3T0XA

Fluorogen activating protein m8vla4(s55p) in complex with dimethylindole red
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
EPVLTQSPSVSGTPGQKVTIFCSGSSSNVEDNSVYWYQQFPGTTPKVLIYNDDRRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCLSWDDSLNGWVFGGGTKVTVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin variable lambda domain M8VLA4(S55P)
publication title A variable light domain fluorogen activating protein homodimerizes to activate dimethylindole red.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dye-binding protein
total genus 22
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3t0xA00
4WGWB 1KTDB 4JO4H 4PRBB 4JFFE 4MCYA 1H3TA 25C8L 1JFQH 1CXEA 3MA7A 4LK4A 4M5ZH 3WNNA 5JDJA 1DSFH 1M6OB 3R1GH 1J1XH 2PTVA 1FE8H 1U8HB 1L7IL 4RGMB 1Q9LA 4OI7A 4NCDA 2CR3A 4I1NB 5CS7A 4X9GA 1EAJA 1DDHB 3QDJB 4P5MB 2X70B 3D18A 3WN5B 4LU5L 2ZCLH 3GMNB 4I0KA 4DGYH 3BZDA 4ZYKA 3ARBC 1NCDH 4XPAH 5GGQL 4X6CF 3QDGE 1CT8B 4LQFL 3TJHC 1QRND 2WINB 3ZE2F 3S97C 1D3CA 5DK0B 3O6FB 4G8IA 1DUYA 4JM2F 5JXEA 3OKDB 3WL9A 1UM4H 2AXFB 2IQ9L 3NCEB 2F9BT 3BPOB 4Y2DC 3B4NA 1N7MH 2QQQA 3AY4A 4C83B 2W65A 3DYPA 4LCIL 3DETC 5I2IB 3MRDA 3GEWB 5T5FL 3EFFA 4MNHA 3A67L 3QXAA 2Z31B 4C56E 5CSZA 4PLOB 5JIKA 3IFLH 5IB1A 4FQCH 1WTLA 1LHZA 3SKNA 3HNSH 4QRTB 3JVGA 3IXAA 2R2HB 6CGTA 1BVKA 4EOWL 3MRMA 2FX8H 2V17H 5F97E 4QHMB 1LO2L 1YEIL 1U3HD 4XT1C 4JPKH 2ATKB 5JIIA 3DO7B 3PDGA 1Y6NR 2QLVB 5IW6B 1YEHH 4M93C 4KKCD 5IJKA 1M71A 4RAHA 4YGAB 1W8OA 5E00A 4OZ4A 3CDGA 4X7TA 3RL2A 5I76A 2IPKB 4WWKA 5FHAL 5HVHC 5E03A 4P3DB 5EO1A 3RZCC 2AQ2A 4JFQB 2WAHA 4GRLC 1DBBH 5EN2A 4Q6IC 3HRZB 1EFQA 5DEGA 4PRPA 1AI1H 2X05A 3L3KB 1NMAL 4WUKH 3BOVA 4JZJA 4YE4L 4BZ2H 4E41E 1T22B 3MBEA 5BVPH 3RWFA 1XIWA 3TVMC 2XWJA 4GG6F 3L9RB 5CBAA 5BJTB 2AVGA 5IB3A 3MLRL 3QRGH 3SE8L 4MX7A 3SGJA 3I50H 4XCNA 1UB6A 5KAQF 5C8JB 4UTAH 3C2AL 4NBXB 3FMGL 4I2XE 2IPTL 1EIBA 4I77L 4DZBA 4JFED 3UJTL 2LTQB 5JW3L 1YMHA 3D39B 4HIXL 1U2HA 4L4VD 2P8LB 1FYHB 4YDKL 5FKPB 2ICCA 5L8JB 1CICB 4G43A 1ZHKA 3ARQA 2VERN 4D9RE 4F9LA 2NY7H 5I1GH 3QDGB 4RZCB 2DKSA 5KVEH 2D9CA 1JBJA 4HFWA 2VAJA 3EKCA 4X7SH 2R2CA 1BQLH 4DQOH 3FB5B 2O5YH 4P2QB 2VR5A 2E9JA 1KBGL 3BZFB 1Z9LA 2P5EB 3GSWA 2DLFL 4WY7H 3X12B 3EAKA 1NFDB 3L3HB 4JN2A 4XXDA 4G8EA 1BFVL 3RL1B 5C0RL 3O9WA 5I18H 3IS1X 4KZDH 1WF5A 1DEEA 3T0EB 4P57A 4JANA 2GJ6A 1CFQA 3S96A 2HJLB 3B43A 4F37K 2OSLB 4X6EA 1K9TA 3KPRA 1RUPH 5GRWA 3Q1SH 3DGCR 3PJSB 25C8H 2WWKT 4Y4FA 5ELIA 1A2YA 1DLFL 1BJ1J 5KN5B 2CLZA 2HT4D 4PJIE 2VZTA 4Z7NE 1T4KB 4CNIA 1Y18B 4W4OA 4QRRA 4WRLA 1HH9B 3VFSA 4XAKE 4WCYL 1XR9A 3TN0A 3OKEA 2DQUH 2QL1A 4HUVB 1DQLL 4N9GB 4E0RA 3KPSB 2OR7A 3QIBA 3IS0X 3B9KD 3IDIA 4JM2D 1YEFH 1X4YA 1B4JH 5D72L 1TPXC 2IGFL 2QQLL 3BQUC 5I71C 5KANG 3MXVL 4NRZB 3L7FB 4E41B 2CO6B 4C57C 3L7EA 3ARGA 4L8SB 3QI9B 4WTZA 4O5LL 5EA0H 3TO4D 4R6UA 5D70L 1NFKA 4JO2L 5CCKL 4HK0B 4JVUA 1IT9L 4OKDA 3WJJC 1DANT 2HKHL 5DVNA 5IMMA 4I2XB 3F5WA 1HH6B 3WNMA 3I6GB 1CDJA 4MB3A 1GGUA 4C4KT 5FO8A 1X9QA 4OZFA 4S0TD 3IVKA 3BO8B 5E99H 4P9HL 5CMAA 5T5FH 5IIEB 1P1ZA 1MHEB 1OGAA 4HS8H 2O61A 3PWNA 5CJ5A 3ES6B 1HSBA 1P84J 4FXLA 1XT5A 2XZAL 4WW2A 1RUAL 4HF5L 2KDGA 4G3YH 3DRQA 1T89C 2JK5B 4X99A 3BGFC 3KLHD 5EU4A 4EOWH 2PXYD 4KJQC 4J2XA 4UB0L 1KIRB 1LO2H 1YEIH 2B0SH 3C08L 1U8JA 1UG9A 4Z7UE 5FYKE 1H9VA 5GZNC 4M4PA 4O2FA 1ULVA 4U6XA 4FXGB 3SGEI 4A6YA 4JY6B 4Q0XH 1Z9MA 4DFHA 1C1EL 1MREL 5DHVH 1EPFA 1P4LB 4HD9A 3LQZB 5EC2A 4PJ9C 1JZ4A 5BRZA 1NMAH 1LO5B 2NTSP 1XZ0B 3QFJD 4YE4H 1J1PH 3G6AA 7CGTA 2YXFA 4D9LL 3UBXG 5F3BB 2OMNA 4FFVD 4U6TA 5HHME 2VDNH 5J4MA 5D7IA 5FOJA 4FQIH 1OAXL 1MLCA 3P4OB 3VD3A 3I02A 2C7UB 3QJHA 3V7MA 1LMKA 1KCSL 3DWTA 4AQ1B 3C2AH 4NO5A 3FMGH 3MRLB 2IPTH 1D5MB 1XGUA 2DWDA 3QUYA 4LPXA 1PY4A 2OCFD 3UJTH 5JW3H 1IAKA 2CIIA 4YDKH 5E6IB 5A2LH 2A9MH 2BSRB 4OV5B 3ROOA 5IVNA 3FB6A 4QHUB 3KDMB 1JPFA 1UYWH 4JM4L 3K74B 1AKJA 3IJYB 4NUGH 2NYYD 1C7TA 4N68A 2WLYA 4BK5A 4D3CH 3E6FA 4L29B 4OTXH 3CSGA 2DJUA 3C60C 4LMQE 3RX8A 5J12B 1XF1A 5FA4A 2F15A 1MNUL 4XBPB 5IFJA 2ESVD 3NN8B 4AENA 2DLFH 1T7XA 1NCWL 5CIPB 1G7PB 2H3NB 2N1KA 4PJ8C 4X5XB 2AEQL 4JR9L 1BFVH 3DRTA 5C0RH 3HCVB 4MA1C 3VWKB 2Q8AL 5KG9B 3U7YL 1G9MC 4ZG1A 2VDQL 4MNGA 3K46A 3DI3B 1Z2KA 5C0JB 4OSUH 3RWDB 1YC7A 1MCRA 4HIJA 3S36H 3U36B 1M4KA 4N0RA 1S5HA 3U0TA 4HWEL 3MROB 3ILQD 4OFDA 1QSFE 3OGOE 1ZT7A 4IM8A 3U2SA 1DLHB 4OCSH 4AJ0A 1DLFH 4P46D 5GZOC 1TDQA 2OL3L 2XA8L 2AGJH 4QWWC 2X1XR 3JTSA 3RIAF 1FNGA 4WCYH 4ERSL 2P7TB 3K1KC 4NRYA 1S8DA 4GS7B 3TNMB 1H3PL 3O3AA 1C12B 1TQBB 5D72H 5B8CA 2GAZA 1KENL 2IGFH 2MPAH 1IGMH 4NC2B 5MERA 4XPTH 3ZDXE 1U95B 3QDHA 3PWLA 4LVOB 1BLNB 3UTSB 5TPWL 2Y6SC 1ETZA 1KJ2A 1FZKA 3CVIL 4O5LH 3ZYZA 4HUXB 4PBWD 3DV6B 4JO2H 2VJXA 5CCKH 3HI1A 1FJ1A 1FFPB 1IT9H 5JXEC 5GSRA 2ZPKL 3EOBA 1LP9B 5ANMB 3MLTA 3HI5H 1E27A 4IOFD 3AY4C 4L1HA 2ZG1A 3ARVA 2AJ3A 1AQDB 4P9HH 1EVTC 1VERA 4MD4B 5EPMB 5HGAB 4ODXB 5FA3A 1KACB 4Y8AA 2VQUA 4MMZC 4NM8L 1NC4A 1RUAH 4HF5H 3S88H 4IRSA 4JDVB 4IBLT 2P5WD 1RUML 4A6YL 4LCUB 1MRDH 3AUVA 5GRXG 5EFIB 4KQ4L 5IJKC 3GHEL 2HG5A 4DVBB 3MTRA 3ARBB 2R0WL 1D9KA 