1NLBH

Crystal structure of anti-hcv monoclonal antibody 19d9d6
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
218
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTDFSMHWVNQAPGKGLNWMGWVNTETGEPTYADDFKGRFAFSLETSASTAYLQINSLKNEDTATYFCARFLLRQYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords antibody 19D9D6 light chain
publication title Crystal structure of a hydrophobic immunodominant antigenic site on hepatitis C virus core protein complexed to monoclonal antibody 19D9D6.
pubmed rcsb
total genus 42
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2003-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nlbH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nlbH02
2HLAB 4HIXH 4LPYA 3BP6B 1J8HB 3O3DA 5BMFH 5C0BE 2PYEE 4L9LB 4AQ1B 1LHZA 2OP4H 3AM8A 4JEGB 3WS3B 4K9EL 4HJ0D 1V8HA 4GRLA 3RUGA 5DJXA 4RX4D 5E9DA 3W9DA 3OKOB 3QWRD 5DD0L 5GSRB 5GZOD 4E41E 2EDRA 1KJ3H 1ZSDB 4R26H 4ZOBA 2HVKA 4YPJA 1S7VB 4X6EB 2P42B 5E4EB 3VXQB 1IQDA 4L3CB 4XNMB 1ZHKB 2HKFH 2RJMA 4M48H 1S5HA 3K1KC 3LD8C 1GGIL 1FL5A 3ZDXF 1N0LA 1R3KB 2V9RA 1DJSA 2R8SL 4O9HH 4PLKD 3WCYA 1DZBA 4OCMC 4Y4FB 4UAOC 4FQQA 1MCJA 1LEGA 5E1HB 4YWGL 4KI5C 5HHOD 4UQ2A 1J05B 2E6JA 3S34H 5IT2H 4ZFOL 1UZ8A 4JFZL 4F7TB 3FQXA 3SQOL 3LY6A 1QBLH 4TSCH 3RY6C 1PY9A 3NFNA 2KKQA 1YEFH 3K4AA 4FA8A 4JFEB 2AJZA 1V7NH 3Q6GL 4RISL 4AG4H 4YR6B 3UTSD 2PTVA 1MPAL 4JFDB 4X8JB 4FMFA 5AZ2H 5IEHB 5F9JB 5DQJA 5C70A 2C4FT 1T5XB 2DQJH 3T2NH 2BSSB 4UAOB 4E42B 3QG6A 1IM9B 5J1SC 1YEJL 1F58L 5L2KE 4XP1L 4U1LB 3W0WA 1UCBL 1GXEA 4KHTL 2YD1A 3PWJA 2V7HB 3G6JB 1XF2A 3LN9A 3WS6C 2P8LA 4N8VG 3HG1D 5E0QA 3N85H 2VKXA 3TBSA 1GPOH 5HHPA 4ZOCA 2WBJC 2A83B 3KLDA 1B0GA 2ZOKB 3MV7E 1NMBH 5JPMA 3BOVA 4XPGL 1U0QA 4OSUH 2P49B 3D9AH 3UBXI 1ZA3B 3RVTC 4K7PX 3T08A 2AJSL 4HS8H 3C5SA 1I9IH 2EEDA 3W81A 2IPTL 2YPVL 5KSBE 1F3RB 2A6JB 5AYUL 5INCA 3MGTA 5IB1B 4A6YA 2YC1B 5BV7C 1IC4L 4HQQH 3CSPA 1DUYA 1UWEL 3VCLB 4PJ5D 1YEIL 3RWGA 4TUKH 5GJTL 4PGJA 4TPRH 1IAIL 4NQDD 5ISZA 5HDBE 4KUCF 1FO0A 3DWTA 4X8XA 2WBJB 4U6XA 5IBTL 1YN7A 3GMMB 5T3XD 1K8IA 3IFPA 4P2QB 3DO3A 1RJLA 3MODL 5FYLE 3CSBA 3IXTB 1ZT1A 1QSFB 1A1MA 3L7EB 5DD6A 3UJIH 5EUOB 2DQUH 1R3LA 1VEOA 3IT8D 4PJ7F 2P43B 3W39B 4F8QA 1KACB 3ILQC 4X98B 5LGJA 2NR6C 3HLAA 5DK0B 2FGWL 4RGNC 4BZ1H 3MJ7A 1CK0L 2IEPA 5HHXL 1A7BA 2IG2L 2VITB 1FBIH 1MQKH 1K5NA 4QHUA 5HD8C 3PWPD 4FQXA 3ZDYE 4AT6B 3QNXA 3CFIC 2MHAA 1MOEA 1LE9B 3TV3H 3VD3A 5IMKB 2E27H 1S9WB 5SWZB 4DOHB 4YBLB 1KIRA 5CHNB 5DI8B 3HS0A 4IRJA 4M9OA 2WIIA 4YXLH 5FYLL 3L5XH 4M61A 1OTUD 2H3NB 5DHXB 3T04D 4U1MA 2SEBB 5K9QG 3O6FA 2AQ1A 3P77B 4PJGA 4JRWA 5IR1B 1P2CA 2P7TA 3L3DB 4FQ1L 2DQCH 1PLGL 2IC2A 4RGNB 4R4FL 5DUMH 4F9LA 5TQ0L 2X4QA 3DXAB 3IS0X 3ZDZE 4KK9C 3L3JA 1E4JA 1TCMA 2GSGA 2HT2C 4FHBD 4RMRA 2H8PA 3O3BA 2R0LL 1OP3K 3H9SA 4MA3B 3WLWD 1ZHLA 5J6GA 1WIPA 2FSEB 2VZVA 3MLZH 4AL8L 4MD5B 2PTTA 2Q8AH 4PLNC 2OQJB 1UYWH 2XZZA 5E9DE 3DVGB 4NKIH 4JG0H 1CVRA 4NQTA 4KROC 3SKMB 2QTEA 1D5BB 3PDDA 2OK0L 4JFPA 5T1KA 1I3GH 5IFAH 1KELH 1HH6A 4NO3A 4YFEA 1CGVA 3GO1H 4TNVF 3SDCB 3UTZA 3ZE2E 1QVOA 3GBMH 4Q6IC 4RAUB 5F93C 1JPFA 3KHQA 2P48B 4NHUA 1N5AA 4IDJL 4APQA 1XF3B 5E2TH 3CDFA 4YX2H 3CC5B 1XGPB 4ODWA 3ARQA 3QH3B 2A0LC 3G5ZB 4HX1B 4QHMA 4F80A 1KIQA 1ZANH 1WT5A 2AABL 2DQEL 4GAGH 4G8FA 5GRJL 3CPLB 1AXSB 1U92A 1GL4B 1MHPH 2EDOA 4HFUL 3NIFE 5F9WC 4KROB 3STZA 2CXGA 2EYTB 5KZCD 1RZ8A 2JK5A 4F33B 3WKML 3HUJB 5F7DB 1P84K 5ALBH 5T1MA 4MD0A 4JFOA 4KRPD 4GSDL 4P23D 1QFOA 2B2XL 4KI5F 4KVCH 1IL1A 5J6HA 1AFVH 3T1FA 3VXNB 4EI5A 5CEZE 1QACA 4ODXB 4QRPB 3PJSB 1AIFB 1NC2A 2IFFL 4OFYD 4X4XA 2MWCA 1S7TB 3W0WE 5J9PB 5IBLD 5FO9B 3MXVL 1OOAA 1E28A 2BHZA 4KH2A 4MWFB 3SE4A 5D1XB 2K1MA 1F02I 2J6EA 5DEGA 2NW2A 4HWBH 1J1XH 5F9WB 3RRQA 2PCPB 4OB5H 3D0LA 5J12B 5F6HJ 1KB5L 1U8OB 3RWCB 2ICWB 4OZ4B 1NAMH 5SV3A 4GMTL 3MA9H 2FL5B 1WFUA 1GOHA 2YD2A 3L3KA 4LP5A 5HBBA 1JGDB 1ZT7A 1CDGA 3DX8A 2FIKA 4FFVC 1BAFL 2MQ0A 3D18B 5DVMA 5CEZL 1CGXA 3PABB 4DN3L 5GS0L 4PRBA 4YEEA 3UC0L 4GOSA 43C9A 1HXMA 4QHKI 1IZJA 4G6ML 2NLJA 3I75B 5EN2B 2BDNH 3IKCB 3V4PL 1XR9B 3AXLB 1HE7A 5F7FA 5ISZE 2H32A 2VR5A 2PXYD 5DD0H 5EUOF 1VDGA 2DJSA 2F58L 3UTPD 4RSVA 1SYSB 2MNUA 1UXSA 3V9FA 1QTYT 2EIZB 4M00A 1RZ7L 4Q74A 4BKLA 4PY8I 4JFXB 5D7KE 4QT5B 5IHZA 5D6CB 3MRMB 3GJEA 2R56L 4WFHE 1ZWIB 1A7OL 3LHPH 4QGYA 2JIXD 5CZXD 1GGIH 1XEDA 4G7VL 3HCVA 2IBGA 5DMIL 3WE6B 2ARWA 3E2HC 1FL3A 4A6YL 4S2SB 1QHOA 5FF6A 5C0RL 1LILA 4YWGH 1IAIM 1KJ2B 1SMAA 4XTRC 3FHAA 3L5WA 1G9MC 1FO0L 2HJLB 4LK4A 4EBQH 2X4SB 4JFZH 1QRKA 2M26A 2OTUB 3WFEH 5LWYH 4PJIA 1RZFH 4YZFF 1LNUB 2CLZA 5C3TA 4P2RA 5H8DA 1P9MA 1QRND 1CICD 1EV2E 3BD4A 4HUWB 4KK5C 4OZIB 3GFUA 3Q6GH 4PJGE 1U91B 4Y88A 1MFNA 4TSAL 4PBXA 1OGAA 1M7DB 5HHVH 4HLZH 4JY6A 4OLZL 2CKBA 4PP1D 1AQKL 1KEML 2VLKE 3C9NA 1MI5D 3H9ZA 1F58H 4XP1H 4AENA 2OSLB 2GSIA 1H8NA 1UCBH 3H9SE 2ARJB 4KHTH 3GMRA 4GUPA 1NLBL 4LNRA 5IMMA 1I8IA 3J8F7 3W11C 5M7QA 5DHVB 2ENSA 4Y19A 2KH2B 2AJXL 3UPCA 4HGMA 5TJWK 4WENB 5F70A 4LLMB 3EDDA 4GFTB 4LKXB 4HG4J 2XA8L 2V2WA 1KENL 2CUMA 3JTSB 3QXDB 4WY7H 4U0RC 3TJHC 1NDMB 2V17L 1U2HA 5GGTH 1PY4A 