1NLBH

Crystal structure of anti-hcv monoclonal antibody 19d9d6
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
218
Chain Sequence
b'QIQLVQSGPELKKPGETVKISCKASGYTFTDFSMHWVNQAPGKGLNWMGWVNTETGEPTYADDFKGRFAFSLETSASTAYLQINSLKNEDTATYFCARFLLRQYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody 19D9D6 light chain
publication title Crystal structure of a hydrophobic immunodominant antigenic site on hepatitis C virus core protein complexed to monoclonal antibody 19D9D6.
pubmed rcsb
molecule tags Immune system
total genus 42
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2003-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nlbH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nlbH02
4Y2DC 3RUGE 5HD8C 1IGTA 3S97C 3WIFA 2ILLA 3EYSH 4LDEB 4RMRA 3FJTA 4X9FA 3PL6D 4FRWA 3JV5A 4P3DB 1FYTA 3O4LD 3ZE2E 4FZ8H 3A6BL 3FQNB 5BMFL 1RVFH 4G9FE 3MBEA 1I1AD 4FXKA 4GQPH 4DKFH 2Y5TB 5T5FL 3QPQC 5IEHB 3QEQA 3GIZH 3BHBA 1QBLH 4FQXC 4KUZH 2P4AB 5D1QB 2ZOKB 1A4JB 1MVFA 3Q48A 3SHSA 4NGHH 3GBNH 4R3SB 1IGJA 2R56L 4PBXA 3L5IA 4Q0XH 1S7TA 2ZG1A 3I50H 3ALXA 5ECJE 3DRTA 3FB5A 2XA8H 1R3JA 1T7XA 3L5WB 3P0GB 4K7PH 4ONHB 3KYNA 4V1DD 5DI8A 5T1LB 4E0RB 4RGNC 1QQDB 5ESQB 1U8KB 1YN7B 3MR9A 1S8DB 1TVBB 3F5WB 2F54A 3V6OC 4KTDL 3HAEA 4Y5YC 5T1KB 5SWQB 1NAML 2V5SA 3PHSA 3MRNA 3VGFA 5JXEC 2NY4B 1EVUA 2XWTB 2BNRB 5J6GA 3OAUL 1CE1H 3TCXA 5IHUH 2IAMD 5KVFL 3ETBF 4OGYL 3S35H 2AJSH 4OD1H 1WFTA 1IGCH 5FYLD 4ZXBD 3SQOH 1XGPA 4W81A 5C0RH 5J13B 3K4ZA 4ZFOL 4QXGL 1OLLA 5GIRB 5EH1A 4L3ED 5IJVA 5DSCA 1SQ2N 2Y23A 1ZTXH 3DRQB 4UAOC 3TIDA 1ZANH 3MV7A 1B90A 5GSRB 1CL7I 3GKWL 3QUZC 5GZND 3KXFD 3MUJA 1N6QH 4F58L 5J11B 1P4IH 2X7LA 2XKUA 4HGWB 3EGSA 3O6KH 2ED9A 2XIDA 2EKSB 2Z35B 1WWCA 4DFIA 4L8BA 3BAEL 4DKEL 4H1LH 1GC1L 2VLLA 5BXFA 3U1SL 3CSBA 3QPXL 5IQ7H 4K3EL 4QGYA 4YIQB 3OZ9L 4LCIH 2X1WL 1UXSB 1OM3H 3HE6B 1TJHH 3TEUA 4P2OD 3TVMD 1HI6A 1UJ3C 5DHVB 2K9UA 2EXWD 2C4FU 3EYQD 3PF2A 12E8H 4NDMB 4ODHL 3O2DA 3TJEH 1CK0L 3PXJA 3RX8A 2HFEB 3BGMB 2XKSA 4G6MH 4NBYB 2R0LH 1D5IL 4PGEA 1R5VB 5HY9B 5D7LE 4YLQT 2X4PA 3VD5A 5FYJD 2FX7H 3NFSH 1YMMD 2VZSA 3MLWH 2F5AH 4QRSB 4NC2B 1UACH 1F4XL 2V2TB 4IIQA 4R7NA 1AD0B 3B8SA 3F7VA 3BWUC 4JCMA 2IQ9L 3HLAA 3HC0A 2XPGA 2HLAA 3UTTA 4JPIB 5CJOL 5EU7E 2XN9D 4U1KB 1I3VA 4UT9H 5MENB 5I1KH 4YC2C 1CGXA 3O2VH 5GGSY 5I17B 4KK6C 2UWEE 4I0PD 1UWXH 4P57A 5J1SC 1AC0A 4U1NA 2ARWA 1FNSL 3VU2A 4Z77B 3RUGA 1ODAA 3HNVL 2GTWB 4HV8A 4TSAH 3FRPG 2FJFB 2XYCA 5TDOA 4BFIB 3BN9D 1FZMB 2OI9B 3MJ9L 5E99L 1N8ZA 3TP4A 1KELH 4Q97A 3U0TB 4LU5H 4UOJA 4R26L 1KB5A 3MRPA 4U1IB 4YXHH 5KJRL 4JJ5A 4XXCA 1KB5H 2V2WB 4KVCL 1C16B 4WFGE 4QRRE 3HHRB 2WUBL 2WP3O 2VABA 3QULA 3R0NA 4IRJB 2ADIB 2DIBA 3GJFB 3BH8B 3QAZB 3U30B 2H32B 3AB0B 4WO4A 1PZ5B 3HUJB 4WI7A 1A5FL 1NEZB 4LDLB 2NYYD 5HHQA 3VJ6A 3UO1L 3BPNC 4HIIA 3IETA 1F00I 5FHAH 2J5LB 4I4WB 1B88A 2X05A 2CXGA 1JNNH 3BO8B 4TOYH 4XBGB 3RAJH 4N9OB 5HYIA 4ZOCA 4ETQA 1F2QA 4XX1E 4RA0C 1HZHL 5EU6E 2XQYG 2YR3A 4XP4H 2IBZY 5FYKL 3OKKB 1MY7A 4O2EB 5J9PB 3EYOA 3QG6B 4XB8A 3MRHA 1T89A 5L2KD 2B1HL 3G6JF 2Y36H 4HKBA 4XVJH 4BH7A 15C8H 1G7JB 3IU4L 3RVUC 1BJ1J 2CKNA 4U7KA 1KFAL 3KPSE 5B38G 4OFYD 2BOBB 1MCFA 3OKOB 5F7YC 4LSVH 3D5OF 3WXVH 1NGXA 3QWQB 4OLWH 5JHDB 1H3UA 1HNFA 3CFBA 4U3CA 3DJ9A 3KPTA 4NQXA 4RFNB 2GSGB 2NY5H 3ARFD 4HHAA 2GAZB 2VLJB 4HS8L 4L4VE 4GW4B 5FO8B 1JI2A 1FYTD 3DBXB 3VDAA 2IANE 5I71C 5TDPA 1OAUL 5E8OA 3IVKB 4WI2A 5JW4Q 1JHKH 3VGBA 3JZ7A 2NX5B 3MBED 4XXDB 2HT4C 4OTXH 3QEQD 1IAIH 3WHE1 4MJ4A 3DV4B 4OM0L 1ZMYA 3T4AB 1CTNA 1G0XA 2P8LB 5D7LA 4OLZH 5EPMA 1T2XA 1BF8A 5EDXA 3EDDA 2CIKB 2D03H 2VQ1B 4JVUA 1GSMA 1YEFL 1BD2E 1VSCA 1YEHH 4BELD 1C5DA 1EFXA 3QI9B 3B9KA 2WINA 4YH6A 4YHZH 4XMKH 2C3VB 4MVBC 4LARH 5J06A 2EDFA 4L8SA 2F54D 2H2SC 4JDTL 5BV7L 1T1XB 1XR8A 4XC3L 5HGAA 3MNZB 3NA9L 4G3YH 2D7MA 1UXWB 2X4SB 2EIEA 3LD8B 2YA0A 2UWEA 3CVHH 2NY0B 2AK4D 3KXFB 1I9IL 4OZGF 5CIPA 2A1WH 4OF5A 2OTWA 4LSUH 1RMFH 5EZOH 2D4DA 3MNVB 4M43H 5IB4A 1KIQB 2CUMA 4IOIA 3B3IB 4IMLB 5CSBA 2G2RA 1T3FB 2Y06L 3QQ4B 3M8OH 3H9YA 2GK0B 3MRKA 1AGEA 5JR1L 4LHUB 5LQBH 1Q9LB 4FABL 1RHFA 4KAQL 2KH2B 2Q7YB 3B5HA 5MEOB 1AO7B 1MHHB 1CU4H 4HKJB 2HKHL 1BOGB 4M02A 3C8HA 3U7WH 2YPKA 5F6HJ 4QRRA 2XTJC 4Z7QF 3LN5B 3STLA 3BZDA 1HXYA 3QCTL 4TSCH 3CDYA 3T0EC 2B0SL 2BCKA 1BFVL 2ZJSL 5IBUG 5ITBH 3L3GA 2PO6B 3IJHB 4NRXB 2ICCA 4YHLH 4RAUB 5D7JC 1XF4B 4XNMA 4PJ9A 4PJFF 4HG4K 2EIDA 3MCLL 2QSQA 2CLZA 4PJ7B 3CX5J 1GC1C 3KR3L 5HTSA 5JMOC 1WWAX 3QWOB 5E9DE 4HW6A 3C60B 2SEBA 5EU6A 5L7XH 5AAMA 2B1AL 5FF6B 3EZ8A 3QO0B 2MHAA 3QUYC 4FG6D 4Y19E 1TQCC 3DV6A 1K3ZA 4JM4H 5DTFB 2NY3C 5K9QG 2ERJB 1G1YA 5I66B 5IT2L 5I15H 1MIML 1HYSD 3FZUD 4W6YB 4FQHB 3UTTD 1SY6L 4HUNB 3KPSA 2MSPA 2CK0L 1A6VH 1DE4B 1UB6B 1EHLH 4APQA 3GSXB 1TFHA 1KJ2B 5DJZA 1IL1B 1WZKA 4XPGH 4EN3C 5T3ZL 4HKXA 4LSDA 4NKDA 3HR5A 2CXKA 1NJ9B 3IFLL 3VFVB 5I75B 2AEQL 5TQ0H 5FYJU 3CMOH 4L4VA 1U3ZA 1CG9A 1ZLWH 3BDYH 1D5ZA 3KPNA 4HPYL 4IOSD 4WY7H 1RZIA 3K3QA 2GTZB 3KDMB 3EJYC 4HJJL 4P46B 3B2VH 2BSSA 1I4FA 3BI9X 4YHYC 4ETYA 1E28A 1TQBB 1FVDB 1BWMA 5FUCC 5F44A 2HN7A 1EGJA 2FHBA 1XF3B 3STZB 