQCH 4PJ8B 3VXRE 4JDZA 4OCLC 1CLOL 4Z18A 1SY6H 3FMGH 5F3BB 5GS0D 3HI6H 2DQGL 1DL7L 2XTJD 3BKCH 2EXYD 3UJTH 4LLMA 4HWEH 5FV1L 4X6CB 4LDOB 3HI5L 5CSBA 3WE6A 3QIBB 4JFEE 3PQYB 4CUCA 1EK3A 3LOWA 1UXWB 3F62A 4L8DA 2J8HA 3P0YL 3GMNA 4OI9A 5TJWK 3REVB 5IW6B 4RNRB 4FQCL 3D2UD 1K5NA 3GDBA 2R0ZL 2YR3A 4HW6A 3DUSA 4DKDC 2XZQL 3CVHA 4H0GA 4O2EA 1NGXA 2BSED 2XQYG 4L3ED 3AMLA 3WO4C 4XP1H 4R7NA 3CX5J 2DTML 4IRJC 5A1AA 3ARED 1T0PB 4U6XA 4A6YL 4WY7H 4LSPH 1XGRA 3GBML 1GPOL 5C0CD 5GGTH 3U9PL 4J12A 4ODXB 4TSCH 2QR0A 4LL9A 4OZIA 4F9PA 1HKFA 1R5VB 3IAGC 4DKEL 2IPTL 2N7BA 5E9DE 5I8CB 4IOIB 2DM4A 4MAYC 5CEZL 4NUJA 5I1CL 3SJVE 4H0HB 4YHYB 4KMQA 3BDYH 5EZOH 3N1PC 4MA8H 1NGPH 4KRNA 3RDTB 1PZUB 3B83A 3QEUA 4PJEB 1OM3H 5BZDB 1F4YL 1RIVH 3BGFB 3QO0B 1LO2H 1A7QL 3MV7E 2ESVD 1AXTL 1E6OL 3U83A 4YGAB 3VXNA 3MLPA 3TBSB 2EECA 1A47A 4PJ5B 4PJFE 4OIBA 2FHCA 2VE6B 43CAB 5CZXD 2BJMH 4JRXA 3VFWB 4KUZH 3SO5A 2HTKD 4PJFF 3QPQD 5TDNA 1WWCA 4YXKL 5CJ5A 1S7QA 5J56B 3QDME 1KLUA 3P9LA 3ZT7A 1SVZA 5CIPA 1FV1A 1XGPA 1PKQA 2Z8VC 5D2NA 2NW3B 1WJ3A 1DLFL 2D9CA 2C4XA 3VFPB 5JOFA 1AP2A 1WSST 3K4AA 4FQJH 2LU7A 1R3KA 1YPZA 5DQJB 1HE7A 3B9KB 1RU9H 4GFTB 2ATPA 2B2XH 2ICES 3SDDA 1JN6B 3NFNA 4LCWB 4IOFD 3UTSE 1YEJL 3IFPA 4EUPB 4EDWL 2CIKB 4OAWA 1F6FB 2W65A 5L2KE 3PJSA 1Q0XL 5D7IB 4G8FA 2X1OA 3T0EC 1CG9B 2GAZB 2E7CA 2VABB 2R0KH 4HXBL 5D1QB 4PS4L 1NFDB 3DYMA 3RL2A 1MAML 5HYQB 3LS5L 3A6CH 3QO1B 1QYGL 4NPYA 1B0GA 3X11B 5FKAA 1R5WB 4XTRC 3C9NB 5AZ2L 2W60A 3K46A 1C1EH 1HXYB 4PRAA 4BSWB 1YJDC 5HGHB 4Y16C 2OX5A 4NFCA 3N1FC 3T1FA 1C16A 3TFKD 1QR4A 2LU4A 2YA2A 4JFPA 4HZLA 4DQOL 4JG0L 3BPLC 4NC0B 4UTBH 5BV7B 2APBA 5EIQA 3ZDZE 4J7RA 1NJ9B 4Z0XA 1FYTB 1I1YA 1U3YA 4P46A 4R7DA 2CKBH 5MP6H 3VXOA 4HFWB 3V7AG 3QHFH 2W92A 4ELKA 1MVUA 3FO2B 4GG8A 3WUWG 5JDSB 3M1BA 5KSAB 3GIZL 1U8OB 1INDH 3C5ZA 5BJTA 2G9HA 2E7HA 3GI9H 2AEQL 1DZBA 2E3VA 4OV6F 3TPUB 4LKCA 5I1KL 5B38B 2P5WB 4YUEL 5SWQA 4YQXL 3LKPB 2VQTA 4PR5B 1U93A 2F5BL 3PIQB 1NCDH 4EEEA 3WMSA 3FFCE 1HNFA 3C8KB 4Q2ZB 5T1KB 4I18A 4JANA 2ORBL 1JVKA 1D5XB 1LP9B 1L4IA 3MOAH 5C0RH 4O2CB 3ZTNH 3RUGB 1NH6A 3QEGL 3VXSD 1S7WB 2QKIB 3SPVB 3UX9B 4HXAH 3OV6A 4R0LC 2IH1A 3TV3H 1AD9B 3GMPA 3FRPG 2ICEB 4Z7VE 5D93B 3U0WH 3SKOA 4ZFFA 4AEIH 1JRHH 2E27H 4MVBD 1XGUB 5C9JB 2EDBA 5A16A 3EFFA 5B4MC 3S88H 2FBJH 5HPMB 4AT6A 3CLFH 3HAEH 4KXZH 1A8JH 4P2RA 4RFOL 3KXFA 2GJ6D 4CJ0A 3X3GH 4NBZB 3GKZA 2QTEA 1Q9WA 2DRUA 5LKNA 2O61A 3RGVC 5KW9L 5MERB 5TQ2H 3RWIA 4P2QD 4Y88A 4MNGE 4M62L 3QCTL 3MJ6A 2QEJA 5L9DH 4WUUE 4K07A 1CDUA 5EU3A 1RZIA 3FRUB 3NIFE 3WYRA 5GS3A 2HRPH 4PRPD 2X4TA 5GJSH 3QZWB 4U1MB 4PRIB 3NIFF 1X3DA 4M00A 2K9UA 2Z8WC 4UILL 5DHVB 2VDKH 2BNQB 4Z95H 2OZ4L 2FLBT 4PJXE 