2ZCLH 1FYTE 5IG7B 2ITCB 4TUOA 2RHEA 2H1PH 3B6SA 1N4XL 2IPTH 3S98A 4ORGB 1G7PA 3CDGB 3FB6B 2YPVH 3S88H 5DMJB 4HUKB 4X7CC 4NKDB 5AYUH 4HIHB 4KMTL 3GSWB 4PJHF 3MUZ1 1UWEH 2CDGA 3D85A 1F3JA 1A1OB 3U82B 3WNNA 2OL3B 5I16A 1KBGL 1AGDB 5TPWL 1EHAA 3HUJF 5HXMA 3MMEB 3EOAB 4X80L 5I1EL 1WTLA 3VFTA 1NGWA 4LKCA 3I2CL 3QJFA 4MAYD 3UZQA 4MYWB 4R4BB 2F54A 1WCBB 3RTQA 4U0RB 1DE4B 5GGUB 3KXFB 3WHXA 3NCMA 4YO0A 1FVEA 4KK6C 3WBDA 2QQNH 1M71B 3DVFA 5GS3A 3UBXG 3ARBC 2FGWH 1G7LA 1IQWL 1UXWB 3CUPB 2R1XB 1LO3L 3F5WB 1DLHB 3HZMB 1BD2D 5HHXH 2IG2H 1CGTA 3S9DB 3KPPA 1ODAA 1U8IB 1YQ2A 2HRLA 4N68A 2G60H 4H0HB 1V3MA 2AK1L 3OF6A 4HK0A 1QNZL 3F65A 4L1HA 5FKPA 3LIZH 3TC9A 2AEPH 1MCCA 3P30L 4ELMB 5F7UA 1X3DA 5I73C 5H2BA 3EYSH 5HGHA 2OBGA 1GGBL 4FZ8L 2NW3B 3A6BL 5CSGA 4YXKL 3OPZL 3UAJD 5FYLH 1CDYA 3S36L 4ZUVA 4M3KB 2HH0L 2HLFC 2QJDA 4L8BA 1NUNB 5F88A 4LF3B 4CBPA 5FHBH 1S7UA 4YIQA 1GGTA 3SCMC 3ARBB 5E4IA 1WZKA 1UVQA 3ARSA 3IDXL 1D5XA 3LQAC 3PXHA 2DBJA 1FJ1A 1RUML 2J8UB 4FXGA 2A73B 1XGYL 3MX0A 3QEGL 2G9HB 4D8PA 4KKCC 3VH8A 3VRLE 1JF1A 1N64L 3RWIB 3HMWL 3LKSB 4JZJB 2J6EL 3DBXB 3A6OA 3D2UA 4AL8H 5I73B 5DJ8B 4PGZA 2X4OB 2ZG1A 1I1AD 3CZFB 1L0QA 2I9TB 3VGHA 5T5NF 5ITFA 1QYGH 4KKBC 3O8XC 1FSKB 3EGSA 3P4OA 4GKNB 2OK0H 2AEIT 3VI3E 4LLAA 5KAQF 2G75A 3PV7A 4PGDB 1MCOL 1FNSH 1V7ML 5EBWA 1X5JA 1IJ9A 4KKLC 1WCQA 4A2LA 4JKMA 3U36A 1KNOB 3CAFA 4M43L 2QKIA 3BO8A 3MRQB 2AXGA 3OKEA 1X5ZA 4IDJH 1JHTB 1T5WB 3T77A 2C5DC 5ELIA 3MBEA 1RJCA 2NY4D 5IQ9B 5TGBB 3H7BB 1KLFA 2LTQC 1BZ7B 2YBRA 2GJ6D 4V1DD 1CE6A 4PJ7A 3SKNA 2DQEH 3WYRA 4OZIF 3EYUL 2GAZB 1J0HA 1EZVY 1HWGB 2YD3A 3QUYC 5JQ6L 3GMLA 2EH7H 4HFUH 1F11A 1VGEL 1D5ZA 3CFDA 3O8XB 4PJIE 1RURL 3E0GA 4P2RE 4L4VD 5D93C 1YMMB 3WKMH 2P5ED 4Y4KA 1VSCA 4U1KA 4Y4HA 4CVZA 4BH8B 5ICYA 5IB4B 3MRNB 4YDVB 3CH1B 3ARFD 5DD3H 5C0GB 1MHHB 4HJJH 3T3PF 3EYFA 2AXJA 2YKLL 5C0CB 3T65B 4HXBL 4POZD 4D9QE 4R2GD 3LS5L 3HA0A 5I30H 1UH2A 3U7WL 4LLUA 1XIWC 4MJ2A 4WI4A 1JFQH 4GS7C 1VKXA 3D1MC 1Y18A 1JUFA 1QA9B 2HLAA 1OF2B 4JPWH 3MXVH 3BP6A 3FJTA 1UA6L 5AD0B 1J8HA 1A3QA 1VACB 1KIPB 4Y19E 4L9LA 4NC2B 4ZMAT 1S9YB 2Q1EA 4R96A 3WS3A 2NY0D 1U8KB 1F4YH 2WM0A 1UB5B 2FJGB 3C8DA 3GMNB 1A9EB 3FQNB 3OKOA 4GMTH 5GSRA 4NJ9H 1XGRB 4P4KB 5T5FH 1ZSDA 1BAFH 4I5BB 1S7VA 4X6EA 1EVTC 2FNBA 5DJZB 5CEZH 3VXQA 5CEYB 3KPTA 3K8KA 2HTKC 4L3CA 4XNMA 2E9IA 1ZHKA 4GS7B 5TDPB 3UC0H 4H1LG 5TE7L 1R3KA 3IDGB 3S37X 4DZBB 5MI0B 2Q8BH 3WV0A 2FB4H 4G6MH 1IGFL 2NX5B 4Y4FA 2AEWA 4OTXL 1TMCB 5IROA 2FGZA 3ZDXE 5IQ7L 4HSQA 1P69B 1BJ1J 3UDWA 1A6UH 1J05A 2BSED 4M7ZB 4Z77B 1PEWA 3RVWC 2BY0A 1MLCB 1RZ7H 5DEZA 2F54E 4F7TA 4U3HA 3EFDL 2APTA 4X4ZA 1W72L 3MRHB 5D7LD 3L3IB 4WUKH 3OKMB 2EKSB 1ED3B 1SMOA 4JFEA 4G7VH 5C0AE 4UOJA 4YR6A 4A6YH 3VJ6B 4ELMF 4PS4L 1CGSH 2O5XL 4X8JA 1Z9LA 5C0RH 5IEHA 5F9JA 5GRUH 2FECL 1DCLA 3VA6A 4RFEB 3D0VB 1T5XA 3NH7L 2BSSA 1FO0H 4E42A 1IM9A 3I6KB 3VXTB 4NC1C 4LHUG 4U1LA 3CD4A 4PBVC 1J11A 1UT9A 2V7HA 4PJ9C 5GXBB 3G6JA 2EEAA 5DR5L 3C87A 3O0RH 1JZ4A 2J8UF 2A83A 4YHOL 3RY6A 1JYXA 2ZOKA 5IHLB 4TSAH 5TE4L 1CWVA 3L6FB 4KDTC 3RFZC 3IDIB 1ZA3A 2QSTA 3D25B 5C86A 1AQKH 4DZ8B 2VZSA 3VDAA 3TVMC 4PP2B 4PB0L 2A6JA 5IB1A 2YC1A 5JXEC 4ZTPL 5K59F 3VCLA 3OAZK 2AJXH 4C58B 1LEKB 4D9LL 3QIWB 3O6KH 2LU4A 3HI6H 2XA8H 1NSNH 2WBJA 3HN3A 1CXEA 3GMMA 5C6TL 1JWUB 1Q9KB 5I76B 2B5IC 4IOFC 5KSAD 4P2QA 4RFOH 3IXTA 4KI1A 3L7EA 1QSFA 1F3DJ 5EUOA 4TQEH 4I2XB 4CN1A 4RRPG 4M3JA 3W39A 4X98A 4FN0A 4KMTH 5DK0A 2IWGA 2Q7YB 3K4DA 2VZOA 2GJZB 2VITA 4RFNC 4KQ4L 2BNUB 4PJ7E 2B1HL 3X17A 5TPWH 4G8EB 5FM4A 4AT6A 1G84A 2W59A 4X80H 4QNPF 1LE9A 1EJ6A 4LGSB 4YAQB 3K74B 4ZUWB 3BW9B 5IMKA 3I2CH 4KZEL 3VGAB 1MCPL 1S9WA 4J3UA 5SWZA 5CHNA 2HT3C 1Q0XL 5DI8A 4K7FB 2VXTL 1FNGB 1DBKL 1FZJB 3ZKMD 2H3NA 5K9OB 1MWAB 2FO4B 2SEBA 1IQWH 3P77A 5F7MC 3Q5TA 5IR1A 3L3DA 1J9CT 5BJTB 4WNQB 2EZ0D 3DV6B 4ZNEE 4N8VB 1RZIB 3GKZA 1ZLSH 2P47B 4KJQC 3JWDC 2ZUVA 4XHJC 5EPMB 3B3IB 4RBPK 4JCMA 1J8HE 5HDQL 1EJOL 2BXYA 2EO9A 4MA3A 5E94B 4R90H 1OLLA 4JRYB 2YUVA 4FZ8H 1D9KD 2FSEA 3A6BH 3U6RB 4MD5A 1RIUL 2OQJA 5I8EB 3S36H 4JHAH 3DVGA 2VDNL 3IFLH 5FYJD 1FLRL 3SKMA 5FECB 5EU7C 1D5BA 5J06A 4I3SH 3IDXH 3QJHB 2ICEA 2GHWB 3NCBB 3P4MB 4KDVA 1RUMH 4MX7B 4CDHA 1XGYH 3QEGH 4DKDC 2D7QA 3SDCA 2LAGB 3DI2B 4XBGB 4RAUA 2X6MA 2W91A 2DQGL 2YZ1A 5TQ2L 4JJ5B 2J6EH 4H25B 1K6QL 3CC5A 1UWGL 1XGPA 4LMQE 3QH3A 3G5ZA 4HX1A 5TDOB 3BRFA 4K8RD 4EI6B 5SX5K 3SDDB 2ZKHL 1I3RB 2NQCA 4FTVB 3F12B 4OBRA 1G7JB 1VEPA 3CPLA 1AXSA 2CLRB 3I6LD 1T22B 1MCOH 1P7KB 3I3DA 3OKDB 1NMAL 3VGGA 1CF8H 3FO2B 1V7MH 2EYTA 1SBSL 3TNNB 3UXFA 4F33A 3KPRA 3HUJA 1YNTB 4JFEE 5F7DA 4YHZH 4RWYL 4M43H 5BS0B 1TZGH 3MZTA 2GUOB 2YR3A 3EBAA 4L8CB 5E03A 2QADD 4NJAL 4JFDE 5GS2D 2BRRL 3QIBC 4OFPA 1ND0B 3DMMC 5GGSY 1T66C 3VXNA 3VFPB 4ODXA 5HYFA 3VW3L 4I13B 4QRPA 3PJSA 3VFVB 1AIFA 1KCKA 1IE5A 2H32H 3OKLB 3HHRB 3QWQB 4KI5E 1S7TA 1OSZB 5J9PA 2BERA 5FO9A 2BC4B 5JQ6H 4MWFA 5IFHL 5D1XA 4XRCB 3LZFL 1JGEB 2VO5A 4I0PD 5C09D 5HYSG 3GSOB 4ZPVB 2PCPA 5J3HD 1U8OA 1MJUL 2ICWA 3MJ9A 4OZ4A 1EVUA 3RWCA 1TNMA 4X9BA 3UZVB 2FL5A 2YKLH 1S78D 2HAZA 1JGDA 4HXBH 1A5FH 1H8OA 1ADQA 4QRRA 1CFVH 