3PWLB 3BVNA 4WV1C 2XACC 1I9RL 5H94A 4JFHE 1RJYB 5FM4A 1BD2A 1BEYL 4WO4D 4PJEE 4PG2C 2W65B 4LP5A 2AJVL 4Q7DA 3VRJB 3ARQA 1B9ZA 3IDNA 1F4HA 2DQGH 5DRNA 1YDPB 4TPRH 1Z9LA 4MNHB 1BVLA 3GM0A 4AJ0A 1IC4H 4ZODA 4RZCA 2R1WB 4X99B 3BXNA 3BZFA 1LO3L 3BZEB 1U91B 5JW4N 4MCYB 2WQ8A 3BESR 3IGAB 1FORL 1IKNA 4L4TE 3QQ9C 1QBBA 1T5XA 1J11A 2YA1A 5MP6L 2IMNA 2IH1B 5T1DH 5LGJA 4OLVH 3UPRB 1MFDL 4WDIB 4MX7B 1YA5A 4TTDD 4Y1AB 2EDDA 2GJZB 2CJUH 3ARFB 3ZKXC 3ZT6A 4NPYA 5F6HI 4KROD 4OZFH 5T3XL 1BGXH 5FK9A 4NYLB 5DJ0B 4ODXA 2IC2A 4NO5B 1JZ4A 4Y4HB 3VWJD 1LEKB 5T33H 1G1CA 2UUDK 3DROA 4AQOA 5KSUB 1QO3A 5HDOA 2OXGA 5IF0B 5A16A 1A22B 3VXPB 2IPUK 3O3EB 2VDRH 3SOBH 5JW4R 4YQXL 5D7SH 3MLSH 1I7RB 5KSBE 4KZEL 4NM4H 1CICB 1XF2A 4NNXA 3B6SA 3O8XC 4KRPD 4RCAA 4OCXL 2BSTA 2BMKA 2P49B 4Q9CA 4MS8C 1HH6B 3EOTH 1L0XA 4WU7A 5IB1A 3TCLA 4PJ5A 2R2HB 1A6AA 4QHUA 5C2BH 5J8OA 4P5MB 2FATH 4LPUA 4YZFF 4K3HA 4M7LH 4X6EA 5E9DA 4LLDA 4XP6H 5D7LD 4PR5A 3OV6A 2C7UA 3QIBB 4WI6A 3QDGB 3IXAA 5J6GB 2AK4B 4FXGB 4NOBA 5HHMB 5F71A 5FV2A 1EFXD 4Y19A 1R3LB 3B9KD 4X6BA 4U0QB 5ESAB 1EO8L 3D69B 2E9JA 3NIFE 3QCUL 1GGIL 1HHGA 2EH8H 2IFFH 1U41A 3MACH 5IW6A 3VXRE 4L1HA 1D5MA 3QDMA 1QA9B 4YUEH 3QISA 4QHLA 1DQJA 3CAFA 3V79C 3WLBA 5IFHL 1PKOA 2NY4C 3MRLB 1QBAA 2LAAA 1UG9A 4N68A 1KN2H 1SEQH 4LIQE 1JF1A 3T0AA 1SHMA 2AJZB 2ZWLT 1CQKA 2X7LB 3QA3A 4H1LB 4ZOBA 4ZOAA 5J13C 2HMIC 3LN9A 1INEL 1A47A 3MRQB 1NGQH 3P9MB 4XAWH 3ZHKA 1QHOA 3TT3H 2BRQA 3GM8A 5IR1B 3ES6B 5I1EH 2H2PD 1DLHB 1T66C 3QDJE 4PP2A 5BV7C 4GOSA 3VXSB 1EHXA 5DRXB 4NNYB 3WHXB 3V5HB 3SKJL 3GRWA 4G8FA 3O0RH 3UAJD 1ZGLM 5J11C 5IROA 4JQIL 1QFUL 4JZJB 2AGJL 5GRWA 3ISWA 4OCNC 2ED7A 2R29H 2Y25A 4IRSC 4KJPD 4YK4B 4KKLC 4WFGD 4DN4H 4QRRD 2AJUL 4HIEA 4HK0A 4TYUA 2OMBA 5I1JL 3BPCA 2DKSA 1S7SB 2NX5E 3CMGA 4X7EC 2X10A 1XCQB 2P8MB 1H3PH 3MJ6A 2AEIT 3R06A 3DETC 5DWUL 2VWEE 3LS5H 3CH8A 4YHKH 5HXMA 2NY7L 1U8HA 3DX9A 4PJEA 3ZHDA 4YHMH 3HMWH 4PJ9D 1OW0C 4XHJC 2YSSB 5L9DL 3C5SB 3HZKB 4NHUB 2DAVA 4OGZA 1CWVA 4R7NB 5HSFA 1WC7B 4LEXH 4LF3A 4AL8H 1ORSB 2PR4L 1KF9B 4MXQC 3MOAH 1DQMH 3DVGB 1J8HB 1JWSB 5E6IA 4KZDH 1Z9MA 2VAAA 3C8DA 3MROB 4BH8A 1AI1H 3BYYA 3T09A 4L4TA 2FL5A 1KACB 5EU6D 3HB3D 3GKZA 2YC1A 3DWTA 4GS7B 4K8RL 5CJQL 1EJ6A 1J10A 1KJ2L 4R8WL 3BFOA 5KN5A 3N1PC 3SY0A 4M7JH 3SDXA 4WTWA 3RNKA 1FVEA 2IWGA 5TDOB 1RFDH 3O3AB 5ANME 3HG1A 3WDHA 2QSVA 5ABDE 1P4LB 1KCSH 2NXYC 4A2MA 5K9JH 3KPSD 3GUTB 2JJTA 3MREB 1GGBH 4XCFL 4APQD 2LU4A 2WMPA 4N1EA 4LLQA 3WFDL 3VXOA 4M61B 2FB4L 4JG1L 1UH3A 4JFXB 2P7TA 4PIRF 1TNMA 4TNWF 2BDNH 2NW2B 2X1QA 1BWWA 3CFEA 1PQZA 3N85H 3OPZL 4Q9BA 5KANG 3VFSB 5IEKA 2OI9C 4YPGB 5TQ2H 1UCBL 4L4VD 5KSBA 4NO0B 5CLWA 3VG0H 1P6AB 2HT3D 2CDGB 3WFHB 4GG6F 3WEXB 3P4OB 2G9HB 5CLTA 4HFWA 1P84K 5DD3L 3R8BB 1KCUL 5I8OL 2YS4A 1GZPA 4I48A 1T83A 2FDBP 4CMMA 2XXMB 3QXWA 1CDBA 1CDHA 4KKCC 4PJ7E 4MNGB 3U30C 1BD2D 3AB0C 2X1PA 1BBDL 2C3XA 3P77B 4OZIF 2DMKA 4GKOA 8FABB 1FNEA 1VA9A 4CN4A 1I9EA 3QHTC 4CMHB 1F5WA 2ICWB 2Z31B 3U0PB 1TZHB 5IB5B 3EYSL 3VXRA 5GISH 4GLRH 2J5LC 3SCMC 3SDCA 3PGDA 4DGYH 3GMLA 3AREB 3FKUS 4FZ8L 2A83A 1E4JA 1RVFL 4NRZB 1JYVA 1FP5A 3GIZL 1QBLL 4KUZL 1QSVA 4OCRH 3VWJB 4N0FA 1MEXH 4RQQA 3RWJB 5A1AA 4NGHL 5TE4H 3GBNL 4PJAA 2YXFA 4NN5B 3MV8A 3IRZA 4Q0XL 3BEWB 2NNAB 3I50L 1NFDF 2XA8L 4JZNB 5DS8B 1IEAB 3QDJA 3IJYA 3IS0X 4K7PL 3S88H 43CAA 1PSKH 2FEEL 1WBYA 3AROA 3NCMA 3VGEA 1R6VA 4JPVH 1HILA 4KRNA 1X4XA 5LGHH 5TDNA 1T7VA 5HYFA 4KRPB 4XGZB 1XGYH 3H9HA 32C2B 5GS2H 1LEGB 4P5TB 5ALCL 2A6DA 3MJ7A 3KPRE 4WUUB 1Y0LA 4JKLA 2COQA 3ULVH 4RFNC 3SPVA 3BD3A 3FB6A 1CE1L 5IHUL 1JRHH 1KPUA 4Z78A 4GBXA 3S35L 2AJSL 4OD1L 4J4PA 4MZ3A 1U3JA 1IGCL 3SQOL 4YWGH 1KC5H 2VRAA 4ODVH 2I27N 5C0RL 4DOHE 3FFDB 1N7MH 3EO1B 2N56A 5SX4H 2Q76A 5H35A 1G0DA 1NC2B 2MNUA 2P5WB 4PJ5D 1FIEA 5JPMA 1ZTXL 1ZANL 3RWIB 3FT3B 4PJCB 5HI3C 2JCCB 1L9NA 4WFED 5E9DD 1N6QL 3GDBA 3CVHB 2E9IA 4KJYA 1P4IL 2QQQA 3ROLB 3O6KL 3L1OH 1LD9B 2HJFB 2YPVL 2IAMC 3FQWA 3W39B 1TCMA 4O51B 3QI9C 1TTGA 4KJWD 4Y19D 4ZO9A 2FIKA 2FNBA 4BSVA 5IQ7L 3CZJA 4XCNB 2CPCA 4LCIL 3QDMD 1OM3L 3RWEB 5ANMA 1TJHL 4W68A 3BH9A 5CGMA 5EC2A 3LD8C 2DB8A 5FHBH 12E8L 2YA2A 5I18L 1F11B 5D1ZB 4L8CB 4HJ0D 3TJEL 2ZOLB 4U7MA 4J6RH 4NUGH 5D9SB 4G6ML 2PYEA 3MV11 2R0LL 5GRVL 2I07A 5ITFB 4YE4H 5GS1A 4DUWA 4MD5A 2FX7L 3NFSL 1JGEA 4PRPA 3T1FB 3BX7C 2IH3A 2BC4A 4MJ6A 5DJCB 3MLWL 3DGGB 2F5AL 4KC3B 4XBPA 1UACL 2D31A 2ARJQ 2P5EE 1AGCA 5M94B 3OAZH 3TVMC 3PHQB 4U6HB 3DVNA 4Q2ZA 5CD3B 2JJVA 3L9RB 4I5BB 2MOVA 3EYQC 4CN1A 4DKDC 4UT9L 1MIEH 2FHCA 4Y5VB 5I1KL 3D85A 3P9LA 1RV6X 3U4EB 5D6DA 3KPLA 3X11A 3O2VL 3WJJC 3U4BH 1JHTB 3RKDC 5AG9A 4RISH 5AEAA 5JZ7C 1ZHBA 5HDBF 2C3HA 4RBPK 1OT1A 4BK4A 4X8XA 4D0BB 2FGWH 2BVYA 7FABH 4TUOA 2HFFA 4TSAL 3LH2H 2FO4B 1LHZA 3PP4H 3QDGE 3OJVC 3PIQA 4N9GB 1A02N 5HHME 1GJIA 1K4DB 4P2CG 4MA1C 1KELL 4QT5A 4AK1A 1C08A 4D2NA 2NMSA 3MRJB 4LU5L 4UU9B 5E6ID 4ODTH 3SE3C 1DN0B 4XVTH 3C60C 4BQ8A 1CDCA 4R9HA 3LKOA 2D7PA 4YXHL 4L4TD 5FKPA 4I0PC 5HYSA 1F3JA 1KB5L 1J05A 2ZSWB 5GSVA 1ND0B 1P6FA 4Q6IB 2ATKB 2ERJC 1E4KC 3BP7B 5KAQG 1MVUB 4TUJA 1T1ZA 3ZDXE 5KAQF 3IT8D 3WJLA 1Q9OA 4IDLA 