1NLBH

Crystal structure of anti-hcv monoclonal antibody 19d9d6
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
218
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTDFSMHWVNQAPGKGLNWMGWVNTETGEPTYADDFKGRFAFSLETSASTAYLQINSLKNEDTATYFCARFLLRQYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hydrophobic immunodominant antigenic site on hepatitis C virus core protein complexed to monoclonal antibody 19D9D6.
pubmed rcsb
molecule tags Immune system
molecule keywords antibody 19D9D6 light chain
total genus 42
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2003-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nlbH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nlbH02
1G6RA 5L8JB 5DF0A 4HUNB 4JZOB 5E95B 2OK0L 4GRWE 4K94C 1JV5A 4NM8L 3WHE0 1FL6A 4C58B 3REWB 5CEYB 4NKIH 3DVFA 2YD9A 3CFDB 4ZSOE 2H26A 4QRQA 3U0TB 3S36H 2F53A 4L4VB 3BFOA 1QBLL 3OR6A 3S96B 1Q9WB 2JCCB 2R2EB 2O5XH 3VXMD 3G6AB 1WZMA 1ZVSB 5GSRA 1BPVA 1DQML 4TTDD 5GGRA 3GKZA 1DQMH 4JKMA 1YC8A 1MIML 2Z9TA 1AD9A 4HMCA 3OB0H 4OGAC 4G80A 5KSAA 4Z5RB 2I27N 4NKMA 1HEZA 1WC7A 3HLAA 1BZQK 1A02N 1D6EB 3LCYA 4LQFL 1UACH 1DQDL 2NTSP 4LDLB 1CR9L 4PYGA 1TZGL 3MRQA 3BWAB 3PDOB 5IB4B 5FA4A 1K8DA 3SDYL 4KJWC 3KPLA 4FRWA 1YECL 3MCKA 5HDQH 2APFA 1KPRA 1A7QH 2WMPA 1KEML 4XVJH 5CP3A 5D1XC 4PUBL 2RFXA 3TBVA 1U2HA 4PRIA 4OM1H 4BQ8A 2EIEA 3V6OE 1T4KA 4S1DC 1TPXB 4L8DB 5KS9F 5CSZB 1QEWB 3OAZH 5FYJU 3LKPB 4KDTC 4KTDH 2DTSA 1EGJH 1KTLA 4JFYA 1ZLSL 4PGDA 4QHNA 5HYJA 3SDDD 3WUWG 3U79A 1Q9LB 3H7LA 1TNMA 5JXAL 3MLYL 1XF1A 4XWOD 5ID1A 1RZKC 1A6UH 1IEAB 4FFVD 2E7LA 1WBZA 5EWIL 3CNKA 3RTQB 3HI5L 5I1CL 4XRCA 2EE9A 4KJQD 5DI8A 2QTEA 3O2WL 1QNZH 4HCRH 4XVTL 4GW4B 4NZRL 2FX9H 4BQBA 4PFEA 3U0WH 4FNLH 3UTZA 4EDXB 5MENA 4PRPE 4PJDE 1GGYA 1BLNA 3HPJB 2ARJQ 4DEPC 4KY1L 4JFEB 5J3HC 3HAEA 2F54E 2NTFA 1N5YL 3DJ9A 4U2YA 2VWEC 2ZKHL 4PRHB 5D9SA 1FAKT 1WBYA 2C3WA 4B41A 1IVLA 1T1XA 4EQ3A 1FDLH 2VJXA 5EBGA 1YYML 2ZUYA 4FXGB 2PXYB 1ONQB 3V6ZB 4BQ6A 2RIKA 1UB6A 2ERJB 3GMOA 4NGHH 3VH8A 1RZFL 1MHHA 3UTTA 1X3DA 4AJ0A 2VL5B 4UV7H 1JZ2A 4HS3B 4IIQA 1KG0B 5EFIA 4HWBL 5I1LB 4TUKL 4O00A 2DQCH 5FAAA 4AYFA 3P4NA 1QVOB 3Q5YA 1YNKH 4NNXB 1LK3H 1UM5H 1BX2A 1Q72L 3DXAB 3CDFA 4ENED 4I48A 3I85A 5F1OB 2XQYG 2OJEA 3QCVH 3BH8A 1T5WA 4GAYB 3RJQB 5E08L 3MLXH 1ZLUK 5EC1B 3WFCH 3IDYB 3WFCL 4YXKL 3DSNA 4GRWH 2EC8A 3Q6FA 5J4MA 5ADPL 4O2EB 3L7EA 2VDRL 1S9WA 4RWYL 4Z6AT 5IKCA 3LRSB 1IM9B 3VW3L 4ZUWB 4F37K 3L95A 5B39G 3TBSA 1BFTA 1U8NB 3HE6C 43CAB 2CIIA 5IT2H 4GKSB 4OT1L 4MNGE 4YZFE 1AP2A 2DM4A 2E9JA 4XTRC 2XRAL 3MA9L 3BDYH 2F5BL 1PD6A 43C9B 4U3HA 3MRPA 2MCG1 1CFQB 4M1GL 2XIDA 1LEIB 3BEWB 2WWKO 4KTYA 1CS6A 1L4IA 5T1KD 2R15A 2HRLA 3GMQB 5I17A 4GW5B 1T5WB 5D1ZC 5IQ7H 5JW4M 4X5XB 3L9RB 4YK4B 3P0YH 2J3SA 3QIWD 1NFDF 4OJFL 4YHML 3KPRA 3BE1L 4RA0C 3HC3H 5L9DL 2NY2D 3QH3B 3T4AA 1XF3A 4MYWB 1TVBB 1PYWA 3HZKB 1I8KA 5FA3A 4YPGB 1NGYB 1SY6H 2GHWB 1B0RB 3QQ9D 5ITBL 1QTYT 1VA9A 5GIRA 5FGSA 4JFEE 1NFKA 3D9AH 1MJ8H 4HKJB 5CINL 3W11C 3N85L 1VFAA 1NANI 1CE6A 4L9DA 5F7FA 3TV3L 3BIBX 1XH3B 3CFEB 4FQXB 5DRZB 1U3HB 3X13A 3HRZB 3QUXD 4LSTL 4DKFL 2DQDL 2NY6D 1Z0MA 3U1SH 4CN1A 4IDJH 3CFCH 1W0VA 2XFXB 4H25B 1F3JB 1NBYB 4W70A 2Q3AA 3SE4A 5DVLA 1OGAD 3K8LA 3O8XD 1ODAA 5IUSA 5TPWL 1AXIB 2DQUH 1FFQA 4BSVB 3B2VH 2XTJC 2P5WB 3P11L 1YJDL 2VSDA 3QIBD 5HHOB 4JKPH 4HD9A 4NQXA 3QUYD 4XPFH 4I13B 2A9NL 5CP3H 3H9SD 4CJ1A 3GSNL 3BI9X 4ZPTA 2EDYA 3BN9D 3EO9H 1IQWH 1IGFH 4L1HA 4XBPA 3KR3H 3VWKC 4X80H 3KPRE 3SKNB 5C9JA 4U1MB 4NJ9H 4GKNB 2MTPA 3KXFB 3RWFA 5IVNA 3OSKA 2GCYB 4U1KB 3RWEA 5IBTL 4NN7B 5DJAB 1U91B 3KJ4B 4HK0A 3TNNB 4JHZA 5EOTB 4K71C 1VFBB 4FQCH 1OT1A 4F9PC 3VDBA 1QLRB 5GRUL 1FNLA 1H8SA 2VDLH 4PJ8B 4LF3A 4Y5YB 1R3KB 3C6SB 1FRGH 4LSSL 3BKMH 4DUWA 4EOWL 4BFIB 5FOJA 2J8HA 4YO0B 4QXTA 3CVIL 3MFFB 3FRPA 1YMMD 4PGEA 3U2SA 1H0DB 5TE7L 4NFCA 5ADOL 2OMNA 5CJ5A 2VLRB 3FONB 3CSGA 3TH4T 3EJZD 1YQ2A 3X14A 5DJ2B 3I3EA 4YHPB 5EU4A 3H9YA 4Q6IC 1MCFA 2QQQA 3ARQA 3P0VL 5INCA 2VXTH 3OJMB 1AHWB 4ISVB 2NY7L 3OJDB 2Y23A 5JHDA 2CMRH 1G9MC 5EO1A 1LK2A 3CLFL 2Q76B 4XPHL 3IB4A 3TBTA 4DCQA 1K4CB 1Q9KB 4GQ9L 3MV9E 1X6LA 2VLME 2YC1B 4UT7L 1HSAB 1JI2A 4R3SB 3RVWC 3MLPA 2HJFB 1K2DA 5CJOH 5JO5B 2CO6B 3WUWA 4P23B 5I1DA 4YWGH 4DGYL 5HI5C 4XH2B 5GJTL 3RTQC 2BVEA 3UBXI 3OKKB 1P7KB 3CFCL 4ALAL 4WNQA 1G7JA 2KQMA 4FN0A 2X1XR 5E24E 4IDLA 4L8SC 1SYSB 1X5XA 3UC0H 3DIFB 1RZJC 1KJVA 3O45A 1TTGA 2VRAA 5J6GA 5CEXB 5LBSL 3BSZL 5IB4A 4H20L 4MQ7A 1I9JL 5AZ2H 5FUOH 3TA3B 4F7CB 4PJ7F 3TO4B 2V5TA 5DUMH 4YUEL 4IOFC 3RVTD 3UCRA 4HUWA 2YRPA 3W5MA 4P2QA 4WO4B 1E6JH 5KJRH 1FCGA 1OB1A 3FB5A 2CRMA 1XF4A 3RUGF 1TLKA 1SEQL 3WEXB 3IVKB 5L2KD 4MDJA 1SYVA 2O5YL 5D6CA 3TCXA 3IT8D 4U6HB 1LO3L 5JUEH 5DJYB 5EIIB 1ZEAL 1OM3L 2NXZD 3BE1H 4NCC2 1II4E 3WFDL 3MJ9H 4QXGH 1ZT4B 2MWCA 3BPNB 1OSZA 3C5ZD 2X70B 1KJVB 3BRDA 2UYLA 2AKRA 4I0KA 3BP6A 5ENWA 4KDWA 2ED7A 2IPUK 1NMCB 4YAQB 4X6CB 3WS6A 3NPZB 1O0VA 4JGJA 4LLDA 4UUJA 1E4XH 1NCNA 3QYCA 1NGPH 2VZTA 4BELD 1QACA 1MY7A 3VXSD 2XOTA 4H88H 1OWRM 1NMBH 3GIZH 4R7DB 4ZD3L 1RQ5A 1QO3A 4JHWH 4KZDL 1NEZB 3WS3A 5L6YH 