1QFHA 3TIDB 3JZ7A 3QIBB 3P4LA 3D18A 3LKRB 3EUUA 5A1AA 3PABA 5CIPB 3IAQA 1A3RL 1UA6H 4U05A 3MACL 2QQKL 2Z92B 5B21A 3WXWH 3B9AA 5DJYB 3PXJA 3JTTB 4EDXB 1QFUL 1XGTA 5DVOA 3I75A 5EN2A 1DVFD 3IKCA 1XR9A 3AXLA 3C5ZC 3WSQL 4ISVB 1CU4L 3PWUB 1BVLB 2A38A 1IEHA 1SYSA 5DSCB 3Q48A 1GYAA 4N0CC 4F2MB 3EJYC 2EIZA 1LP9B 2I27N 4JFXA 4QT5A 1QSFE 5D6CA 3MV8A 5J4MA 3MC0A 3MRMA 5EUOE 1SY6L 2CKBH 1ZWIA 4YQXL 1EO8L 2Z8WC 1T80A 4FRWA 1R3HB 1NC4B 3CFEB 3WE6A 4J4PD 2OJEB 4S2SA 1IGFH 3BQUD 1WAAF 2UV3A 4OTXH 3JXAA 3QRGH 5H37G 4MNGB 2VH5L 2VB5A 4GBXD 5IQ7H 1CVSC 1KJ2A 3STLB 5C3LD 4Z18A 4LFHD 2HJLA 2X4SA 4XVJH 3SBWC 3RA7H 4NSKB 1IKFH 3NCYS 5SWZE 1K2DB 4DOHE 2OTUA 1Z9OA 1W72H 5BQ7B 3C2AL 1R24B 1LNUA 4LDEB 1PX4A 1NGXB 4WTWA 4HUWA 4CRPA 4OZIA 1G1YA 5IJVB 1U91A 4CW1B 3B4NA 4H20L 4Y1AD 4IRSB 4W68A 4YZFE 2YK1H 4L3ED 1PSKH 1LO2L 1ZS8B 1IGCH 1NFKA 4RGNE 1M7DA 3DXAE 1JHLL 5GIRB 5BV7L 4QXUL 1UJ3B 5EOCH 4MXWL 1Q72L 5EU3B 2OSLA 3PP3K 2ARJA 3BWUC 3C09C 3HR6A 2J8HA 3GNML 1NBZB 4LPTA 1QQDB 2GT9B 4G6JL 5DHVA 2VAJA 4Z9KB 4MB3A 4X6CB 1NCDH 3EZ8A 3PP4L 4MXQD 4LLMA 3GBNH 2FX9L 4LKXA 3JTSA 4O58L 3SDAD 3PG2A 2VMFA 4NBYB 1NDMA 4X99B 4H8WH 1OM3L 5IG7A 5D2NB 1JMZA 2ITCA 3VFGH 1OT2A 1VPOL 2HT4C 3K3QA 4LP4A 2PW2B 4ORGA 3CDGA 3FB6A 2YPKB 4NKDA 4HIHA 5CUSL 2JCCF 3GSWA 4B7IA 1UACH 4G9DB 2DLTA 4FXLA 3QBTB 5FXCH 3C09B 2QQLL 1A1OA 3T0WA 2OL3A 4R8WL 2ICWJ 3TYGL 5D72L 3C08L 2YRZA 1NEUA 4V2BA 1M7IB 1UEMA 2V5TA 1AGDA 2NXYD 4O00A 2H45A 1D7FA 4PJHE 5IESH 3MLPA 4GAFB 3MRIB 3MMEA 3EOAA 5C2BH 1AR1C 1BJ1H 1F4AA 5E8EB 4X7EC 3ULSB 5EIQA 4R4BA 1WCBA 4RGOL 1XF1A 3HUJE 1DE4A 1M1SA 5GGUA 3KXFA 1CBVH 1KUMA 2EE9A 4WO4D 1YEGL 5J57B 5JW4Q 4WUUB 2AK4D 1M71A 4JO2H 3O6LL 2I26N 2VNCA 1UXWA 3CUPA 3F5WA 2R1XA 3H0TB 3HZMA 1DLHA 4FFYL 4ZQKB 4MS8C 2B1AL 2VR9A 1TCRB 4TSBL 2HTLD 2B1HH 1U8IA 1L7IL 1GRWA 4Z7QF 1DBBH 5JLZB 4ELMA 2R2EB 3LH2L 1O7VA 2BOBB 1KCUH 1LE5B 3QDMB 4HWEL 1PW3A 2NW3A 2N7BA 4PV8B 4C57C 3PL6B 4NDMB 3FRPA 4XAWH 1DBKH 3QCTL 1QFPA 5D7JD 5HVFB 4WHCA 5E2JA 1X5XA 1F8TL 4WTXA 5FUZL 4UV7L 4DW2L 3QDJB 3ARBA 3QWOB 3PHSA 4P5KB 5JA8B 2J8UA 1A9BB 2O5YL 2A73A 2BVYA 3LPGA 2MQ3A 1T2XA 4EDWL 1N7MH 3NABL 4MJ6B 3BUYB 5HDQH 3WDIA 4JKPL 1GAFL 1MFBH 3GMQB 3RWIA 4K3GA 1OAXH 3LKSA 4JZJA 3HC0B 3DBXA 4NKOB 1LP9F 2GITB 1RQ5A 5DQDH 5DJ8A 1MF2L 1F4XL 1RIUH 2X4OA 4CN6A 3CZFA 4I48B 4L3AA 2I9TA 3NA9L 4H88L 4PPTA 5DC9B 3QUXD 5FOJA 3MJ9L 1CIDA 4PRID 3VD4A 1VA9A 1A22B 4XNYH 4NT6A 4GKNA 2D7PA 4Y5XC 5I1JH 4PGDA 4JRXD 5DVLA 1ADQL 5GGVY 5DYOB 3VRIB 2ICCA 3IETB 5F7HA 2BJML 2B4CC 1KNOA 3MRQA 5GRVK 2DQGH 5BO1L 1AHWC 1JHTA 1T5WA 3QEUB 1T83A 5IQ9A 3OTTA 5TGBA 2OLDA 3H7BA 5K33A 2Z31C 1ZGLB 1BZ7A 3VWKB 4L4TD 4YPGB 2GAZA 2VC2L 2O26U 3UBXB 3IAPA 3O8XA 1J12A 4WHTB 2XZAL 1NMAH 4AEHL 1IC5L 4XC1L 1SBSH 5ITBH 4Y5XB 1YMMA 4OZIE 5E56A 3KPSB 4RWYH 3OAZH 2XT1B 4BH8A 5JHLL 5IB4A 3QQ3B 3MRNA 4YDVA 3CH1A 4B53A 4Y16C 4KK8D 4NJAH 2VN7A 4QRQB 1MHHA 2BRRH 4I3GA 5ADOL 5C0CA 1EUTA 3T65A 2XWJB 3VW3H 3VMOA 1BZ9B 1YYML 3BESR 3QO1B 1QD0A 3V2AR 2R4SL 4X6CF 3T3PE 1QA9A 1KJ2L 1OF2A 1XCTB 2Z31B 4JHWL 4X4MA 1I1RA 4JQIL 4OGXL 4XBEH 5AD0A 4OCYH 1VACA 1IMHC 1KIPA 3BE1L 1GJIA 4OBSA 3V0WL 1S9YA 3MV01 5DMYA 1PKQB 1RU9L 3CFCL 2M1KA 4K2UH 4LOUC 1U8KA 4PJCB 3MYJB 5I6XC 1UB5A 5JW5B 1XZ0B 4N1HB 2FJGA 3GMNA 4JY5H 1MJUH 1A9EA 1KG0B 1LO4L 3FQNA 3L9RB 4DVBB 1QHPA 5ALCH 1MIEL 1XGRA 4P4KA 5IFJB 1UH3A 3DRQB 4LU5L 5BOPA 4Y16B 3DOSA 1BZQK 1DQQB 4I5BA 5MEOB 5DJZA 3VFMB 4KHXL 4XC3H 5C6PB 1A3RH 2EIEA 1MCQA 1NFIA 1FFOB 2CIKB 2QQKH 5TDPA 5E95B 3MV9B 1FZMB 3IDGA 2DQHL 4ZYKB 5IVOA 4DZBA 2X41A 2Z4QB 1G9ML 4ZUUB 2XTJC 2NX5A 3WSQH 1CU4H 4ZSOB 3L7FB 5D6DC 5HI4C 1AD0B 5I6XB 5CJ8A 4Z77A 2DL9A 3W5NA 1MLCA 4RBPH 4X5LA 4YQXH 3MRHA 3L3IA 1EO8H 3OKMA 2EKSA 1ED3A 1NGZB 1BJMA 4YFLF 4BZ2H 5E08L 3X3GH 1K3IA 1TPXB 1S7QB 4LAJH 1DANT 1JNHB 1PG7H 3U48A 4XVSH 3VJ6A 2A2QT 5F44A 1U41A 5L2KD 1EA9C 1BWWA 4NKMB 2VH5H 3QAZC 4RFEA 3D0VA 3WFDH 2XTJB 2ADIB 3FN0L 1EAPB 5CKAA 1A6ZB 3FQWB 4LLVB 3ZT5A 4ELME 3I6KA 3VXTA 4ZPTA 5CSZB 5JR1L 5GGVL 3C2AH 3MV7D 2NZIA 2FZ3B 3OR6B 4F3FB 5CD5D 4JANB 4UU9B 3LSOB 5A2JH 1RULL 5IIEB 1Y6NR 35C8H 2Z91B 4H20H 1IT9H 5SX5H 2DLFL 3L6FA 4ZUTB 1NMCB 3S7GA 1FGVL 4PRHB 3V6BR 2J8UE 3IDIA 1JHLH 3ARGC 3D25A 1M6OB 4QXUH 4FFWD 5EOTB 3QO0B 1VHPA 5DHYB 1P7QB 3KPOB 4DEPC 5GISL 4DZ8A 3QAZB 4CGTA 4UNUA 3P2TA 3FQRA 4NRYB 3RBSA 4PP2A 4JPKL 5C8JB 4YBQC 3GNMH 1OB1B 2D2OA 5D1QC 1G9EA 3B5GA 2R29L 1KIUA 1LEKA 3QIWA 2FX9H 5C07D 1BOYA 1A6TB 2CK0L 3WJLA 4PUBL 5K59E 2VDLH 4O58H 4H1LB 1MJJB 1JWUA 4J6RH 1IKNC 1Q9KA 2YHGA 3KLAB 4HUUB 5I76A 3ULVH 1OM3H 3Q1SL 1RJYB 1VPOH 4OV6F 4EN3C 3ARGB 4I2XA 5EWIL 3O2DL 3UYRL 5CGTA 4H0IA 4DEPB 1CN4A 5A3ID 5CUSH 1LO0L 4O2FB 4QRSB 3R06B 2Q7YA 4ERSH 1R3JB 4PG2C 2GJZA 5DDHB 2ZCKL 5KVFH 2QQLH 5DWUH 3TYGH 4R8WH 5JXEA 5D72H 3FL7A 2BNUA 5CKGA 2VLRD 4HEME 4I8DA 4G8EA 1VCAA 5IEKB 2AJVL 4JPIB 4YAQA 4ZUWA 4NZTL 5L6YL 3BW9A 1AO7B 5HI3D 4N0FB 4N5ED 1YMME 3U83A 4LSTH 4L9DA 5DFTA 4LVNB 4K7FA 3QUZC 2FLBT 1FNGA 3T2OA 4QNPE 1FZJA 2JKXA 5K9OA 1MWAA 2FO4A 4EN3B 3V4VL 5F1KC 4FFYH 3RAJH 1L0YA 4LHUB 5C0CE 5ACZB 4TSBH 2H9GB 2XZCH 2F53D 2LQRA 5BJTA 