3T0XA

Fluorogen activating protein m8vla4(s55p) in complex with dimethylindole red
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
EPVLTQSPSVSGTPGQKVTIFCSGSSSNVEDNSVYWYQQFPGTTPKVLIYNDDRRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCLSWDDSLNGWVFGGGTKVTVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dye-binding protein
molecule keywords Immunoglobulin variable lambda domain M8VLA4(S55P)
publication title A variable light domain fluorogen activating protein homodimerizes to activate dimethylindole red.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3t0xA00
3GB7B 3FQNB 3KPMB 4JY6B 1Y6NR 3I85A 4HT1H 3IRPX 5EBWB 4CN4A 5JR1H 25C8H 4HEPG 5A2FA 3D85B 4GO6B 4V2CB 3VXTB 1CGUA 3LS4L 5C08E 5FDWA 4L8SB 3MA9H 1BJ1H 1ZLUK 2MJWA 3TNMB 3RA7H 4NKQB 1TVHB 3OKKA 5CGMA 1M6OA 4M1DL 3V5KA 1ZT4A 4L5FL 3VWKA 1FLTX 3LV3B 1F3JB 3WNPA 1LDPH 3GO1H 3H9SE 5IBUG 4R3SB 4D0DA 3AU1A 2DJUA 2Y7QB 3MJGX 1JHTB 5EA0L 1WVZA 1MCWW 1FDLL 4NCDA 1XH3B 3QDGD 2R0ZH 4Q2ZA 1KLUA 4I0CC 2BVOB 4XHQA 4UINH 4NKOB 5SX5H 4IDJL 1HHJA 3QWQB 3WUWB 4KVNH 5E7BA 5JXAH 4XNZC 2WIIB 3D3VD 3I3EA 4PJ5A 1YEIH 4GBXA 1H8OA 3HAEG 1NGWB 1BVKA 1YEHH 3H9HA 5EH1A 3B5GA 4U49A 3S37H 3HZMB 1GGTA 4P9HC 1UFUA 1I75A 1OGTA 3GSOA 1D5BB 1O5DT 2CK2A 5HGAA 5EZIH 5DEZA 2ATKB 5DJAB 2QQKH 2VLJE 5FV1L 1RJLA 5HVHB 4Y0GA 2I07B 2FJHB 3MLWH 2BVPB 5I15L 4NZRL 3BGMB 2PNDA 3IDIB 3OL2A 3H3KA 3ET9F 2CKNA 5TJWK 2GSGA 2C3XA 2EYRA 1HSAA 4ZNEA 5T1DL 4KQ4H 2GJ6D 5DRZB 1K4DA 3WN5C 4M3KB 3RUGE 5H2BA 1U3JA 5IK3A 1FAKT 5FHAH 1CDCA 2HT3D 1WBYB 5FA3B 5F3BA 4X5WA 2IAMD 1OGAB 1DBJH 1UYWL 2X70A 3FQRA 4PJEA 1F11A 3WJLC 2OL3B 2UY6A 1A4KA 2I5YL 3GIZL 2D7QA 3HE7D 1MJUL 4ZFGL 3QXWA 1W72L 3I02B 5I0ZA 2HTLD 2A9NH 4IEFB 4WCYL 4HCRL 5CHNB 3CH1A 4OZ4B 1W72B 3UTSE 1LP9B 3RTQA 4QXGH 4WO4B 2AJUH 1RHHB 2ZOLA 4LHUB 4OSUH 1EV2E 2HLAB 5EC2A 3OZ9H 5E6IC 4JN2A 2DQTL 3DVIA 5JQHC 4Y5YB 4RGNE 3VXOB 3WNMA 4NQCE 4NP4L 4P3CL 1JGVH 3WIHA 3O6KH 5J89A 2OK0L 1UH2A 2YC1B 1TZHB 4PTUA 4AG4L 4ZD3H 3WHE1 5E00A 5INDA 2PYEE 5HI5C 2VZOA 1IM9D 1EERB 3FQTA 4QWWD 3LRSA 1GC1H 3VFSA 3SJVB 2WUCL 4Z7UF 3FO0L 3B3IB 1T1XA 3FT3B 1T04B 3WS6A 3JTSB 1RSFA 3L3IA 3SCMD 1CG9B 1DUYA 1I7ZA 3LKNA 3RP1A 3K8KA 5FOBB 5DJ2A 1QBLH 4OB5L 4EI5A 2LTQC 2OZ4L 4KJWD 5D1QD 5HPOA 4DAGL 3RIAF 1G9EA 4U6HB 1U8KA 3Q3GB 3MXWH 2MCPH 4DKDC 1OM3L 4NN6B 3C5JA 4WHTB 3VGEA 3EFDH 2H8PB 1HOCB 2AAVA 5DJDB 4YFLI 1PG7X 3L9RB 1MHHB 2G9HA 4TSBH 4Z76B 1S9YB 4POUB 4PGBA 2O5YH 3ULSB 3PP3H 3V95A 3IRZA 5CUSH 1S9WA 1Q0XL 4S10A 3OSKA 1B2WL 3QA3B 4M62H 5E8DL 3VXSB 4M6NL 1KB9J 2R0WL 3KYOB 3RZWA 4Y5VB 4YQXH 5ALBL 4U1GB 5KSBA 3PDGA 1R3KA 4I18C 3MLZH 1VEPA 3HG1E 1UQSA 4KHXH 2EC8A 2FDBP 4X80H 4ZPVA 4Y89A 3TN0B 4HULB 5JW3H 1I8LA 4FQJH 3H0TA 4W6YB 1FFOA 3SEPA 1OAKL 1WTGT 3QDJA 2X4UA 3EOAA 1IAIH 4NNXB 3KDMA 1EO8H 4WTXA 5E5MA 4TUOB 1CD1A 1KC5H 5DK2B 5E4EB 4P23D 2VERN 2V7NA 4PY7B 4EEEA 1OWWA 1CDHA 4MXQD 2OR8A 4JLRB 2J88L 3GSRA 2D7PA 5CJOL 3BMWA 3IDYB 3RX8A 1JTOA 3SOBH 1T80A 2J5LB 3QCUL 3QFDA 3DNKA 4Z7WF 1ACYH 3T0WA 4EBQH 3NBNA 2ADIB 4NN5C 4AEEA 2VE6B 4G42A 1G9MC 1XGYH 3D0VA 2Z8WC 4LFHG 1SQ2N 5T3XL 4F3FB 1OSPH 1XGQA 1KCRL 3KG5A 5DD0L 2R2HA 4PP1C 3U7AA 3G08B 5T3ZH 1PVHA 5FKAA 5GJTL 1IT9H 2E6JA 1SM3L 1RJYB 5HPMA 5FDYA 3QNYA 4KKNA 2DI9A 4JFDA 2OTUB 3ROOA 3NABL 3T65B 1A21A 4R90L 2DLFL 2YA1A 5DRNB 4QRRB 5JIKA 1MIML 1P9MA 3QEQA 4CW1A 3C2AH 2R23B 4PTTA 2P48B 1L7IH 2F54D 2XRAH 3ZT6A 4E41B 1WLHA 3O45B 2D9CA 1B0WA 1LD9B 4FFYL 5EZJB 3REWB 5LG1A 1X5YA 2Z9TA 4PFEA 1OAQL 1JV5B 2EDWA 3TA3B 5EUOE 3VXMD 4Z9KB 4C59B 2EIBA 2GITB 1VFBB 4LU5H 3HAEH 1AE6H 4AM0B 4FTVB 3U36A 4MLSA 3P9MA 2ZG1A 3IVKA 4NBYB 1GGIL 2J4WH 1U42A 5IHLB 3F58H 2CLRB 4JPWL 1JNNH 4U1IB 1OAZH 3QO0A 4WUUB 4GT7A 4HK3N 4DQOH 1A9BB 3BAEH 4KPHH 1XCTA 5I1GL 5JO5B 4HIHB 1N5YH 1A1OA 2D0HA 2FX7L 4R0LA 4WENB 4XB7A 2EDBA 4KJPD 1HHKA 4GG6B 2WM0A 4YPGB 4Z7VE 2YOCA 1P4LA 3NCEB 1LQSR 1XAUA 1RIUL 3ARBB 4JFPA 1WEJL 3PGCB 5IUSA 3WCYA 4ENEC 1JYVA 1JGLH 1UZ8B 1BFOB 4RIRB 5E95B 2P5EE 2Q8BL 3JWOL 1T5WB 2VISA 2NX5E 2W0KA 3IFPB 1KUMA 5DGRA 3D48R 3ARQA 5GGUA 5AYUL 4WNQA 1DQJB 4JO1L 5DJXB 4OGYH 5EO9A 4Y4HC 1CBVL 4WI3A 1XF1A 3MGTB 3QIUD 1N59A 2JB6B 4GRLB 1FCCA 4JHAL 5F9AC 1AD0A 5HI4C 3PWVA 4MQXD 5B39B 1U8JB 1WICA 5DZLA 2C4FT 3KS0J 5DQDH 5DRWA 3LRGA 1UEYA 4X7DC 4JAMB 5LGKA 1BP3B 5BVJA 3HB3C 3VXPA 5CD3B 5BW7C 2E9BA 5C07E 2YWZA 1JHKL 4XHJC 5I8CA 2E7LA 5IWLC 3ZLQC 3P0GB 3RAJH 4KQ3L 2FD6L 5E8OB 3F12A 5SWSE 3C5SA 2JK5A 3BP7B 1H8SA 1FYTA 4GRWE 4EN3A 4NDMA 32C2B 3NFNA 5I66B 4LF3A 1WBXA 3LSOA 4MNHA 2BY3A 1JNLH 5GZOC 2YXFA 3H42H 1MJ7L 5D4QA 1LNUA 1OTUD 2X2YA 4FNLH 4Q9RL 5DJ0B 4XPGL 4P5TD 4Q9QL 4OLXL 4OBRA 4EDXB 4QRQA 3V4VL 1BQHB 3QEGH 4NQUA 1CICD 5GGRA 3QCTL 4JANA 4JB9L 3UTPD 4NQEA 1JPGB 3P4MB 4HKJA 4MVBC 3TBWB 4CVXB 1ZT7A 4R4NC 1FFPB 2AJYL 2YKLL 1QKZL 1X7QB 4Y5YC 3Q5YA 1BX2A 3RIFF 1VPOL 5D6DC 1XF2B 2EXWC 2VN7A 3QPXH 4RWHA 2NZ9D 3KPSE 5KJRH 2OMBA 4OLVL 3S36H 5TDOA 2P1YA 5GRUL 1KN4L 5IMMB 1E6JH 4XBPA 4TTDD 1SJVA 4L4JA 4FQIH 4LLVA 5T33L 3H8NA 4ZUTA 5KSVA 5DC4B 4YNYA 1BFVL 4K7FA 3WKMH 4HC1L 4M7JL 2O5ZH 2V5SA 4OD3H 