1EAPA 4NRZA 2FLRT 3RZCB 3CSBA 5BMFH 1VDGA 1LO0H 4J4PD 4JO3H 1P2CB 1AO7D 3TA3C 1KEGH 4KZDH 4KUCD 5J06A 3BPNC 4QOKB 3ARGD 4YHLL 3BESR 3K8MA 4TTGA 2X4RB 5EZJA 3PGCA 2Z31A 5EBMA 4Y5XC 4R7NB 4W6YB 1F3RB 5C07D 3FQNA 4MD4B 2P8PA 2GAZB 4LCCA 3JWDL 4XGZA 4ZQKA 3W5NA 4MA7L 1MQKH 3NMEA 4XCEA 1NLBL 3HCVB 5JQ6L 2UY6A 1QRKA 1EFXD 1W72A 1G1CA 4XPFL 2DDQH 3IKCA 2VWEE 3U2SB 2G75A 1U8OB 4PJHA 5ISZA 2X1OA 3DV6A 4QY8B 2AJUL 1ETZA 4JFQB 2AQ3A 4LOUC 4ETYA 1LP9E 4F7MA 3MODL 4LPCA 2VISA 1S7TB 3EOAA 3GB7A 5FYKU 3T65B 3W0WE 2YSSB 5C0CA 4ODSL 4XAWL 5CD3B 3VGHA 4P5TA 3QFJD 3L3HB 2MQCA 3BP5B 4EDXA 4H1LH 1E28A 1JJUA 3E2HC 1AGCB 2GYSA 4M7KL 1V3MA 3G5ZB 4ODVL 3MRQB 2EDLA 3FTGA 4PREB 5KVFL 5GZOC 3FO0H 4UT6L 2Y1VA 1WC7B 3B2UD 3V52L 1NLBH 3KXFA 4LHUG 3RWFB 3VXPA 1SHMA 1BX2B 5E4EB 3KVQA 3GUTA 3EJYD 3MNZB 2IAMA 5T1LA 1FZOA 4I18A 4JZNB 4M61B 4KRMB 1BD2B 5DEFA 3RDTD 4DVRH 1VSCA 4MA3B 4WI3A 4XPGL 1VHPA 1OQXA 4Y5YC 3PWPD 1ZLWH 1I3RB 1T83A 1KTLB 4OGXH 5DUBA 1UM6H 2D9QB 1LO2L 4X9BA 2E8YA 4E5XA 2HRPH 4NQVB 4L8DA 3S4SA 3GSRA 4XP4H 5FYJH 4PGEB 3P0GB 1VCAA 2XTJE 4P2OD 4U31A 1DUYB 1N26A 4FZ8H 3ECBA 3VFUB 1TITA 5MEPB 1VEOA 4HS8H 5EO0B 1M7XA 5IIEA 2UUDK 4K8RL 3OF6D 3S7GA 4CN6A 5F7EL 4Y1AE 1EUUA 4K7PL 4ZUWA 2VZ1A 1C5DA 4JM4H 4FNLL 1U8IA 4FA8A 4LPWA 3MJ9L 5C0CE 3RBGA 2VQ1B 4DZ8B 1T1YB 2P42B 4R4FL 3RWIB 4N90E 4XBEL 2VDOH 3G5VA 1E4XI 4IRZH 2QQNH 2XZZA 4PJCB 3V4PH 5MHSD 4HV8A 4OUOA 1QSVA 4UDTA 3P4NB 3SGKC 1HWGB 2C1OA 4XP9L 5MHSE 4N0UE 3AB0C 4K3GA 2UZIL 4X7CC 4FQJL 2FWOB 4UTAH 2NLJB 1I4FB 5I1GH 4EBQH 4DTGL 3VFPB 4TUKH 4X6FB 3V8OA 3WFHA 2NW3A 4HHAB 3GSWB 4N1EA 2X4OB 3CU1A 4APQD 3TIEB 4G7YH 3SKMB 3TBVB 4PJDA 1ZHNB 3LB6D 3QG7L 4DKEH 4WW2A 4NQCE 5FHAH 1PY9A 3PF2A 2A6IA 4KGJA 5DHVA 4R26L 4Y0GA 4PJ7A 3DYMA 2LVCA 1TVHA 5C0DA 1I1AB 1C12B 4MNGB 4NM4L 3VXQA 1OAZL 2GCYA 4ZMAT 1YJDH 3DYOA 5KS9A 5B38B 4JO1H 2OQJA 3QULB 3S3SA 3ARGB 3C08H 1I8IA 4Z7UF 1U0QA 5SX4I 1QR4A 3T8XA 5CGYD 3WNKA 3BEVA 4DAGH 5EC1A 4PD4J 5L88L 4M43L 4IHOB 2A74B 1I4FA 4OFPA 2I07B 3ARBA 2AEPH 1RVFH 2VQUA 2ZOLA 4X9HA 4NNYA 4QXUH 2J6EH 5KVEL 1FQ9C 2GY5A 3P9LA 4OZHE 2DQIH 4KKAD 4M5ZH 2Q7YB 2JIXB 4UT9H 2ZUSA 5F9OL 3JTTA 4OZGF 3MREA 4ODTH 4G6KL 1ZGLM 3QPXL 3CH1A 1K8IA 4WO4D 1QZ1A 3C9NB 5AYUH 4FZEL 2VTFA 3FN9A 1UM4L 4OTXH 3TA3A 4NWUL 2MHAA 2H26B 1TQBC 4HS6A 4KDTA 3VFTB 4OZGB 4ZTOH 2ZG2A 4DJMA 5KS9B 3EO9L 4NKDB 1VFAB 1I8IB 3INUL 5D70H 4M7ZB 3IFOB 1UYWL 3VRLF 2DQGH 2H2PD 1WAAA 3BD3A 3IDXL 2WINA 4J3SA 1OAXH 1CXLA 4Y1AB 5DXWA 4NZTH 4WI4A 4RCAA 5C07A 1EHXA 4DGIH 1NC2B 1ZS8B 3T0BA 4NC1C 4TPRH 1J8HA 1WWCA 3TN0A 1WWBX 3QZWB 2E7MA 3G08A 1EBPA 3VCLA 5DS8A 5ALBL 4XHJD 5KZCD 2ADIA 5FHBL 4E5XB 3QO0B 5DFTA 3IGAA 4MWFA 4UIKH 4XX1E 2MPAL 3H6JA 1RJCA 3GMRA 3HUJB 1S7WA 3PIQB 3ZDXE 3PHQA 3GK8H 2PKDA 1AJ7H 3MUJA 2DTMH 2HH0H 3KPNA 3STZA 1CFVL 4J3WA 2VZVA 3EIFA 4K7PY 1I7TB 1EVTC 5F9WC 1CICA 4OFDA 1A14L 4Y8DC 1KOAA 1A47A 2BZDA 3I6KA 3D2UD 4ONHA 4Z7WE 5D6DC 3MXWH 2R1WB 1LO5B 4P23D 3TLRA 2NMSA 5C1MB 2PNDA 2ZCHL 3QUML 4W6WB 3RP1A 5AG9A 2H3NB 2XN9E 3IJSB 4G42B 2W9EH 5KVFH 4PJ8A 3GHBL 5GSVA 4DOHB 5DC9B 4IRJC 3IAGC 1GCFA 4RQQB 3VGFA 1PGRB 3R8QA 4HEPG 5ABDE 5FO9A 4HLZH 4EI5A 5D2LE 3WNMA 4LCYA 1AGDA 5E8NA 4QY8A 1WIPA 3PE9A 5T1KB 5C07E 2D9CA 2XZQH 1NANH 3ARTA 1I1YB 4XXCA 5DJCA 2R69L 4GMSH 1V7MH 2IANB 3NN8B 3ARBC 1GYAA 3QG6B 4MQSB 4P49A 3ELAT 4FFVC 3GSUB 4TOYH 4KRPC 4TOYL 1H3WM 4PJGA 4Q2ZB 4WVRA 2J1KA 5I74B 2BVYA 4OCWL 3WXVH 4UIMB 4CBPA 5DTFB 1S9VB 4HC1L 4RFOH 1QQDB 3QIBB 5HHOD 4HIXL 3T1WA 4NSKB 4ZFGH 2ED9A 2OS7A 2AXJA 4Z7UB 3LEVL 4OKVA 3BEVB 3O2WH 1JRHH 3QCVL 2YRLA 3RX5A 5ESQB 3WFBL 1HILA 1JWUA 1YUHA 1V5JA 3UTQB 5HVWA 2AXFB 1NBQA 4FQXD 1GC1C 2BVQB 4NC2B 4LEXH 4XWGH 5F70A 5D7LB 4X5WA 5DT1H 5M7QA 1MJJB 1ZLSH 1QP1A 5EO1B 4H1LG 2W60B 4RGNC 3Q6FB 4F7MB 4HC1H 4RFOL 4JLRA 2UWEF 5E9DD 1W72H 5C08D 3HNVH 3WN5B 3MCLH 5E6ZA 3ZTNL 4JDTH 2CQVA 5TFSL 5C08A 4KMTL 25C8H 5AG8A 4NZTL 4TYUA 3CFBB 3I6LE 4GKZA 2IALA 3TFKD 1U3HD 1TJGH 3MFGB 1CZ8H 3SOBH 3RWGA 3AAZA 3RGHA 4CU8A 4N8VB 3LKPA 3SDYH 3BZ4B 3TA3D 1RUPL 1BZ7B 1LE5B 4YE4L 1A6VL 4XMKL 1O5DT 1A7OL 3BEWA 3O3DA 3GHEH 3RTQD 1N5YH 3DIFA 2XI9A 4Y4FC 3ARXA 1A7BA 3GBLA 3D0LB 3WJLA 5EOTA 3GIVB 3IDMA 5HGHB 1YZZA 5K59F 5L2KA 4NQCB 4PV9B 4K8RD 1UCBL 4A6YA 3SDCA 1BFOA 2PN5A 4QF1B 4ZD3H 3EZJB 1ZGLA 2X4SA 5SV4A 2X70A 4LOUD 2X10A 5T5FH 4FQQB 1NDGA 4MB3A 1PEZA 4JFDA 2X44D 4L1DA 4FMFA 3WL9B 2RJMA 5E5UB 4N9GB 5EG6C 3H3BC 4P2QE 4PRDA 4MGXA 4FXKB 5B39A 4WW2C 4XI5C 5E9DE 3QIWA 4LDOB 1F4YL 4N8VA 4V1DD 3FHQA 5L0QC 3BH9B 1I3RA 5GS0L 1MWAB 4L3CA 1DZBA 3LV3A 3D18A 1QSFA 4NT6A 3FQUA 4TNVF 1T66C 3OBAA 1FGVH 3HCVA 4NHCH 4OF7A 3SQBA 3O4LB 2Y7QA 2MKLC 1FO0A 2GY7B 2NZIA 3P3YA 1IGIH 5EZOL 3VXUA 4DKEL 1JMXA 4HCRA 3UTTB 5DQJB 1U3HC 2FJHA 7FABL 4NIKB 2FIKB 5F71A 2FRGP 4I4WB 3D85D 4Y4HD 1RU9H 5B4MD 4UILL 4EIGB 1MSPA 2VAAB 4R4BA 5CZXC 5D7SL 1KFAH 3WL9A 1XGQB 5HDQL 1LHZA 3BUYA 2CR6A 5ID0A 1TQBB 3MRKA 4J2XA 3Q3GA 1YQVL 3FQXB 2YK1H 4M02A 4WHDA 2APTA 3O2DL 5EC2B 3ZKQD 1EUTA 4BM7A 4ETQA 5KSBA 2EDRA 4DW2L 1FSKB 2Y6SD 2ID5A 2BOCB 3LKSB 2FJFA 4PGCA 3FB8A 1UM4H 1F00I 2X41A 1UA6L 1FGNL 5KSUA 3I6KB 