4BZYA 3C6LC 4WNQA 1FNHA 3DV6A 4N8VA 1RZIA 1HHHB 4PJCF 2NPLX 4R0LB 4MNHB 5EPMA 3B3IA 1DLFL 3LH2H 1UADC 5AEAA 5E94A 3NZ8B 2PO6B 3BWAB 3U6RA 3VXSE 4O02L 3LQZB 4I77H 4DGYL 3QCTH 5I8EA 4Z5RB 4KZDL 3QUZB 4UILL 2HWZL 1F8TH 5I1IH 4UV7H 5CJOH 4YEFA 4PLJC 3QJHA 1SJHB 3P4MA 2HVJB 4MB5A 2WIMA 4MX7A 5E24E 1X9QA 5HVHC 1GHFH 5SX4H 3NABH 3C6LB 1KLGB 3TO4D 3DRTB 1X5KA 4XBGA 2A77H 1GAFH 3FN9A 3UEZA 4WFFE 1YECH 4NCC1 4JJ5A 5GGQL 4LRNL 3KPNB 4O2CB 1GH7A 4B41A 4H25A 1MF2H 1OCWH 5TDOA 4KPHL 4HJ0C 4EI6A 4P9ML 3SDDA 1UKQA 1I3RA 1OVZA 4QO1A 3MJ9H 4FTVA 3F12A 2EYRB 2PN5A 3CZJA 3IKKA 1JRHH 1JPSL 3O4LB 1Q1JL 2CLRA 5L0QC 3BP5B 5F6IC 3PQYB 4L8SB 1T22A 1P7KA 4A2MA 3OKDA 1ADQH 3PP3H 3U9PL 1EHLH 1IARB 3FO2A 3TNNA 2A9ML 4LIQE 1YNTA 4ZUSB 5CEZD 2ZOLB 5HVHB 5BS0A 1NAKH 2GUOA 3TLRA 1UGNA 4Q9RL 4L8CA 4UDUB 2OZ4A 3HC3L 5GS0D 4YDIH 3P0YL 4MDJB 2CR3A 1U8NB 1ND0A 2AEQL 4MLIA 3R8QA 1R0AH 2F19L 2WWKO 3VFPA 4KQ3L 2O61B 1BHGA 3VFVA 3D39D 3ZKXC 3OKLA 4JQVA 1X5AA 2MFNA 2HFEB 3G5YB 1OSZA 2BC4A 1PKOA 1FFRA 3K0WA 3CLFH 4XRCA 2XZAH 1JGEA 4AEHH 1IC5H 2AGJL 2CD0A 5F6IB 1IGTB 5I19L 3GSOA 4ZPVA 2DLGA 3RNKB 3H3PH 1QBBA 4XNXL 1I8LA 4LIQL 4MZ2A 5DD1L 5E8NB 1NANI 1JGUL 2EXYC 4JPVL 4N1EA 2CSPA 5ADOH 1B0WA 4JM4H 3F7QA 3TIDA 3QIBA 3LKRA 2DM7A 1Q0YL 2R4SH 2EYSB 1EHNA 1GGUA 1KJ2H 5CIPA 1WUNT 5FGRA 3GI8L 1TJHL 1RD6A 2Z92A 3IJHB 3MO1B 4NC1E 3BP4B 3BE1H 5DJYA 5HHOB 4ZTOH 4EDXA 3JTTA 3U0WL 5DJ0B 3G9VA 1OAKL 4U7MA 3REWB 5D7KD 4ISVA 3DYMA 3GK8L 3PWUA 2E7CA 1ZLUK 1VADB 2JB6B 1BVLA 1FFNB 4WFHD 5EBMB 3BYTA 3BX7C 3KR3L 5DSCA 4F2MA 3T2PA 1JHKL 4ALAH 1LP9A 4XP6L 2I24N 5CEXB 3V8OA 5KVGH 1JTOA 3UTSB 4MXVE 1JNNL 4I2XE 4KHXH 1NLDL 3B8YA 1JV5B 1R3HA 1NC4A 3CFEA 1QR1B 1PQZB 1YMHB 3FMGH 4FQXD 1QKZL 3F7YB 4MNQD 4F7MB 5I1GL 2OJEA 4HH9B 4AEFA 4X9IA 3WL9B 5DHVH 1JNLH 3FZUD 4MNGA 2NY6D 1J18A 2WLYA 1CR9L 4MJIA 3STLA 3HG1B 1RIHL 4WI3A 3LKOB 1DQLL 3L95B 2OYPA 4NSKA 1OGTB 3SO3C 1K2DA 2NY1C 2DM3A 2DB8A 5KW9L 2V9TA 5FIEA 5BQ7A 1R24A 2BK8A 4OCWH 5BVPH 3MR9B 1NQBA 1NGXA 3EDEA 3HPLB 4MQSB 4NN7C 5HYJD 3QHZH 2FEDD 1TJIL 2M8XA 4NZDA 5IJVA 2R4RL 5TF0A 4CW1A 4IRSA 1AGFB 2VLKD 1ZS8A 1IGML 2UUDK 1LDSA 2XKNB 4IJ3C 4LCIL 2D0FA 2OL3H 1KCVH 5GIRA 2NTSP 1UJ3A 3F62A 3BAEL 4PJ5B 1OAUL 3MUJA 5HYSB 5EU3A 3QHFL 4G42B 1MSPA 2EECA 4NQDB 1TJGL 4JRYE 2CKNA 5JR1H 5KVDL 1QO3B 1UM4L 1KOAA 1W2KT 2EDNA 3SKOB 1W8OA 1NBZA 3SO3B 1QQDA 2NY1B 1HEZB 1RULH 1I7ZB 4X6CA 3QISA 5I8CB 3ZTNL 3DETC 4OCSL 5DJ2B 2A6DB 2APXA 4NN7B 1FYTD 3RZWA 1MWAL 3GSNB 4HUMB 5E00B 3T09A 2JJUA 3TP4A 1GZPB 4GXUN 4X99A 4HGWB 5D2NA 2EDYA 1H3XA 5GISH 2GK0B 2QLVB 2PW2A 1YNLH 1A0QL 2YPKA 4LSQL 3PWPB 2XXCB 3FHQA 2C9AA 3C5JB 3RP1A 4G9DA 5I2IB 1EEYB 4GLRH 4XHQA 4JFFE 2R29H 1EBPA 1M7IA 2LABA 4FTVE 3A67L 1ZTXH 2CK0H 5EC1B 2WMPA 3HRPA 4PUBH 5D5MF 3FONB 3MRIA 4DFIA 5E8EA 5EU7E 3ULSA 1H8SA 4UTAH 5EWIH 4PD4K 5BS0E 4WUUA 4ZNCD 4G8IB 4CUCA 4GRWB 3C60D 3H0TA 4ZQKA 4G8GE 1FH5L 3JWDL 1WTGT 4OGYL 5FUOL 1ZGLP 3BN3B 1TCRA 3CU7A 5KVMC 4WI9A 1JGVL 3AB0B 4MAUL 3QUML 3QFJB 5DLML 4XAKE 4W4OA 5JLZA 4NZTH 3QULB 4PFEA 3T0ED 5L6YH 1I9RL 2R2EA 2BOBA 3RZCC 1IAII 1B9ZA 1LE5A 3KS0J 4U33A 2VXVH 4Z7QE 4PV8A 3PL6A 2D0HA 4NDMA 4Y0GA 1MVUB 3LQAH 4ZDHB 4BELD 3KNBB 4P23C 4KAQL 5ADPH 4OM0L 1HH9B 2YD9A 2ATKB 4LPWA 1H3WM 1VFMA 3QDJA 4S11A 3QWOA 4WI8A 4WV1C 4P5KA 3OAYK 5LBSL 4WEMB 1B0RB 5GRYA 3PWLB 1A9BA 2ZJSL 4HK3N 1DEEB 3S36X 3WIFB 2DDQL 4I4WA 1FAIL 3BKJH 4PD4J 4GJTB 4MJ6A 3BUYA 5T3ZE 4WCYH 5KSVB 3WDHA 5IMOB 3GMQA 2XG5A 3SJVD 3HC0A 5HDOA 4KGJA 1YEKL 1M05B 4NKOA 4O02H 2GITA 3BPCB 5EO0B 3RZCB 2OMBA 2W9DH 4I48A 1U6AL 5KZCB 1MRFL 4JDTL 2DTML 1G7HB 4LFHG 1LP9E 4AIZB 1CL7L 4KRPB 3CJJA 4P23B 5KVEH 1KJVB 3IDYB 4OFKA 2D4FA 3RU8L 5DYOA 3VRIA 1WLHA 3IETA 2OTPA 5C08E 3FKUS 3P0VH 3ROOB 5T3ZL 2HG5B 3QEUA 4U1HB 3TA3D 4MNGE 4KPHH 1WITA 4P9MH 2LU3A 1R3IH 1ZGLA 2NY3D 3VWKA 5DJ6B 3TBTB 1KJMB 3P73B 2CUHA 3ZO0A 3SGJC 3HC4L 1JPSH 4YPGA 1AE6H 3UBXA 4CMHC 4WHTA 3ROLB 5HJ3B 3BSZL 3U9PH 4JHBA 4Y5XA 2A9MH 2VDKH 2MKLC 3RY4A 3KPSA 2ZUYA 5INDB 2GEEA 2XKSA 2HFTA 3QQ3A 4Q9RH 4QRQA 4K07A 4WW2C 1JTTA 5IVNA 4M7JL 2P5WD 4HWUA 3LRGA 1CLZL 2XWJA 1KPRB 3C2SA 4KQ3H 4S10A 5HGGS 4HULB 3ZSSA 1BZ9A 3NCCB 3QO1A 1FNEB 1D6EB 2YOCA 4XMLL 4Y19D 1DL7H 3FB8B 4KTDH 1XCTA 2Z31A 1OPGL 2PXYB 1K3ZA 3DHMA 4PGBB 2AGJH 2FD6L 1CGWA 4HF5L 5I15H 5I19H 1PKQA 4X6CE 1BBJB 4PJCA 3MYJA 3DSFL 5JW5A 1XZ0A 4X6BB 4D9RE 1KG0A 4LIQH 5DD1H 3L9RA 4DVBA 5D1ZD 1EMTH 1WFOA 4JPVH 4OCNC 3QP3A 4C55A 4ACPA 2HMID 1BQLH 5IFJA 3DRQA 5HHQA 2JIXB 3H3KA 3DNKA 4WEUD 3JV6B 2A1WH 5D2NE 1DQQA 1OARH 5MEOA 4Z6AT 1YEHL 1Q0YH 4PP1C 4W6XB 3VFMA 1U3HD 3MRGB 3GIVB 3P3YA 3GI8H 1FFOA 2CIKA 3LVEA 3MV9A 3QQ9D 1FZMA 4OLEA 5F1SA 3S35H 4ZYKA 4HUNB 2IH1B 3SPVB 4ZUUA 3L5IA 2R69L 1Z0MA 3B5TA 4ZSOA 3GK8H 4K23H 3L7FA 4Y5YC 1CDHA 4YXHL 4OLWH 1AD0A 2G5BB 3KR3H 1QRNB 3LOWA 4OT1L 3HE6D 1JHKH 3AM8C 4HKXB 4GRWF 3BRDA 1X7QA 4M1CD 5JOEA 2FX7H 4WWID 5C0AD 2CK2A 3OGOE 4NN6B 2YA2A 1JGLL 3V0VB 1NGZA 4WUUE 1INQB 1KXVC 4P5TD 4F15C 1S7QA 1QKZH 2CJUH 3TM6A 2X4RB 1JNHA 2X42A 3IJSB 1MI5B 3SE9L 3MPCA 1KV3A 4NKMA 1B4JL 2OI9C 3DURB 1CR9H 2ADIA 1RIHH 1EAPA 3PWVB 4M6OL 1A6ZA 