2GK2A 2Y5TA 2VXVH 3QCVL 5CFHA 5B4MC 2OR7A 4LASL 3KAAA 3G6JA 4P46B 5F3HB 2CGRH 5DT1L 4R4BA 1T2QH 5IESH 3DMMA 1XF5A 1AXTL 2C3WA 2W91A 4CDHA 1YEKL 4DKFL 4NN6C 4CVUA 1G7QB 2XTJB 3KNBA 4WEBH 4LLUB 5F7NC 1HXYB 2NR6D 5FYKU 1KF9B 1F13A 1QFUL 4X7CC 4HDIA 5BS0B 3G5VB 2AQ3A 4R2GB 3L5WA 1Q9WA 3BH9A 5BZWB 1VESA 3BWAB 1KLFA 1D6EB 2P5WA 4LPXA 5C08D 3GK8L 5IF0A 4JFOB 2BC4B 3UC0H 2WMPA 2NZIA 4Y5VC 3I75B 4U1GC 4ZG1A 1D9KB 2NY3B 1QSFA 2VB5A 4XTRC 4OQTH 5D72L 3GGWA 1Q9KA 1KCUL 2BP3A 3K4AA 4PRAB 3H9SD 2PCPA 1PW3A 1TETH 2WIMA 3P3YA 4PJ7F 3N1PC 4KZEH 3P4OA 4KI1A 1WJ3A 4ZTPL 2XYCA 2P8PB 4JKKA 1NC2D 4LCIH 1TITA 5ICYA 1HI6A 3DETC 1RURL 1QP1A 2X41A 4HUWB 1I9EA 2NLJB 3F5WB 2GJJA 2F5AH 4HJ0D 4HQQL 5IW6B 2BNRB 5BOPA 4YAQA 4KDTC 4YHZL 2EXYC 3PQYB 1NCUA 2HH0H 2VAAA 1KENL 3C6LD 3VXSD 1P7QA 3V4UL 3WIIL 1SJHB 4IIQA 5IBTH 1HH6A 3IJYB 1QLFB 4F57H 1DBKL 3QXDB 3R1GL 3TBTA 3LPFA 3VI3F 1E4XL 3CFCH 3LH2L 3OKNA 3SQOL 5HD8D 1QRKA 5C0CB 2M8XA 3I50H 3WNKA 1LE5B 4FXKA 1OLLA 2VLJD 5HYJB 1U8MB 1DN2A 3A6CH 3JUZA 3MRDB 1A9EA 2XNAB 5DUPH 4ZFZB 5IV2A 1G7JA 4S0TD 5FCSH 1IGJB 3CNKA 3K81A 4NQDE 4NCC2 3VW3H 4K94C 4X83A 1I8MA 1AR1C 1E0OB 4OM0L 5TDPB 4XVJL 2R1YB 1LK3L 3RZCB 3X13A 1KEML 3GJFA 5D7KD 4K8RH 4JQIL 3BEWB 3KPRB 4QHMB 3IDMA 3UTTA 1MREL 4AT6B 4NHUB 2XN9B 4X7FC 3TA3C 1G6RH 2B5IB 1LHZA 5T3XD 1VKXA 3UXFA 5HHQB 5CD5D 4U1JA 3UO1L 4X6FA 4PJDF 5DUBB 5D7IF 4PRIE 3A6BH 3KPTA 3CFKA 4Y4KA 1TMCB 3T4YB 5CZVL 1MAKA 2LU3A 4WW2A 5KSAA 3UTSD 4KKCD 3GIVB 4WIQA 5C9KA 1JE6A 2Y5EA 4PS4H 2WWKO 5ERWB 5HSFA 5HDQL 5I2IA 1NBYA 1YY9D 3QWRA 3ARBC 3MRQA 4F2MA 3T1FA 3BVNB 2ICCA 4RGND 4JRXB 3E2HB 4Y4FA 2YRLA 4NQCD 4DW2H 4EDWH 1A6UL 2Z93A 3O4LE 3A67L 3D18B 4DUVA 5DFTA 5FYJH 2XACC 4KKBD 2PYED 4UV7H 2C3VB 5JUEL 1UWEL 2EKJA 5F1SA 1D5ZB 2DOCA 3L5XH 1MNUL 3TBYB 1U3HB 3HNVH 1FRGH 1KYOK 3C08L 4QNPE 1QVOA 4Z7QE 3DGGA 4LL9A 3D39B 4L8DB 2J6EH 3EDKA 1MHPH 2H2PD 1DBML 4OJFH 2MMXA 5EOQH 1MFAL 4MSWB 1AY1L 4JQVC 4I4WA 5DDHA 4DVRH 4D8PB 1DVFB 4XP9L 3U4BL 4UT6L 4GAJH 3QNXB 5I9QC 3WFDH 4C83B 2C1PA 1M7DA 1DQDH 3TT3L 5E24E 4I9WE 3LN4A 4MXWH 4JR9H 4CMMA 4GKNA 2HMIC 1QEWB 1SYSA 4XPAH 2OJEB 4YXKL 3ETBF 3MRLB 4ODVL 1NCNA 4PRHA 3VXUB 4KK8C 1WBZA 1EAPA 4WFED 3MRRA 3EOTL 4MAYC 1E4WL 5AG8A 4GRLD 3QR2A 4MQSB 1JWUB 1MLBA 4ZUWB 3EW3B 3NPSB 1FZKB 2CIIB 5EBGA 4Q6IC 1NFDA 3ZL4H 1ERNA 3NA9L 4HV8A 5ID0B 4UTBL 3C60B 1S7WB 1U41A 2BSRA 4N8VA 3TO4C 1FPTL 5IB3A 3RIAK 4UQ2B 1XT5A 4OF5A 4S1RH 3CUPA 1DQMH 1QFOA 4HKBB 3S96A 3IU3A 3HLAA 4AQOA 4C4KO 4Q0XL 5BVPL 5E8EB 1SMOA 1Z3GH 1U8QB 2IFGA 4E42B 5ALCL 3T0XA 3IJSA 1LO2H 4UV4H 4L4VA 1G7LB 4GQ9H 4LCCB 1CDIA 4OLEA 5CKAA 5TQ2H 2DL2A 5IHUL 5KG9A 4NZDA 4JFQA 3ZTJG 5FGCB 5IEKA 1J1OH 4G9FE 2AK1L 3QQ9D 1A7QL 5I73C 5ILTH 1F4YH 4A6YH 3OAUL 1HQRB 2OBGA 4RSVA 4P46C 1V3KA 2BK8A 5ANMA 4XNQB 2IADA 5SX4I 1HSBA 3K1KC 4G5ZL 2LFGA 4RAVA 1FZJB 4LLWA 2ZUUA 1W8NA 4PREB 4Z78A 3PG2A 2XXMB 2BSTA 4MQ7B 4CNIA 2EDXA 1PDKA 1V3JA 5JOPE 5CP7A 4DVBA 4J3SA 1ACZA 5AUMB 5C09E 1T20B 3W5MA 4NO0A 2XI9A 1U58A 4HS6A 2GTWB 3GHBL 2IANE 1CLZL 4Y5XB 1EVTC 3U0PB 1LVEA 3H9YA 2EYTB 2ZUYA 4NQVA 4K3EL 5HJ3B 4IRJD 4XP5L 5HHPA 3O3EA 1TCRB 4MB5A 5GGSY 1G9NC 2NY3C 3LKQA 4D9LL 3U9PL 4L3EE 1Q1JL 1NGQH 2X4PB 2HKHH 4C55A 3FB6B 4HSQA 5FKPB 4XMLH 3PGFL 2JJWA 1RZ7H 2ICWA 2XTJD 4N1HB 2HT2D 3V9FA 5IJKC 4MD4B 4LPCA 1KJ3L 1AH1A 1QFWM 2GIYA 5GQBA 1SEBA 3Q5TA 1IAIM 1D7FA 5K9KA 5EPMB 4KDWA 4IOFC 1HEZB 4UOJA 2QADB 1F58H 4R2GD 2YR3A 1X6NA 2E3VA 4OGXL 1AKJD 3MODH 1IGCH 5DLMH 2R4RL 3RWIB 4OV5A 3CXDH 2R1WA 3DVNA 3QG7L 2NY4D 4DTGH 5I17B 5DR5H 5F1KC 5KTEL 4OZHA 3B8SA 3DV6B 3L7EB 4XC1H 1Q94A 5AD0B 4P9HL 4JO4H 2HRPL 5DRXB 3DI3B 4DGYH 1UVQA 2ID5A 2NY7L 5HHMB 4YHKH 5DC0A 4XRCB 2DQIL 3PJSA 3J8F7 1IBGH 3KPNB 1D3CA 4OCYH 4MDIA 1A1NA 1G7PB 1RHFA 3MYJA 2NX5D 2YZ1A 3HR5B 1UCBH 2IMMA 1MRCH 1I7RB 3SDXA 5I1CL 5JPMA 4F37K 4XBEH 3BXNB 3O11B 3FO9A 3DYOA 5TQ0H 1FNSH 3AVEA 3JWDC 3MFGB 4UIKH 3WKNA 3NCBB 3N50A 1MFCL 3HRZA 1MHCB 2A6JA 3BKML 2AERT 2AEQL 2HVJB 3RZCC 3PP4L 4JFED 5C07D 4LRIA 1WZLA 1S7VB 2XY2A 4R7NB 2FCBA 1JPTL 1NAML 5IVXE 3LQAC 4ODWA 5SWSD 4YGAB 5I16B 1BMGA 1MIEH 4XP6H 4KKLC 3HUJE 2RFXA 5HXMA 5ACLA 4RISL 1NCBL 4OLYH 1OT1A 2MNUA 4OZGE 3U46A 1IAKA 3LHPH 5DK0B 2JLLA 5D1ZD 3QSKB 1T1ZB 1A3LL 1M7XA 5B21A 1IARB 1L0QA 1A6WL 1JRHH 3V2AR 5DI8A 3MV11 1XR9A 3STLA 1UENA 1R5VA 3BD5A 5KANG 4JCLA 3TIEB 2UWEE 1BFSA 2PR4L 1U8PA 3U2SA 2YD1A 1X5XA 5J4MA 4MDJB 1UJ3A 1R5IB 3TNNA 2R15A 1C08B 4AENB 1DTUA 4LSUL 4IRZH 2XKNA 1FG9C 4FQHB 4HAFA 3T0BA 2HFFA 3MQIA 2XN9D 3E2HC 1MI5E 3OR7A 4F7TB 3MBED 3VFOA 43CAA 5KS9B 1BD2D 3KPSD 3SO5A 3VFRB 4BFIB 3MFFA 5ETUB 1WISA 4CBPA 5FK9A 4QT5B 2OXHA 2VL5B 4ZQKB 3X14B 4NT6A 5E0QA 4ODHH 1F4XH 1KCVH 2FH6A 2VLKA 3VFMB 3RDTC 5C0JB 1FZOA 1FFNB 1KB5A 1U3HC 5IFHH 3WFEH 2VDRH 4QY8B 4PGDB 4Y8AA 3TBVA 1U95B 1ZVHA 1YEDB 4N1EA 2P8LA 3CFJB 4GKZA 4AIXA 2ZCLH 5EU5A 4F9PA 2P4AB 5J1AA 4M4PA 2EKSA 1VFOA 1B4JL 1JHLL 4JRXD 5E08L 4LMQI 1NLBH 4Y19E 3LEXB 3O6LL 3RHWF 3MLSH 3UYPA 3B9KA 5FM5M 1V7NH 2NY5C 3THML 5DTFB 4U1MA 2FJGB 5KVGL 4ZO6A 1K8IA 1S5HA 2VLLA 4ZXBA 2OTWB 2HRLA 2FX8L 1RD6A 3WDHA 5KOVC 4NN7B 