1NFDB 3BIKA 1RUMH 3L5JA 1E4KC 3BW9B 2HFGL 3LKNB 1NUGA 2EO9A 3V7AE 2CLZA 4MJ6B 4XMKH 4OCLC 4HH8A 3FB6B 2APVA 3U7WL 1RMFH 3QHFH 1A7PL 3ARVA 2VL4A 5CD5C 3QRGL 4KK8C 5EU5B 4JG0H 4MDJB 1RK0B 1N6UA 4MJIE 2BY1A 4HKZB 2C1OB 4BH7A 4HIXH 3R06A 4X6DA 1I7RA 2YPLD 4UQ3B 5D4QA 2VR5A 3DUHA 1QBBA 3VFRB 4K3JL 3CDCA 1G9MH 1WVZA 2V7NB 3QUZB 3FMGL 9CGTA 3KXFD 4PBXA 5J13C 4Q74A 2NY3C 3P0YL 4JM2D 5ACZB 1UJ3A 5H8DA 4KKBC 3OKMB 3VXUE 2ADFL 3KPNB 4HJGB 2VZSA 3OTTA 1PX3A 5J12C 1UWGH 1MVUA 1NGWA 3VXTA 1D5MA 2N7BA 2GKIA 3GNMH 4YAQA 5F7KC 3HG1E 2Q87A 1HXMA 3T1FA 2D0HA 5HI5D 1SVZA 1A3LH 1KV3A 5E8PA 4KXZH 3VD4A 5T3XD 3WDJA 3MRCB 5MERB 3IDIB 1K3ZA 3ISWA 1YEFH 5E2VL 3MRFA 1HEZB 1K2DB 2P1YA 5FYJD 5JO5A 3NPSB 2R8SH 1M7IB 3NCJL 4OUUB 4NQVA 4BZ2L 5FK9B 2EDEA 1EZVX 1RAMA 1IGCH 2E9BA 4I5BB 3WIHH 4X6BA 3LEVH 2R23A 3E3QE 4GLRH 2YMXH 5GRYA 3RDTA 2NXYC 3ARDB 2VLJE 1BQHA 1DVFD 1DEDA 2ZOLB 3BJ91 4HIIA 4QRUB 5EUKA 3QRFM 3RX8A 2F5AH 5D71L 1A5FL 3BKYH 1U8IB 2XPGA 4KJYB 3RZCA 5C0EA 2RGSA 3G5YB 1FYTD 1CFVH 4GT7A 1K8IB 1X5JA 4LSQH 2W1NA 1BFSA 1AE6H 4I77H 1MCRA 3L3JB 3PNWA 1V7ML 2XKUA 1CBVL 3IDIA 2PTTA 5C2BL 1Y6KR 4WFGE 1ORQA 1VFOA 2CRIA 3VE0B 4UU9A 3C2AL 2JB6B 5FM8A 5CUSH 4CUCA 1WV7T 5I8OH 1YEHL 3C8KB 3O3EB 4P9HC 1BAFH 4UBDD 4Y7MA 2HTKD 4MJ2A 3UP1A 3ZHLA 1YC7A 1GZPA 5C0AD 3RKDD 1XR9B 5HXMA 4DGIL 1EBAA 1OARL 2FHFA 1FNGA 2X4OA 4XCCH 4WUUE 3O4LE 3MBEB 4MNQA 2F58H 2NLJA 4CAGA 2I60H 1T21B 3F7RA 4OB5L 1NCAL 2ZJSH 4HUVA 1U8KA 2BNRE 3DI3B 1IFHH 2P8LA 1IFHL 1YMHA 3T4YB 4E9LA 3S5LB 4GG6A 3O2DA 3LD8B 4JY4B 1GGTA 4ELKB 2OR9L 2PYFA 3GJFB 1QBML 5JHLH 3F7YB 5FGRA 5EDXA 4YPJA 3MV7B 3H3KA 2FR4B 4EJ1C 1PX4A 3NFPB 1UCTA 1WGOA 4HKBB 4XXDB 4ZO6A 3VGGA 2BNQB 3LAFA 4PJ7E 1VGKA 2R8SL 2JELL 4N9GA 4JZJA 3EOBB 1UXSA 4HT1L 5IMOB 3BOVA 5I1AB 4PJ5A 3BT2L 5JW4N 2YD4A 3VFMB 1JUFA 1HCFX 1Y18B 3JV6B 5H35A 3Q48A 4XC1L 2VLKA 4TPRL 1XGTB 1JTPA 4X7TA 3ILQD 2VLKD 3TJEL 3PWNB 5HYIA 3PWUA 4Z7NF 5GQBA 3SQOH 1NCTA 4ZDHA 1A7QL 4DGVH 4GRLD 4XVTH 2R56H 1MQKL 1C5CL 4POZD 2FIKA 1WBZB 3OWEA 5T1DL 1NCCL 4UIMA 4CU6A 5JW3H 4HEME 3QA3B 5IFAH 5TDPA 3DX6A 4CADB 1T1WA 4KV5F 3MYZA 5JPMA 3MRGB 4H8WL 1RMFL 2YOCA 3QHFL 1NAKH 5JOFB 1AGFA 3QG6A 1MH5A 3KPQB 4YFLF 2EYTB 3TWCL 4HX1B 1FG2A 3BMWA 1JHTB 3GI9L 3MGTB 3KLHD 2BNRA 1CFQA 1BREA 2I24N 3QIWC 2J4WL 2EZ0C 3DVGA 1LD9B 1WAAE 1DBBH 1HCVA 5I17B 1LGVA 2HTKC 3V6ZA 3LQAL 4F15C 5DEFB 5HYSA 4U1SB 3BGFB 1UWGL 4ZFOA 5C0NC 35C8L 4PUBH 4FQ2L 3BHBB 3SDDB 3MMEB 5DVNA 1FAIH 3D25B 5BZDA 2BFVL 3U83A 4WI6A 1I3GL 2BOBB 2CDFB 5ICYA 3UTSB 4ONHB 1MJ7L 1A0QH 1ZHNA 2VLKE 3LN4B 5FHAL 1WZ1H 4ODUA 3H2WA 4LHUD 5CEZD 1DVFC 2Q7NA 3PXHA 4KMQA 1NEZG 1LK2B 2ADGA 5E2UH 1V3KA 1JPGB 2VXTL 4GAFB 5DTFA 3BYTA 2QSCH 3MACH 2YN3A 4Z7WA 1A6UL 5DWUL 5KAQF 3GMOB 4FQJH 1HDMB 1EJOH 4O4YH 3HC0B 1KB5L 2BJMH 4M7LT 4IIQB 1HQRB 1CF8L 5LCVL 3TN0B 2C1PB 3EGSA 1GGCH 4GBXA 1VKXB 3LS5L 2BVQA 4EOWH 4WEUD 2DI9A 3QUYA 3S35X 1G0XA 4OIIH 4Y5XA 1XIWD 2DRUA 1I85A 3M1BA 4G7VH 1JTTA 4FG6D 4GRLC 4B5EA 3U9UB 1O7VA 5CJOL 5TQ0L 4YXLL 1MPAL 2R1YB 4JRYB 4WUUD 1S9WB 1IQDA 1DUYA 1BVKB 2R0KH 3U7AA 4Q97A 2P5WD 3DOSA 1JZ5A 5C3TA 1PSKL 3U9PL 5C6WH 3O8XB 3K3QA 5I8OL 2ICWJ 3DX7B 1JNLL 5FGBC 1ZHBA 5JIPA 4LSUH 1IAIH 5C0BB 3IXTA 1KTDA 2P5EE 3KPSD 2D03H 1CZ8L 1IAIM 3ULSB 4XNUH 3STBA 3QDGA 5JQHC 2DWDB 3WHE1 3UJJL 3BZFA 4APQA 3REWA 4ZTPH 2OL3H 4YXHL 3U0TA 4KKAC 1F90L 4F7TA 1KF9B 4N8PA 5A3IC 3QULA 4LSSH 4KJWD 4I0PB 4HLJA 2YA1A 1DL7L 3N9GH 5I9QC 4IRSB 1MRDH 1JV5B 5E8NB 1W0VB 4PJXF 3L3OB 4ESKA 3LRGA 2ESVD 1OVZA 1TTUA 2GUOA 3AVEA 4GUPB 4NN7C 4UT6H 3HG1D 3QAZB 1U41A 5JPMB 5F21B 1A9EA 3WDIA 1F8TL 4MD5A 5D96C 5C0RH 5TF0A 4Z77B 4JREC 5CZXD 2VAJA 3VXUD 5J13B 4L9LB 2CD0A 3GMLA 3LKQA 2GTWB 3RKPA 1J1OH 4ODSH 5CD5D 5C08E 3WD5L 4HH9B 1EK3A 2BOCA 3LKSA 1U8MB 3TT1L 4ZTPL 4XCYB 4EDWH 4UU9B 1CDYA 3MJ7A 4MJ5B 5J6HB 1N6VA 4G5ZL 5ILTH 5A2KH 3TJHD 3QFJE 4RGNE 5IMMA 1R3LB 4JN2A 4QRRB 1MAMH 1JP5A 5BZWA 5TGBB 3GJEA 4ZYKA 5C70A 2Z4QB 4BKLB 1S5HB 2VL5A 1JTOA 1KPVB 4HWUA 3RWIA 4Z8FL 3G5VB 4R8WL 5I73C 1V7NL 3DURB 1P9MA 5T1KA 2YPLE 2NY4B 2BVOB 4JFFD 1T2QL 1RJZA 4JRXE 4LK4A 1KIPB 5AUMB 5IW1B 1I8MA 1R3JA 5DK0B 2X1PA 2ADIB 4TVPL 3D0VB 2Y5TA 5KG9B 5F7LB 1JGEB 1YPZE 5ICZB 2XWTB 2AJYH 3F58H 1EFXB 4BZ1H 1A14H 1WFTA 3H9SA 4OB5H 4LLUB 4JY4A 5EU6A 5F1SA 43C9A 4U6XA 1UZ8A 4L8SA 1IM3A 5LAXA 1OD9A 4BQ9A 4JPVH 2X05A 4N8VG 1J8HD 2MHAB 3VFTA 5FUZL 5I66B 3D3VA 4XCYA 3SDCD 4KK6D 4MB5A 1IRAY 4FFYL 2DTML 2VOTA 2XQYK 2B4CH 1K5NB 3TIDA 5B3JE 4NWUH 1KIUA 1BBDL 4JZJC 1IMHC 2PR4H 1QSFE 3KDMB 2VDML 4XC3H 3K4DA 3QPXH 1AY1L 1P53A 3F7PC 3C8KA 1ED3A 4D2NA 4D0BA 3VFOB 1YYLH 3RVVC 1CDHA 5E8OB 5IBLD 3VXSE 3RVXC 2AEQL 4B7IA 4LRIA 4RMSA 3QWOA 3BPCA 3QDAA 5J56B 1HH9B 1MVFA 3QQ4B 2NR6D 3INUH 4L4VE 4Y4HC 1DBAH 1MCBA 1UH4A 4KKCC 4M1CD 3CUPB 3U7WH 3O8XA 4OQ1A 2XN9D 3IF1A 5I73B 1F4WH 4PGZA 5I6XB 1K9TA 4PTUB 1CGYA 2RFXB 2Q8BL 2Z8SA 3S98A 5AAWA 4I2XE 1N5AA 1XH3A 3CFEA 4A6YH 1B3JA 4OSUL 4PJIA 2FHCA 3FHAA 3DUUA 3KDMA 3D6GA 1JI1A 3CH8A 2B20A 1F4YH 3L3KB 1MFAL 2ED8A 3C6LB 3BQUA 2ADJA 1GC1L 1KT2B 1MCKA 2GT9B 1JNHB 1JE6A 4PTTA 3H9SE 3PABB 4I8DA 4KI5F 1AFVL 1DFBH 4AM0A 3RGVA 