1MFAL 5HHXL 3MRPB 4D9QE 5D70H 3JWNC 4JRYB 1BOGB 2KDGA 2MQ3A 3KPLB 3BDXA 3GSUB 5IBTL 3D0VB 3MA7B 4S1QL 3V6OE 2XWJB 2MTPA 5EU4A 5SWSE 3LIZH 1AKJD 5M7QA 5KZCD 3BPCB 4GQ9H 2X1PA 5FGCE 5FYKD 1OB1B 4JJ5A 1U58B 3UTTA 3HE6B 5I8KL 2A1WH 4LVHC 4NQCB 4PJAE 4FA8A 4GRWB 5DMGD 5EC2B 1A14L 1CLYH 1KLFA 2IAMA 2AJUH 3HUJA 4UNVA 3V4UH 2VB5A 3NIDE 3TN0C 4JEGB 3DUUB 3BN9C 3RU8H 4ZFOA 1EPFA 4P9MH 3U46B 1LEKA 1A4KA 3NIDF 1ZHKA 2FDBP 1R24A 4LDEB 4GBXA 3PXHA 4LLYA 3L95A 3WS3A 1TJGL 2YD9A 1JNJA 1JIBA 3JV6B 4G9FB 3EOBB 4LASH 4WTWA 3NFPA 4WTZA 3WBDA 3UDWA 1FL5A 3TZVC 5A3IC 1WIOA 4D9RD 4KQ4H 4I5BB 4HIHA 4M7LH 4FNLL 5FA4B 3VXPB 5D1XD 4QHUA 2FJHB 1I8KA 3GKWH 3SDCD 1T0NA 3T65A 5LWYH 3CUPA 1G9ML 5DQDL 4XZUB 4O51A 1BX2A 4P5TA 2AJXH 3BWAB 4NJ9H 5FCSH 2P8LA 3Q5YA 4QXGL 2I9LB 3QI9C 4L8CB 1Q8MA 2J8UF 5IMMA 5KS9B 2V2XB 4U7MA 4YJZL 4DZ8A 3BW9A 5I2IB 1QVOA 3P3YA 1FLRL 5FGBA 3WLBA 5EOTB 1U8HB 1IAKA 3IDYC 4JZNA 1WZMA 5FB8B 5FV2A 2BSRB 1HNGA 4OFYD 3PWNA 1G0XA 1FBIL 4M48L 3WXVL 1YY9D 4CMMA 2Q7YB 2D4FA 4DGIH 3BZDA 2FB4L 4MDIB 5EN2A 2QHLA 4BYHA 1MCPH 3IJYB 4NDMA 1YC7A 3RZCA 5HHQB 4NKOB 4RGOL 3PQYE 4LIQH 3OXRB 4YDVB 4QT5A 4YHKH 4X9BA 1LO0H 3G5YA 4ZUTA 3X3FH 1NC4A 4L8SA 3S9DB 2WIIA 4N8VG 4U1GB 5E03A 3QQ4B 2F53A 1UGNA 4OM0L 3UP1A 1F00I 3U7AA 4OSUL 1X4YA 1KLGB 4NZRH 5F1IA 3KPPB 3VXRD 5IF0A 2VXTL 5HGAA 3K8LA 2DI7A 5DJ8B 1H9VA 4OFDA 3IS0X 3ECBA 3IS1X 3IDUA 1HIMH 1T89A 2DQHH 4U1NA 4YEEA 1TQCB 3BJLA 3JWOH 4L4JA 5HHMB 1II4E 3V6ZA 4WNQA 4F7PB 2YRPA 4PJDA 2FSEB 5HI5D 4HMDA 3ES6B 4PJEE 4RWHA 4C56D 1S7VB 2NXZC 1OCWL 5B39G 1MRDH 1I8IA 4V2BA 3QP3A 1ONQA 1FNAA 1HXMA 5DEFB 3ZKND 3GJEA 1LK3L 4EN3B 1RJZA 4ZTPH 4EKXA 2ADGB 1QR1A 4PJ7B 3PWVB 5DQ9A 1MCOH 4NO2A 4PJ5E 4CJ1A 4ZPVA 5E9DD 4DGYL 1Y6KR 1JWSB 4XNYL 3CFDB 4MQXD 4PTTA 2DQEL 4XNXH 3BH9A 4JFDE 5FK9A 3SJVD 1AQDB 2H9GA 1RURL 2P8MB 4WI4A 5F44A 5IHUH 1RIHL 1V7NL 1DBAH 4X6DB 1UWXH 5FYJL 4Z7QE 3DURB 5ALBL 5TH2B 1TCRA 4OLWL 5AEAA 4RMRA 3MV7D 5HHPB 3U4BL 3VGEA 4NN6C 2AXGB 4PJHA 4Z7QF 1FZMB 1BD2A 2OXGA 1U8LB 2H6PB 1TJIH 4LLWB 1H15B 1V3LA 1Y6NR 3VFOA 4LCWE 1FZKA 1V7ML 4HD9A 2XN9A 3DRTB 1YJDL 1YEKL 4RAHA 3F7QA 4QCIB 4H25B 3DMMA 4X99B 3P30L 2R2BB 1FO0A 5D7IE 3RX8A 1M6OB 2Z93B 1DE4A 4XNUH 4HULB 4ONHB 1FNHA 1EHLL 2VH5L 3GMLA 1MREH 1NFDE 2PO6A 4WO4A 5D7IF 5IBUG 2ZUUA 3B5HA 5FYKL 4NWUH 4ORGB 1HOCA 1GGBL 1ACYH 1T7VA 3FCTB 5AZEL 3OAYH 4PB9H 3UTSD 4CKVX 2VLME 4AM0B 2R1XB 2XA8H 1TVHB 4OQTL 3QXDA 3SE3A 1FFNA 2D7NA 1J11A 1YNLL 2DLHA 4Z7OE 3THMH 5C71A 1KIRA 1KPVB 3GIVA 5HYJA 5L2KD 4M03A 1NBYB 5INDA 4Z8FH 1FYTE 1ZLVK 3T3ME 3OG4B 4WWKA 1YMMA 1JPTL 3O6FB 4X8JA 5C0EA 3GSXA 3T3MF 5C09B 4Y7MA 5MEOB 2CD0A 3L7FA 4X0KA 3RKDD 3O3EB 5DMYA 2RQ8A 1MPAL 3INUH 