4KZDL 2C1OB 3JVGA 1AGDB 5MENB 1DZBA 2C4FU 2XPGA 3RWFA 3JXAA 1JGUL 1LO4H 3C8HA 3D39D 1R3JA 5F7MC 3W9EA 5CEXA 2A83A 3NPSC 5DMGD 2JJSC 1JF6A 5CILL 1QSEA 5J9PB 3F7YA 3FQUA 2A38A 1ITBB 1NCCL 5I18L 2YUVA 1GHFL 3S9DB 4FXLA 3FQXB 4FQ2L 3N9GH 4PJHB 3C60C 5EO0B 5FB8A 1U8IA 1HZHH 3QIBA 1DVFD 1VGEH 3W82A 3ZTJH 5ITBH 1NMAH 4H26B 3KS0H 4HWNA 1D6VH 1ZA3A 3HAEB 5D2LA 4LEOB 3VXUD 1NEUA 3BQUD 4I3SH 4YDJA 1KB5H 5DEGB 4WFFE 4LCCC 3TIDA 3ZE0E 4PB0L 1J1XL 3N85H 4DWHA 4GMSL 3DXAE 4HGKC 3PL6A 4YHNA 3PGDB 2CDEA 4E9LA 1KELL 1MUJA 2DQUH 4FMFA 4Z77B 1TZIA 3L3KB 5DK3A 4E5XB 3OF6D 4OLZL 5TFSL 4FQCL 1RUKH 4JFXA 1FNEB 5ADOL 1P84J 1J0JA 1MH5A 3GSUA 5E9DE 3SDCB 1MPAH 4X6DE 2R2CA 1KPUA 5DS8A 3AREC 1P4IH 3VXRA 5D7LE 5ESAA 5F7LB 3ULVH 3MV9E 4MB3A 1OP3H 4KTDH 3I2CL 4O58L 4UDTA 5MP6L 1F4HA 2YMXH 5K9JH 3GI9L 4OF7A 4OLUL 1UG9A 2JF1A 4U6VL 1I9RL 4NQDD 1HXMA 3OKDB 5FO7A 3L6FA 1UACH 2HWZL 3BJLA 4LOUD 5TDNA 3SJVE 3ZHDA 3KYAA 4Y5XC 5IW1A 3VXQA 1WFNA 2H3NA 4IOIA 3F7RA 3DBXB 1BVZA 3U0TA 2V2WB 4LDEB 3SE8L 2AJVH 5ICZA 1VEMA 4FQPA 3QH3B 2Q76B 1R3IH 3H7BB 2R0LH 3QJFB 2GHWB 2BZDA 5HVFB 1BIIA 3O3AB 4PJ9B 5DMKA 2GFBA 4F15C 1MCJA 4HWZA 2J8UA 1QLEH 1RU9H 4GMTH 4X6BA 5K9OA 4TSAL 5F7YC 4PRID 3KYMA 3RWHB 5EUOF 4XP4H 4K71C 3CMOL 3ARGB 3UTOA 4HPOL 4QGYA 1J8KA 1ORQA 4AH2A 2NTFB 1WIOA 3EO0B 2HP4A 1IC4H 5F9JA 1IQDA 4M8QB 5HVGB 5GISL 2DF3A 5F6IC 3AY4C 1YJDH 4RMTA 5BRZE 4GBXC 2CDFB 1EHLL 5CIPH 4NJAH 1OCWL 2Z4QB 3MRKB 1MLCA 4JFYB 4NPYA 3SE9L 2YPLA 1CXKA 1TIUA 1YEEL 1A6PA 2HVKB 3F65A 3LIZH 4XCCH 2WBJB 4OZFH 5AAMA 4YHYC 4CVZB 1T03H 1NLDH 2LQRA 1YEGL 4XVTH 3L3HB 2PW1B 2ZCHH 4QF1A 3EYFA 5E1AB 3VD3A 4ZS6C 2F74B 3L1OL 2CDGB 1GC1C 4X9GA 1LEIB 1X5KA 4PJCE 4P2QB 2M1KA 4I0PD 1NGYB 2CRMA 3M45A 4HKZA 1RFDL 2DAVA 1OAXH 3RKPA 3S35L 3OXSA 3QAZC 3RY6A 3RX7A 3OJ2C 2Q86B 3UZEA 1MQKH 4V1DE 5K33A 4I9WD 5DSCB 5DD1L 4L9DA 2GUOB 35C8L 3QHZL 4O02H 3SY0A 1SBBA 1ZLWH 5GGTL 1OY3B 1FJ1A 2BDNL 5CJXA 4WWKB 5D93B 4JN1L 4OCSL 4KTYA 3LAFA 4GRWF 3WXWL 4BM7A 3SGKA 4H20H 2VXQH 2WZPD 3PWPE 4U1KB 5F7DA 4NKIH 2HN7A 2MHAB 1DN0A 1MQ8A 1ZK9A 5EZOH 2A74B 3SDYH 1INDH 2JB5L 3QULB 3K2UL 3O81A 3D2UB 1LEGB 1D5MB 3FOLB 3FT2A 3O9WA 1W0WB 4XCYA 5MEPB 4U6YA 4YE4L 2I26N 3QUYA 3QNZA 1SVZA 4P4KB 3EFFA 3K7UA 2FEEI 4J1UA 1H15B 1NCAL 5IFAH 2FZ3A 3U4EA 3T8XA 4BQ8A 1N4XH 2XWJB 5HHOA 4ODSL 4J12A 3U6RB 1TQCB 4Z8FL 4LLDA 1MJJB 4RNRA 4WI6A 4G9FD 2ZUVA 4PP2B 1DBAL 1JI1A 3BE1H 2AJZA 4WUKL 4AIZB 5I19H 1F90L 5C8JA 1NC4B 3FQWA 4U1NB 3EZJB 2WV3A 2FECI 5HHNA 4EI5C 4P3DA 1GGCL 3HG1A 4LQFH 5E6ID 4TNWK 1MAJA 2LAAA 1DUZB 3FTGA 2KKQA 3T0EE 4XBGA 4D3CL 4RA0C 4NSKA 5F88A 1J9CT 2EE2A 4JFFE 3EYVA 2B8OT 5JOPD 1QR4A 4JKPL 1C5DB 1MFDH 5F71A 3WSQH 3MRBB 2WUBH 1PZ5B 2DMCA 3KJ6L 1INQB 2LU4A 4NN7C 5E94A 4X99A 4CDGC 1II4E 1NBQA 2DMBA 4Q97A 4LSRL 4HZLA 2BHYA 3ALPA 3QO1A 5SWZB 4X4MA 5D5MA 1T1WB 5GRZA 4PRNB 3U79A 3VE0B 4LSSL 5LGJB 1XIWA 1HIML 4LCYA 2YEZA 3HMXA 1IM3A 4N0FA 5INCB 5IT2L 1OF2B 1CD8A 3VGHA 1C1EH 1UM4L 4N90D 5FO9A 1BGXH 3HC3H 3MRIB 4NYLB 4ZOAA 3KPLA 2YXMA 1G6RB 3VXNB 2WBWB 3HCVA 1XFPA 3CFEB 4XC3L 1A7BA 1IC7L 2DIBA 3DRTB 1KEGL 3FN0L 4R8WL 5CINL 1AJ7H 1DFBH 4H88H 1MCLA 2H26A 4LEXH 2Q7YB 1YEFH 4RX4A 3ARWA 2JCCB 5IEHB 2PKDA 2YUWA 4G8GE 2APXA 3QRFM 5IFJA 2B1HL 4I48B 4WFHE 1MWAL 3IFNL 4NO3B 3VD4A 1JPSH 3O0RL 2RJMA 1ES0B 2OS7A 2YWYA 1KJ2A 1BZ9A 1PKQB 3B2UC 2AXFA 5CJQH 3T1WA 1ZTXH 3CZFA 4KAQL 4N0UE 1MWAB 4PRDA 1T0MA 1V7MH 3BO8A 3MOBL 3WUZA 3ZYZA 3SDCC 1CLOL 4O4YH 2ENYA 4QOKB 3O2WL 3ARYA 2CLVB 2VSDA 1IQWH 4FQLL 1EEQA 2HG5A 3HC4L 3BESR 1BAFL 2JIXA 1KJMA 3VFVB 4KGJA 2LVEA 2Z31D 4HJGA 4PJGA 1GGBH 4K94L 3QFJB 5EU6A 1FIGH 2X5PA 1C12A 1J0IA 2P8MA 5DWUH 3ZYOA 1P9MC 4MZ3A 4XXDB 3CU1A 2NYYC 4MWFA 4PJFE 3QXUA 4M9PA 1AO7B 1JWMA 4KY1H 2N7AA 1Q0YL 3VRLE 5I1JH 4CU8A 9CGTA 1I85A 1CXEA 3CX5K 2Q87A 3I6GB 1I1AB 5KVFL 4Z7VA 4X9FA 3HHRB 1H3XA 2AJSH 4PJ9C 2Q3AA 3PABA 4QXTA 3F6LA 4GXUM 4ZUVA 3P73B 3ALXA 3IS1X 4H0HB 3PF2A 2RCSL 2V7HA 4LSTH 3KYKL 1C16B 1Q72L 4WFGD 4QXWA 3DUUA 3GSQA 2EH7H 3LPWA 3ZKSD 5FYLL 2V2TB 3GBML 2PO6A 4KXZH 4I2XB 3ARGC 3IAGC 3VRIB 5HGGS 4OZIE 4EOWL 5LXGL 4NWUH 4LSPL 2C3HA 5I6XB 5HYIA 1LEKB 5JOFA 5JW4R 4O00A 3QUXA 3MRFA 1NBZB 4ZYKB 3V0WH 3PHQA 2VLRA 3NFSL 5C0BE 1EFXB 3BUYA 5E8PA 5AWNH 5L9DL 3AS2A 3LKSB 5I1DB 3HN3A 4HGWB 3WV0A 1MI5D 5JXEA 3DRQA 4FQXB 4QRPE 2FLBT 4JZJA 2E8YA 3MRHB 3MREA 3RWJB 2AABH 4LCWA 4X98B 3BSZH 1H3PL 4K3GA 3MJ9L 1RZJH 1P4BL 1WV7T 3T3ME 3DX6A 1VGKB 2YD2A 2CIKA 5D71H 2GW5A 2ZUWA 2BERA 5EBMA 4WDIB 4OCWH 3GDBA 2VDPL 2F53B 3DGCR 1LE9B 3GFUA 5SWQB 4QNPF 4HG4J 1N3NA 1IKFH 1PFCA 3I6KB 5CCKH 5F72S 3M1BA 1MRDL 1TTGA 4A6YB 4Y19D 1X5ZA 2B4CH 3GKWL 1HYSC 4X6CE 4HWEL 2WBJD 1WC7B 4HUVA 2BFVH 5JQ6H 2X1WL 5HGDA 3LQZB 4IDLA 5H37G 3TCLB 4WWKC 3BRFA 3EYQC 2NY2B 5FUZH 1OW0C 5D93C 2CUMA 1WQVT 3RPIB 3S4SG 1XCQA 3P77A 1PG7W 1ZEAL 2GCYA 2I9LA 1BEYL 1MCEA 5HI4D 4YFEA 4M7LT 5IMLA 3BOVA 4KWUA 1U0QA 4WI4A 3CLEH 3UTZB 3WLWD 1ADQL 2R4SH 3HB3D 4F7CA 4KVCL 1XR8B 3HPJA 3QQ3A 2A1WH 2F5BL 3IYLW 4XMKL 4TN9A 1A7PH 1B0RA 3FAWA 4YIQA 5T5NG 5D8JH 3TWCH 3X3FH 4QRSA 1HE7A 4DGVH 4WU5A 4G9DA 5EO1B 3PWUB 4PLJC 1U3YA 