4ZTOL 4HZLB 2R0WL 1MFBH 1TFHA 5HHQB 2W9DH 3KLDA 2DYPB 1BIIA 1F58H 4OZFH 3E6FB 3BISA 3AY4A 4Z7NE 3KS0H 3TWCH 3OAZK 4QHMA 5FB8A 4PLNC 4XP9H 5AWNH 5D7LD 2K3TA 3ET9F 1RZ8A 3VFSB 3UROR 3ZZ1A 2X4PB 5BV7C 4MCYA 5IFAL 4WRLA 4JN1H 1UWEH 4G8EA 5KVDL 3VJ6A 3VXUB 4KTDL 5CBAA 4D9QD 2DI8A 5M95B 4X4YA 2R56L 3GJFA 5E6ID 4FQ1H 1NEZA 3LZFH 1I1FB 1MCDA 4IS6A 4FQLL 3PABA 2E9WA 3VXQB 4WEBL 1N6QL 1L7TH 3HG1A 3DUSA 5DLML 5I76B 1LP9B 4M3JA 5IB1A 1WK0A 2CR3A 1Y0LB 2W9DL 4JB9H 3OKOA 4XCNA 5E4EC 1P5UA 2R0WH 4GXUN 4NUJA 4PJHF 5D7JD 2MNUA 1OSZB 5D7JA 4PJIE 3S34L 1ZV5A 1RZIB 2BHUA 5T3ZH 5I1IL 2VZOA 4JFPB 1EHAA 1UWXK 4RGNB 5AWNL 5D1XB 5IVZA 4BSJA 1R24A 1QFHA 3M45A 4GLRI 3N1QC 3S5LA 1IC7H 2CPCA 3WKMH 3F8UB 1PVHA 1QKZH 3FQXA 2YXMA 3MV8E 1OAQL 5GS0C 4LCWB 2VDNH 1UB5A 3VXNA 4XPBL 2C4FU 5AAMA 3S36L 3LZFL 5CEZE 3NA9H 3KYNB 1FFRA 3GBNL 3R0MA 4RFNC 1LVEA 1S3KH 4HJJH 4EUPH 1Z9MA 4NN5C 4S1RL 4HX1A 3E3QC 3GSQB 4P59H 3BX7C 1NCBH 3VXOB 1KTDB 3FOLA 3QZWA 4OI7A 3FO9B 1OCWH 5E8OA 1XGTA 4IOSD 1TZHB 4QRRE 2FJGB 1T7ZA 4JFXA 4MJ5A 1A2YA 2IQ9H 2HJLA 1F3DH 1QSFB 3UYRL 3MODH 5IEKA 3FFCB 3WUWB 4EEEA 4JR9L 2DQEH 2NCMA 1RIVH 2FHBA 4HHAA 4XRCB 4ZS7H 5GRUH 4JFFA 3OAYK 4IMKA 5FUZH 5FCUH 2H9GA 3TP4A 1K6QL 4YGAB 3QNZB 3VW3H 3P4LA 4H0IA 1B0WA 4RZCB 2R2CA 4PJIB 5CP7A 5E1AB 3P77B 1A9EB 5BOPA 2EDNA 2VXUL 5TE4L 4I9WE 4ODWB 2IGFL 3L3KA 4HWEH 3JUZA 4Y1AD 2GW5A 2X42A 3MBXH 3GM0A 2EKSB 3H7BA 5AYQA 3ZLQC 5DEGB 1EAPB 1G7IB 3VXPB 2X7LB 4R8WH 1OHQA 2NY6C 5BO1H 3G5XB 2QSQA 3HZMB 1A6AA 2V2WA 1P1ZB 1A4JB 4HH9A 1ONQA 1MF2H 4QXTB 4WV1B 2H45A 5JXEA 3FRUB 1G84A 4LLDB 4UUJB 3UJJH 4BFEA 5HVHB 1KCVL 4F3FA 3UEZA 5C86A 5FKAA 4XNMB 4UTBH 2XZAL 3QDGB 4CVUA 2R2BA 3RWGB 3C2SA 1E4XL 4NPYA 3ARSA 1PG7L 3BDBA 5D72L 1KLFA 1JZ8A 3OKLA 4WU7A 2OP4H 5C71A 4RX4D 5IK3B 4NO0D 4LLYA 4O51A 2P5EB 5ICYB 2EDBA 2ADFH 3VDCA 3MLSH 1PDKA 3DARA 5E94B 5JXEC 1X9QA 2WQRA 4ETQB 3KPQA 1NAMB 3FAWA 3VGBA 3RVUC 1MPAH 4WEMB 4HDIA 2GTZA 2FZ3A 4PJBE 4LL9A 4KKLD 2GAZA 4LCCB 5DD3H 4G6JL 3G04A 4QWWC 4JRYE 3DYPA 3RFZC 5I8EA 4TRPH 3QJHB 3FRUA 3WD5H 3MNWB 4AEFA 2FL5B 4PJXA 2BC4A 3O3UN 4WFED 1JGDA 4RGOL 1U8OA 2OJZL 1KJ2B 3K1DA 1CLCA 5DQ9A 3QDJA 4H20H 4AL8H 2YRZA 3I02B 5JDSA 1Q38A 3TH3T 3U0PB 4KJPC 1K6QH 5L6YL 3NAAL 2DIJA 1IT9H 3VFVA 2SEBB 2JK5A 4HZAA 4ZXBB 1DL7H 1YYMH 2XZQL 3WIFA 2ZKHH 1B6UA 5IB3A 4M1GH 4QRPB 1JK8B 4BSWB 2Z93B 3DRQB 5HDBF 3B3IB 5E2TH 1RUAL 1T2XA 2YUZA 1OAKL 5E6IA 2V2TB 4YHZH 4O9HH 4LCWD 5TQ0H 5DHYB 5D70L 1E6OL 2QBWA 5IEHB 5I75B 5BO1L 1KB9K 1BFVH 3RWDA 4AIZA 4NKOA 4J23A 5D7JC 3TVMC 3EYSL 1L0QA 4Q6YA 4WTXA 5INDA 3PWVB 1QA9B 4Y5VC 1U36A 3W9EA 3O3DB 3QDME 4QRQB 4CVZA 4X7EC 5AYUL 4RNRB 4XP5L 5LGHL 5GS0H 5C0AB 5I75C 2NX5B 1F45A 5DZLA 4RDQG 5EIIA 1OP5H 4LNRA 5HD8D 3O0RL 3BKJL 5TGBA 4WFHD 4AT6A 1DQLL 4PJXE 3ARWA 4M7LH 4G6MH 1FN4A 3X3GH 1NGXB 2BOBA 2RCSH 2X1QA 1FVDB 5E99L 5EA0H 1GJIA 1U8KB 3FB7A 1IEBA 1SM3H 2XXMB 2BSSB 4NNYB 3WO3B 3AC0A 3BZFB 4MXWL 2B0SH 1D9KC 2BERA 2VITA 3DX7A 5HDOA 4LAQL 1OW0A 2Q8AH 4FS0A 2GJ6B 4E41E 1QBAA 1JRHI 3L3JA 1JNLH 1BM3H 4KHXL 2BY2A 3QR2A 5IBTH 2HTLC 1Z9OA 1S9YA 3RUGA 1FFNA 1KCRL 2CDFA 4HFUH 2KPNA 3RWEB 3A0OA 3WNNA 4ZO7A 1A22B 4Z7WF 1ZS8A 1ZAGA 1JWUB 3T2NL 3EYFB 3UXFA 2UUDH 4P4KC 4R7NA 4POZC 1MIMH 2FLBT 4H25A 5B8CC 1RK1A 4CGTA 4HXBL 2VAAA 4O2CB 4JO2H 3HS0B 1BOYA 5FGCB 2W07A 1RJZB 5AUMA 1D6VH 1R6VA 4EI6B 5TH2A 4ODHH 4NRXA 1T80A 4MWFB 5F1NB 3QDMA 2B39A 4IJ3B 2H32H 3F62A 5IR1B 1FSKC 2R23B 2QQKL 4NJ9L 4L4TB 1N0XH 3LQAH 4H1LA 5BS0D 2ZNXA 1ZLWK 2DM7A 2V7HB 1SBSH 3D39D 3ZSSA 2IANA 3IAQA 5EU7C 3MNWA 5J6HA 2YBRA 3DV4A 1NBZA 2JJSA 1U8MA 1L7IH 2UWEE 4X8JB 4Z7VE 3WLBA 2CLVB 3TT3L 3C08L 1IAII 3FCTA 2A74A 4UT7H 1K4CA 1Q9KA 1KEMH 4NBYB 4X98A 1AD0A 4U1NB 3PUCA 3ZTJG 2KH2B 3QIBA 3ORJA 4J1UA 1MAKA 4LHJB 1I7ZB 2HTLD 5FYKL 5IW6B 2YKLL 2FH8A 4OCYL 2H6PA 1IGIL 1CD1B 4G8GA 2G5BB 1FVCB 4Y8AA 2G5RA 3CSYB 1I9RH 4P57A 4OF0A 2JJSC 5D2NE 4LVHC 2HVKA 3BZDA 3S8WA 3L3OA 2AJUH 5CAYB 1CBVH 2YPLA 2BNQE 4TN9A 4YH6A 3FQRB 3SGJC 1H0DA 3V6OA 4JRXA 3HZYA 1TQCC 5IHZA 1LEKB 4P0DA 1L0YA 1MHPH 5GGSY 3B8SA 4MQ7B 4R2GD 1CK0H 1T66D 5LXGH 1FNAA 1RJYA 1TCMA 2DBLL 5KSAC 15C8L 2J8UE 1EEYA 2NY5C 3EUUA 5DYOB 3O9WB 2LAAA 5I30H 2MQ3A 1KB5A 1XAUA 1KCLA 1N3NA 5GRVL 1A4KA 1DCLA 3LSOA 5HPMA 3I2CL 2G5BA 4G8FA 4HC1A 4FG6C 4P23A 5I1DB 1JMZA 3GHEL 2IANE 2FJHB 4NOBA 5L2JA 5IP4A 4NYLB 3QFDA 4WWKD 5IVOA 4GKOA 3GSNA 5IHUH 4Z7VA 1U8HA 4RAUA 4LU5H 4YQXH 5HHME 3U9UA 1EEZB 2VISB 4UAOB 1A1OB 5FYJE 4XCCL 4OZFA 1A3RL 4OCWH 5DMIL 4EI5D 5F93C 3HNSH 1VADB 3WFDH 2A6DA 1GRWA 2XQBL 1JHLH 4MNHA 5DRWB 4WHYH 4UINH 1CDUA 4I2XA 3R4DA 1UH3A 2A38A 2L7JA 5ESVB 3JVGA 5KBNC 2C3VB 4B50A 2DQDH 4TVPD 4EDWL 4YHLH 4NQCD 3KAAA 4ZUSA 2EICA 4P5KB 1NLDH 4JM2F 4PYHA 1MY5A 3TZVA 4LBEB 5DT1L 5KSVA 4U1HA 3O6LH 2H8PB 5LJYH 1BD2A 2WIIA 1BIIB 2HFGH 5MEPA 3ZDXF 1XCQA 4QYOB 4HWBH 4X99B 4MJID 2J8UA 1OARH 4QEGA 2OQJB 3IFNL 4ZFZA 5CWSA 4PV8A 3QWRD 2IBZX 3ROOA 2VKWA 1KJ3H 2M8XA 4LCUB 3V6FB 5TJWK 4Q0XL 4W4OA 2NW2A 3P9MB 1WZLA 5ETUB 2ITCA 4GUPA 2GUOB 3N06B 1ZHLA 2M1KA 3BPOB 3QPQD 3SDDA 1OTTC 3QJFB 5LGJB 1WISA 1UZ8B 4L8SB 4JJHA 1Y6NR 5C0CD 5E9DB 1T0PB 