3FQWA 4LLVA 4KJYB 5D6DA 4Y5YB 5CSZA 4RDQG 3QDME 2Z0BA 4BYHA 1AD9B 1YQVL 2ZNXA 3CX2A 1AR2A 3GGWB 2FZ3A 3OR6A 4F3FA 1XAUA 1MFCL 5E8DL 4JANA 4UU9A 3LSOA 5IIEA 2IQ9L 4NWUH 2R4RH 4AIOA 2Z91A 5JZ7D 5A2KH 2VZUA 1F45A 4KJPD 4ZUTA 5SV4A 5B3JF 1R5IB 4LCIH 1Z0NA 3QPQD 4PRHA 1X6NA 1M6OA 5EOTA 3BYYA 1OAUH 3QO0A 5DHYA 1P7QA 3KPOA 2JJSC 4UOW1 3EIFA 1TJGH 4NRYA 4W6YB 1UM4H 1ZK9A 5C8JA 3BD5A 1WFTA 1T21B 2IPUG 1MFAL 3ZL4L 9CGTA 3DUUB 3S4SG 1EZVX 4MAYB 3ZTNH 1QSED 4OCSH 2EDQA 1X5HA 1A6TA 1MWAH 1T2JA 4H1LA 1MJJA 3FT3B 1TZIB 3KLAA 2GCYB 4HUUA 2ID5A 5KANI 2X05A 4HCRL 4UV4L 1S3KH 1BD2B 1RJYA 4WGVB 1K4DB 1V3KA 5L8KB 3ARGA 4JO3L 4YE4H 5F6HI 5JHDE 1A0QH 3HZYB 4MQ7B 4O2FA 3TBWB 4QRSA 3R06A 2YXFA 1R3JA 4HAFA 5I74B 5DDHA 3GB7B 5B39G 3A6CL 3JWOH 3QDHA 3V52L 3ES6B 1WK0A 1E27B 1O5DT 1I1AC 3CVHB 2YRPA 3BZ4B 4RWHA 1ZHBB 5IEKA 3NFPB 3HB3D 4JPIA 4P2CG 1FCGA 4I18A 1V05A 5DA0B 2QL1A 3BHBB 3F7PC 1AO7A 2I5YH 4N0FA 4OAWB 4NWTL 4RA3A 5FOBB 4BFEA 1IKNA 2GY5A 2ZZUT 3BH8B 3KPSE 3P40A 1UKSA 3VMPA 3J7HA 4OFIA 4D94A 4NYLB 4EN3A 5FM5M 4ZXBD 2D7TL 1IFHL 4L5FL 1FH5H 4LHUA 3JWDH 4NQED 5ACZA 3CVIL 2W1NA 1ZLUH 4C56D 1J8HD 4PG2A 2NY4C 3BUTA 1HHHA 2VABB 3ILPB 2NZ9C 4R0LA 1JZ7A 4MNHA 1I1AB 4CKVX 4OQ1A 4UBDC 3RVVD 3UTTD 4LCYB 1CLYL 3KJ4B 3NZ8A 3CH8A 2PO6A 1PKQE 2M2DA 3BWAA 5IW3A 4JJHA 4PJCE 3PUCA 3LQZA 4WW2F 4PY7B 2BZDA 4Z5RA 3FFDB 2EXWD 2F8VA 3QUZA 5EA0L 2A74B 5EO9B 1A7QL 1E4XH 2X89A 2OZ4H 3UJJL 3OG6B 1II4E 2B4CL 1OY3B 5LBSH 1SJHA 4LEXL 2HVJA 4Z76B 2ZJSH 2RR3A 4R2GC 5A43C 2UY6A 1FAIH 1RZKC 3LN4B 2NY4B 3C6LA 1KLGA 2R15A 3NCJL 3DRTA 1N5YH 1YUHB 1YNKL 2GJ6B 4V1DB 4KDWA 5LGHL 4F9LC 4S1RH 1YEKH 2VKWA 3KPNA 2ED9A 4O2CA 4EUPG 4YGAB 5I1HH 4ZSOE 4RIRB 1HHJB 4AMKL 2UUDH 1B88A 2E9WA 4L4VB 1U6AH 3HZVB 3N1QC 1DUZB 3OJDB 4OZGB 2QSQA 4JB9L 1A47A 4RRPA 1WEJH 2EYRA 3EO0B 2P5EB 3OV6A 3O4LA 2NXZD 3BP5A 4RA0C 3PQYA 4L8SA 2R0ZL 3ARFB 3ARWA 4HD9A 4NBZB 4Q9BA 1KIRB 1WICA 2CR6A 3SOBL 5I71B 2Y06L 4JFDD 2E3VA 3ZYZA 5JW4R 3OR7B 2IPKB 4IM8A 4R2GB 5CIPH 4ZUSA 2ZOLA 3BRGC 4YHNB 1P2CB 4UDUA 4U6YB 2R0KL 4M5ZL 5J0BA 4MDJA 4AYFA 4Q2ZB 1YC7A 4KI5D 1A8JH 1U8NA 4ETYA 2EIDA 2XTJE 2O61A 3RUGF 2DBLL 2NY0B 2HFEA 4APQC 3GRWA 4UINH 3ULUD 3EW3B 4RX4A 4JFHE 3QWRA 3LDBB 3BSZH 4XGZB 1YYLL 5EU6D 4XB8A 1IGTA 1CDCA 3RNKA 3T0XA 7FABL 4NQVB 3KS0H 1A6WL 4NNXB 2WBWB 2AV7B 5E8NA 3V7AG 2FX8L 4PRHE 5KOVC 3BKML 3EKCA 4PYHA 5KJRL 2ZSWB 4XZUB 3CU1A 1HHGB 2C7UB 4XMLH 2EYSA 2BHUA 4KRLB 1OPGH 4S1SH 3TN0D 5CBAB 2Y6SC 4EI5C 3IJHA 3MO1A 3BP4A 2GQHA 5HHOA 1BFVL 4U1IB 2WBJD 3MLUL 1CCZA 4HF5H 3NN8B 4J3VA 5DJ0A 4NNYB 3VXOB 5HHME 3DSFH 2BSRB 3OG4B 3REWA 5GRXG 2VERN 3MLYL 4OCLC 2QHRL 3SE4C 5DO2C 2CRZA 5D7LB 1VADA 2JB6A 5EBMA 3AVEA 15C8H 4EVNB 4PJDB 2G5RA 4WDIB 2BVEA 5CEXA 3UTSA 4ZFGL 1YEHH 3ARVA 4QTIL 5E2WL 4FXKB 1MVFA 3H7LA 3EO1B 1B90A 2UY7A 4DGVH 4PY8J 1JV5A 1D6VH 1BM3L 2MTPA 1MAML 4I0CC 1QR1A 1PQZA 1NL0H 5FYKE 1YMHA 4FZEL 4JFYB 3F7YA 4F7MA 1K4CB 1OHQA 2HP4A 4HH9A 1KTLB 1JYNA 3VU2A 2R69H 3WL9A 1NGYB 2J88L 1QLEH 3DROB 3T1WA 3GSQB 4YXHH 3OAYH 4ONGL 3HG1A 4HIXL 3LKOA 3QI9D 3L95A 1AO7E 25C8H 2AKRB 1OGTA 5BMFL 3WNLA 1TNNA 5KSAC 3U4BL 1A7RH 2OP4L 5FGCE 1JGLH 3MR9A 3HPLA 2R2HB 3BGAA 3RDTD 3DXAD 2RGSA 2VXUH 5I1LB 3FRUB 3U7YH 1AGFA 3DX6B 4Y8DC 3WKNA 5HD8D 5FYKL 2XKNA 1HNGA 1RUKH 5CZKA 4PJ5A 5HYSA 4M6OH 4C54A 2ZUWA 1S7XB 3RPIB 4G42A 5F7EH 4OV5B 4M48L 1G7IB 4NQDA 4S1DC 5DJCB 5HGDA 5D70L 2AV1B 1QO3A 4O9HL 5DFWH 1D5IH 1MQ8A 1YQVH 3K8LA 3BIBX 3QXVA 3SKOA 1L4IA 4RQQB 1HEZA 4JHZA 1I7ZA 5BOZG 5KSAB 4XNUL 5I8CA 3UPRB 4XP9H 4HPOL 1FAKT 2ZWLT 2JJTC 4IMKC 3AS3A 5DJ2A 3ZKMC 2A6DA 1XF4B 3GSNA 4KK9D 5E00A 1PX3A 1P9MC 1GZPA 5F96L 2KUTA 3V4UL 4TSCL 1J5OH 4MCZB 4HGWA 1HSAB 2GK0A 1YEFL 2VZTA 3NPSB 1GC1H 1FDLH 3WHE1 4XH2B 3PWPA 3C5JA 1Y0LB 2FECI 5I2IA 1EEYA 2CRMA 4QGTA 4XNZB 5AZ2L 4ONHB 1AQDB 1IGIL 1RUAL 5EC1A 3FONA 3PQYE 4GG6B 2VQ1B 1X5LA 2EIBA 2ED8A 3AY4C 5C9JB 1SYVB 2EO1A 4UV4H 3IYLW 1JYVA 2V7NB 4Q97A 1QUNA 3N85L 1GPOL 5ESAB 3LAFA 5BZDB 4CVWA 4NRXB 3DHJA 4G8IA 2A0LD 1NMBL 3O9WC 3IFOB 1KPVA 1EGJA 3RKDC 4HBQA 4OSUL 3D9AL 3EHBD 1T89A 3A6CH 4BA8A 3KLHD 1U8LB 1D9KB 2FEEI 4K8RC 1WWBX 1R5VB 3HAEG 3QFJA 2BNRD 3CDYA 3E6HB 3QULA 4OIBA 2CRYA 1F6AB 1KYOJ 5ANMB 5I8KH 4RMUA 3MLTB 4TPRL 4YDKH 1MVUA 2XQYG 4NUGL 5K9KB 4YHKL 4NZJA 3RL1B 4ZDHA 3KNBA 1LK3L 1HH9A 3RTQC 5DGQA 2VUOA 5TFSH 2ATKA 2MPAH 1EFXD 5K9QI 3BGMB 2VWEC 3O9WB 2EDKA 4DK6A 1B0RA 3PWLA 5F9DC 3UJIL 5BZWB 1DEEA 2AI0L 3GZKA 3WIFA 3BZDA 2VISB 3VGFA 2HKHL 5MEND 1KCSL 5KSVA 3GRWL 5HHOE 4H8WC 4XWGH 1WWAX 3GM0A 4PJDF 3NMEA 1M05A 1FBIL 1MQKL 4I0PC 3BPCA 3NAAL 5EO0A 4U1NB 5FEBA 3LB6D 4FQCL 5EA0H 3I02B 3VA2C 1A7QH 2FATH 2DIBA 1G7HA 4FFVD 3TV3L 3UJJH 4XP4H 3FQTB 2B4CH 4J3WA 4P23A 5LVEA 1KJVA 5L88L 1JNJA 1W0YT 5DC0A 3L5XL 4CDGC 1YNKH 4OFDA 1UEYA 3PIQB 3ROOA 4OFYA 3BKYH 4JZOB 5DQ9B 1TVDA 2HG5A 3DJ9A 4U1HA 1GGCH 3P11H 2DQCL 2Z8SA 1P6AB 3HRZB 5DUML 4AMKH 1DVFC 3QZWG 5DJ6A 3TBTA 3HG1E 2C3GA 4I0PB 1EIBA 1KJMA 2LVCA 4JB9H 5C09B 5E8PB 4KRMB 1CD9B 5AG9A 4P2YA 4Z7NF 3S3JA 1JWMB 3ROLA 3P0GB 5HJ3A 4CVUA 4HK3J 4TOYH 2Q8AL 4Z7VB 2IJ0C 5MERB 5INDA 1S9XB 3CXHJ 2R0KH 1UZ6F 1VB9A 