4OZGB 5T1MB 1IGIL 2XKSA 2A6IA 4OB5H 5E2VL 2DS4A 3SDDB 1YUHB 4WWKC 3AU1B 4KDTA 4OF8A 2CLVA 5F7LB 4S10A 5TH2B 5IK3A 5SWZB 4JAMA 3EYVB 2FX7H 4IS6B 4PRHD 4Y2DB 4JRXA 2EDXA 1XCQB 3TA3C 1FVCB 5D7LA 2NY3C 3EJJX 3QUMB 4RQQB 4JZJC 1WJ3A 4W68A 3MBEC 1OP3H 4LEXL 4GKSB 4OD2A 4DVRL 4PJAA 4M6ML 4NZUL 4DUVA 5EIQA 4HS6A 2P42B 2PETA 4BFBD 1OAXH 3CFCL 4MQSB 3SGJC 1VFBA 2BDNL 5BS0A 7FABH 1MUJB 4M93B 2I27N 4WI6A 5MEOA 3QB7C 4HUWA 3T3MF 1JUFB 1TCRB 2KZWA 3ARFB 3D69B 4I0PC 4WI8A 2AW2A 4MS8D 2D7QA 1VEOA 2DI7A 4HV8A 5HVHB 1DL7L 3BJLA 3RZCB 1BQHA 3SJVE 4U2YA 4JFEE 1ZEAL 4YDVA 4GRLB 5J3HC 3OG6B 4Q6IB 2QHLA 4L4VE 1BPVA 4B5EA 3MJ9A 5C0CA 2X89D 4U1SB 3QSKB 1IL1A 3HZKA 3TVMB 1MVUA 3UDWA 1MNUH 2FH6A 4LGPB 4RX4D 2VXSH 1NCWH 4LHUG 2VNCA 2NX5D 2VLLA 3QNXA 3O9WC 2AEQH 3VFVB 5HXMA 5DWUL 3DO3A 3GGWB 3VFWA 3U7YH 3FAXA 2ZOLB 4G7YL 1NAKL 4JY4B 3INUH 4DKDC 1X5GA 3O2VH 3OKNA 2Y06L 3U1SH 2BRRL 3NFPB 5I75C 1CI5A 4GQ9L 3V9FA 4B53A 4G9FD 4AL8H 3WIFB 5LAXA 2OL3H 2YPLD 2DM4A 5T1LA 1FPTH 5DRNB 5K9OA 3ULUL 5EU3B 4ERSH 1NUDA 3EDFA 5FV2A 3LQAL 4U6HB 3ZSTA 2RQ8A 2FD6H 4WEUD 4FNLH 5AWNL 3MV01 4F2MA 2NMSA 1KENH 1NKOA 2AJYL 43CAA 2Y5TA 2Z4QA 2BVPA 3SDXF 1AIFA 3ARGC 4OZFG 5TPWH 3GSNL 4NQEE 4WUUA 1OARH 1QLEL 4ZUVA 1WFTA 3UTZA 2EH7L 2Z8WC 4OCRH 4OZFH 1E28B 5K33A 5DD6B 5ICZA 2ZUSA 4R2GD 2Q86A 1QKZL 3CPLB 1PEZA 4N8PA 5C0GA 3UX9B 1JRHL 2GIYA 5JW4Q 2FSEB 5T5NG 2CLRA 4Z77A 2APTA 1JTPA 2F54A 1L9NA 4EI5B 1AGEB 3QIWD 2XXCB 4AM0B 2Q76B 1KLFA 5EBLA 2HP4A 4WW2C 5HI4D 3SJVB 1AC0A 4MQXD 4PJCA 3U6RB 4NM8H 3QBTB 3C5SB 4G8GB 1TPXB 3QFDA 3OX8B 5I6XC 4W6YB 4QGTA 4A6YH 5JA9A 1X5ZA 1T66C 2VLKA 5J1AB 2VO5A 5TGBB 4KQ4H 1GGBL 3GHEH 3ZL4H 2DQHL 4PRAA 1A1OB 2EIBA 2V7HB 4CVZB 3HZVB 1FZMA 4LLWA 4TULL 3O2WL 2VDML 4GAYB 5E2VH 2GFBB 1PD6A 1OSPH 1WK0A 4YR6B 3R0MA 1ZKAA 4QF1B 4M3KB 4IRJD 4TQEL 5HYQA 2BNRE 4F7CB 1MCKA 3F7RA 2Y7QB 5DYOB 2CRIA 2DQTL 1F6AA 4KZEH 3RIFK 4GG6E 4G9DA 2C3XA 2AXGB 3C8DA 5GS0C 2E7CA 5JLZB 3O3UN 2R2BB 3TZVD 4XAWH 1CG9A 5BVJB 4LBEA 2FYYB 3HZMA 2BZDA 3KWWA 3CFCH 3BGFB 4DN4H 2BDNH 4QYOB 1FV1B 2Z35B 4ZUUB 5I1HL 3QUYC 2NLJA 3C8KA 1YEDB 4QRPD 1S7VA 4ACPA 1S7QA 4ODWB 3REWB 4LSRH 4JDZA 2OQJA 2YD6A 4MAUL 4NQEB 3TF7C 2OJEA 5IB2A 1YEKL 5C0FB 3HFMH 1OCWL 1IM9B 4LASL 4PJ9B 1IKFH 4HLJA 4Y2OA 3A6BL 2X10A 2X4SA 3PABA 4LLDA 3R0NA 4CN4A 5CFHA 2H1PL 3U0WL 2H9GB 3D1MC 3T0AA 5ETUB 2R29L 3EHBC 1JWSB 2X4RB 4P4KC 5CILL 1JVKA 3WO3B 1FCGA 3OJMB 5JHDD 4UU9A 5D2NA 5T33H 2XFXA 5FF6A 1KOAA 5EUOA 1EFXA 1EX0A 2Y06H 3UBXB 2BRRH 1MAMH 1Y0LA 1FN4A 2HFFA 3FB8A 2EIZA 2H8PA 1T7VA 3C5ZD 2M2DA 4PJGA 5A2KH 4BH7B 3VFNA 3K3QA 4GBXD 2VIRA 4UMGA 3BKJH 3WS6C 5F8QC 3TNNA 4CKVX 2BNQB 4QHLA 3BX7C 3M1BA 4NQVA 1QSEA 5JW5B 1VFAB 5DQJA 3V7AE 2FJGB 4UBDD 1IM3B 3C60B 4R8WL 1KJ2H 3ZLQC 3HMXL 4CN1A 2BNRB 1P53A 3VD5A 3QDME 1FFNA 4ELMA 1NLBH 4JRYD 2H2SC 5IB4B 2ZUQC 2AJYH 2I07A 1ONQA 5EG6C 1X6NA 1J10A 4NUJA 3QNZA 1JNHA 2A73A 4MA1B 4NKDA 4OM0H 4RDQF 4S1QL 1MCNA 3WNPA 1FFRA 1KB5A 4PLJD 5D5MA 1QLEH 1A9BA 4UQ2A 4HCRA 2EH7H 4P23D 3WXWH 2BVUA 4HJGB 1IKNC 3MV9D 2D03H 1U8MA 2HFEA 4MCYB 4NN6C 4NCC1 1QKZH 3P73A 2AXJA 3MA7B 4QHKI 2CMRL 4APQA 3SDAD 4PV9A 1T1YA 4OGZA 3TIEA 1B88A 1G7QA 1Q9LB 4ZO7A 4HT1L 5KZCD 4ZFOL 1UZ6F 3STLA 3HE7A 3UTTD 1E4WL 4IRSC 2F19L 2E27H 3D18B 2J6EA 1YZZA 1ROWA 1SMOA 3MRQA 1KCRH 3QUXD 3NH7L 3W0WD 1IGCH 4ZYKB 3KPQA 2XY1A 5MEQA 1AD0A 1D9KC 3FHAA 2P5WE 1U3YA 4G8IB 1DUYB 3O2WH 1VEPA 3S4SA 2VDPL 1VGEH 3D25A 3PXJA 5FGRA 2W65B 3DV4A 2R9HC 3JSSA 3MRDB 4OF5A 3EFFB 3QXAB 1T5XA 2DQTH 1JZ3A 5CSZB 1RU9L 1MFAL 5IB1B 5FYJU 4MCZA 5DRWA 4OZIA 4NKIH 3SKNB 1QRNA 3IXAB 2YRLA 3GK8L 4M6OH 4PRHE 1QFPA 3BKYL 1H3UA 5DA4A 3BIKA 1BVKB 3MRMB 5C9KA 5FYKL 4LLMA 5TF0A 5BXFA 3MJGX 1NCBH 1FAKT 3PQYD 3K4AA 1DE4A 5I1HH 1AY1H 5C7XL 2W1NA 3ALWA 3K80A 1XGTA 1M71B 3WHE0 4ZS6D 5C6TH 1YJDC 2LVEA 3H9SD 5E00B 4OZ4B 1RZ7H 3CDGB 3LZFL 4X7TB 5LWYL 3RL2B 3QXTA 2GITA 3MJ9H 5F1IA 3I3EA 5I76B 4WWKB 2PO6D 3EW3B 4MAUH 2AJUL 5EO1B 5T3XD 1QBBA 1YEKH 1IEBA 1OCWH 5EN2B 4ONFL 1UADC 1CE1H 1OP9A 2NY3B 2XICA 4JN1L 5DEGB 4PRPB 5IOPA 2AK1H 1ZGLP 3VXMA 4JZJB 2NNAA 2X7LA 4P5TC 2YOCA 3MBEB 4J8RA 3RWFB 1XIWB 3VGFA 3LD8C 1DR9A 4MA7H 2XWJB 4DFIA 5CBAB 3VU2A 5GRYA 5IB3B 1P5UA 1YY9D 4MX7B 4J6RL 5I9QC 3WUWA 2ZJSL 4XCNB 1UB6B 2BNUA 1B4RA 2CSPA 2ED7A 3D5OF 3LQMA 3L3JA 2FR4A 3O6ML 4DZBB 4AIZA 5HDQL 1WZLA 4RMSA 5BOZG 1YMHB 2NX5E 5ABDE 5JO5A 4G43B 1NH6A 3C6SA 1ZHKB 3N1MC 2ID5A 3KYOA 3SKOA 1UM5L 1JGLL 3FO0H 4JEGB 4PJEF 5CJXA 4UNVA 4HFWB 1BGXL 4KMQA 3CLFL 1FNFA 3DVIA 4LF3A 3QJFA 2R0LL 4KTEH 3U7WH 3RY6A 5IBLC 4HFUH 4YDIH 3ZMRA 3GSWB 1C5CL 5TDPA 4XP1H 1OB1A 1WBYA 2YPLE 1HE7A 4JN2B 4XXDB 4G8EB 2VR9A 3O9WB 4YBQC 5JHLL 4FTVA 2QADD 2X4OA 4OCXL 1DEEB 4Z7QF 3B2UD 4JANB 4P57B 2GJ6B 1CFQB 3S96B 2ZUXA 4X6EB 3SBWA 3KPRB 3ZKND 4PRID 3OB8A 4LCCA 5I75B 4CVWA 1IC7H 4Y4FB 1A2YB 4WI2A 2ICWI 4P3WA 2CLZB 4Z7VA 1V7NH 4HJJL 4J3TA 2FEDC 4Z95L 1MPAH 1S7TA 3MLWL 5KSAA 4CNIB 4QRRB 3VFSB 1XR9B 3TN0B 3OKEB 3IU4L 4HT1H 5E24E 3H2WA 4E0RB 3MRFA 3TEUA 1JPSL 3QIBB 4WEBH 1E4WH 4QCIA 3IDIB 4MXWL 2EDNA 5IQ7H 2F19H 2VH5H 2Q8BH 4OD3H 3A6CL 4TVSa 1D6EA 2OTPA 2XWBA 3W9EA 