2CDGB 4LPXA 3F5WA 4XBGB 3RPIB 3VWKD 1MUJB 4R9HA 3CJJA 1ADQA 5BVJA 4P5KA 4EIZC 2V5SA 4L4TE 3SDXF 3GSVB 1OAYL 2CK2A 1BQSA 4HJJL 2HH0L 3PIQA 3F12A 5ANMA 4WU5B 5E1HB 3MBEC 1WCBA 2DQHH 4JFOA 1NUNB 1F6LL 1MLCA 2G60H 1YMME 2D2OA 1HHHA 2FEEI 1TJIH 4PRPD 3MRDA 3JWDH 4OGZA 5I1JL 3ZKND 4WY7L 1L6XA 1INEL 5F7MC 4Q9RH 4YEEA 4TSAH 5DC4B 4QXWA 1Z6JT 5BV7L 3VFOA 3SE4C 4MHHI 3MLYH 3OR7A 2JE8A 4KC3B 1NFDE 2WV3A 3F65A 3WIIH 4RIRA 3K2MC 1OL0A 1QFWI 5K9KA 4RA3A 4LLAA 3QNXB 4HCRL 4Y4HA 4MAYA 3DGCR 1MHEA 4N1HB 4X5WB 4Q9CA 5D1ZD 1MCLA 1CTOA 2YD2A 2Z31D 1XIWC 4JFEA 3DBXA 5DJXA 1JWMA 5BS0A 1RFDH 1Z9LA 4MMXC 1PZ5B 1IM3B 2F15A 3B5HA 1D9KA 5A40E 3FO9A 2XWTA 1I8LC 5E56A 3LDBC 4JVWA 2BSTA 4FQLH 3WSQH 4M6NL 3VXOA 3O81A 4R6UA 4KTEL 5JDJA 3VH8B 3L1OH 4CVWA 3EKCA 5ICXB 4PJFA 3I6GA 2FL5A 4PJXB 3NFNA 3J8F7 5FO9B 5FO8A 2X5PA 4LQFH 1ZVYA 2J88H 4GOSA 2W9LA 3QISA 2NQCA 5I0ZA 3VWKB 3S6CA 1NUDA 4PP1D 2ZUVA 5DQ9B 2HT2C 1UT9A 4BK5A 4WTWA 3U7YL 3EYFA 2UVFA 3IAPA 3B5TA 1TQCB 2Y72A 4LCIH 5D7KD 2Z35B 4NNPH 3HUJF 4K8RH 2ESVB 2IFGA 1U8JA 3MV8B 3BAEH 5E6IB 5TPWH 4JO4H 5EBLA 5HHNB 2A6JB 1CVSC 3OB8A 4ODXB 3GMMA 1QRNA 1AY1H 3S4SB 4CN4A 3MRRB 3OHXA 3QIUB 5T5NF 5IB2A 3V0WH 5I71B 1FGNH 1HXYA 4LKCA 4KJQC 4X9FA 4EI5B 3TESA 2AERT 35C8H 1NAMA 4UNVA 2I9LB 3B9DA 3TBYA 4NKIL 3TBWB 3SKMA 1XCTA 4JKKA 4RRPA 3U4AA 1CIUA 1EA9C 2Z93A 3OGCB 2WNGA 2QADC 3G6JE 3LEXA 1ZGLB 1J86A 3LKRA 3FN3A 1AC0A 4I9WD 5ID0B 5C92A 5CINH 4P2RD 1AC6A 3VA6A 4X6DF 5I76A 4LEXL 4JPWL 5F44A 3SDXA 1U8QB 4JKWA 4N0YL 4XPGH 5DWUH 5B22A 3UTQA 4MVBC 3D39E 1UENA 2AABH 1HHIB 2OJZH 1BF8A 4ONFH 1CICD 4RGOH 1YEJH 5BS0E 1GZQA 1WICA 3DI2B 2AJXH 2R2HB 2ICES 5DMGD 5DJ0A 3NCFB 4OKVB 2F58L 5BW7A 3LB6C 2QQNL 3QJHA 3IU4L 3MRLA 4WENB 3KWWB 2V9TA 1BZ9A 3BAEL 1W8NA 4JKPL 1FH5H 3SGDI 1HI6B 4F2MA 4ZFFA 2JCCA 4R96A 3DTXB 1RK1B 2V2XB 2W0KA 5HD8C 2XG4A 3QIUC 5SWZB 2EDKA 4OD2A 3P77A 2ZOKB 4R26H 1HHGB 1JPFA 1IJ9A 4YE4H 4U6TA 3CVIH 4POYA 3CMGA 2EIZB 4YBLC 1B0GB 4CNIB 5C7XL 4Z0XB 2HVJA 3GMNA 3RL2A 4AH2A 4N68A 5KN5A 1A6PA 2G9HB 3C6LA 2EIBA 4NQDD 3O9WD 4NSKA 5H94B 4KMTH 5JOPE 3O9WA 4JHAL 3ZYZA 1ERNA 5HGAB 4R97C 2O5ZL 4B53A 4WHYG 2X4SB 5CLWA 5IFHL 4ZUSB 4ZXBD 4DQOL 4G8IA 4JFXB 3MUGA 1T20A 5E00A 4K94H 5FKAB 4QRTA 4BH8A 1CL7I 3RL1B 1GGBL 3KYKL 3T2QA 1OTSD 3FT2A 4RMWA 5H2BB 4MVBD 5D1QC 4HWBA 3VXRD 3WE6B 5T1DH 4BZ2H 1JVKA 3U48A 2X4PA 2Q7YA 3EOTL 4L9LC 1JWMB 5BS0B 2HVKB 2RQ8A 2LAGB 4MXVE 4U3XA 2VR4A 43CAA 1ACYL 2PUQT 3BO8A 3K7UA 2PCPB 3FO2A 4R0LB 4GMSL 4NUGL 3QUKB 2FZ3B 1FYTB 1HN1A 1N2RA 5BQ7A 5LQBH 3GMPA 3DO7A 2Q20A 2Y36H 2JCCE 4ZFGL 5F3HA 1GOGA 3MGOA 2BSRB 3DVNA 4WJ5B 3T77A 3LDBB 3QBTB 1BQUA 1CLOL 1YN6B 2XNAB 3QEUB 3QXAA 1MFDH 2QKIB 5DJYA 1DSFH 4ZSOB 2IFFH 4G6FD 1SMAA 4JDVA 1YA5A 2X4NA 1UM6L 2W60A 5I1HL 1DANT 5ILTL 1DQJB 3FFCE 5F7NC 2Z35A 1HILB 4AL8L 4NPYB 5GSVB 2D31B 1U42A 2O5YH 4MX7B 1XGQA 3SDAD 4MA8H 2ZUTA 3W9DB 5C0EB 5DD6B 4OIIL 1XGUB 4JFHD 4QTHA 5F1NA 4GRLB 5LWYH 3GKWL 3SGKA 3PGFL 4JPKH 3A67H 2MOVA 1F8TH 5KTEH 2DMCA 3QJFA 4GSDL 1UB5B 2R9HC 3MC0A 2IQAB 1TJHL 1YN7A 1ZVSA 5GSRB 5DJXB 1OWWA 1T5XB 4O58H 4RZCA 5E2JA 5CP7B 5E1AA 1AR2A 5IVXA 1OF2A 1BEYL 3VXMB 5IG7A 2Z91B 1NCWL 3IETA 3GSNB 3MBEA 4L4VD 4Z7VB 1FZMB 4S0SD 5K33A 1PG7H 1U95A 4LLQB 4X7SL 5HGDB 4HS6B 1A0QL 3PWPB 2ATPA 1NDGB 3K74B 4PJGF 2GJ6D 3RA7L 1R3IH 2AGJL 3KPSB 1KN4L 1LP9A 1T3FA 3FL7A 2XV6B 5FV1L 1JUFB 1Y18A 3JV6A 5H35B 7FABH 4P4KD 2YPKB 4GKSA 1UJ3B 4GBXB 2LE9A 1G7HA 3MRNB 4TQEH 4F57L 2ATKA 2V5MA 3LS4H 4JFYB 3I75B 1FL5B 1D5BA 4O2FA 2BVPA 3CPLB 4APQC 2VABB 2R1XB 1G7QA 1VGKB 2D3VA 1QEWA 5ADOH 2R4SH 5EO9A 1KJMA 4HIJA 1XGPB 3WXWH 4UTAL 1BJ1H 4Z7QF 4UZGA 1G7IA 4N1CA 3ARDA 1J05A 5KVMC 4AIZB 5JOFA 2ICEA 4HGWB 3CSPA 3UAJC 4LSRH 2JJTA 3F6LA 3P73A 3C5SA 1GGCL 3V6FA 1R3HA 1VACA 3RGVD 2NZ9C 1EXUB 2KDGA 3QQ3B 4NOFA 4WI8A 3W82A 5KSAB 2O61B 2XICA 4NQUA 4P3CH 3EJYC 4LLVB 3O4OB 3PHSA 4U1SA 4TSAL 1A21A 2QSCL 5E8DH 2J7LA 3BRGC 3BH8B 4ZXBA 1UEYA 1MCOL 5DHXB 3HAEB 3ULUF 4ZAKC 3QCTL 2PTTB 3CFKB 5LAXB 2NY7H 3UTSD 4AK1A 4IS6B 4MXQC 2AJXL 3VI4E 3T0XA 2X6MA 1VESA 3HI1A 3JV0A 3CK0L 5BRZB 1Q0YL 3TPKA 4RISL 1MHCB 3MJ9A 3TPUA 5FECB 1LO2H 1BHGA 4QHUB 4PJIF 3O0RH 2L0DA 2BX5A 4LPVA 5BVJB 4NRXB 3WSQL 1HIMH 4I3GA 3IDGA 1MCJA 3QQNA 1XZ0A 3C6LD 2WBJD 3DRTB 3GSVA 1DN2A 5EZJB 3K4AA 4D9QE 1UA6H 4NKOB 4QT5A 3IXTB 4FFZL 3HAEG 3MO1A 1EPFA 3F7YA 1OP5K 3BUTA 4N0UA 4Y19D 2CLZB 4V2CB 4LLVA 3HR6A 5GISL 5FK9A 5E99H 5T3ZD 4Y4KB 2CK0H 4OGYL 3LN4A 4HJ0C 1DUZA 2VH5H 4ZS6D 5F96L 1NQBA 3O3AB 3RHWK 4GXUM 3SCMB 3HUJE 2ZUQC 5E8PB 1FNGB 1M6OA 4Y4FD 1A6TA 1RU9L 4NQCA 5FYKD 2WIIB 3TF7C 3D25A 1CXKA 3CLFH 1T89C 5BOZG 1GIGL 1R3JB 5DK0A 4C59B 1XZ0B 3BO8B 3L5WB 1RUPH 4GW5A 3QG7H 1BJ1J 3QXDA 5K9OA 4J8RA 1RHHA 2VLMD 1EDQA 3MRBA 2ENYA 4JVUA 2Y9RT 1KUMA 3MUY1 1J5OL 3HZYB 3EFDH 4G5ZH 1OAKH 1X5IA 5CGYC 3B2VL 5TDOB 3JBG7 5DVOA 8FABB 3FT4A 5DVKA 2QHLA 4JN2B 1U8QA 4M7JL 4RMVA 4RNRA 2DI7A 2DLFH 1IAOA 2E7BA 1LWRA 5EZLB 5E00B 4MJ6A 4MDIA 4NP4H 2Z31B 1SQ2N 4IMKC 1KTRL 4BUHA 2HJFA 1LNUB 5C0RL 4PP1C 3DMMB 3RWCB 3WHXA 2FEDC 2NY4D 5IQ9A 4M8VA 3OX8B 1ND0B 1SJHB 2IPTH 5DD5H 3IDNA 4LGSB 1J0ZA 3CVHA 1RPQA 