3VRLF 4J4PC 2N1KA 3AGVA 4JGJA 4XTRD 2R23B 1I3GL 1KPRA 1V3JA 5IFAL 4PJ5E 3DSNA 5GJSL 1C1EL 4L4JA 3MUGB 2P8PB 1FNEA 1D6EA 3FB8A 3KYAA 1DVFB 4NQDE 3VDBA 5E2UL 2DLIA 5FO7B 3QCVH 2PXYA 3MBEC 5E7BA 3SGJA 3ARXA 4PGBA 1YYLH 5T3XE 5E2TL 4CU6A 1RPQA 2EE2A 1BBJA 2B39A 3ZT6A 1TITA 5FFLA 1ZANL 4X6BA 2DLEA 1WC7B 4GAGL 3MGAA 4J3SA 1A3LH 1WBXB 1NGQL 3WO4B 2JIXA 4S1QL 4UT9L 4Y4KC 5JO5B 3JV6A 2D7NA 1C16B 1H3TA 3BQUB 4U4BA 1UCTA 3MRGA 3GIVA 1TXKA 3BO8B 5GGRY 4GBXB 5B8CC 1U8QB 4BSJA 2XXMB 4GG6F 4OCRL 2IH1A 3WIHA 3SPVA 2H6PB 5T3XL 3W9EB 2RFXB 3MLYH 2VQTA 4I3RH 3SDXB 1KULA 3TJHD 43CAB 3DPBA 2G5BA 2HYMA 2X4UA 4HKBB 1QRNA 4FQPA 1CICA 2HJFB 3GSNL 3CFDB 4HKXA 3KG5A 1F5WA 1NPUA 2DD8L 4Y1AB 4ZFGH 4OGAD 4HWBL 4L3EB 5E2WH 4EOWL 5E70A 3UPAA 4OB5L 3V0VA 3E3QC 1BM3H 2EDWA 1INQA 4GRWE 2C3XA 1NAML 3MA9L 2X4RA 1CFBA 3IJSA 1MI5A 3L3GB 4YDLC 3UTQB 5B8CB 1H0DB 2J88H 5GRWA 2FO1A 1EO5A 3DURA 1W0WB 3AROA 2ZNWA 3QFJE 3PWVA 1A4JB 1TZHB 4KJYA 4F7PB 3IU3B 4Y5YA 3MCKB 4H1LH 4Y4FC 5I17B 1T3FB 2JELL 1AD9A 5IROC 3U4BH 3ARYA 4R96B 3GGWA 3SDAB 3UDWC 2BDNL 4FP8H 1N2RB 3RPKA 3ARPA 4WFED 1ZEAL 3KDMB 1Z3GH 4WO4C 4WI7A 1ZOXA 1MCKA 3LN5B 4N9GB 1A7PH 5FYKH 1R5IA 2VLJE 1TTUA 2HTLC 4HS3B 4YDLB 1F6FB 1MCIA 1EEUA 4K3JH 3LHPL 5B3JE 3QG7L 2R1YB 5D70H 4Z8FH 4PJ8C 1BMGA 2NXYB 1T21A 4JO4H 5MEPB 2KPNA 3DUUA 4WVRA 2HLFD 5AZEH 4Z78B 1B6UA 3O3EB 3K81A 2OS7A 3RKPA 4XNUH 4MAYA 5IW1B 1FVDB 2VSDA 4HPOH 1AKJD 2Y5EA 3HZKB 3SCMD 3P4NB 4EBQL 3L5HA 4Z95H 1I9JH 2BVPB 5E5UB 4LDOB 4WO4B 3FT3A 1TZIA 2AK4B 2GCYA 3WFEL 4KKCD 5LWYL 5F96H 3V4UH 1RZFL 1NCWH 1BD2A 2LVEA 1K4DA 1WZLA 3G6AB 3HZYA 4MQ7A 1TETH 2JJSA 5T1LD 3TBWA 1G6RB 1ITCA 2GW5A 4X4YB 1OSPL 5HHVL 4I9WD 4PJ8B 1IGIH 3GB7A 4DJMA 3ES6A 1E27A 3CVHA 2D4DA 4WFGD 1RUAH 4Z7VF 5EFIB 3BZ4A 1ZHBA 3NFPA 3IGAB 5B38G 2YN5A 1FFQA 5D7JB 3BHBA 1JIBA 2VAAB 5FCSH 2XIDA 4OAWA 3KPQB 4M7LT 5FOBA 1JTPA 1NBYB 5CJXA 4E5XB 3BH8A 3QCUL 3ZE1F 4ODUB 2J5LC 4NYLA 2MKWA 2FH8A 3UYOD 4WY7L 1RZGB 1REIA 5GGTL 4K3DH 1YJDH 4OF0A 3U0PB 2ZCLL 3QUYD 3EJZC 1LDPL 4MB4A 4ODTL 2VABA 1MREL 3ILPA 2H1PL 5E99L 3VXSD 5L9DL 4HZAA 1I1AA 3S88L 3PHQB 2YD4A 1T6WA 4M62L 4LCYA 2PTUA 3QUXB 1DQTA 1E6JL 4PRIB 2EDEA 2XQBL 3OKYA 1FPTH 3CLEH 3JVGC 4XWOC 5EG6C 3CMOH 4PY7A 4NUGH 1OWRM 2IMMA 1NBQA 4YHKH 3FFDA 2FR4B 4G43B 4JRXB 4U6VH 4NN5C 3OB0K 4J3TA 1LK3H 2A74A 5EO9A 3GSRB 3T4AB 1XIWD 4YBLC 3SY0B 3LEXB 2J5LB 1I7UB 2V5SA 3RJDA 5IM7B 1OAQL 1PAMA 3QEQE 1HNFA 2EH8L 4Z76A 4NO2B 3U4AA 1JL8A 3ARDD 2ADJB 2AI0H 3S4SB 2PF6A 2HKHH 1KCSH 3LN4A 2VDML 3GRWH 2QQNL 1YUHA 3ULVC 2GJ6A 4V1DA 3UP1A 2DMKA 4L4TB 3BKCH 4NC0B 3EOBB 3W2DH 3NAAH 5D71H 4P9HH 4JO1H 2YA0A 4RIRA 3SKJH 1HHJA 4FQCH 2G60L 3BH9B 4L4VA 3BPNC 3HZVA 1KCRL 1DUZA 3OJDA 4IOIB 1QRNE 2GIYA 4OZGA 3SGKC 3RWDB 1FNAA 2P5EA 3EO0A 2AEPL 3LIZL 4OJFL 4NN5B 3FO9B 3I9GH 2KBGA 2HTKD 3EYSL 1MJ7L 3ARFA 3V6OC 4MQXC 2L4OA 5L88H 5B39B 5FUCC 3OR7A 2IPKA 2IQAB 4JLRB 1S9KC 4YHNA 5GZND 2PYFB 4U6YA 5FHBL 4K7PH 4Q2ZA 3RBGA 3SDCC 3WIHL 1HOCB 4O5LH 4PTUB 4UT6H 3RVWD 3LS4H 4ZFOB 5IGXH 5DK3A 2PNDA 12E8L 5DUPH 3VG0L 5ABDE 1ES0B 3BPNB 1KXQE 2V5MA 1YY9C 4XGZA 3RUGE 5J1AB 4Z0XB 4LQ1A 1LO5B 4NQVA 4NNXA 2O93L 3G04B 4MQTB 3RX5A 2AV7A 1QYGL 2RB8A 4QHNB 5EZJB 1RSFA 1S5IH 2ICEB 2ZSWA 1FNSL 2VOTA 4UT7H 4XZUA 5GJSH 1C1EH 2R1WB 3T0DA 1HHGA 2C7UA 1PJ9A 2EC8A 2XN9D 1PGRB 4QYOB 5E2UH 3G5XB 4PJ9D 3UZEA 5DXWA 5CBAA 3VFSB 1FIGL 2HA1A 4U1IA 4HMEA 3NN8A 4NNYA 3VXOA 1I7TB 3B2VL 1MUJB 1BQSA 2BSRA 4WI6A 5CD5C 4U1GC 4ESKA 5D1XC 5E6YA 5D7LA 2QSCL 1NGQH 4EVNA 2V2TB 5LQBH 5CGMA 2EH7L 4S1QH 4UT9H 4PJDA 5GHWH 4YHYC 2WZPD 1EX0A 3SE3A 4WDIA 3MTRA 5J12C 1CXHA 1BD2E 3MRKA 4EUPB 4NQXB 3HNVL 3D3VD 1SEQH 4G3YL 3TVMD 4FXKA 1GOGA 3KPRB 5JDSB 1BIHA 3EO1A 1QP1A 5L2KB 2NY7L 5JXED 5DVKA 5EU4B 5D96B 3IJYB 3K46A 1RFDL 3BI9X 3ZT7A 3I3BA 3K4ZA 5DD3L 3LEVH 2K7QA 4HJJL 4JFYA 5JDJA 4DVRL 4OCRH 1K4CA 4NQCD 1KTLA 3HMXA 1NGYA 5T3XH 3G6JF 4KU1A 5I30L 4WRLA 2EC9U 1JFQL 3DROA 4DCQB 2FHCA 1RUQH 3GSQA 4IOFD 2DMBA 4JPWL 4U1GB 1RUPL 4PGCA 3GSNH 2AKRA 2Z93B 2DD8H 2ATPB 5FKAB 3N9GL 3FAWA 4RDQF 4EOWH 1BEYL 3MRLB 4MA7L 4YHYB 1F4YL 2Z35B 2R2HA 5DURD 5TE6L 3OBAA 2BY3A 5I1LA 3FRUA 4PRPD 2APVA 1J0YA 4NJ9L 5A3IC 4LLQB 5EB9A 4LPCA 2Q6WB 3DX6A 4PJBA 5T5FL 1NCCH 1JPGB 4QRRB 3ZTJG 5C0NC 4JRYD 3NFSL 1P84J 3STBA 5IW6B 4J8RB 1S7XA 3O45B 3RPIA 1N6QL 4OV5A 3PHOB 1G7IA 3K8MA 5DJCA 2HT3D 4QTHB 2AV1A 2VDPL 5C07B 1MCNA 2JELH 1XGTB 2Q8BL 2CDEB 5HI3C 1B4RA 2FJFB 2FB4L 4N5EC 4NHCL 4DKAA 3MNWB 4RQQA 3FFCD 5KSAA 3UPRA 5H37H 1ZEAH 4B0MM 1AY1H 4V2CB 4RAVB 1MELA 1A6UL 1XF4A 3IAGC 4GRWH 1EGJH 1OLZA 4LEOB 3GJFB 1J87A 4GH7B 4RMSA 5DMGC 3MV8B 2C4XA 1HSBB 4MCZA 4WUKL 1HSAA 1Z9MA 3SGEI 2AW2A 4V1DE 4JFFD 3QG7H 2VLRB 1FNLA 3CNKA 4XH2A 5A16B 4XMKH 1FIEA 4MJ4A 1ZA6B 1Y0LA 4FTVD 1KN2H 1CGSL 1MFDL 1KSRA 1CFNB 1AQDA 4ONHA 5GRUL 5HGAB 3VD5A 3X11B 5E2VH 2R2BB 1N6UA 2QBWA 2P5EE 2J2ZA 3V7MA 3GM8A 4GG6A 2JJTA 2UZIL 2VQ1A 4IMKA 3FB5B 5C9JA 1SYVA 5EC2B 3G9AB 3ULVF 2V7NA 4TN9A 3O0RL 2F53B 4G8GD 5ESAA 5BZDA 4YGVB 4BUHA 5E6ZA 4XBPB 4NRXA 5CINH 2EDBA 4F8TA 4KJWD 5D9SB 3IFOA 4MMXC 4UTBH 1OSPH 3V0AC 1OW0A 2IH3B 5FGBC 3TPKA 4M8QB 3DIFB 