3D85B 1CD1B 3N06B 3IJHA 2P5WE 4MD5A 5E5MA 4ZSOB 5L0QB 4I3SH 3QUYD 1EHAA 5FHAL 2NY7H 3TNNB 4LHUD 3O41B 4OUOA 1LP9E 4I1NB 4OLYL 4GAYB 4I13B 4Q58C 5FGSA 1DBBH 2ICWJ 5IJVB 5HYSA 3IDMA 3RUGE 1GOFA 4X4MA 3LVEA 1FNEB 3ILPB 3ARFB 3LEVH 1U8PB 2VWEE 2GJZA 2VC2L 4N0UA 5EC1A 4EUPG 5T3ZL 4MJ5A 3WUZA 5BOZG 2B20A 1RUAL 5MEQB 5ADOH 5IP4A 1OP5H 4PJ9C 4HLJA 4NC2B 4PGBA 2DWDA 3P73B 5J0BA 3N0PB 1RZ7H 1FNSH 4O9HH 2VLLA 2GCYA 1YUHA 4TOYL 4C83A 1T1WA 3HMXA 5IB1A 1KPRA 4JREB 1QA9A 4WW1B 3DVFA 5IQ7H 5I8EA 4U1KA 2FR4B 3E2HB 2X5PA 4NO3B 3L3KA 3G5ZA 3I50H 1G7PB 3EBAA 1LDSA 5J6GB 2ARWA 1U36A 1ZKAA 3V8OA 3IFNL 4FXGB 4H1LA 4RIRB 4YBLC 2M1KA 3QQ3A 3SKUD 5C3LD 4DOHE 4PRIE 3ZYIA 2FIKA 3D69B 4F7MB 4FQXD 5B8CB 2HH0L 3RWFA 1CFVH 5IHLB 5ESVB 4JQVA 3MNZB 2BNQE 1CE1H 4MQ7B 4IRSD 4PJ8C 2DQIL 2ICCA 1JBJA 2BXZA 3O8XB 5H94A 1F2QA 2Z8RA 2I5YH 4UBDC 5D7LB 4PGEA 4NYLB 5T3XH 5EOQH 3B5GA 3MJ7A 4E9LA 4JRYE 3OGOE 2XT1B 3LDBC 3VWKB 4QOKB 3QIBC 4CVZA 1T83A 2CUIA 4WUUD 4YGVB 4M5YL 3AVEA 3A67H 1FFPA 2G60H 5JXED 5CEYB 4LQFH 15C8H 4TUJB 4N5UA 4EDXA 4MWFA 1K3ZA 2F19L 3TJHD 1MFEL 2HJFA 3MLWH 3S35L 4H8WC 4GRWE 1TPXB 4G5ZH 5B3JE 2H3NB 1W72L 4DVRL 3NZHL 5C7XH 4KZDL 4BFIA 4GRWF 2NY0D 4D9QD 1VESA 4GT7A 1AI1L 1NAML 1UYWH 1MVFA 5B3JF 1PQZB 1T03H 3U4EA 1GAFL 1VADA 3IU3A 2DICA 4L9LC 3D3VB 5SWSD 3IETA 4B50A 4NZTH 4G9FE 3I9GL 2NY2D 3L3GA 4I4WB 5FDWB 1IZJA 5F1NB 4YHYC 3W11D 1KENL 2AXFA 2OR9H 5I1AA 3SO3C 2HFEB 3TA3D 2FJGA 5MENB 1YDPA 1A4JA 4JHAL 3ARYA 2X4SB 3GSOB 3TPKA 3BGFC 3T3PE 1BAFL 5C6TL 1REIA 4MX7B 2PTTB 1I3GL 2IALA 5IB4A 3T3PF 3FTGB 3W0WB 4HG4K 5ELIA 4Y4KC 2Q6WA 3FOMB 5KS9E 5D2LA 3PUCA 4G3YH 1QOKA 3J7HA 1IC5L 5KS9F 3STZB 5EOCH 3QG6B 4RX4A 3ZDXE 3LKSA 4YE4L 2GHWB 4UTAL 1FDLL 1IJ9A 3JWDC 4J1UA 3R1GH 2PCPB 4M1DL 2CSPA 1U3JA 2R29H 5IG7B 4DVBA 4HIIA 2SEBB 2WBKA 5GRJH 4TTDD 1QSFD 2E9WA 3W9DA 2FNBA 3R06A 3UYOD 4XBGA 2VXUL 1SJHA 2VLKA 3I75A 5EBWB 4HWBH 4QRRB 3ZKQD 4CW1A 2XACC 1A6ZB 3HZMA 3KNBB 4K3GA 1WZ1L 5J13C 4HKJB 4NKDB 1MWAB 3TBWA 4N5EC 4X5XB 1MCLA 2EDWA 2X10A 2VISB 4LARL 4BZ2L 2X05A 5JHDB 2VL5B 2PTVA 3SEPA 1IAIH 2D7PA 2GTWB 1JGVL 2Y1VA 4OFIA 3AB0B 3HRPA 4K3JH 2G75B 4UT6H 1WT5C 1YEEL 2C26A 2X4QA 3PQYD 5IROA 1ITBB 1JF1B 5HHME 3EOAB 1HSBB 3RP1A 4A6YA 1R3JB 1BFVH 3DUHA 4MQSB 4UOW0 1JZ5A 4MGXA 3LPGA 1OGAE 1JPST 5HJ3B 4P4RB 1MLCA 3L5WA 1ZHBA 3LMJL 4Q7DA 4WU7A 5EBLB 2LU3A 2CO7B 5HI3D 5T5FH 5IR1A 5BV7C 3B2UD 3BT2H 4HIJA 1L0QA 2DMCA 4KFZC 2Y5TB 1A2YB 4JM4H 5KSAC 4PJ7E 1S8DB 5ANMB 4BUGA 3WIIH 1DBJL 2Z4QB 1DCLA 3ALPA 1SJEB 4X7CC 3LKOB 3VFUA 5KN5B 1HILB 4PJ7F 5ADPL 4LK4A 1CICD 1RZGB 2IH3B 1N3NB 3PG2A 1BFOA 5E56A 3RDTD 4X6DE 4D2NA 4BQCA 4GAGH 3UMTA 1GSMA 1S3KL 1S9YA 2D4DA 1HHIB 3C6LD 1FVCB 