3HG1D 2J7LA 5CZXD 1CDYA 3C5ZA 4F7EA 1E27A 1AXSB 3RY6A 5DVLA 4XNXH 3U4AA 4K8RC 5CEZH 4F3FA 5BQ7A 5FHAL 5IIEB 5DJ6A 3AAZB 4C54A 3KPRA 4D0CA 4K94L 3I2CH 2C9AA 1JNNL 3O3BB 1OF2B 4TOYL 4M1GH 3RAJL 5HJ3B 3FQUA 5J6HB 5I75C 1A6UH 3O45B 4C83B 3AGVA 3B2UD 1QLFA 2Q3AA 5FKAA 1H3WM 4XP4L 1C5BH 1J0YA 4PD4J 2BY3A 4P46C 4FQLH 1UJTA 2IADB 1UH4A 5DQJB 1TQBC 4HK3J 3CUPB 3GSRB 2NYYC 3QNYA 5C07E 4XVJL 15C8L 4JM2B 4ZDHB 3F6IA 2W91A 5SWZA 1G7MA 5JQ6H 2ITCA 1S7XB 4HGKC 3QXAA 1MWAH 2DBJA 3E8UH 4Y4FA 3KG5A 4G7YH 4QRTA 4LSVL 4PB0H 2C3WA 3WXVL 3VXTA 1MLBB 4X6FB 4OLWL 3ZTNH 4M93B 5E1AA 4K7FA 1G9MC 1DQQB 4P2YA 2DTMH 2NY5L 2VDQH 4L5FH 5HYJB 4FFVD 3VXRD 2DJUA 2WV3A 5DEGB 3FTGA 3SDCD 1GOFA 2CDFB 4OZFB 1T5WA 3MMEA 4JZOA 3UYOD 3VFNA 4KFZC 5FA4A 2JJSA 1JHKL 1VADA 3ARGB 1M7IA 4WW1B 5C08B 3P0VH 2ZSVA 2Q6WB 4LDOB 4OTXL 3OKEB 5FO9B 1P7QB 3HC3H 4G5ZH 2AW2A 1IAIL 1B0RB 4ZQKA 1D9KA 2DLFH 3MV8D 2VYRE 1H3XA 4KK9C 1TVHB 4OLZL 4EDXA 2D03L 1JPGB 1ZLSH 3QDJD 1FG2A 3ARFC 5AUMB 1VEPA 1YEHL 2P5EA 5JORA 5I1AB 1U8MA 4ZUTB 4YHZL 4XMKL 1BQHG 2EEBA 4LARL 4ZO7A 4HXBH 1Y18B 1PKQE 2VZTA 3MBEC 2Z8RA 1KJVB 2VDKH 2WIIB 3P2TA 1YMHA 4UIKL 3MUY1 4G3YL 3ORJA 2B4CC 1VKXA 1FV1A 3CVHL 1FL6B 2QR0A 4UI2A 4S1SH 5KOMC 3W9DA 1SBBA 2A1WL 2DDQH 3RGVB 3QXTA 4LSUL 3V0AC 4GBXD 1RMFL 4J4PD 5EZOL 5F7DB 4M43L 1TCRA 1OVZA 3D39A 3K46A 2UZIH 3LQZA 1NMCC 2BVOB 3TWCH 1JK8B 4OCWH 2P43B 3H2WA 5ACMA 1UEMA 2LVCA 4HX1B 3M8OL 2D7OA 3VH8A 5LQBL 2CUHA 3QDMB 3LS4H 4M6NH 4JREB 4BQCA 1G7IA 2K1MA 5HHOE 4S1DD 1HQRB 3QIBC 1CU4L 2VDLH 3GJEA 3LRSA 3U7WL 3TA3A 2RHEA 4S0SD 2UUDH 5F1IB 1P7HL 4GG8A 1NGWB 4KI5F 4TSCL 4DN3H 5FECA 2WIMA 5ITBL 5B8CA 5DK2B 4YHLL 1DL7H 4PTUA 4PP2B 1YPZE 1T20B 1AFVH 4TVSa 4DCQA 4MQSB 2QKIA 5DMGD 1GXEA 5E5MA 2HA1A 1ES0B 1T0MB 4C58B 1OHQA 1W8NA 3MGAA 1KCKA 3BZ4B 4PTTB 4PJGF 3ZE0E 4UDTB 3VD3A 2YBRA 1IQWH 2EDLA 4OZHF 4OD2A 2PYED 5DEFA 3OGCB 1FH5H 1WAAE 3MJGX 1LILA 2EH7H 4LCWB 5IVZB 2DQJH 4PRPD 3QZWG 5EO9A 5L7XL 5AZ2L 2O61B 3VFOB 4PV9A 2JB6B 1FQ9C 2DBLH 4HC1H 1KLGA 1KIRB 1XGRA 4UDUB 2D0FA 4J3TA 3W5NA 4JM4L 2GHWB 3ZKMD 4JZJC 3MRFB 3OKNA 5I15L 5HVHC 5C07A 1EXUA 3HPLB 4YK4C 4YDVB 1I1YB 1WZ1H 5CP3H 1SJVA 3NCCB 2BP3A 5CHNA 3RWHA 5KG9B 2Z0BA 1ZXQA 1QFWI 5JO5B 5FV1L 1N0LA 1YNTA 2A9NH 1A6VL 5F9OH 2AJ3B 5E8DH 2EDNA 3HA0A 1EHLL 2P5WE 1MUJB 5C9JB 4YHIA 3S7GA 2J8UB 1ZKAA 1U3HB 4XPGL 3GHBH 4EI5A 1W8OA 3TN0A 4JRXB 3QXDB 1TLKA 4F37F 2F74B 4FG6C 5HVGB 1JPTH 4QRQB 1H0DB 1DQTA 1KTDA 1T7ZA 5TQ0L 3FONA 1FNAA 3SDAB 1U8OA 5H2BB 3CMOL 3KNBA 4XPFH 3BDYL 3FT2A 2X4OA 1HYSC 4N1HB 3FZUC 4WY7L 1AD9B 4ELMF 3B2VL 5CBAA 4KUCF 3T2PA 4X7TB 1S9XB 1CXKA 2UYLA 2NTFB 2W59A 1G0YR 1X5ZA 3RZCB 3I85A 4MJ2A 4JANA 4OV6F 1ZHNB 4GS7C 4KKBD 3QXVA 3V52H 2E6PA 4KMQA 5C09E 2AI0H 2PW1A 1WWWX 3BE1H 4LSTH 5DXWA 4EUPH 2A6IB 1T04B 1FCGA 1O5DT 3L7EB 4NC1C 3CU1A 1IC7H 4PJXA 5AD0A 1DSFH 1NUFA 4U6TA 5IEKB 4IS6B 5BRZB 4HCRH 4ZFFB 1JUFA 3GBLA 3C5ZD 1JWMB 1LE9A 1JNJA 1CL7H 1U8NA 3MCKB 3BQUB 1PKQA 1HOCA 2DIJA 2BNUA 2DQGL 2EYTA 4TPRL 2CRYA 3CC5B 3KPRD 3KLHD 3U46A 1IC4L 4XXCC 4DW2H 4KHTH 4XMPH 2HP4A 3WSQH 4MNQA 3KVQA 1JNHA 2YN5A 2KPNA 1FZKA 1ETZA 1OD7A 1I7UA 3GMNB 2EDWA 3OR6B 5JQHC 2CKBH 5T1DL 4U1MA 3VFTB 3EDEA 4WO4C 1A6WH 1NLBH 4OLVL 5FAAA 1FNEB 1N6VA 1ZA3B 2CJUL 1NBZB 3IDJB 4FQQB 4K94C 4OIAA 5BZWA 1KB9J 1ONQA 5SWZD 3MNWA 4OZ4B 5J4MA 4X5LA 1BGXL 3QEHB 5HHOA 5BJTB 1Z0MA 3OMZA 2LFGA 4OIBA 5T33L 3UYPA 1D6EB 1XF1A 5DFWH 1ZT1B 2DWEA 3QG7H 5C7XL 3UXFA 4OKDA 2Z8WC 1J86A 4X9BA 3F12B 3PWVB 4QHKI 3KJ4B 4FA8A 2VDRL 1I3RA 1T89C 5INCA 3SOBL 1MCKA 1M6OB 5D7SL 2GT9B 3MLSL 5LAXA 1YPZA 1WBXA 3L7FB 3QQ3A 4NM4L 5KW9H 1R3HA 4RAVB 2PCPA 1GOGA 2B7DT 1JF5A 4X5XB 1SMOA 3EOTL 3L6FB 1CVSC 1BZQK 5EU4B 3HZYB 3VWJC 3M07A 4Y2OA 4JFQB 2FATL 1W72A 1D9KD 5DQ9A 4NN5C 3TNNA 4M7LL 1WAAA 1K8IA 4B50A 1CFQA 1S7RA 5H37H 4ZNCD 5FOBA 3EYFB 1HHIA 3FB6B 3KWWB 5DD0H 1MF2H 2P5ED 5E2WH 1D5XB 2JJWA 3DUSA 2XG4A 1LP9A 1KLUB 1QBMH 3C8KA 3BKCH 1U95A 4GAJH 4KRPC 4ODSH 2EH8L 3MACL 1HQ4B 4R4BA 4Z0XA 4JB9H 1SYVB 4YUEL 4G8IB 2ATPB 4F33B 1MSPA 3GK8L 5GJSH 1DTUA 5CJBA 2VISA 1KN2L 4PJHF 3MBXH 1CT8A 3F8UB 1SEQL 3MXWH 1WFNA 1R5IA 5L8KB 3CSPA 3O3DA 1CDGA 3RU8H 1NGQL 3D39D 5ALBH 3EOAA 4XAWL 3B9KC 3TT3L 3BP6B 2CO6B 3PGFH 5I1EL 2CSPA 4QRUB 2BVUA 4IJ3B 1DFBH 1CFBA 4Q9QH 3MGTB 1GL4B 1DBJH 3GMOA 3IFPB 4LPWA 1PZUB 2RQ8A 4MDJB 1KG0B 4LHQB 4XP5H 5FGBA 4GQ9H 2E9WA 3O0RL 4QYOB 2YHGA 4YHPA 1U92A 4U1JB 3RBSA 4XBEH 2R29L 4KTEH 3TA3D 4JRYE 1A6TB 5D6CB 2PXYA 5DZLA 1I85A 4DN4L 4AM0A 2H1PL 5C09A 2FSEB 1H3PL 5F1NA 4JFFB 5DRWA 3WIHA 4YHKL 3LS5L 4N1CA 4NT6B 3HMWL 1EV2E 4XBPB 3K0WA 3WIHH 3EBAA 5KSAB 2W1NA 3MRIB 3VD7A 1DEEB 4AIZA 1FFPB 5D1ZC 3GO1H 3UAJC 2HJKA 3DUUB 1QRNA 1HHHB 2FX8H 4LEXL 2BRRH 5HHNB 3KPMA 3I84A 4PRBB 3D3VE 3L3KB 3MOAL 4WGWB 3TPUB 5DD6A 1DQML 1DUZA 2V9TA 1HHJA 3HNTH 4YGAB 1VGEH 3SEPA 4BUHA 3VRIB 5I1IH 4KZDL 4X80H 2X44D 3S98A 2EDTA 1NUDA 3ZYZA 2PUQT 5IB2A 1AI1L 4DZ8A 4NQSB 3LMJH 3LPFA 4QF1A 2P44B 1XF5B 2YD4A 5J7CC 4G43B 1F42A 1I1FB 3K8KA 4FNLH 3V4VH 5IJKA 1I8KA 2ARJB 1ERNA 1LO5B 3CDCA 3G04A 4GMSH 4XCEA 4PJ9C 4M7JL 4PGCA 2R39A 5C0AE 4RNRA 2XICA 4NC0B 4RMTA 1IGYA 