3L7EB 3ARGB 5HTSA 4EDXA 2VXUH 2VXTH 4GRWF 3T1FA 4XMPL 1UCTA 2BVEA 5M7QA 1MQ8A 5IMMB 3SCMD 3B9KA 3QG6A 3F5WB 2EDBA 5ADPL 3CIQA 4BFEA 5FO8B 4OZFB 5FV1L 3IVKB 5A3ID 1RIUL 3MUGA 1BECA 5CMAB 4EIZC 3MACL 3NZHH 3PP3K 3LEYL 1P1ZB 1OGAB 3ETBF 5CKGA 4R7NA 3PWNB 2O61B 3TO4A 1HSBB 2ITCA 1MFAH 1GGTA 3QWQB 4HZAA 1NMBL 3ZYOA 4WW2B 3IF1A 5J6HB 1U6AL 2BERA 3DRQB 4X99B 3BKYH 1UVQA 4LHJB 5C09A 5EU4B 5CGYC 5I6XB 5GHWH 1ITCA 2AK4D 2YA1A 3T3ME 5D6DA 1WSST 2GJJA 5F6HJ 1U8JB 5FUCC 1A5FH 3LEVL 4O2FB 4ORGA 4U6XB 4UV4L 2EO1A 4XBEL 4JB9L 1T2JA 3LZFH 1N4XL 5HYJD 1WCQA 3L3IA 5FM5M 2X9YA 4OQ1A 4WI7A 4RGNB 2YUXA 2HT2C 3NACL 2GHWB 1MFDL 1AGDA 1P4BL 2APXA 5ITBL 4ONFH 4QOKD 5EC2B 3CMOL 4WWID 1M1SA 5BRZB 1Q72L 5EOCL 1ZMYA 5CEZD 3G6AB 3KYAA 5SX5K 3GRWA 3O6LL 3E3QE 4IEFB 3OSKA 1KYOJ 5D7IB 1MLCB 2C26A 1DFBH 1IGYA 3EDKA 3I02B 3UYOD 3QJHB 5KSBF 1MCHA 1TNNA 5F88A 4NO5B 1OTUC 4PG9B 2DWDB 3QUYB 3SY0A 4R26H 4K94H 1RZKH 5HDQH 3WFHA 2A9NL 3BRFA 3QUZD 2BY2A 4AEHL 3QFJA 1IAKB 1CDHA 3D3VA 1NJ9A 2CIIB 1J88A 1KYOK 3RVXD 5JHDE 5E6YA 1JGUL 3ROOB 5T3ZD 5JMRA 1W0VA 3FB6B 2NW2A 4K94C 1JPFB 1RZKC 1JGLH 1UM5H 1AJ7L 4CUCA 1LQSR 3W2DL 1AKJB 2FGZA 1F8TL 1JPGA 4N90D 1BFSA 5CSBA 3CLFH 3OR7A 1MFEH 3E6FB 2R0LH 1RVFH 1KB5H 3HS0A 5FA4B 5EZLA 5IFJB 1SY6L 2W9EL 4AENB 1JN6A 4HCRH 1A6AA 3SDXE 3MV7E 1W2KT 4KHTL 3UJIL 2ADGB 2QEJA 3QISA 1PG7L 5BZWB 3TGXA 3S7GA 1E0OB 3DRTB 4P4KB 1MLBA 4OCWH 2DF3A 4NO2A 4MNGB 4LCYA 1CLYL 2O5ZH 4HIJB 4JRYE 4R4ND 1S5HB 1M05A 5J57B 3U0TB 1VGKA 2ESVA 4APQC 1ZT7B 3U2SB 3QEQE 5I30L 4ZFGL 2PF6A 4HJJH 4M00A 4JZOA 3MLWH 3VW3L 2J6EH 2UZXB 3RIAK 1FC2D 3JTSB 3MV9E 1FNGB 1E4KA 4XCCH 3IU4H 2WZPD 4NRYB 1S8DB 3U7AA 5BS0E 3KG5A 1JPSH 3O3AB 1EJ6A 4MXWH 5B8CB 1H8NA 2AXHA 2GAZB 3S4SG 1TMCB 3EZJB 5MERB 4K3JL 3PWLB 1HIMH 4K3GA 2HLFC 3OAZK 3MGTA 1ETZB 2X1PA 1KJ2B 1FZKB 3UTTE 2QSTA 4OZHA 1BM3L 3T2PA 4XMPH 3HI1B 3KXFE 1C08A 3E2HC 3VGGA 4DUXA 5GSRB 4NN6B 3EOBB 1DQDH 3MLTB 5HVFB 4JHAL 3W0WE 1E27B 2Q87A 5ESQA 1KJVA 3WNKA 2DJ4A 2CDGA 1RIUH 1KIQA 3CCHB 5CP7A 3LEYH 5F9WC 5DJ0A 4XI5D 5FA3B 1NMBH 3ZDZF 5F1NA 1NC4B 1P7QD 4IRSB 1G7MA 1JF1A 1NSNL 4P2RD 5JZ7C 3FO9A 3H42H 4CDHA 3HC3L 4RCAA 2HG5B 3FO2A 2O26U 3ZYJA 4F3FA 4R7DA 1D9KB 4H88L 2A6IB 3C09C 4JB9H 1YEEH 1CIUA 1N4XH 5DT1L 2CLVB 3QPXL 4JAMB 3UEZA 2FB4H 3E8UL 4HGWA 4JRXB 3WUWG 2DLTA 5LQBL 5D7LB 2XN9A 1P4BH 5ITBH 1U93A 3H9SE 3BD5A 4LARL 3CMOH 4I5BA 2YD3A 4NNXA 1T2QL 4L4JA 5EOCH 3A0OA 1MCOL 3BE1L 5ISZE 4OD2B 4KK5D 3JUZA 2HMIC 4PJAB 2YA0A 5TQ2L 2X9XA 3PDDA 1MFBH 4HS6B 4H1LA 3X13A 1VHPA 4QHNA 5CUSL 3W39A 5I1JH 1VFBB 5BS0B 3VCLA 3D2UA 1IGTA 1JPST 3TBTA 3HZYA 5MEOB 1G7JA 2R8SH 3DI2B 1K85A 2GY5A 4AEHH 4F7EA 2NY1C 4F8TA 5I1KH 5BMFL 1TVDA 4HV8B 4WFFD 1JGUH 2MJWA 3CD4A 4OGAD 2IBZY 1BQHB 5CJXC 1KCVH 4YDVB 1QR1A 1AJ7H 2IG2L 4U3HA 3RY6C 2C1PA 3JXAA 5C0CB 3BW9A 4BYHA 1IL1B 4LLYA 3HZKB 5C07E 1KLUA 4PJDF 1MVUB 3NA9H 4IMLA 3LD8B 5TF1L 2W9EH 2HKFH 2B39A 3N50A 1MHPL 5T1DH 2KQMA 2CUHA 2VLLB 3QNXB 1PG7H 3UAJD 4GXVL 5I9QB 3T77B 3VDAA 2HTLC 3SDYH 3VFWB 3LPWA 3ARTA 4FXKA 5DC4B 3WIHL 2AJZA 3TJEH 5IVXA 3OKNB 2YN5A 3WDJA 4LCCC 3ULVF 1R3LA 4ZUWA 1JWUA 3L6FA 4FZ8L 2XTJD 5LAXB 1WT5A 4XC3H 2WSKA 5KSAC 5T1LB 1UZ6E 3O4LA 3VW3H 3QPQC 5KTEL 4NT6A 5K9OB 2CH8A 1A1NA 1EAPA 5FCSH 2DQGL 1HQRA 1LGVA 3HNVL 4YH6A 2J5LC 5FUCE 1LO4L 3QA3A 1PSKL 4F2MB 4G9FA 43CAB 1VCAA 2Y5TB 2Z4QB 2BVPB 1HHGA 4YHNA 4RA0C 1AIFB 5D2LF 1WICA 4ZPTA 4PYHA 4GKOA 4WUUB 4ZUVB 2O5XH 3UTZB 5I8EA 1RQ5A 1KN4H 3LKNA 2L4OA 5ICZB 1UENA 3FFCA 2Q86B 1EMTL 4TTDC 4QGYA 2N7AA 5AYQA 5C0GB 5FECA 4S0SD 4PG2A 2CLRB 4KWUA 4Z77B 1CXLA 3G5ZB 3TC9A 2F54B 1I1AD 3JV5A 2V9TA 4X98A 1MJUL 5ILTH 3BN9C 5FYLE 5E2TL 5HDLA 2VOTA 2VLRE 5EBLB 5CEYA 3ARUA 4Q9QL 5F7NC 4NC0B 2XYCA 2YRPA 3MLUH 2IAMD 3B2VH 4PJCB 3MNZA 3E6HB 2QV2A 3QFDB 1T3FA 3FZUD 4KI1A 1AHWC 4PJHA 2VWEC 1QBAA 5D6DC 2VLKB 3OL2A 4KK9C 1R24A 4OV6F 4LCWD 2HFGH 2NZ9C 5JQ6L 3V8OA 4H0HB 3HC3H 5C08D 4ZUSA 2C5DC 5AD0A 1DCLA 4OKVA 1FORL 1QYGL 4LRNL 4PRAB 1MIMH 3LS5L 4GUPA 1FZMB 4ZMAT 4HWBA 4LLWB 1PZ5A 3QQ9D 4R0LA 4KMLB 3SQBA 3W11C 1CFBA 1H8SA 3ZE0F 4U4BA 3QPXH 5HHQA 3VA6A 5HYQB 3ABZA 4PJFF 2XQBL 5LQBH 4OQTA 4X5LA 3GKZA 2X6MA 1F6AB 3BUTA 4LARH 1UKQA 2XG4A 1AGBA 4G9DB 1J0ZA 4BZ1L 5HYJE 3IAGC 3IDNA 1MCOH 2PW1A 5JNYA 1U8LA 1A7PL 1YEJL 1TJHL 1CG9B 5TQ2H 3X11A 2PR4L 1N2RA 4LBEB 1YMME 3HZMB 3KWWB 1IGJA 4A2LA 5DEFA 3RNKA 1QFHA 5SV4A 3V8CA 2NLJB 3C8KB 3L95A 1S7VB 2F8OA 2RCSL 2NPLX 1S7QB 1IBGL 4JDZB 5BMFH 4PJEE 4ORZC 1J8HE 5F7WC 5SWQA 2OQJB 3VGAB 5ACLA 2OJEB 4YQXL 5IB2B 5TJWK 1LE9A 3VRJA 3G5YA 2BCKA 2IG2H 4YHPA 3DTXA 4S1SL 2X4SB 3PABB 4LLDB 4QRPA 1FL5A 2ADFL 3ULVD 5T3ZE 2MTPA 5ACZA 4RRPG 5CJQL 1MHPH 2ZNXA 3JUYA 3ZT5A 4Z7QE 2DLIA 2NY4C 4GW1A 5HHXL 4GXVH 3KYNB 3SKJH 5F8RC 3TBWA 3LIZH 4WGVB 4UU9B 4FOMA 5D2NB 2XFXB 5CLTA 5FF6B 4KMTL 4FQJL 1RJYA 5EUOB 4YUEH 3ZT7A 3UTQA 3WIHH 5ALBL 1OLZA 3MCKB 3UTPD 2EDEA 3TP4A 1AR1C 1Y0LB 1FN4B 4U1GC 2HFFB 1F3DH 3FB8B 3VFTA 2EIZB 1WCBA 2H8PB 3E0GA 4PJGB 1KXQE 1SEBA 4N8CL 5GJTL 1NAML 3VFNB 4Z8FL 2VIRB 4KVCH 5E8OA 4HC1A 2VRAA 1F11A 3ZTNL 3TNNB 3BP5A 4QHLB 1E4KC 2I60H 3M1BB 2HJKA 4NQVB 1QSEB 