4X7FC 3QUML 4OFVA 1IGTB 1A3RL 2APWA 2EYSB 3K81A 4X8XA 4JM2F 4NOBA 4ODHL 3LQZA 1A02N 1XGYH 4UT9H 1HQRA 2P47B 3H9SA 4PGJA 3O4LB 4KJYA 4OLUL 2VWEC 4JFDD 4QHNB 1S9VA 2XWTA 1GZQB 1G9EA 2YD7A 3WS6C 3AU1B 1Q9LB 3RWDB 4HUXB 3O0RL 4X9GA 4FZEH 1VKXB 4NM8L 4AH2A 2EDXA 4APQC 3F5WB 1YYLL 4G6FB 4LQ1A 3CLEH 5IUSA 1RZ8A 1S78C 4IMLB 1U95B 1FYHB 3UJIL 3I6GA 4K23L 4TVPH 3N1QC 1IRAY 4R4FL 1J8HB 4ZUUB 1TVBA 3G6AA 3ZE1F 5DC4B 1P6FA 3GB7B 5ISZE 3R0MA 3ARDD 1NDGA 1E4WL 2GT9B 4XVUC 1QUNA 3KPRE 2RFXB 3ULUE 4E41D 1NUDA 1P7QD 5GIRA 1IC7L 4ZUWB 3U2SB 4O58H 1MCSA 3E1F1 5BS0A 3QUXB 5ALCH 3EYQD 3MV8B 5GJTH 5TPWL 4NNPL 3VRLE 3MBEA 2VIRB 3CJJA 4Y5VB 1GOHA 1IGYA 3MGAA 3MXVH 1OP3H 3MLRH 2AAVA 3VRLF 1J1OL 4OZGB 1CQYA 2ZKHH 1QHPA 4M6NL 3NPSC 1HH6A 3QT2A 4AEHH 4KKCD 2VLMD 1BLNA 5D8JH 1ES0A 5CP7A 4JFXA 1QNZH 3HG1E 1RK1B 4ZSOE 5GRZA 4NCC1 2F58H 5C07B 2O5YL 1XR9B 3QQ9C 1FYTD 5ESQA 1JUFB 1IL1B 3EYFA 2RJMA 2DJUA 1HYRC 2CMRL 3HE6C 3IRZA 3OB0K 1AD0A 4HJJL 5TE7H 2X6MA 4RFEA 4IIQB 4OKVB 3DV4B 3C8HA 2E9IA 5GGSB 2J2ZA 4W68A 2JJUA 2YRLA 1M71A 1Q9OB 2H32H 4U1HA 4LSTL 3GHBL 4DKFH 1CD9B 3SQOL 3P11L 3EYSH 4JB9L 4LPCA 1GGCL 4HMCA 3HR6A 3TCXA 4GSDH 3DPBA 1MIMH 3EO9H 1JGLL 3DO7B 4EBQH 2PXYB 2CUHA 4YHLH 4XBEH 3LB6C 1A1MB 4K94H 3UBXA 4OZHF 3D2UA 4H5SA 1YNKH 3NH7H 1MLBA 4MS8D 3BZ4B 3L5IA 4JPKH 2J7LA 3LRSA 3MLYL 3MZGB 4G8IA 4R8WL 3VH8G 3WDJA 4JY4A 3OGCA 4YDJB 5DYOA 3L1OH 4L3EA 4PJCA 4Z7UA 1F3JB 1WBYA 3FQTA 5DEGA 3C5SB 1CDCA 3TEUA 5IVNA 4JKPH 3AREC 2P48B 3CSYB 3GMOB 3QPXH 1BQUA 4BH8B 4F8TA 1NDMA 1OD7A 4WGVB 5IK3A 4LEOB 3MLSH 2BRRH 2XZCL 3N9GL 4CU6A 3S34H 4H8WL 4QXUH 1J1PL 5KSUB 5IFAH 5D7LE 5CJ8A 1QRND 3X13A 4NZDA 5BVPL 3WHXA 3B3IB 4QOKE 4RMTA 4NGHH 4LDLB 3QWQB 1T20B 1G1YA 2OZ4A 5E2WH 1V5JA 2W9LA 2XWBA 2F74B 2DYPD 1JGUH 3UAJD 1MHPH 3ARGB 4XGZB 2P45B 4PRHB 5CAYB 5H2BA 3C09B 2BNQD 3KPMA 4JDZB 5FECA 4HH8A 3V4PL 3FHAA 4DAGH 2FZ3A 4GW1A 5TF1L 4PY8I 3DVGA 5CZXC 5A2KH 2VLRB 2X70B 5CZVL 4HUNB 4M5ZL 5I1HL 5C6WH 4MB4A 1CLZL 5EH1A 1NCBH 1VSCA 3EFDH 5CUSL 1G7IA 1AXSB 2VDLL 1TQCC 3GMNB 5I73B 2XPGA 3FO0L 3PHOA 1WEJL 4WFEE 1A5FH 5D96C 5I15L 3KPQB 2JKXA 3BYTA 5MENE 3VGAC 1DQJA 1A6TA 1IBGH 5HI4C 1HDMA 3ZE2F 3GHEL 2ZG2A 1K4DB 2EE9A 5DFVC 2NZIA 1CXIA 5IEKA 1JWMA 2QSCL 1XGRB 4XNZB 3VFRA 4CVXA 5HD8C 1NBVH 4AEFA 4EJ1C 4K3DH 3QRFM 3W0WE 1C8PA 4D0BA 3L6FA 4EN3C 5JLZB 4GG6F 1X5IA 4RAUA 4ZMAT 1NUNB 5HGDB 1MH5B 2BOCB 4HCRH 3KS0H 2FCBA 1OPGH 4JVUA 3GUTB 1K6QL 2FX9H 3QEUB 5DVNA 1JK8A 4XPTH 1Y6MR 2VTFA 1FFQA 3D25B 3CCHA 1BVZA 3O6KH 4OT1L 1LE9A 5CJXC 5JOPE 5E8OA 3BO8A 2VAJA 4XNQA 2CDFA 2ED7A 5JDJA 1OTTC 3HCVA 1T80A 3ZHDA 1I9RL 4LF3A 1FAKT 5KSBB 5I17A 5SWZB 3S96A 4QRRE 1VFMA 4IRJA 5HYEA 5I1GH 2YC1A 3RWHA 