4HWZA 3K8KA 5SWSE 4JVPA 4P3WA 4PB9H 4P46B 1QSFD 5GGUB 3DSFH 2AV7B 3SE3C 4GMTH 4JY5L 5EC2A 5FF6B 4WNQB 4XVUD 1GHFH 4D9LL 4PS4H 5EU6B 5MENE 3OJVC 2C3VA 2P8PB 4XGZB 4L4TA 1MRFH 4H1LB 4KQ3H 5K9QG 1F11A 1G9NH 1QYGL 4OLZH 1J8HE 4GRWF 1A1NB 4NRYB 2G75B 1FJ1B 1YYLL 2I25N 4FXKA 1SVCP 3VD3A 3U36A 2NXZC 1H5BB 3IU3A 1J7VR 2FR4A 2DLTA 4NO0B 3CZJA 3MLZH 3P4MA 2DWDA 4S10A 1NJ9A 1YEKH 4KXZI 5C6PB 3QUZC 4XCFL 4F7EA 3MXVH 4I5BA 5JPNA 3W11D 2BNUA 3EYUL 3U9PH 1PZ5A 1AXTL 4HUVB 1OP9A 3RI5F 4JO3L 2F74A 3BDYL 2ITCB 5EU3A 2NY5H 3CSYA 3TNNA 5C6TH 4B0MM 4RGND 4UQ2B 1JGVL 3LIZL 5FIEA 4HDIB 4S1QH 2HKFL 3VXME 1A5FH 3X12B 1KBGH 1X4ZA 4YIQB 4YDIL 4Y5YA 4KHTL 1A3LL 2JKXA 2VDRH 3QIUD 1D5MB 2NY4C 4FQIH 3ZMRA 3S97C 4AQ1B 1T03L 5CJ8A 5DR5H 3TZVB 1VKXA 3MXWL 3IJSA 3C8HA 4PJ5B 3OAYH 3MLZL 3OXSA 5D1ZB 1K3IA 4NBXB 1L6ZA 4PJFE 5GPRA 3QEUA 3REVB 4JDZA 3S3PA 4HKXB 3P4OA 2ZCLH 2VLLB 1FFPB 3KYMA 1AI1H 1H3PH 3MACL 3PWJA 1MFDL 3SGJA 4EN3D 4CW1A 2AEPL 4ZXBC 5E6IC 2YD6A 3B9KC 5C0GA 1ZWIB 4MZ3A 4MA3A 2QADB 2Y36L 3QT2A 3BPLC 3LMJH 1WITA 2E3VA 1BQHB 3ULSA 3LKRB 2Y07L 5FYLD 1V8HA 1QRNE 5DA0B 3V5HA 4RAUB 5FV2A 5DJ2A 5DJ8A 5JLZB 2NY0D 3QAZC 3TN0D 3HRPA 3F7VA 3OKYA 1U8PB 2HVJB 3GMNB 3RL2B 3U4BH 1D5IH 2AQ1A 1ZKAA 3ZSTA 1BVKA 4R7DA 4IMLA 1QFOA 5ADPH 2EYRB 1HSAA 1WQVT 4R3SA 2BRRL 5BQ7B 3DO7B 3V7MA 4OCSH 3M8OL 1NMBL 2BCKA 2ZPKL 3GIZL 5HI4D 4DCQB 2I5YL 5BCAA 3MOAH 3O6FB 3OKOB 1ZXQA 4JFDB 5IGXH 2NNAB 3QO1A 3VXMA 1NGWB 3VXTB 2J4WH 4JANB 3QQ9C 2MSPA 3ZKSD 5J1TC 3MLVH 5HYSB 3QUXA 4XNYH 3DLQR 1BQHG 2XY2A 1BZ9B 3RDTC 3D5OF 1MI5B 4XP5H 2PTUA 3K0WA 5IJVB 2YHGA 2D03L 2AKRB 2DN7A 2NY2C 4ZPVB 4FQ1L 2DQIL 4MS8C 4KFZC 2OR7A 1OD7A 1HDMA 5D6CB 1MLBB 1CDJA 3MTRA 1YEDA 2B1HL 3MRJA 4OZFB 3SPVB 4NFDA 1NCCH 4OCXH 5FF6A 1FZKB 1GL4B 3FB5B 3QA3A 3K2UL 1O7SA 3EO1B 4YHYC 2F8OA 2FEDD 2KUTA 3G04B 5MP6H 4WFFE 5D2NB 6FABH 2BCKB 1GVIA 4UILH 3MNZA 4PB0H 3J7HA 4MD0B 3QI9A 4N5EC 3GJFH 2VH5L 5F96H 5BXFB 3L5HA 4N9OB 3QPQC 4HFWA 1DJSA 3RHWF 3FTGB 4PREA 1QLEH 1BVLB 4FTVA 4G6AC 2F54D 2ICEB 4HGWA 4KK5C 5DYOA 3FOLB 1XCQB 2X9YA 1K4DA 1WIUA 3FT4B 4KPHH 1NKRA 4EN3C 3TFKC 4NHUB 3QDHA 3MJ6A 2BXYA 1MCWW 5ICZA 2DYPD 2R4RH 1NDMB 2KL6A 5FCSH 5CHNB 5IB5B 5B38G 1CG9A 2ARWA 3W0WB 3GI9H 4H8WC 4JFDE 1ORSA 4CMHB 1G9EA 2W65B 3MLTB 4TTDC 5ERWA 3AREB 3TM6A 4YFLI 3U46A 4OZFG 3TO4C 1OP3K 3STLB 5BVPH 2HKHH 5E9DA 3I75A 3GGWA 4WWKC 3QCUH 1P7HL 4OCSL 4KZEL 4M7JH 4XMPL 1CI5A 1TNNA 5EU4B 1CDIA 2RBLA 4PJAE 4PJBB 1ZHBB 2ZZUT 4P2OB 4R4FH 1LQSR 1YMHB 2WWMC 4ODWA 3PHOB 3IKKA 4NNPL 1WFUA 2AEQH 5CGMA 3DBXB 2OTUA 1OY3B 3MJ8A 2AXHA 3MCLL 4P3CL 5C0FB 3E1F1 4J1UB 5TF1H 2HLAB 1XR8A 3K46A 5JHDE 1UZ6F 1ZVHA 4HUUA 4IDJL 1FHGA 4AG4H 3QO0A 1C5DB 1JZ4A 1BBDH 3HFML 3VG9C 2OP4L 1NGQH 5D7IA 4ZUUB 4XI5D 4XP1L 2DICA 3KGRA 4ZAKB 3PJSB 2RB8A 3MR9B 5ID1B 4O02L 5IVXB 4UAOC 3OKLB 1CL7H 4Q58C 5MERA 3ZL4L 2OYPA 25C8L 1X4YA 5BZDB 1PAMA 1TVHB 1XIWA 3V5HB 3A6BL 2V9QA 4QHUA 3W39A 4MA7H 3D1MC 4Q6IB 4OGXL 2IH1B 5CMAA 1F4XL 1NL0H 3OX8A 2FNBA 2EYSB 5MEOB 3DRTA 3ARBB 2OSLA 1CT8B 1JCKA 3EFFA 5F9JA 3ZTJH 2IBZY 1KJMB 5EULV 2QV2A 2AJSH 4LLWA 1NAMH 3QFJB 4JQIL 1IGCL 2OK0H 1CLYL 4M62H 5FKPB 1UZ6E 1J0HA 3WNLA 1D5BB 4O2FB 5IVXE 1FZOB 3CFBA 4I18B 5AD0B 4P9ML 3M07A 1YNKL 5HTSA 1CICB 4JPIB 2YPKA 2ESVE 3SE3A 1NGZA 2DJUA 1M6OB 4JFFB 2WP3O 1R5VA 2DQEL 4PGBB 1WWAX 3LN9A 3Q1SL 4MB4A 2CIKA 5DVMA 3B8YA 4ODBD 3HLAB 3MLSL 2I9TB 3C5ZA 3KPOA 4R4ND 4WUUB 3EYQD 3C6SA 4RMTA 1JIBA 3KYOA 1OTUC 4U0QB 2EYSA 3VRLE 2FCBA 4A2MA 4U1JB 5T33L 2EDTA 4RFEA 2WBWB 4HULB 4OF5A 2SEBA 3THMH 1YJDC 4ZS6C 5EO9B 3TVMD 1G7JB 1H3VA 3JVGC 4U6XB 4XB7A 3DVIA 1P1ZA 2FX9L 3B9KB 3FOMB 2D7MA 1W72B 4X6EB 2FDBP 3ZKMC 4YR6B 3BPCB 1HH6B 3LQZA 1G6RB 3QXDB 2NY3D 4I3RL 2X4UA 4YDIH 4YUEH 2H8PA 3DSFL 5F89B 4FP8H 1H3UA 4Y2DB 3IFLH 5IW6A 3ARDD 2C3GA 1JGLH 1FO0B 2AXGA 5F9OH 3NCJH 2VLJA 1INDL 1AJ7L 3UJIH 1HHKB 3LKOA 4P2CG 2GQHA 2IADB 4LCUA 2VLJD 3CXDH 3PQYD 3IU3B 1RJLB 4Z18A 2LFGA 5TDNA 1KJ2H 5EIQA 1NGPL 2DWEB 2CDEB 5DI8B 3LPFA 3ZE2F 1LDPL 1FL3B 4PJHE 5ISZE 5SWZA 1CYGA 4WFEE 3WO4B 1KULA 4R4NC 2JK5B 5ENWB 1JYXA 2AQ2A 3T0EB 3GSQA 4J6RL 5T3XE 5DDHA 1T5XA 4N5ED 3AUVA 5F89A 4K55A 1L9MA 2CO7B 1I1FA 3V4UL 4LIQE 4M62L 3UTPD 1P84K 5HBBA 5HHPB 3MYJA 4D9LH 1F6AB 4XZUA 5I1CH 5EOQH 5FHBH 5EBWB 2XN9B 1FGVL 4NHCL 3ULVD 3EO0A 5CGTA 4QRPD 4GXVH 4MCYB 3ULVE 2PW2B 32C2B 4P4RB 3MQIA 3W81A 1ZGLP 1A64A 4XTRD 3ULVL 1MH5B 5FYLE 3KXFE 1D6VL 1MWAA 1P6AB 5DC0A 3ME0A 2W0FB 3A6BH 4D0BB 4MX7A 2E7HA 3PWVA 2P44B 4KRNA 5T5NG 1ZA3A 2X4RA 4QHNB 5HYJB 5HHXH 2M26A 3VWJC 5BJTA 1VEMA 3HUJA 3GMRB 4D9RE 5F9JB 1S7WB 5FA4B 2IG2H 5T3XH 4PBVC 3PL6D 4IRJA 1IBGL 1RZJL 1UH2A 4TSCL 5BW7C 4G43A 4TSBL 4DW2H 2IQ9L 3UTTD 5CIPA 1P7QD 3O2DH 4LRNH 1FZJB 4HFUL 5K9OB 1RUKH 2BSSA 1XF2A 1KENH 3MV01 1NPUA 3SDCB 3QB7C 2V17L 3L95B 1YN7B 1MJJA 5HYEA 4RISH 4KY1H 2E27L 1HXMB 2QR0A 3GO1L 2YSSA 4FQ2H 3T1FB 4HBCH 1FVEB 3I9GH 3LEYH 3IU4H 4KU1A 1H3XA 3M17A 3BXNB 4NZRH 3U0WL 3IJHA 4OCYH 4XMPH 2IMMA 3GSNH 4UV4H 4L8BB 4XNZB 3RZCD 5IG7B 3P0VH 1CE1L 1MIEH 2AV1B 3AXLA 3GDBA 2WUCH 3VRJB 4MA1B 4OCMC 3TEUA 6FABL 1NEUA 1F11B 1T6VN 1G6VK 2OTWA 2CGRL 1BIHA 