2DQFA 1AH1A 4O00A 5DQJB 4HWUA 3GSOB 1GGYA 3JWOH 4HKBB 1LK3H 3H3PH 2DQGH 3QHFH 1MELA 3PE9A 1X44A 2IWGA 5E2WL 4YEFA 1LO4H 4ELMB 1CGSL 4RMQA 3K0WA 2FO4A 3C5ZA 2I07B 4NKMA 1ONQB 3BXNA 4GRWE 2AP2A 4NUJB 3QNZB 1JNHB 2A73B 4GBXA 4NKDB 3MREA 2RBLA 4JG1L 1KB5B 3FAWA 1PLGH 1SJHA 5C0AD 5D5MB 4UQ2B 1A9BB 4IJ3C 3BP6A 3O6KH 4LNVA 3S9DB 1P4IH 1U8MB 5GS0L 2HFEB 1UKTA 3ARDD 3P73B 3PP3H 1EUUA 4APQB 3HPJA 3V2AR 1L9MA 2J4WL 4PV9B 1T1YB 3TIEB 5FO7A 1G7QB 4FQ1H 4TUJA 3O8XD 4HJ0D 1OY3B 5E2TH 4ZXBA 3MFFA 4MJID 3STLB 2DIBA 4P23A 3HE7B 2GKIA 1ZS8A 5TE6L 4Z7WF 3VWJD 1ACYL 3ARSA 5B3JF 4I3SH 1B3JA 1UB5A 5HDOA 2HAZA 2DLHA 2DM3A 1F5WA 2E6QA 1XGPA 3GI9H 2VDRH 3MRQB 1T6VN 5SWSD 5BV7L 3HI6L 1RPQA 3I2CH 4M6NL 3CLEL 5C70A 3KPQB 5MEQB 2NY5C 1AD0B 1FORH 1QYGH 4B0MM 3E2HB 1WFUA 1H5BA 3S4SB 4NO0D 5K9QI 5MI0C 3D25B 3KYKL 3DV4B 5IW1A 2UYLA 2PYFA 1BREA 3VJ6A 1T5XB 2W60A 4K8RC 4BZ1H 5F9WB 4MCZB 5DRWB 4OZIB 1A7PH 3OF6D 2MHAA 4U2ZA 1QRNB 2HYMA 1UZ8A 5KSBE 2PR4H 5MENA 3BIKB 4F9PA 1RURL 4LLMB 5BXFB 1I7ZB 3VMOA 3DURA 3M8OL 1A21A 1DE4B 2YWYA 1XGTB 4TSAL 1LWRA 2DYPD 3AM8A 1E6OH 5IFAL 3MRGA 5D9SA 4Z0XA 1RZGA 3UP1A 1BQUA 2EIDA 5TDNA 3VFGL 1IBGH 3C09B 5F71A 2GITB 5F1IB 3L1OH 1MI5D 1FO0L 1MOEA 4FMKA 1IEBB 2W0FA 4YHOL 1L0YA 3LEXA 4K3HA 2HT3D 3PQYA 5IOPB 4GLRI 1HWGB 3VXMB 2X7LB 5DGRA 4G8FA 5F96L 4J8RB 4S1SH 4XPHL 3EYQC 5FXCH 5B4MD 4X8XA 2ADFH 3K8MA 5HD8C 4XZUA 5DLML 1W0YT 5CJQH 3RDTD 4G6FD 1QSVA 3WUWB 1MWAL 2XKUA 5HHXH 2A77H 3BT2L 3U82B 2BNUB 2K1MA 4EN3D 3L3JB 1KEGL 2FHCA 2FR4B 3BYTA 1VENA 3LRHA 4AIZB 4FQJH 1XF2A 2GQHA 12E8L 5ALBH 5JO5B 2NY1B 3JV4A 4M7JL 1LO0L 5DVLA 2HVKA 1ADQL 3C6SB 1WT5C 1N59A 3KYOB 3SEPA 3SKOB 4N8CH 4Z8FH 4KUZL 1HCVA 1J86A 2Y9RT 1UH4A 1N6UA 4EXKA 3WXVH 4LF3B 3GMRA 3QJFB 4N5EC 5L6YH 5TDPB 1OB1B 2DQDH 2ERJB 3UZQA 4WIQA 3CXDH 4M61A 5DUMH 5E2WH 1WBYB 2QBWA 1CGSH 3STBA 3E1F1 4FTVB 3MLXL 5JDSA 4MHHI 2X4OB 1KG0A 3BFOA 3D0VA 4JG1H 3RJQB 5JW4M 1JV5A 1QZ1A 1OT2A 3PL6D 4WVRA 4AT6A 4B50A 4PYGA 1I3VA 2EXYD 3OZ9L 4KHXL 2APFA 4LCCB 1FAIL 1BF2A 1XMWA 5FGBA 1LK2A 2FDBP 4EXPX 2AAVA 4UOJA 1WBXA 1WUNT 2DOCA 3BN3B 3PDOA 4Z7VB 5J89A 1P69B 3DYOA 1OM3L 5KSAB 3ZDZE 3G5XA 1F4XL 3MRFB 4IDJL 4ZSOE 4PRIA 4QCIB 5L2KA 6FABL 1W72A 5FCUH 5TE6H 1YJDL 1ACYH 1FG9C 3WIIL 2K7QA 1JNLH 2JCCA 1WWWX 4DW2L 4RWYL 4J3UA 1DQQA 4HWBH 1OAUL 2XWBB 2AI0H 3W9EB 5BV7H 2DRUA 4M6NH 4PJ7A 1H8OA 3EO0A 3C9NA 4EDXB 5I16A 3U9UA 3T1FB 5GRVK 4OQTH 4O02L 1MIEL 5HHOD 2Q6WA 3DPBA 3B9KB 3QG6B 4WTWA 4O2EA 4LPTA 4PLKC 5EU6D 5C08E 2X09A 5GISH 2HJFA 4BQCA 3MUGB 1BBDL 3LKSB 1JHKL 4R7NB 3TO4B 2ITCB 1C7SA 4KKNA 1RZJL 3O2DA 4JHZA 1HKLL 4EZMA 3IF1B 2XTLA 3GSRB 3RNQA 3SCMA 1UVQB 5C09B 4P4RA 5FUZL 1A7OL 1RURH 4JFHE 4Y19D 3BZ4A 2EEBA 2H2PD 3M8OH 3QXVA 5FM8A 3RJDA 3S37X 4OGYL 5JOPE 4DEPC 4ORGB 1L4IA 4Z9KB 4EDWL 2BVTA 5E4EC 4ZODA 1UC6A 2D0FA 3L3IB 2A0LD 4X8JB 3GMLA 2K9UA 1FO0H 1NCCL 1AXIB 2DQEH 1AGDB 3EDJA 4HX1A 5IW3A 1JMXA 2AK4A 4YHOH 2GT9A 1CDIA 3VI3F 4F7PA 4OCYL 1R0AL 4MLSA 4PJDE 5T3XL 1BIHA 5F96H 3D6GA 3MNVA 2IH3A 3RVTC 2OBGA 4CVUA 4UAOC 3SE9H 1GH7A 2VITB 3A6OA 4JFXA 4POZD 5DLMH 2X41A 4U6YA 1TVHA 2PCPA 1ZANL 3W5MA 1IGYB 3VGDA 1Q9KA 4HH8A 3VFUA 5F88B 4QOKA 3ULVE 3SY0B 5J1SC 3WFHB 3HUJF 3QFJB 12E8H 3NAAH 2IEPA 3D3VB 1NJ9B 1LO0H 1A6WH 4XC1H 4JJ5A 4PUBL 1I9RL 5E2JA 1W0VB 2NW2B 1MCFA 1K8DA 4KUZH 2NXZD 3HG1E 4Y5XA 3LH2H 4KRPC 4G6KH 1JPGB 3UTPE 3SGDH 3OR7B 2ICEA 4XP4L 1W8NA 4I8DA 5DMGC 2JJVA 3HS0B 2WK2A 5EZLB 4OAWB 2ZCHL 2HVJA 1KLGA 1ZWIA 1JN6B 1A6AB 2DTSA 3BH9A 3TFKD 5D2LE 2YHGA 3ZKMD 5IMOA 3DUUA 4S1RH 4P0DA 2NY4B 3AB0B 3RWCA 1GZQA 3IYLW 1MLBB 2VC2H 4NN7B 3MLXH 3LHPL 4NO2B 4ZFFA 3B8YA 3PHSA 1CF8L 1WIPA 2JIXD 1Z5LA 4LCYB 2FWOA 2VLJD 4O4YH 3IRPX 2NXYD 5EB9A 3HNTH 1N8ZA 4KHXH 1M05B 1VGKB 2ESVB 4KTDH 15C8L 3X3GL 1S78C 4Q9RL 3T1WA 4F33A 1I1RA 1U8IA 4ZXBC 1F4XH 5DXWA 1JK8A 4R3SA 3ZT6A 2ARJB 1QFUL 2CPCA 4RWYH 3WFCH 1KELL 5KSVA 3DXAE 3GNML 2R15A 4O58H 1OAUH 5GGVY 3MGTB 4Q58C 5D96C 4GXUN 5DRZA 4PJBF 4OZHB 5D1XA 4IJ3B 2ZCKL 4E42A 5J8OA 1C08B 4O02H 3ZE0E 2EDKA 1NGYA 1MQKL 1PDKA 3UJJL 3G6DH 4PJFE 1Z3GL 4DKAA 2IFFH 5ESQB 1KJVB 2CDGB 4MA8L 2ZSVA 3T0BA 1I8LA 1KIQB 3IGAA 4N0UE 3RHWF 4QEGA 5CP7B 2MWCA 1JHKH 3DX6A 5DJ0B 2ZG3A 1FFQA 2DM2A 1JYNA 3NZ8A 5C9JA 1SYSA 2HH0L 1X5KA 1HKLH 2APWA 3N1FC 2XWTA 5F1NB 4POYA 1G84A 5J7CC 1JF1B 4KROD 5FUZH 1A7OH 5BW7A 3FO9B 1GOHA 3CH8A 2CR6A 1FLTX 1TJGL 2OP4L 3H7BB 4XVUD 2BXZA 3LOWA 5EOQH 4JREB 4F3FB 4R7DB 4EDWH 3B8SA 4BK4A 3O4LE 2FHFA 4KI5F 4KPHH 2EZ0C 3V6BR 2I24N 1AE6L 5MI0B 1I7TA 4HGWB 3EYOA 3T65A 3DVGA 2XN9B 5C0BD 1IILE 1U93B 5GIRB 2CD0A 4I5BB 4NNXB 5F9JA 1RMFL 1NGQL 5T3XH 3WUZA 2FIKA 1MI5E 1YY8A 1Q9OA 4LKCA 1RI8A 1JRHI 1ZTXL 4H1LB 2VZVA 5CEZL 1G7IA 3X13B 5I1CH 3HE6D 4QHNB 3SOBH 3W39B 1DN0A 1NCAL 1KTLA 1ZANH 2KBGA 5DJ8A 1A6TB 5HPMA 3WFDL 2MKLC 4U49A 2RGSA 3VCLB 3D2UB 1IGTB 3TBTB 2D7OA 3HZYB 1NDGA 1G7JB 1PKQE 1N0XH 1J1OL 1NCTA 3MLSL 2VYRE 2X9WA 4U7MA 4U1HA 4F7EB 4FABL 4LKXA 4KKAC 5H2BA 3S3PA 1CBVL 2AV1A 1ZGLA 2CKBA 5CJOL 3RAJL 4M1CC 4XX1G 5DFVC 1QR1B 3GMOA 1S7UA 3TYGL 1VFMA 4CJ1A 5T3ZL 1C5BL 2C1PB 1PJ9A 3BW9B 2Z0BA 4LLYB 1KLUB 2IBZX 