1X5GA 3P2TA 1KT2A 3E6HA 4APQA 4R4FL 5IHZA 1XGTA 4MJ6B 2VC2L 1TZGH 2EEBA 3IKCB 4U05A 4M43L 3TFKC 3ZDZE 4MZ2A 3O8XB 4WVRA 1NCWH 4BZ1L 3TPUA 1P1ZA 2VABB 4L8BA 4X9IA 4WI7A 5F1OB 3RWEB 4MJ2A 2R0KL 2CUHA 1WAAF 4HXBH 4DN4L 2QQNL 1S7XB 5I1KH 4JY5L 4P2RA 2GTZA 1I3RA 1DL7L 1XGPB 1ZAGA 1GPOH 3T77A 4RDQF 2BOCA 4P4KD 3QWOA 3FB7A 4ODTL 5DVMA 1HINL 4JDZB 5EWIH 1NANH 2DQJL 1IEAB 5GS0L 2G75B 2QBWA 1W2KT 5KS9F 2AV7A 1QRNA 4MA3A 5D70H 4FABL 4LARL 4JQXA 3MV01 3ES6B 4MNQA 4O9HL 1RK0A 4MA8L 1T7ZA 4HLZH 3WXVL 5J6GA 4W6XB 4ERSL 3ARDA 1G9NL 3INUL 4WU7B 4DOHE 1YPZA 1J11A 4XI5C 5IKCA 3FT4A 4P5MB 5A2JH 4KMTH 5FA4A 4NZTH 1S7UA 4XCEB 4BKLA 1GIGH 3MTRA 4Y1AA 2R2BB 2EZ0C 3SDDA 3V52L 1DQTA 3DVFA 5F7WC 4K8RC 4X8JA 2VO5A 1G0DA 2XIDA 5JHDE 2E27L 5IR1B 4ZUUB 4NRYA 2D7TH 3SDAB 2NNAB 4B50A 3BRGC 2ATPB 3MV8E 1QQDA 3GBLA 2GEEA 3C5ZB 3QUZD 3RVVC 5IB4B 4X0KB 2ZKHH 43C9B 2P7TA 1ED3A 4JM2A 5GZNC 3BFOA 3O4OB 1ZE3C 1T0NA 5DA4A 1FQ9C 2H2SD 1DLFL 3S5LG 4NM8H 5BRZD 1FORH 5SWZD 1QACA 4PV8A 1OD7A 4HHAB 4IIQC 1OQOA 1F2XK 1DE4A 2GQHA 3HRPA 3NTCL 4PJIE 5FGRA 3WFCH 3MROB 1HHIA 1RUQL 3SKUD 5B8CB 4PJHF 2BY0A 2OR9H 4JPIB 5EU3B 2DQFB 4GW1B 1U8LB 5K9QG 1JZ8A 4NHCH 2AJ3A 1QR1B 1UM5H 3DETD 4PJAE 3DURA 4ZTOL 2PXYA 1GOHA 4UTAH 5I1IL 6FABL 3KXFE 1A3RL 3JWDL 4WGWB 4YHIA 5CAYB 4PJXB 5J12C 2CPCA 2V2XB 1M7IA 3AC0A 4QRTB 4HWBL 3CFDB 4YUEH 1ZVSB 2H32A 3ARVA 2WWMC 4POZD 1TJHH 1ZANL 2BOBB 5B38A 3MXVH 4BQCA 1L6ZA 2ICWI 3FRPG 1P5VA 1YNKL 5FIEA 3S4SA 1I1AC 2IQ9L 3D3VA 1JZ6A 4TOYL 4V1DD 5DVKA 3GUTA 1DQQA 4MA1B 1NGZA 5IVOA 2VXUL 5HYQA 5CEYB 2IALB 2R9HD 1NCDH 3QIWD 4O2FA 1E6OL 3HUJF 4HH9B 4PB9H 3IXTB 1MFBL 1OVZA 5EC1A 1E4JA 4NKDB 5E03A 3WS3A 3VMPA 1FNAA 2VR4A 5IBLD 3PWPD 2G60H 4GAYB 5I6XC 4IJ3B 1AO7D 3I9GL 1CFSA 3W2DL 4MD5B 3B8YA 1YUHB 3DYMA 2X40A 4FFZL 3FRUB 4UIMB 2R56L 3CVHA 3HS0B 5ESQA 3RGVD 1ZA6B 4M6MH 1UWGL 4B7LA 5IVZB 4BSVA 4YH6A 4RBPK 1MY7A 1YYML 3HZVA 1CU4L 3EO1B 5CBEB 4XZUB 4RFEA 3BZFA 4BUGA 1CE1L 2BJML 1XF3A 4N0CC 3PHSA 1LK2B 2EIZA 5T1KA 2IAMA 3GHEH 1YMHA 3V6FA 4XGZA 3VA2C 1J8HA 4DK6A 2IQAB 2WSKA 3IFLL 5FYLD 3P9LA 3PDOB 3HE7A 5L0QC 2VKWA 2BY1A 3U4AA 5C0EA 5H37H 4XPTL 2HJLA 4PJ8D 3VGAB 4BUHA 4PJ5E 2WW8A 4C58B 1EFXD 2IPTL 3VFUA 5AAWA 4M48L 1W0VA 3EUUA 4M6OH 5HHME 5DYOB 3T0ED 4JRYA 4C56B 4M1CC 1UC6A 4PGCB 4HIXL 4XH2A 4P5KB 4X7EC 4UQ3A 2D0GA 1FVEB 2YD9A 2K7QA 3WLBA 2DTSA 3GMQB 3QJHA 3GM8A 3AGVA 2NY2C 3MOQA 4NNPH 3T09A 3WFBL 2K9UA 3WFHA 1HN1A 3VFNA 5JR1L 5ICXA 3S7GA 4Q6YA 2IPKB 3CDGA 4X4YA 1MRFH 2F53D 2CKBA 5JA9A 3F7VA 5EOTB 2VXTH 1IM9A 2WANA 2A6KB 3MA9L 1T2XA 1YQVH 5C0DB 3CVHH 4YXLL 3WEXB 2VQTA 4ZNEE 3QUKA 1A6VH 1T4KB 2YD4A 3FCTA 5J3HD 1AGBB 5D1XA 1U8OA 4MJIB 4HFUH 2J1KA 2ED7A 3V5HA 4JG0L 4OM1L 2EO1A 3RI5K 4MNGB 4DFHA 1HKLL 1CGSH 5C6PB 2AK4E 5FF6A 3JV5A 1M71A 3WUWG 4G6AD 4PJEE 4G8FA 2QR0A 3ULUC 2B1AL 5F93C 4LMQE 1X5AA 4MAYD 5C09A 4LKCB 3EYOA 4UT7H 2CLZA 1X5LA 2IANA 4WFHD 3GMRA 2G5BA 2H6PA 1FO0H 4TVPL 5DJYB 4OCMC 1FLRH 4RFOL 4YHPA 2VDOL 1T21A 3F7QA 4YFLF 5DEFA 1RAMA 5KVEH 5CIPB 5EIVA 1FGNL 3ZKMC 4L3EA 1XGRB 3QUMH 3QEHA 3MV7E 4F7EA 1RUPL 2MKWA 4TUJB 3SHSA 1JGEB 3MMEA 3QEUA 5F9WB 3S88H 3TM6A 1H5BA 3S3JA 3GMOB 3JSSA 3LN5B 1G7HB 4DN3H 4OZFB 3FRPA 2DQEL 4X6DF 1Q9LA 5L88H 4PLNC 4ISVA 3GSNH 4OIBA 3CSGA 4P57A 2MOVA 3FFCB 4XPHH 4ELKB 4KQ4L 4PRPA 3O3UN 3G5ZB 4Z5RA 2UZIH 3FN3A 1NKOA 5I1LA 1JIBA 2B2XH 1OHQA 1PGRB 2W92A 1L9MA 2MQCA 3IAQA 4G7YL 4L3CB 3TVMB 3VWKB 4RFNB 4PY8J 4YJZL 4KRNA 3SDAC 4HF5L 1UM6H 1HNFA 3G6AA 4ELMA 3PHOB 3CJJA 5I8KH 3C5ZC 1UJTA 5HDOA 4JFZH 1BFTA 1OTTD 3BPOB 4LAJH 1N8ZA 3ZDXE 1WIPA 1FVCB 1DBBH 4FS0A 3K8LA 3O4OC 3QG6A 1AGFA 2BVQA 1ORSA 5MENE 1J0KA 5GS0D 2Q8AH 2VDKH 5T1MB 1AP2B 5LQBH 2APVA 2MCG1 4G7VL 1G7MA 2G2RA 1BQUA 5C0BD 3V0VA 3ARTA 5SX5K 1KIQB 3VWJD 5KSBE 1CIUA 3IF1A 3B9VA 1S7QA 5B8CC 4QRPD 5IVXA 3HE6B 4HKXA 1VHPA 1UB6B 2LV4A 2ICEB 4ZAKA 3MOAH 3QDJE 3OV6A 5EUKA 5HGAB 3VXMA 3NFPB 2C5DC 2YSSA 2OTPA 3BDYL 3WIFB 3GB7A 4P9MH 3FQNA 3KPMA 4HUXB 3TZVB 2X4SB 4JY6A 1PSKH 4LPWA 5JOEA 3HNSH 5EBWA 2I9TB 3FZUC 4H5SB 1OP9A 4WGVB 3D85A 3VXTA 4LRIC 4PJCF 2NPLX 2FHBA 4OI8A 4GKOA 4W70A 1J1PL 3TNMA 1TVHA 3WNOA 2VZUA 1LO5B 5ENWB 3TPKA 4WTZG 1CF8H 4MA1C 3REVA 3EJZC 3EO9L 3LV3A 4NJ9H 1F11B 2Y7QA 3ISWA 1JHTA 3OHXB 4GSDH 5LWYL 1D5IL 1N6QL 1XH3A 1T66D 5E2TL 4JFDE 4IRSB 1CZ8L 3C09B 5F6HI 2Y36H 4M62L 4TRPL 5IM7B 4IJ3C 1CL7I 4OT1L 5GHWH 3QEQE 4NKOA 4L9LB 1ETZB 1N0XL 3LKOB 2M2DA 3W9DB 4YHMH 2JJTA 2MFNA 3RTQB 3WUWA 4XNYL 4KK5D 4V2BA 2WIIA 4TTGA 1KBGH 2PUQT 4DKEL 1RUML 4XT1C 1NGWA 2ILLA 1GSMA 3WIHL 1UEMA 5BO1H 1QFWL 4U3XA 3HZMA 3FMGH 3MCLH 3V7AG 3EJYC 1I3GL 3VFWB 3KPOB 4UB0L 2VWEC 1A6ZB 4WHYG 1YN6B 2IG2L 3DPBA 3LZFH 5DMIH 1D5BA 4ZO9A 1B0GB 4LBEB 2ATKA 3QDMB 3JWNC 5DJAA 3LRSB 3RFZC 3O6ML 2I07A 5E2VL 4NNYA 2FJHA 3SOBL 1I8IB 1I1YB 3ZE1E 4NZJA 2X1XR 1WUNT 3BGMA 2Z35B 3IDIA 1AGEB 2F8VA 4F9PC 3LKNB 1YDPA 4D0CB 3LS4H 1EEZB 5DRZA 5BW7A 3PE9A 4ZOBA 3EJJX 1J0ZA 3HKFA 1IT9L 2A6DA 4IS6B 1WBYA 5FA3A 5IWLA 2FO1A 4M1DH 4OUUB 4L5FH 5DJCA 1SVCP 1DDHA 4ZXBC 4PG9B 1OGAA 2GJZB 2FX9L 3ULVC 2OL3A 4JO2L 1FSKB 1A22B 3JVGC 5J13B 5EA0H 1FDLH 4UUJB 1ZMYA 