5C07D 3LSOB 2HVJB 1BQLH 1RFDL 4Y5VC 1BAFH 2XT1B 3IKKA 1KCSL 5K9JL 4BSWB 1KT2A 4N90E 4WTXA 4QT5B 5DC4B 1S9KC 3S37H 3TBVA 4V2BA 1FL5A 1GGBL 4ZUVB 3DNKA 3K4AA 1N2RB 2GY5A 5ERWA 1U58B 2OL3A 5JLZB 4ONFH 2GCYB 3RWDB 3MRCA 3ILPB 2GITB 4GKNA 4WEMB 4EI5D 3TN0D 1H8OA 1J05B 4LCYB 5E70A 4C56E 2BDNL 4U1SA 3N85L 5HGBA 3S36H 5TQ2L 3AS1A 4LASH 1FYHB 3PV6A 5IUSA 4LLMB 3KGRA 4HZLA 3UX9B 1IAIM 3VG0L 1HDMB 3MA7B 3V0WH 1WIOA 3DI2B 5I76A 1PEWA 4F7PA 2DKUA 3B4NA 5INDB 1FL3B 2FD6H 4D9RE 3RI5F 1FFQA 4JHWH 4Q6IC 3UTOA 3BEVA 5D71H 3GSUA 4M7KH 4U1HA 4W4OA 4WW2B 3TT1H 3N0PB 1ZT7A 5CJ5A 5ISZE 2IFGA 4GKSB 5E94A 2E7HA 3IJSA 2EICA 3MOBH 4RBPH 5J1AB 3RIFF 4G8GB 2JLLA 3RJDA 1JYXA 1X9QA 4CADB 5JIHA 4OZGE 3QDAA 5F7KC 5GISL 3T2OA 4D94A 2FZ3A 5CUSH 3EDJA 2J8OA 4OT1H 1JL8A 2D9QB 3VXQA 5F9JA 3P4NB 1MWAB 1NBYA 1NMAH 3LPGA 4QXTB 4MNQD 3M1BA 5BW7C 4WHYG 3CU7A 5SV3A 2AQ2A 4OCRL 3LKPB 1MEXL 5I8CA 3FRPA 1YJDH 5LXGH 5TE4L 5F3BB 2X4RB 4ZTPH 3WDJA 5KVDH 3S88L 5EC1A 2C26A 3F7YB 1PSKL 3GI9H 4NFDA 3KPPB 3S5LG 2VL5B 3GSNB 3T0DA 5HHOD 5JDSA 5LGHL 3VFNB 3ZTJH 1A3RH 1W0VA 1S78D 1XGYL 1U8JB 2NCMA 2Z92B 4YDJB 1G6RA 4H0GA 4JRYA 3D9AH 3G6DH 3Q5YA 1SYSA 3B9VA 1QEWA 4PGZA 2PYFA 4HH9A 3ULVL 1FO0H 1BJ1H 3LQMA 3U6RA 2AABH 3MA9H 4PJFE 3Q6GH 1JRHL 1FRGH 4MSWA 1N5AB 4YWGL 1KC5L 1MAMH 1SEBA 3BUYB 4ODVL 1AHWA 1N7ML 3I02A 1RUQH 3B8YA 5E6YA 5CMAB 1N4XH 2GFBA 1MQ8A 1UKTA 1QFPA 3RDTB 1NANI 1T7YA 3D18B 4QTIH 3D3VA 3RX7A 2L4OA 1WCQA 2HG5B 1MNUH 1JGUH 5F7LB 2FR4B 3C6SB 5C0EA 3L1OL 1FV1B 3LQAH 3SO5A 4CW1A 5C0AA 2YD5A 3UJJH 5EO1B 4NQTA 3WL9B 4N0UA 3VI3F 4UUJA 4YGVB 5B38A 5KS9B 4JDZA 2G5RA 2ICEB 3D6GA 1I75A 3IFOA 5A43C 3ZSSA 2EYRB 5I1DA 1IVLA 4JY6A 3GIVB 4PJBB 3MRRA 3O2WH 1UQSA 3MSPA 3VFWB 5B39B 5FHBL 1GRWA 2VLKE 4H8WH 3MFFB 5JIKA 3MRGA 1MCPH 3RGVC 1Q0XL 3SE4A 1LK3H 2M26A 3GJEB 4J6RL 4NUGL 2Z91B 5EBWA 4M00A 4ELKB 2LTQB 3MRDB 4C56A 4YE4L 1YN6B 4KJWC 4NKMB 5E08H 1I8MB 2BZDA 5JUEL 3U9UA 3SKMA 5D96B 3MLVH 4JREC 2QHLA 1HKLH 3Q2CA 2M1KA 3MO1B 2EIZA 5HYQA 3GEWB 4Z7VB 3QJFB 4HJ0C 2PXYD 1MIEL 5C09D 1XGTA 2G5BA 1UVQA 3GMRB 2YPLE 1VPOH 3U4BL 3PQYB 4YDKH 5ISZA 1ACZA 3HE7A 4RISL 2EDYA 1WITA 3QIWD 4LVHB 5HGGS 4FMFA 4MQ7B 2FGWL 1SJHB 7FABL 3RFZC 3LH2L 3PP4L 1LO4H 4OZGA 3MV9E 1QRND 5T1MB 4XVUC 2UVEA 1XR9B 2Z8SA 4OCSH 3BYTA 3HN3A 4R4FH 3KHQA 4XX1G 3L3HA 5HDLA 1CTOA 1SM3H 5MERA 4ODTL 4XVTL 3V8CA 1AGFB 1D5BB 5DF0A 4D8PB 5AG8A 5DA0B 4M3KB 4X0KB 1KXVC 5C0JA 5DMYA 1IJ9A 1U93B 3DVIA 1BVKB 2R0KH 1ZLUK 4ZFGH 4ODUA 1JZ3A 2E3VA 1XIWB 4I13B 5EUOB 5GRJH 2VITB 5D2LB 4NN7C 4B41A 4XNYH 1I7TA 1T1YA 1DUYB 5KSVA 1X5AA 3FCTB 4S2SA 1CR9H 4NNPH 3SBWC 5IFJA 4P4KB 3C6LA 4XNXL 5CEZL 1Q94B 2AKRA 4AENA 4PV8A 3QXUA 3I2CL 4EUPB 5CBEA 3NABH 1X5IA 4M1GL 4EQ2A 1IILE 4PJFA 2ZNXA 1K9TA 3SDAC 5JXAH 1C5BL 1RZGB 3QUMA 5HGHA 1A9EA 1Y6KR 5C8JB 5ICYB 4J3WA 4CVXB 3ARTA 4FQLL 2AERT 1L6ZA 4L3CA 4YZFE 4JLRB 5CZXC 5BOPA 4YHNB 3T0WA 2FO1A 3RZCC 1OGAB 4MGXA 3WFCH 5HVWA 4XPTH 5F88B 1U8NB 1S5IH 5F7NC 3QFDA 1OGTB 3TPKA 3UP1A 3VFPB 5JQ6L 4KRMB 2DQHL 4D0DB 4E9LA 3UJTH 3H9SE 3C87A 1MWAL 3E8UL 1U8LB 4G7YL 2YUXA 4LQ1A 1ADQH 4PB0L 3GZKA 4MNQB 4GAGH 1JNLH 1VHPA 2CKBB 3B2UC 3ZTNL 3ABZA 5J57B 3HS0B 4D3CH 4WI3A 2Z4QB 4TTGA 5B4MC 2DTML 2WWKO 4M1CD 2VDQL 1NCTA 4L5FL 2R15A 3I9GH 4KXZH 1KGCE 2HRLA 3NN8B 4U6XA 4WWKB 3TZVA 4QNPF 4RFEA 4LCCA 1OP5K 3FB7A 5IMKA 1ZT4B 1Y6NR 1INQB 2VLKA 3P0VL 1OAQH 4RMQA 2X70B 3HC3L 3FN3A 4U49A 2EKJA 4G5ZL 5SX5K 3X13A 4MA8H 3WN5A 2Q8AH 2DLFL 5IK3A 1BVZA 1WEJH 5B21A 3C2AH 2YD7A 1XH3B 4CVZB 1ZLSL 5FUZH 4WHCA 3AVEA 1ZVSA 2BSRA 2B39A 3L5JA 2IG2H 4FFVC 2E6QA 1KULA 4LNRA 1RD6A 4PJDB 4J3UA 1IFHH 4OAWB 4OFIA 1DZBA 4HXBL 2FWOB 4JRYD 5DK0A 2VDKL 4WFFE 3I3BA 3FQXB 2VR5A 5F6IC 1A2YB 3D0LB 2YPLA 3LN4A 4FTVB 5EIVA 2QADB 3QH3B 4J3VA 4WEBH 1MCSA 5D5MB 2DDQL 5DGRA 4X6DB 4NCC2 1MHCB 2UZIL 3TWCL 2EEAA 4GUPB 4NJ9H 4OCWL 3WKMH 3MV9A 4NWTH 4MD0A 5I1LA 3MRMB 4UQ3B 4Y4KA 1E6JH 3ULVC 3D3VD 4EOWH 1FLTX 2FJGA 4M6NL 3LS4L 5E7BA 4NQEA 4G8GE 3WS6A 1K4CA 3OKDB 1M7DA 3PGCA 2HTKD 2VDLL 5J1TC 1SJEB 5EFIA 4GBXC 1IM3A 4J4PC 1IAOA 2LE9A 1P7KA 2DMCA 3V5KA 3GMMA 1RSFA 1RJCA 4DN3L 5C0AD 3EYUH 5IKCA 2F53B 1DL7L 1S7WA 2C4XA 3AU1A 4PY8I 5F89B 3IDMA 3NA4A 4N90D 4F7CB 5IG7B 5C0NC 5JW5A 2V5TA 1XGQA 3UDWA 3H42H 1H15B 4WIQA 1IQWL 2AXHA 1OQXA 3S4SB 1FH5L 1AKJA 3FQRA 4C56D 2EH7L 4GG6E 3BRDA 1EFQA 1QSEE 1RURH 5E2VH 2DQJL 4IJ3C 2OR7A 2BVEA 2DBLL 4HC1L 3HZVB 5IV2A 3QIWB 4HQQH 4QRPB 4BQ9A 2YEZB 1EX0A 3JV4A 5JNYB 1MAKA 1UM5H 3KYOA 4MQTB 5DMGC 3P11L 3STBA 4D9RD 4N8CH 2OCFD 2DICA 1BX2A 1M05B 2Y72A 1SVZA 3H9SA 3TO2B 1EEYA 4G42B 3GNMH 3QNXB 2A9NL 1I7ZB 5F9OL 3BMVA 5E8DL 3HE7D 5GS1C 3UTSE 5DHYA 2EDQA 4ZO8A 5E2JA 5IMLA 3GHBL 3AMLA 1JPTL 1ZAGA 4PRIE 1DDHB 5KSAC 4EDWH 1LDPH 3PWUA 4ZAKA 1PLGH 5DJYA 2DQUH 1CFTA 4XPFL 3ZKMC 5EU3B 1RUKH 7CGTA 2R1YB 5BVPH 4H5SB 4BZ1H 1JWUB 5DR5H 1J87A 3ALWA 5B3JF 1GPOH 1WBZA 3EW3B 4Z6AT 1ZHLB 2EDBA 4ZSOE 1NFDE 5F8QC 4G8EA 3BP5A 3CPLB 4NO3A 2OP4H 4XH2A 5KS9E 5JOFA 3KPQB 2F8OA 1VCAA 1R3KB 3V52L 1V3KA 4QHMB 2AI0L 5K9OB 3IXTB 2FX9H 3BE1L 4LSTL 5JOPE 1I1RA 4X98A 1TZIA 2OX5A 4HUUB 4UT6H 1XGUB 3CFKA 2KL6A 1JIBA 1IC7L 3WUZA 