2LQRA 3ESVF 4IMLB 1CGVA 1U8OA 4RFNC 2IPUG 3OAYK 1GGCL 2DMKA 1CR9L 3MLYL 3L5HA 2VXQL 5E8DH 1OTSC 1N64H 1U58A 3WV0A 4NPYA 2F5AL 5JPMA 4M8VA 3V6OE 3U9PH 2E8YA 2AJZB 2F58L 5IVXB 4ZAKD 5FGBC 1R3LB 1QEWA 3MRHA 4ZUWB 5IBTL 1JWUB 3I9GL 3L6FB 1ZLUK 15C8H 4PIRF 1H3VA 4ZTPL 3BMWA 4Q9RH 1XGYL 2G9HA 2XACC 3RVUC 3O4LB 5KVGH 1X4ZA 3RVVD 3LB6D 4NT6B 2NY6C 4PB9L 1DVFD 3CSBA 1EH9A 1A1NB 1F2QA 3FT3A 4Z7WE 2MCPL 1EAPB 5B3JE 1LEKA 1A14L 1NBVL 4ODBD 4MWFA 1HQRB 4OLWL 3CK0H 4NJAH 5TE7L 1QFUH 5GRVL 4G9FB 4LLAA 4YHNB 1HHGB 3GNMH 2R69L 4ZPTB 1MEXL 3EFDH 1EO7A 3I3BA 3GIZH 2ICWA 2PYEE 5I8EB 2FZ3A 1GGIL 3LKNB 2YA2A 3FFCB 3MZTA 1FC1A 4TSCH 5E5MA 5JOEA 1A0QL 1QOKA 4GAGH 2BJML 1MQKH 1EA9C 4YX2L 5FECB 1XR8A 3DMMC 4JLRA 2CKNA 4V1DE 5BCAA 3CUPA 3LS4L 4X98B 3MV8D 3VFOA 5HHOE 3PWPD 4Y16D 5DJXA 5CEYB 1P9MA 1ND0A 1BJMA 1KXTB 2CJUL 2RIKA 3REVA 2EDTA 4KI5D 2HH0H 4R2GB 1GC1C 1KTRL 1FLRL 3GUTA 4ODVH 1F4AA 1I9IL 4G6ML 2I5YL 1T3FB 4PJHB 4J3XA 1R24B 2CDFB 5I17A 3N1GC 4UDUA 1AO7A 5IF0A 2MOVA 2UV3A 4GW5A 3L5XH 4YFDB 4ZUSB 2OP4H 5KW9H 5AD0B 2CIKA 4OKVB 4CBPA 4K55A 1YQ2A 4GUPB 1PZ5B 4Y19E 3FN3A 2IAMA 5BV7B 1AE6H 4YBLC 3V0WL 4ETYA 1QBLL 5HHQB 4HKZA 5HGGS 4KK8D 1JYWA 4NN5C 4OGXL 4LCWA 4WU5A 4NOFA 1AGBB 3IDNB 1NGQH 2PW1B 5EO9A 4PJ5D 1U8LB 5JNYB 3BAEL 2VKWA 4LPCA 3ROLA 3X11B 3RTQD 2FBJL 1N2RB 2H6PA 5F1OB 5TFSL 4XWOC 3AROA 1HSAA 5CEZH 4G6AC 4XNYH 1IGJB 1AR2A 2F53D 1NCAH 2B2XH 4W6WB 2BY3A 4LVNC 2B5IC 5DEFB 3RNKB 2N7BA 1TZIA 4YXHH 1RUQH 3VXUD 4DEPB 4L4TE 1F58L 3L95B 1OPGL 1BFTA 2N4IA 5LCVH 2VISB 5IUSA 4YIQA 4HLZG 3VXSA 5SWQB 2NW3A 1CBVH 1LE9B 4HLZH 4Y5XC 3VRJB 3G5YB 4FQPA 2YK1H 4UOW0 1HYSC 2BCKB 1D5XA 1KPUA 3H9HA 1HK6A 3NCYS 2PTTA 3V6FA 5CD3B 1MH5A 4YHPB 3TYGH 3DTXB 3VXTA 4RAVA 5KSUA 5T3ZH 1C5BH 4QRPB 2VTFA 1FL5B 1U91A 3QXUA 5HI3C 3BPCA 4IRZL 1GGCH 2Y36L 3TH3T 4GW1B 4JZNA 1YNKL 4HW6A 2Y5EA 4L5FH 3TBWB 2IAND 1AGFA 5GGUA 1K6QL 2X1WL 5CAYB 1RJYB 5ALCH 3S35X 2F58H 3UTQB 1F4YH 4LDLB 4RMVA 1FZJA 4JE4B 3VFTB 3UROR 5IBTH 1WCBB 4L3ED 5JORA 1JZ6A 3P11L 1AGCA 5FHBL 3V4UL 1SEBB 2KZ1B 5E8OB 3CFEA 3DJ9A 4O9HH 4ZTPH 4UT7L 1F11B 2VLJE 1XGYH 1NFDF 3BP5B 2HJKB 4PB9H 1T03H 2DQFB 4PY8I 2MCPH 4TRPH 1G1CA 1A14H 3FT4A 3R8BB 2IF7A 5I66A 4TUKH 1LE5A 3TLRA 2OTUA 4ZNEA 2FO4B 1KTKE 4MJ5B 4NKMB 3I84A 4X4ZA 3KGRA 3AGVA 5C0IB 4GBXB 1IGFL 3MREB 3MRJA 1DBML 2R69H 1SJHB 2YD2A 4K9EL 5D1XC 3C5JA 5F7KC 3BP6B 1R3JA 3CZFA 3D85A 5DRXA 1IVLA 3R06A 1JZ7A 3JV0A 2LAGB 2F5BL 3HPJB 4JO1L 2EICA 2HTKD 3O6FD 3F6LA 3LS4H 1GHFL 4LSUL 5FO7B 4TUJB 2NCMA 1DUZA 4Y4KD 4XVJL 4ZXBB 3MFFB 1MJ8L 5C0AA 4P23B 2G60L 1ZS8B 1FCCA 2GK2A 5JPNA 5L8LB 5C0ND 5EBMA 1UB5B 4QO1A 4HAFA 1XGPB 2I5YH 2VUYA 4LMQI 5BW7C 4NQCD 3T0DA 1OD7A 4RAUA 2EDDA 3RGVA 2C4FT 2YR3A 4LSVH 1VEMA 1II4E 1G6RA 4MJIA 4FQXA 3U4EA 2YMXL 5D93C 1OLLA 2QHRH 4HHAA 4Y0GA 4HKJA 1H5BB 3VG0H 3VWJA 1TNMA 3V0WH 1QBLH 4KFZC 1KV3A 5DSCA 5L9DL 3UYRL 4ENEC 1N0LA 4JFDD 5DD0H 5KVMC 4K2UL 2UYLB 2PYFB 5IW1B 5SWSA 3K7UA 4F15C 3VJ6B 1GIGL 5D1ZA 4WO4D 1F2XK 2W60B 4R96A 3UZVB 4IIQA 3N0PB 4CN6A 4XPBL 2MHAB 1UZ8B 1X5FA 2FBJH 4D9QD 5MENB 3WEXA 1ZV5A 1EDQA 3QIUD 1SJVA 3VXRE 3DURB 4QRSA 3HUJE 2YBRA 2FCBA 5D8JH 5ESAA 1K5NA 1IAIL 2NY2C 1F58H 1WFNA 1KCUL 4MYWB 1ERNA 3BPOC 3MRGB 1RZGB 4GSDL 4JHBA 5D9SB 4Z0XB 4DN3H 5TDNB 1OPGH 5AG8A 5LBSL 3LPFA 5K9JL 3KS0J 3OF6A 5AZEL 3AMKA 1NMCC 1ITBB 2Z31C 1EEUA 3D39D 4JDTL 2B1AH 3MPCA 2W0FB 3F6IA 3LEXB 2OYPA 4F58L 3IJSA 3K8LA 3PQYB 5GJSL 3QDGD 2DMBA 4G8FB 4UUJA 3S34L 5C3LD 5T1KA 4XZUB 1TZHA 3CVHL 1GAFH 2XPGA 3ESUF 2QSVA 3ULVL 1YNKH 1MFCL 3S3SA 35C8L 3NCCB 2F8XC 5DGQA 1XF2B 4YPJA 3CFJA 1RZ8A 4XGZA 3WO4C 3T0ED 4ODUA 1BWMA 3JV4B 2HVKB 2ZKHL 2NTFA 3AS1A 1N59B 1E6JH 3VDBA 5FHBH 3RDTA 3QHZH 1K4DA 4LP4A 3QCVH 4WFEE 3TYFA 4UI2A 4P2OD 3S5LG 3QAZB 4Y1AE 4BFGA 3GMRB 1QQDA 2KQNA 4ZS7L 2NY5L 4FMFA 4M61B 4WJ5A 4J3VA 2GTWA 4RFNB 1F00I 3KPSD 1OF2A 4PJBE 4M8QA 2CK0L 2LTQC 5JDSB 1KG0B 1IGFH 5E4IA 4OI9A 4JRWA 4E41D 1CICC 1JV5B 4K9EH 3GM8A 4IOSD 4AT6B 5E2UL 4NHUB 3VH8A 3BRGC 2OZ4L 3MOQA 3QI9D 4RBPK 3S98A 3VXRB 2WBJD 1CVRA 1LK2B 4HPOH 1WBXB 3B3IA 1FYTA 3PDOB 4UT6L 3ZDYF 3F7YA 3OBAA 3MOBH 3ZHLA 4YWGH 4LSUH 4LVEA 1HHIA 4Y4HA 2NY6B 1P9MC 4XVJH 5F7YC 5DDHA 1MJ8H 3TBSA 3AREA 5J56B 2AKRA 3RP1A 4PRIB 5L2KB 2J8UA 2E7HA 1W72B 4CU7A 4D9RD 2JCCB 1A6VL 2ZUVA 1DQQB 1OWRM 3SDCC 3T2OA 3NCBB 1LP9F 3N9GL 4PJ7B 1BIIA 4D0BA 5I8CA 3ALPA 3EO0B 3C9NB 5I16B 2CXGA 3U9UB 5IQ9A 4KI5E 5EULV 5D7JD 3AS3A 3EOYG 4S1DD 5BOPA 2G2RA 4XH2A 4LDOB 4NWTH 2V5SA 1JCKA 3KHQA 5KS9A 1CGYA 4O2EB 4YFLF 1T5WA 2H45A 2HJFB 4OLUL 2BMKA 1I4FA 3TPKA 2RB8A 1GIGH 1I1CA 5FKAA 5L0QC 5CP3A 4YHLL 4L8SC 1F90L 3RNQB 4HPYH 4KQ3H 3SCMB 4OZGF 2A1WH 2JJTC 4P4RB 3BZ4B 5HJ3A 5EU6A 1RIVL 5DJ6A 2JF1A 1F13A 5C6WH 1CDBA 1VADA 1TTGA 1IAIH 5IVOA 2YWZA 1KCUH 4GSDH 5LBSH 1NCNA 2G5BA 2ORBH 4ZD3H 2F53E 4NDMA 3GMLB 4U0QB 4YBLB 5GGRY 4PRNA 2BY0A 5I8KH 3QXWA 4HX1B 5E6ID 2AK4B 2GT9B 1EV2E 4GMTL 4NN5B 4F7PB 3FFDA 4F58H 1S9YA 1OTTD 2X4TA 1R5WA 4J23A 3MNVB 2IH3B 4UT9H 4JFZL 1FL3A 1BQSA 2AABH 3BDXA 4BFIB 3VGEA 5EUKA 4JFXB 1RIHH 1BD2E 4RGOL 4U6YB 1TVHB 2PCPB 5E8EA 4WU7A 1Q9KB 2GTZA 3VFUB 1MFCH 