4WWID 4YC2C 2XRAL 4NM4L 1T7VA 5EU7C 3BHBB 3I02A 3MLPA 1HQ4A 5CHNA 4IDJH 4OZ4A 1W72A 3EKCA 3TGXA 3EHBC 1B9ZA 5DJ6A 1LP9A 1MELA 4OCXL 2B20A 5JHDD 4WO4A 1A6TB 1RHHA 2KQNA 2F9BT 1YQ2A 4LHUA 5EZLB 1X5FA 2HLAA 3MV8D 3QXVA 5C6TL 1E28B 4U1HB 4Y5YA 5FECA 3L5JA 2J4WL 1FYTE 3VXOA 1CDUA 4K7PX 2AGJH 4KJQD 1Z5LA 3IU4L 2Q6WB 3MLRL 1QBMH 1S5IL 4X7TA 2DM7A 4KRMB 3P0VL 2YC1A 3LB6D 1JPFB 3IFOB 3QHFH 3EAKA 2ORBL 1JZ3A 5C0AB 1TENA 3SJVA 4ZSOB 4ONHB 5D2NB 3S34L 3B3IA 3QFDB 3OB0H 1MCHA 1YY8B 1KN2L 2R29L 3FT3A 4NZRH 1T04A 1YJDC 3HZKB 4NQEE 2NXZB 2ZUTA 3JTSA 2HFEA 5DQJB 4MJID 3SE3C 5FV2A 3EZ8A 1CG9A 2K7PA 4O2CB 3TJHC 5FOBA 3FONB 4UOW0 3ARFB 4MB4A 2VH5L 4U6HA 3KLDA 2BNQB 3Q3GA 1CS6A 1MCNA 5B39G 4WHTA 3KLHD 5IG7B 4MX7B 2FNBA 1KLGB 5DD5L 3NIGE 2H8PA 1HOCA 3MNZB 1JTPA 3RWDB 5DJDA 3JV6B 1UYWH 3L9RA 1MHHA 2DYPD 4Z76A 4ZUSB 1ZSDB 1S9YA 2ADJB 2NXYB 4Z18A 3T0VA 3ULSA 3GIZH 4ZFGH 1MJUH 3PIQB 4KV5E 4EVNB 1W72H 3EDJA 3QA3A 4WCYH 4HCRH 4PJFF 4Y5VA 5IQ9B 4TVPD 3VRLF 4NQTA 4URTB 3B9EA 4FG6D 3TN0A 12E8L 2QSCL 4U2ZA 2ZNWA 3ARED 5A3IC 3LQMA 3U36B 3P9MB 2DQTH 2R8SL 1YNTA 4NNXA 2J7LA 2OI9C 4Y16B 4NP4H 4P3CH 1EGJA 4TUOA 2J2ZA 2OK0H 2UYLB 5DK2A 4N0RA 3VJ6B 5I76B 1ZLVH 4AG4H 4PY7A 4P0DA 1ROWA 2P5WE 1L6XA 3W0WB 5EU4B 4JLRA 3BKCL 4OZIF 1EEYB 1H3UA 4HK0B 2WUCH 3FO0H 1QNZL 2E7MA 5GRVK 1P4LB 3TVMD 1QSFE 1JFQH 3VWKD 2HKFH 2VE6A 4FFVC 1CGVA 1RK1B 2PTTB 4J3WA 4PV9B 4LVNC 3X3GL 4F3FA 3F7PC 4ZFOB 4OB5H 3PV6B 3G08A 4IHOB 2OZ4H 5JIHA 4DAGH 1AGCB 4PY8I 4WNQB 1YMMB 1OM3H 5C3LD 1RJYA 3QI9B 2FEEL 3VDBA 3MRPA 1NAKL 3T3MF 2UZXB 3TZVC 2OTUA 3PWVB 3T65A 2GKIA 4PJ5D 4TSCL 5DRWB 1I3VA 5DRNA 4QRRA 3B5TA 3CD4A 1FAIL 2R23A 5BVJB 1Q0XH 4E41A 3O45A 1B2WH 5E8DH 4M6NH 5ID1B 5KSUB 1LD9A 4XMPL 3HE6D 5ALBH 5EZJA 3REWA 4J7RA 2XZZA 2Y6SD 4XB8A 1NFKA 5I0DA 3PWNB 1JV5A 1OTSC 3TA3A 4U1LB 4X6CF 3S37X 2GITA 1VFBA 4AM0A 1OAKH 4FTVA 3BW9B 3NFNB 1E27B 3W11D 4Z7UB 4M5ZL 1VACB 2Z91B 1LNUB 3VG9C 2CLRA 5F9DC 5BJTA 2NY0B 2UV3A 4U1IA 2ZCKL 1T1YB 4WUUA 1N64L 4JANB 1A9BA 4NBXB 1MJ8H 3M17B 5C0FB 4R7DB 4HIHA 5JO5A 2J88H 3DX9B 4JVUA 5CJOH 1MY5A 4GG6A 2CJUL 2UUDH 3O9WC 3QCUH 4YPGA 1IEBA 3IAPA 4AL8L 1QPPA 3ARBA 3LD8B 1I1CA 1UZ8A 5T3XH 4QTIL 1BFOA 4D9RD 4RIRA 1KCRH 1Z2KA 5DD0H 3KPPB 8FABB 1T5WA 5FYKE 3IFPA 4ACPA 4BFGA 5GJTH 2X05A 1SM3H 4I2XE 1DQJA 3ME0A 3CXHK 5DJXA 1F3RB 1CGXA 1V3MA 3MGTA 2JB6A 1G1YA 4YNYB 3DVGA 3NABH 2R2EB 4K7FB 3RTQD 5B39A 3O3BB 1U8JA 1ZWIB 2NW3B 4R90H 2DLFH 2AQ2A 3ZDZF 3CFCL 2YN5A 1MIMH 4L1DA 1KIRB 4JAMA 4P2YA 2AXGB 3GRWA 3BPLC 4ONFL 3BPNC 5CD3A 4I3GA 4MCZA 4HK3J 4Q9BA 2HT4D 4HW6A 1T7YA 4KI5C 4FFYH 1KG0A 4KKAD 4LGSB 5E4IA 5DUPL 1OAQH 2W1NA 3BP7A 2X6MA 1A2YA 1J05B 4HDIB 4J6RL 4DCQB 1S9KC 1ZHNB 32C2A 3D69B 5I66A 2HYMA 1GGIH 4ONGH 5DJ0A 4Z7WB 4JPWH 3DOSA 4EDXA 4OGZA 1BQHA 3FOMB 1XZ0B 3CAFA 4HGMA 5D7JB 5I1GH 4LSQL 1M05B 5D96B 3LMJL 3BDBA 1IMHC 3TBWA 4CVXA 2FX7H 2QV2A 3IJHB 4YZFF 4M7ZC 4RQQB 4QRUB 3CLFH 1UB5B 1FFPA 3EDFA 4S1SL 1RIUH 1A7NL 1BIHA 1WEJH 3GSVB 3R0NA 1XF2A 1HI6B 3O6FB 4L4TB 2IBZX 4PRHE 2Q8BH 3JWOH 4YDKL 4L29B 1KPRB 1E4KA 1QHOA 3CC5B 2DICA 3NCFB 5IMMA 5AYUH 3IXAB 3DTXB 4JO1H 3N1GC 1CBVH 5D2NC 1NFDE 4W4NA 4MAUH 1BF2A 2NXZC 5ISZB 4NC1E 1IE5A 3JTTB 4PUBL 4PJIF 4G80B 4P46A 4RGMC 5F3HA 4PJBE 3T3PE 1PX3A 2MPAL 2UY7A 1L0YA 2EDDA 3ARFC 3QDJD 3K80A 1JHKH 4I13B 2WNGA 1CGWA 1G7QA 5DVNA 4QGTA 5JMRA 2FD6H 1RZJC 1CVRA 4LLUA 1S7SB 4BH7A 3ULUE 2VDQL 1HXYA 3QDGB 1INEL 4PJAF 1H3VA 5BS0A 3G5VA 5C0AD 3RL2B 5BZWA 4CJ0A 3BWAA 2ZUQB 1MJ7H 5JZ7C 1D6EA 3ROLB 3D9AL 5C0NC 4XPGH 1WIUA 1I85C 2BC4A 4JFOA 4Q9QH 4OLXH 3VDCA 3E6FB 3B2UD 3I75A 3IDMB 3V4VH 3IB4A 4JZOB 4JCMA 3UTTB 1D9KA 15C8L 5ANME 3QCTH 2BSSB 4R9HA 4JB9H 2QEJA 1PYWB 5FYKL 3BGAA 4JR9L 4FQQB 3C2SA 2B4CC 2CSPA 5LKNA 4QHKI 2AJYH 2YKLH 4UU9B 1QKZH 1VPOH 2EO9A 2P8PA 1UZ6E 4JFDD 1EMTH 1HWGB 3CFKB 4Y16C 4Y4KB 4HUWA 1ZHLB 2NLJA 3F5WA 3OKOB 1AQKL 1S9XB 5IW6A 3QEQD 2BNRA 4ONOA 4JPVL 4H0IA 5GRUH 1NUFA 1KN4H 3PQYA 2O61A 2DLHA 4YBQD 1SJHA 4HAGA 5I2IB 1BFVH 3IJYA 5DFVD 4BK4A 1PG7L 2VL4A 4L3AA 1DQML 3QXDA 4HC1H 4M7JH 4Y2DB 1YNLL 3TYFB 5JXEC 3QCVH 4KK9D 2D2OA 4G8IB 4LASH 5C0CA 1IILE 4FZEL 5F8RC 2XG4A 4HXAL 1LE5A 1M4KA 1A5FH 1AXTH 1X5IA 3T4AB 3ILPB 1YEKH 4DKFH 3QI9C 4CGTA 5HYJA 2XNAA 5B3JE 3V4PH 4ZFZA 1HHGB 3O2DL 4FFWC 1QFUH 1IGJA 3BP5B 4HJJL 5I1EL 2DKUA 1YC8A 4OZHE 4MYWB 5I74B 3SQBA 1DEEB 1R6VA 5MI0B 1QO3B 2V17L 5TDPA 1FO0B 2R1YA 4M3JA 3GK8H 3RZCA 4I4WB 5DURD 3ARZA 3BEWA 3KPRA 3QUMB 4AT6A 4NHUA 1CFBA 5D72H 2OM5A 2I24N 1KCUH 3OJDB 3SDXE 1VDGA 5HHQA 2E6PA 4D0BB 1K5NA 5DUBA 4BQ9A 4KROD 4O51B 3G04B 2DQHL 4K9EL 4ZTPH 3SPVB 2A0LD 3GSWB 1RURH 3T4YA 2FWOA 5CZXD 5DHVB 4HQQH 2JJVA 4N68A 3GIVA 4YHZH 4DGIL 1Q9OB 2PF6A 1KENH 3BIAX 2ICES 1L7TL 3V4UH 3WIIH 5ERWA 3SCMB 3LDBB 1CFQB 2DJSA 3R1GH 2EDKA 3BVNA 1E4XH 4OKVB 3ULUL 5D1QB 3LH2H 3SQOH 4EN3D 4GRWH 1F58L 4I3RL 2ERJB 3EYQD 4APQC 3HI1B 3D18A 3DX8B 1AFVL 3SGDI 4L4VB 1WZ1L 3FO1B 3TT1L 4PJEF 3OBAA 4KUZL 4UAOC 4YEEA 2C3VA 5LAXB 5J0BA 2FB4L 4RMWA 2NY0D 1FZMB 1D5ZA 3RDTA 1X9QA 2EICA 3TBYA 1YN7B 1U3HA 4Y88A 5IEKB 4JO4L 4NQED 1UXWB 3AS0A 1S78C 1T6WA 3D39A 3MCG1 