4QRRD 3MZGB 2BC4B 1TCRA 2JTDA 3PWPE 3BMVA 1KNOA 2VIRA 5J3HD 3U36B 3KYKH 4ZNEE 2YA2A 3CFDA 2KKQA 3E6HA 3KNBB 5IM7A 2UWEB 4NQEB 4YHNB 3NN8A 5CEZL 5GRXG 4DQOH 5IMLA 4AMKL 3BN9C 4P48A 4E0RB 1GC1H 3AM8C 4KK9D 4HPYL 1U8PA 2GJ6A 1JGVH 3MNVA 3ZHKA 4P2QD 3PHOA 1BLNB 2PCPA 3FO2B 4WEBH 3MV8D 1JYNA 5L2KB 4J3TA 2LQRA 5C0DB 3ARFD 3T0EC 3ESUF 4KI5E 1ZA6B 2ZPKH 3M8OH 1JHKH 3BRFA 1E27A 4UOJA 2A6KA 2QSTA 1C7TA 2Y4SA 4OCNC 2OXHA 4NZUH 4UQ3A 1UWEL 3UBXB 4LEOA 3GBMH 4M48L 1GXEA 3QQ3A 1JHLL 1K8DB 1DE4B 5F6HI 3HPLB 3V0VA 3UJTL 4K3HA 1CXFA 2QEJA 1LE5A 1A3RH 4G9DB 4L29A 2AGJH 1KXQE 1W2KT 5JIIA 1R5WB 4Z5RA 1J0KA 5LVEA 5TFSH 3T4YA 4NQXB 3RVUD 1EEQA 3WMSA 3T0EA 1LP9F 1MAJA 2NY1B 4P5MA 4YNYB 5ETUA 5A43C 4ONGL 5CILH 1FRGL 4OI8A 2C7UA 4HIJB 4KROC 1KIRB 1VGEH 1PY4A 4OIBA 4JLRB 5DMYA 3D48R 4X4XB 3G08B 1IC4H 5DD3L 4M9PA 1AO7E 1WWWX 4HF5H 3CGTA 4AEIH 3DROA 4JPWH 4G8IB 4GSDH 3ULVH 4YHOL 4ZNEA 3K1KC 2HYMA 1LMKA 3BUYB 2P5WE 4KJPD 4G42A 5F7WC 3BIAX 2DLHA 5DRNA 1FVDA 4H5SB 1IQWL 3ZYOA 2YD8A 4F7EB 5EUOB 2NX5E 1BOGA 1F5WA 4Y2OA 4WCYH 4DGVL 2X9XA 5GGTH 3NABL 1N64H 1SJHA 4M1DH 3SDDC 3QXWA 2R0ZL 3TO2A 4OM0H 1FJ1A 1KJ2A 1RZ7H 4XNXL 4QRSB 2HG5A 5IMKB 2JF1A 2J8UF 4D0CB 3GK8L 4F15B 4RBPK 4UDUB 1I9RL 1KJ2L 5JW4R 3NCYP 4PD4K 1BWMA 1AKJD 3A6CL 3O6MH 1WFNA 3CXDL 4HWEL 5TQ2L 4S0TD 5C0BA 2D7NA 1URLA 3B83A 4NYLA 2VXQL 2YUWA 1U93B 4HK3J 4YX2H 5EN2A 1I9JH 5F7DA 2X4QB 5C2UB 5IB3B 5ITBH 3U82B 4LSVH 1MF2L 4X83A 4XNYL 2AEIT 5I2IA 4Y4FA 5HHMD 3W9DA 3HRZA 1FO0H 4OD3L 3ARGA 3IXAA 4P2OC 3O11B 3FT3A 3WJLC 1MVUB 2B1AL 3WFEH 5FOBB 4DK6A 3QIBC 5FM5O 1FNHA 1IAOB 3N9GL 5ACZA 3PL6C 4UNUA 2I9TA 4ALAH 1FZKA 3KNBA 5FDWA 2P5WA 4XVUC 2PXYD 2PYEA 2XQBH 5JTWA 5KANI 3HE6D 3OAUH 5D2LA 5EBLB 5IROC 3H3PL 1AGBB 4P59L 3D2UB 3QEQE 4MLIA 3BGMB 2NX5A 4JFED 1RULL 2NX5D 1DANU 5EUKB 5HHOE 4CADA 1DEEA 1FV1A 3QFJA 3CZFA 1SJEA 1X7QA 2F5BH 3MRIB 4NDMA 4ZFZB 5GS3A 4OAWA 3BIKB 1QD0A 2V17H 3EO0B 4P99A 3RIFF 4FTVE 5DQDL 1F4AA 4DN4H 4P9MH 4LRNL 4PJ9A 5KSVB 4JZOA 3M1BB 2PO6A 2E5EA 3FO1B 2AXFA 1FE8H 1YPZB 2BNUB 4F8TA 4LP4A 3L3DA 1CFBA 1IL1A 3GSRB 2VYRE 3S36X 4WI9A 2AABL 5F88A 5A16B 4GAGL 4IRJB 4LMQE 4PG9B 4DK3A 2DQCL 3ARDC 3L6FA 3FQWB 1ZSDB 2R4SL 1FZJA 3O6LL 1LD9A 4YDLB 4PJAA 4DFIA 3NCMA 2ZOKA 2OI9C 1R0AL 4OGAD 1JZ7A 4HMDA 4K3DL 4Y16B 3MRGA 4YHPA 3R06B 5F72S 2Z92A 4LSUL 1H9VA 1JNNL 1HHIA 4GFTB 2P8LB 3TNMA 3T3PF 1MCPL 5DMKB 3VXSA 4ELMA 4WO4A 3VD7A 3DGGB 1JWSB 2H1PL 3KPMA 4Y4HB 5D7IE 2X4TA 2OL3B 4AENA 3SKJH 4M1DL 4NO5B 3KJ4C 1Z9SA 3HMXH 3BN3B 5J12B 2VR9A 1OOAA 2PW1A 1G7PA 1S9XB 3NIGE 4LVHB 5AZEH 1INQB 3OR7B 1TENA 4L3ED 1T04A 3FN0L 3GB7B 4P9HH 1IT9L 1J8HB 3EO1A 3ULVC 2VUOA 1A6WH 2P5ED 1FORL 1U8JB 5HVFB 1R0AH 3O6KH 3KYAA 2DM2A 3L3HA 2BVUA 3MSPA 4M6AA 3KPPA 3HE7D 4JZJB 3JXAA 3ARZA 5L7XL 3QDJD 5DSCB 3PQYA 1RJYB 1EJOL 5DK2B 4WHTA 5IMLB 4A6YL 1Z5LB 2DQFB 5HI3D 4M5ZL 1F2QA 4E41D 1MCWM 4YGVA 4DKAA 3IJYB 3SJVD 4I4WA 5AEAA 1ZA3B 1IGTB 1F4WL 4HKBA 2CH8A 1G0YR 4MNQD 5T5FL 3MUGB 3VH8G 3SO3C 5INDB 2ESVA 3LHPL 2I60L 5KW9L 2EYTA 1I7ZA 3V52H 2GSIA 1HHKA 4LFHG 1TJGL 32C2A 2Y7QB 1B4JH 4NWTH 3HMXL 3Q6GH 3VI3E 2D0FA 1L7TL 3PGCB 2AJ3A 3UZQA 1CU4H 2Z8WC 1QFPA 3FONA 5GHWL 3C5JB 3K80A 2CSPA 2XWJA 4K9EL 4X99A 4X7TB 3VXRA 5HYSG 2GJJA 3O41A 4FXGA 1KYOK 4F57H 1CR9H 3GFUA 2Q8AL 4LSTH 4DKFH 4QTIL 1EHNA 4QNPE 3H9SB 1ZK9A 3M17B 5DK2A 2IAMD 5LQBL 3L1OL 1YNLL 1SYSA 5DK3A 1WSST 1QR1B 5GIRB 3TZVC 3CZFB 3HPJA 4N0CC 4I3SH 4JY6B 4LSQL 4OZGA 3T65A 4GG6F 4PV9A 1U6AL 4RAHA 3RQ3A 5KSBE 4LVOB 1L7IL 1MHEB 5F9AC 1EH9A 2O5XL 5I1EH 3EOBA 1NSNL 4ORZC 1NGZB 2GK2A 2VDMH 4JEGB 2VLJB 4H8WH 5D96B 4GG6B 3ZE1F 3FQNB 4MD4A 1OGAA 4GG8B 4EVNB 3MBXL 2HT4C 1PG7W 5F7YC 1FE8L 4Z7WB 3X3FL 2E8ZA 2FB4L 2ZCKH 3NFPA 2BVTA 4XMLH 4JHBA 1QFWL 3BH9A 5FKPA 5EZIL 3IFNH 3L3IA 3QXVA 4IRSC 4MNQB 5JR1H 2YD7A 5T1LB 4R90L 3A67L 1MAML 4OCRL 2YR3A 2CRZA 2AEWA 5GGRY 5IROA 3RVTC 3ZDZF 3MRJB 3SPVA 4JO2L 4P4RA 2P7TB 5IBUB 2IH3B 1T0MA 2AJYL 3BWAA 3CK0H 3PDOA 5FDYA 4MJIA 3MPCA 4HUWB 4C56A 5KZCB 5SWZE 4TULL 2FD6L 4QHKJ 2ATKB 4A6YB 1IE5A 5K93A 3B6SA 5I16A 4LSDA 1PG7X 3HR5A 1YEKL 2YBRB 5GS2D 5JNYB 1MJUH 3UX9B 2D0GA 5LKNA 1H3PL 2E27H 1NCDL 5ITFA 2VITB 3H8NA 1DLFL 1VFBA 4YFEA 4G9FD 5GZNC 1ORQB 3VE0A 5IIEB 4YEFA 3DVGB 3VRIA 5EN2B 1B88A 3G6JF 3GBNH 5A2FA 1KYOJ 4M8QA 5CEYA 2A6JA 4OZGE 1P7QA 1UC6A 1I8KB 5FA3B 1KJ3L 4YPGA 3ETBF 5D6DA 4Q9QH 4EZMA 4K07A 5EA0L 5EWIH 4ONFL 3ULUH 2JIXD 5IMMB 5I1LA 1D7FA 5GGRB 1IEAA 1ED3B 3RIAF 5LBSH 1GGIL 3BKCL 5DD5L 4J4PC 3QUYC 1I8LA 3OV6A 3I2CH 2NY5L 3V9FA 1CLYH 1Q94B 4JQIH 1LILA 2XKNB 3MROA 4JCMA 3EYUH 3RIFK 2IH1A 4X6EA 3NFSL 3PL6A 4IRJD 3EYVA 3HMWH 4OF6A 1FDLL 5LXGL 1F4XH 1NL0L 1ZLVK 2X89D 5F97E 2OL3L 4OLYL 5C2BH 3OKEA 1ZA6A 3OKMA 1T1ZB 1N3NB 2JLLA 5D8JL 3TBSB 1U8LA 2IMNA 2VQTA 3WYRA 5IMOA 3EYQC 4BQCA 4PJ7B 1IM9A 4UV7L 3NGBB 4R96B 2R2BB 2R69H 2V6HA 3SJVE 4YQXL 3NH7L 5GS2H 4GJTB 3LKQB 1IAIL 2PETA 3LOWA 4FQHB 1QOKA 4W6XB 5FFLA 1DQDH 3WDHA 4W81A 4PGBA 3CX5K 1X44A 1JGUL 1OGTA 4PB9L 3JWOL 4CMHC 1QUNA 1R3LA 5DJ6A 4QHKI 4JAMA 3O4LA 1I7RB 4I48B 1E6JL 1QSZA 1MNUL 2VUYA 3T2OA 2GJZA 1ULVA 3MRNA 4CVXB 5IFHH 4IRSA 3RRQA 3DXAE 1G7MB 