4X4ME 35C8H 4KV5F 4QOKB 4P99A 5AZ2H 2FLBT 5AYUH 1QA9A 3KNBA 1B0RA 4PBXA 3ECBA 1KPVA 4OIIL 5J9PA 5EU5A 3N06B 4AK1A 2UWEA 3FCTA 4MVBC 3Q0HA 4JJ5B 2VZ1A 2GSGA 5JA8B 2IH1A 1V7MH 4Y5XB 2ZP0T 3GHBH 2ICEB 2J8UF 1D5IL 2JB6A 2VXVL 4L3EE 1FBIL 2HVJB 1KLGB 1ZWIB 3NIDF 1RK0A 3BH9B 3M07A 5IMOB 3V0VA 3DUUB 2D7NA 3VFPA 3RWCB 3DVFA 1GZQB 2CK0H 1T0PB 4PB0L 3TWCH 4ZFFB 5DO2C 1Z5LB 3KAAA 2FWOB 3UTSD 3B83A 5E2UH 2Q7NA 1N8ZB 5C86A 1ORSA 3QDJE 3S6CA 3U4BL 1VPOL 2L7JA 4F33B 1MF2L 4M7ZC 1O0VA 2VLME 1U8IB 3BKML 4XCEA 3V4PL 2JIXA 4HQQL 1GYAA 1JK8B 4R3SB 1J87A 1MFNA 4K3EL 4KVNH 5DUBA 3VWKC 4KAQL 1G6RH 3D0LB 2BSED 5KSVB 4ZOBA 2EC9U 3RUGA 3VA2C 3C6LA 2K3TA 3KPPA 2DBLL 3RGVC 3GBNL 3N9GH 5DRZB 5I1IH 4U7SA 5D1XB 1XH3A 4E42B 3N85H 4FQXC 4LIQE 5ADOL 5M95B 1NGYB 3ARBD 1GRWA 4JQXA 4R97C 4YNYA 3TJHD 3WYRA 4URTB 4HGMA 2A2QT 2YD9A 2ZSVB 1UXWB 4OLUH 3RHWK 3IGAB 5D1ZC 1TQBC 3FTGA 4HUMB 4Y2DD 5DQ9A 5IEHA 3DX6B 4IIQC 1KUMA 3V5DA 5DD5L 3DETD 3FO1A 3NZ8B 5C9JB 1SYSB 1QSFD 2XWTB 4ISVA 4YHLH 1CK0L 1YPZA 4TOYH 2Y25A 1OP5H 1ZVHA 2A6JA 4F57H 1S9WA 2EDRA 1QO3A 1DBAH 1RIVH 3OJDA 3P9MA 1QFOA 3CFKA 1T83C 1CFVH 4D9QE 4EQ2A 1INEL 5F44A 4HK3N 4TUOA 4X6DA 4AYFA 5D93B 1UA6L 4M9PA 4ZOCA 1RZFL 1I7TB 1MHCA 3H6JA 4XMKL 5I0DA 3EYOB 3T65B 3DVGB 5DQDH 4ONGL 4WHTA 4F15B 1MCWM 4LSTH 2UZIL 3MCG1 3MX0A 4OD1H 2YEZB 1OHQA 4XB7A 5F9JB 3RZCD 4GRLD 2FIKB 1LNUA 4LRIA 1YY8B 3KPNA 4J3WA 4LKCB 3D39E 4RIRA 1WEJH 4FP8L 3IKCB 3MBXL 3W5NA 2OK0H 2WANA 2AJXH 4GMSL 4ELKA 1JTOA 5HBBA 1G7IB 2DKMA 3TVMD 1DN0B 1KTLB 5DJ8B 3VXOA 3VGHA 5HPMB 2CXKA 3SDDC 5C0BA 3MNWA 1WV7T 5EZIL 2P8PA 1NDGB 4P2QE 4FN0A 1I8KA 2NY2B 3K81A 2FECL 4U1HB 4CMHB 4OIIH 1EGJA 4LKXB 2P5EE 1JNJA 2J8HA 4NP4L 5H2BB 2AV7A 1NMCB 4QHKJ 4N1CA 1NFDE 1GOFA 2AV1B 1I3GH 1ZGLB 2CKBB 1KN2H 3Q6FA 3U30C 1N6QL 3FQNA 3GMOB 1WAAF 2FATL 1S7UB 3T0EE 3WFEL 1NANI 2VDKH 4PRDA 4XP9L 1A7RL 1D5IH 3V52H 3VH8G 3H3KA 5B22A 3IU3A 1U8OB 2UY6A 5GGSY 4JG0L 1ZLSH 1IARB 1ZSDB 3ARFC 1MRCL 3GI8H 2GW5A 4WI5A 5HI5C 3WS3A 1U58B 2HWZL 2YD4A 4NPYB 5JPMB 3GJFK 5MP6H 2CUIA 2C4XA 3KPSE 3KPTA 5DI8A 1OAQL 4HDIB 3WO4B 1R5IA 1QEWB 3MRHB 4YEEA 1AQKL 1VPOH 4M4RA 5BQ7A 2G9HB 1CU4H 4Y4HC 5B3NA 3BWUC 3BKMH 2QQNL 3FT3B 4NQTA 3AREC 1LEKB 5E70A 3V4PH 4MWFB 4M1DH 4ONOA 4KAQH 4UINL 3SJVD 1T7YA 1UKSA 2XTJB 1FIGL 5L88L 4G8GD 3RWIB 4DAGL 3BQUD 5D7KD 4G42A 2ICWB 1DVFA 2FZ3B 2MSPA 5ADOH 5E5MB 3HB3C 2UVEA 3CSYA 1OD9A 1CXKA 4F7MA 4FFWC 5LKNA 4Z0BH 1XR8B 5J13C 4JLRB 5CP3H 3CUPB 3VFOB 4XNXL 1IAOB 4H25A 3CMGA 5DJXB 3F7VA 4HULB 1GL4B 4R4BB 3WSQH 1ND0B 4J4PC 3L3GA 1SM3H 2H32H 5DD5H 4K7PY 3O3EA 3REVB 3BJ91 2AJSL 1A9EA 3GUTB 4BQ9A 5I19H 3RKDC 5I1LA 3SDCB 4UDUB 4KU1A 1AO7B 3NCJL 5IF0B 3ZHDA 4GW5B 3MV8A 1NGPL 4LHUA 5CZXC 2EEDA 4KJQD 3PWPA 4Y16A 2CIKB 5FYJD 1T21A 2BC4A 2DI9A 2BOCA 3JWDL 4EI5C 2DQJL 2IAMB 5GZND 5IROA 1L7IH 4MDJA 4YO0A 4HKZB 2JJSA 1RZFH 5CKAA 4XMKH 5JXAL 1M7DA 3MRBB 4NQED 4L3AA 4ONGH 1IJ9A 4QY8A 1D5BA 3QG7L 4WU5B 2OL3A 2UZIH 5EO9B 4Z76A 1IM9D 4LU5H 1ZLWH 4PJ9D 5L0QB 4FP8H 3BI9X 2H6PB 3MBXH 1VACA 4GMSH 4AG4L 1EGJL 1HSAB 2HRPL 5GGQH 1UH3A 5IEKA 4LQFH 1I7UA 1TZIB 1S7WA 5EZIH 2IQ9H 1A6PA 1ZGLM 4G5ZL 4PJ5A 5ESVA 3H9ZA 4LCIH 4YIQB 3RKPA 1CL7I 3VXSB 4YHYB 3WLWC 2NW3B 3BP4A 3G6JA 3A67H 4MNQA 3P4LA 4DOHB 1IEHA 1D5XB 1KPUB 3H9HB 2PTTB 3V6FB 1XCTA 1MH5B 1N6QH 5IP4A 3WFEH 3VXTB 4RAVB 5KSUB 4H8WL 3VXUA 1U91B 1CE6A 3BPCB 5E9DA 4AY0A 2FRGP 2WUBL 5LGHL 3DSNA 4NQXA 1WC7A 3C60D 1VB9A 2BNRD 4JZNB 4RBPH 4X7FC 1S9VA 1MRCH 4PJ8D 1S3KL 2WWKO 2HWZH 1AGFB 5L2JB 1P84K 5GGUB 2HLAA 1OSZA 5AAWA 5FHAH 1FZJB 3ZDYE 4M5YL 1AQKH 5JORB 2G75A 4XHJC 1AGCB 1J7VR 1GC1L 4XBGA 3ZTJG 1VDGA 3CFEB 4JCMA 4HIIA 2FX9L 1P2CA 3UTSE 4L8DA 3ZTJH 3EJYC 1NLDL 2W59A 4NOBA 5GZOD 2IANA 2RJMA 4EEEA 3GDBA 1MCQA 3MLRH 3TV3L 4IOIA 3SE8H 3FT4B 4QWWD 4YC2B 5CGMA 5I66B 1LE5B 1CFNA 1LP9E 1T7ZA 2OTUB 5ANME 3QEUA 1KIUA 4I77H 1ZHNA 3C6LC 1A3QA 1FIGH 1J0IA 4HMDA 4HUKB 3FJTA 2YD8A 3MRJB 4HIXH 4XNMB 4DAGH 1TVBA 4RSVA 3C5JB 3CZFB 1R3JB 3D85B 5DRXB 3R06B 4C4KO 2B1HL 3IRZA 2Y6SD 2XQYK 4NFBA 3SE3A 1N5YL 1I9JL 4JQXC 4NC1C 1VSCA 5JXED 1KBGH 1KGCD 5EC1A 1YYML 2XRAL 4XNXH 4M7ZB 3BIAX 1DUZB 4BUHA 4ZOEA 5K9QG 1YECL 1FNEA 3T2NL 4OFYD 4OZGE 1PX4A 4FFYL 1JL8A 5JPNB 5JW4N 2V6HA 5EBMB 9CGTA 3WD5L 3PF2A 4PP1C 5SWZE 2VAAA 4MJ6A 3W9DA 4PV8A 2J3SA 1DTUA 5TQ0L 4XPFL 4RAUB 3SGDI 1CDGA 1FH5L 3RGVB 2ZNWA 1NGPH 3VFRA 1ZT4A 1J5OL 4Y4KA 1G6RB 4IDLA 2D3VA 1PYWA 4MJIB 4FQXB 1JHLL 3U4EB 4OUUA 4HHAB 3JWDH 3QDMD 4HKJB 3VWJB 1JJUA 3IT8D 4R97B 2B4CL 3PIQA 5DSCB 4WW2F 3OKOA 3ULSA 2W38A 1DQLH 5SWSB 4WWKD 3MXWL 1IC4L 4NQCA 5E8PA 5MEPA 5D1ZB 2VDOL 1XEDA 2VZSA 2QQLH 4R96B 4IIQB 3TA3D 3MXVH 2NY3D 3V79C 3MC0A 4BKLA 2AQ3A 3MBED 3WEXB 5IM7B 5D7SL 3ZYIA 4KV5E 1X5IA 1EGJH 2HRPH 2UUDK 2MCG1 1CTNA 2EYTA 5D70H 2MFNA 5F9OL 5JIPA 3AAZA 3OQ3B 4GLRH 5ICXA 4JFDA 4QRSB 3GKWL 2HKHH 5ESAB 3LMJL 1K5NB 4RMTA 1FYTE 3MLVL 4WO4A 2N56A 3GSNA 3FHQA 3D9AL 2DD8L 5GPRA 1OWWA 4I18A 4JFFA 1UJ3A 5DZOA 2ZUWA 2OTWA 1IQWL 3QIUA 4NHCL 4OI8A 2J8UE 4I0PD 5D7IF 3JVGC 3IJSB 2XZAH 4C54A 3NIDE 4RFEA 4P9HC 4LLQA 4JPWL 2XIDA 4JQIL 4XNUL 4UUJB 2YD1A 5J3HD 1JP5A 