3ZKMC 4LAQH 1YEDB 3RJQB 3WIFA 1UM5L 4O5LL 4WCYL 3WKNA 1RUMH 1X5YA 3QNXB 1U9KA 4XPGH 4QTIL 1KLUB 3F58L 2B39A 4QYOA 5JHDE 4MAYA 3OKOB 5BV7L 2DQJH 2JLLA 2VYRE 3V6FA 3OAZK 3VDCA 3VW3H 5C0GB 3SCMB 5F1OB 1PLGH 5CJBA 2ATPB 3CVHH 4OM1H 4YDIL 2DQFA 3FB5A 5GHWL 1NGQH 1G9NC 3S4SG 4HT1H 4XXDA 3TIDA 2E8ZA 1A6WH 1KUMA 5E8EA 3VFTA 1YMHA 2HT2D 2JELL 3DHMA 2V7HA 4GUPB 4DTGH 4YHMH 1KTDA 4HX1B 5EZJB 5F6IB 2RB8A 1FQ9C 3HZKB 3OKDA 3RL2B 4HS6B 4AIXA 3E6FA 2D7TL 3O4OC 4LGRB 1SVCP 5ANME 3VWJD 4WU5A 4RDQG 4EVNB 1KN2H 2JK5B 1KEGL 2A73A 1YQVH 2FATH 3STLA 4A2MA 2FH6A 1I8LA 2DL9A 1IKFL 2R0WH 4M4RA 1SYVB 3U7YL 5T33L 1OGAD 2BOBB 3DV6B 4NQVA 2VZ1A 5L8LB 2IANA 1R0AL 2EDHA 2CLVB 2MHAB 5T1LB 1J8KA 3F7RA 4PRDB 1A9EB 4FG6C 4G6AC 4M7ZC 1GHFH 1IGFH 4AMKH 4TNVF 5BO1L 4C54A 1U2CA 1BZ9B 2HLAB 1JPFB 4ZUSA 4XPAH 1MVUB 2D31B 4PREB 2HMIC 3LN4A 3O9WD 1OY3B 1QSEB 3JV0A 4BSJA 1LO5A 5BJTB 2G9HB 1F11A 2PR4H 3WFEL 3T0EA 2XY1A 3BKJL 3O4LE 5CKAA 5CIPH 5CGMA 3LN5A 4YLQT 4LLVB 3T0BA 2EE3A 4W6YB 4M4PA 4BQ9A 3UJJH 5L8KB 1I1FB 2IBZY 3W5MA 4X80H 3VG9B 4RGMB 3X12B 4E5XA 5HHOA 5E24E 4Y16A 3FL7A 3D18A 4L4TB 4JM2D 2ZCKL 3BHBA 4XAWH 4IHOB 4IJ3B 4UIMA 2P5EE 4KRLB 1J8HE 3BD5A 1FVEA 4LKXA 3UYRH 4NO5A 1AKJA 5TQ0L 3RIFK 3H3PL 1K8DA 1B9ZA 5DSCB 3J8F7 4R90L 5L2JA 5E00B 1WUNT 5I1EL 1R3HA 1U8IB 4PTUB 1I1RA 2K7PA 3MV8E 4D0DB 3WDHA 2W38A 4DJMA 1F42A 1JHKH 2W9DH 4NRXB 5H35B 4OQTA 4KTYA 3QXAA 1P5UA 4GO6B 3AS1A 3DX6B 3BE1H 1MNUL 2JIXA 3PDGA 5DVKA 5ISZD 1NGZA 3MREB 3WFBH 4FMKA 4IOSD 3QDGB 3TT3L 4R2GB 4BH7A 4S10A 3CVIH 3VWKC 3KPRD 1IEBA 1EMTH 4S1RL 2YD1A 1NCWH 5E99L 5D1XA 5C07E 1E4KC 3KYOB 3SDCC 1ZHLA 2EDFA 4G8EA 1T22A 4WHTB 4R96A 2VRAA 1FC1A 4XPHH 4FFVC 3EO0A 3VRIA 4G6JL 3BXNB 1S9XA 2UYLA 2N7AA 3FT2B 1NGWA 5I19L 4ZFZA 5JQHC 4HIEB 3FONB 1GCFA 4PP2A 1ZSDA 3IAPA 2O26U 3NN8B 2YD5A 3HG1D 4K8RL 4HBCL 4ODTL 3RGVA 2AJSH 1UA6H 1QQDB 1OQXA 1TXKA 3MRHA 5FA3B 5JXAL 4ZNEE 3VXUB 3GM0A 3UTTB 5E6IB 3BUYA 4OCYL 4QO1A 3VGGA 1CT8B 1HCFX 5DK3A 1AO7B 4WW2B 3W2DH 2B1HH 3ARFD 3HZVB 5EA0H 2ERJB 1S7XA 3BAEL 1MHCA 4NNYA 1IM9D 2UUDK 4JO3H 4Y19A 1ZHKB 4LSQL 5CGYC 2D2OA 3L95B 3VXRA 4KI5E 5E8PA 1RY7B 2UV3A 3RHWF 4CVUA 2J4WL 1KPUB 1OSPL 1CFQA 3IU4H 2HTLC 1IGJA 1U8MB 2I25N 4JFEA 3CXHK 5LQBL 2HG5B 2EH7H 5ETUA 2VZTA 1L6ZA 1FCGA 1KN4L 4AG4L 1D5ZA 1BVKB 4XX1E 3TT1L 3FO1A 2ARJB 2JB6B 3PWPB 4EOWH 2NY6B 2P8LB 2ZNXA 3VFGL 3CMOL 3QHTC 5HI5C 4LPYA 3LEXA 4MJID 4X6FA 5E94B 4XI5D 1QVOB 2PYEB 4IRZH 2F15A 4P4KA 3WLBB 1S7SA 5JA9A 5L88H 2A9ML 4JZNB 5BVJB 5IBLD 3NACH 3HNTL 4PRHE 4D9LL 2V7NB 5F89A 2FD6L 5HHVH 5E9DA 2AJVH 2OL3H 1HZHH 2C3VA 3BD3A 3SJVA 3U0PA 5F7EH 1FSKB 4JPVH 1ZS8A 3AB0C 5T5NF 1F5WA 3HPJB 1JZ4A 3Q6GL 3TZVA 4ZS7H 3G5VB 1KSRA 