1DSFL 3C5JA 4MQXD 1BIHA 1NQBA 5A3IC 4JFEA 5EO0A 5EN2A 1CL7L 1NUGA 3DX7B 4K3EH 3QB7C 3C6LD 1V8HA 3L95A 4LMQE 3WD5H 4FN0A 4WTZA 2L7UA 3UJIH 3FO9A 4DW2L 4KHTL 2LVEA 4XMPL 5DJXA 3WSQL 1GIGH 4NN6B 1N3NA 5IBLD 1E4WL 4Z7VE 2R2BB 3TBWA 4OUUB 1X5LA 2CKBL 1NLBL 3PP3H 1V3JA 4GRLA 4LVOB 5E56A 4L9LA 1X5KA 3GSVB 3PQYE 3NFPB 3DI3B 1IAMA 4YBQD 3RY6C 3THML 4MAYB 3OG4B 1YC7A 3HUJF 4KK5D 5ICZA 5AWNH 3IDGB 5GPRA 1F4XH 5ID0B 2QV2A 3QFJE 2W92A 2WBJB 1Z9OA 2WWMD 3QG7L 4MMXC 5A2KH 4DVRH 2BHUA 4Z0BH 1A1MA 3VG9B 2HRPH 1OAZH 1TJGH 4YXKH 3W0WE 3NIFF 2AV1B 1QFOA 4HUVA 1IM9A 2DM7A 1INDH 3TZVD 1KPVB 5KW9L 2ZUSA 5I8EB 3LKSA 5I30H 5SWSE 4LKCB 2Q1EA 4P0DA 2VLKD 3G9AB 2B2XH 4JFDB 2PN5A 5EUOE 1JV5B 3O9WB 4QTHB 4Z95H 1W0VB 2QQNH 4YEFA 4OLXH 2ADGB 3LAFA 1FO0B 3T3ME 2APTA 1SYSB 1H5BA 1TJIH 1URLA 1F4YH 3I6KB 4GG6A 1KTLA 1QSEA 2BERA 2VLRE 1ZVHA 3CNKA 1YECH 5CKGA 3LKQB 5DD0L 4ODWB 1MF2L 2BVQB 5E2WL 3ZE1F 1RZFH 2WUBH 1QBML 3BKCL 4GAJL 4ODSL 4XNQB 5HHPA 3D48R 4N8VA 3LKRB 4U6VH 4JB9L 5D1XB 1BQUA 1S5HA 3IRPX 4MWFA 1F8TH 5GGUB 2OR9H 1F13A 5F97E 5GJSL 5HDBE 4OZIA 4Y2DB 1IGFH 5IB3A 3VXME 1A5FH 2HJLB 3N06B 3MBXL 5ICXA 3UTSA 1CE6B 3MXWL 4FFWC 2EYSB 4HGMA 4OFVA 3PWPA 3G6JB 1RJZB 1BQSA 1HHKA 3RU8L 2Q86A 2IEPA 5ALBL 4PRIA 3DURA 1F4AA 3LRGA 4LPCA 3PGFL 3MV9D 4U2ZA 4HUWA 4X83A 1DFBL 4U0RC 3E0GA 3RDTC 4Y4KD 1JZ6A 4Q9QL 4N0UB 1DBJL 4JY4B 5IVXB 4XP5L 4NQED 4GQ9L 1FZJA 4XI5D 3RVXD 3EJJX 3NCBB 4ZSOA 3MRRB 1NFDA 4JO4H 2VC2H 3MV01 3L3OA 4XBEL 4KTEL 1FFOB 1A1NB 3LV3B 3ZKQD 4TVPE 2Z93B 4MDIB 3FQTA 4OKVA 3TYFB 4OBRA 1DQDH 3Q1SH 3PWJA 3IDIA 4Y16A 1GVIA 4R4ND 1X5FA 5EOCJ 3CXHK 5I1HH 1IQDA 2OTUB 1BECA 4M8QB 4Y5YB 1BP3B 4A6YA 1FBIH 3CSYA 3TBTB 4ZO6A 5JPNB 3WIHL 2GSIA 4LHUG 3RL1A 3GO1L 4OCLC 2FX8L 4JPKH 2BRRL 4HWBA 4NKOA 2P45B 3X3FH 5DJ2A 1OTTD 5I2IA 2LTQC 3HNTL 1VGEL 4PGBB 5I1IL 1AKJD 4PJDE 4Y5XB 4X80L 2X1XR 1AGDB 1RK0B 1IGML 5TGBA 2CIIA 1A7OH 3TJHD 4HWBH 3LMJL 4Z7WB 2ESVE 3VWKB 5D96C 2X4QB 1S9YA 4AT6A 3EOBB 4FNLL 5GRVK 3V4VL 1J1OH 1X4ZA 1G7QA 1VACA 2VL4A 4GMSL 4FTVE 6CGTA 3PDOA 1GZQB 1RHHA 1EEQA 1YEFH 1BQLL 4X6DE 1BAFL 4X8JB 4X9HA 4P9HH 2RCSH 3IFNH 1KNOB 2DD8H 3M17A 1CLYH 3H9SD 3QFJA 4PJIB 3S37L 2VZVA 4MD4A 1R5WB 5DMKA 3PJSA 4CJ1A 4PJ7F 1FFNA 1S9WB 4OGAC 2NY2D 4ISVA 1Q9KB 2C1PB 1CFNA 3FO2B 4ONFL 5BV7H 5C2UB 3ARDA 1PYWB 4OF7A 1MCWM 3W0WA 1DEDA 35C8H 3RWFB 4MA3A 1KGCD 3NH7H 1UWXK 1A3LH 3S36L 4ZAKD 4LASL 5ENWB 1MCOL 4POUB 5CJ8A 4JFZH 4G6FD 3G5XA 5SWSA 1MI5E 3V0WL 4UT7H 2XZQH 2WLZA 3B83A 3FFCE 5HYSG 1F58H 3BISA 1CF8H 3G5VB 3WFBH 3FL7A 2FD6L 1EZVY 2MKLC 4NRYB 1L7IH 4XRCB 2VN7A 1ACYH 4JHWL 1U0QA 4UMGA 4XCYA 5F7EH 3RWCA 2R9HD 3O6FA 4M7KL 4QY8B 3QUXB 4P4RB 3TT1L 2VLRA 3L3IA 3CFDB 2J4WH 4GLRI 5EUKB 2EE2A 4C4KT 4JJHA 5DRZA 3LIZH 4XZUB 2VXQH 3MOBL 4JFED 3NAAH 5IQ9B 4NQDE 3RIAK 4HJGA 1CDIA 4UZGA 1G7HB 4P4KC 3VMPA 2BVPA 4IOFC 5CSZA 4ERSH 2DYPB 5C0CB 3P3YA 5CUSL 3X3GH 2PTTA 2YUWA 4OT1L 3ZO0A 2QEJA 5C3TA 3OR7A 1RZ8B 4ZS6C 1ITBB 3KYMB 3VXMA 1NMAL 4EI6A 5EZJB 1UCTA 1YQ2A 4M6MH 1FCCA 1YJDL 3U2SA 4E42A 5LXGL 3VD4A 3GSOA 1RAMA 2X4UB 1UH2A 4HIHB 3GMQB 1QHPA 2UY6A 2IALA 2LAGB 3V6FA 4GRLD 1ZLUH 4ZTPL 4MB3A 5ACZB 1DVFA 1A64A 1T0PB 5KVDL 3RY5A 3NBNA 3HRZB 5DGQA 3GI9L 4AEFA 1JN6B 5CWSA 4DQOH 3MRBB 1ZWIA 2AS5M 3EYVA 2HFGH 3GMPA 1A21A 3TZVB 1HSBB 5GZOD 4LCCB 3OXSA 1A3RL 4X5WA 4ONGH 3D2UB 5BS0A 2LQRA 3MLXH 5E8NA 3D9AL 3G6DL 2E9BA 2P24A 5F7HA 4HF5H 2OZ4H 1OSZA 1EH9A 1FO0L 3N1FC 2ZNWA 4NJAH 1BM3H 2AABL 3MA9L 3VFMA 43C9A 3Q6GL 3TESA 2XKNA 1FRGL 4WWKC 1IM9D 5L88H 3BPNB 1F02I 3DUHA 3O11A 1MAML 1K2DA 3OKLA 4PJGE 2BSRB 4OZHE 3OHXB 5ID1A 3LKNB 1FAIH 1RUQL 4MHHI 2XZCH 1QFWH 4ZUWA 3X12A 1N4XL 4YDLB 5LGKA 4HDIB 3RPKA 3AXLB 4QTIL 2ZUUA 3BW9B 4N5EC 4O02H 1MNUL 1JGUL 3VXUB 3NZ8B 3VFRA 3RNQA 5GGSB 1QSED 2G75B 3BP4A 4HULB 3LCYA 1F6AB 2CRZA 3J7HA 3ULUH 2ZCHH 2VE6B 1M71B 3LQAL 2FYYA 1JPST 4JFPA 4F7MA 1KSRA 1YYMH 1NEUA 3IAQA 1V7MH 3UJJL 4K7PX 1AR1D 1JYNA 2NY6D 3W2DH 4KV5F 4E41B 5FDWA 3O2WL 5GGVH 3SKOA 1MFAH 1MJUH 1R24B 1N64H 3GBMH 3NFNB 3AY4A 4H8WL 3UTSD 3TO4D 1MCPL 3U36A 4LBEA 2OLDA 1FJ1A 2EXYC 3DX6A 4PRAA 3PWPD 1LNUB 4QXWA 3JTTA 1FC1A 1QVOA 5C9KA 5I71B 3H7BA 4NUJB 4PRID 5HI4D 3HTLX 1BFSA 5E08L 3S35X 3BKYH 3MLVL 3Q5OA 1V3LA 4LVEA 1MI5A 4YAQB 1HKLL 3FFCA 4MCZA 4NQCA 2L7JA 5EU5A 2VXVH 4Y88A 1EVTC 1I8IB 5DMJB 2WLYA 4KDTA 4PG9A 3TIEB 1AIFA 2CR6A 2X9YA 4BFEA 1BMGA 4N0CD 5C0BB 5JOPD 3JV6A 4H1LG 3JSSA 1VPOL 4YDKL 3MYJB 4Y16D 4JFDE 2R23A 1G84A 1BQHA 2DM3A 3L5XH 4HS6A 2CO7B 4TNVF 4NQDA 1NGZB 5C0FA 2IBBA 4O2FA 1LO4L 2VZOA 3DXAA 5F1SA 4MJIA 4OCSL 3WFZA 1YEGH 4LSRH 4R4FL 4FOMA 4EKXA 4P2RB 3K4DA 1SM3L 2PXYC 1U8IB 3GSWB 4G80A 4PRDB 5FYLH 3ZYOA 3P4MB 3H0TA 5I0DA 1PDKA 3V0VB 5JW3L 3QIWC 5CEYA 5E8EA 2UY7A 1T4KA 2R0KL 2H6PB 4ZFGL 4HKZB 5KVEH 1VFAA 1AP2B 1U9KA 5GRJL 1K5NA 3MLUH 4XNYL 5D2NB 2GJ6A 4OFPA 4H25A 1CFTB 4ZFOB 5F8RC 4YFLI 2NXZD 1RZ7H 1CR9L 4JHAH 2E8ZA 4NNPL 5DFVD 2GEEA 3T0EB 4ZPVA 2A6KA 4LPXA 2XWBA 3QEUA 5D7JB 4NO3B 3ARDD 1RIVH 3NABL 3W0WD 5IJKC 2OJEA 3D0VB 1NC4B 5JXAL 4Z7UE 3V5DA 4F9PA 4PJGA 3OX8A 4OZHA 3W9EB 3ARUA 1DQLH 5SWSD 1J88A 4HS3B 4D9QE 2YRLA 2O5XH 4RGNE 5HBBA 