1BEYL 4UB0H 3RU8L 5T1KB 1TZHB 3C08H 3OJ2C 5LGHH 1SMAA 1FFOB 1TLKA 2XPGB 5F7EL 1DEDA 3BGMA 4CU6A 3CDYA 1S3KH 4TN9A 5KS9E 3O9WD 5IWLA 1GPOL 2DQCL 1LO3L 3QDGA 4KK6C 3CFJB 1RZ8B 4XGZB 1C1EH 1CGTA 1MREH 4ODUB 1DBJL 4MHHG 4M5YH 3EZ8A 5C92A 1K4DB 1XIWC 3TYFB 4G6FB 2E8ZA 3L5IA 4D9LH 3X12A 5AEAA 3U30B 1K8IA 4HGKC 4Y5VA 4AZ8A 4C56A 1QQDB 4W81A 4YXKL 3MMEA 2GTWB 1EHLL 1KCSH 3N1QC 1QP1A 1SHMA 2IBBA 1OF2B 1JGEA 4M8QB 4B7LA 1TITA 1F3RB 5J0BA 5SV3A 3PJSA 4BJLA 2Z93A 4P2OA 1B2WL 4DKEL 4F9LC 5F21B 4ZFZA 3VH8B 3ARGD 3MUY1 2Z92A 4JCLA 3WKML 4JM4H 1MJ7L 1N5YH 1I9JH 1PBYA 4G8GE 3B3IB 1B90A 1FYTB 5D7KE 1OW0A 3F7YB 3Q5YA 1K3IA 3DX8A 2BHYA 1HHIB 4Y4HB 2Y4SA 1NC2A 2AERT 4PS4L 1YN7A 1YECH 5DDHB 3TBSB 3AREB 2AKRB 3T2NH 2ZUYA 4JR9H 3Q6GL 2J8UB 1TQCC 4M48L 1OGAD 2Q8AH 2Q3ZA 2WBJA 3KPLA 2VDQH 5HGDA 2LU7A 5I1AA 1UWXK 2D7TL 3JBG7 1R5VA 2IJ0C 4XPFH 1BIIB 4D0BB 5I8CB 5IT2L 1FH5H 1UH2A 3BD3A 4I2XA 1BOYA 4LIQL 4HWEH 4C55A 4Y4FC 3DSFL 4GXUM 2XZZA 1T66D 1UGNA 1WGOA 4WI3A 5IMLA 1X7QA 2G2RB 2XA8H 4XH2B 4W4OC 3QQNA 5IROC 2HN7A 3TN0C 5KS9B 2JJSC 3D87B 5J13B 4XRCA 1T5WB 1FIEA 3QIBC 3BYYA 1H3PH 5FYJE 4KDVA 2BMKB 1G9NL 1I4FB 1CLZL 5F3HA 2VDOH 2COQA 1P6AB 2Z9TA 1KIRA 4V2CB 5FKAB 3OG4B 5D7JA 3H0TA 5BRZD 1CVSC 2X1QA 5FAAA 1MCPL 5GS0D 3WNOA 2P45B 1F97A 3G04A 3HMXA 3CVIH 5IHLB 1OQXA 4PD4J 5F9OH 5HJ3B 5EU6B 5ID1A 4XMLL 5DJ6B 4NQDE 3GKWH 2ZPKH 1VADB 1UEYA 1F45A 4L8BA 5CEXA 3UYPA 1REIA 1KULA 3D9AH 3LQZA 2YPVL 1QVOA 2G5BB 3QUYD 4OCLC 4NDMB 3K2MC 2ADJA 1WAAE 4PJAF 4PRNB 4PJIA 4OT1L 4UTBL 1I3RA 2WNGA 4PD4K 1H3WM 3FFDB 5D1QA 4I0CC 1S9YB 4KY1L 5HYEA 2X4TB 1R5WB 4QRUA 3IAPA 1RUMH 4XNUH 1UACL 1FL3B 2NQCA 3IJHA 4LSQL 5EUKB 4ZFOA 2WUCL 5E8EB 2R0WH 3UZEA 4WU7B 5F7EH 2GTZB 3BIBX 4NKQB 1IGIH 2BNQE 1B0WA 2BSRA 4RGNC 3EHBD 1QA9B 3KNBB 4P4KD 4X4YA 2DQCH 5H8DA 1B0RB 1LO3H 3ECBB 1KPVB 2JB5L 5J9PB 5EU5B 3HAEA 2UWEB 3FCTB 3OPZL 1V3LA 4I3GA 3MCLL 3LV3A 2GSGB 5DFTA 5GS1A 2IH1B 4N0FA 3THML 1X5JA 4LEXH 4DVRH 5I15L 1ZA6B 2V9QA 5C3TA 4M6MH 4NZUH 2JB6B 4Y8DC 1RUKL 3QH3A 3ARYA 4JKMA 1RK0B 1XF3A 4UDTA 1EHLH 3V0VB 3VFPB 3HTLX 4NQSA 4X7DC 2NXZB 4Z7UA 2H2SD 4D8PB 3PWVA 1KSRA 1VA9A 3GJEA 4UV7L 1ZVSA 2AJVL 1DL7H 4GRMA 4W70A 1F6LL 3DBXB 1I75A 1ORSB 1ZEAH 43C9A 1MJ7H 4NQDB 1KEML 2CUMA 5EZJA 1N6VA 1INQA 4JKLA 5DHVB 4MXQC 4XCEB 2OJZL 1QFWI 3BHBA 2JIXB 4BSVA 5GSVA 1IMHC 1YN6A 4R90L 5DUBB 3Q6GH 1J18A 1DANU 5DWUH 2ATPA 1KGCE 4G7YH 1JMZA 1ZHLA 1NAKH 3RUGB 3NTCL 1NC4D 3C6LB 1FZOA 3H7LA 2D7TH 3KPPB 4IRSD 4NBYB 3FOLA 1A3RL 4GQ9H 4HXAL 3T0XA 1KB9J 3DSFH 1XH3B 2XT1B 3LAFA 3MV7D 1D9KD 1FDLL 4YNYB 2ED8A 4UILL 3ULUH 4JPVL 5C71A 1WVZA 3K1DA 4PJCF 3LQAH 1BJ1H 2BXYA 1RHFA 3FTGB 4BSWA 4U7KA 1G9NH 5B8CC 1CLZH 4K23L 5DQ9B 5IEHB 1M7XA 2P8MA 4JRXD 5AWNH 3V5DB 2R9HD 4YPGB 3ULUC 3FO1B 1XFPA 1T04A 4ISVB 2EDFA 1YPZB 1MCPH 3QEQD 3GSNH 2D4DA 2A6JB 2QSQA 3SO3C 1S9WB 1QO3B 1PKOA 4G7VL 4WV1A 3RZWA 3OJDB 4XMLH 3P9MB 4PRPE 4KJPC 3CFKB 4WO4C 1J0HA 3DIFA 5BS0D 3EYVA 3KR3L 1JRHH 5TDOA 3FQUA 1XCQA 4X6DB 4I18C 2X4QA 1UJ3C 2YPVH 4M03A 3BSZL 3Q48A 4YDLC 5E0QA 1QSFA 1NFIA 4GKSA 3QIUC 4Z78A 1MHCB 1GJIA 4UTBH 3ZKQD 2WBWB 4NQUA 3ALXA 4KY1H 1VFUA 2VSCA 3KXFD 1LNUB 3KPNB 2YUWA 3GIVA 4RIRB 5IGXL 3RA7L 3P40A 5C0CD 1J0KA 4LSQH 4ELKB 4P5TD 2X4UA 1GGBH 3OXSA 5GS3A 3VXOB 5F70A 2DQHH 3KLDA 4HS3A 1RFDL 3VI4F 4TVPD 3MNWB 4TULH 2P8PB 4KDTC 2VDMH 5F89A 1I8KB 4OF3A 3WL9B 3RVWC 5KOMC 2P47B 4TQEH 5KJRL 2AV7B 3VE0A 1QUNA 3MCLH 4MNHB 1P7KA 1CYGA 3LN4A 3DGGA 1PG7W 3ET9F 3Q6FB 3FQNB 4BUGA 4OLYL 3VD7A 5E5RB 2GJ6E 4PRDB 3KPRE 1RUKH 3BDYL 1BAFL 2VL4A 3IU3B 4KKBC 3UC0L 4RWHA 4XTRC 4YAQA 5KVFL 3RFZC 2I26N 2ZOLA 5EUOF 3WKNA 2GEEA 2XQYG 5IBLD 4K3DL 2FBOJ 1QLRA 4CW1A 3WS3B 1WWBX 3MGOA 4QRRE 4PJGF 2EO9A 3B6SA 1QBML 2GK0A 5ISZD 4YBQD 4OFKA 5DI8B 4E9LA 4M7LT 1R5IB 1U3HA 3OAUL 4LASH 1OW0C 3P2TA 3JV6A 5BQ7B 3A6BH 3BESR 4LGSB 3UDWC 4DCQA 4ELMF 5B39A 3L5WA 1TTFA 2H1PH 3U0WH 3H3BC 2R1YA 4RMUA 2FEDD 2R29H 5L8KB 3ZSSA 5CILH 5D5MF 2YC1A 4PP2A 5ICYA 2I25N 3EJZC 2EXWC 2KKQA 1B6DA 3NTCH 4H0IA 3IAQA 4M5ZL 1A3RH 4G42B 4HXAH 1DSFL 4LOUC 2VLKD 2R2EA 1OGAE 1J1XL 1DVFB 5C07D 3EYFA 2D9QB 3EO1A 4ODHL 1EO8L 4KJWC 3CSYB 4F7MB 2IFGA 4C58B 1FDLH 3SJVA 4JFEA 1EBAA 4R8WH 2NY0C 3HMXH 4H25B 4L4VA 3F7VB 2V2TA 3BQUA 2DL2A 3BEWA 4K23H 3L3GB 4NWUL 5D7JC 3F7PC 3O3EB 2R4RL 1TQCB 4NYLA 2JE8A 1NCDL 4S1QH 1A9EB 2MKWA 2A83A 4X6FA 4RGNE 1SY6A 3QUML 4HWZA 5I1LB 3KJ4C 1MY7A 4K7PX 3GO1L 2L0DA 3MV8B 5IHBA 4KRMB 4LHUB 1UM4L 4D2NA 5BRZE 5CGYD 3PWPB 2CMRH 1T21B 2BC4B 4HBCL 2BOCB 1RJLA 4KKLC 2ZOKA 4MDJB 5D7IE 3RIFF 5FGCB 3IFLL 4OZIF 4YO0B 4FQCL 1AXSA 3HNSL 3O11A 1M7DB 3EGSA 4Q9CA 4QY8B 5BVJA 5D1QC 4FG6C 5GGTL 1D5BB 4MA3A 2OL3B 2WIIA 3UPCA 2HT2D 4JFYA 2WWMC 4JPKL 4Z76B 4WNQA 1IAMA 2XKNA 5IGXH 3RA7H 3NH7H 3HAEG 1VACB 5F1KC 4M1GL 2CK2A 3HAEH 1OVZA 5IEKB 1SEQL 4X6CA 1GSMA 1I7UB 3JWNC 4LPYA 2DKUA 5FYLD 1RFDH 1S7WB 2VLRD 4NQEA 4FS0A 5HSFA 1FNHA 2X44D 4JM2A 2VDPH 2C9AA 1DBBL 5CIPH 5A40E 1V8HA 4PJ5B 5ESVB 4PJ9A 4HG4J 5DURB 4WUKL 3BP4B 5GS1C 3G6JB 2K7PA 5F93C 5BVPL 3P4NA 4MNQB 1RU9H 1Q94A 1HQ4A 2NZIA 2Q7YA 4YDJA 1XCTB 4QKXB 3QRGL 4MNGE 3GK8H 3V0AC 