2OSLB 1RI8A 2EXWD 4HS8H 5CKGA 4JO4H 1RUQH 1XF5A 1T5XA 1MIEH 3TBVB 5D7JB 2VITA 4ZUTB 1W72A 3FAXA 5BRZA 3HFMH 1D9KC 3BP7B 3WUWA 1CGUA 2I07A 4R4BA 3QXWA 3GM8A 4G80A 5J1AB 5DT1L 4ZFGL 1JPGA 1QTYT 1INQB 4OCXH 3MLUL 1OT2A 3VA6A 4DEPB 3X17A 3B5TA 4Y4FB 1DBKH 5C0JA 2E5EA 1LEIB 4J8RA 4MD0B 1BREA 2VN7A 3QDMA 2CXKA 1NL0H 1WC7A 4OZIF 2EDYA 4YBQD 2WUBH 2W0KA 2MKLC 3TVMC 1MQ8A 3V6ZB 5DRZA 4Y4HA 1CL7H 2NY3D 4N8PA 3GSQA 1U8NB 4YHZH 3QNYB 3AMKA 3TO4B 3EO1B 4I9WD 1AQKL 1A6UL 2B4CC 5DD1L 1Z5LA 1NCAL 2R69L 8FABB 4KK6D 4GLRI 4UV7H 2AK4A 3C60C 3UTSA 2BRQA 4FQLH 3WFDH 4XVJH 5TE6H 3VFSA 3SDXB 1BJ1J 2FEDD 2FIRT 4M3KB 1X6LA 1I7UA 2ED9A 3FRPA 5KSBE 3IDXL 1YYML 5EIVA 5SWZE 3TBYB 1TJHL 4J4PD 4N0YH 3LN9A 1WLHA 3BH9B 3EHBC 4Z78A 1AE6L 4RMQA 4GKZB 2R0LL 1CGTA 1FAIL 5BQ7B 1FE8L 3K3QA 4LLQB 5J3HC 2AEPH 4PD4K 1CFBA 1VFAA 3ULUL 5F1SA 4N1HB 4ZD3H 4U4BA 3RKDC 4P3CH 2XKNA 5FEBA 3D87B 4NNXB 5IB3A 1JTTA 4TUKH 2P42B 5JOPD 2FHBA 1F4HA 4WI2A 3QRGH 2YKLH 2JCCB 3SGDI 3BEWA 5E2UH 4CDHA 2V5YA 4X5LA 3QUYA 3P0VH 3PWUA 2XN9B 4OJFL 4QRRD 4TNWF 5ABDE 1BJ8A 2HJLA 1INEL 2VLJB 5JPNB 4M43L 3DMMB 2YXFA 3RTQB 3WLWD 2YPVH 1X7QB 5DUBA 1TETH 5ID0B 4M8QA 3RNKB 3MRNB 4XVTL 1KG0B 4MDJA 3A6BL 2R9HD 5DS8A 5E7FA 5JOEA 2DF3A 3HKFA 2Y07H 2BHYA 5EWIL 2CDEA 2OTPA 1BEYL 3EUUA 3UTQA 1KCKA 5IHZB 4TVPD 3FFCA 4ZG1A 3PV6A 2EDOA 5DMIL 2LFGA 4OD2A 2FGWH 5I76A 2X89D 2X4OA 3KR3L 5LAXA 3QAZC 3ZT5A 2RCSL 4PJGB 5LGJA 4K3EL 1FL6B 1SHMA 3QB7C 2QQKL 5JORB 1OAZH 4M7JL 1XCTB 3QNZA 1PDKA 2IG2H 4X8JB 1Z3GH 1QSEE 4UNTA 5F9DC 2YUZA 4Z7VA 2MSPA 4M61A 4P59H 3SDAC 3M8OL 4KJPD 3QUMA 4L4VB 3TJEH 1IEAB 1O0VA 2BDNL 2FX7H 5E08H 2DI9A 4JGUA 3KLDA 2CIIA 3QISA 4MA3B 5ICXA 2BHZA 3BKML 3QULB 1VFUA 3DROA 4F7CA 5HVGB 1EO5A 3R0NA 1ETZA 4ENEC 4L4TE 2OJEB 1LO4L 1UJTA 1XF3B 4MNGA 5DD3L 4GMTL 3SGJA 2PXYC 3W39A 3MO1A 2QQQA 4M1GH 4X98B 4JLRB 1FO0H 3WFHA 3VGBA 3LS4L 1VGKA 2NW2A 3KYMB 4WDIA 3O4LD 4MNQB 1J86A 4MJ5B 2B5IB 2ATKB 4JQIL 2GW5A 4W70A 5DJDA 2VJXA 4Q9QL 4U6YA 3KGRA 4PJXA 1FGNL 4KI5C 3O3DB 3QXVA 4HPOL 2BVQA 4G6FD 5ILTH 3P77B 5FYJU 3VXMD 4C83B 3RZWA 5I16B 1BWWA 1DFBH 1KPRB 5DI8B 3B9EA 1IFHL 1K8IA 2P5ED 5JPMA 4DN4L 2IMMA 1SQ2N 4YHNB 1U8KA 1QFUL 2VQ1A 4N8VA 5F7YC 1ADQL 4GXVL 3VFMA 4YPGB 1T04B 32C2B 5KG9A 3CDGB 4Z5RB 5JTWA 4M7KL 2FX8L 2HFFA 1X4XA 4YHOL 1FG2B 1MRFH 2J5LC 3MV9D 3K2UH 4PJAA 4U1LB 4RFNB 1T66C 3QUXD 2P24A 3MV8D 1UZ6F 5LG1A 3PWLA 1N2RB 1U3HD 3ARGC 1OARL 1A7PL 1S9WA 1Q9KA 3OKNB 4PJ9A 2DAVA 4O02H 1H3VA 4ETQA 1FZJB 4KJWD 2COQA 1X5LA 2NY4D 4HV8B 2CLZB 1F90L 4MCZB 1G7QB 1WBZB 4QEGA 2FYYB 4OCRH 2EZ0D 1U6AL 5I66A 1TITA 3QHZH 3OJDB 4JHWH 5B39A 1FFPB 1LD9A 1UH3A 1XAUA 4NN7C 5I73C 2A2QT 5F7MC 5CILL 4XP5L 2MWCA 3VXUE 4G8GB 