4L8DA 4D2NA 4OGAC 4OM0H 4XVJH 1GH7A 1LK3H 4PJ7B 1KEMH 5DUML 5IJVB 1HDMB 4JQIH 1MRCL 1K6QL 4D8PA 1BPVA 1MREH 3QNXA 4C83A 4RGOL 3MLVL 2VWEE 4XBEL 5AZ2L 5GJSL 5KBNC 2OQJA 1QEWA 4QYOB 2ESVB 3ELAT 3MRLA 3UO1H 2O5XL 3MRNA 1XEDA 4JQXC 3RU8L 2VLKE 3NN8B 5JHLL 5EN2B 3U7YH 4X4XB 4P23B 5GS1B 1JWUA 4ZUWA 4GLRI 4G6KL 3S36X 3CK0L 5CZVH 2JJSA 4YR6B 3R8QA 1FZKA 2CIIA 3LEVL 4N5ED 5HHPB 2PW2B 4G43B 3CVIL 5E8NB 1MAML 5ID0A 3N1FC 5D96C 3C60A 3DMMD 1JMZA 1S7WA 1IGTB 4GW4B 2MTPA 5HDQH 1GOFA 2FBJL 4OLYL 4UQ2A 3SKJL 1RIHH 4HKBA 3CFBB 2EC9T 3LKPB 5E8EA 1U8QA 2D7OA 4E42A 4GAFB 4YBLB 3U83A 5LVEA 4OCNC 4LIQH 3U1SL 4JM2C 4K23L 1NL0L 3A67H 4O2EB 3DROB 3TBSB 1RULL 1FL6B 1G7LA 3FO2B 4CU7A 3ZDXF 4LCCA 4ESKA 1OQXA 4RRPG 5JUEH 5EU7E 1UWEH 4OFYA 4XI5D 1QSEE 4BSJA 1MNUH 3C08H 5D7JD 5IIEA 2F54B 1QSFD 3WDJA 1OSZB 1R24B 4NQXB 5KSBF 1DBMH 2L0DA 1HQRA 2NY6D 5T5FH 1MFAH 2XWTB 3L7FB 3ARRA 4PJDB 4XNQA 3CSBA 4OAWB 4U33A 5GSRB 3RVTD 1AY1H 3AXLB 5F7KC 1FYHB 4CN6A 1FZJA 5D7IB 4L4TD 2ZUSA 4ODHL 3TESA 4XP9H 4PREA 3U4BH 4UT6H 2VDML 5MHSD 5D2LE 4MQ7A 3TT3H 3CU7A 2H1PL 3T2QA 7FABL 1T3FB 1KB9K 4X8XA 4YXKH 5AUMA 4ODVH 3H6JA 4D9QE 3FFDB 4FA8A 1T20A 2X44D 3EOTH 2ZUQC 1E4WH 4KC3B 5DZNA 2ZUXA 4Y5XA 2FIRT 5ISZD 5GGSB 5BQ7A 3U0PA 2EECA 2GAZB 4UI2A 2EYTA 3SGEI 1Y18B 5HJ3A 3DO3A 3SGJC 3MLSL 1CR9L 1TCRA 3NA9H 4F8QA 5E5UB 4ODWB 2O26U 4UTBH 3EOBA 1OARL 3FB6A 5F21B 3WMSA 1QLRB 2XWBB 3MA7B 5JW5B 3VXRE 4MD4A 4BA8A 3FJTA 1T6VN 3FB8B 3H7LA 4Q0XH 5BVPH 5F7HA 3Q1SL 3QZWB 4HS8L 5EPMA 3NZHL 5ALCH 1RZKL 1HEZA 1UADC 1WSST 3UDWA 3MLXL 3UBXI 2J3SA 1JK8A 3O3DB 4C54A 3QIUB 2VUYA 3RWIA 5DD6B 3JBG7 4ZO8A 1JWSB 4LGPB 5I17A 1U92B 3DV6A 5IHUH 3L7EA 3AY4A 1RZIB 1WWCA 2A9ML 3UTTD 2VMFA 4JREC 5AD0A 2AK1H 5DRXA 1A7QH 5EG6C 5C0GB 4IOSD 3OAUH 4XRCA 1QA9B 2HT3C 5LJYH 2X7LB 4U0QB 2J8UE 2HJKB 1G7PA 2IAMC 5FYKD 4G5ZH 3ZMRA 1GAFL 1KB5L 3HR5A 4P2OB 5FK9B 2NCMA 1I7RA 4Y4KD 5CLTA 5H35B 1B6DA 3Q6FB 5KSAD 3BXNA 3HE7C 5HYSG 1S7TB 3K8MA 2DQUL 2HTLC 3C8KB 4P5TB 5I74C 4TVSa 5MI0C 2BMKB 1MHCA 5M94B 1CLZH 5EU5B 3HA0A 3ZE1F 4W68A 5J1AB 1CICB 3QWRD 4I0KA 2HVJA 4Y2DD 1JF1B 4K3EH 4Y4FD 3BKJH 4N9GB 1S7VA 4XP5H 4R7NA 2YPLE 4HEME 4M93C 4D9LH 3U9PH 1ZHKB 4P59L 1Q1JH 5I16A 2BRRL 2ED8A 2AK4A 3GNML 1KJ3H 2DQGH 5DK0A 1T1ZA 2PETA 2MQ0A 1T83A 4CADB 4P99A 3MJ6A 1EZVY 2A83B 4QWWC 4E0RB 2VRAA 4OGXH 4RMRA 3MJ8B 2R4RH 1WAAA 4LDLB 3TIEA 4OFKA 2AJVL 3QG7H 1Y0LB 4LQ1A 3HI6L 1U8IB 1MHEB 4HFWB 5D1XC 5KTEH 4MDJA 1R5IA 2X9YA 1C08A 4AENA 3LDBC 3EYUL 4P9HH 4FQHA 1C8PA 2V6HA 3DHJA 2HRPH 3MCKB 3MO1B 1QLEL 3MV7A 2FR4B 2NY7H 4KJWC 4LVOB 1BREA 5D1QC 4BH8B 4ZNCD 2DQIH 2HFGL 4QEGA 1S9VB 4U4BA 3LS5L 4F7TA 4NZUH 5KS9A 3CDYA 3NZ8B 3VFRA 4BFIA 5HBBA 5ETUA 4QT5A 2VL5A 4ZQKA 3X14A 3ARPA 5I1CH 4UDUB 3VFMA 5C0JA 3RPKA 3BZEB 3DV4B 4QY8A 4PGDA 5FO8A 5C08B 1U95A 4PBWD 4UBDD 1MFCH 1YEDA 3CFJA 2W0PA 2AEQH 4HUNB 5C3TA 3RBSA 5JPNB 1MH5B 3FL7A 1DQLL 1H5BC 1IAOB 3C6SB 4LSVL 5DS8B 2DTML 1JPTH 3LEXA 1NAMH 3H9SB 3IDGB 5E2WL 5J7CC 4JY4B 1KPVB 5DTFA 1MCPL 3DECA 4L4VD 1NC2B 2OTWA 4PGJA 4RISH 1NCBH 3BN9D 5HDLA 3HMWL 5HHOE 3NIGF 4BFEA 2X4RB 1OP3K 2C1OA 1A3LH 4P23C 1AGDA 1JUFB 5GS1C 5MENA 4XWGH 4MXQC 1A6WH 4JG1H 1UH3A 5BXFB 4QHNB 3C6LB 4RWYL 6CGTA 3ARSA 2DWEB 4KV5F 5IB2B 1A7RL 2FBOJ 2PR4H 1HILB 1TQBB 2Y9RT 3L3GA 1F5WA 2IBGA 4KI5E 3G6JF 2A73B 1YECL 4X6BB 3TH2T 1BZQK 3LPGA 5TH2B 1NGPL 4H26A 4XPBL 2BXZA 4YBLC 2DBLL 5F9OL 2ESVD 4XVSL 2VXQL 3HAEA 4NO0D 2VLJB 4AH2B 5L2KE 5DEGA 1JYWA 1N0LA 4HIIB 3OB8A 1MCCA 3SDYL 1KFAL 2ARJQ 1CL7L 1KV3A 4X4ME 5D5ME 3PGDA 4KRLB 4TPRH 2DMKA 4HIJB 3RUGB 4Z77A 5HI3D 3L3KA 3EGSB 4E5XA 2IBBA 4GS7C 1TPXC 2CRYA 1HHHB 2YK1L 2H45A 4ZAKC 4S1DD 1B4JH 2NY1D 1JHLH 4ZS7L 3SDCA 1R3LB 1I7UB 3O6LH 4ZPTB 4P48A 3THMH 5J11B 2ZJSL 4I5BA 5KVGH 4N0YL 5CMAB 2FX8H 4H8WL 4PLKC 3OKDA 3BE1L 4CU6A 3H2WA 2X89A 4KZDH 2XQBL 3IKKA 2YRPA 3UTSB 4XWOD 3NA4A 3OKLB 3ZT5A 1JGUH 3MUHL 4L8SC 5TE7L 3DBXA 1DJSA 5CILH 4KJPC 2V2WA 5I18H 2HA1A 1GHFH 4FQ2H 4OTXL 3QH3A 2Q76A 3H7BA 3QJFA 5JORB 1IZJA 5C0IB 1F45A 4RGNB 3O3AA 4PJ9A 1FN4B 1FJ1B 4NQCB 3AS3A 4PD4J 5GGVL 4ODXB 1XF4B 1ZLWK 4G3YL 4GKSB 3UEZA 1PX4A 4PJGE 3RWHA 5EU6E 2PYEB 2RIKA 1XMWA 3ARGA 2NTFA 3QIUC 5F7DB 2WP3O 3EIFA 4M8QA 3KLSA 3QDHA 2JJTC 4MQXC 4S2SB 4PB0H 1KCKA 3G5XB 4GMSH 1U8HB 5GGRY 2CDFA 4JDTH 1CTOA 1KELH 2EDOA 2H9GB 3MRKA 1LMKA 4K2UL 5FUOL 1SJEB 3ILQD 3QUYB 4OLZH 5TFSH 4P4RB 5GGQL 4FQCH 2ARWA 2XZCL 3TJEL 5ADOH 2HVKA 1A0QL 4MLIA 4CVZA 2C7UB 1GCFA 4L8CB 1VA9A 3SO3B 1DFBL 4CRPA 2I60L 2OCFD 5ABDE 3L3HA 5HVHC 2PW1A 3RJDA 3I2CH 1CDYA 1R5WA 4O58H 5MP6H 2F74A 5CS7A 1OTUC 2QJDA 3GI9H 5IVNA 4OLUH 4U6VH 5ECJE 1I9RH 4P5TC 4WW2F 1LEIA 3QPQD 4FXGB 3OX8B 4P2QA 4UNVA 2VLRE 3FQWB 2W9EL 1CICC 3BN3B 2EYSB 1X5HA 1IC5L 1NGYA 3DO7B 2XA8L 1K3ZA 4X6EB 1U6AL 5KOMC 4MJ5B 3KVQA 2F58L 2OJZL 4M5YL 3CH8A 3EJYD 4BQBA 3T2NL 2Q86A 2CO7B 3SE8H 1H0DB 2JTDA 4FQ1L 4LCWE 5DSCA 2GUOA 4YDIL 4P2OD 2VZ1A 2NZ9C 2VLKD 4WWKA 4FP8L 5E94B 1OW0A 1X4YA 4TSAH 1R0AL 4ZOCA 3KJ4B 4PRBB 2D03L 4KY1L 2R69H 4XAKE 4F7MB 3CMOH 2ARJA 3HMXL 4HPOH 3QO1B 4U1KA 2WWKT 2XA3A 4H0GA 2BY2A 5E2UL 5IB1B 2MHAA 4NCC1 2A74A 4WO4C 