5KSBF 3P30L 4YXLH 1B4JL 4NWTL 3LRHA 1PKQE 1T1WB 4FP8L 4N8CH 3MOBL 2FO4B 3IDUA 1ZT1B 1U3ZA 4UMGA 1XF5B 3MLRH 4V2BA 1KCUH 3SJVB 1FYTE 1M7DB 3TO4D 1NSNH 1FNEA 2GJ6E 4E41B 1JF1A 3S35H 4JQXA 3CMOH 5C7XH 1YY9C 4TRPL 1ZHKA 4MA8L 3MFFA 4DWHA 1Z3GL 3UO1H 4OM1L 2AAVA 1NUFA 3GSOB 4KKLC 1PQZA 3QSKB 1KB5H 3TC9A 4PJEF 3MRHA 4KROB 1SJXA 4FABL 4CL7A 5GRJL 4ZUTB 3AM8A 5JIHA 3DNKA 2WINB 2N1KA 2VZ3A 1ADQH 1T0MB 1JGEA 4S1SL 1KGCE 1N8ZA 3T08A 1FG2B 4X6CF 1IQDB 4KUZL 4WO4C 3RNKB 1IAKB 4M43H 4YDVA 1SJVA 1U3YA 3U6RB 2Q76A 3TBTB 4XPBH 4WGVB 3T0EE 4HIIB 2VKXA 2AJVH 4GRMA 2DL9A 4OLWL 3P11H 2J12B 4N0FB 4RMUA 5F1IA 1I9IH 4O2CA 2YA0A 2MJWA 3UPRA 4HUXA 4HXAH 1BD2D 1EEZA 2RAMA 3PHQB 2GK0B 1QG3A 4WI2A 5DD1H 2QR0B 4LGPB 1LE9A 1FFOB 1OAUL 2A77L 3UO1L 4PJAB 2FB4H 5DFVC 4L3CB 4XAKD 2ENSA 3B9KD 1N0XL 2RHEA 2PYED 1KIQB 4JDZB 3T04D 4L8BA 5T3ZL 5I1IH 4X9GA 1IGTA 1IC1A 1YEEL 2ITDA 1ES0B 3VGAC 4H5SA 1YMMB 4U7SA 5HHXL 5C07B 3IS1X 1DQTA 1A7NL 5MI0B 3BP5A 3ARRA 3ALPA 4ZFOB 2J6EL 5KVEH 1Q0YH 1QLRA 4F2MB 3MUHL 1DQJA 4ZFFB 1P4IL 3QUYB 2B4CC 1TZHA 2EKJA 4HAGA 1CCZA 3T0VA 2HFEB 1FL3A 3D85B 6CGTA 3CVHB 2H32A 3UDWC 3IRPX 1W8OA 2WM0A 3A6OA 3MRRA 1U93A 2IH3A 2HFFB 3V4VL 4DUVA 4MA1C 3VXSB 3BP4A 1FIEA 5T1LD 1DDHA 4KTEH 3VMNA 2P8MB 4Y16D 4M7ZC 4X6FA 1NCBL 1FV1B 1D3CA 3KPMB 3EAKA 4U0RC 3QEQB 4LQ1A 4L8CA 2X40A 3WUZA 3I50H 3KJ6H 5GJSH 1Q9WA 2FBJL 3HNVL 1Z3GH 1NFIA 4XC1H 2B0SL 5HGAA 4ERSH 1KB9J 1EMTH 4TUOB 1RIUL 2XA8L 2MCPL 3T3MF 4F7PB 4LEOB 1A6ZA 2VDQH 3CAFA 5DZNA 5IT2L 2ORBL 1UCBH 5HY9B 4M7LL 3TV3H 2HFEA 3ALXA 2EE2A 4M8QB 3D3VB 1LO4H 4I0CC 4M7KH 1MNUH 3VFGL 5EUOE 3EHBC 4YO0A 4OSUH 3IDMB 4X6CA 3GI8H 3KPLB 4M9OA 5LWYL 4LARL 5KG9A 1MRDL 1HOCB 3NPSC 1YEIL 4KK9C 3VU2A 3X12A 4FQIL 2BDNH 5HHMB 5C0IB 1I3VA 3ARGC 4WY7H 2UWEA 12E8L 2DF3A 1XF2B 2V2WB 4PTUA 1HSBA 1JF1B 3RZWA 1X5ZA 1IGML 2NXZB 2DQHL 1MHPL 1QLFA 4JB9L 4WGWB 3RI5K 1XGYH 1S7VA 3AS1A 4UB0L 4XNZC 4W4NA 1I1CA 4K7PH 3CH1B 4Z7OE 5EZLA 3B9AA 1KLGA 5T33H 1GGUA 1AXTH 1XMWA 3CFKA 4PJEB 5IOPB 1RZFH 4Z76A 1J05B 3HB3C 1M7IA 5C08B 3AXLB 4P2QB 2F53B 3U1SL 4HJ0D 3R1GL 2BNQA 3SKUD 4JZNA 4M61A 3QDGE 3HPLA 1RY7B 4WUKH 5I1KL 3QDJB 2EXWD 4QGTA 3UBXA 1JGLL 3DUUB 1AE6L 4I77L 5FGBA 1P6FA 4RGMC 4M03A 5A16A 1OTTD 2PYEB 1FBIH 1QYGH 2P45B 1C12A 3DXAD 2YZ1A 3CFJA 3S4SG 4H0HB 4HUMB 1RZKL 5IK3A 2IF7A 2FSEA 4WW1A 2CLRB 1CFSA 4K2UH 1EAJA 3BP6B 1TMCB 1AO7B 2I5YH 3O2VH 1G7PB 1S9XA 2VMFA 4FQXC 2EH8H 5MEQA 5J11C 2FX8L 1UXWA 4POUB 3EYVB 1VENA 1JYVA 4XP6L 1A6TB 2YN5A 4AENB 1FZMA 4WIQA 2VN7A 1MUJA 1WBXA 4XPTL 1Y0LA 1B2WL 3AAZB 1OM3H 4JE4B 3VG0H 3V5DA 2EKSA 4JKLA 5D93B 3RY6A 2DKMA 4QHMB 5FB8B 2AVGA 3T2NH 1TJIL 1TIUA 4HK3N 3EZ8A 2AV1A 5FDWB 1JF6A 1OAYH 1HZHH 1RZGA 3K81A 1X6NA 4EI5C 2ZSWA 5IV2A 4K9EH 1E4WL 1CT8A 3EFFB 4NM4H 3THML 5AZ2L 5DRZA 1OSPL 4NO2A 3UJTH 1XGYL 2XG5A 3T3ME 4YK4C 5JQ6H 5JOEA 4XXCC 1IAMA 1UXWB 2F5AL 3AS0A 5EB9A 1GAFH 1OAXL 4M6OL 3IDXH 1DBKH 3MV7E 5DR5L 1WEJL 1YPZA 4OFIA 5EO0A 3D3VD 3AMLA 1JZ3A 3E8UL 5HJ3B 3HR5B 4Z78A 4WW2B 4GW4A 4EUPA 3GSXB 2DM3A 2YWYA 3SCMD 4C4KT 4I18C 1UKSA 5I1EL 4OZHF 3QHTC 2BSED 3TT3H 1LK3L 1UM5L 1AR1D 2F53E 2CXKA 5KAQG 3HB3D 1OLLA 4J3UA 1S9YB 2WBKA 2ARJA 2ZUXA 4IM8A 5KANG 5FCUL 4KAQL 1RUML 1MCCA 3DMMA 3V5KA 4G9FE 4XBPB 1QQDA 4ODTL 2VZUA 2APWA 1I7UB 5B4MC 1A2YB 1RI8A 4PIRF 3FRPG 4HPOH 5K9JH 3NIFE 4X5XA 4X6BB 1KACB 5SX5H 5C0BD 1NC4D 1Q0XH 2IAMB 2P4AB 3TNMB 3V6BR 3T2PA 3RWHA 1OGAB 3B4NA 4OF8A 5FYKE 3CLEH 2WUBL 4HW6A 1ZLVH 2NY6B 4YHIA 2BK8A 2Q86A 4Q7DA 4BFIA 2KQNA 3L5WA 4JRYD 2COQA 2C3HA 5DHVB 3LHPH 5KW9H 2DAVA 4KWUA 3OF6A 5DRXA 2OLDA 2VDLL 3RVWD 1NKOA 4O2EA 2YPVH 3LS5H 1OAQH 1NFDA 2JJUA 4NKDA 3OKEB 4AIOA 2C26A 1EERB 2ITDB 1OGAE 2XTLA 4G7YL 1MLBA 3ARUA 2N56A 5FUCC 5TE7H 5IBLC 5CEZH 4LDEB 4OZIB 4LVEA 4ODHL 5CCKL 5HYJE 3RWHB 1WFOA 1QBMH 4XHJC 1NMCC 5GRVK 3HE7B 1JPSH 3KR3L 1BGXL 2A77H 5J9PA 5E2UL 3QWQB 4LPTA 4PJCA 4CU7A 4S2SB 4HGKC 1KXVC 1I8MB 4G9FA 1ZOXA 2UZXB 4NC1E 3WXWL 4U2ZA 3U6RA 4WHCA 2X7LA 4I2XB 4LCIL 3FQTA 1KCRH 2BSTB 4PRPA 5EORL 3VCLB 2IFFL 2BFVH 2Q8BH 5IWLC 1T1ZA 4GRWB 1Q8MA 5BRZE 2MFNA 1JN6A 2F54A 1J9CT 2X09A 2YEZA 1WUNT 2PO6C 1C1EL 2QHRL 1HNGA 4C83A 3L7FB 2OMBA 3PL6B 3SN6N 3BJLA 3CX2A 3SE8L 5T1MB 2NZ9D 4KMLB 2EYRA 1F6FB 1CVRA 5GS1C 4TSCH 5MP6L 5IEKB 3PWJB 3P2TA 4G43B 1MWAH 1EEUA 4G6AD 4P2OA 5I15H 2C7UB 5IHLB 4G80B 4P3DB 4P23C 1FPTH 3VMOA 5EU5A 3EYSH 3SDXE 4TNWF 5I8EB 1T21A 5JW3L 4JQVC 1LO0L 4YBQC 1H8NA 2AJZB 5CJBA 2FATL 4HUXB 2JJTC 5FEBA 4J8RB 2W0LA 4HQQH 1MHHB 4MQTB 1DDHB 3VFNA 1VFMA 1HINH 4PJCE 1YEDB 3BZ4A 4ZS7L 1A1NA 1CIDA 5DMGC 2BY3A 1FL6B 3OXSB 5D1ZA 2A2QT 4J12A 3MOAL 3O3EA 4K9EC 5TE6H 3MXVL 5I16B 1MQ8A 4M6OH 5D2NC 1JBJA 3Q2CA 3DUSB 2DIAA 1TTFA 1P7KA 4YHYB 2OZ4L 4AEHH 4E42B 4ZAKA 4F9LA 4OJFH 4YHMH 1DBMH 3L5XH 4URTB 1AQKL 2YUXA 4N90D 4JGMA 4K3JH 3NABH 3E6HB 3ARED 1YPZF 3RNQB 3HMWL 1I1RA 5IV2B 1REIA 2OCFD 4WDIA 1CFNA 1AH1A 3DXAA 3CC5B 2WZPD 4WI7A 3RDTB 1PKQA 1JPGA 5ESQA 4XWGL 3X3GL 4KAQH 3ABZA 4QHLA 2CJUH 1N7ML 2XTJD 4PGDB 3IVKA 2NY1C 1ZE3C 5HYQB 2PW2A 1KC5H 3HI1B 4YX2L 1F6AA 4XZUB 2WQ8A 3F58L 4N0FA 1SY6L 3ROLB 3UMTA 1T22B 4OZIA 4PRBA 3HZVA 5EBWA