1KULA 1NMBH 4EI6B 3UTTE 3U7WL 5GRVL 1IZKA 5JR1H 2NX5D 1OGTB 5CCKL 1DLHA 3MRLB 1AO7E 4QHKI 3QUZB 3HUJE 3IDJA 3WXWL 1LDPH 1MFDL 3EZ8A 1GGIL 5JUEH 1PX3A 4XNZC 2WWMD 4WI5A 4WW2F 1OWRM 3HUJF 5EO1B 1JPSH 5DRWA 2Q7NA 1EDQA 4ZXBB 1G6VK 3OJ2C 1H8SA 3BKYH 3ILQD 4PJ8A 1N6QH 3TF7C 5F3BA 3UTPE 4AQOA 1UKSA 5A2JH 5F96H 3B2VL 1MWAL 4U49A 4X6CA 2FLRT 1YDPB 4ZO6A 3QIBA 4QHMB 3MNVA 1DDHB 1UXWA 1UACH 2Y6SC 3QDJD 1BGXH 2CPCA 3O6MH 3MCLL 4YDKH 3EYOA 4WI7A 5DJYA 3HC3L 3REVA 4H1LH 5IW6A 4MXVE 3PWPE 1RZKC 3N85L 2ADFH 1W0WB 4CGTA 1AC0A 1CIDA 3GEWB 2Q6WB 4ELMB 4H0IA 5HI3C 3BPNC 4OIIH 1Q94B 4P2YA 4L1HA 2DLIA 3REWB 2VUOA 3KDMB 4KTDH 3LH2L 2EEAA 1MY7A 4UOJA 1M05B 2QQLH 1R5VA 5I8CA 2DN7A 4IOIA 4L9LA 5HHNB 3TWCH 4ESKA 4P2OB 1VPOL 4RQQA 3MOBL 4YFLF 4OD3L 5CINL 1CICC 4Q74A 5C0AD 2ZPKL 3ARTA 1EEYB 1XGTB 3RDTA 1F4WL 4PJEA 4M6ML 3GI8H 5BZDA 3QO0A 4ODUB 4NN5C 3NCJH 4OCNC 3F6LA 3C6LC 4ZAKD 3TBSA 1AGFB 2B4CL 2WMPA 4RGNB 2XZAL 4PRHD 1R3IL 4KAQH 4PJ5A 2RR3A 5EO9B 4OV5B 2KBGA 2MJWA 2VE6A 43CAA 5F6IC 3VFWA 1YY8B 2Y36L 4NM4L 3OZ9L 3V52L 1WVZA 3MLVH 2X4QB 2NY5L 5E95B 2BHUA 2GIYA 5JIPA 4BKLB 3OWEA 4FFYH 3VFPA 4PJDE 4WFFE 3VDBA 5IB5B 3L5WB 2W07A 2H45A 5DQJA 3B9KA 1TFHA 4OGAD 4PJDF 1JN6A 2IPUK 4LCWA 5DFTA 2BVYA 3SDXE 4CMHB 4BK4A 4EUPA 3ROLB 2CIKA 5EO0B 1GYAA 3KYNB 5KVFH 5DRXB 1BZQK 5D7IA 1OVZA 3T77B 1CG9A 1OT1A 2GAZA 2VABA 1P4LA 3EYQC 5D1QA 1NFDA 3BESR 5HDBF 4F57L 4U6VH 1UKQA 5HYQA 1EO8L 1WT5A 3X11A 5HDLA 1R5WA 3C9NA 2EYRB 3FZUD 4BSWA 1HXYA 5FM5O 2OR7A 5B3NA 1CLOH 2VDQL 4KVNL 2NR6D 4LSSL 2DQGH 1DL7H 3N1MC 1WFUA 2JCCE 1H3UA 3EYUL 2CUMA 5DC9B 4PJHF 4IJ3C 3MRQB 4U0QB 3HI5H 3H42L 2XN9E 2JCCF 1NJ9A 3BISA 1FYTA 2VLJE 4YK4B 4JRXD 1BJ1H 4HFWA 4LRIC 3P0YH 2Z92B 3FO2A 4FQCH 5JDSA 5J1TC 2R0ZH 5KSAA 2OK0L 5I9QB 4UT7L 1U8OA 4XP9L 1G84A 3QWRA 8CGTA 5C0IB 4Z7NF 1ZANL 2DTMH 4YC2C 4LSRL 4A6YH 4Q6IB 3SCMD 3GBMH 1GPOH 1LO3L 1IGCL 3U9PH 2P5WA 3ZZ1A 4BUHA 3LKPA 4PR5A 3DIFB 3PIQA 5IVXB 2YPKB 3G04B 4DKEH 2GFBB 2IPTH 2OR8A 4AENB 2O93L 3C8KA 4Q2ZA 5T1KA 5CEZH 1D5XA 1LP9A 5I1CH 4R2GC 2QSTA 4LMQI 3V5KB 2F54B 1MCNA 4LPTA 4O2CA 2PNDA 4PJGE 2J1KA 4X9HA 1VEPA 5I74C 3RUGA 1HINL 4ZUVB 1S7WA 5GGQL 3QG7L 3SGKC 5DMKB 2QKIA 1F4YH 3SPVA 2AERT 1DQLL 2QADD 1A7QH 4MS8C 1YMME 4XMKL 3VD5A 3WSQH 3R4DA 1AXTH 2AABL 2XYCA 3WS6A 2ICEA 1E27B 1E6OH 1NUGA 5F7UA 1XGUA 5C9JA 4FQ2L 1MJ7L 4L5FL 5HPMA 3GJFK 4L4VE 2R15A 3DVNB 4NRZB 2EIEA 1LMKA 5F7WC 4YXKH 5T1LD 3OQ3B 4N0CD 5MERA 4P46D 1WFTA 3UTZB 4LU5L 1U91B 1DLFH 3QFDB 2ZJSL 4HHAB 4GRLB 3DXAB 5E6IC 1C5CL 1QSED 1AD0B 4X4ME 3C5ZD 3EGSB 3FRUA 1ZTXL 2OCFD 1TZIB 1F4AA 3H7LA 3HR5B 4JG1L 2X9WA 4CL7A 3ZE0E 4JFQB 4U1MA 5TDOB 2ERJC 4PRIA 2PKDA 5DZLA 1HHKB 1YEJH 4JFYB 3MCG1 3UAJC 