4Y2DD 1U8LA 2NY2C 5DRXB 1D9KA 5E7FA 4XP5L 2OCFD 3MZGB 1R5VA 3JWNC 4XVUD 2VJXA 3E6HA 2JLLA 3QT2A 2BVUA 1F6AA 3ZKNC 4XCNB 5CCKH 5ANMA 1HYSC 2HFFB 4Q58C 3MRFB 4B50A 3AY4A 3QCUH 2Y4SA 2AXFB 2A9NL 3MLTA 3VFUB 2WSKA 5HI5C 5K9KA 2P24B 4K3EH 4M1GH 3RL1A 3EYOB 3O6KL 3DMMD 3HI6L 1NSNL 3TO4B 5GS0C 5T3ZD 3BGMA 2XACC 3FT2B 3O9WA 3QUKB 4F58H 1LDPH 4RFOL 1CE1H 5BZWA 2APFA 1NCNA 5DFVD 4ODTH 4TQEL 1MREH 5L9DH 2VISA 5E99H 2NY2B 1JZ3A 4KWUA 4RNRB 3B9VA 4M62H 5IKCB 1G7MB 1E6JH 2XQBH 1KB5B 1HILB 2E7HA 4PG9B 2X7LB 3DTXB 4HWZB 4U1NA 1CDIA 3MREB 3UJTL 1L9NA 5D7LE 3CIQA 1SHMA 3I02A 4MSWB 5FDYA 4Q9QL 4PJDE 2W0PA 2IAMD 4Z7OF 1EHXA 4JN1L 3JV4A 3FQTA 1OAQH 1TQCB 1TQBC 3NTCL 3VXMD 5C08D 2EH8H 3FQUB 1QEWB 5FK9B 2XA3A 4JDVB 1WBYB 5TDNB 4UDTB 1U58B 1FORH 2VDMH 2YA1A 3G08B 1QLFB 3RL2A 4KKAC 3D39B 3I6GB 3PIQA 3TO2B 4AJ0A 5JA9A 4JZOA 4JM2C 5DQ9A 3C5ZD 5KTEH 1U3JA 1EAJA 3HRZA 3X3FL 1KCRH 4I0PA 2LAAA 1ZLSL 5C09A 5ENWB 4JZJC 3M8OH 5E8PA 2X09A 3V5KB 4OJFH 5LCVL 3ETBF 1U8HB 2XV6B 3DYPA 1EPFA 4R90L 4LQFH 1JWMA 1MJ7H 3VXUD 4EIGB 3BDYL 1TQBB 1TTGA 4Z7VA 3VDCA 4Z7NE 1FSKC 3WFBH 5MERA 4JHAL 1S9XA 3IFLL 3HAEB 1F90H 3WIHH 2GTZB 4I3SL 2PR4L 4XX1G 1B6DA 5C0DB 2R23A 4JM2B 1KTKE 1MAJA 1OAZH 12E8H 2NY6C 4QEGA 3MUGA 2P8PA 1UZ6E 3T8XB 4NO0D 3VG0H 4KVNL 1DVFA 1T83C 5FO7A 3U9UB 3IDMB 4OM1H 1Z5LB 5CBEB 1Q9OB 5GS1B 4L29B 1J0KA 3EYQD 1H3VA 2AS5M 1H3UA 1N26A 2ICES 4DKFL 4HJGB 2FEDC 5TF1H 4FQIH 3RWJB 1WC7A 3BPOB 1WBXA 4QXTB 4NT6B 3VWJC 2Q86B 1RZJH 2Y23A 5JO5A 2DJ4A 3DARA 3TT3H 4J4PA 4MNQB 1C16A 1CF8L 1VEMA 2J7LA 3BZFB 3BQUA 1IM3B 2DL2A 4YHZL 5K93A 2NY6B 1TZGL 4GBXA 1FIGH 1U8QA 1UG9A 3DUSB 4I1NB 3GMOB 1Y6MR 3B2VH 5JPNB 2H6PA 4FQLL 4LBEB 3OWEA 1QR4A 4LARL 3QR2A 3W9EA 2RFXA 1ACZA 4LPUA 4LHJB 2X4PB 3SDXA 43CAA 4ODSH 5M95B 2QSCH 4GG6E 4HKBA 3QXTA 2HJFA 5HYJB 3QSKB 2AVGA 3VWJB 2CLVB 4G80B 4Y1AA 4CL7A 3HNVH 4G3YH 4L3EA 2VLKB 2NY7H 4N9OB 3QZWB 4P4KC 1RFDH 1I1YB 5KSUB 4UQ3B 5F7KC 3VXRD 1T7WA 1OGAE 4DVRH 1CI5A 1ITBB 2DYPD 4Y5VC 5EOCJ 3OB0H 3L3GA 2KZ1B 3UTQA 5SWSD 1A5FL 4LSRL 5B8CA 4FG6D 1H0DA 1CFVL 2W92A 1VFOA 1L6ZA 4P5MB 3QDMD 3REVB 1W0WA 1AR1D 4K94H 3CXDL 4GW4B 3ESUF 1A4JA 1TZHA 5MI0C 1RUPH 4MD4B 4P49A 3WXWL 4F7PA 3IU3A 3MCKA 5FYJE 5ANME 5I17A 1T3FA 1FYTB 2RBLA 3N9GH 5E8OA 1XH3B 5E6IC 1BEYH 4MA7H 2F5BL 1MCRA 1Y6KR 4K55A 3SDAA 1W8NA 4M7ZC 3WUWG 1N2RA 3RIAK 5TE6H 2X70B 3KDMA 3MCG1 2GK2A 4LLWB 4PRAB 1FP5A 2YS4A 1PFCA 4N0UB 3LN5A 4N9GA 2OXHA 1ZAGA 1ZT4B 4PV9B 4K3HA 1BECA 4KUZH 4Y5VB 1SM3H 3NFSH 4HS3A 2CKBL 4HDIB 3CVHH 5FO8B 2DICA 1N6QH 1NFIB 1NCAL 2ADFH 2WBKA 4JR9H 4QWWC 4CN4A 4DK3A 3JV5A 1NUDA 2R1YA 2VDPH 1QBAA 2W38A 4X9GA 1Q38A 2GKIA 3I6LE 4NHCH 5MEPA 5DZNA 4Z78A 3OL2A 4NFDA 3O3EA 3QRGL 4MGXA 2FWOB 3KYKH 4JQXA 5IW1A 1FVDA 5E6IB 3EYVB 4F57L 1AJ7H 3HZKA 3BN9C 3VFRB 3P4NA 4LSUH 3FT4B 3QHTC 2AQ3A 2BVPA 4XVJL 5I75C 2Q76B 3MGOB 4WO4A 3RA7L 3O2VL 1IKFL 2AK4A 5JHDD 3B9DA 5KBNC 3C60B 2VWEE 5D2LB 3FO0L 1UM5H 3WIIL 4WGWB 5BRZD 1X4ZA 1C7SA 3G6AA 3B8SA 4K8RL 4P2OD 1RIVH 1G6RA 2WWMC 4LDLB 2YK1L 3OXRB 1PSKL 2BNQD 1IGCL 4U1SB 4X4YA 1IEBB 1MFDH 4DFHA 3T0EB 4PJ8A 1KTRL 4Z0BL 4OF6A 2E7BA 5EOCL 5C09E 5EFIA 2Y1VA 4ZS6C 3IGAA 3ARED 2UZIH 2ZG2A 4ZPTB 5CS7A 4LSSL 3IRPX 2IGFH 4PTTB 5D7JA 2VAAA 3D87B 2VL4A 3E8UL 3QIWC 5I75B 3KPQA 4Z7VE 2XICA 1NBYA 4E5XA 1D5MB 4I0KA 3EFFA 4JM2F 3WJLC 3VE0B 1NCDL 5I1CL 3MUHL 4LCWB 4ODUA 5I1KH 3GBNL 3C8KB 1J0ZA 5CWSB 3CX5K 1RZGA 3O4OC 1RVFH 3ZE1E 2ZG3A 1XR8B 3U0PA 3H42L 2PW1A 3SJVB 4H8WL 5IJKA 3MRBB 4XP5H 3VFGL 5J7CC 3S37H 2I9LB 3FQRB 4HKJB 3F7VB 3ZZ1A 3BPLB 3PHQA 2MJWA 4Y89A 1UACL 1OL0A 2Y36H 2NTFB 3QUXA 5FA3B 4UNTA 2E6PA 4PRIA 2RAMA 3OJMB 2E7LA 2DS4A 4UIKH 2A9NH 5FA4B 4Y16D 3TZVD 1L7TL 1J1OH 4PGEB 1U9KA 2FR4A 4G43A 1KC5L 4JRXA 1HINH 3VGAC 5IESL 1RZKH 3GSRA 3T4AA 4ZD3L 3SY0A 3LEXA 5C2BL 1I7UA 4F7EB 5IM7A 4TTDC 2IAND 2NYYD 4NO2A 3O4OB 3HE7D 2ADJA 2QR0B 3S4SA 3TA3B 1CBVL 2Y07L 4L8DB 2VYRE 5F89B 3T2QA 3D6GA 4GXVL 3O3AB 4XPAH 4JO2L 4ZS7L 3CX5J 3ZYOA 2WUBL 4AM0B 1J88A 4KY1L 4L4TA 3EOBA 4WJ5B 1FE8H 2IADB 5MP6H 3MFGB 2AXHA 1P6FA 3UJTH 1U8JB 3BFOA 3S5LG 4G6KH 1LEIB 3JVGA 3BH9A 4XCCL 3UTOA 4IOIA 1P4IH 4WI5A 4Q9QH 3RWDA 5D1ZC 2FJHB 2IF7A 1DBBL 4JN1H 3TCXA 3FO9A 3NTCH 3JWOC 4M6AA 4Y1AE 4FFZH 4J3XA 1KCUL 2W0FB 4ENEC 4XAWL 2XOTA 5B39A 2P5WB 1U3HC 2IQAA 3NZHL 3BT2H 3MLVL 4JLRA 1CT8B 1I3UA 1X5YA 2GYSA 1OD7A 2PYFA 2BSTB 3PE9A 5B38B 4QOKD 1NBVH 4XCYB 3X3FH 5HI4D 3Q5OA 4NRZB 1HOCA 2YUZA 4PTUA 1BWMA 3EZJB 4M8VA 4ZFOA 1QZ1A 4OD3L 1CZ8L 2VDQL 1N7ML 5B4MD 5LCVH 5CGYD 2Q20A 1ES0A 3WNKA 3SGKA 1MFBL 3VFWB 1OAXL 5J13C 5D1ZB 4M1CC 4G9FD 5EDXA 3SDDC 3DX7B 3BDYH 4NO5B 2VXSH 5DQDL 2C4FU 5J1AA 4ZAKD 3U1SH 3M07A 2GI7A 4Z0XA 1AC6A 3V6OA 1LO5A 1JPTL 3I50H 3G04A 1QFWI 3E3QE 1CL7I 1BQUA 4P5TC 4HBCH 2JF1A 1F00I 4QHNA 1U3HB 4XNYL 5EZJA 2ZP0T 5JORB 2ZUXA 3S3PA 2PR4H 5I1JL 1A4KB 3I3EA 3HMXH 4HEPG 2X44D 4UMGA 2R1WA 3WLBB 4KVNH 3P9MB 4QYOA 3G5XA 5HHMD 1P4BL 2IPUK 4HPYH 3VFSA 1GGYA 1I3VA 3TH2T 4X5XB 4N0YL 3HE6B 2XKUA 1PYWB 5J13B 4JQVC 1I7TA 1MCEA 1MUJA 4YHML 4NP4H 4DKFH 5D2LF 5AWNH 4GMSL 3G5VB 5C0AB 4BSVB 5LXGL 2V2TA 2OTWB 3RHWK 1NFDB 2AK4E 5F21B 4P5TB 