1IM3B 3QULA 5BV7L 1EHLH 1S7RB 3B9KD 4YWGL 1OCWH 3KLAB 3D2UA 1C5CL 2RHEA 1D5MA 1LEGA 3FOLA 1W0WA 5MEPA 2VLMD 4OQTA 3SE9H 4ZXBD 5BV7B 5FHBL 4GOSA 4NO5B 1YEEH 1AD9B 4OCRL 4P4KA 3R06B 3FN9A 1EXUB 1X5JA 1H15A 1ZLSL 4MS8D 1YEGH 1OAYL 1NFIA 4D94A 2XWJA 2ZOKB 1QSED 1KJ2L 3U6RA 4R96B 1MJJA 1OWRM 3I6LE 3L3DB 3MNVB 2QSVA 3L1OH 4PP2A 1RMFL 3K46A 4AIZA 1KJ2B 3QIBD 1BOGB 1NC4A 1TJIH 4IRJB 5E5RB 4U1NA 4LAQL 3Q6GL 2EDQA 4LP4A 1FL3A 2KQMA 1MFNA 1RFDH 2WK2A 3S35H 2V9TA 5CSZA 1DUZA 5EUOB 1Z0NA 1TNNA 5HYEA 3ZSSA 1CXIA 5D71L 5EOCL 3T3PF 5DVLA 2JIXB 5DD1H 35C8H 3QHZH 4G6FD 1C5DA 3CX2A 3NH7L 4FRWA 5GGTH 3UPRB 1NDMB 3MRBA 4D9QD 2KUTA 2UVFA 4DUWA 3V0AC 4HJ0C 1PZ5A 2P8MB 1INQA 3ULUF 4JN1H 3PL6D 4MWFB 1AKJB 4OCSH 1IKFL 3WXWH 2NY4B 4QXUL 3C6LC 3LEYL 5IOPB 4JGMA 5EFIB 2V5MA 1T1WA 4N8CL 5F7UA 2XT1B 4PRNA 3DJ9A 2XZAL 3CDCA 4Z7VB 5DO2D 1V5JA 3VE0A 5LGJA 1AQDB 4C4KT 4P2RE 2BFVL 2JB5H 3TN0C 4YDLB 5HD8C 5INCA 1OF2A 3K2UH 2FATL 3VXRD 2P5EB 5FUZL 1MCRA 3MRIA 2NX5B 4NYLA 3BIBX 4YE4H 1G6RA 3VXNA 5EBLB 4LKXB 3CFEA 3QB7C 3DRTA 1QRNE 3QXAB 5E4EC 3C9NB 1MFEL 4MNQE 1UZ6F 1AR2A 2HLFC 1NCAH 4H1LH 3CLEL 5JLZB 1YPZE 4ODSH 4M6AA 2Q7YA 3IDYC 2JCCA 4Z8FH 5IEHA 2IC2A 3M8OL 4Y1AE 3GBNL 2J5LC 4I48A 4NO3A 3MZGB 1DBAH 2IEPA 1ES0A 2FL5B 4JFEB 4WUKH 5C07B 3STZB 3LOWA 1F90H 1PKQA 3T2PA 1MWAA 2P46B 4J3XA 3S98A 2EC9U 5SWSB 4W4OA 1CE6B 1OT2A 3OTTA 5DXWA 4JGJA 1AXIB 1P7KB 4QOKA 1IEHA 2CLVA 1GZQB 5CD5C 4GRWB 4D3CH 2QSQA 1IJ9A 1JP5A 4YGVB 4NWTL 3ZTNL 4TULL 1FIEA 4RMQA 2K3TA 5D1ZB 3VFVA 4JKPH 3QFJA 2BCKB 2EDNA 5DHYB 2CH8A 2Z8SA 2N4IA 3KJ6H 1BLNB 2R1XB 1KACB 5C2BL 4AMKL 4OFDA 4LNRB 1QYGL 4KHTL 4KKCC 1AO7A 3IDXL 4LSRH 4OZHF 2J6EA 4CKVX 2A77L 1TJGL 2YPLD 3I6GA 1I1AA 4S1QL 1YY9C 4LSSH 1HIMH 1FGVL 3BD4A 4RGNC 5IT2H 3WD5L 3MBEB 1UM4H 1BD2B 3KPSB 3V7MA 1C16A 2W0FB 3ESUF 3R0MA 1I9JL 2I9LB 3SDXF 3DLQR 2V2TA 1F4AA 4XC3H 4I2XA 1IC7H 1CQYA 5L2JA 1CLYL 2OSLB 5EORL 5I1HL 1KEGH 3VRIA 4KMTL 5IMLB 3FN0H 5C0RL 4R8WH 2AEIT 5CINH 2E7CA 1LEKA 1BBJB 3FB5B 3ZE2F 3Q5OA 4TUKH 2VXSL 1GZPB 1CQKA 2F15A 1NBZA 3TYGL 4ZYKA 4GUPB 2H2PC 3D3VE 3AMLA 1CFTB 1F6FB 2AI0H 2B1HH 1MWAH 3IFNH 4S0SD 4XCNB 3O0RH 1EFXA 3LKSA 5I1DA 3MLTB 4HGWA 4HS3B 5F96L 3HZYB 1IGYB 3P4LA 4FQXA 4QRSB 4KAQH 1HKFA 1OTSD 3BX7C 3MOBH 4GG8B 3MRHA 3RWJA 4X98A 1CLOH 3O2WH 2XICA 2EDTA 1NGXB 1VGKA 3JWOC 4FQLH 3HC4H 1RZ8B 3MGOB 2OP4L 1BAFH 5EDXA 2VKXA 4GRLC 4WDIA 4K94H 2OX5A 3H3PL 2F53A 1LE9A 1KGCE 5SWQA 5JMOC 5J6HB 3O9WD 1Q0YH 2AEWA 2OR9L 5I8EA 5F7EL 2GJ6E 4A6YA 3QUYD 4EQ2A 1F3DJ 5KVFH 2Y4SA 3OJVC 3FB7B 1WC7A 2UZYB 4LPUA 1NSNL 3LQZA 4Q7DA 4YUEL 3GMPB 3TCLA 1J8HE 5HHOD 2RCSH 3RPIA 1BVLB 4HMDA 4HUUB 3BQUB 3KJ4C 3KYKH 3TV3L 5FYLH 3VG0L 4KK6D 5FCUL 2I27N 3FT4B 1GGUA 3BP4B 2NMSA 5LXGH 4LSPH 5EB9A 3QQ9C 3UTZA 1JN6B 3HI5H 1KULA 1J10A 3HG1D 1XR8A 4IM8A 1U93B 3NFSH 5SV3A 4JRYE 1NCDL 3VD9A 1ADQA 4PJBA 5L9DH 3BKYH 1SMAA 1IGML 4KMLB 1IL1B 1DLHB 1MCBA 2EH8L 1TTUA 5EO1A 3PWUA 5KW9L 1KIPB 1E4KC 1H3PH 3KGRA 3MJ9H 4KH2A 1T0NB 5FGBC 5IGXL 3E8UL 2A2QT 3EOYG 4MJ6A 3RNQB 2XKUA 4NQDB 4GFTB 3IKCA 3RVWC 3O8XA 3WJJA 3OJMB 1CFVL 2YRZA 3MLYL 1XIWD 2VABA 2DQCL 4YXHL 2VDPH 4HUKB 3RWEA 1IGIH 4YDVB 4IRJC 1A64A 1A4JB 5CSGA 1S7XA 2RAMA 4JZNB 5A16B 3IDJB 1MRDH 5F1NB 4G6ML 4WJ5B 1XGPA 1EBAA 2XTJC 2HT2C 3GKWH 4HWEH 4YHLL 4CN1A 4J3VA 4CMHB 5T1LA 3VCLB 1BOYA 3BUTA 4PRIB 2KZ1B 4RA3A 3OPZL 4Y8DC 2G75A 3MX0A 4IMKC 5D2LF 4R2GC 3P11L 4J3TA 2X9XA 1V8HA 5A2KH 4UILL 4WW1B 1ZEAH 4EI6B 1S8DB 1BEYH 1HCFX 2NY4C 1J5OL 4WU7A 5KN5A 4P5MA 3WO4B 4XCEA 1D9KC 3DIFB 2R2BA 1ADQH 4KVCH 4NQSB 1T89A 1JI2A 4YDLC 1CWVA 2ZPKL 5IR1A 2F5BH 4ZUUA 4XMKH 1G7IB 3SDAA 2NNAA 2ATPA 3O4LB 2FIKB 2JIXD 1TCMA 1F00I 3C5ZA 5EC1B 5F7FA 1NEZB 5EU6D 5IB4A 2KL6A 4X0KA 1MRFL 43C9A 1KXQE 1MCIA 2VXTL 2W65B 4R4FH 4XCFL 3CVHL 4PRPE 5TGBB 4M43H 1P84K 4XNZB 4HHAA 3GMNB 4BZ1H 1JVKA 2AKRB 4I0PB 3MROA 4F58L 4JVWA 4LHQB 2R0KH 2D4FA 1CT8B 5B8CA 2P5ED 4DN4H 4JFHE 2QQNH 3S3PA 4JPIA 4ELME 1H3GA 5EU3A 2DQFA 4GW1A 2GSIB 4JY5H 1DL7H 4QO1A 4BYHA 2PO6D 5LCVL 1QR1A 2J8UF 3QRGL 2MKLC 1RZGB 4ODTH 1HINH 3OXRB 4PJXA 2V2XA 3CFIC 1CFNB 4QRTA 2DQJH 3CFDA 5HHXL 5ADPL 1ZVSA 1FLRL 3QUXD 4XP1L 5GS0H 3TF7C 5FM5O 2EDRA 2W9LA 4FABH 2VLRD 4LARH 4YK4B 1EPFA 4O9HH 3RKDC 3WXVH 1OB1B 3B4NA 4ERSH 1CK0L 4OZFG 2Y07L 1G9NH 3INUH 1YEJH 1BQLL 5JXED 3WN5B 4EIGB 5JNYB 3GZKA 3V52H 3RUGF 1MSPA 4EUPB 2X4QB 4G8EB 2B5IC 4DKAA 2E27H 3VRJB 1BWMA 2DKMA 3QYCA 1NAMB 5CEYA 1WZKA 2IALA 3MBEC 4Z0XB 3VXME 2CKBL 2IFFL 4HH9A 1RVFL 3IXTA 5DD3L 1XGUB 4NKDA 4XAKD 2ADGB 1RIVL 4PIRF 4XVUD 2B2XL 1IZKA 4G9FB 4MD5A 3QUKB 1DLFH 1YUHA 3PWJB 2EDJA 2W60B 3FRUA 4UIMA 1MCWM 1K2DB 3NTCH 1ZA6A 5GRJL 3MRGB 5IVZA 2V9QA 2RGSA 5E6IB 5JW4M 2BVUA 1RUQH 5CBEA 1S3KL 4XZUA 5GXBB 1CDJA 2AEPL 1LK2A 2IWGA 1U8NB 4AEIL 5CKGA 3TO2B 5C09B 4ZTOH 5I1IH 2IQAA 6FABH 1A3RH 1QPXA 3WE6B 2BVYA 4NRXB 3I6LD 3PDOA 4HWBH 1FBIH 3V8CA 4WEMB 1T21B 1RQ5A 5DMGC 5GIRB 4B53A 1EEUA 1ZANH 1FNFA 4L3EB 4RMSA 1N7ML 1YNKH 5DYOA 2LTQB 1JNJA 1DVFC 3RIFK 3L3JB 3ARUA 4TOYH 4C56A 4HIEB 1UGNA 4PGCA 2BSED 4P5KA 1FVEA 3GMQA 1K8DB 1Q9LB 2VXUH 5CP3H 3RWGB 1C5BL 1A6AA 5IMOA 