4NKIL 5D7SL 3S5LB 3ZE0F 1FL3B 4EDWH 3OF6A 4HJ0D 1ED3B 5DHVA 4XT1C 1BBJA 4JFHE 2W0FB 2VZ3A 3VMOA 3DARA 4KTEH 1Q0XH 3MXWL 4QY8B 3MRPA 4NHCL 2BVEA 5DHXB 2NY1B 3ARBB 4JE4B 1WV7T 4JRYA 1BOGA 4HXBH 1A3LL 2Y06H 3KPLA 4PS4H 3GSUA 3JVGC 4XP1L 3D0VA 3MA7A 2XWJA 2APVA 3LS5H 1QYGH 4EI5B 1QBBA 2PTUA 4BZYA 3BPCA 3RVUC 1MLBB 3TH3T 2QHRL 1I9IL 2VSDA 1OB1A 1U58A 3FB7B 3HE6A 3T0AA 5DUML 4NQCA 1J7VR 4URTB 1A7NL 5EC2A 3ZT6A 4DQOH 2C4FT 4JG0H 3MLXL 4NQEB 2Q1EA 1ZT7B 1CCZA 3BDYL 4TN9A 3BP4B 4I0PC 3DUUA 5DR5L 3S36X 3U46A 1FZOB 1VFOA 4QNPF 1RIVL 3KXFD 5K9KB 5IJKA 1DVFB 1HWHB 3MRBB 1OAQL 2K1MA 3GIZH 2C3XA 3LKNB 1AHWC 3BWUC 3JV6A 4G9FA 3EOBA 1FSKC 5FUZL 2AEQH 3WHXB 2ZUQB 3JWOC 2FL5A 1A7OL 5FA4A 3D6GA 3VXPA 5I1KH 2FJHA 1A7BA 4YUEH 2XWBB 4YQXH 5D7JC 3OBAA 5F70A 4XZUA 4NZUL 3MGOB 4KRPB 3U0TA 2F5BH 4G8GE 3BWAA 2FGZA 2I9LA 4L8CA 2ORBH 5KS9A 5FF6B 4Y5XB 5I2IA 5EDXA 4X9FA 3FQRB 5EOTA 4AQ1B 1U8HA 3QEGH 2ZCHL 4Y4FC 1UB5B 1RZKL 1ZK9A 1RU9L 1FGVL 1Z0MA 3QIUB 3NCEB 2Q7YA 5K9JL 1GL4B 4PUBL 2G5RA 3UXFA 3L5HA 4MDIA 1RZJC 3LKRB 3IJYA 3LCYA 3OR7B 5HHQA 4NKOA 4XMPL 4ISVB 3UTTD 1V05A 3OXRA 4YDVA 2DDQL 2EC9T 1HSAA 2ZWLT 4RFOH 1AO7D 4NSKB 2IAMD 3IVKB 3LRHA 5IMLB 1KBGH 5ACMA 1T7ZA 5KW9H 3QQ4A 1M7XA 1EZVY 4LPWA 1GRWA 4LHQB 4M62H 1P7HL 3QCTH 4GBXD 1KLGA 3SBWA 3KPPA 2HT2C 1AFVL 2NYYD 5D2LF 1IARB 3I6LD 3TH2T 4WRLA 4LPVA 4JPWL 4GOSA 3UTPD 3IFOB 1JRHI 3BP5A 2EIZB 1C08B 3ZO0A 4UILH 4NQTA 4KXZI 3JSSA 1LE9B 2OZ4H 4GAJL 5FXCH 1MFAH 4P5TD 5HHXH 1H0DB 2BVPB 4F7PA 2NY6D 2FSEA 3ES6A 4HK0B 4MD4B 5I17B 1S7VA 5IBTH 4S1QH 3SKJH 5J7CC 1V3KA 1JYWA 4Y1AA 5DEFA 4EN3A 1X5JA 3NA9L 4IS6B 4RGNE 2ADGA 1MJUL 4M7LT 4PJ7A 1T3FB 3PWVA 2WBJC 4W6WB 4HWZB 2QLVB 4O00A 3E8UL 3CFDA 5TE4L 2Z35B 3RI5K 3KYAA 1XIWB 4OFPA 1A14H 4XAKE 1AQDA 5JQ6L 2P8MA 2XG4A 3Q0HA 1WIUA 4X6DA 2V6HA 3PGCB 3DURA 5TH2A 2YD6A 3R8BB 3HC0B 5HHPA 2IMNA 3MJ8A 5CJXA 2AXGA 4HJGB 1FZMA 1TJGH 2F53D 4MAUL 1U8LA 2H6PA 2YWZA 4LLWA 3CU1A 1H15A 5E8EB 3RVVC 2WAHA 1LNUB 2V17H 4ZQKB 5AD0A 3S88L 4L3AA 5GZOC 4FNLH 3BQUC 4QRSB 3DRTA 2GITA 1WTLA 3MRRB 4QCIA 4H25A 1G9MH 5DQDH 4X99A 2R2BA 3EIFA 1K2DB 3PWJB 4QXGH 4OCWL 1M6OA 2Z93A 4JO1L 1HCVA 4ONHA 4KKBC 3BEVA 4WFFD 1IQDB 3TO4D 2XRAL 4ORGA 2UZXB 3BRFA 2R1YB 3FCTA 1KB9K 4G9DB 5GRYA 1FBIH 4M48H 3VU2A 1OOAA 3WXVH 1WF5A 1CDGA 1QEWB 4AM0A 2R1XA 4PGCB 4V1DB 4NBYB 2FB4H 3U48A 4HUMB 1TVHA 6CGTA 1KB5B 3VI4E 1KPVA 5HY9A 4RGOH 1ZWIA 1NBYA 3H9SE 3NIGE 2VSCA 4WVRA 1JZ7A 3VI4F 4H20L 1FFRA 5K59E 3KPSB 2XICA 7CGTA 2B5IC 2GK0B 3KJ4B 3O6FA 1HI6A 2J12B 1RJLB 3O2VL 5K59F 4OM0H 3GK8L 1CS6A 5C09A 5MEOA 1WTGT 2VZVA 4ZOBA 1JHLL 3O3EA 4OSUH 1BPVA 5IW1B 4JN1L 2LTQC 2VXTH 1VACB 1BD2D 1CD1A 3D85A 1UH2A 1I9JL 4NKQB 4UIMB