1T1WB 2RR3A 3VA2C 4LFHG 1EO7A 3W11D 1S5IL 3V6OE 5D7IE 5TH2B 4PJ8B 5FYJH 1NKRA 3QUYB 3QZWA 3T77B 1TQCB 5IVOA 3UJTL 3UTQA 3CZFB 3O6FD 5GGQH 4LLUB 4LAJH 3SKNA 4F9LA 1ADQL 1NCAH 5IOPB 4RDQG 1JNLL 4EVNA 3OJDB 1V7NL 1W0WA 3ZKND 4D3CL 4RDQF 5BCAA 3EDFA 4P2QA 5DYOB 1KN4H 1S9VA 2AJYH 4NQVA 4QEGA 5IHZA 3I9GL 2WQRA 4QWWC 5K59E 1ZVYA 1NGPH 1WLHA 5DD5H 3V95A 2NY7H 3FHAA 4EN3B 1B0GA 3P73A 3DO7A 3HCVA 2Y6SD 4WJ5B 3VXMD 5L9DH 3DSFH 2H8PB 2JE8A 4NN6C 1MRDH 1OAQL 4W4OC 4A2LA 1WZMA 3KJ6H 1UEYA 4LLYA 3NIDE 2Q8AL 1WEJL 2HAZA 4ELMA 5I6XB 3C2AL 3D87B 4LVOC 5EOQH 3QRFM 2A74A 4GRMA 1BFOB 1DVFD 1HWGB 3G5ZB 3GB7B 2EDKA 5FUZL 4MAYC 4XWGH 2IG2L 1FN4A 2OTPA 4R7DA 5I16B 2XFXB 1IFHL 4EJ1C 2V7NB 1MELA 1CD1A 2V17H 2O5ZH 2Y7QB 4WV1B 5BS0D 3ULSA 4U3HA 3V2AR 4TVPD 2I60H 2V2XA 5HDQH 1YNKH 3QDHA 2RAMA 3T2QA 4HMEA 4I2XA 5MEQA 4WEBL 3RPIA 2A73A 4CL7A 4IHOA 3OWEA 2YOCA 3BKJH 1U8PA 5CGYD 3O3UN 3SDDA 2MQCA 3MTRA 2KUTA 5EIQA 2AV7B 1ZLVK 2DQEH 3F65A 5DFTA 4NJ9L 4POYA 3PNWB 3WKML 3QQNA 1Q1JH 4NWTL 3DMMA 3ZE0F 4B7IA 2CR3A 2NY6B 1E6JL 3ESUF 4EOWL 3FT4B 1WAAF 2CD0A 1MLCA 4LLVB 1RK1B 1N26A 1G9MH 4CU6A 2NW3A 4GW1A 3V4UH 1UZ8A 3QJHA 1LEIB 1ZK9A 1I9JH 5C0CE 4PREA 2ORBH 4ZUUB 3TO4B 4QOKB 5DJAB 5EZLB 1DR9A 4U33A 2CDEB 3VFUA 3PWPB 4R0LA 1NDMA 4XNUH 1AHWC 3G08A 3SN6N 1BBJB 3ARBA 3EYUL 1HINH 5TJWK 2VR9A 4WWID 4AH2B 4Z76A 3N50A 5FIEA 5HGDA 1ZA6B 3LQAC 3H42L 4FQXA 2HTKC 3PDDA 4AIOA 2HVKA 2JCCF 4HSQA 3U7YH 1FVCA 1S7UB 4JR9H 1HYRC 2KQMA 3NGBC 3O8XB 4DGVH 5IVNA 1K8DA 4X7DC 4PY7B 4GJTB 1LE5A 1RURL 5E2VL 2NR6C 4Z7UA 4O5LL 3P9WB 4ESKA 4OI8A 3AFLA 4JFOA 3VCLA 2AXFB 4HQQL 5I0ZA 1MI5D 1MJJB 2E7BA 5IMMA 3FFCD 4H8WC 1RJLB 1UM5L 4NQCD 4P48A 1XMWA 2B4CH 1M1SA 3V6OA 4GT7A 5D7IA 1KUMA 4N8CL 3DLQR 3V6ZB 3T3PE 1OSPH 3SE4C 1HSAB 3VE0A 5JXEA 1DBBH 2X4NA 2ENYA 3DPBA 3GNML 1XZ0A 3O81A 4LEOA 1QUNA 5ALCH 1YUHB 3KYKH 1UGNA 3BGAA 4NQDD 3HAEH 3SJVB 5F7UA 4EDWL 1OAXH 2V7HA 1LDPL 2N1KA 4PJHA 1A9BB 1PLGL 4BKLB 2DQUL 3DXAD 4MJID 1RUKL 5BVPL 3SGEI 1G9EA 3BWAB 3UTZB 4BZ1L 4Y5XC 5DR5L 3RTQB 3QUZA 4J3XA 2XY1A 1UKQA 1QLRA 1GPOL 1FDLH 3OJ2C 2GQHA 5DVNA 1YEDA 3VWKC 2OP4L 3MJ8A 5BV7B 2W60B 2EO1A 1SBSH 1WCBA 2RFXA 2JK5B 1Q38A 2I5YH 2FX9L 4NBZB 1NBQA 3IS1X 5E2TH 1G7LA 4HUXA 4WNQB 4UT6L 5FM5O 1FNGB 1WTLA 2DQFB 4L29B 1N59B 3WNOA 1G7PB 2YPVH 4IRSB 5FCUH 2GJ6D 5ETUB 4E5XB 3RGHA 1NANH 3I6GB 5ESVB 2E6JA 1UJ3A 4KI5D 2XWJB 3IB4A 4HMCA 3EO0B 4LPTA 4FZEH 4P5KA 3G5YA 3UZEA 3WD5L 3V9FA 5JHLH 4O2CB 3UJIL 4H26A 1B6UA 2DMBA 4M6OH 1P5VA 1GIGL 4CDHA 5I18H 3WE6B 3DIFA 5KZCB 1IAKB 1QSFB 4M03A 4MQXC 5EBLB 5C0BE 3WKNA 3O2DH 4R2GD 3H9ZA 1HXMA 3S96B 4YO0B 2J2ZA 3FB8A 5GGRA 1PGRB 5GGTA 3NCYS 2I9TB 5AWNL 4PRHA 3HMXA 1NFIA 5I1GH 1NCDH 1OD9A 4LRNH 1J0HA 3RVWC 3QUXC 3I3EA 3WLWD 1ZS8A 1X44A 1Z5LB 3FAWA 3HMXH 3REWA 4G6JH 4PUBH 3FAXA 3VI3E 5KBNC 4I18A 4DVRL 2R8SH 4Z0BL 5C0GA 5E8PA 1H9VA 2HRPL 1OAZL 4P2QD 1TJGL 2NXYB 4YXKL 1ZSDB 1DJSA 5FB8A 3JBG7 3CXDH 1INDL 1P1ZA 3E6FB 4YBQC 2I24N 1NLDH 1OAYH 5I30L 4UV7H 3LOWA 4KK5C 4GW5B 2H3NB 4YDIH 2B2XL 4Z95L 4JM2F 1FSKC 1C12A 2H26A 3MLTA 2OSLA 1MHEA 2QQNL 4OLXL 2WWMC 4QHNA 2XTJE 2OQJA 4I1NB 2P8PB 1TJIL 4G9FA 1F4YL 4MMZC 4CNIB 4L8DA 4KUCD 4NKQB 2KKQA 2NY1D 3T0EE 4JHZA 5FUOH 3NCEB 1YECL 5L2JA 3CLEH 3E6HA 1RZFL 3TZVC 2N7BA 1JGDB 4LCCC 4QCIA 2PW2A 4JFYB 5FGCE 4OZFG 5F9WB 4HWZA 2ITDB 4OB5H 4XP9H 4U6VL 2BNQE 4WI4A 4WFHE 4XPHH 1CD9B 1L7TH 4G9DB 1F8TL 4P23B 2OR9L 1I8LC 2I9LB 3BOVA 5EBGA 4DUXA 2JIXB 1IGFL 5DUBA 4FQ1H 5F1KC 3C9NB 1WWBX 3HZMA 1A1OB 1U2HA 3PABB 3SCMB 3SDDD 3BP4B 3FOMB 1RUPH 3DHJA 4K94H 5K9KB 5E6ZA 4Z8FH 3GSQA 4YDLC 4YFDB 3DMMD 5DJ8A 4LCUB 3VXNA 5DDHB 1KYOJ 4Z5RB 4ZFZB 3JTSA 2YRZA 3LEVH 4JO4L 4O00A 2VC2L 2V9QA 3L3DA 3EOYG 4GKZB 3CD4A 3HI1A 3PUCA 1DLFH 4S1QH 3PL6B 4AG4H 1DQDL 3Q1SL 2NLJA 2APFA 3O4LB 5HD8D 5E00A 3S5LA 4ZOEA 3ARBD 3PWNB 3O41B 5I1HL 3QIUA 1KPRA 1I1AB 3CCHA 3IKCA 4U6YB 1BZ7A 4HEME 2H9GB 3O4OC 4QLRA 4Y4KC 5C92A 1FBIL 2BOCA 1ZEAH 1JE6A 1NGYA 4XB7A 1MFEH 1AQDB 3QPQD 3T4YB 3TNMA 4JPKL 5FUCE 3O6LH 4F8TA 1ZOXA 1UM6H 3X3FL 5LBSH 4V1DB 5IM7B 4J1UA 1S7QA 1A7OL 4HWBL 1VFBA 2VN4A 1L0YA 2DWDA 1F3DJ 4R4NC 1LK2B 4LLWB 4HZAA 1J1OL 2FECI 4NFCA 1SMAA 4D9QD 4RGND 4F7TB 5IMOA 3RWGA 1B4JH 4ORGA 1JP5A 4KRLB 4GMTH 5HPMA 1C5CH 4FQPA 1CXEA 1A6ZA 2IAMB 3UDWC 4P9HL 2RCSL 3IFNL 4ZUSB 3RL2B 2CLRA 4NSKB 5JXED 3OAZK 2DD8L 2IPKA 1CLYL 4ZXBB 3TF7C 4M4RA 1MH5A 2AEPH 1CN4A 1T0NB 3WS3B 3ECBA 3GFUA 1BIIB 4L3EB 4QNPE 4UIKH 1ORQA 2VZ1A 3REVA 35C8L 4XHQA 2XZZA 1XCTB 3N1MC 3NH7L 1A3LL 3CH1A 4DVBA 1NAMA 4UIMB 4ZYKB 4I9WE 1QFHA 1GAFH 3D25A 4JFZL 5CIPH 4ZPTB 3DX8B 1MOEA 4UT7L 2XZQL 3ROOA 2FH8A 3SKUD 1F58L 1OPGH 1F90H 1X7QB 1CF8L 2AXGB 3WFBL 3MLYH 5FYKE 1L7IL 4Q74A 1MREH 1ACYL 2NY2C 2XNAB 4WU5B 3O6MH 3FOLA 5FO7B 3MV7D 4NZUH 1KXTB 5F7EL 1PFCA 5EBMA 3QO1A 1NFKA 4P2OB 5GRYA 3TVMB 1IZJA 4HWUA 3MFGB 4R96A 2J4WL 2AQ1A 2CQVA 3VW3H 3LIZL 5D2NC 2VXQL 1Q9WB 2VLME 1AGBA 2XY2A 3NAAL 1S7VA 2XQBH 3IU3B 2FEDC 3RHWK 2BNQA 4ERSL 1QACA 1UWGH 3X3GL 4F2MA 1T6WA 2FJHA 1YMMB 1CFSA 3QNZA 4NO2A 4ZTOH 1JPFA 4FQCH 1UB5B 1X3DA 5CCKH 3CX2A 6FABH 4I3RH 4DFHA 2R9HC 5CS7A 3CDGA 5F93C 2IBGA 3V6BR 5DD1H 