4KXZI 4MDIB 4IHOB 4EUPA 4NQXA 5ITBL 1I8LC 5JDSA 5L2KA 3OKNB 5EU4A 1NKRA 2W0LA 3IJYA 5D1QD 1P1ZB 2WLZA 3WUZA 4YJZL 1LK2B 1DEDA 4FQLH 2B7DT 3ABZA 1F2QA 4LARH 1JP5A 4DCQA 3QA3B 4OKDA 1QOKA 4U6TA 2Z93A 4XBEL 1BGXL 3G6JE 4OCYL 2ATPA 5FKAA 5IB3B 2DM2A 1QSVA 4OI7A 2IBZX 1E4WL 3MRLA 4IS6B 4K2UL 2Z35A 4JY5L 1N0XL 3GSXB 5ALCL 3HFML 5AAMA 3M45A 2QEJA 5C0EB 4LLQA 2Q6WA 4PBWD 1G6RL 4NZUL 4LSRH 1C5CL 1JPGA 4M9PA 4X7SL 3TIEB 1KXTB 1OWWA 3T0BA 2XYCA 5HY9B 4DWHA 3CXDH 2OJZL 4NKQB 4DUXA 4X9FA 5IW6A 1C8PA 4XC3L 2FHFA 4J8RA 5IB2B 2DQTH 3O45A 1B2WL 1QSEB 1T1ZB 3PHOA 4QTHA 4PRIE 2WP3O 5C07A 3TWCH 2GFBB 5ETUB 2CDEA 3MLRH 1NDGB 2HRPH 2FJFA 2F5BH 4UB0L 5JNYB 3MNWA 1AP2B 1FHGA 4O4YH 1KGCE 4MXVF 3O81A 4LLYB 1PDKA 4RAVA 5K9JH 4CU8A 3TPUB 5FAAA 4P2QE 4X0KB 1CFTB 2BVOB 3GJFA 3F6IA 4LEOA 4D2NA 4BFBD 3AAZB 1HSBA 4KKNA 5DT1H 1DQDL 5HSFA 1O7SA 1EH9A 1S7SB 4XPTL 2FH6A 4IRSC 4BZ2L 1NCAH 1IC7L 3X3GL 2VLRA 2D9CA 1JZ2A 4J12A 5A16A 1PG7L 2EDXA 1ZA6A 4XVSL 2W9LA 1UJ3C 3D5OF 4XI5C 5FYJH 3LKNB 2E7MA 1AXTH 1CFNA 3QQNA 1CLOH 4X7TB 5HGAA 3WFDL 3X11A 5DC4B 2R2BA 4F57H 4MJIB 2EXWC 5DD5H 4ODHH 3KHOA 3BMWA 4TNWF 2VDOH 3O2VH 3DV4A 3NOIA 3UO1H 3FB5A 4U2ZA 4ZXBB 1MFEH 1N59B 5EC2A 1F13A 4EKXA 4U3XA 3FO0H 4NQEB 1Q8MA 3MCLH 4U49A 2ESVD 3WIIH 2F53A 4Q0XH 4C56B 4PRNB 4YGVA 4XBPA 35C8L 5IWLC 3O6ML 1IT9L 4K8RH 4DUWA 1DBAH 2OR7A 2BFVL 3ULVE 1M7XA 5D9SA 4M4PA 4ODVH 5C9KA 4OD1L 5EU5B 5D2NC 1MNUL 4Z0BH 2H2SD 3UTTB 1MEXL 1X5IA 2IH3A 4YFLI 5I1AA 4M8QA 3VD7A 3DIFA 4EZMA 3KYMB 2N7AA 5DRXA 3DX9B 2P45B 3W82A 2Z8VC 5I66B 1C5BH 4LSSH 4OCXH 5MHSD 2NXZC 5ICZB 4C4KO 3E8UH 4XCNA 2UZXB 2HFFA 1LVEA 3MRFA 3V6OE 3DI3B 5GS2H 2AXFA 2XZQL 5I1CH 3VFUA 1EO7A 2P24A 3HNTL 3MOBH 3EYOA 5FUCE 2RCSH 2VDLL 4H5SB 4R97C 3TO4A 4BQ8A 3EO9L 5ACLA 4J6RL 3MRPB 4JAMB 3ULVL 3FT2A 4W81A 4HIEB 3QUKA 3H42H 4HZLB 2XTLA 5FGBA 5AYQA 2APWA 1KLUB 2XFXB 2B0SH 3GJFK 4RNRA 1T1WB 1WV7T 1YN6B 3L1OH 3SQBA 5IKCA 3ULUC 1G7MA 1MLBB 2NY5H 5ECJE 4ERSL 1NFDF 1KB5A 1HILA 3CK0H 5KVFL 5DWUL 2NXZB 2X4NB 4PG9A 5D7IB 5DEFB 1L7TH 2X7LA 3DTXA 4HWZA 1GC1C 2YPLD 3MREA 2EXYD 4S0SD 4W4OC 1KC5H 3LD8B 4MSWA 1YEEH 3QXUA 2VRAA 1DBJL 1MRCH 4ZD3H 4QF1B 2NCMA 3PL6C 4R97B 3FQUA 1QEWA 5FK9A 3KPRE 1A14H 4LSTL 4NOBA 1X44A 4JDVA 2Y07H 1WBYA 2K9UA 4UDTA 1U58A 3MLSH 5TDNA 4GXVH 4Z7OE 3EDJA 3G08A 1QLFA 4ZS7H 3TN0C 3D39A 3I6GA 1AI1L 3TO2A 1J8KA 2WUBH 3RAJL 4KY1H 4TULH 2XZCL 3MRRB 4QRPE 3M17B 2YZ8A 1TIUA 4RAHA 3PDGA 4XCCH 5EU6B 2ZUUA 4HIJB 5ENWA 2BCKB 3V5KA 3HNSH 1U8HA 1YPZB 3RGVC 1SVCP 5GSVB 1XT5A 1ONQB 2W65B 5LAXB 4I77L 2A6IB 1MCFA 2VDRL 2GY7B 3NZHH 3MLVH 2F5AH 5BCAA 4FQ2L 1HDMB 3HAEA 4U3CA 5I1IL 5CJOL 2HFGL 5IUSA 4QRRE 5F1NB 3TN0B 5C0DA 2GTZA 3EDFA 4JM2A 1FRGL 2X9XA 4P46D 3VGEA 1GHFL 4I4WB 4LHQB 4OD3H 1CZ8H 2VDQH 5J8OA 2NY1D 3T8XA 3G6DH 4JE4B 1SBBA 3QIUC 2A77L 2C1PB 3U9UA 3QI9C 3V7AE 5JOPD 5C07E 3IDMA 1YECL 4AEIL 1D3CA 1Z5LA 3QNYB 1Q9OA 5CBEA 4CJ0A 5GS1A 4L29A 4M5YH 5FYKU 3VWKC 1T6VN 2WWKT 2X1PA 3B2UD 3RGVB 2QHLA 1OCWL 2VTFA 1JPTH 3MRJB 1TLKA 3RDTC 4HJGA 2YD8A 3RWJA 5JW4N 1MH5B 4QXTA 1JF5A 1JRHL 1K9TA 5BV7B 2Q86A 4GAJH 4LCCC 1U8MB 3MV8E 4JN2A 5D8JL 1O0VA 4MNQA 3BVNB 3WFCH 1EHLL 1J0IA 3BZFA 5I8OL 1IM3A 2VLRE 2DI8A 5HVWA 1P4BH 3GUTB 1NAKL 2ZCHL 4M7KH 4OKVB 1HCVA 3DUSA 3QIUB 4YDIL 4N0YH 3O11B 3GMOA 3QI9B 3DETD 5JPNA 1R0AL 4LBEA 3S97C 4YHMH 5GGSB 4GMSH 2X4PA 1WF5A 5LXGH 3RDTB 5HYJA 1T1YB 3LPFA 4HFWB 3CLFL 3QDGD 2CLVA 4G80A 3VWJA 4LCCB 3ARTA 4UZGA 4KMLB 2F53E 4FOMA 2VLKA 2P8MB 2AJ3B 3H3PL 3QZWA 2YD7A 1QBMH 5DF0A 1I1YA 5KSUA 1HHKB 4UQ3A 2QQQA 4LSVL 4XMPH 3QFJD 4JM4L 4P5MA 5C0BD 3REVA 2PYED 4MVBD 2MCPH 4GW4A 2X40A 2F9BT 4K71C 4HIIB 1KPUB 3F7RA 3MOAL 4MD4A 2J8OA 1BGXH 4JGMA 3HTLX 4ZTOL 1FYTA 1E4WH 1XH3A 5IB5B 2XQYK 4WU5B 4E41D 2W60B 1N0XH 2DKMA 2VLJD 1P5UA 4C59B 2X70A 4HT1L 3NA4A 3HFMH 5DK2B 1DQMH 4LLWA 3THMH 4PRAA 5IHUH 4N0UA 5HHQB 1G6RH 4OUUB 4NZUH 1C5CH 1ZT4A 4PV9A 4ALAL 4X7SH 2ERJC 1GCFA 5C7XL 3EHBC 5KVGL 4Y5VA 2WINB 4FQJH 3KLHC 4WEBL 4WWKD 2OJZH 5D7IF 1TPXC 4HDIA 4P3CL 4PJHB 5FO8A 1IVLA 3RZCD 1NANH 1B2WH 2F8XC 3FMGL 4K71B 2HJKB 3AC0A 5J89A 1M4KA 3AS1A 3CFBB 1ZXQA 4UB0H 3TBVB 1JNLL 4XPHL 2FWOA 1N8ZB 4Q6IB 5E6IA 1FZKB 3VFNB 3EYVA 3N1FC 3VFRA 4IBLT 3MOQA 5IMLB 1INEH 3FT4A 4QRTB 3F8UB 3H9YA 1ZLVK 1OTSD 1MRDH 2EDDA 2Q76A 2YD5A 1MCWW 3MGOA 1OTTC 1X7QB 3QYCA 1CQKA 1FG9C 3KPMB 1DQDH 3C60A 3KXFE 3ULUF 5D2LA 5EBLB 4OCWL 2ERJB 5BVPL 4XPTH 1IC7H 3QHZL 5JUEH 3GKWL 1NMCC 3D39E 4ZFZB 1U93B 4JG1H 5F7NC 1CG9B 1YPZF 3OXRA 2BNRB 4U1SA 1IEBA 5CILL 2YXMA 3T0EA 4OLVH 2DKSA 3INUH 2OL3L 1KCVL 3LB6C 5FM5O 1DBMH 1WZMA 4U1JB 1EUUA 5IVZB 3V79C 4PTTA 2X1QA 5GRVL 2WQRA 1D5MA 2BVTA 4LSDA 4LVOC 1EFXB 1W0VB 2YWZA 3VE0A 1B3JA 1CYGA 4LCWA 3CFKB 1LD9B 3O6MH 3TCLB 3C8KA 5CWSA 2BFVH 4K9EH 1OQOA 5MENB 4OD1H 3WFHB 4N90E 1MNUH 1MEXH 4DAGL 1XR8A 3H6JA 4N0RA 3SJVA 3MRBA 3OGCB 4P3DA 3WUWB 2I9LA 1YNLL 4HKJA 3F7VA 2C3VB 2MSPA 2P4AB 3OJ2C 2NTFA 1OAYL 5FA3A 1CFQB 1MJ8L 1NCBL 5FA4A 2XZQH 2R8SH 2E6QA 2V5RA 3HNTH 4PGEA 4I18C 4KTEL 3QEQD 4LVOB 1ZTXL 5FYLD 4F9PC 4MCYB 2XY2A 3EO9H 4G6AD 4F7EA 4LVNC 4MNQE 1WQVT 2ADGB 4LASL 3OKKB 2QR0A 4HG4K 4UTAL 3RV