2F74A 2FNBA 3VXUB 3I50L 3QQ4A 5FYKH 1CE6B 5E9DB 3BDYH 1QSED 4QXWA 5DVKA 1BZ7A 4NQXB 5C7XH 2WW8A 2EDWA 4HMCA 1S9VB 4YJZL 4A6YB 5LWYH 2HLAB 3HC4L 1QBMH 1U0QA 2NY7L 3VGAC 1OSZB 2AJUH 5E7BA 1A02N 1EXUA 2VZUA 2FLRT 3PWUA 4X7SL 1BQLL 2PXYA 3P4MA 1YMMD 2G75B 3OV6A 4JQVA 4JN1H 1Z0MA 2Y1VA 1AP2A 4XBGB 1I8MA 3QNYA 3C60A 4FQQA 4HIIB 1P2CB 4WY7L 4WENB 1IAII 4APQD 4L8DB 4WHDA 4PJ8A 2IANB 4GG6A 2J2ZA 5I18L 4IOIB 1EERB 3JTTA 3CX5J 4J6RH 1PAMA 2ZJSH 3HR6A 4AQOA 1J8HD 3IDGA 2D2OA 2L7UA 1CFNB 5D2NC 1E4XL 5IHUL 1XGUB 3QEUB 1WTGT 2E9IA 3VFMA 4HJGA 1ZHNB 3O6MH 2NR6C 3QDAA 4NZJA 1TVBB 4Z7VF 1EEZA 2HLFD 3Q3GA 4ODHH 1EO8H 1LEGA 4JHWL 2BX5A 4TTGA 3CX5K 2DQUL 4L3CA 2E6JA 4PGEA 1BGXH 3P3YA 1FNAA 2YPKA 2P43B 1YEFL 1B4JL 5EC1B 5JOFA 1C5CH 1INDL 4MB4A 3KYMA 1UQSA 1FNEB 1S7SA 4NWUH 5JHLH 3T04D 5EA0L 2R4RH 3DVNA 4OCXH 2WP3T 3QUMH 2VAAB 4MJ6B 1MJJA 3W9DB 4PV8B 4WV1C 4JRXE 5D7LE 3GO1H 2PN5A 3GMMA 4RRPA 3CDFA 3VFRB 1ZT4B 1G6VK 4Y4KB 3LN9A 5JZ7D 3HRPA 4I9WD 1PYWB 5E99L 3X17A 3IDYB 4HBCH 4OUUB 4PJAE 1FQ9C 4Z18A 4OFYA 4Z95H 3WIHA 3LDBC 4HS8L 5FYJL 3PIQB 3OKOB 3ULSB 1KT2A 3HE7C 1WZMA 3LKRA 4NQCB 4G3YL 5E8PB 5MEPB 5GGTH 1P6FA 4CDGC 2B0SL 2BY1A 4P46A 5DHYA 3A6CH 3VXMD 4BKLB 4GAFB 4MXVF 3QDMA 4XNZB 5HGHA 2HMID 4M1GH 4X0KA 2EYTB 3SO3B 3AAZB 1FJ1B 1SEQH 5ICXB 4JFDB 4GJTB 4Q0XL 1HXMA 1H0DA 3EOTL 3V6ZA 4MLIA 1ZHBA 5C2UB 4WO4B 5C0CE 3WFBL 3GSNB 5ADPH 3Q5OA 3HLAA 3TA3A 5K9KA 4I18B 2FGWL 2AJ3B 3LKQA 1UJ3B 4JFFB 2OTWB 1J12A 4U1MA 4YDLB 1Z9SA 4JFOA 1J1PL 3MACH 4TVPE 3NIFE 4HUUA 3ISWA 4OCMC 1F3JA 2NY1D 3QIUB 3CFBA 4XPGL 1EHNA 3TO2A 1MCEA 4HSQA 2R1WA 2VDNL 4FQIL 2CDEA 2J7LA 1A4KA 1U6AH 4RFEB 3EUUA 4LLQB 3IFOA 1T0MA 1GVIA 2WP3O 5E1AA 3OKLA 5DVOA 1CLOL 3QZWA 1VKXA 2IMNA 1LDSA 3LEVH 3O41A 1CXIA 3BGMB 4U6VL 4UV4H 4DJMA 4XBEH 5B39G 4I0PA 2A9ML 2IMMA 3HC4H 4FTVD 5FO9A 5IK3B 2HTLD 1UYWL 3S37L 3NACH 2P5WA 4NUGL 4N0YL 1U3HC 4KH2A 1MFDH 3VXPA 3FQWA 4MDIA 4D3CL 1I7RA 2DWEA 4KKCC 4OTXL 1KIPA 1Q72H 2YSSA 1NBYA 4JKKA 1G9ML 4RISL 3HKFA 3O6LH 3H8NA 4MD5A 1K8IB 4WUUE 4Y5VB 4C56B 5KSAD 2IC2A 3QPQD 3H9YA 3MMEB 2AEIT 4PRHA 4Z7OF 4OSUL 1HWHB 3WLBA 1E4XH 5IHUH 4HUWB 1JGEB 4UZGA 3S36L 3CH1A 5CHNA 4OIBA 2A9NH 2F54E 5DS8A 1FHGA 1HILA 2Z93B 4OCSL 3WMSA 4P2OB 3SO5A 4ZFZB 1CZ8L 3NGBC 5KOVC 2KH2B 2AGJL 2Z92B 1HDMA 4PJCE 4JHWH 3W2DH 3AMLA 1F8TH 4QRQA 2GUOA 2VLKE 4TTDD 3DX8B 2ERJC 2MPAL 1SY6H 1IGML 2APVA 1INDH 4XPTL 1ZVYA 1NC2B 1YN7B 4KHTH 4YLQT 1UWGL 3UJIH 4HK3J 3DX7A 2R0ZL 1G7LA 3BN9D 3FONA 4OZHF 4QXGL 3QWOA 3ZHKA 2A74A 2WBJB 3KPLB 5HGDB 4KC3B 3SBWC 1A1MA 4PLNC 5I1AB 2ILLA 4N1EA 1CLYH 1R5VB 5FOBA 2X89A 4JVWA 5DJZA 5C09D 3HI5L 3QO0A 4RX4A 2JELL 4KK9D 2NZ9D 5I30H 1MCDA 4ZFGH 5J6GA 5IMLB 1X7QB 2NX5A 4O2CA 3WBDA 3VXNA 3FL7A 3K2UL 1NEUA 2HN7B 4P2CG 5FYJH 2QQKL 4XRCB 1CIDA 2OI9C 4WFGD 3S88L 5J6HA 3W11D 2NY0B 5F3HB 1NAMA 4EQ3A 1MRDL 3B9DA 1J0JA 2BVYA 1V3JA 5FDYA 2Z8RA 5D7JB 3H0TB 2HT4C 2DAVA 4K3JH 1A22B 2YPLA 5IMKA 3VI4E 2DTML 3G04B 4DZ8A 8FABA 4OFVA 4UIKL 1BM3H 3GSXA 4OB5L 3KJ4B 4LP5A 1RD6A 5ID1B 4D0CA 4YHML 5HGBA 3L3OA 4IHOA 3B9KC 1PY9A 3EOTH 4JM2C 2FX7L 4L8BB 5CEXB 4JHAH 3WFBH 3OB0K 1MHHA 1LILA 1U3JA 1QVOB 4HH9A 3LSOA 2FGWH 2VABA 1OAKL 4LVHB 1OAYL 2ADJB 2IALA 4NZRL 3TO4C 4BH8A 4D94A 4PJIB 3D3VD 4XPGH 1I3RB 5E94A 2FJFA 4W6XB 4POUB 5D1QB 4MD0A 5D2NE 3TBYA 1PGRB 3RY4A 1B0GA 3ELAT 4QRUB 5EUOE 1NSNH 1IQDA 1VFOA 7FABL 1QACA 3IJHB 5HYSA 4ZFOB 1CLOH 4NSKA 4PG9A 3TIDA 3QIWA 4PJGE 1HOCA 3KJ6L 3CC5A 1RK1A 4U6VH 4H88H 5I74C 3WFZA 2NY4D 4OF7A 5DT1H 1QSEE 3IXTA 4ZTOL 4X4YB 5IG7A 2BVOA 3KLHC 3S37H 2PXYC 3E8UH 3HAEB 3IFPA 4N0YH 3V95A 2EKSA 4JQVC 3LV3B 1HNGA 4DWHA 4ELME 5KAQG 4JFHD 5EBWA 2I9TA 5GS1B 4N0FB 1T2QH 3PGCA 1AR1D 3BE1H 1G9MH 4RISH 3PGFL 2VXSL 4U31A 5JOPD 3WHE1 1SBBA 1U8KA 1RV6X 5D5ME 2ADGA 4R4FL 2CRZA 5BZWA 4M3JA 4ZOAA 4YXLL 5ID0A 2EYSA 3QH3B 2YXMA 3DNKA 4P4KA 5CUSH 3UXFA 5IV2A 4IRJA 4PY7A 1K4CA 1L0QA 1XF3B 4UDTB 5EH1A 5HVWA 5IVXF 1S9XA 3INUL 3O2VL 3U1SL 4GKZA 4NQSB 1RAMA 1FL6A 4MB5A 1M7IA 4Z7UB 2R1XA 4AL8L 2AQ1A 4YZFF 3PWVB 3BH8A 4RFOL 4FFVC 3TZVA 1HHKA 2R56L 2V5RA 2W9DL 2VUOA 3GJEB 1ZVSB 1CZ8H 1Q8MA 4GRMB 1FPTL 2CGRL 3WS6A 43C9B 1F4WL 3CXHJ 5DJDA 5EZJB 3TM6A 1INQB 4EBQL 1U36A 2FD6L 1FO0A 4HIEA 3RPIA 4FNLL 3VXQA 5TF1H 1H15A 1QNZL 4MMXC 2FECI 3BHBB 4BSVB 5GSVB 4H20L 3AB0C 4JGUA 1UWGH 1YN6B 4NN7C 4Q97A 4L9LA 4U3XA 2R0ZH 1OARL 1SJXA 1FVDA 1SJEA 2ATPB 4OCRL 4QXGH 4R9HA 3EYSL 5HHMB 3WDIA 1R3KA 2NYYC 4QNPF 3TCXA 3HG1D 1ZHLB 3CXHK 1EFXB 1BZQK 1IKNA 1FZOB 4H0GA 5DF0A 5C0EA 3FOLB 4JJHA 1MWAA 3B5GA 3SE4A 4AIOA 1PQZA 2W0PA 2JELH 3DYMA 5DA0B 3ZZ1A 3V7AG 4FZ8H 1LD9A 2EE3A 4OZIE 1QRNE 3K2UH 2R23A 3CCHA 2P46B 2YUZA 5KTEH 2AS5M 5JHDA 2QQKH 4QXTA 3KHOA 1EZVY 3QP3A 1ADQA 1UJTA 3HNVH 4I9WE 2W91A 4BSWB 3GSQA 5DJAA 1Y6MR 4X7CC 1MCBA 2V9RA 1FFNB 4PJHF 2P8MB 3ILQC 1PSKH 2ED9A 2XN9D 2ZZUT 4P46C 5DZNA 3JWOC 1T04B 5DVMA 3ZL4L 2WIMA 3SDXA 4K8RD 5LGJA 3MV7A 4GO6B 4M9OA 2DTMH 3MYZA 4UIKH 4WV1B 1NL0L 4U1KA 2IQAA 1JIBA 4YHMH 1EMTH 1OSPL 1BX2A 3VXME 3DIFB 4OJFL 3U46A 4WDIA 5TDOB 3FQUB 3D2UD 4JRYA 3SN6N 2X4QB 1N5AA 4KZEL 3UCRA 1QSFB 3LDBB 1OAKH 3QEQA 1CGUA 1MJUH