1KJMB 3EFFA 4M6ML 5EOTB 4RX4A 4TSBH 4MA1B 2J3SA 4LPYA 5M7QA 3OXRB 2XN9B 1EEZA 1IZKA 4I3GA 3LEXB 1DBAH 4HH8A 2EZ0C 4RSVA 5AZ2H 3WUWB 4I0PB 4PJ8C 1X5GA 4DQOL 4XWOD 3PE9A 1IEBB 4X6CB 2HFGL 4PRHD 4JAMB 2X4TB 2BNRE 2FGZA 4MJ5B 4ONGL 3OKMA 4YNYB 1QR1B 1TDQA 1JPSH 3OB0H 3MLXL 3VGAB 4DZBA 4HF5L 5C0DA 2IQAB 2OZ4L 1WZLA 2ADJB 5F3HB 4NJAL 2HT2D 1BM3L 1X5JA 3I75A 4DK6A 2CLVA 3VMNA 4ZD3H 5EIIA 5DURD 4L9LC 3D1MC 4YR6B 5L88L 3T65B 4UQ2B 1P4BH 4NZDA 2RJMA 3VGHA 2BFVH 4PBVC 1RIHH 1FAIL 5GZOC 3GGWB 1PG7H 2XZCL 1QFWL 3Q3GA 1QPPA 4X4YA 2IANA 4O02L 3G6AA 5I6XC 4X4XA 2Q87A 1FZOB 4G9FD 2V2XB 4WCYH 3N1QC 3RVTD 4LSSH 3MJ9A 3ULUL 2A73B 2ZCHL 5BZDB 1HWHB 2VIRB 2WM0A 3QUKA 4PG2A 2C1OB 1HH9B 1YYML 1ZHKA 1NCCH 1V7ML 1EGJH 3DTXA 5F96L 5C0IB 3T8XB 1N5YH 4RGMB 1QG3A 3OAYH 1NDGB 2RB8A 1T22B 4RIRA 1ZGLA 3W2DL 1J0JA 3RVVD 1P2CA 1BZ9B 5GGVL 1MFAL 1MJUL 1EAPA 1N64L 3GBML 3MYZA 1H5BC 1BHGA 2WZPD 3IF1B 4M5YH 5L2KB 3WFEH 2E7MA 1Q8MA 3ULVF 3MUGA 1OB1B 4LAQH 5FA3B 3FRUA 3FO1A 1HEZB 4GAYB 4PYHA 2I25N 5K33A 2GUOA 2QHRH 2JELH 5B3JE 2VMFA 3DHMA 2UZXB 4JN2B 3BKYL 3VI4E 1KIPB 2ADFH 3X14A 2R1XB 3HKFA 2NY6C 4CKVX 3ARBB 4GXUM 2YWZA 1FPTH 3RVUD 5MENE 5CEXA 3JWDH 3PHOB 3UYRH 3L3JA 5HPOA 3HPJA 4X9GA 1REIA 2VXVL 3ZDYE 1AH1A 1YY8A 1IGTB 3KLAA 3WIFB 4DWHA 4R97B 3TO4C 2A6JA 1EUUA 4X9IA 1U2CA 1FYTB 5A2LH 1FNFA 5HI4C 3QIUD 3MBEB 4FXKB 4GRWH 4M48H 5EZIH 1J18A 3L5XL 4P3DA 5C7XH 3QEQB 3BHBB 1QP1A 3FQNA 4K71C 1ZLVH 1IGJB 2Y5TA 1S7TB 2A38A 4P3CH 5IEHA 5D1QA 3DRTB 3FB5B 1WQVT 5GRXG 4Q6YA 1LO0H 1R3JB 2ZOKA 1A4JA 1YEGL 4LSRL 5T3ZE 4R3SA 4N5UA 3KYNB 5DI8B 1SVCP 4N0CC 5FYLL 1NMCB 4K3JH 3L5WA 1EA9C 4ONHA 4Y16C 3MR9B 2F54B 5FFLA 5T1LA 4E0RA 3HAEB 1OP9A 1QQDA 5ESQA 3HUJE 3DYMA 1U8KA 1YN7A 3MRNB 5KVEL 1S8DA 1TVBA 3F5WA 3WO3B 1LQSR 5T1KA 5L8JB 3TBSA 2H2SD 2NTSP 3MLUL 4LK4A 5SWQA 3LB6C 1H3TA 3WYRA 4KJQD 4IM8A 2XWTA 1RZ7L 2BNRA 4BA8A 1XGPB 2X40A 4JHAL 3V7AG 4TRPH 3ET9F 2QQKL 2R69H 1RIVL 3GK8H 5IJVB 5DSCB 3SGJC 3UCRA 3SGDI 3TIDB 2DI7A 3MV7B 5GIRA 5EB9A 3TBYA 4P9HC 4AMKH 3DRQA 3EGSB 1J9CT 1Q72H 1RIUH 3RTQC 5GSRA 1DQLL 5TFSH 5BVJA 4L8BB 2O5XL 3M45A 2VLLB 1VENA 2NXZC 4Y89A 5BXFB 4HGWA 2V6HA 5DFVC 1EEUA 2NZ9D 4PRNA 3K8MA 2EKSA 2Z35A 3BGFB 3AS2A 5FYJL 5JHDE 2XTJD 5K9QI 3ZE1E 3U79A 3ARDC 1YYLH 3LEYH 4KXZI 5GGQL 5CFHA 3QYCA 4YIQA 1NCAL 1HI6B 2VLJE 5E0QA 3GRWH 4Q9RH 4RMSA 5HVHB 1UXSA 3WMSA 3HE6A 5T3XE 2H1PH 4P59H 1JZ5A 2YWYA 4RMWA 1KN4L 4WI8A 4V1DE 5AYUH 1TENA 2X89A 2AJYL 5DHVA 5C1MB 3QHFH 4NDMA 4WTZG 5LCVH 4PGEB 2BNQD 2X4PB 1DBKH 2HFEA 1NGPL 3BGMA 3OTTA 5DD5L 3UC0H 2GY7B 2VDOH 1R5VA 5HY9A 2Y1VA 3MZTA 3DSFL 2AEWA 1MRDL 3O6FC 4IIQB 1X4YA 3WCYA 2BVTA 3ZSTA 3KJ6L 4WI5A 3F7VB 4QRSA 4RX4D 3HLAB 3HC0B 1PJ9A 2XPGB 2HLAB 3ZKNC 2YZ8A 5EOQL 3UTTB 2V2TA 4WW2F 1AD0A 2NY3D 2XXCB 4DUVA 3F7RA 4OUOA 2MQ0A 3ME0A 4XWGL 1JFQH 4YXLH 4JPIA 5DURB 4U1KA 3VFGH 4P57B 5MENA 3H7LA 2QTEA 1NCNA 3QP3A 2JKXA 4U1NB 5I17A 4K23H 2XOTA 2V17L 2O5ZL 4LL9A 3RUGB 3KXFE 3WIIH 4EQ3A 4HV8B 5DJDA 1T80A 4Z77A 2I60L 2R0ZL 1L0QA 5HDQL 1N8ZB 1YNKL 2GTWA 2FJFA 4HG4J 4LGSB 4BFIA 1FZMA 3BKJL 1KB5B 3MRPB 5TE7H 1SY6A 1WVZA 4P3WA 4JJ5B 3U0TA 4HUKB 2DQEL 4U1LA 1AO7E 1Q1JL 1WGOA 4U1IA 4O9HH 2VABB 3QULB 2CK2A 1TPXB 2W38A 2V2WA 3BIAX 2IAND 3CLFH 1G9ML 4WO4B 4IRJA 2W0FA 3V4UL 3GJFA 3BH8A 4KQ4H 1GYAA 1I9JL 5HHQB 3VJ6B 2H32A 2ORBL 1YMME 3GJFH 4HIIB 5CGYC 1PZ5A 5DZNA 3IETB 4AEHH 3HUJA 4N8VG 2H32H 5F9WC 4XNUL 2D9CA 2WNGA 2D7QA 1HINL 4ETQB 2YD1A 4I4WA 1K6QH 2VZ3A 4P23C 3IDYB 3BO8A 4XBGA 1F6LL 1IT9H 2XN9E 3IAPA 4MLSA 4NKIH 3ULUC 3EYOB 3MRHB 3QQ9D 4HIJA 4O2EA 1EHAA 5GHWH 4HKBB 5J9PA 3U7YL 3L3DB 3WXWH 4BH7B 4JR9L 2DJ4A 2EDXA 3QG6A 4DGVL 2HLFC 4KROB 2OJZH 1NPUA 4I9WD 1G7JA 3WHE0 1NGXB 1K85A 2W0PA 1OARH 2BOBA 3OKOA 3CFBB 2B4CL 4NQXB 5KS9F 1OTSD 4HHAB 5B39G 5JHDA 1RZKH 1OSPL 3PL6C 1JBJA 2XI9A 4I3SH 1DBBL 2GSGA 1UM4H 5TDPB 2VUOA 5E8OB 2GAZA 2JJUA 1GGUA 2VLJA 4KDWA 1I1AC 3TGXA 4GW4A 2IPUG 5FO8A 1LDSA 2ICES 2QQLH 3DBXA 3KYKL 2BXYA 3IVKA 2BJML 4JVWA 3SGKC 2NX5A 1OAXL 4XXDA 5EPMB 5D7LB 5D1QD 5EOCH 1J0KA 3DV4A 3T4AA 2HH0H 1KBGH 4UTAL 2P8LA 5BO1H 5DQDH 1C5DB 2DI8A 1EFXB 5SV4A 2CIKA 1FDLL 4C55A 3B9KB 3EUUA 4LPVA 2VQ1A 2WINB 4Z7VF 2I26N 4ALAH 4L8SB 3H3BC 1SBSL 5T1LD 3QI9A 2VXUH 3UBXG 2I5YL 2C3VA 1XR8B 4KPHH 5E2TL 5HGAB 2D0HA 2DM2A 5T1KD 2UWEB 5CIPB 1QLEH 1T1XA 5FCUL 3MNZA 2OTWB 2E7LC 1FAKT 4ZXBC 1UXWA 5IB4B 2X4SA 5HHXH 3KXFA 4FZEL 4IOIB 2P1YA 5JHLL 3AC0A 4HWNA 5IW1A 4N8PA 3MNVA 2G2RB 3V4PH 1GGYA 2HMID 1KIQA 4M6OL 2EDRA 3MRKB 1AGEB 3B3IA 5GZNC 4IMLA 2YUZA 4Y1AE 1T3FA 1QFWM 3QQ4A 1MJ8H 2GK0A 1Q0XH 1UZ6F 4LHUA 1Q9LA 2K7PA 2YD8A 2Q7YA 3O2DL 2YPKB 4QRRB 5MEOA 1AO7A 5EUOF 1MHHA 4HKJA 3STLB 1WV7T 4KI5C 5JUEH 1HXYB 1UKSA 2IPTH 1BOGA 5IBTH 1Z6JT 2BCKB 3T3MF 1OCWH 4KKLD 2GYSA 3QEQE 3L3GB 3LN5A 4S10A 4OM1H 1NCDL 3BSZH 5I1GL 4XCCH 4LRNL 4P2OC 4NHCH 4XNMB 4PJ9B 3E1F1 3HMXL 4EUPG 4G6JL 2PO6A 3IJHA 4NRXA 2EXWC 4PUBL 4RAUA 1CLCA 4F80A 2R8SL 3HE6D 4URTB 2CLZB 2DRUA 1XF4A 4OQTA 4KV5E 2B20A 2X89D 1IE5A 1B2WH 2DLTA 4OQTH 1BF2A 3CXDL 4JFHD 4PJ7A 2GKIA 1JF6A 2SEBB 5EU6B 1NLDL 1OAYL 4MXQD 1O0VA 1V5JA 4UV7L 3QWOA 5KANI 2MHAB 5HI5D 