2XFXB 1F6AB 1UWXH 1E6OH 5AZEL 5EIIB 3HC0B 1MFBH 1WGOA 1JGDB 4JVPA 2IPKA 3OWEA 3F8UB 1ZGLM 5JTWA 2FJFB 5EOTA 1S78D 4OIIL 4FZ8L 1BM3H 1FH5L 3C8DA 3O41B 4OGAD 4XNMB 3I9GH 1PBYA 5C0DA 4NOBA 3W2DH 4HPYL 3WEXA 3NCJL 4I18B 4P2RD 1T4KA 1CD9B 1QFWI 1AGBA 3KPQB 4FFZH 4MJIA 2R56H 1IAII 1UWGH 1LWRA 1NUNB 1YYMH 1CU4H 4MNGA 1OGAE 1CE1H 1QRND 2BJMH 3VGFA 3D0LB 4Q58C 2XV6B 4PR5B 5I75B 2Z31B 4A2LA 1TVDA 4QTHA 3ARDD 1IFHL 3CCHB 4LKCA 1OLZA 4LOUC 2BX5A 3IFLH 4HX1B 1G7MB 5F89B 4Y1AD 1G9ML 5DQ9B 1MCFA 3SDDD 5LBSL 5DJYA 3SBWA 1QTYT 4XPTH 1LP9E 3UBXB 2IGFL 4KRPD 5CBAB 5D5MF 3OKMB 5CIPA 5IVXB 3KHOA 3SE3A 5HYSB 1TLKA 2IPTH 1XGRA 4M48H 3HUJB 4TUJA 4PBVC 1JGEA 5GSVB 1LO3L 3UTQB 5EUKB 3UJTL 3MJ7B 3GMOA 3P30L 4OZGB 2F19L 3LN5A 1G7HA 4JM2D 5SX4H 4OZFA 2YSSB 4F80A 4LNVA 2GT9A 4JJ5B 4JKWA 2IH1B 2CRIA 1VFAB 3VD5A 4WY7L 2VITA 3WFBH 5GRXG 3NCMA 1VADB 5JDSB 2UWEB 3FFCA 4ELKA 4DZBB 3RVUD 3G5ZA 4GW5B 5D9SB 3WO4C 5KAQG 2SEBB 3GSXB 5C1MB 1IVLA 5DJ8B 5D7SL 3E1F1 3HFML 4YXLH 3S97C 4L3CA 3TVMA 3REVB 2X4TB 4UT9L 1MI5B 2HTKD 3UYRL 2PXYD 5AG9A 5C70A 4OLWL 3PHOA 3TEUA 2LABA 4OV6F 4JG0H 4OM1H 1F8TL 1HKLH 3CZJA 5I30L 5TE6H 2QADC 1PAMA 3UDWC 3MNWB 1G0XA 1FVCA 1RZFL 2YA2A 2C3GA 2B1AH 4PJGF 1OPGL 3B6SB 3O2VL 4HD9A 5GGVY 1I8KB 1ZGLB 3VFGL 1F2QA 5T1MA 1AP2A 1I1FB 1X4XA 4M00A 4JDVB 3VXSE 1WK0A 3CSPA 4I0PC 1KIQA 1PQZB 2BNUB 4OF8A 1A14L 1IGFL 4M4RA 3TH4T 1MF2L 4TVPH 4RFOH 2VDOH 3MRMB 2AJXH 4Y19B 3T0DA 1FGNH 4Z7VF 3HE6A 1UCTA 2AGJL 3ECBB 2MWCA 2X4NB 3O4LD 5IB5B 1BF8A 1UB6A 3SKNB 1RUPH 1QBML 2DKSA 2ICEA 3B83A 2VDLL 3QHFL 1GRWA 5ESVB 3K1DA 3NFPA 1OL0A 4Z7NE 2DQEH 4Y4HB 3UYOD 3WIFA 3V7AE 4NNYB 4HUXA 3TZVA 2X4SA 1KGCD 3PNWB 4NRZA 4YK4C 3UROR 2I9TA 4H5SA 5E6ZA 4OIAA 2ZZUT 4LLYB 1YDPB 4BSWB 4AZ8A 1EBPA 3NIFE 4AK1A 4ZDHB 2J8OA 5D7KE 3NACL 3C87A 2A6DB 1LO5A 7CGTA 2ZWLT 4WV1B 4G7YH 5ENWA 2OL3L 5DJCB 1DDHB 5T1KD 5BMFL 1MCDA 4RZCB 1BHGA 1J8HD 3ABZA 4HF5H 4OF6A 5T3XE 4RAUB 3PV7A 1F4WH 3V6OA 3OHXA 1QHPA 4OUOA 3IGAB 3NAAL 2VZ3A 1T83C 1LO0L 4IRSA 3WNLA 1ZS8B 2J12B 1HQ4B 3DXAB 4BQ6A 5IM7A 4QRRE 2ZSWB 1ETZA 4L9LA 2FYYB 3T0AA 3LKOA 3MACL 5CEZE 1HYRC 3W9DA 4E41E 5DJ6B 5IW3A 2J8HA 4G7VH 4N5UA 4LLMB 1NUDA 4JRYD 1P2CB 3RL1B 3EDDA 3X11B 2VDNL 2CD0A 2X09A 5E9DB 4ETQB 3MRCB 4X6DB 5FECB 3VFWA 3KPOA 3IDNB 3CDFA 5D7LB 1A6ZA 1U3ZA 3MRJB 1Z5LB 1YN6A 4NKMB 3MV9B 5H94B 4FTVE 5HY9B 4X7TB 1B0GA 3VGDA 1MCOL 1UKQA 4LBEA 3RGHA 3SE4C 4HG4K 3HTLX 3VD7A 3QDMA 3VFPB 2DDQH 5I8OH 4OI7A 1H9VA 2ZG2A 3BDYH 4K3HA 1J0HA 4H1LB 3ZT7A 4WUUE 1I8IA 1I1YA 5SV4A 2Z35A 4LRNL 1JFQL 2QKIB 2HFEB 5D1XD 1AGEA 2HKFL 3UMTA 3GJEB 1BJMA 4GG6E 1A7OL 3OB0K 1ZHBB 1AHWB 4D0CA 4JM4L 1EEZA 1FG2B 1J1PH 4IS6A 5HYFA 1TVBB 4OUUA 2DI8A 4PG9A 3QUZB 2GJZA 3EO9H 5C09D 1V05A 5HI5D 5L2KA 2IAND 5LWYH 1D5IH 4UUJA 4WFEE 2Q3ZA 2W9DL 4ZFFB 1N6QH 5E2TH 4XX1E 2XZQH 5D6CB 1CZ8H 3BHBA 5BRZB 4ORGB 4TRPH 1P7HL 4RMVA 3TP4A 4YX2L 4OT1H 5TE4L 5CWSB 5HGHB 1N0XH 1ZVYA 4L3ED 4P2CG 2VQ1A 3DSFL 4XNYH 1MCSA 1A6TA 2DLGA 4F33B 3RBGA 5LGHL 4DKEH 5EZLA 1KCSL 1RUMH 1NJ9B 1EGJL 1MEXH 3WIHH 1E28A 4J4PA 1QFWH 4HLZG 3D6GA 4U1HA 1JNHB 5MEOB 1I3GH 1YNTB 4UB0H 2IG2H 2Q6WA 5I75C 2Z31C 2ICWJ 2QHRL 2ITCB 4QCIB 3IFOA 1JPFA 1MJ8L 4PRPD 1F3DH 1UXSB 2CRZA 4PJCB 1KTRL 5KVDL 5C0AA 4NOFA 3O6MH 4ZSOA 4ONHA 5D2NA 5E2VH 4CVWA 3DYPA 1ZLVK 1YY8A 1YPZF 4JKLA 3WNNA 3HZKA 3R8BB 4O5LH 5DQJA 4M61B 3MBXL 3B9AA 3HNTL 4JFHD 4O2CA 4V1DB 3OR6B 3ZYJA 4DJMA 2QQLL 1PY4A 3FONA 2EDLA 3ARFA 4M7LL 2P47B 3V6BR 2BNQA 3QIWB 4HBCL 3DX7B 5IG7A 4MX7A 3BRDA 1KLGA 4KFZC 3MRPB 3BJ91 3DUSB 3MNZA 3NGBB 3GMMA 5C6WH 3RWDA 2ZP0T 1I3UA 3JV6A 4KJYB 3BP6B 2FX9H 5CEZL 4JM2F 4ZUSA 1ZSDA 4JO2H 3PWPB 2Y23A 2ADJA 4TQEL 4UMGA 4JEGB 2EE6A 3KWWA 5HHVL 3GM0A 1SBSL 3PIQA 3RNKB 4EVNA 2YD6A 4NM4H 3D25B 1U2HA 3EYSL 4ALAL 1AI1L 1MCKA 4YO0B 4BZ2L 3NCYP 2FEDC 5FM4A 1G0YR 5IQ9A 3RGVB 1N2RB 4OCXH 4PP1D 4ZAKD 5F44A 4OBSA 5BOZG 5DJZB 4M7KL 5I1AB 2XTJE 5C6TH 2LU7A 4ODUB 1D5XB 1F42A 1K4CB 1JCKA 1T7XA 2A6IB 4ONGL 5KZCB 3F62A 4F37F 2ITDB 4Y16A 2MQ3A 2EEDA 4PLKD 5BS0E 2ADFL 5BJTB 3IU4H 3NCCB 3MLRH 2QSTA 3S6CA 3U9UB 2UYLA 1S5IH 3VJ6A 5I76A 3D85D 4OCLC 3P0VH 1ONQB 4JRWA 3MR9B 1T22B 1NMBL 5FM8A 3RVXC 3W0WA 5EU4A 1HH9A 2ORBH 5E99L 4PJ8B 1EEYA 3IT8D 4HK0A 3S34H 3BPCB 1WFTA 2V9RA 3CLFL 1IEBB 1KN2H 2R29H 1K3IA 4K3JL 4IMLB 1UH4A 1YYLL 3T0EB 1RK1A 2PTTA 3GMLB 2UUDK 4PV9A 4XAWL 1O7VA 2WBJC 4ZFOA 4JFFB 3PV6A 4IHOA 3Q0HA 1M1SA 1AGCA 2VH5H 3BEVB 3JV0A 4JHBA 3OAYH 3LRHA 2JKXA 1YMMA 1WCQA 3QI9A 3L95B 4DZ8B 5DD5H 5MERB 1H8NA 2BNRE 3W39A 4MAUL 4R26L 3DVGB 1WWAX 3GRWL 3PQYE 4XNUL 5T5NF 5ACZB 1CTNA 1A8JH 1MVUB 4Z7QF 4QLRA 3QQ4B 3AUVA 3WLWC 2P24B 4QKXB 1UKTA 4MCZB 4QHLB 5J57B 4JFEE 1FE8L 5CGYC 1QBAA 3AMKA 1ZKAA 4ENED 5KSUA 5ID1A 1KG0B 5FXCH 5C0CE 2QL1A 4WV1C 5I9QB 4PG2C 2CXKA 5HGBB 5E1HB 3WHXB 4YEFA 2FGWL 3PWNA 1HCVA 4U1LA 12E8H 3BT2L 2QSCH 1A2YB 1NBVL 2JELL 3JUYA 4RAHA 1T5XB 3K0WA 5HYJE 3BW9A 3IDUA 2FO4B 2R8SH 4Y4HD 1E27A 2VIRB 3NMEA 3VFTA 4MAYB 2OYPA 4Z7UA 1KJVB 4M1GL 4XPFH 1VACA 5ITFB 2Z91A 3BIKB 4YBHA 1T7WA 2DLIA 1B88A 2YBRB 4G8GB 4U3HA 1OAUL 4X5LA 5HDBE 1T1YA 1FL5B 4Q6IB 4KTEL 4U1SB 3M17A