3SE3A 3C60A 4YDIL 3DV6B 4GO6B 5FF6A 4FMKA 5CILH 3QO0A 2AK4E 1J0ZA 1V3MA 5DTFA 5C71A 1QD0A 1E4KA 2DJSA 5I66A 3KPSB 5FUOL 3E3QC 1RUMH 1F4WH 2WBKA 4FQHA 5MEND 1NMBH 3CLEL 3FMGH 4APQB 5DJZB 1OTUD 1F45A 3JWOL 4JKPH 4OB5L 1DE4A 4HKXB 4NKDB 1UB6A 3HR5B 4XP9L 4XPHL 3GSXA 1L7TL 1KJ2A 3VGAC 3BN9C 1IL1A 4L4VB 1CG9B 3MGOA 4EIZC 1D5ZB 3KPNB 4FFYL 4JN1H 1NJ9A 1RZIB 3A67H 3VFVA 1YQVH 4FQ1L 4JGJA 2BSSB 1I4FB 5LJYH 3VXSE 1E28B 4HBQA 2GTZA 3KDMA 1RUPL 1VB9A 4P46A 2E8YA 2HN7B 4NWUH 3J8F7 1IMHC 4Z8FL 1MFBH 3QUKB 1FVDA 3BVNB 4QGTA 1GHFH 1MCWW 4U2YA 5H94B 1XF3A 4PJDF 2PF6A 3STZA 1BD2B 5C6WH 3PWLA 2J6EA 1ZGLB 4IRJD 3LEVL 3H8NA 1RJYA 3RRQA 2J6EH 5TF1H 5H37G 3IDNB 3MXVH 5DRNB 1B3JA 1DLFL 4S1QL 1FG9C 1BVLB 4AG4L 2DQHH 2W65A 3VRJA 4KI1A 4RZCB 4RGMC 4Z7OE 3BXNB 5D5MF 3BZFB 1CXFA 5CSGA 1YDPA 2XQYK 2V5RA 4X6DF 4MNHA 3TH4T 3DMMC 2ENSA 5ACLA 1FFRA 5I73B 2CMRH 4LMQI 2R1WA 2A0LD 4FQIH 4X99A 1J8HE 1T5XB 1ZEAL 3BZEA 1U91A 5CJXA 4MCYA 4OI7A 4W4NA 3IGAA 2E5EA 5LGJB 1MFEL 4LSPH 1CLOL 3O6LL 4JDVA 1P9MA 4UINH 1UM6L 1C1EH 3GHEL 2IH1A 5LBSL 4BQBA 3UPRA 4WDIA 4NPYB 1IBGH 2QJDA 4MX7A 4Y1AA 2GJZA 5FK9B 4R0LC 4GRWB 4NC1E 3ARFA 3S34H 4YX2H 4ODXB 3ARBC 3UBXI 1P84J 3RJQB 3DROB 8CGTA 4CDGC 4NYLA 1QO3B 1B4JL 5DJ0A 4NO5A 1Z3GH 4WHTA 4Y4HA 1LEKA 5A16B 4GMTL 2F15A 1C5CL 2Q8BH 3WNPA 4R97C 3CSGA 5KSUA 5JHDD 5IF0A 4JGMA 1XF2B 3VXPA 4NNXB 4OGXH 1PY9A 3O3EA 3B6SB 3S4SG 2AEPL 2BSTB 2VLJD 2BMKB 1CXLA 1I7RA 4WU7B 1CGSH 4PLNC 5IB1B 1CICA 5T3XD 1OL0A 3TCLB 4PJ5B 3VRLE 1A6AB 1CD8A 4QHUB 3OKYA 2NX5D 1HH6A 4X6EB 5E9DB 5JA8B 4LLDB 2D4FA 4PR5B 2R2HA 2C7UB 3H6JA 1GAFL 4P5MA 5J12C 3TBSB 3IXAB 4D9LH 5HI3D 5CZVH 3QIBA 4Y19B 4JCLA 1OPGL 1F90L 3QDGA 4X6BB 5FYKU 5MHSE 3MLYL 4J12A 4JEGB 2AK4A 4FXGA 4MNGE 5GGRY 1MREL 1HHGB 3O6ML 5IW6B 3QI9D 4NZUL 1D5MB 1R3LA 2ZUQC 5ESAA 4QHLB 3D69A 1DQJB 4V2CB 3WLBB 2VERN 1UT9A 3VW3L 1KEMH 1AQKH 1QA9A 3TBYB 3CX5K 2EDHA 1JF1B 3MRLA 3QA3B 2XQBL 2W9DH 4JKWA 1DANT 3BT2H 2NY0D 5BVJB 2F19H 3WO4B 3BDXA 1UWGL 2AJZA 4H1LA 4PRNB 3VDBA 4ZTOL 3MRQA 3NZHH 4FQCL 3S37X 3P9MA 5CCKL 6FABL 4I3RL 5GXBB 5IR1A 3NCFB 3ES6A 3IDXH 1DLHA 4G8FB 1IARB 3VXSA 3ZT7A 5DD1L 1T2JA 1NCUA 5DRXA 4TSBL 4NNYA 4LHUD 3WHXA 3EZJB 3PXHA 1VGKA 3ZZ1A 3V5HA 1YEJH 2DQCH 4J23A 1AO7D 4HIEB 4HK0B 3S36X 2DQIH 4JZJA 3BPCB 1DBAL 3BGFC 4PPTA 3QCVH 4WUUE 2BY0A 1WTGT 3R06B 1IC5L 3EJZD 5CD5D 1S7SA 1AY1H 3DX9B 1U8HB 3LZFH 4PJEB 1XCQA 2VDMH 3RKDD 2P8MA 3P11H 1JPSL 2PO6D 3JWNC 4LLAA 5JZ7D 4HLZG 4NN7B 3WNMA 4LF3B 3D85D 2YSSA 3C5SA 3HZKA 4NHUA 5E6IB 4ZD3L 2ZUTA 2VAAB 1WC7A 1P4BL 1ORSA 1A7QH 2O26U 4JKKA 4BH8B 4L4TB 2FL5B 4HBCH 3W81A 3DVGA 2YC1B 4OD3H 4PJCE 1J8HA 1JWSA 2JCCE 4WENB 4XWOC 2BFVL 1RIHL 3MROA 1PG7L 1QKZH 3C60D 4IIQC 5KN5B 1WJ3A 3SY0B 3SDXB 4UNUA 4I18C 1HCFX 5DJDB 3RNKB 1FVEB 1GOHA 1P53A 3HG1B 4HFUH 4WCYL 3HR6A 2HT2C 2RIKA 4LSSL 4H88H 2NQCA 3O3AA 1P4LA 3SGEH 4LLQB 3VXOB 3GUTA 4KHXH 1NCCL 1EGJL 3MREA 1N5YL 4U1LB 2P7TB 1FIGH 4K8RD 3ZTJG 3CFEB 1PQZB 3CGTA 4M61A 4JFXA 5E5RB 5KSBB 3T0BA 2ZUXA 1JHLH 2NW2A 3UMTA 3VFSA 1MHPH 4YPGA 4M5YL 2W0FB 3WFEL 4X7FC 5F9DC 5IW3A 4NO0A 3RVTC 4LAQL 4O58H 4MYWB 5GS3A 5KTEH 4P46D 4HFWB 5B22A 2CDGA 3WFHA 3JWOC 3WEXA 3P4OA 2QHRL 2JELL 2E7CA 1N0XH 3JVGA 2MFNA 2G9HA 1GZPB 2ADFL 1E4WH 1TPXC 4I48B 4CMMB 1FPTL 3JWDL 3HI6H 3RVVC 1TETH 3UYRL 2D2OA 1UA6H 2WP3T 3KPOA 4RMVA 1TMCB 4KMTL 4MNGA 3THMH 3P77A 4UILH 3VXRB 8FABA 3SDCB 3PGDB 4XPBH 4HIJB 3U82B 2X2YA 3GMLB 2AAVA 2ICWA 2A83B 2F5BH 2Z31A 3U0PA 1TZHA 5IB5A 4Y4FD 3BPOC 1MRCH 4M48L 5EZIL 1IEHA 4JE4B 3AREA 3IDYC 5F6IB 2YK1H 4N0FB 4RQQB 4NRZA 4K3DL 4PJAB 3OF6A 3MV8B 2X9XA 1VEOA 2QLVB 4P3CL 3BPLB 4TTDC 3VWJA 1LO0L 2ZCLH 4LRIA 5I8KH 3RWJA 5IVXF 1EMTH 3QDJB 3IJYB 2DL2A 43CAB 2VTFA 3EDKA 1IRAY 1WBYB 2NNAA 3BEWA 4KK9D 4KROC 2DKMA 4JZNA 1HILB 4K3JL 5DS8A 4Z7UF 1IEAA 4Y1AD 2R4SH 5TDNB 3H9HB 1MPAL 3QIUC 1WFOA 4I0CC 2BK8A 2A6DB 3MJ7B 1Y0LB 1W72H 4R90H 3P40A 4XGZA 4Y4HD 4B5EA 32C2A 5D7IF 3SPVB 1LEGA 4P5TA 4KGJA 2X09A 1CXHA 1KPUB 4WUUA 4Z78B 2AVGA 4GBXB 3QRGH 3DECA 5JMRA 4U31A 1MJ7H 4TRPL 2Q76B 1RPQA 3MX0A 5H35B 1P5UA 3NIGF 1CICD 2R69L 3VGGA 2EC9U 2CRIA 3FFDA 3EO1A 5JPMB 4JO3L 3BKMH 4Z7WF 1NC2A 2P5WA 5K59F 4KJYB 4AMKL 3RQ3A 1Q72L 3RWIA 1A3QA 1RIUL 3FT3A 4PJCA 2JCCA 2XV6B 5TFSL 3CVHA 3FQWB 4KJQC 3QIBD 2FIKB 3DGCR 4BSVB 1TITA 3ROLA 3QDGD 5A2IH 1LD9A 4L8SC 2HJFA 5HHMD 3NIDF 3W39A 4O51A 1YEEH 3FN9A 5EU7C 5IW1B 4PJIF 1YYLL 5ANMB 3LEYL 3BH9B 4XCNA 5HYJE 5EC2B 4DEPB 5JIPA 3GRWL 4Q9RL 4ACPA 3RWEA 2LV4A 4P59L 4L9DA 1MCHA 5AYUL 1RZJH 1XT5A 2PYEB 3W5MA 2E27L 2I07B 2ZPKH 3QHFL 5LCVL 5C08E 1F11A 5D1ZA 4L8CA 4GRWE 5GS1B 2ZOLA 1DBKL 1K3IA 4MD5B 2H2PC 2NZ9C 1JGEB 2VNCA 4PRPB 2APWA 5D9SA 3UC0L 2VDOL 2IH3B 2BC4B 4MJ6B 4WEUD 5ITFA 4K9EH 4KGLA 2D31B 5E7FA 1AGCB 1KLFA 3T1FA 5DJCA 3VXSD 5ILTH 3DVNB 3DGGA 4Q2ZB 2EO9A 3T0XA 4KJPC 2CH8A 2MWCA 3PHQA 4U6HA 1IGMH 3D85B 3P9LB 5CD3A 1M4KA 1AJ7H 3KPLB 3L9RA 3X11B 4I5BA 2FBJH 1JFQL 2ZUWA 4XPAH 4YXLL 4Y5VA 3TV3H 3VFGL 4PJ5E 2MQ3A 1AR2A 5B3NA 1ZHBB 3U4EA 3PP3K 3RP1A 5DC9B 4K23L 4UB0H 1JHTA 4WFEE 3WIIL 4TUOB 3MLRL 3A0OA 2HFFB 5E03A 1EERB 3PIQB 4NZTH 2W9EH 4D0BA 1WK0A 5GJTH 4N0Y